data_7SWJ
# 
_entry.id   7SWJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.371 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7SWJ         pdb_00007swj 10.2210/pdb7swj/pdb 
WWPDB D_1000260963 ?            ?                   
BMRB  50135        ?            ?                   
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          50135 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        7SWJ 
_pdbx_database_status.recvd_initial_deposition_date   2021-11-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.status_code_nmr_data            REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Amani, R.'   1 0000-0002-8501-2689 
'Wylie, B.J.' 2 0000-0001-8183-2762 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Front Mol Biosci' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2296-889X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                772855 
_citation.page_last                 772855 
_citation.title                     'Water Accessibility Refinement of the Extended Structure of KirBac1.1 in the Closed State.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3389/fmolb.2021.772855 
_citation.pdbx_database_id_PubMed   34917650 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Amani, R.'        1 ? 
primary 'Schwieters, C.D.' 2 ? 
primary 'Borcik, C.G.'     3 ? 
primary 'Eason, I.R.'      4 ? 
primary 'Han, R.'          5 ? 
primary 'Harding, B.D.'    6 ? 
primary 'Wylie, B.J.'      7 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Inward rectifier potassium channel' 
_entity.formula_weight             37167.473 
_entity.pdbx_number_of_molecules   4 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              I131C 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Inward rectifier potassium channel protein,Potassium channel,Putative inward rectifier potassium channel' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNVDPFSPHSSDSFAQAASPARKPPRGGRRIWSGTREVIAYGMPASVWRDLYYWALKVSWPVFFASLAALFVVNNTLFAL
LYQLGDAPIANQSPPGFVGAFFFSVETLATVGYGDMHPQTVYAHAIATLECFVGMSGIALSTGLVFARFARPRAKIMFAR
HAIVRPFNGRMTLMVRAANARQNVIAEARAKMRLMRREHSSEGYSLMKIHDLKLVRNEHPIFLLGWNMMHVIDESSPLFG
ETPESLAEGRAMLLVMIEGSDETTAQVMQARHAWEHDDIRWHHRYVDLMSDVDGMTHIDYTRFNDTEPVEPPGAAPDAQA
FAAKPGEGDARPV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNVDPFSPHSSDSFAQAASPARKPPRGGRRIWSGTREVIAYGMPASVWRDLYYWALKVSWPVFFASLAALFVVNNTLFAL
LYQLGDAPIANQSPPGFVGAFFFSVETLATVGYGDMHPQTVYAHAIATLECFVGMSGIALSTGLVFARFARPRAKIMFAR
HAIVRPFNGRMTLMVRAANARQNVIAEARAKMRLMRREHSSEGYSLMKIHDLKLVRNEHPIFLLGWNMMHVIDESSPLFG
ETPESLAEGRAMLLVMIEGSDETTAQVMQARHAWEHDDIRWHHRYVDLMSDVDGMTHIDYTRFNDTEPVEPPGAAPDAQA
FAAKPGEGDARPV
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   VAL n 
1 4   ASP n 
1 5   PRO n 
1 6   PHE n 
1 7   SER n 
1 8   PRO n 
1 9   HIS n 
1 10  SER n 
1 11  SER n 
1 12  ASP n 
1 13  SER n 
1 14  PHE n 
1 15  ALA n 
1 16  GLN n 
1 17  ALA n 
1 18  ALA n 
1 19  SER n 
1 20  PRO n 
1 21  ALA n 
1 22  ARG n 
1 23  LYS n 
1 24  PRO n 
1 25  PRO n 
1 26  ARG n 
1 27  GLY n 
1 28  GLY n 
1 29  ARG n 
1 30  ARG n 
1 31  ILE n 
1 32  TRP n 
1 33  SER n 
1 34  GLY n 
1 35  THR n 
1 36  ARG n 
1 37  GLU n 
1 38  VAL n 
1 39  ILE n 
1 40  ALA n 
1 41  TYR n 
1 42  GLY n 
1 43  MET n 
1 44  PRO n 
1 45  ALA n 
1 46  SER n 
1 47  VAL n 
1 48  TRP n 
1 49  ARG n 
1 50  ASP n 
1 51  LEU n 
1 52  TYR n 
1 53  TYR n 
1 54  TRP n 
1 55  ALA n 
1 56  LEU n 
1 57  LYS n 
1 58  VAL n 
1 59  SER n 
1 60  TRP n 
1 61  PRO n 
1 62  VAL n 
1 63  PHE n 
1 64  PHE n 
1 65  ALA n 
1 66  SER n 
1 67  LEU n 
1 68  ALA n 
1 69  ALA n 
1 70  LEU n 
1 71  PHE n 
1 72  VAL n 
1 73  VAL n 
1 74  ASN n 
1 75  ASN n 
1 76  THR n 
1 77  LEU n 
1 78  PHE n 
1 79  ALA n 
1 80  LEU n 
1 81  LEU n 
1 82  TYR n 
1 83  GLN n 
1 84  LEU n 
1 85  GLY n 
1 86  ASP n 
1 87  ALA n 
1 88  PRO n 
1 89  ILE n 
1 90  ALA n 
1 91  ASN n 
1 92  GLN n 
1 93  SER n 
1 94  PRO n 
1 95  PRO n 
1 96  GLY n 
1 97  PHE n 
1 98  VAL n 
1 99  GLY n 
1 100 ALA n 
1 101 PHE n 
1 102 PHE n 
1 103 PHE n 
1 104 SER n 
1 105 VAL n 
1 106 GLU n 
1 107 THR n 
1 108 LEU n 
1 109 ALA n 
1 110 THR n 
1 111 VAL n 
1 112 GLY n 
1 113 TYR n 
1 114 GLY n 
1 115 ASP n 
1 116 MET n 
1 117 HIS n 
1 118 PRO n 
1 119 GLN n 
1 120 THR n 
1 121 VAL n 
1 122 TYR n 
1 123 ALA n 
1 124 HIS n 
1 125 ALA n 
1 126 ILE n 
1 127 ALA n 
1 128 THR n 
1 129 LEU n 
1 130 GLU n 
1 131 CYS n 
1 132 PHE n 
1 133 VAL n 
1 134 GLY n 
1 135 MET n 
1 136 SER n 
1 137 GLY n 
1 138 ILE n 
1 139 ALA n 
1 140 LEU n 
1 141 SER n 
1 142 THR n 
1 143 GLY n 
1 144 LEU n 
1 145 VAL n 
1 146 PHE n 
1 147 ALA n 
1 148 ARG n 
1 149 PHE n 
1 150 ALA n 
1 151 ARG n 
1 152 PRO n 
1 153 ARG n 
1 154 ALA n 
1 155 LYS n 
1 156 ILE n 
1 157 MET n 
1 158 PHE n 
1 159 ALA n 
1 160 ARG n 
1 161 HIS n 
1 162 ALA n 
1 163 ILE n 
1 164 VAL n 
1 165 ARG n 
1 166 PRO n 
1 167 PHE n 
1 168 ASN n 
1 169 GLY n 
1 170 ARG n 
1 171 MET n 
1 172 THR n 
1 173 LEU n 
1 174 MET n 
1 175 VAL n 
1 176 ARG n 
1 177 ALA n 
1 178 ALA n 
1 179 ASN n 
1 180 ALA n 
1 181 ARG n 
1 182 GLN n 
1 183 ASN n 
1 184 VAL n 
1 185 ILE n 
1 186 ALA n 
1 187 GLU n 
1 188 ALA n 
1 189 ARG n 
1 190 ALA n 
1 191 LYS n 
1 192 MET n 
1 193 ARG n 
1 194 LEU n 
1 195 MET n 
1 196 ARG n 
1 197 ARG n 
1 198 GLU n 
1 199 HIS n 
1 200 SER n 
1 201 SER n 
1 202 GLU n 
1 203 GLY n 
1 204 TYR n 
1 205 SER n 
1 206 LEU n 
1 207 MET n 
1 208 LYS n 
1 209 ILE n 
1 210 HIS n 
1 211 ASP n 
1 212 LEU n 
1 213 LYS n 
1 214 LEU n 
1 215 VAL n 
1 216 ARG n 
1 217 ASN n 
1 218 GLU n 
1 219 HIS n 
1 220 PRO n 
1 221 ILE n 
1 222 PHE n 
1 223 LEU n 
1 224 LEU n 
1 225 GLY n 
1 226 TRP n 
1 227 ASN n 
1 228 MET n 
1 229 MET n 
1 230 HIS n 
1 231 VAL n 
1 232 ILE n 
1 233 ASP n 
1 234 GLU n 
1 235 SER n 
1 236 SER n 
1 237 PRO n 
1 238 LEU n 
1 239 PHE n 
1 240 GLY n 
1 241 GLU n 
1 242 THR n 
1 243 PRO n 
1 244 GLU n 
1 245 SER n 
1 246 LEU n 
1 247 ALA n 
1 248 GLU n 
1 249 GLY n 
1 250 ARG n 
1 251 ALA n 
1 252 MET n 
1 253 LEU n 
1 254 LEU n 
1 255 VAL n 
1 256 MET n 
1 257 ILE n 
1 258 GLU n 
1 259 GLY n 
1 260 SER n 
1 261 ASP n 
1 262 GLU n 
1 263 THR n 
1 264 THR n 
1 265 ALA n 
1 266 GLN n 
1 267 VAL n 
1 268 MET n 
1 269 GLN n 
1 270 ALA n 
1 271 ARG n 
1 272 HIS n 
1 273 ALA n 
1 274 TRP n 
1 275 GLU n 
1 276 HIS n 
1 277 ASP n 
1 278 ASP n 
1 279 ILE n 
1 280 ARG n 
1 281 TRP n 
1 282 HIS n 
1 283 HIS n 
1 284 ARG n 
1 285 TYR n 
1 286 VAL n 
1 287 ASP n 
1 288 LEU n 
1 289 MET n 
1 290 SER n 
1 291 ASP n 
1 292 VAL n 
1 293 ASP n 
1 294 GLY n 
1 295 MET n 
1 296 THR n 
1 297 HIS n 
1 298 ILE n 
1 299 ASP n 
1 300 TYR n 
1 301 THR n 
1 302 ARG n 
1 303 PHE n 
1 304 ASN n 
1 305 ASP n 
1 306 THR n 
1 307 GLU n 
1 308 PRO n 
1 309 VAL n 
1 310 GLU n 
1 311 PRO n 
1 312 PRO n 
1 313 GLY n 
1 314 ALA n 
1 315 ALA n 
1 316 PRO n 
1 317 ASP n 
1 318 ALA n 
1 319 GLN n 
1 320 ALA n 
1 321 PHE n 
1 322 ALA n 
1 323 ALA n 
1 324 LYS n 
1 325 PRO n 
1 326 GLY n 
1 327 GLU n 
1 328 GLY n 
1 329 ASP n 
1 330 ALA n 
1 331 ARG n 
1 332 PRO n 
1 333 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   333 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BOC38_05990, DF122_01560, X994_2342' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Burkholderia pseudomallei' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     28450 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli M15' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     1007065 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    P83698_BURPE 
_struct_ref.pdbx_db_accession          P83698 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNVDPFSPHSSDSFAQAASPARKPPRGGRRIWSGTREVIAYGMPASVWRDLYYWALKVSWPVFFASLAALFVVNNTLFAL
LYQLGDAPIANQSPPGFVGAFFFSVETLATVGYGDMHPQTVYAHAIATLEIFVGMSGIALSTGLVFARFARPRAKIMFAR
HAIVRPFNGRMTLMVRAANARQNVIAEARAKMRLMRREHSSEGYSLMKIHDLKLVRNEHPIFLLGWNMMHVIDESSPLFG
ETPESLAEGRAMLLVMIEGSDETTAQVMQARHAWEHDDIRWHHRYVDLMSDVDGMTHIDYTRFNDTEPVEPPGAAPDAQA
FAAKPGEGDARPV
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 7SWJ A 1 ? 333 ? P83698 1 ? 333 ? 1 333 
2 1 7SWJ B 1 ? 333 ? P83698 1 ? 333 ? 1 333 
3 1 7SWJ C 1 ? 333 ? P83698 1 ? 333 ? 1 333 
4 1 7SWJ D 1 ? 333 ? P83698 1 ? 333 ? 1 333 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7SWJ CYS A 131 ? UNP P83698 ILE 131 'engineered mutation' 131 1 
2 7SWJ CYS B 131 ? UNP P83698 ILE 131 'engineered mutation' 131 2 
3 7SWJ CYS C 131 ? UNP P83698 ILE 131 'engineered mutation' 131 3 
4 7SWJ CYS D 131 ? UNP P83698 ILE 131 'engineered mutation' 131 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 'CC2D water edited' 1 isotropic 
2 1 1 'CCC3D DARR'        2 isotropic 
3 1 1 NCACX               1 isotropic 
4 1 1 NCOCX               1 isotropic 
5 1 1 CANcoCA             1 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7.6 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         100 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  'closed state' 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '25 % w/w POPC, 25 % w/w [U-13C; U-15N] KirBac1.1, 100% H2O' 
_pdbx_nmr_sample_details.solvent_system   '100% H2O' 
_pdbx_nmr_sample_details.label            15N_13C_sample 
_pdbx_nmr_sample_details.type             liposome 
_pdbx_nmr_sample_details.details          'protein was reconstituted in 100% POPC lipid bilayer' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 ? ? Agilent 600 ? 
2 ? ? Agilent 750 ? 
# 
_pdbx_nmr_refine.entry_id           7SWJ 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   3 
# 
_pdbx_nmr_ensemble.entry_id                                      7SWJ 
_pdbx_nmr_ensemble.conformers_calculated_total_number            800 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             7SWJ 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'target function' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
2 'data analysis'             NMRFAM-SPARKY ?     Markley                                    
3 refinement                  'X-PLOR NIH'  3.2.9 'Schwieters, Kuszewski, Tjandra and Clore' 
4 'structure calculation'     'X-PLOR NIH'  3.2.9 'Schwieters, Kuszewski, Tjandra and Clore' 
5 'chemical shift assignment' NMRFAM-SPARKY ?     Markley                                    
1 'peak picking'              NMRFAM-SPARKY ?     Markley                                    
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7SWJ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLID-STATE NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     7SWJ 
_struct.title                        'KirBac1.1 mutant - I131C' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7SWJ 
_struct_keywords.text            'MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PHE A 6   ? SER A 10  ? PHE A 6   SER A 10  5 ? 5  
HELX_P HELX_P2  AA2 SER A 13  ? ALA A 17  ? SER A 13  ALA A 17  5 ? 5  
HELX_P HELX_P3  AA3 ALA A 18  ? ARG A 22  ? ALA A 18  ARG A 22  5 ? 5  
HELX_P HELX_P4  AA4 ILE A 39  ? MET A 43  ? ILE A 39  MET A 43  5 ? 5  
HELX_P HELX_P5  AA5 PRO A 44  ? ALA A 45  ? PRO A 44  ALA A 45  5 ? 2  
HELX_P HELX_P6  AA6 SER A 46  ? VAL A 58  ? SER A 46  VAL A 58  1 ? 13 
HELX_P HELX_P7  AA7 VAL A 58  ? GLN A 83  ? VAL A 58  GLN A 83  1 ? 26 
HELX_P HELX_P8  AA8 GLY A 96  ? THR A 110 ? GLY A 96  THR A 110 1 ? 15 
HELX_P HELX_P9  AA9 THR A 120 ? ARG A 151 ? THR A 120 ARG A 151 1 ? 32 
HELX_P HELX_P10 AB1 ALA A 154 ? PHE A 158 ? ALA A 154 PHE A 158 5 ? 5  
HELX_P HELX_P11 AB2 LEU A 212 ? ASN A 217 ? LEU A 212 ASN A 217 1 ? 6  
HELX_P HELX_P12 AB3 SER A 236 ? GLU A 241 ? SER A 236 GLU A 241 5 ? 6  
HELX_P HELX_P13 AB4 THR A 242 ? GLY A 249 ? THR A 242 GLY A 249 1 ? 8  
HELX_P HELX_P14 AB5 TRP A 281 ? ASP A 287 ? TRP A 281 ASP A 287 5 ? 7  
HELX_P HELX_P15 AB6 PHE B 6   ? SER B 10  ? PHE B 6   SER B 10  5 ? 5  
HELX_P HELX_P16 AB7 SER B 13  ? ALA B 17  ? SER B 13  ALA B 17  5 ? 5  
HELX_P HELX_P17 AB8 ALA B 18  ? ARG B 22  ? ALA B 18  ARG B 22  5 ? 5  
HELX_P HELX_P18 AB9 ILE B 39  ? MET B 43  ? ILE B 39  MET B 43  5 ? 5  
HELX_P HELX_P19 AC1 PRO B 44  ? ALA B 45  ? PRO B 44  ALA B 45  5 ? 2  
HELX_P HELX_P20 AC2 SER B 46  ? VAL B 58  ? SER B 46  VAL B 58  1 ? 13 
HELX_P HELX_P21 AC3 VAL B 58  ? GLN B 83  ? VAL B 58  GLN B 83  1 ? 26 
HELX_P HELX_P22 AC4 GLY B 96  ? THR B 110 ? GLY B 96  THR B 110 1 ? 15 
HELX_P HELX_P23 AC5 THR B 120 ? ARG B 151 ? THR B 120 ARG B 151 1 ? 32 
HELX_P HELX_P24 AC6 ALA B 154 ? PHE B 158 ? ALA B 154 PHE B 158 5 ? 5  
HELX_P HELX_P25 AC7 LEU B 212 ? ASN B 217 ? LEU B 212 ASN B 217 1 ? 6  
HELX_P HELX_P26 AC8 SER B 236 ? GLU B 241 ? SER B 236 GLU B 241 5 ? 6  
HELX_P HELX_P27 AC9 THR B 242 ? GLY B 249 ? THR B 242 GLY B 249 1 ? 8  
HELX_P HELX_P28 AD1 TRP B 281 ? ASP B 287 ? TRP B 281 ASP B 287 5 ? 7  
HELX_P HELX_P29 AD2 PHE C 6   ? SER C 10  ? PHE C 6   SER C 10  5 ? 5  
HELX_P HELX_P30 AD3 SER C 13  ? ALA C 17  ? SER C 13  ALA C 17  5 ? 5  
HELX_P HELX_P31 AD4 ALA C 18  ? ARG C 22  ? ALA C 18  ARG C 22  5 ? 5  
HELX_P HELX_P32 AD5 ILE C 39  ? MET C 43  ? ILE C 39  MET C 43  5 ? 5  
HELX_P HELX_P33 AD6 PRO C 44  ? ALA C 45  ? PRO C 44  ALA C 45  5 ? 2  
HELX_P HELX_P34 AD7 SER C 46  ? VAL C 58  ? SER C 46  VAL C 58  1 ? 13 
HELX_P HELX_P35 AD8 VAL C 58  ? GLN C 83  ? VAL C 58  GLN C 83  1 ? 26 
HELX_P HELX_P36 AD9 GLY C 96  ? THR C 110 ? GLY C 96  THR C 110 1 ? 15 
HELX_P HELX_P37 AE1 THR C 120 ? ARG C 151 ? THR C 120 ARG C 151 1 ? 32 
HELX_P HELX_P38 AE2 ALA C 154 ? PHE C 158 ? ALA C 154 PHE C 158 5 ? 5  
HELX_P HELX_P39 AE3 LEU C 212 ? ASN C 217 ? LEU C 212 ASN C 217 1 ? 6  
HELX_P HELX_P40 AE4 SER C 236 ? GLU C 241 ? SER C 236 GLU C 241 5 ? 6  
HELX_P HELX_P41 AE5 THR C 242 ? GLY C 249 ? THR C 242 GLY C 249 1 ? 8  
HELX_P HELX_P42 AE6 TRP C 281 ? ASP C 287 ? TRP C 281 ASP C 287 5 ? 7  
HELX_P HELX_P43 AE7 PHE D 6   ? SER D 10  ? PHE D 6   SER D 10  5 ? 5  
HELX_P HELX_P44 AE8 SER D 13  ? ALA D 17  ? SER D 13  ALA D 17  5 ? 5  
HELX_P HELX_P45 AE9 ALA D 18  ? ARG D 22  ? ALA D 18  ARG D 22  5 ? 5  
HELX_P HELX_P46 AF1 ILE D 39  ? MET D 43  ? ILE D 39  MET D 43  5 ? 5  
HELX_P HELX_P47 AF2 PRO D 44  ? ALA D 45  ? PRO D 44  ALA D 45  5 ? 2  
HELX_P HELX_P48 AF3 SER D 46  ? VAL D 58  ? SER D 46  VAL D 58  1 ? 13 
HELX_P HELX_P49 AF4 VAL D 58  ? GLN D 83  ? VAL D 58  GLN D 83  1 ? 26 
HELX_P HELX_P50 AF5 GLY D 96  ? THR D 110 ? GLY D 96  THR D 110 1 ? 15 
HELX_P HELX_P51 AF6 THR D 120 ? ARG D 151 ? THR D 120 ARG D 151 1 ? 32 
HELX_P HELX_P52 AF7 ALA D 154 ? PHE D 158 ? ALA D 154 PHE D 158 5 ? 5  
HELX_P HELX_P53 AF8 LEU D 212 ? ASN D 217 ? LEU D 212 ASN D 217 1 ? 6  
HELX_P HELX_P54 AF9 SER D 236 ? GLU D 241 ? SER D 236 GLU D 241 5 ? 6  
HELX_P HELX_P55 AG1 THR D 242 ? GLY D 249 ? THR D 242 GLY D 249 1 ? 8  
HELX_P HELX_P56 AG2 TRP D 281 ? ASP D 287 ? TRP D 281 ASP D 287 5 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASN A 227 ? VAL A 231 ? ASN A 227 VAL A 231 
AA1 2 ARG A 170 ? ARG A 176 ? ARG A 170 ARG A 176 
AA1 3 ALA A 162 ? PHE A 167 ? ALA A 162 PHE A 167 
AA1 4 ILE A 279 ? ARG A 280 ? ILE A 279 ARG A 280 
AA2 1 MET A 207 ? HIS A 210 ? MET A 207 HIS A 210 
AA2 2 GLU A 187 ? LEU A 194 ? GLU A 187 LEU A 194 
AA2 3 MET A 252 ? GLY A 259 ? MET A 252 GLY A 259 
AA2 4 MET A 268 ? GLU A 275 ? MET A 268 GLU A 275 
AA3 1 ASN B 227 ? VAL B 231 ? ASN B 227 VAL B 231 
AA3 2 ARG B 170 ? ARG B 176 ? ARG B 170 ARG B 176 
AA3 3 ALA B 162 ? PHE B 167 ? ALA B 162 PHE B 167 
AA3 4 ILE B 279 ? ARG B 280 ? ILE B 279 ARG B 280 
AA4 1 MET B 207 ? HIS B 210 ? MET B 207 HIS B 210 
AA4 2 GLU B 187 ? LEU B 194 ? GLU B 187 LEU B 194 
AA4 3 MET B 252 ? GLY B 259 ? MET B 252 GLY B 259 
AA4 4 MET B 268 ? GLU B 275 ? MET B 268 GLU B 275 
AA5 1 ASN C 227 ? VAL C 231 ? ASN C 227 VAL C 231 
AA5 2 ARG C 170 ? ARG C 176 ? ARG C 170 ARG C 176 
AA5 3 ALA C 162 ? PHE C 167 ? ALA C 162 PHE C 167 
AA5 4 ILE C 279 ? ARG C 280 ? ILE C 279 ARG C 280 
AA6 1 MET C 207 ? HIS C 210 ? MET C 207 HIS C 210 
AA6 2 GLU C 187 ? LEU C 194 ? GLU C 187 LEU C 194 
AA6 3 MET C 252 ? GLY C 259 ? MET C 252 GLY C 259 
AA6 4 MET C 268 ? GLU C 275 ? MET C 268 GLU C 275 
AA7 1 ASN D 227 ? VAL D 231 ? ASN D 227 VAL D 231 
AA7 2 ARG D 170 ? ARG D 176 ? ARG D 170 ARG D 176 
AA7 3 ALA D 162 ? PHE D 167 ? ALA D 162 PHE D 167 
AA7 4 ILE D 279 ? ARG D 280 ? ILE D 279 ARG D 280 
AA8 1 MET D 207 ? HIS D 210 ? MET D 207 HIS D 210 
AA8 2 GLU D 187 ? LEU D 194 ? GLU D 187 LEU D 194 
AA8 3 MET D 252 ? GLY D 259 ? MET D 252 GLY D 259 
AA8 4 MET D 268 ? GLU D 275 ? MET D 268 GLU D 275 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O MET A 228 ? O MET A 228 N VAL A 175 ? N VAL A 175 
AA1 2 3 O ARG A 170 ? O ARG A 170 N PHE A 167 ? N PHE A 167 
AA1 3 4 N VAL A 164 ? N VAL A 164 O ARG A 280 ? O ARG A 280 
AA2 1 2 O ILE A 209 ? O ILE A 209 N MET A 192 ? N MET A 192 
AA2 2 3 N GLU A 187 ? N GLU A 187 O GLU A 258 ? O GLU A 258 
AA2 3 4 N LEU A 253 ? N LEU A 253 O TRP A 274 ? O TRP A 274 
AA3 1 2 O MET B 228 ? O MET B 228 N VAL B 175 ? N VAL B 175 
AA3 2 3 O ARG B 170 ? O ARG B 170 N PHE B 167 ? N PHE B 167 
AA3 3 4 N VAL B 164 ? N VAL B 164 O ARG B 280 ? O ARG B 280 
AA4 1 2 O ILE B 209 ? O ILE B 209 N MET B 192 ? N MET B 192 
AA4 2 3 N GLU B 187 ? N GLU B 187 O GLU B 258 ? O GLU B 258 
AA4 3 4 N LEU B 253 ? N LEU B 253 O TRP B 274 ? O TRP B 274 
AA5 1 2 O MET C 228 ? O MET C 228 N VAL C 175 ? N VAL C 175 
AA5 2 3 O ARG C 170 ? O ARG C 170 N PHE C 167 ? N PHE C 167 
AA5 3 4 N VAL C 164 ? N VAL C 164 O ARG C 280 ? O ARG C 280 
AA6 1 2 O ILE C 209 ? O ILE C 209 N MET C 192 ? N MET C 192 
AA6 2 3 N GLU C 187 ? N GLU C 187 O GLU C 258 ? O GLU C 258 
AA6 3 4 N LEU C 253 ? N LEU C 253 O TRP C 274 ? O TRP C 274 
AA7 1 2 O MET D 228 ? O MET D 228 N VAL D 175 ? N VAL D 175 
AA7 2 3 O ARG D 170 ? O ARG D 170 N PHE D 167 ? N PHE D 167 
AA7 3 4 N VAL D 164 ? N VAL D 164 O ARG D 280 ? O ARG D 280 
AA8 1 2 O ILE D 209 ? O ILE D 209 N MET D 192 ? N MET D 192 
AA8 2 3 N GLU D 187 ? N GLU D 187 O GLU D 258 ? O GLU D 258 
AA8 3 4 N LEU D 253 ? N LEU D 253 O TRP D 274 ? O TRP D 274 
# 
_atom_sites.entry_id                    7SWJ 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . MET A 1 1   ? -14.958 32.562  183.077 1.00 0.00 ?  1   MET A N    1  
ATOM 2      C CA   . MET A 1 1   ? -14.311 33.467  184.054 1.00 0.00 ?  1   MET A CA   1  
ATOM 3      C C    . MET A 1 1   ? -14.165 32.771  185.370 1.00 0.00 ?  1   MET A C    1  
ATOM 4      O O    . MET A 1 1   ? -14.703 33.213  186.385 1.00 0.00 ?  1   MET A O    1  
ATOM 5      C CB   . MET A 1 1   ? -15.162 34.731  184.250 1.00 0.00 ?  1   MET A CB   1  
ATOM 6      C CG   . MET A 1 1   ? -15.216 35.595  182.988 1.00 0.00 ?  1   MET A CG   1  
ATOM 7      S SD   . MET A 1 1   ? -14.710 37.315  183.285 1.00 0.00 ?  1   MET A SD   1  
ATOM 8      C CE   . MET A 1 1   ? -13.937 37.534  181.656 1.00 0.00 ?  1   MET A CE   1  
ATOM 9      H H1   . MET A 1 1   ? -14.251 32.229  182.391 1.00 0.00 ?  1   MET A H1   1  
ATOM 10     H HA   . MET A 1 1   ? -13.336 33.722  183.668 1.00 0.00 ?  1   MET A HA   1  
ATOM 11     H HB2  . MET A 1 1   ? -16.195 34.432  184.533 1.00 0.00 ?  1   MET A HB2  1  
ATOM 12     H HB3  . MET A 1 1   ? -14.738 35.333  185.081 1.00 0.00 ?  1   MET A HB3  1  
ATOM 13     H HG2  . MET A 1 1   ? -14.555 35.138  182.220 1.00 0.00 ?  1   MET A HG2  1  
ATOM 14     H HG3  . MET A 1 1   ? -16.253 35.576  182.589 1.00 0.00 ?  1   MET A HG3  1  
ATOM 15     H HE1  . MET A 1 1   ? -12.838 37.387  181.716 1.00 0.00 ?  1   MET A HE1  1  
ATOM 16     H HE2  . MET A 1 1   ? -14.126 38.555  181.261 1.00 0.00 ?  1   MET A HE2  1  
ATOM 17     H HE3  . MET A 1 1   ? -14.343 36.802  180.923 1.00 0.00 ?  1   MET A HE3  1  
ATOM 18     N N    . ASN A 1 2   ? -13.425 31.646  185.370 1.00 0.00 ?  2   ASN A N    1  
ATOM 19     C CA   . ASN A 1 2   ? -13.225 30.902  186.580 1.00 0.00 ?  2   ASN A CA   1  
ATOM 20     C C    . ASN A 1 2   ? -12.073 31.540  187.308 1.00 0.00 ?  2   ASN A C    1  
ATOM 21     O O    . ASN A 1 2   ? -11.337 32.329  186.726 1.00 0.00 ?  2   ASN A O    1  
ATOM 22     C CB   . ASN A 1 2   ? -12.925 29.418  186.342 1.00 0.00 ?  2   ASN A CB   1  
ATOM 23     C CG   . ASN A 1 2   ? -14.140 28.653  185.832 1.00 0.00 ?  2   ASN A CG   1  
ATOM 24     O OD1  . ASN A 1 2   ? -15.277 29.093  185.984 1.00 0.00 ?  2   ASN A OD1  1  
ATOM 25     N ND2  . ASN A 1 2   ? -13.889 27.465  185.214 1.00 0.00 ?  2   ASN A ND2  1  
ATOM 26     H H    . ASN A 1 2   ? -12.992 31.285  184.547 1.00 0.00 ?  2   ASN A H    1  
ATOM 27     H HA   . ASN A 1 2   ? -14.119 31.012  187.177 1.00 0.00 ?  2   ASN A HA   1  
ATOM 28     H HB2  . ASN A 1 2   ? -12.107 29.324  185.597 1.00 0.00 ?  2   ASN A HB2  1  
ATOM 29     H HB3  . ASN A 1 2   ? -12.585 28.955  187.293 1.00 0.00 ?  2   ASN A HB3  1  
ATOM 30     H HD21 . ASN A 1 2   ? -12.948 27.141  185.117 1.00 0.00 ?  2   ASN A HD21 1  
ATOM 31     H HD22 . ASN A 1 2   ? -14.646 26.913  184.862 1.00 0.00 ?  2   ASN A HD22 1  
ATOM 32     N N    . VAL A 1 3   ? -11.877 31.195  188.610 1.00 0.00 ?  3   VAL A N    1  
ATOM 33     C CA   . VAL A 1 3   ? -10.846 31.852  189.387 1.00 0.00 ?  3   VAL A CA   1  
ATOM 34     C C    . VAL A 1 3   ? -9.449  31.569  188.874 1.00 0.00 ?  3   VAL A C    1  
ATOM 35     O O    . VAL A 1 3   ? -8.692  32.511  188.657 1.00 0.00 ?  3   VAL A O    1  
ATOM 36     C CB   . VAL A 1 3   ? -10.907 31.516  190.878 1.00 0.00 ?  3   VAL A CB   1  
ATOM 37     C CG1  . VAL A 1 3   ? -10.768 29.983  191.126 1.00 0.00 ?  3   VAL A CG1  1  
ATOM 38     C CG2  . VAL A 1 3   ? -9.804  32.320  191.585 1.00 0.00 ?  3   VAL A CG2  1  
ATOM 39     H H    . VAL A 1 3   ? -12.418 30.497  189.074 1.00 0.00 ?  3   VAL A H    1  
ATOM 40     H HA   . VAL A 1 3   ? -11.022 32.909  189.266 1.00 0.00 ?  3   VAL A HA   1  
ATOM 41     H HB   . VAL A 1 3   ? -11.885 31.844  191.286 1.00 0.00 ?  3   VAL A HB   1  
ATOM 42     H HG11 . VAL A 1 3   ? -11.173 29.717  192.126 1.00 0.00 ?  3   VAL A HG11 1  
ATOM 43     H HG12 . VAL A 1 3   ? -9.699  29.681  191.087 1.00 0.00 ?  3   VAL A HG12 1  
ATOM 44     H HG13 . VAL A 1 3   ? -11.326 29.414  190.353 1.00 0.00 ?  3   VAL A HG13 1  
ATOM 45     H HG21 . VAL A 1 3   ? -8.818  31.828  191.442 1.00 0.00 ?  3   VAL A HG21 1  
ATOM 46     H HG22 . VAL A 1 3   ? -10.013 32.385  192.673 1.00 0.00 ?  3   VAL A HG22 1  
ATOM 47     H HG23 . VAL A 1 3   ? -9.751  33.349  191.170 1.00 0.00 ?  3   VAL A HG23 1  
ATOM 48     N N    . ASP A 1 4   ? -9.042  30.290  188.722 1.00 0.00 ?  4   ASP A N    1  
ATOM 49     C CA   . ASP A 1 4   ? -7.711  29.988  188.231 1.00 0.00 ?  4   ASP A CA   1  
ATOM 50     C C    . ASP A 1 4   ? -7.669  29.894  186.707 1.00 0.00 ?  4   ASP A C    1  
ATOM 51     O O    . ASP A 1 4   ? -6.795  30.502  186.098 1.00 0.00 ?  4   ASP A O    1  
ATOM 52     C CB   . ASP A 1 4   ? -7.058  28.730  188.861 1.00 0.00 ?  4   ASP A CB   1  
ATOM 53     C CG   . ASP A 1 4   ? -5.545  28.868  188.970 1.00 0.00 ?  4   ASP A CG   1  
ATOM 54     O OD1  . ASP A 1 4   ? -4.980  29.769  188.295 1.00 0.00 ?  4   ASP A OD1  1  
ATOM 55     O OD2  . ASP A 1 4   ? -4.935  28.078  189.738 1.00 0.00 -1 4   ASP A OD2  1  
ATOM 56     H H    . ASP A 1 4   ? -9.626  29.510  188.936 1.00 0.00 ?  4   ASP A H    1  
ATOM 57     H HA   . ASP A 1 4   ? -7.107  30.841  188.501 1.00 0.00 ?  4   ASP A HA   1  
ATOM 58     H HB2  . ASP A 1 4   ? -7.479  28.564  189.876 1.00 0.00 ?  4   ASP A HB2  1  
ATOM 59     H HB3  . ASP A 1 4   ? -7.286  27.842  188.239 1.00 0.00 ?  4   ASP A HB3  1  
ATOM 60     N N    . PRO A 1 5   ? -8.567  29.123  186.058 1.00 0.00 ?  5   PRO A N    1  
ATOM 61     C CA   . PRO A 1 5   ? -8.548  28.981  184.594 1.00 0.00 ?  5   PRO A CA   1  
ATOM 62     C C    . PRO A 1 5   ? -8.529  30.243  183.749 1.00 0.00 ?  5   PRO A C    1  
ATOM 63     O O    . PRO A 1 5   ? -8.373  30.124  182.540 1.00 0.00 ?  5   PRO A O    1  
ATOM 64     C CB   . PRO A 1 5   ? -9.801  28.149  184.278 1.00 0.00 ?  5   PRO A CB   1  
ATOM 65     C CG   . PRO A 1 5   ? -9.988  27.275  185.520 1.00 0.00 ?  5   PRO A CG   1  
ATOM 66     C CD   . PRO A 1 5   ? -9.584  28.206  186.660 1.00 0.00 ?  5   PRO A CD   1  
ATOM 67     H HA   . PRO A 1 5   ? -7.690  28.397  184.305 1.00 0.00 ?  5   PRO A HA   1  
ATOM 68     H HB2  . PRO A 1 5   ? -10.681 28.809  184.121 1.00 0.00 ?  5   PRO A HB2  1  
ATOM 69     H HB3  . PRO A 1 5   ? -9.638  27.520  183.377 1.00 0.00 ?  5   PRO A HB3  1  
ATOM 70     H HG2  . PRO A 1 5   ? -11.048 26.951  185.618 1.00 0.00 ?  5   PRO A HG2  1  
ATOM 71     H HG3  . PRO A 1 5   ? -9.324  26.387  185.481 1.00 0.00 ?  5   PRO A HG3  1  
ATOM 72     H HD2  . PRO A 1 5   ? -10.450 28.769  187.040 1.00 0.00 ?  5   PRO A HD2  1  
ATOM 73     H HD3  . PRO A 1 5   ? -9.153  27.614  187.485 1.00 0.00 ?  5   PRO A HD3  1  
ATOM 74     N N    . PHE A 1 6   ? -8.767  31.463  184.305 1.00 0.00 ?  6   PHE A N    1  
ATOM 75     C CA   . PHE A 1 6   ? -8.711  32.658  183.458 1.00 0.00 ?  6   PHE A CA   1  
ATOM 76     C C    . PHE A 1 6   ? -7.267  33.069  183.314 1.00 0.00 ?  6   PHE A C    1  
ATOM 77     O O    . PHE A 1 6   ? -6.922  33.876  182.451 1.00 0.00 ?  6   PHE A O    1  
ATOM 78     C CB   . PHE A 1 6   ? -9.494  33.879  183.989 1.00 0.00 ?  6   PHE A CB   1  
ATOM 79     C CG   . PHE A 1 6   ? -8.758  34.715  184.981 1.00 0.00 ?  6   PHE A CG   1  
ATOM 80     C CD1  . PHE A 1 6   ? -8.099  35.860  184.584 1.00 0.00 ?  6   PHE A CD1  1  
ATOM 81     C CD2  . PHE A 1 6   ? -8.738  34.360  186.301 1.00 0.00 ?  6   PHE A CD2  1  
ATOM 82     C CE1  . PHE A 1 6   ? -7.431  36.634  185.505 1.00 0.00 ?  6   PHE A CE1  1  
ATOM 83     C CE2  . PHE A 1 6   ? -8.071  35.130  187.225 1.00 0.00 ?  6   PHE A CE2  1  
ATOM 84     C CZ   . PHE A 1 6   ? -7.417  36.268  186.827 1.00 0.00 ?  6   PHE A CZ   1  
ATOM 85     H H    . PHE A 1 6   ? -8.984  31.596  185.271 1.00 0.00 ?  6   PHE A H    1  
ATOM 86     H HA   . PHE A 1 6   ? -9.088  32.379  182.485 1.00 0.00 ?  6   PHE A HA   1  
ATOM 87     H HB2  . PHE A 1 6   ? -9.763  34.545  183.143 1.00 0.00 ?  6   PHE A HB2  1  
ATOM 88     H HB3  . PHE A 1 6   ? -10.432 33.535  184.477 1.00 0.00 ?  6   PHE A HB3  1  
ATOM 89     H HD1  . PHE A 1 6   ? -8.106  36.152  183.544 1.00 0.00 ?  6   PHE A HD1  1  
ATOM 90     H HD2  . PHE A 1 6   ? -9.249  33.473  186.611 1.00 0.00 ?  6   PHE A HD2  1  
ATOM 91     H HE1  . PHE A 1 6   ? -6.918  37.529  185.188 1.00 0.00 ?  6   PHE A HE1  1  
ATOM 92     H HE2  . PHE A 1 6   ? -8.062  34.838  188.265 1.00 0.00 ?  6   PHE A HE2  1  
ATOM 93     H HZ   . PHE A 1 6   ? -6.894  36.873  187.552 1.00 0.00 ?  6   PHE A HZ   1  
ATOM 94     N N    . SER A 1 7   ? -6.404  32.516  184.188 1.00 0.00 ?  7   SER A N    1  
ATOM 95     C CA   . SER A 1 7   ? -4.982  32.844  184.229 1.00 0.00 ?  7   SER A CA   1  
ATOM 96     C C    . SER A 1 7   ? -4.246  32.785  182.880 1.00 0.00 ?  7   SER A C    1  
ATOM 97     O O    . SER A 1 7   ? -3.443  33.673  182.629 1.00 0.00 ?  7   SER A O    1  
ATOM 98     C CB   . SER A 1 7   ? -4.200  31.948  185.205 1.00 0.00 ?  7   SER A CB   1  
ATOM 99     O OG   . SER A 1 7   ? -2.831  32.323  185.217 1.00 0.00 ?  7   SER A OG   1  
ATOM 100    H H    . SER A 1 7   ? -6.706  31.843  184.860 1.00 0.00 ?  7   SER A H    1  
ATOM 101    H HA   . SER A 1 7   ? -4.926  33.860  184.583 1.00 0.00 ?  7   SER A HA   1  
ATOM 102    H HB2  . SER A 1 7   ? -4.611  32.057  186.232 1.00 0.00 ?  7   SER A HB2  1  
ATOM 103    H HB3  . SER A 1 7   ? -4.276  30.885  184.899 1.00 0.00 ?  7   SER A HB3  1  
ATOM 104    H HG   . SER A 1 7   ? -2.453  31.920  186.001 1.00 0.00 ?  7   SER A HG   1  
ATOM 105    N N    . PRO A 1 8   ? -4.428  31.782  182.016 1.00 0.00 ?  8   PRO A N    1  
ATOM 106    C CA   . PRO A 1 8   ? -3.695  31.713  180.737 1.00 0.00 ?  8   PRO A CA   1  
ATOM 107    C C    . PRO A 1 8   ? -3.812  32.917  179.838 1.00 0.00 ?  8   PRO A C    1  
ATOM 108    O O    . PRO A 1 8   ? -3.004  33.077  178.923 1.00 0.00 ?  8   PRO A O    1  
ATOM 109    C CB   . PRO A 1 8   ? -4.278  30.494  180.025 1.00 0.00 ?  8   PRO A CB   1  
ATOM 110    C CG   . PRO A 1 8   ? -4.750  29.612  181.163 1.00 0.00 ?  8   PRO A CG   1  
ATOM 111    C CD   . PRO A 1 8   ? -5.286  30.603  182.185 1.00 0.00 ?  8   PRO A CD   1  
ATOM 112    H HA   . PRO A 1 8   ? -2.647  31.531  180.919 1.00 0.00 ?  8   PRO A HA   1  
ATOM 113    H HB2  . PRO A 1 8   ? -5.128  30.789  179.372 1.00 0.00 ?  8   PRO A HB2  1  
ATOM 114    H HB3  . PRO A 1 8   ? -3.506  29.978  179.423 1.00 0.00 ?  8   PRO A HB3  1  
ATOM 115    H HG2  . PRO A 1 8   ? -5.550  28.922  180.817 1.00 0.00 ?  8   PRO A HG2  1  
ATOM 116    H HG3  . PRO A 1 8   ? -3.906  29.028  181.586 1.00 0.00 ?  8   PRO A HG3  1  
ATOM 117    H HD2  . PRO A 1 8   ? -6.333  30.856  181.956 1.00 0.00 ?  8   PRO A HD2  1  
ATOM 118    H HD3  . PRO A 1 8   ? -5.216  30.184  183.208 1.00 0.00 ?  8   PRO A HD3  1  
ATOM 119    N N    . HIS A 1 9   ? -4.808  33.799  180.064 1.00 0.00 ?  9   HIS A N    1  
ATOM 120    C CA   . HIS A 1 9   ? -4.962  34.952  179.205 1.00 0.00 ?  9   HIS A CA   1  
ATOM 121    C C    . HIS A 1 9   ? -4.065  36.045  179.716 1.00 0.00 ?  9   HIS A C    1  
ATOM 122    O O    . HIS A 1 9   ? -4.058  37.155  179.185 1.00 0.00 ?  9   HIS A O    1  
ATOM 123    C CB   . HIS A 1 9   ? -6.396  35.507  179.171 1.00 0.00 ?  9   HIS A CB   1  
ATOM 124    C CG   . HIS A 1 9   ? -7.405  34.527  178.652 1.00 0.00 ?  9   HIS A CG   1  
ATOM 125    N ND1  . HIS A 1 9   ? -7.401  34.175  177.312 1.00 0.00 ?  9   HIS A ND1  1  
ATOM 126    C CD2  . HIS A 1 9   ? -8.406  33.880  179.311 1.00 0.00 ?  9   HIS A CD2  1  
ATOM 127    C CE1  . HIS A 1 9   ? -8.402  33.321  177.190 1.00 0.00 ?  9   HIS A CE1  1  
ATOM 128    N NE2  . HIS A 1 9   ? -9.042  33.107  178.366 1.00 0.00 ?  9   HIS A NE2  1  
ATOM 129    H H    . HIS A 1 9   ? -5.463  33.699  180.809 1.00 0.00 ?  9   HIS A H    1  
ATOM 130    H HA   . HIS A 1 9   ? -4.647  34.667  178.213 1.00 0.00 ?  9   HIS A HA   1  
ATOM 131    H HB2  . HIS A 1 9   ? -6.708  35.800  180.196 1.00 0.00 ?  9   HIS A HB2  1  
ATOM 132    H HB3  . HIS A 1 9   ? -6.432  36.407  178.520 1.00 0.00 ?  9   HIS A HB3  1  
ATOM 133    H HD2  . HIS A 1 9   ? -8.696  33.924  180.354 1.00 0.00 ?  9   HIS A HD2  1  
ATOM 134    H HE1  . HIS A 1 9   ? -8.699  32.831  176.263 1.00 0.00 ?  9   HIS A HE1  1  
ATOM 135    N N    . SER A 1 10  ? -3.283  35.746  180.767 1.00 0.00 ?  10  SER A N    1  
ATOM 136    C CA   . SER A 1 10  ? -2.394  36.718  181.341 1.00 0.00 ?  10  SER A CA   1  
ATOM 137    C C    . SER A 1 10  ? -1.180  36.842  180.455 1.00 0.00 ?  10  SER A C    1  
ATOM 138    O O    . SER A 1 10  ? -1.174  36.407  179.305 1.00 0.00 ?  10  SER A O    1  
ATOM 139    C CB   . SER A 1 10  ? -1.926  36.350  182.764 1.00 0.00 ?  10  SER A CB   1  
ATOM 140    O OG   . SER A 1 10  ? -3.049  36.222  183.624 1.00 0.00 ?  10  SER A OG   1  
ATOM 141    H H    . SER A 1 10  ? -3.286  34.845  181.193 1.00 0.00 ?  10  SER A H    1  
ATOM 142    H HA   . SER A 1 10  ? -2.915  37.663  181.355 1.00 0.00 ?  10  SER A HA   1  
ATOM 143    H HB2  . SER A 1 10  ? -1.376  35.384  182.748 1.00 0.00 ?  10  SER A HB2  1  
ATOM 144    H HB3  . SER A 1 10  ? -1.259  37.139  183.172 1.00 0.00 ?  10  SER A HB3  1  
ATOM 145    H HG   . SER A 1 10  ? -2.909  36.854  184.335 1.00 0.00 ?  10  SER A HG   1  
ATOM 146    N N    . SER A 1 11  ? -0.113  37.454  181.012 1.00 0.00 ?  11  SER A N    1  
ATOM 147    C CA   . SER A 1 11  ? 1.105   37.691  180.283 1.00 0.00 ?  11  SER A CA   1  
ATOM 148    C C    . SER A 1 11  ? 1.779   36.381  180.002 1.00 0.00 ?  11  SER A C    1  
ATOM 149    O O    . SER A 1 11  ? 1.358   35.326  180.476 1.00 0.00 ?  11  SER A O    1  
ATOM 150    C CB   . SER A 1 11  ? 2.101   38.577  181.046 1.00 0.00 ?  11  SER A CB   1  
ATOM 151    O OG   . SER A 1 11  ? 2.617   37.878  182.169 1.00 0.00 ?  11  SER A OG   1  
ATOM 152    H H    . SER A 1 11  ? -0.124  37.773  181.957 1.00 0.00 ?  11  SER A H    1  
ATOM 153    H HA   . SER A 1 11  ? 0.837   38.154  179.348 1.00 0.00 ?  11  SER A HA   1  
ATOM 154    H HB2  . SER A 1 11  ? 2.945   38.861  180.380 1.00 0.00 ?  11  SER A HB2  1  
ATOM 155    H HB3  . SER A 1 11  ? 1.594   39.500  181.400 1.00 0.00 ?  11  SER A HB3  1  
ATOM 156    H HG   . SER A 1 11  ? 3.350   37.353  181.839 1.00 0.00 ?  11  SER A HG   1  
ATOM 157    N N    . ASP A 1 12  ? 2.862   36.460  179.185 1.00 0.00 ?  12  ASP A N    1  
ATOM 158    C CA   . ASP A 1 12  ? 3.594   35.295  178.751 1.00 0.00 ?  12  ASP A CA   1  
ATOM 159    C C    . ASP A 1 12  ? 4.107   34.507  179.923 1.00 0.00 ?  12  ASP A C    1  
ATOM 160    O O    . ASP A 1 12  ? 4.509   35.038  180.957 1.00 0.00 ?  12  ASP A O    1  
ATOM 161    C CB   . ASP A 1 12  ? 4.803   35.642  177.873 1.00 0.00 ?  12  ASP A CB   1  
ATOM 162    C CG   . ASP A 1 12  ? 4.381   36.117  176.492 1.00 0.00 ?  12  ASP A CG   1  
ATOM 163    O OD1  . ASP A 1 12  ? 3.182   35.941  176.147 1.00 0.00 ?  12  ASP A OD1  1  
ATOM 164    O OD2  . ASP A 1 12  ? 5.252   36.659  175.762 1.00 0.00 -1 12  ASP A OD2  1  
ATOM 165    H H    . ASP A 1 12  ? 3.200   37.335  178.846 1.00 0.00 ?  12  ASP A H    1  
ATOM 166    H HA   . ASP A 1 12  ? 2.908   34.678  178.193 1.00 0.00 ?  12  ASP A HA   1  
ATOM 167    H HB2  . ASP A 1 12  ? 5.397   36.444  178.363 1.00 0.00 ?  12  ASP A HB2  1  
ATOM 168    H HB3  . ASP A 1 12  ? 5.446   34.745  177.764 1.00 0.00 ?  12  ASP A HB3  1  
ATOM 169    N N    . SER A 1 13  ? 4.076   33.175  179.717 1.00 0.00 ?  13  SER A N    1  
ATOM 170    C CA   . SER A 1 13  ? 4.480   32.194  180.690 1.00 0.00 ?  13  SER A CA   1  
ATOM 171    C C    . SER A 1 13  ? 5.969   31.935  180.604 1.00 0.00 ?  13  SER A C    1  
ATOM 172    O O    . SER A 1 13  ? 6.496   31.119  181.360 1.00 0.00 ?  13  SER A O    1  
ATOM 173    C CB   . SER A 1 13  ? 3.767   30.857  180.493 1.00 0.00 ?  13  SER A CB   1  
ATOM 174    O OG   . SER A 1 13  ? 4.238   30.219  179.315 1.00 0.00 ?  13  SER A OG   1  
ATOM 175    H H    . SER A 1 13  ? 3.761   32.799  178.849 1.00 0.00 ?  13  SER A H    1  
ATOM 176    H HA   . SER A 1 13  ? 4.250   32.592  181.665 1.00 0.00 ?  13  SER A HA   1  
ATOM 177    H HB2  . SER A 1 13  ? 3.947   30.198  181.362 1.00 0.00 ?  13  SER A HB2  1  
ATOM 178    H HB3  . SER A 1 13  ? 2.675   31.024  180.392 1.00 0.00 ?  13  SER A HB3  1  
ATOM 179    H HG   . SER A 1 13  ? 4.781   29.483  179.611 1.00 0.00 ?  13  SER A HG   1  
ATOM 180    N N    . PHE A 1 14  ? 6.661   32.584  179.638 1.00 0.00 ?  14  PHE A N    1  
ATOM 181    C CA   . PHE A 1 14  ? 8.091   32.367  179.382 1.00 0.00 ?  14  PHE A CA   1  
ATOM 182    C C    . PHE A 1 14  ? 8.993   32.511  180.606 1.00 0.00 ?  14  PHE A C    1  
ATOM 183    O O    . PHE A 1 14  ? 10.183  32.195  180.512 1.00 0.00 ?  14  PHE A O    1  
ATOM 184    C CB   . PHE A 1 14  ? 8.660   33.310  178.308 1.00 0.00 ?  14  PHE A CB   1  
ATOM 185    C CG   . PHE A 1 14  ? 8.296   32.920  176.916 1.00 0.00 ?  14  PHE A CG   1  
ATOM 186    C CD1  . PHE A 1 14  ? 8.747   31.730  176.385 1.00 0.00 ?  14  PHE A CD1  1  
ATOM 187    C CD2  . PHE A 1 14  ? 7.514   33.745  176.137 1.00 0.00 ?  14  PHE A CD2  1  
ATOM 188    C CE1  . PHE A 1 14  ? 8.419   31.370  175.099 1.00 0.00 ?  14  PHE A CE1  1  
ATOM 189    C CE2  . PHE A 1 14  ? 7.186   33.384  174.851 1.00 0.00 ?  14  PHE A CE2  1  
ATOM 190    C CZ   . PHE A 1 14  ? 7.637   32.197  174.333 1.00 0.00 ?  14  PHE A CZ   1  
ATOM 191    H H    . PHE A 1 14  ? 6.220   33.252  179.044 1.00 0.00 ?  14  PHE A H    1  
ATOM 192    H HA   . PHE A 1 14  ? 8.179   31.362  179.029 1.00 0.00 ?  14  PHE A HA   1  
ATOM 193    H HB2  . PHE A 1 14  ? 8.281   34.341  178.470 1.00 0.00 ?  14  PHE A HB2  1  
ATOM 194    H HB3  . PHE A 1 14  ? 9.771   33.325  178.370 1.00 0.00 ?  14  PHE A HB3  1  
ATOM 195    H HD1  . PHE A 1 14  ? 9.361   31.074  176.985 1.00 0.00 ?  14  PHE A HD1  1  
ATOM 196    H HD2  . PHE A 1 14  ? 7.159   34.682  176.538 1.00 0.00 ?  14  PHE A HD2  1  
ATOM 197    H HE1  . PHE A 1 14  ? 8.778   30.436  174.692 1.00 0.00 ?  14  PHE A HE1  1  
ATOM 198    H HE2  . PHE A 1 14  ? 6.571   34.036  174.249 1.00 0.00 ?  14  PHE A HE2  1  
ATOM 199    H HZ   . PHE A 1 14  ? 7.380   31.914  173.323 1.00 0.00 ?  14  PHE A HZ   1  
ATOM 200    N N    . ALA A 1 15  ? 8.486   32.994  181.756 1.00 0.00 ?  15  ALA A N    1  
ATOM 201    C CA   . ALA A 1 15  ? 9.311   33.216  182.929 1.00 0.00 ?  15  ALA A CA   1  
ATOM 202    C C    . ALA A 1 15  ? 10.041  31.961  183.403 1.00 0.00 ?  15  ALA A C    1  
ATOM 203    O O    . ALA A 1 15  ? 11.011  32.095  184.155 1.00 0.00 ?  15  ALA A O    1  
ATOM 204    C CB   . ALA A 1 15  ? 8.493   33.728  184.125 1.00 0.00 ?  15  ALA A CB   1  
ATOM 205    H H    . ALA A 1 15  ? 7.519   33.221  181.852 1.00 0.00 ?  15  ALA A H    1  
ATOM 206    H HA   . ALA A 1 15  ? 10.045  33.956  182.660 1.00 0.00 ?  15  ALA A HA   1  
ATOM 207    H HB1  . ALA A 1 15  ? 8.351   34.827  184.054 1.00 0.00 ?  15  ALA A HB1  1  
ATOM 208    H HB2  . ALA A 1 15  ? 9.017   33.499  185.078 1.00 0.00 ?  15  ALA A HB2  1  
ATOM 209    H HB3  . ALA A 1 15  ? 7.493   33.242  184.145 1.00 0.00 ?  15  ALA A HB3  1  
ATOM 210    N N    . GLN A 1 16  ? 9.593   30.721  183.047 1.00 0.00 ?  16  GLN A N    1  
ATOM 211    C CA   . GLN A 1 16  ? 10.305  29.524  183.515 1.00 0.00 ?  16  GLN A CA   1  
ATOM 212    C C    . GLN A 1 16  ? 11.700  29.560  182.947 1.00 0.00 ?  16  GLN A C    1  
ATOM 213    O O    . GLN A 1 16  ? 12.659  29.312  183.679 1.00 0.00 ?  16  GLN A O    1  
ATOM 214    C CB   . GLN A 1 16  ? 9.638   28.215  183.053 1.00 0.00 ?  16  GLN A CB   1  
ATOM 215    C CG   . GLN A 1 16  ? 10.282  26.964  183.661 1.00 0.00 ?  16  GLN A CG   1  
ATOM 216    C CD   . GLN A 1 16  ? 10.120  27.021  185.174 1.00 0.00 ?  16  GLN A CD   1  
ATOM 217    O OE1  . GLN A 1 16  ? 9.011   27.156  185.689 1.00 0.00 ?  16  GLN A OE1  1  
ATOM 218    N NE2  . GLN A 1 16  ? 11.258  26.906  185.908 1.00 0.00 ?  16  GLN A NE2  1  
ATOM 219    H H    . GLN A 1 16  ? 8.792   30.578  182.470 1.00 0.00 ?  16  GLN A H    1  
ATOM 220    H HA   . GLN A 1 16  ? 10.356  29.571  184.591 1.00 0.00 ?  16  GLN A HA   1  
ATOM 221    H HB2  . GLN A 1 16  ? 8.561   28.242  183.330 1.00 0.00 ?  16  GLN A HB2  1  
ATOM 222    H HB3  . GLN A 1 16  ? 9.704   28.149  181.946 1.00 0.00 ?  16  GLN A HB3  1  
ATOM 223    H HG2  . GLN A 1 16  ? 9.784   26.050  183.267 1.00 0.00 ?  16  GLN A HG2  1  
ATOM 224    H HG3  . GLN A 1 16  ? 11.362  26.928  183.409 1.00 0.00 ?  16  GLN A HG3  1  
ATOM 225    H HE21 . GLN A 1 16  ? 12.139  26.787  185.450 1.00 0.00 ?  16  GLN A HE21 1  
ATOM 226    H HE22 . GLN A 1 16  ? 11.217  26.951  186.906 1.00 0.00 ?  16  GLN A HE22 1  
ATOM 227    N N    . ALA A 1 17  ? 11.841  29.917  181.631 1.00 0.00 ?  17  ALA A N    1  
ATOM 228    C CA   . ALA A 1 17  ? 13.158  29.982  181.021 1.00 0.00 ?  17  ALA A CA   1  
ATOM 229    C C    . ALA A 1 17  ? 13.000  30.255  179.554 1.00 0.00 ?  17  ALA A C    1  
ATOM 230    O O    . ALA A 1 17  ? 12.813  29.330  178.763 1.00 0.00 ?  17  ALA A O    1  
ATOM 231    C CB   . ALA A 1 17  ? 13.968  28.675  181.140 1.00 0.00 ?  17  ALA A CB   1  
ATOM 232    H H    . ALA A 1 17  ? 11.065  30.144  181.047 1.00 0.00 ?  17  ALA A H    1  
ATOM 233    H HA   . ALA A 1 17  ? 13.694  30.798  181.480 1.00 0.00 ?  17  ALA A HA   1  
ATOM 234    H HB1  . ALA A 1 17  ? 13.286  27.813  181.297 1.00 0.00 ?  17  ALA A HB1  1  
ATOM 235    H HB2  . ALA A 1 17  ? 14.671  28.734  181.999 1.00 0.00 ?  17  ALA A HB2  1  
ATOM 236    H HB3  . ALA A 1 17  ? 14.555  28.499  180.213 1.00 0.00 ?  17  ALA A HB3  1  
ATOM 237    N N    . ALA A 1 18  ? 13.089  31.543  179.146 1.00 0.00 ?  18  ALA A N    1  
ATOM 238    C CA   . ALA A 1 18  ? 12.967  31.865  177.745 1.00 0.00 ?  18  ALA A CA   1  
ATOM 239    C C    . ALA A 1 18  ? 14.327  31.747  177.109 1.00 0.00 ?  18  ALA A C    1  
ATOM 240    O O    . ALA A 1 18  ? 14.511  31.012  176.139 1.00 0.00 ?  18  ALA A O    1  
ATOM 241    C CB   . ALA A 1 18  ? 12.457  33.295  177.495 1.00 0.00 ?  18  ALA A CB   1  
ATOM 242    H H    . ALA A 1 18  ? 13.223  32.303  179.777 1.00 0.00 ?  18  ALA A H    1  
ATOM 243    H HA   . ALA A 1 18  ? 12.300  31.146  177.297 1.00 0.00 ?  18  ALA A HA   1  
ATOM 244    H HB1  . ALA A 1 18  ? 13.237  33.898  176.984 1.00 0.00 ?  18  ALA A HB1  1  
ATOM 245    H HB2  . ALA A 1 18  ? 12.201  33.788  178.457 1.00 0.00 ?  18  ALA A HB2  1  
ATOM 246    H HB3  . ALA A 1 18  ? 11.549  33.273  176.855 1.00 0.00 ?  18  ALA A HB3  1  
ATOM 247    N N    . SER A 1 19  ? 15.316  32.482  177.659 1.00 0.00 ?  19  SER A N    1  
ATOM 248    C CA   . SER A 1 19  ? 16.659  32.464  177.114 1.00 0.00 ?  19  SER A CA   1  
ATOM 249    C C    . SER A 1 19  ? 17.309  31.077  177.165 1.00 0.00 ?  19  SER A C    1  
ATOM 250    O O    . SER A 1 19  ? 17.894  30.662  176.162 1.00 0.00 ?  19  SER A O    1  
ATOM 251    C CB   . SER A 1 19  ? 17.614  33.480  177.775 1.00 0.00 ?  19  SER A CB   1  
ATOM 252    O OG   . SER A 1 19  ? 17.243  34.801  177.409 1.00 0.00 ?  19  SER A OG   1  
ATOM 253    H H    . SER A 1 19  ? 15.168  33.064  178.455 1.00 0.00 ?  19  SER A H    1  
ATOM 254    H HA   . SER A 1 19  ? 16.552  32.727  176.072 1.00 0.00 ?  19  SER A HA   1  
ATOM 255    H HB2  . SER A 1 19  ? 17.568  33.394  178.879 1.00 0.00 ?  19  SER A HB2  1  
ATOM 256    H HB3  . SER A 1 19  ? 18.657  33.298  177.442 1.00 0.00 ?  19  SER A HB3  1  
ATOM 257    H HG   . SER A 1 19  ? 16.657  34.711  176.654 1.00 0.00 ?  19  SER A HG   1  
ATOM 258    N N    . PRO A 1 20  ? 17.258  30.332  178.284 1.00 0.00 ?  20  PRO A N    1  
ATOM 259    C CA   . PRO A 1 20  ? 17.890  29.007  178.346 1.00 0.00 ?  20  PRO A CA   1  
ATOM 260    C C    . PRO A 1 20  ? 17.446  28.020  177.309 1.00 0.00 ?  20  PRO A C    1  
ATOM 261    O O    . PRO A 1 20  ? 18.100  26.991  177.133 1.00 0.00 ?  20  PRO A O    1  
ATOM 262    C CB   . PRO A 1 20  ? 17.541  28.471  179.732 1.00 0.00 ?  20  PRO A CB   1  
ATOM 263    C CG   . PRO A 1 20  ? 17.347  29.722  180.566 1.00 0.00 ?  20  PRO A CG   1  
ATOM 264    C CD   . PRO A 1 20  ? 16.701  30.707  179.603 1.00 0.00 ?  20  PRO A CD   1  
ATOM 265    H HA   . PRO A 1 20  ? 18.958  29.103  178.277 1.00 0.00 ?  20  PRO A HA   1  
ATOM 266    H HB2  . PRO A 1 20  ? 16.606  27.870  179.697 1.00 0.00 ?  20  PRO A HB2  1  
ATOM 267    H HB3  . PRO A 1 20  ? 18.370  27.853  180.138 1.00 0.00 ?  20  PRO A HB3  1  
ATOM 268    H HG2  . PRO A 1 20  ? 16.683  29.516  181.433 1.00 0.00 ?  20  PRO A HG2  1  
ATOM 269    H HG3  . PRO A 1 20  ? 18.324  30.109  180.927 1.00 0.00 ?  20  PRO A HG3  1  
ATOM 270    H HD2  . PRO A 1 20  ? 15.599  30.598  179.619 1.00 0.00 ?  20  PRO A HD2  1  
ATOM 271    H HD3  . PRO A 1 20  ? 16.970  31.744  179.878 1.00 0.00 ?  20  PRO A HD3  1  
ATOM 272    N N    . ALA A 1 21  ? 16.309  28.280  176.635 1.00 0.00 ?  21  ALA A N    1  
ATOM 273    C CA   . ALA A 1 21  ? 15.826  27.367  175.635 1.00 0.00 ?  21  ALA A CA   1  
ATOM 274    C C    . ALA A 1 21  ? 16.857  27.236  174.552 1.00 0.00 ?  21  ALA A C    1  
ATOM 275    O O    . ALA A 1 21  ? 17.082  26.141  174.039 1.00 0.00 ?  21  ALA A O    1  
ATOM 276    C CB   . ALA A 1 21  ? 14.514  27.824  174.980 1.00 0.00 ?  21  ALA A CB   1  
ATOM 277    H H    . ALA A 1 21  ? 15.758  29.096  176.802 1.00 0.00 ?  21  ALA A H    1  
ATOM 278    H HA   . ALA A 1 21  ? 15.690  26.409  176.110 1.00 0.00 ?  21  ALA A HA   1  
ATOM 279    H HB1  . ALA A 1 21  ? 14.723  28.353  174.026 1.00 0.00 ?  21  ALA A HB1  1  
ATOM 280    H HB2  . ALA A 1 21  ? 13.964  28.514  175.656 1.00 0.00 ?  21  ALA A HB2  1  
ATOM 281    H HB3  . ALA A 1 21  ? 13.864  26.949  174.764 1.00 0.00 ?  21  ALA A HB3  1  
ATOM 282    N N    . ARG A 1 22  ? 17.517  28.346  174.169 1.00 0.00 ?  22  ARG A N    1  
ATOM 283    C CA   . ARG A 1 22  ? 18.501  28.252  173.125 1.00 0.00 ?  22  ARG A CA   1  
ATOM 284    C C    . ARG A 1 22  ? 19.719  27.577  173.683 1.00 0.00 ?  22  ARG A C    1  
ATOM 285    O O    . ARG A 1 22  ? 20.525  27.028  172.933 1.00 0.00 ?  22  ARG A O    1  
ATOM 286    C CB   . ARG A 1 22  ? 18.935  29.614  172.556 1.00 0.00 ?  22  ARG A CB   1  
ATOM 287    C CG   . ARG A 1 22  ? 17.808  30.316  171.797 1.00 0.00 ?  22  ARG A CG   1  
ATOM 288    C CD   . ARG A 1 22  ? 18.181  31.742  171.383 1.00 0.00 ?  22  ARG A CD   1  
ATOM 289    N NE   . ARG A 1 22  ? 18.339  32.566  172.612 1.00 0.00 ?  22  ARG A NE   1  
ATOM 290    C CZ   . ARG A 1 22  ? 18.764  33.859  172.513 1.00 0.00 ?  22  ARG A CZ   1  
ATOM 291    N NH1  . ARG A 1 22  ? 19.043  34.395  171.289 1.00 0.00 1  22  ARG A NH1  1  
ATOM 292    N NH2  . ARG A 1 22  ? 18.911  34.617  173.639 1.00 0.00 ?  22  ARG A NH2  1  
ATOM 293    H H    . ARG A 1 22  ? 17.358  29.246  174.572 1.00 0.00 ?  22  ARG A H    1  
ATOM 294    H HA   . ARG A 1 22  ? 18.086  27.637  172.343 1.00 0.00 ?  22  ARG A HA   1  
ATOM 295    H HB2  . ARG A 1 22  ? 19.273  30.264  173.392 1.00 0.00 ?  22  ARG A HB2  1  
ATOM 296    H HB3  . ARG A 1 22  ? 19.793  29.463  171.868 1.00 0.00 ?  22  ARG A HB3  1  
ATOM 297    H HG2  . ARG A 1 22  ? 17.561  29.728  170.888 1.00 0.00 ?  22  ARG A HG2  1  
ATOM 298    H HG3  . ARG A 1 22  ? 16.903  30.350  172.440 1.00 0.00 ?  22  ARG A HG3  1  
ATOM 299    H HD2  . ARG A 1 22  ? 19.144  31.753  170.827 1.00 0.00 ?  22  ARG A HD2  1  
ATOM 300    H HD3  . ARG A 1 22  ? 17.382  32.197  170.762 1.00 0.00 ?  22  ARG A HD3  1  
ATOM 301    H HE   . ARG A 1 22  ? 18.135  32.173  173.509 1.00 0.00 ?  22  ARG A HE   1  
ATOM 302    H HH11 . ARG A 1 22  ? 18.936  33.838  170.464 1.00 0.00 ?  22  ARG A HH11 1  
ATOM 303    H HH12 . ARG A 1 22  ? 19.355  35.342  171.216 1.00 0.00 ?  22  ARG A HH12 1  
ATOM 304    H HH21 . ARG A 1 22  ? 18.708  34.225  174.536 1.00 0.00 ?  22  ARG A HH21 1  
ATOM 305    H HH22 . ARG A 1 22  ? 19.222  35.565  173.566 1.00 0.00 ?  22  ARG A HH22 1  
ATOM 306    N N    . LYS A 1 23  ? 19.888  27.595  175.022 1.00 0.00 ?  23  LYS A N    1  
ATOM 307    C CA   . LYS A 1 23  ? 21.044  26.957  175.603 1.00 0.00 ?  23  LYS A CA   1  
ATOM 308    C C    . LYS A 1 23  ? 20.783  25.458  175.617 1.00 0.00 ?  23  LYS A C    1  
ATOM 309    O O    . LYS A 1 23  ? 19.627  25.037  175.577 1.00 0.00 ?  23  LYS A O    1  
ATOM 310    C CB   . LYS A 1 23  ? 21.363  27.429  177.044 1.00 0.00 ?  23  LYS A CB   1  
ATOM 311    C CG   . LYS A 1 23  ? 21.830  28.886  177.095 1.00 0.00 ?  23  LYS A CG   1  
ATOM 312    C CD   . LYS A 1 23  ? 22.412  29.276  178.460 1.00 0.00 ?  23  LYS A CD   1  
ATOM 313    C CE   . LYS A 1 23  ? 21.367  29.307  179.576 1.00 0.00 ?  23  LYS A CE   1  
ATOM 314    N NZ   . LYS A 1 23  ? 21.984  29.747  180.847 1.00 0.00 1  23  LYS A NZ   1  
ATOM 315    H H    . LYS A 1 23  ? 19.249  28.041  175.648 1.00 0.00 ?  23  LYS A H    1  
ATOM 316    H HA   . LYS A 1 23  ? 21.871  27.174  174.946 1.00 0.00 ?  23  LYS A HA   1  
ATOM 317    H HB2  . LYS A 1 23  ? 20.452  27.317  177.672 1.00 0.00 ?  23  LYS A HB2  1  
ATOM 318    H HB3  . LYS A 1 23  ? 22.157  26.782  177.473 1.00 0.00 ?  23  LYS A HB3  1  
ATOM 319    H HG2  . LYS A 1 23  ? 22.604  29.044  176.314 1.00 0.00 ?  23  LYS A HG2  1  
ATOM 320    H HG3  . LYS A 1 23  ? 20.970  29.550  176.863 1.00 0.00 ?  23  LYS A HG3  1  
ATOM 321    H HD2  . LYS A 1 23  ? 23.207  28.551  178.733 1.00 0.00 ?  23  LYS A HD2  1  
ATOM 322    H HD3  . LYS A 1 23  ? 22.881  30.281  178.377 1.00 0.00 ?  23  LYS A HD3  1  
ATOM 323    H HE2  . LYS A 1 23  ? 20.553  30.019  179.328 1.00 0.00 ?  23  LYS A HE2  1  
ATOM 324    H HE3  . LYS A 1 23  ? 20.937  28.295  179.734 1.00 0.00 ?  23  LYS A HE3  1  
ATOM 325    H HZ1  . LYS A 1 23  ? 21.319  29.584  181.630 1.00 0.00 ?  23  LYS A HZ1  1  
ATOM 326    H HZ2  . LYS A 1 23  ? 22.212  30.759  180.790 1.00 0.00 ?  23  LYS A HZ2  1  
ATOM 327    H HZ3  . LYS A 1 23  ? 22.855  29.203  181.016 1.00 0.00 ?  23  LYS A HZ3  1  
ATOM 328    N N    . PRO A 1 24  ? 21.838  24.626  175.663 1.00 0.00 ?  24  PRO A N    1  
ATOM 329    C CA   . PRO A 1 24  ? 21.668  23.170  175.682 1.00 0.00 ?  24  PRO A CA   1  
ATOM 330    C C    . PRO A 1 24  ? 20.828  22.676  176.849 1.00 0.00 ?  24  PRO A C    1  
ATOM 331    O O    . PRO A 1 24  ? 20.725  23.370  177.859 1.00 0.00 ?  24  PRO A O    1  
ATOM 332    C CB   . PRO A 1 24  ? 23.091  22.611  175.805 1.00 0.00 ?  24  PRO A CB   1  
ATOM 333    C CG   . PRO A 1 24  ? 23.971  23.707  175.233 1.00 0.00 ?  24  PRO A CG   1  
ATOM 334    C CD   . PRO A 1 24  ? 23.273  24.999  175.639 1.00 0.00 ?  24  PRO A CD   1  
ATOM 335    H HA   . PRO A 1 24  ? 21.237  22.845  174.750 1.00 0.00 ?  24  PRO A HA   1  
ATOM 336    H HB2  . PRO A 1 24  ? 23.345  22.415  176.868 1.00 0.00 ?  24  PRO A HB2  1  
ATOM 337    H HB3  . PRO A 1 24  ? 23.198  21.677  175.215 1.00 0.00 ?  24  PRO A HB3  1  
ATOM 338    H HG2  . PRO A 1 24  ? 24.994  23.653  175.669 1.00 0.00 ?  24  PRO A HG2  1  
ATOM 339    H HG3  . PRO A 1 24  ? 24.033  23.624  174.128 1.00 0.00 ?  24  PRO A HG3  1  
ATOM 340    H HD2  . PRO A 1 24  ? 23.623  25.333  176.640 1.00 0.00 ?  24  PRO A HD2  1  
ATOM 341    H HD3  . PRO A 1 24  ? 23.481  25.789  174.888 1.00 0.00 ?  24  PRO A HD3  1  
ATOM 342    N N    . PRO A 1 25  ? 20.216  21.495  176.756 1.00 0.00 ?  25  PRO A N    1  
ATOM 343    C CA   . PRO A 1 25  ? 19.353  20.971  177.814 1.00 0.00 ?  25  PRO A CA   1  
ATOM 344    C C    . PRO A 1 25  ? 20.076  20.535  179.059 1.00 0.00 ?  25  PRO A C    1  
ATOM 345    O O    . PRO A 1 25  ? 21.293  20.357  179.065 1.00 0.00 ?  25  PRO A O    1  
ATOM 346    C CB   . PRO A 1 25  ? 18.649  19.779  177.174 1.00 0.00 ?  25  PRO A CB   1  
ATOM 347    C CG   . PRO A 1 25  ? 19.652  19.278  176.150 1.00 0.00 ?  25  PRO A CG   1  
ATOM 348    C CD   . PRO A 1 25  ? 20.333  20.543  175.633 1.00 0.00 ?  25  PRO A CD   1  
ATOM 349    H HA   . PRO A 1 25  ? 18.609  21.703  178.091 1.00 0.00 ?  25  PRO A HA   1  
ATOM 350    H HB2  . PRO A 1 25  ? 18.430  18.996  177.932 1.00 0.00 ?  25  PRO A HB2  1  
ATOM 351    H HB3  . PRO A 1 25  ? 17.708  20.096  176.677 1.00 0.00 ?  25  PRO A HB3  1  
ATOM 352    H HG2  . PRO A 1 25  ? 20.390  18.597  176.629 1.00 0.00 ?  25  PRO A HG2  1  
ATOM 353    H HG3  . PRO A 1 25  ? 19.136  18.745  175.324 1.00 0.00 ?  25  PRO A HG3  1  
ATOM 354    H HD2  . PRO A 1 25  ? 21.396  20.337  175.388 1.00 0.00 ?  25  PRO A HD2  1  
ATOM 355    H HD3  . PRO A 1 25  ? 19.812  20.922  174.728 1.00 0.00 ?  25  PRO A HD3  1  
ATOM 356    N N    . ARG A 1 26  ? 19.295  20.355  180.158 1.00 0.00 ?  26  ARG A N    1  
ATOM 357    C CA   . ARG A 1 26  ? 19.851  19.964  181.434 1.00 0.00 ?  26  ARG A CA   1  
ATOM 358    C C    . ARG A 1 26  ? 20.228  18.490  181.346 1.00 0.00 ?  26  ARG A C    1  
ATOM 359    O O    . ARG A 1 26  ? 19.420  17.597  181.598 1.00 0.00 ?  26  ARG A O    1  
ATOM 360    C CB   . ARG A 1 26  ? 18.827  20.162  182.586 1.00 0.00 ?  26  ARG A CB   1  
ATOM 361    C CG   . ARG A 1 26  ? 18.150  21.565  182.585 1.00 0.00 ?  26  ARG A CG   1  
ATOM 362    C CD   . ARG A 1 26  ? 19.158  22.713  182.715 1.00 0.00 ?  26  ARG A CD   1  
ATOM 363    N NE   . ARG A 1 26  ? 18.399  23.988  182.846 1.00 0.00 ?  26  ARG A NE   1  
ATOM 364    C CZ   . ARG A 1 26  ? 19.065  25.181  182.844 1.00 0.00 ?  26  ARG A CZ   1  
ATOM 365    N NH1  . ARG A 1 26  ? 20.424  25.205  182.719 1.00 0.00 1  26  ARG A NH1  1  
ATOM 366    N NH2  . ARG A 1 26  ? 18.370  26.350  182.965 1.00 0.00 ?  26  ARG A NH2  1  
ATOM 367    H H    . ARG A 1 26  ? 18.307  20.482  180.131 1.00 0.00 ?  26  ARG A H    1  
ATOM 368    H HA   . ARG A 1 26  ? 20.738  20.553  181.606 1.00 0.00 ?  26  ARG A HA   1  
ATOM 369    H HB2  . ARG A 1 26  ? 18.039  19.381  182.503 1.00 0.00 ?  26  ARG A HB2  1  
ATOM 370    H HB3  . ARG A 1 26  ? 19.348  20.018  183.556 1.00 0.00 ?  26  ARG A HB3  1  
ATOM 371    H HG2  . ARG A 1 26  ? 17.582  21.691  181.640 1.00 0.00 ?  26  ARG A HG2  1  
ATOM 372    H HG3  . ARG A 1 26  ? 17.428  21.617  183.428 1.00 0.00 ?  26  ARG A HG3  1  
ATOM 373    H HD2  . ARG A 1 26  ? 19.790  22.586  183.621 1.00 0.00 ?  26  ARG A HD2  1  
ATOM 374    H HD3  . ARG A 1 26  ? 19.800  22.788  181.813 1.00 0.00 ?  26  ARG A HD3  1  
ATOM 375    H HE   . ARG A 1 26  ? 17.403  23.971  182.936 1.00 0.00 ?  26  ARG A HE   1  
ATOM 376    H HH11 . ARG A 1 26  ? 20.933  24.349  182.629 1.00 0.00 ?  26  ARG A HH11 1  
ATOM 377    H HH12 . ARG A 1 26  ? 20.909  26.079  182.717 1.00 0.00 ?  26  ARG A HH12 1  
ATOM 378    H HH21 . ARG A 1 26  ? 17.374  26.333  183.055 1.00 0.00 ?  26  ARG A HH21 1  
ATOM 379    H HH22 . ARG A 1 26  ? 18.857  27.223  182.963 1.00 0.00 ?  26  ARG A HH22 1  
ATOM 380    N N    . GLY A 1 27  ? 21.508  18.254  180.975 1.00 0.00 ?  27  GLY A N    1  
ATOM 381    C CA   . GLY A 1 27  ? 22.085  16.931  180.760 1.00 0.00 ?  27  GLY A CA   1  
ATOM 382    C C    . GLY A 1 27  ? 22.624  16.239  182.014 1.00 0.00 ?  27  GLY A C    1  
ATOM 383    O O    . GLY A 1 27  ? 23.066  15.100  181.902 1.00 0.00 ?  27  GLY A O    1  
ATOM 384    H H    . GLY A 1 27  ? 22.141  19.010  180.826 1.00 0.00 ?  27  GLY A H    1  
ATOM 385    H HA2  . GLY A 1 27  ? 21.294  16.314  180.366 1.00 0.00 ?  27  GLY A HA2  1  
ATOM 386    H HA3  . GLY A 1 27  ? 22.905  17.067  180.066 1.00 0.00 ?  27  GLY A HA3  1  
ATOM 387    N N    . GLY A 1 28  ? 22.649  16.894  183.206 1.00 0.00 ?  28  GLY A N    1  
ATOM 388    C CA   . GLY A 1 28  ? 23.356  16.344  184.382 1.00 0.00 ?  28  GLY A CA   1  
ATOM 389    C C    . GLY A 1 28  ? 23.167  14.847  184.697 1.00 0.00 ?  28  GLY A C    1  
ATOM 390    O O    . GLY A 1 28  ? 24.191  14.167  184.795 1.00 0.00 ?  28  GLY A O    1  
ATOM 391    H H    . GLY A 1 28  ? 22.193  17.770  183.339 1.00 0.00 ?  28  GLY A H    1  
ATOM 392    H HA2  . GLY A 1 28  ? 24.405  16.494  184.194 1.00 0.00 ?  28  GLY A HA2  1  
ATOM 393    H HA3  . GLY A 1 28  ? 22.998  16.913  185.232 1.00 0.00 ?  28  GLY A HA3  1  
ATOM 394    N N    . ARG A 1 29  ? 21.930  14.270  184.864 1.00 0.00 ?  29  ARG A N    1  
ATOM 395    C CA   . ARG A 1 29  ? 21.836  12.811  185.122 1.00 0.00 ?  29  ARG A CA   1  
ATOM 396    C C    . ARG A 1 29  ? 21.329  12.206  183.849 1.00 0.00 ?  29  ARG A C    1  
ATOM 397    O O    . ARG A 1 29  ? 21.120  10.995  183.771 1.00 0.00 ?  29  ARG A O    1  
ATOM 398    C CB   . ARG A 1 29  ? 20.899  12.324  186.321 1.00 0.00 ?  29  ARG A CB   1  
ATOM 399    C CG   . ARG A 1 29  ? 21.668  11.849  187.623 1.00 0.00 ?  29  ARG A CG   1  
ATOM 400    C CD   . ARG A 1 29  ? 21.036  10.611  188.407 1.00 0.00 ?  29  ARG A CD   1  
ATOM 401    N NE   . ARG A 1 29  ? 19.583  10.869  188.591 1.00 0.00 ?  29  ARG A NE   1  
ATOM 402    C CZ   . ARG A 1 29  ? 18.712  9.830   188.760 1.00 0.00 ?  29  ARG A CZ   1  
ATOM 403    N NH1  . ARG A 1 29  ? 19.160  8.536   188.765 1.00 0.00 1  29  ARG A NH1  1  
ATOM 404    N NH2  . ARG A 1 29  ? 17.384  10.089  188.919 1.00 0.00 ?  29  ARG A NH2  1  
ATOM 405    H H    . ARG A 1 29  ? 21.077  14.782  184.821 1.00 0.00 ?  29  ARG A H    1  
ATOM 406    H HA   . ARG A 1 29  ? 22.838  12.446  185.282 1.00 0.00 ?  29  ARG A HA   1  
ATOM 407    H HB2  . ARG A 1 29  ? 20.220  13.159  186.598 1.00 0.00 ?  29  ARG A HB2  1  
ATOM 408    H HB3  . ARG A 1 29  ? 20.266  11.486  185.959 1.00 0.00 ?  29  ARG A HB3  1  
ATOM 409    H HG2  . ARG A 1 29  ? 22.705  11.579  187.335 1.00 0.00 ?  29  ARG A HG2  1  
ATOM 410    H HG3  . ARG A 1 29  ? 21.734  12.712  188.321 1.00 0.00 ?  29  ARG A HG3  1  
ATOM 411    H HD2  . ARG A 1 29  ? 21.160  9.675   187.824 1.00 0.00 ?  29  ARG A HD2  1  
ATOM 412    H HD3  . ARG A 1 29  ? 21.500  10.496  189.410 1.00 0.00 ?  29  ARG A HD3  1  
ATOM 413    H HE   . ARG A 1 29  ? 19.241  11.808  188.586 1.00 0.00 ?  29  ARG A HE   1  
ATOM 414    H HH11 . ARG A 1 29  ? 20.137  8.341   188.641 1.00 0.00 ?  29  ARG A HH11 1  
ATOM 415    H HH12 . ARG A 1 29  ? 18.514  7.785   188.893 1.00 0.00 ?  29  ARG A HH12 1  
ATOM 416    H HH21 . ARG A 1 29  ? 17.052  11.034  188.911 1.00 0.00 ?  29  ARG A HH21 1  
ATOM 417    H HH22 . ARG A 1 29  ? 16.739  9.335   189.043 1.00 0.00 ?  29  ARG A HH22 1  
ATOM 418    N N    . ARG A 1 30  ? 21.126  13.060  182.805 1.00 0.00 ?  30  ARG A N    1  
ATOM 419    C CA   . ARG A 1 30  ? 20.620  12.577  181.539 1.00 0.00 ?  30  ARG A CA   1  
ATOM 420    C C    . ARG A 1 30  ? 21.432  13.173  180.431 1.00 0.00 ?  30  ARG A C    1  
ATOM 421    O O    . ARG A 1 30  ? 20.924  13.977  179.650 1.00 0.00 ?  30  ARG A O    1  
ATOM 422    C CB   . ARG A 1 30  ? 19.158  12.978  181.287 1.00 0.00 ?  30  ARG A CB   1  
ATOM 423    C CG   . ARG A 1 30  ? 18.201  12.465  182.365 1.00 0.00 ?  30  ARG A CG   1  
ATOM 424    C CD   . ARG A 1 30  ? 18.079  10.940  182.379 1.00 0.00 ?  30  ARG A CD   1  
ATOM 425    N NE   . ARG A 1 30  ? 17.043  10.569  183.385 1.00 0.00 ?  30  ARG A NE   1  
ATOM 426    C CZ   . ARG A 1 30  ? 15.718  10.615  183.054 1.00 0.00 ?  30  ARG A CZ   1  
ATOM 427    N NH1  . ARG A 1 30  ? 15.336  11.011  181.804 1.00 0.00 1  30  ARG A NH1  1  
ATOM 428    N NH2  . ARG A 1 30  ? 14.770  10.271  183.976 1.00 0.00 ?  30  ARG A NH2  1  
ATOM 429    H H    . ARG A 1 30  ? 21.314  14.037  182.866 1.00 0.00 ?  30  ARG A H    1  
ATOM 430    H HA   . ARG A 1 30  ? 20.725  11.505  181.516 1.00 0.00 ?  30  ARG A HA   1  
ATOM 431    H HB2  . ARG A 1 30  ? 19.090  14.087  181.241 1.00 0.00 ?  30  ARG A HB2  1  
ATOM 432    H HB3  . ARG A 1 30  ? 18.837  12.575  180.303 1.00 0.00 ?  30  ARG A HB3  1  
ATOM 433    H HG2  . ARG A 1 30  ? 18.561  12.806  183.359 1.00 0.00 ?  30  ARG A HG2  1  
ATOM 434    H HG3  . ARG A 1 30  ? 17.195  12.908  182.196 1.00 0.00 ?  30  ARG A HG3  1  
ATOM 435    H HD2  . ARG A 1 30  ? 17.766  10.556  181.384 1.00 0.00 ?  30  ARG A HD2  1  
ATOM 436    H HD3  . ARG A 1 30  ? 19.037  10.468  182.681 1.00 0.00 ?  30  ARG A HD3  1  
ATOM 437    H HE   . ARG A 1 30  ? 17.319  10.284  184.303 1.00 0.00 ?  30  ARG A HE   1  
ATOM 438    H HH11 . ARG A 1 30  ? 16.027  11.268  181.129 1.00 0.00 ?  30  ARG A HH11 1  
ATOM 439    H HH12 . ARG A 1 30  ? 14.365  11.045  181.565 1.00 0.00 ?  30  ARG A HH12 1  
ATOM 440    H HH21 . ARG A 1 30  ? 15.046  9.986   184.894 1.00 0.00 ?  30  ARG A HH21 1  
ATOM 441    H HH22 . ARG A 1 30  ? 13.802  10.307  183.734 1.00 0.00 ?  30  ARG A HH22 1  
ATOM 442    N N    . ILE A 1 31  ? 22.720  12.782  180.338 1.00 0.00 ?  31  ILE A N    1  
ATOM 443    C CA   . ILE A 1 31  ? 23.568  13.283  179.286 1.00 0.00 ?  31  ILE A CA   1  
ATOM 444    C C    . ILE A 1 31  ? 23.482  12.281  178.191 1.00 0.00 ?  31  ILE A C    1  
ATOM 445    O O    . ILE A 1 31  ? 22.963  11.182  178.399 1.00 0.00 ?  31  ILE A O    1  
ATOM 446    C CB   . ILE A 1 31  ? 25.028  13.433  179.664 1.00 0.00 ?  31  ILE A CB   1  
ATOM 447    C CG1  . ILE A 1 31  ? 25.404  12.544  180.871 1.00 0.00 ?  31  ILE A CG1  1  
ATOM 448    C CG2  . ILE A 1 31  ? 25.315  14.922  179.941 1.00 0.00 ?  31  ILE A CG2  1  
ATOM 449    C CD1  . ILE A 1 31  ? 25.300  11.050  180.564 1.00 0.00 ?  31  ILE A CD1  1  
ATOM 450    H H    . ILE A 1 31  ? 23.138  12.150  180.985 1.00 0.00 ?  31  ILE A H    1  
ATOM 451    H HA   . ILE A 1 31  ? 23.159  14.219  178.939 1.00 0.00 ?  31  ILE A HA   1  
ATOM 452    H HB   . ILE A 1 31  ? 25.654  13.122  178.799 1.00 0.00 ?  31  ILE A HB   1  
ATOM 453    H HG12 . ILE A 1 31  ? 26.450  12.774  181.169 1.00 0.00 ?  31  ILE A HG12 1  
ATOM 454    H HG13 . ILE A 1 31  ? 24.748  12.786  181.733 1.00 0.00 ?  31  ILE A HG13 1  
ATOM 455    H HG21 . ILE A 1 31  ? 24.377  15.515  179.923 1.00 0.00 ?  31  ILE A HG21 1  
ATOM 456    H HG22 . ILE A 1 31  ? 26.006  15.330  179.174 1.00 0.00 ?  31  ILE A HG22 1  
ATOM 457    H HG23 . ILE A 1 31  ? 25.788  15.041  180.940 1.00 0.00 ?  31  ILE A HG23 1  
ATOM 458    H HD11 . ILE A 1 31  ? 24.236  10.729  180.565 1.00 0.00 ?  31  ILE A HD11 1  
ATOM 459    H HD12 . ILE A 1 31  ? 25.850  10.460  181.328 1.00 0.00 ?  31  ILE A HD12 1  
ATOM 460    H HD13 . ILE A 1 31  ? 25.735  10.833  179.566 1.00 0.00 ?  31  ILE A HD13 1  
ATOM 461    N N    . TRP A 1 32  ? 23.955  12.648  176.978 1.00 0.00 ?  32  TRP A N    1  
ATOM 462    C CA   . TRP A 1 32  ? 23.910  11.717  175.889 1.00 0.00 ?  32  TRP A CA   1  
ATOM 463    C C    . TRP A 1 32  ? 24.828  10.609  176.270 1.00 0.00 ?  32  TRP A C    1  
ATOM 464    O O    . TRP A 1 32  ? 26.001  10.831  176.570 1.00 0.00 ?  32  TRP A O    1  
ATOM 465    C CB   . TRP A 1 32  ? 24.386  12.310  174.550 1.00 0.00 ?  32  TRP A CB   1  
ATOM 466    C CG   . TRP A 1 32  ? 24.289  11.335  173.398 1.00 0.00 ?  32  TRP A CG   1  
ATOM 467    C CD1  . TRP A 1 32  ? 23.223  11.101  172.577 1.00 0.00 ?  32  TRP A CD1  1  
ATOM 468    C CD2  . TRP A 1 32  ? 25.344  10.462  172.940 1.00 0.00 ?  32  TRP A CD2  1  
ATOM 469    N NE1  . TRP A 1 32  ? 23.539  10.143  171.653 1.00 0.00 ?  32  TRP A NE1  1  
ATOM 470    C CE2  . TRP A 1 32  ? 24.835  9.743   171.860 1.00 0.00 ?  32  TRP A CE2  1  
ATOM 471    C CE3  . TRP A 1 32  ? 26.627  10.257  173.362 1.00 0.00 ?  32  TRP A CE3  1  
ATOM 472    C CZ2  . TRP A 1 32  ? 25.591  8.821   171.198 1.00 0.00 ?  32  TRP A CZ2  1  
ATOM 473    C CZ3  . TRP A 1 32  ? 27.396  9.327   172.693 1.00 0.00 ?  32  TRP A CZ3  1  
ATOM 474    C CH2  . TRP A 1 32  ? 26.885  8.617   171.625 1.00 0.00 ?  32  TRP A CH2  1  
ATOM 475    H H    . TRP A 1 32  ? 24.343  13.547  176.793 1.00 0.00 ?  32  TRP A H    1  
ATOM 476    H HA   . TRP A 1 32  ? 22.901  11.342  175.809 1.00 0.00 ?  32  TRP A HA   1  
ATOM 477    H HB2  . TRP A 1 32  ? 23.772  13.204  174.309 1.00 0.00 ?  32  TRP A HB2  1  
ATOM 478    H HB3  . TRP A 1 32  ? 25.443  12.633  174.650 1.00 0.00 ?  32  TRP A HB3  1  
ATOM 479    H HD1  . TRP A 1 32  ? 22.266  11.595  172.651 1.00 0.00 ?  32  TRP A HD1  1  
ATOM 480    H HE1  . TRP A 1 32  ? 22.943  9.803   170.961 1.00 0.00 ?  32  TRP A HE1  1  
ATOM 481    H HE3  . TRP A 1 32  ? 27.047  10.802  174.195 1.00 0.00 ?  32  TRP A HE3  1  
ATOM 482    H HZ2  . TRP A 1 32  ? 25.204  8.260   170.361 1.00 0.00 ?  32  TRP A HZ2  1  
ATOM 483    H HZ3  . TRP A 1 32  ? 28.414  9.151   173.011 1.00 0.00 ?  32  TRP A HZ3  1  
ATOM 484    H HH2  . TRP A 1 32  ? 27.506  7.894   171.117 1.00 0.00 ?  32  TRP A HH2  1  
ATOM 485    N N    . SER A 1 33  ? 24.304  9.374   176.264 1.00 0.00 ?  33  SER A N    1  
ATOM 486    C CA   . SER A 1 33  ? 25.108  8.261   176.649 1.00 0.00 ?  33  SER A CA   1  
ATOM 487    C C    . SER A 1 33  ? 24.515  7.056   176.020 1.00 0.00 ?  33  SER A C    1  
ATOM 488    O O    . SER A 1 33  ? 23.374  7.083   175.566 1.00 0.00 ?  33  SER A O    1  
ATOM 489    C CB   . SER A 1 33  ? 25.121  8.022   178.169 1.00 0.00 ?  33  SER A CB   1  
ATOM 490    O OG   . SER A 1 33  ? 23.830  7.609   178.616 1.00 0.00 ?  33  SER A OG   1  
ATOM 491    H H    . SER A 1 33  ? 23.361  9.184   176.001 1.00 0.00 ?  33  SER A H    1  
ATOM 492    H HA   . SER A 1 33  ? 26.107  8.417   176.275 1.00 0.00 ?  33  SER A HA   1  
ATOM 493    H HB2  . SER A 1 33  ? 25.859  7.232   178.424 1.00 0.00 ?  33  SER A HB2  1  
ATOM 494    H HB3  . SER A 1 33  ? 25.398  8.959   178.697 1.00 0.00 ?  33  SER A HB3  1  
ATOM 495    H HG   . SER A 1 33  ? 23.189  8.072   178.068 1.00 0.00 ?  33  SER A HG   1  
ATOM 496    N N    . GLY A 1 34  ? 25.312  5.972   175.952 1.00 0.00 ?  34  GLY A N    1  
ATOM 497    C CA   . GLY A 1 34  ? 24.831  4.744   175.398 1.00 0.00 ?  34  GLY A CA   1  
ATOM 498    C C    . GLY A 1 34  ? 24.478  3.868   176.553 1.00 0.00 ?  34  GLY A C    1  
ATOM 499    O O    . GLY A 1 34  ? 24.019  2.741   176.371 1.00 0.00 ?  34  GLY A O    1  
ATOM 500    H H    . GLY A 1 34  ? 26.255  5.976   176.279 1.00 0.00 ?  34  GLY A H    1  
ATOM 501    H HA2  . GLY A 1 34  ? 23.947  4.949   174.816 1.00 0.00 ?  34  GLY A HA2  1  
ATOM 502    H HA3  . GLY A 1 34  ? 25.642  4.291   174.846 1.00 0.00 ?  34  GLY A HA3  1  
ATOM 503    N N    . THR A 1 35  ? 24.684  4.384   177.786 1.00 0.00 ?  35  THR A N    1  
ATOM 504    C CA   . THR A 1 35  ? 24.394  3.607   178.959 1.00 0.00 ?  35  THR A CA   1  
ATOM 505    C C    . THR A 1 35  ? 23.003  3.922   179.388 1.00 0.00 ?  35  THR A C    1  
ATOM 506    O O    . THR A 1 35  ? 22.470  4.983   179.076 1.00 0.00 ?  35  THR A O    1  
ATOM 507    C CB   . THR A 1 35  ? 25.300  3.931   180.110 1.00 0.00 ?  35  THR A CB   1  
ATOM 508    O OG1  . THR A 1 35  ? 25.093  5.275   180.524 1.00 0.00 ?  35  THR A OG1  1  
ATOM 509    C CG2  . THR A 1 35  ? 26.753  3.735   179.657 1.00 0.00 ?  35  THR A CG2  1  
ATOM 510    H H    . THR A 1 35  ? 25.036  5.305   177.933 1.00 0.00 ?  35  THR A H    1  
ATOM 511    H HA   . THR A 1 35  ? 24.467  2.562   178.700 1.00 0.00 ?  35  THR A HA   1  
ATOM 512    H HB   . THR A 1 35  ? 25.097  3.252   180.963 1.00 0.00 ?  35  THR A HB   1  
ATOM 513    H HG1  . THR A 1 35  ? 24.201  5.308   180.879 1.00 0.00 ?  35  THR A HG1  1  
ATOM 514    H HG21 . THR A 1 35  ? 27.216  4.716   179.414 1.00 0.00 ?  35  THR A HG21 1  
ATOM 515    H HG22 . THR A 1 35  ? 26.794  3.090   178.754 1.00 0.00 ?  35  THR A HG22 1  
ATOM 516    H HG23 . THR A 1 35  ? 27.348  3.255   180.464 1.00 0.00 ?  35  THR A HG23 1  
ATOM 517    N N    . ARG A 1 36  ? 22.388  2.988   180.146 1.00 0.00 ?  36  ARG A N    1  
ATOM 518    C CA   . ARG A 1 36  ? 21.055  3.203   180.627 1.00 0.00 ?  36  ARG A CA   1  
ATOM 519    C C    . ARG A 1 36  ? 21.220  3.803   181.978 1.00 0.00 ?  36  ARG A C    1  
ATOM 520    O O    . ARG A 1 36  ? 20.476  4.692   182.391 1.00 0.00 ?  36  ARG A O    1  
ATOM 521    C CB   . ARG A 1 36  ? 20.264  1.899   180.800 1.00 0.00 ?  36  ARG A CB   1  
ATOM 522    C CG   . ARG A 1 36  ? 20.181  1.099   179.509 1.00 0.00 ?  36  ARG A CG   1  
ATOM 523    C CD   . ARG A 1 36  ? 19.488  -0.253  179.701 1.00 0.00 ?  36  ARG A CD   1  
ATOM 524    N NE   . ARG A 1 36  ? 20.251  -1.040  180.718 1.00 0.00 ?  36  ARG A NE   1  
ATOM 525    C CZ   . ARG A 1 36  ? 21.404  -1.687  180.369 1.00 0.00 ?  36  ARG A CZ   1  
ATOM 526    N NH1  . ARG A 1 36  ? 21.945  -1.509  179.131 1.00 0.00 1  36  ARG A NH1  1  
ATOM 527    N NH2  . ARG A 1 36  ? 22.034  -2.491  181.270 1.00 0.00 ?  36  ARG A NH2  1  
ATOM 528    H H    . ARG A 1 36  ? 22.823  2.127   180.399 1.00 0.00 ?  36  ARG A H    1  
ATOM 529    H HA   . ARG A 1 36  ? 20.546  3.890   179.970 1.00 0.00 ?  36  ARG A HA   1  
ATOM 530    H HB2  . ARG A 1 36  ? 20.749  1.281   181.586 1.00 0.00 ?  36  ARG A HB2  1  
ATOM 531    H HB3  . ARG A 1 36  ? 19.237  2.139   181.134 1.00 0.00 ?  36  ARG A HB3  1  
ATOM 532    H HG2  . ARG A 1 36  ? 19.624  1.689   178.751 1.00 0.00 ?  36  ARG A HG2  1  
ATOM 533    H HG3  . ARG A 1 36  ? 21.210  0.928   179.122 1.00 0.00 ?  36  ARG A HG3  1  
ATOM 534    H HD2  . ARG A 1 36  ? 18.449  -0.117  180.071 1.00 0.00 ?  36  ARG A HD2  1  
ATOM 535    H HD3  . ARG A 1 36  ? 19.479  -0.832  178.754 1.00 0.00 ?  36  ARG A HD3  1  
ATOM 536    H HE   . ARG A 1 36  ? 19.890  -1.130  181.651 1.00 0.00 ?  36  ARG A HE   1  
ATOM 537    H HH11 . ARG A 1 36  ? 21.499  -0.904  178.472 1.00 0.00 ?  36  ARG A HH11 1  
ATOM 538    H HH12 . ARG A 1 36  ? 22.794  -1.977  178.885 1.00 0.00 ?  36  ARG A HH12 1  
ATOM 539    H HH21 . ARG A 1 36  ? 21.653  -2.609  182.188 1.00 0.00 ?  36  ARG A HH21 1  
ATOM 540    H HH22 . ARG A 1 36  ? 22.878  -2.964  181.015 1.00 0.00 ?  36  ARG A HH22 1  
ATOM 541    N N    . GLU A 1 37  ? 22.236  3.299   182.696 1.00 0.00 ?  37  GLU A N    1  
ATOM 542    C CA   . GLU A 1 37  ? 22.538  3.778   184.004 1.00 0.00 ?  37  GLU A CA   1  
ATOM 543    C C    . GLU A 1 37  ? 23.998  3.519   184.147 1.00 0.00 ?  37  GLU A C    1  
ATOM 544    O O    . GLU A 1 37  ? 24.551  2.654   183.464 1.00 0.00 ?  37  GLU A O    1  
ATOM 545    C CB   . GLU A 1 37  ? 21.763  3.071   185.145 1.00 0.00 ?  37  GLU A CB   1  
ATOM 546    C CG   . GLU A 1 37  ? 21.863  3.795   186.503 1.00 0.00 ?  37  GLU A CG   1  
ATOM 547    C CD   . GLU A 1 37  ? 21.178  5.161   186.405 1.00 0.00 ?  37  GLU A CD   1  
ATOM 548    O OE1  . GLU A 1 37  ? 21.534  6.062   187.216 1.00 0.00 ?  37  GLU A OE1  1  
ATOM 549    O OE2  . GLU A 1 37  ? 20.278  5.319   185.539 1.00 0.00 -1 37  GLU A OE2  1  
ATOM 550    H H    . GLU A 1 37  ? 22.822  2.570   182.348 1.00 0.00 ?  37  GLU A H    1  
ATOM 551    H HA   . GLU A 1 37  ? 22.360  4.844   184.016 1.00 0.00 ?  37  GLU A HA   1  
ATOM 552    H HB2  . GLU A 1 37  ? 20.693  2.993   184.857 1.00 0.00 ?  37  GLU A HB2  1  
ATOM 553    H HB3  . GLU A 1 37  ? 22.159  2.043   185.266 1.00 0.00 ?  37  GLU A HB3  1  
ATOM 554    H HG2  . GLU A 1 37  ? 21.363  3.189   187.290 1.00 0.00 ?  37  GLU A HG2  1  
ATOM 555    H HG3  . GLU A 1 37  ? 22.925  3.940   186.786 1.00 0.00 ?  37  GLU A HG3  1  
ATOM 556    N N    . VAL A 1 38  ? 24.660  4.280   185.025 1.00 0.00 ?  38  VAL A N    1  
ATOM 557    C CA   . VAL A 1 38  ? 26.075  4.148   185.200 1.00 0.00 ?  38  VAL A CA   1  
ATOM 558    C C    . VAL A 1 38  ? 26.401  2.776   185.723 1.00 0.00 ?  38  VAL A C    1  
ATOM 559    O O    . VAL A 1 38  ? 27.498  2.268   185.493 1.00 0.00 ?  38  VAL A O    1  
ATOM 560    C CB   . VAL A 1 38  ? 26.610  5.177   186.148 1.00 0.00 ?  38  VAL A CB   1  
ATOM 561    C CG1  . VAL A 1 38  ? 26.235  6.551   185.578 1.00 0.00 ?  38  VAL A CG1  1  
ATOM 562    C CG2  . VAL A 1 38  ? 26.013  4.951   187.549 1.00 0.00 ?  38  VAL A CG2  1  
ATOM 563    H H    . VAL A 1 38  ? 24.205  4.964   185.591 1.00 0.00 ?  38  VAL A H    1  
ATOM 564    H HA   . VAL A 1 38  ? 26.530  4.268   184.229 1.00 0.00 ?  38  VAL A HA   1  
ATOM 565    H HB   . VAL A 1 38  ? 27.717  5.101   186.209 1.00 0.00 ?  38  VAL A HB   1  
ATOM 566    H HG11 . VAL A 1 38  ? 26.685  7.347   186.189 1.00 0.00 ?  38  VAL A HG11 1  
ATOM 567    H HG12 . VAL A 1 38  ? 25.131  6.684   185.587 1.00 0.00 ?  38  VAL A HG12 1  
ATOM 568    H HG13 . VAL A 1 38  ? 26.595  6.650   184.534 1.00 0.00 ?  38  VAL A HG13 1  
ATOM 569    H HG21 . VAL A 1 38  ? 26.494  4.078   188.036 1.00 0.00 ?  38  VAL A HG21 1  
ATOM 570    H HG22 . VAL A 1 38  ? 24.922  4.763   187.481 1.00 0.00 ?  38  VAL A HG22 1  
ATOM 571    H HG23 . VAL A 1 38  ? 26.178  5.846   188.187 1.00 0.00 ?  38  VAL A HG23 1  
ATOM 572    N N    . ILE A 1 39  ? 25.457  2.142   186.439 1.00 0.00 ?  39  ILE A N    1  
ATOM 573    C CA   . ILE A 1 39  ? 25.704  0.834   186.967 1.00 0.00 ?  39  ILE A CA   1  
ATOM 574    C C    . ILE A 1 39  ? 25.372  -0.165  185.892 1.00 0.00 ?  39  ILE A C    1  
ATOM 575    O O    . ILE A 1 39  ? 25.964  -1.243  185.819 1.00 0.00 ?  39  ILE A O    1  
ATOM 576    C CB   . ILE A 1 39  ? 24.865  0.518   188.170 1.00 0.00 ?  39  ILE A CB   1  
ATOM 577    C CG1  . ILE A 1 39  ? 24.980  1.636   189.232 1.00 0.00 ?  39  ILE A CG1  1  
ATOM 578    C CG2  . ILE A 1 39  ? 25.325  -0.844  188.718 1.00 0.00 ?  39  ILE A CG2  1  
ATOM 579    C CD1  . ILE A 1 39  ? 26.407  1.842   189.760 1.00 0.00 ?  39  ILE A CD1  1  
ATOM 580    H H    . ILE A 1 39  ? 24.565  2.543   186.632 1.00 0.00 ?  39  ILE A H    1  
ATOM 581    H HA   . ILE A 1 39  ? 26.754  0.765   187.208 1.00 0.00 ?  39  ILE A HA   1  
ATOM 582    H HB   . ILE A 1 39  ? 23.799  0.432   187.864 1.00 0.00 ?  39  ILE A HB   1  
ATOM 583    H HG12 . ILE A 1 39  ? 24.620  2.589   188.789 1.00 0.00 ?  39  ILE A HG12 1  
ATOM 584    H HG13 . ILE A 1 39  ? 24.318  1.386   190.085 1.00 0.00 ?  39  ILE A HG13 1  
ATOM 585    H HG21 . ILE A 1 39  ? 25.026  -1.660  188.029 1.00 0.00 ?  39  ILE A HG21 1  
ATOM 586    H HG22 . ILE A 1 39  ? 24.865  -1.033  189.711 1.00 0.00 ?  39  ILE A HG22 1  
ATOM 587    H HG23 . ILE A 1 39  ? 26.430  -0.861  188.830 1.00 0.00 ?  39  ILE A HG23 1  
ATOM 588    H HD11 . ILE A 1 39  ? 27.054  2.300   188.982 1.00 0.00 ?  39  ILE A HD11 1  
ATOM 589    H HD12 . ILE A 1 39  ? 26.853  0.875   190.067 1.00 0.00 ?  39  ILE A HD12 1  
ATOM 590    H HD13 . ILE A 1 39  ? 26.392  2.516   190.643 1.00 0.00 ?  39  ILE A HD13 1  
ATOM 591    N N    . ALA A 1 40  ? 24.407  0.195   185.017 1.00 0.00 ?  40  ALA A N    1  
ATOM 592    C CA   . ALA A 1 40  ? 23.950  -0.694  183.969 1.00 0.00 ?  40  ALA A CA   1  
ATOM 593    C C    . ALA A 1 40  ? 25.031  -0.945  182.954 1.00 0.00 ?  40  ALA A C    1  
ATOM 594    O O    . ALA A 1 40  ? 24.895  -1.846  182.125 1.00 0.00 ?  40  ALA A O    1  
ATOM 595    C CB   . ALA A 1 40  ? 22.734  -0.150  183.203 1.00 0.00 ?  40  ALA A CB   1  
ATOM 596    H H    . ALA A 1 40  ? 23.968  1.089   185.055 1.00 0.00 ?  40  ALA A H    1  
ATOM 597    H HA   . ALA A 1 40  ? 23.693  -1.630  184.437 1.00 0.00 ?  40  ALA A HA   1  
ATOM 598    H HB1  . ALA A 1 40  ? 22.410  0.819   183.630 1.00 0.00 ?  40  ALA A HB1  1  
ATOM 599    H HB2  . ALA A 1 40  ? 21.887  -0.867  183.267 1.00 0.00 ?  40  ALA A HB2  1  
ATOM 600    H HB3  . ALA A 1 40  ? 22.990  0.003   182.133 1.00 0.00 ?  40  ALA A HB3  1  
ATOM 601    N N    . TYR A 1 41  ? 26.109  -0.139  182.977 1.00 0.00 ?  41  TYR A N    1  
ATOM 602    C CA   . TYR A 1 41  ? 27.187  -0.284  182.024 1.00 0.00 ?  41  TYR A CA   1  
ATOM 603    C C    . TYR A 1 41  ? 27.781  -1.667  182.092 1.00 0.00 ?  41  TYR A C    1  
ATOM 604    O O    . TYR A 1 41  ? 28.295  -2.158  181.094 1.00 0.00 ?  41  TYR A O    1  
ATOM 605    C CB   . TYR A 1 41  ? 28.332  0.715   182.245 1.00 0.00 ?  41  TYR A CB   1  
ATOM 606    C CG   . TYR A 1 41  ? 29.422  0.589   181.236 1.00 0.00 ?  41  TYR A CG   1  
ATOM 607    C CD1  . TYR A 1 41  ? 30.627  0.015   181.576 1.00 0.00 ?  41  TYR A CD1  1  
ATOM 608    C CD2  . TYR A 1 41  ? 29.234  1.037   179.948 1.00 0.00 ?  41  TYR A CD2  1  
ATOM 609    C CE1  . TYR A 1 41  ? 31.630  -0.104  180.642 1.00 0.00 ?  41  TYR A CE1  1  
ATOM 610    C CE2  . TYR A 1 41  ? 30.238  0.918   179.015 1.00 0.00 ?  41  TYR A CE2  1  
ATOM 611    C CZ   . TYR A 1 41  ? 31.434  0.348   179.362 1.00 0.00 ?  41  TYR A CZ   1  
ATOM 612    O OH   . TYR A 1 41  ? 32.464  0.228   178.406 1.00 0.00 ?  41  TYR A OH   1  
ATOM 613    H H    . TYR A 1 41  ? 26.211  0.591   183.649 1.00 0.00 ?  41  TYR A H    1  
ATOM 614    H HA   . TYR A 1 41  ? 26.763  -0.139  181.043 1.00 0.00 ?  41  TYR A HA   1  
ATOM 615    H HB2  . TYR A 1 41  ? 27.946  1.754   182.186 1.00 0.00 ?  41  TYR A HB2  1  
ATOM 616    H HB3  . TYR A 1 41  ? 28.784  0.556   183.248 1.00 0.00 ?  41  TYR A HB3  1  
ATOM 617    H HD1  . TYR A 1 41  ? 30.786  -0.342  182.583 1.00 0.00 ?  41  TYR A HD1  1  
ATOM 618    H HD2  . TYR A 1 41  ? 28.294  1.486   179.668 1.00 0.00 ?  41  TYR A HD2  1  
ATOM 619    H HE1  . TYR A 1 41  ? 32.571  -0.556  180.917 1.00 0.00 ?  41  TYR A HE1  1  
ATOM 620    H HE2  . TYR A 1 41  ? 30.082  1.275   178.007 1.00 0.00 ?  41  TYR A HE2  1  
ATOM 621    H HH   . TYR A 1 41  ? 33.019  1.010   178.469 1.00 0.00 ?  41  TYR A HH   1  
ATOM 622    N N    . GLY A 1 42  ? 27.713  -2.320  183.270 1.00 0.00 ?  42  GLY A N    1  
ATOM 623    C CA   . GLY A 1 42  ? 28.321  -3.619  183.455 1.00 0.00 ?  42  GLY A CA   1  
ATOM 624    C C    . GLY A 1 42  ? 27.771  -4.658  182.498 1.00 0.00 ?  42  GLY A C    1  
ATOM 625    O O    . GLY A 1 42  ? 28.527  -5.506  182.026 1.00 0.00 ?  42  GLY A O    1  
ATOM 626    H H    . GLY A 1 42  ? 27.245  -1.938  184.063 1.00 0.00 ?  42  GLY A H    1  
ATOM 627    H HA2  . GLY A 1 42  ? 29.375  -3.506  183.262 1.00 0.00 ?  42  GLY A HA2  1  
ATOM 628    H HA3  . GLY A 1 42  ? 28.093  -3.928  184.467 1.00 0.00 ?  42  GLY A HA3  1  
ATOM 629    N N    . MET A 1 43  ? 26.457  -4.665  182.186 1.00 0.00 ?  43  MET A N    1  
ATOM 630    C CA   . MET A 1 43  ? 25.967  -5.707  181.307 1.00 0.00 ?  43  MET A CA   1  
ATOM 631    C C    . MET A 1 43  ? 26.481  -5.454  179.890 1.00 0.00 ?  43  MET A C    1  
ATOM 632    O O    . MET A 1 43  ? 26.203  -4.403  179.313 1.00 0.00 ?  43  MET A O    1  
ATOM 633    C CB   . MET A 1 43  ? 24.432  -5.788  181.239 1.00 0.00 ?  43  MET A CB   1  
ATOM 634    C CG   . MET A 1 43  ? 23.955  -6.907  180.307 1.00 0.00 ?  43  MET A CG   1  
ATOM 635    S SD   . MET A 1 43  ? 22.165  -7.184  180.385 1.00 0.00 ?  43  MET A SD   1  
ATOM 636    C CE   . MET A 1 43  ? 22.240  -8.151  181.918 1.00 0.00 ?  43  MET A CE   1  
ATOM 637    H H    . MET A 1 43  ? 25.803  -3.993  182.523 1.00 0.00 ?  43  MET A H    1  
ATOM 638    H HA   . MET A 1 43  ? 26.351  -6.624  181.704 1.00 0.00 ?  43  MET A HA   1  
ATOM 639    H HB2  . MET A 1 43  ? 24.031  -5.963  182.260 1.00 0.00 ?  43  MET A HB2  1  
ATOM 640    H HB3  . MET A 1 43  ? 24.031  -4.820  180.872 1.00 0.00 ?  43  MET A HB3  1  
ATOM 641    H HG2  . MET A 1 43  ? 24.243  -6.651  179.264 1.00 0.00 ?  43  MET A HG2  1  
ATOM 642    H HG3  . MET A 1 43  ? 24.488  -7.842  180.579 1.00 0.00 ?  43  MET A HG3  1  
ATOM 643    H HE1  . MET A 1 43  ? 22.791  -9.101  181.761 1.00 0.00 ?  43  MET A HE1  1  
ATOM 644    H HE2  . MET A 1 43  ? 21.222  -8.402  182.279 1.00 0.00 ?  43  MET A HE2  1  
ATOM 645    H HE3  . MET A 1 43  ? 22.760  -7.582  182.719 1.00 0.00 ?  43  MET A HE3  1  
ATOM 646    N N    . PRO A 1 44  ? 27.233  -6.399  179.305 1.00 0.00 ?  44  PRO A N    1  
ATOM 647    C CA   . PRO A 1 44  ? 27.770  -6.246  177.954 1.00 0.00 ?  44  PRO A CA   1  
ATOM 648    C C    . PRO A 1 44  ? 26.863  -6.699  176.834 1.00 0.00 ?  44  PRO A C    1  
ATOM 649    O O    . PRO A 1 44  ? 26.991  -6.241  175.700 1.00 0.00 ?  44  PRO A O    1  
ATOM 650    C CB   . PRO A 1 44  ? 29.003  -7.132  177.986 1.00 0.00 ?  44  PRO A CB   1  
ATOM 651    C CG   . PRO A 1 44  ? 28.550  -8.317  178.834 1.00 0.00 ?  44  PRO A CG   1  
ATOM 652    C CD   . PRO A 1 44  ? 27.605  -7.709  179.872 1.00 0.00 ?  44  PRO A CD   1  
ATOM 653    H HA   . PRO A 1 44  ? 28.076  -5.229  177.770 1.00 0.00 ?  44  PRO A HA   1  
ATOM 654    H HB2  . PRO A 1 44  ? 29.284  -7.459  176.961 1.00 0.00 ?  44  PRO A HB2  1  
ATOM 655    H HB3  . PRO A 1 44  ? 29.856  -6.610  178.467 1.00 0.00 ?  44  PRO A HB3  1  
ATOM 656    H HG2  . PRO A 1 44  ? 28.017  -9.062  178.204 1.00 0.00 ?  44  PRO A HG2  1  
ATOM 657    H HG3  . PRO A 1 44  ? 29.411  -8.804  179.330 1.00 0.00 ?  44  PRO A HG3  1  
ATOM 658    H HD2  . PRO A 1 44  ? 26.710  -8.355  180.007 1.00 0.00 ?  44  PRO A HD2  1  
ATOM 659    H HD3  . PRO A 1 44  ? 28.124  -7.592  180.847 1.00 0.00 ?  44  PRO A HD3  1  
ATOM 660    N N    . ALA A 1 45  ? 25.923  -7.619  177.139 1.00 0.00 ?  45  ALA A N    1  
ATOM 661    C CA   . ALA A 1 45  ? 25.034  -8.170  176.132 1.00 0.00 ?  45  ALA A CA   1  
ATOM 662    C C    . ALA A 1 45  ? 24.003  -7.154  175.768 1.00 0.00 ?  45  ALA A C    1  
ATOM 663    O O    . ALA A 1 45  ? 23.280  -7.298  174.783 1.00 0.00 ?  45  ALA A O    1  
ATOM 664    C CB   . ALA A 1 45  ? 24.294  -9.430  176.606 1.00 0.00 ?  45  ALA A CB   1  
ATOM 665    H H    . ALA A 1 45  ? 25.797  -7.961  178.067 1.00 0.00 ?  45  ALA A H    1  
ATOM 666    H HA   . ALA A 1 45  ? 25.629  -8.395  175.262 1.00 0.00 ?  45  ALA A HA   1  
ATOM 667    H HB1  . ALA A 1 45  ? 25.013  -10.262 176.766 1.00 0.00 ?  45  ALA A HB1  1  
ATOM 668    H HB2  . ALA A 1 45  ? 23.548  -9.748  175.847 1.00 0.00 ?  45  ALA A HB2  1  
ATOM 669    H HB3  . ALA A 1 45  ? 23.765  -9.230  177.562 1.00 0.00 ?  45  ALA A HB3  1  
ATOM 670    N N    . SER A 1 46  ? 23.913  -6.111  176.581 1.00 0.00 ?  46  SER A N    1  
ATOM 671    C CA   . SER A 1 46  ? 22.927  -5.096  176.409 1.00 0.00 ?  46  SER A CA   1  
ATOM 672    C C    . SER A 1 46  ? 23.145  -4.289  175.163 1.00 0.00 ?  46  SER A C    1  
ATOM 673    O O    . SER A 1 46  ? 22.273  -3.505  174.844 1.00 0.00 ?  46  SER A O    1  
ATOM 674    C CB   . SER A 1 46  ? 22.882  -4.115  177.581 1.00 0.00 ?  46  SER A CB   1  
ATOM 675    O OG   . SER A 1 46  ? 24.090  -3.374  177.648 1.00 0.00 ?  46  SER A OG   1  
ATOM 676    H H    . SER A 1 46  ? 24.532  -5.990  177.352 1.00 0.00 ?  46  SER A H    1  
ATOM 677    H HA   . SER A 1 46  ? 21.976  -5.595  176.329 1.00 0.00 ?  46  SER A HA   1  
ATOM 678    H HB2  . SER A 1 46  ? 22.034  -3.408  177.451 1.00 0.00 ?  46  SER A HB2  1  
ATOM 679    H HB3  . SER A 1 46  ? 22.747  -4.667  178.535 1.00 0.00 ?  46  SER A HB3  1  
ATOM 680    H HG   . SER A 1 46  ? 23.962  -2.607  177.082 1.00 0.00 ?  46  SER A HG   1  
ATOM 681    N N    . VAL A 1 47  ? 24.316  -4.403  174.482 1.00 0.00 ?  47  VAL A N    1  
ATOM 682    C CA   . VAL A 1 47  ? 24.607  -3.574  173.315 1.00 0.00 ?  47  VAL A CA   1  
ATOM 683    C C    . VAL A 1 47  ? 23.427  -3.473  172.346 1.00 0.00 ?  47  VAL A C    1  
ATOM 684    O O    . VAL A 1 47  ? 23.173  -2.393  171.810 1.00 0.00 ?  47  VAL A O    1  
ATOM 685    C CB   . VAL A 1 47  ? 25.812  -4.046  172.538 1.00 0.00 ?  47  VAL A CB   1  
ATOM 686    C CG1  . VAL A 1 47  ? 27.051  -3.863  173.431 1.00 0.00 ?  47  VAL A CG1  1  
ATOM 687    C CG2  . VAL A 1 47  ? 25.615  -5.515  172.109 1.00 0.00 ?  47  VAL A CG2  1  
ATOM 688    H H    . VAL A 1 47  ? 25.024  -5.053  174.747 1.00 0.00 ?  47  VAL A H    1  
ATOM 689    H HA   . VAL A 1 47  ? 24.802  -2.584  173.694 1.00 0.00 ?  47  VAL A HA   1  
ATOM 690    H HB   . VAL A 1 47  ? 25.936  -3.424  171.627 1.00 0.00 ?  47  VAL A HB   1  
ATOM 691    H HG11 . VAL A 1 47  ? 27.663  -4.791  173.433 1.00 0.00 ?  47  VAL A HG11 1  
ATOM 692    H HG12 . VAL A 1 47  ? 26.745  -3.638  174.475 1.00 0.00 ?  47  VAL A HG12 1  
ATOM 693    H HG13 . VAL A 1 47  ? 27.677  -3.026  173.056 1.00 0.00 ?  47  VAL A HG13 1  
ATOM 694    H HG21 . VAL A 1 47  ? 25.298  -6.136  172.972 1.00 0.00 ?  47  VAL A HG21 1  
ATOM 695    H HG22 . VAL A 1 47  ? 26.565  -5.927  171.709 1.00 0.00 ?  47  VAL A HG22 1  
ATOM 696    H HG23 . VAL A 1 47  ? 24.840  -5.585  171.317 1.00 0.00 ?  47  VAL A HG23 1  
ATOM 697    N N    . TRP A 1 48  ? 22.676  -4.565  172.095 1.00 0.00 ?  48  TRP A N    1  
ATOM 698    C CA   . TRP A 1 48  ? 21.550  -4.478  171.183 1.00 0.00 ?  48  TRP A CA   1  
ATOM 699    C C    . TRP A 1 48  ? 20.485  -3.577  171.760 1.00 0.00 ?  48  TRP A C    1  
ATOM 700    O O    . TRP A 1 48  ? 19.953  -2.690  171.089 1.00 0.00 ?  48  TRP A O    1  
ATOM 701    C CB   . TRP A 1 48  ? 20.893  -5.840  170.905 1.00 0.00 ?  48  TRP A CB   1  
ATOM 702    C CG   . TRP A 1 48  ? 19.722  -5.749  169.957 1.00 0.00 ?  48  TRP A CG   1  
ATOM 703    C CD1  . TRP A 1 48  ? 18.390  -5.845  170.245 1.00 0.00 ?  48  TRP A CD1  1  
ATOM 704    C CD2  . TRP A 1 48  ? 19.806  -5.534  168.532 1.00 0.00 ?  48  TRP A CD2  1  
ATOM 705    N NE1  . TRP A 1 48  ? 17.648  -5.707  169.104 1.00 0.00 ?  48  TRP A NE1  1  
ATOM 706    C CE2  . TRP A 1 48  ? 18.500  -5.515  168.045 1.00 0.00 ?  48  TRP A CE2  1  
ATOM 707    C CE3  . TRP A 1 48  ? 20.861  -5.364  167.682 1.00 0.00 ?  48  TRP A CE3  1  
ATOM 708    C CZ2  . TRP A 1 48  ? 18.236  -5.330  166.721 1.00 0.00 ?  48  TRP A CZ2  1  
ATOM 709    C CZ3  . TRP A 1 48  ? 20.599  -5.176  166.341 1.00 0.00 ?  48  TRP A CZ3  1  
ATOM 710    C CH2  . TRP A 1 48  ? 19.301  -5.158  165.866 1.00 0.00 ?  48  TRP A CH2  1  
ATOM 711    H H    . TRP A 1 48  ? 22.853  -5.454  172.511 1.00 0.00 ?  48  TRP A H    1  
ATOM 712    H HA   . TRP A 1 48  ? 21.911  -4.048  170.263 1.00 0.00 ?  48  TRP A HA   1  
ATOM 713    H HB2  . TRP A 1 48  ? 21.650  -6.528  170.469 1.00 0.00 ?  48  TRP A HB2  1  
ATOM 714    H HB3  . TRP A 1 48  ? 20.539  -6.276  171.863 1.00 0.00 ?  48  TRP A HB3  1  
ATOM 715    H HD1  . TRP A 1 48  ? 17.982  -6.008  171.231 1.00 0.00 ?  48  TRP A HD1  1  
ATOM 716    H HE1  . TRP A 1 48  ? 16.674  -5.740  169.051 1.00 0.00 ?  48  TRP A HE1  1  
ATOM 717    H HE3  . TRP A 1 48  ? 21.882  -5.374  168.034 1.00 0.00 ?  48  TRP A HE3  1  
ATOM 718    H HZ2  . TRP A 1 48  ? 17.226  -5.315  166.336 1.00 0.00 ?  48  TRP A HZ2  1  
ATOM 719    H HZ3  . TRP A 1 48  ? 21.420  -5.040  165.653 1.00 0.00 ?  48  TRP A HZ3  1  
ATOM 720    H HH2  . TRP A 1 48  ? 19.121  -5.009  164.812 1.00 0.00 ?  48  TRP A HH2  1  
ATOM 721    N N    . ARG A 1 49  ? 20.171  -3.795  173.045 1.00 0.00 ?  49  ARG A N    1  
ATOM 722    C CA   . ARG A 1 49  ? 19.127  -3.060  173.715 1.00 0.00 ?  49  ARG A CA   1  
ATOM 723    C C    . ARG A 1 49  ? 19.542  -1.637  173.950 1.00 0.00 ?  49  ARG A C    1  
ATOM 724    O O    . ARG A 1 49  ? 18.698  -0.795  174.265 1.00 0.00 ?  49  ARG A O    1  
ATOM 725    C CB   . ARG A 1 49  ? 18.777  -3.709  175.058 1.00 0.00 ?  49  ARG A CB   1  
ATOM 726    C CG   . ARG A 1 49  ? 18.063  -5.047  174.855 1.00 0.00 ?  49  ARG A CG   1  
ATOM 727    C CD   . ARG A 1 49  ? 18.032  -5.905  176.118 1.00 0.00 ?  49  ARG A CD   1  
ATOM 728    N NE   . ARG A 1 49  ? 19.421  -6.382  176.360 1.00 0.00 ?  49  ARG A NE   1  
ATOM 729    C CZ   . ARG A 1 49  ? 19.702  -7.181  177.425 1.00 0.00 ?  49  ARG A CZ   1  
ATOM 730    N NH1  . ARG A 1 49  ? 18.720  -7.513  178.312 1.00 0.00 1  49  ARG A NH1  1  
ATOM 731    N NH2  . ARG A 1 49  ? 20.974  -7.644  177.605 1.00 0.00 ?  49  ARG A NH2  1  
ATOM 732    H H    . ARG A 1 49  ? 20.647  -4.476  173.595 1.00 0.00 ?  49  ARG A H    1  
ATOM 733    H HA   . ARG A 1 49  ? 18.264  -3.069  173.070 1.00 0.00 ?  49  ARG A HA   1  
ATOM 734    H HB2  . ARG A 1 49  ? 19.709  -3.870  175.643 1.00 0.00 ?  49  ARG A HB2  1  
ATOM 735    H HB3  . ARG A 1 49  ? 18.115  -3.030  175.635 1.00 0.00 ?  49  ARG A HB3  1  
ATOM 736    H HG2  . ARG A 1 49  ? 17.021  -4.854  174.525 1.00 0.00 ?  49  ARG A HG2  1  
ATOM 737    H HG3  . ARG A 1 49  ? 18.578  -5.611  174.047 1.00 0.00 ?  49  ARG A HG3  1  
ATOM 738    H HD2  . ARG A 1 49  ? 17.700  -5.311  176.998 1.00 0.00 ?  49  ARG A HD2  1  
ATOM 739    H HD3  . ARG A 1 49  ? 17.378  -6.792  175.985 1.00 0.00 ?  49  ARG A HD3  1  
ATOM 740    H HE   . ARG A 1 49  ? 20.152  -6.127  175.725 1.00 0.00 ?  49  ARG A HE   1  
ATOM 741    H HH11 . ARG A 1 49  ? 17.789  -7.169  178.180 1.00 0.00 ?  49  ARG A HH11 1  
ATOM 742    H HH12 . ARG A 1 49  ? 18.929  -8.101  179.093 1.00 0.00 ?  49  ARG A HH12 1  
ATOM 743    H HH21 . ARG A 1 49  ? 21.695  -7.393  176.957 1.00 0.00 ?  49  ARG A HH21 1  
ATOM 744    H HH22 . ARG A 1 49  ? 21.184  -8.235  178.384 1.00 0.00 ?  49  ARG A HH22 1  
ATOM 745    N N    . ASP A 1 50  ? 20.854  -1.345  173.841 1.00 0.00 ?  50  ASP A N    1  
ATOM 746    C CA   . ASP A 1 50  ? 21.325  -0.003  174.046 1.00 0.00 ?  50  ASP A CA   1  
ATOM 747    C C    . ASP A 1 50  ? 20.694  0.859   172.999 1.00 0.00 ?  50  ASP A C    1  
ATOM 748    O O    . ASP A 1 50  ? 20.359  2.008   173.257 1.00 0.00 ?  50  ASP A O    1  
ATOM 749    C CB   . ASP A 1 50  ? 22.852  0.156   173.933 1.00 0.00 ?  50  ASP A CB   1  
ATOM 750    C CG   . ASP A 1 50  ? 23.583  -0.470  175.115 1.00 0.00 ?  50  ASP A CG   1  
ATOM 751    O OD1  . ASP A 1 50  ? 22.904  -0.818  176.119 1.00 0.00 ?  50  ASP A OD1  1  
ATOM 752    O OD2  . ASP A 1 50  ? 24.834  -0.599  175.035 1.00 0.00 -1 50  ASP A OD2  1  
ATOM 753    H H    . ASP A 1 50  ? 21.541  -2.031  173.624 1.00 0.00 ?  50  ASP A H    1  
ATOM 754    H HA   . ASP A 1 50  ? 20.984  0.316   175.020 1.00 0.00 ?  50  ASP A HA   1  
ATOM 755    H HB2  . ASP A 1 50  ? 23.207  -0.322  172.997 1.00 0.00 ?  50  ASP A HB2  1  
ATOM 756    H HB3  . ASP A 1 50  ? 23.106  1.236   173.891 1.00 0.00 ?  50  ASP A HB3  1  
ATOM 757    N N    . LEU A 1 51  ? 20.544  0.310   171.776 1.00 0.00 ?  51  LEU A N    1  
ATOM 758    C CA   . LEU A 1 51  ? 19.952  1.057   170.688 1.00 0.00 ?  51  LEU A CA   1  
ATOM 759    C C    . LEU A 1 51  ? 18.541  1.399   171.044 1.00 0.00 ?  51  LEU A C    1  
ATOM 760    O O    . LEU A 1 51  ? 18.072  2.478   170.701 1.00 0.00 ?  51  LEU A O    1  
ATOM 761    C CB   . LEU A 1 51  ? 19.922  0.276   169.364 1.00 0.00 ?  51  LEU A CB   1  
ATOM 762    C CG   . LEU A 1 51  ? 21.322  0.065   168.765 1.00 0.00 ?  51  LEU A CG   1  
ATOM 763    C CD1  . LEU A 1 51  ? 21.278  -0.901  167.568 1.00 0.00 ?  51  LEU A CD1  1  
ATOM 764    C CD2  . LEU A 1 51  ? 21.976  1.402   168.377 1.00 0.00 ?  51  LEU A CD2  1  
ATOM 765    H H    . LEU A 1 51  ? 20.839  -0.624  171.568 1.00 0.00 ?  51  LEU A H    1  
ATOM 766    H HA   . LEU A 1 51  ? 20.518  1.967   170.572 1.00 0.00 ?  51  LEU A HA   1  
ATOM 767    H HB2  . LEU A 1 51  ? 19.447  -0.715  169.541 1.00 0.00 ?  51  LEU A HB2  1  
ATOM 768    H HB3  . LEU A 1 51  ? 19.301  0.829   168.631 1.00 0.00 ?  51  LEU A HB3  1  
ATOM 769    H HG   . LEU A 1 51  ? 21.956  -0.404  169.549 1.00 0.00 ?  51  LEU A HG   1  
ATOM 770    H HD11 . LEU A 1 51  ? 22.221  -1.484  167.508 1.00 0.00 ?  51  LEU A HD11 1  
ATOM 771    H HD12 . LEU A 1 51  ? 21.150  -0.334  166.621 1.00 0.00 ?  51  LEU A HD12 1  
ATOM 772    H HD13 . LEU A 1 51  ? 20.429  -1.609  167.675 1.00 0.00 ?  51  LEU A HD13 1  
ATOM 773    H HD21 . LEU A 1 51  ? 21.198  2.150   168.113 1.00 0.00 ?  51  LEU A HD21 1  
ATOM 774    H HD22 . LEU A 1 51  ? 22.647  1.265   167.503 1.00 0.00 ?  51  LEU A HD22 1  
ATOM 775    H HD23 . LEU A 1 51  ? 22.575  1.799   169.225 1.00 0.00 ?  51  LEU A HD23 1  
ATOM 776    N N    . TYR A 1 52  ? 17.817  0.464   171.701 1.00 0.00 ?  52  TYR A N    1  
ATOM 777    C CA   . TYR A 1 52  ? 16.439  0.716   172.070 1.00 0.00 ?  52  TYR A CA   1  
ATOM 778    C C    . TYR A 1 52  ? 16.399  1.914   172.974 1.00 0.00 ?  52  TYR A C    1  
ATOM 779    O O    . TYR A 1 52  ? 15.587  2.818   172.790 1.00 0.00 ?  52  TYR A O    1  
ATOM 780    C CB   . TYR A 1 52  ? 15.779  -0.457  172.811 1.00 0.00 ?  52  TYR A CB   1  
ATOM 781    C CG   . TYR A 1 52  ? 14.378  -0.176  173.232 1.00 0.00 ?  52  TYR A CG   1  
ATOM 782    C CD1  . TYR A 1 52  ? 14.093  0.153   174.539 1.00 0.00 ?  52  TYR A CD1  1  
ATOM 783    C CD2  . TYR A 1 52  ? 13.351  -0.239  172.317 1.00 0.00 ?  52  TYR A CD2  1  
ATOM 784    C CE1  . TYR A 1 52  ? 12.799  0.413   174.924 1.00 0.00 ?  52  TYR A CE1  1  
ATOM 785    C CE2  . TYR A 1 52  ? 12.057  0.021   172.702 1.00 0.00 ?  52  TYR A CE2  1  
ATOM 786    C CZ   . TYR A 1 52  ? 11.781  0.347   174.006 1.00 0.00 ?  52  TYR A CZ   1  
ATOM 787    O OH   . TYR A 1 52  ? 10.453  0.615   174.401 1.00 0.00 ?  52  TYR A OH   1  
ATOM 788    H H    . TYR A 1 52  ? 18.194  -0.427  171.955 1.00 0.00 ?  52  TYR A H    1  
ATOM 789    H HA   . TYR A 1 52  ? 15.896  0.940   171.164 1.00 0.00 ?  52  TYR A HA   1  
ATOM 790    H HB2  . TYR A 1 52  ? 15.753  -1.352  172.156 1.00 0.00 ?  52  TYR A HB2  1  
ATOM 791    H HB3  . TYR A 1 52  ? 16.360  -0.700  173.726 1.00 0.00 ?  52  TYR A HB3  1  
ATOM 792    H HD1  . TYR A 1 52  ? 14.890  0.205   175.265 1.00 0.00 ?  52  TYR A HD1  1  
ATOM 793    H HD2  . TYR A 1 52  ? 13.563  -0.496  171.289 1.00 0.00 ?  52  TYR A HD2  1  
ATOM 794    H HE1  . TYR A 1 52  ? 12.583  0.669   175.951 1.00 0.00 ?  52  TYR A HE1  1  
ATOM 795    H HE2  . TYR A 1 52  ? 11.258  -0.031  171.978 1.00 0.00 ?  52  TYR A HE2  1  
ATOM 796    H HH   . TYR A 1 52  ? 9.868   0.291   173.713 1.00 0.00 ?  52  TYR A HH   1  
ATOM 797    N N    . TYR A 1 53  ? 17.288  1.921   173.982 1.00 0.00 ?  53  TYR A N    1  
ATOM 798    C CA   . TYR A 1 53  ? 17.367  3.010   174.929 1.00 0.00 ?  53  TYR A CA   1  
ATOM 799    C C    . TYR A 1 53  ? 17.652  4.300   174.216 1.00 0.00 ?  53  TYR A C    1  
ATOM 800    O O    . TYR A 1 53  ? 17.013  5.320   174.480 1.00 0.00 ?  53  TYR A O    1  
ATOM 801    C CB   . TYR A 1 53  ? 18.489  2.780   175.954 1.00 0.00 ?  53  TYR A CB   1  
ATOM 802    C CG   . TYR A 1 53  ? 18.923  4.003   176.683 1.00 0.00 ?  53  TYR A CG   1  
ATOM 803    C CD1  . TYR A 1 53  ? 20.110  4.602   176.332 1.00 0.00 ?  53  TYR A CD1  1  
ATOM 804    C CD2  . TYR A 1 53  ? 18.173  4.549   177.704 1.00 0.00 ?  53  TYR A CD2  1  
ATOM 805    C CE1  . TYR A 1 53  ? 20.547  5.723   176.984 1.00 0.00 ?  53  TYR A CE1  1  
ATOM 806    C CE2  . TYR A 1 53  ? 18.616  5.680   178.360 1.00 0.00 ?  53  TYR A CE2  1  
ATOM 807    C CZ   . TYR A 1 53  ? 19.807  6.266   177.996 1.00 0.00 ?  53  TYR A CZ   1  
ATOM 808    O OH   . TYR A 1 53  ? 20.278  7.421   178.661 1.00 0.00 ?  53  TYR A OH   1  
ATOM 809    H H    . TYR A 1 53  ? 17.937  1.172   174.121 1.00 0.00 ?  53  TYR A H    1  
ATOM 810    H HA   . TYR A 1 53  ? 16.415  3.081   175.428 1.00 0.00 ?  53  TYR A HA   1  
ATOM 811    H HB2  . TYR A 1 53  ? 18.150  2.051   176.720 1.00 0.00 ?  53  TYR A HB2  1  
ATOM 812    H HB3  . TYR A 1 53  ? 19.384  2.363   175.442 1.00 0.00 ?  53  TYR A HB3  1  
ATOM 813    H HD1  . TYR A 1 53  ? 20.704  4.183   175.534 1.00 0.00 ?  53  TYR A HD1  1  
ATOM 814    H HD2  . TYR A 1 53  ? 17.238  4.091   177.990 1.00 0.00 ?  53  TYR A HD2  1  
ATOM 815    H HE1  . TYR A 1 53  ? 21.478  6.179   176.700 1.00 0.00 ?  53  TYR A HE1  1  
ATOM 816    H HE2  . TYR A 1 53  ? 18.027  6.106   179.159 1.00 0.00 ?  53  TYR A HE2  1  
ATOM 817    H HH   . TYR A 1 53  ? 21.081  7.712   178.218 1.00 0.00 ?  53  TYR A HH   1  
ATOM 818    N N    . TRP A 1 54  ? 18.632  4.262   173.306 1.00 0.00 ?  54  TRP A N    1  
ATOM 819    C CA   . TRP A 1 54  ? 19.057  5.426   172.580 1.00 0.00 ?  54  TRP A CA   1  
ATOM 820    C C    . TRP A 1 54  ? 17.907  5.994   171.784 1.00 0.00 ?  54  TRP A C    1  
ATOM 821    O O    . TRP A 1 54  ? 17.686  7.207   171.763 1.00 0.00 ?  54  TRP A O    1  
ATOM 822    C CB   . TRP A 1 54  ? 20.205  5.079   171.611 1.00 0.00 ?  54  TRP A CB   1  
ATOM 823    C CG   . TRP A 1 54  ? 20.701  6.259   170.813 1.00 0.00 ?  54  TRP A CG   1  
ATOM 824    C CD1  . TRP A 1 54  ? 21.643  7.183   171.167 1.00 0.00 ?  54  TRP A CD1  1  
ATOM 825    C CD2  . TRP A 1 54  ? 20.273  6.616   169.483 1.00 0.00 ?  54  TRP A CD2  1  
ATOM 826    N NE1  . TRP A 1 54  ? 21.817  8.089   170.159 1.00 0.00 ?  54  TRP A NE1  1  
ATOM 827    C CE2  . TRP A 1 54  ? 20.988  7.756   169.118 1.00 0.00 ?  54  TRP A CE2  1  
ATOM 828    C CE3  . TRP A 1 54  ? 19.368  6.064   168.623 1.00 0.00 ?  54  TRP A CE3  1  
ATOM 829    C CZ2  . TRP A 1 54  ? 20.809  8.351   167.905 1.00 0.00 ?  54  TRP A CZ2  1  
ATOM 830    C CZ3  . TRP A 1 54  ? 19.184  6.661   167.393 1.00 0.00 ?  54  TRP A CZ3  1  
ATOM 831    C CH2  . TRP A 1 54  ? 19.896  7.791   167.039 1.00 0.00 ?  54  TRP A CH2  1  
ATOM 832    H H    . TRP A 1 54  ? 19.112  3.422   173.091 1.00 0.00 ?  54  TRP A H    1  
ATOM 833    H HA   . TRP A 1 54  ? 19.387  6.159   173.299 1.00 0.00 ?  54  TRP A HA   1  
ATOM 834    H HB2  . TRP A 1 54  ? 21.057  4.664   172.193 1.00 0.00 ?  54  TRP A HB2  1  
ATOM 835    H HB3  . TRP A 1 54  ? 19.859  4.296   170.903 1.00 0.00 ?  54  TRP A HB3  1  
ATOM 836    H HD1  . TRP A 1 54  ? 22.168  7.200   172.111 1.00 0.00 ?  54  TRP A HD1  1  
ATOM 837    H HE1  . TRP A 1 54  ? 22.432  8.847   170.176 1.00 0.00 ?  54  TRP A HE1  1  
ATOM 838    H HE3  . TRP A 1 54  ? 18.802  5.182   168.881 1.00 0.00 ?  54  TRP A HE3  1  
ATOM 839    H HZ2  . TRP A 1 54  ? 21.358  9.233   167.615 1.00 0.00 ?  54  TRP A HZ2  1  
ATOM 840    H HZ3  . TRP A 1 54  ? 18.474  6.240   166.698 1.00 0.00 ?  54  TRP A HZ3  1  
ATOM 841    H HH2  . TRP A 1 54  ? 19.735  8.241   166.070 1.00 0.00 ?  54  TRP A HH2  1  
ATOM 842    N N    . ALA A 1 55  ? 17.147  5.120   171.115 1.00 0.00 ?  55  ALA A N    1  
ATOM 843    C CA   . ALA A 1 55  ? 16.053  5.558   170.289 1.00 0.00 ?  55  ALA A CA   1  
ATOM 844    C C    . ALA A 1 55  ? 14.935  6.105   171.131 1.00 0.00 ?  55  ALA A C    1  
ATOM 845    O O    . ALA A 1 55  ? 14.022  6.715   170.599 1.00 0.00 ?  55  ALA A O    1  
ATOM 846    C CB   . ALA A 1 55  ? 15.468  4.430   169.425 1.00 0.00 ?  55  ALA A CB   1  
ATOM 847    H H    . ALA A 1 55  ? 17.304  4.142   171.155 1.00 0.00 ?  55  ALA A H    1  
ATOM 848    H HA   . ALA A 1 55  ? 16.428  6.344   169.654 1.00 0.00 ?  55  ALA A HA   1  
ATOM 849    H HB1  . ALA A 1 55  ? 15.906  4.459   168.404 1.00 0.00 ?  55  ALA A HB1  1  
ATOM 850    H HB2  . ALA A 1 55  ? 14.365  4.540   169.340 1.00 0.00 ?  55  ALA A HB2  1  
ATOM 851    H HB3  . ALA A 1 55  ? 15.692  3.440   169.878 1.00 0.00 ?  55  ALA A HB3  1  
ATOM 852    N N    . LEU A 1 56  ? 14.939  5.855   172.451 1.00 0.00 ?  56  LEU A N    1  
ATOM 853    C CA   . LEU A 1 56  ? 13.846  6.309   173.279 1.00 0.00 ?  56  LEU A CA   1  
ATOM 854    C C    . LEU A 1 56  ? 14.023  7.721   173.814 1.00 0.00 ?  56  LEU A C    1  
ATOM 855    O O    . LEU A 1 56  ? 13.019  8.401   174.023 1.00 0.00 ?  56  LEU A O    1  
ATOM 856    C CB   . LEU A 1 56  ? 13.642  5.400   174.505 1.00 0.00 ?  56  LEU A CB   1  
ATOM 857    C CG   . LEU A 1 56  ? 12.344  4.576   174.443 1.00 0.00 ?  56  LEU A CG   1  
ATOM 858    C CD1  . LEU A 1 56  ? 11.110  5.471   174.636 1.00 0.00 ?  56  LEU A CD1  1  
ATOM 859    C CD2  . LEU A 1 56  ? 12.245  3.758   173.143 1.00 0.00 ?  56  LEU A CD2  1  
ATOM 860    H H    . LEU A 1 56  ? 15.673  5.359   172.905 1.00 0.00 ?  56  LEU A H    1  
ATOM 861    H HA   . LEU A 1 56  ? 12.957  6.288   172.673 1.00 0.00 ?  56  LEU A HA   1  
ATOM 862    H HB2  . LEU A 1 56  ? 14.508  4.707   174.586 1.00 0.00 ?  56  LEU A HB2  1  
ATOM 863    H HB3  . LEU A 1 56  ? 13.619  6.029   175.420 1.00 0.00 ?  56  LEU A HB3  1  
ATOM 864    H HG   . LEU A 1 56  ? 12.367  3.857   175.290 1.00 0.00 ?  56  LEU A HG   1  
ATOM 865    H HD11 . LEU A 1 56  ? 10.194  4.852   174.731 1.00 0.00 ?  56  LEU A HD11 1  
ATOM 866    H HD12 . LEU A 1 56  ? 10.990  6.154   173.767 1.00 0.00 ?  56  LEU A HD12 1  
ATOM 867    H HD13 . LEU A 1 56  ? 11.220  6.086   175.556 1.00 0.00 ?  56  LEU A HD13 1  
ATOM 868    H HD21 . LEU A 1 56  ? 13.248  3.385   172.845 1.00 0.00 ?  56  LEU A HD21 1  
ATOM 869    H HD22 . LEU A 1 56  ? 11.843  4.388   172.320 1.00 0.00 ?  56  LEU A HD22 1  
ATOM 870    H HD23 . LEU A 1 56  ? 11.570  2.887   173.286 1.00 0.00 ?  56  LEU A HD23 1  
ATOM 871    N N    . LYS A 1 57  ? 15.267  8.215   174.060 1.00 0.00 ?  57  LYS A N    1  
ATOM 872    C CA   . LYS A 1 57  ? 15.394  9.524   174.712 1.00 0.00 ?  57  LYS A CA   1  
ATOM 873    C C    . LYS A 1 57  ? 15.514  10.731  173.786 1.00 0.00 ?  57  LYS A C    1  
ATOM 874    O O    . LYS A 1 57  ? 14.668  11.623  173.814 1.00 0.00 ?  57  LYS A O    1  
ATOM 875    C CB   . LYS A 1 57  ? 16.636  9.579   175.619 1.00 0.00 ?  57  LYS A CB   1  
ATOM 876    C CG   . LYS A 1 57  ? 16.654  8.490   176.698 1.00 0.00 ?  57  LYS A CG   1  
ATOM 877    C CD   . LYS A 1 57  ? 15.520  8.630   177.716 1.00 0.00 ?  57  LYS A CD   1  
ATOM 878    C CE   . LYS A 1 57  ? 15.669  7.654   178.883 1.00 0.00 ?  57  LYS A CE   1  
ATOM 879    N NZ   . LYS A 1 57  ? 15.564  6.257   178.403 1.00 0.00 1  57  LYS A NZ   1  
ATOM 880    H H    . LYS A 1 57  ? 16.109  7.734   173.821 1.00 0.00 ?  57  LYS A H    1  
ATOM 881    H HA   . LYS A 1 57  ? 14.520  9.656   175.324 1.00 0.00 ?  57  LYS A HA   1  
ATOM 882    H HB2  . LYS A 1 57  ? 17.546  9.478   174.989 1.00 0.00 ?  57  LYS A HB2  1  
ATOM 883    H HB3  . LYS A 1 57  ? 16.675  10.572  176.115 1.00 0.00 ?  57  LYS A HB3  1  
ATOM 884    H HG2  . LYS A 1 57  ? 16.575  7.495   176.208 1.00 0.00 ?  57  LYS A HG2  1  
ATOM 885    H HG3  . LYS A 1 57  ? 17.628  8.528   177.233 1.00 0.00 ?  57  LYS A HG3  1  
ATOM 886    H HD2  . LYS A 1 57  ? 15.510  9.669   178.110 1.00 0.00 ?  57  LYS A HD2  1  
ATOM 887    H HD3  . LYS A 1 57  ? 14.547  8.444   177.212 1.00 0.00 ?  57  LYS A HD3  1  
ATOM 888    H HE2  . LYS A 1 57  ? 16.661  7.774   179.368 1.00 0.00 ?  57  LYS A HE2  1  
ATOM 889    H HE3  . LYS A 1 57  ? 14.869  7.820   179.634 1.00 0.00 ?  57  LYS A HE3  1  
ATOM 890    H HZ1  . LYS A 1 57  ? 14.880  5.740   178.990 1.00 0.00 ?  57  LYS A HZ1  1  
ATOM 891    H HZ2  . LYS A 1 57  ? 16.494  5.798   178.468 1.00 0.00 ?  57  LYS A HZ2  1  
ATOM 892    H HZ3  . LYS A 1 57  ? 15.244  6.255   177.413 1.00 0.00 ?  57  LYS A HZ3  1  
ATOM 893    N N    . VAL A 1 58  ? 16.574  10.779  172.961 1.00 0.00 ?  58  VAL A N    1  
ATOM 894    C CA   . VAL A 1 58  ? 16.868  11.945  172.120 1.00 0.00 ?  58  VAL A CA   1  
ATOM 895    C C    . VAL A 1 58  ? 15.966  12.012  170.909 1.00 0.00 ?  58  VAL A C    1  
ATOM 896    O O    . VAL A 1 58  ? 15.934  13.004  170.194 1.00 0.00 ?  58  VAL A O    1  
ATOM 897    C CB   . VAL A 1 58  ? 18.321  11.987  171.705 1.00 0.00 ?  58  VAL A CB   1  
ATOM 898    C CG1  . VAL A 1 58  ? 18.587  10.839  170.717 1.00 0.00 ?  58  VAL A CG1  1  
ATOM 899    C CG2  . VAL A 1 58  ? 18.670  13.381  171.142 1.00 0.00 ?  58  VAL A CG2  1  
ATOM 900    H H    . VAL A 1 58  ? 17.211  10.012  172.879 1.00 0.00 ?  58  VAL A H    1  
ATOM 901    H HA   . VAL A 1 58  ? 16.654  12.810  172.729 1.00 0.00 ?  58  VAL A HA   1  
ATOM 902    H HB   . VAL A 1 58  ? 18.953  11.814  172.603 1.00 0.00 ?  58  VAL A HB   1  
ATOM 903    H HG11 . VAL A 1 58  ? 19.679  10.722  170.549 1.00 0.00 ?  58  VAL A HG11 1  
ATOM 904    H HG12 . VAL A 1 58  ? 18.101  11.040  169.747 1.00 0.00 ?  58  VAL A HG12 1  
ATOM 905    H HG13 . VAL A 1 58  ? 18.189  9.884   171.121 1.00 0.00 ?  58  VAL A HG13 1  
ATOM 906    H HG21 . VAL A 1 58  ? 18.232  14.177  171.781 1.00 0.00 ?  58  VAL A HG21 1  
ATOM 907    H HG22 . VAL A 1 58  ? 18.271  13.494  170.114 1.00 0.00 ?  58  VAL A HG22 1  
ATOM 908    H HG23 . VAL A 1 58  ? 19.772  13.518  171.111 1.00 0.00 ?  58  VAL A HG23 1  
ATOM 909    N N    . SER A 1 59  ? 15.263  10.920  170.668 1.00 0.00 ?  59  SER A N    1  
ATOM 910    C CA   . SER A 1 59  ? 14.418  10.698  169.507 1.00 0.00 ?  59  SER A CA   1  
ATOM 911    C C    . SER A 1 59  ? 13.579  11.839  168.935 1.00 0.00 ?  59  SER A C    1  
ATOM 912    O O    . SER A 1 59  ? 13.074  11.618  167.847 1.00 0.00 ?  59  SER A O    1  
ATOM 913    C CB   . SER A 1 59  ? 13.411  9.590   169.786 1.00 0.00 ?  59  SER A CB   1  
ATOM 914    O OG   . SER A 1 59  ? 13.341  9.332   171.179 1.00 0.00 ?  59  SER A OG   1  
ATOM 915    H H    . SER A 1 59  ? 15.284  10.158  171.311 1.00 0.00 ?  59  SER A H    1  
ATOM 916    H HA   . SER A 1 59  ? 15.072  10.354  168.728 1.00 0.00 ?  59  SER A HA   1  
ATOM 917    H HB2  . SER A 1 59  ? 12.407  9.895   169.424 1.00 0.00 ?  59  SER A HB2  1  
ATOM 918    H HB3  . SER A 1 59  ? 13.715  8.660   169.261 1.00 0.00 ?  59  SER A HB3  1  
ATOM 919    H HG   . SER A 1 59  ? 13.320  8.378   171.269 1.00 0.00 ?  59  SER A HG   1  
ATOM 920    N N    . TRP A 1 60  ? 13.327  13.021  169.562 1.00 0.00 ?  60  TRP A N    1  
ATOM 921    C CA   . TRP A 1 60  ? 12.446  13.970  168.876 1.00 0.00 ?  60  TRP A CA   1  
ATOM 922    C C    . TRP A 1 60  ? 12.973  14.292  167.456 1.00 0.00 ?  60  TRP A C    1  
ATOM 923    O O    . TRP A 1 60  ? 12.322  13.871  166.497 1.00 0.00 ?  60  TRP A O    1  
ATOM 924    C CB   . TRP A 1 60  ? 12.122  15.268  169.671 1.00 0.00 ?  60  TRP A CB   1  
ATOM 925    C CG   . TRP A 1 60  ? 10.905  15.181  170.564 1.00 0.00 ?  60  TRP A CG   1  
ATOM 926    C CD1  . TRP A 1 60  ? 9.774   14.435  170.399 1.00 0.00 ?  60  TRP A CD1  1  
ATOM 927    C CD2  . TRP A 1 60  ? 10.725  15.906  171.801 1.00 0.00 ?  60  TRP A CD2  1  
ATOM 928    N NE1  . TRP A 1 60  ? 8.904   14.661  171.430 1.00 0.00 ?  60  TRP A NE1  1  
ATOM 929    C CE2  . TRP A 1 60  ? 9.474   15.552  172.302 1.00 0.00 ?  60  TRP A CE2  1  
ATOM 930    C CE3  . TRP A 1 60  ? 11.513  16.792  172.479 1.00 0.00 ?  60  TRP A CE3  1  
ATOM 931    C CZ2  . TRP A 1 60  ? 9.000   16.072  173.469 1.00 0.00 ?  60  TRP A CZ2  1  
ATOM 932    C CZ3  . TRP A 1 60  ? 11.039  17.320  173.663 1.00 0.00 ?  60  TRP A CZ3  1  
ATOM 933    C CH2  . TRP A 1 60  ? 9.797   16.964  174.152 1.00 0.00 ?  60  TRP A CH2  1  
ATOM 934    H H    . TRP A 1 60  ? 13.700  13.278  170.450 1.00 0.00 ?  60  TRP A H    1  
ATOM 935    H HA   . TRP A 1 60  ? 11.524  13.424  168.733 1.00 0.00 ?  60  TRP A HA   1  
ATOM 936    H HB2  . TRP A 1 60  ? 12.998  15.527  170.304 1.00 0.00 ?  60  TRP A HB2  1  
ATOM 937    H HB3  . TRP A 1 60  ? 11.968  16.099  168.951 1.00 0.00 ?  60  TRP A HB3  1  
ATOM 938    H HD1  . TRP A 1 60  ? 9.585   13.775  169.565 1.00 0.00 ?  60  TRP A HD1  1  
ATOM 939    H HE1  . TRP A 1 60  ? 8.026   14.248  171.533 1.00 0.00 ?  60  TRP A HE1  1  
ATOM 940    H HE3  . TRP A 1 60  ? 12.487  17.084  172.114 1.00 0.00 ?  60  TRP A HE3  1  
ATOM 941    H HZ2  . TRP A 1 60  ? 8.032   15.802  173.864 1.00 0.00 ?  60  TRP A HZ2  1  
ATOM 942    H HZ3  . TRP A 1 60  ? 11.647  18.022  174.215 1.00 0.00 ?  60  TRP A HZ3  1  
ATOM 943    H HH2  . TRP A 1 60  ? 9.447   17.390  175.081 1.00 0.00 ?  60  TRP A HH2  1  
ATOM 944    N N    . PRO A 1 61  ? 14.101  14.985  167.228 1.00 0.00 ?  61  PRO A N    1  
ATOM 945    C CA   . PRO A 1 61  ? 14.548  15.186  165.853 1.00 0.00 ?  61  PRO A CA   1  
ATOM 946    C C    . PRO A 1 61  ? 15.442  14.084  165.331 1.00 0.00 ?  61  PRO A C    1  
ATOM 947    O O    . PRO A 1 61  ? 15.444  13.761  164.139 1.00 0.00 ?  61  PRO A O    1  
ATOM 948    C CB   . PRO A 1 61  ? 15.313  16.501  165.927 1.00 0.00 ?  61  PRO A CB   1  
ATOM 949    C CG   . PRO A 1 61  ? 15.971  16.469  167.308 1.00 0.00 ?  61  PRO A CG   1  
ATOM 950    C CD   . PRO A 1 61  ? 15.029  15.636  168.193 1.00 0.00 ?  61  PRO A CD   1  
ATOM 951    H HA   . PRO A 1 61  ? 13.710  15.306  165.184 1.00 0.00 ?  61  PRO A HA   1  
ATOM 952    H HB2  . PRO A 1 61  ? 16.080  16.555  165.124 1.00 0.00 ?  61  PRO A HB2  1  
ATOM 953    H HB3  . PRO A 1 61  ? 14.622  17.366  165.845 1.00 0.00 ?  61  PRO A HB3  1  
ATOM 954    H HG2  . PRO A 1 61  ? 16.974  15.995  167.246 1.00 0.00 ?  61  PRO A HG2  1  
ATOM 955    H HG3  . PRO A 1 61  ? 16.075  17.499  167.710 1.00 0.00 ?  61  PRO A HG3  1  
ATOM 956    H HD2  . PRO A 1 61  ? 15.607  14.884  168.768 1.00 0.00 ?  61  PRO A HD2  1  
ATOM 957    H HD3  . PRO A 1 61  ? 14.492  16.303  168.893 1.00 0.00 ?  61  PRO A HD3  1  
ATOM 958    N N    . VAL A 1 62  ? 16.207  13.475  166.258 1.00 0.00 ?  62  VAL A N    1  
ATOM 959    C CA   . VAL A 1 62  ? 17.170  12.469  165.930 1.00 0.00 ?  62  VAL A CA   1  
ATOM 960    C C    . VAL A 1 62  ? 16.524  11.245  165.364 1.00 0.00 ?  62  VAL A C    1  
ATOM 961    O O    . VAL A 1 62  ? 17.072  10.663  164.446 1.00 0.00 ?  62  VAL A O    1  
ATOM 962    C CB   . VAL A 1 62  ? 17.998  12.076  167.119 1.00 0.00 ?  62  VAL A CB   1  
ATOM 963    C CG1  . VAL A 1 62  ? 18.851  10.843  166.771 1.00 0.00 ?  62  VAL A CG1  1  
ATOM 964    C CG2  . VAL A 1 62  ? 18.858  13.286  167.513 1.00 0.00 ?  62  VAL A CG2  1  
ATOM 965    H H    . VAL A 1 62  ? 16.134  13.703  167.229 1.00 0.00 ?  62  VAL A H    1  
ATOM 966    H HA   . VAL A 1 62  ? 17.813  12.891  165.174 1.00 0.00 ?  62  VAL A HA   1  
ATOM 967    H HB   . VAL A 1 62  ? 17.333  11.823  167.972 1.00 0.00 ?  62  VAL A HB   1  
ATOM 968    H HG11 . VAL A 1 62  ? 19.156  10.875  165.703 1.00 0.00 ?  62  VAL A HG11 1  
ATOM 969    H HG12 . VAL A 1 62  ? 18.272  9.911   166.947 1.00 0.00 ?  62  VAL A HG12 1  
ATOM 970    H HG13 . VAL A 1 62  ? 19.766  10.816  167.401 1.00 0.00 ?  62  VAL A HG13 1  
ATOM 971    H HG21 . VAL A 1 62  ? 19.573  13.006  168.316 1.00 0.00 ?  62  VAL A HG21 1  
ATOM 972    H HG22 . VAL A 1 62  ? 18.215  14.113  167.883 1.00 0.00 ?  62  VAL A HG22 1  
ATOM 973    H HG23 . VAL A 1 62  ? 19.435  13.650  166.636 1.00 0.00 ?  62  VAL A HG23 1  
ATOM 974    N N    . PHE A 1 63  ? 15.370  10.800  165.908 1.00 0.00 ?  63  PHE A N    1  
ATOM 975    C CA   . PHE A 1 63  ? 14.756  9.576   165.422 1.00 0.00 ?  63  PHE A CA   1  
ATOM 976    C C    . PHE A 1 63  ? 14.434  9.667   163.970 1.00 0.00 ?  63  PHE A C    1  
ATOM 977    O O    . PHE A 1 63  ? 14.703  8.724   163.240 1.00 0.00 ?  63  PHE A O    1  
ATOM 978    C CB   . PHE A 1 63  ? 13.455  9.170   166.120 1.00 0.00 ?  63  PHE A CB   1  
ATOM 979    C CG   . PHE A 1 63  ? 12.790  7.990   165.499 1.00 0.00 ?  63  PHE A CG   1  
ATOM 980    C CD1  . PHE A 1 63  ? 11.707  8.160   164.664 1.00 0.00 ?  63  PHE A CD1  1  
ATOM 981    C CD2  . PHE A 1 63  ? 13.249  6.716   165.751 1.00 0.00 ?  63  PHE A CD2  1  
ATOM 982    C CE1  . PHE A 1 63  ? 11.093  7.073   164.090 1.00 0.00 ?  63  PHE A CE1  1  
ATOM 983    C CE2  . PHE A 1 63  ? 12.633  5.628   165.176 1.00 0.00 ?  63  PHE A CE2  1  
ATOM 984    C CZ   . PHE A 1 63  ? 11.556  5.807   164.346 1.00 0.00 ?  63  PHE A CZ   1  
ATOM 985    H H    . PHE A 1 63  ? 14.898  11.280  166.645 1.00 0.00 ?  63  PHE A H    1  
ATOM 986    H HA   . PHE A 1 63  ? 15.486  8.794   165.555 1.00 0.00 ?  63  PHE A HA   1  
ATOM 987    H HB2  . PHE A 1 63  ? 13.665  8.904   167.169 1.00 0.00 ?  63  PHE A HB2  1  
ATOM 988    H HB3  . PHE A 1 63  ? 12.731  10.013  166.098 1.00 0.00 ?  63  PHE A HB3  1  
ATOM 989    H HD1  . PHE A 1 63  ? 11.338  9.154   164.459 1.00 0.00 ?  63  PHE A HD1  1  
ATOM 990    H HD2  . PHE A 1 63  ? 14.097  6.569   166.403 1.00 0.00 ?  63  PHE A HD2  1  
ATOM 991    H HE1  . PHE A 1 63  ? 10.244  7.214   163.437 1.00 0.00 ?  63  PHE A HE1  1  
ATOM 992    H HE2  . PHE A 1 63  ? 13.000  4.632   165.378 1.00 0.00 ?  63  PHE A HE2  1  
ATOM 993    H HZ   . PHE A 1 63  ? 11.073  4.953   163.895 1.00 0.00 ?  63  PHE A HZ   1  
ATOM 994    N N    . PHE A 1 64  ? 13.808  10.770  163.523 1.00 0.00 ?  64  PHE A N    1  
ATOM 995    C CA   . PHE A 1 64  ? 13.436  10.872  162.134 1.00 0.00 ?  64  PHE A CA   1  
ATOM 996    C C    . PHE A 1 64  ? 14.670  10.816  161.281 1.00 0.00 ?  64  PHE A C    1  
ATOM 997    O O    . PHE A 1 64  ? 14.684  10.140  160.252 1.00 0.00 ?  64  PHE A O    1  
ATOM 998    C CB   . PHE A 1 64  ? 12.722  12.190  161.797 1.00 0.00 ?  64  PHE A CB   1  
ATOM 999    C CG   . PHE A 1 64  ? 11.345  12.296  162.354 1.00 0.00 ?  64  PHE A CG   1  
ATOM 1000   C CD1  . PHE A 1 64  ? 11.144  12.788  163.624 1.00 0.00 ?  64  PHE A CD1  1  
ATOM 1001   C CD2  . PHE A 1 64  ? 10.254  11.915  161.603 1.00 0.00 ?  64  PHE A CD2  1  
ATOM 1002   C CE1  . PHE A 1 64  ? 9.874   12.897  164.138 1.00 0.00 ?  64  PHE A CE1  1  
ATOM 1003   C CE2  . PHE A 1 64  ? 8.984   12.024  162.118 1.00 0.00 ?  64  PHE A CE2  1  
ATOM 1004   C CZ   . PHE A 1 64  ? 8.795   12.515  163.385 1.00 0.00 ?  64  PHE A CZ   1  
ATOM 1005   H H    . PHE A 1 64  ? 13.580  11.544  164.112 1.00 0.00 ?  64  PHE A H    1  
ATOM 1006   H HA   . PHE A 1 64  ? 12.801  10.032  161.900 1.00 0.00 ?  64  PHE A HA   1  
ATOM 1007   H HB2  . PHE A 1 64  ? 13.303  13.047  162.199 1.00 0.00 ?  64  PHE A HB2  1  
ATOM 1008   H HB3  . PHE A 1 64  ? 12.644  12.302  160.693 1.00 0.00 ?  64  PHE A HB3  1  
ATOM 1009   H HD1  . PHE A 1 64  ? 11.993  13.090  164.220 1.00 0.00 ?  64  PHE A HD1  1  
ATOM 1010   H HD2  . PHE A 1 64  ? 10.398  11.528  160.606 1.00 0.00 ?  64  PHE A HD2  1  
ATOM 1011   H HE1  . PHE A 1 64  ? 9.727   13.285  165.135 1.00 0.00 ?  64  PHE A HE1  1  
ATOM 1012   H HE2  . PHE A 1 64  ? 8.135   11.724  161.524 1.00 0.00 ?  64  PHE A HE2  1  
ATOM 1013   H HZ   . PHE A 1 64  ? 7.796   12.601  163.788 1.00 0.00 ?  64  PHE A HZ   1  
ATOM 1014   N N    . ALA A 1 65  ? 15.740  11.522  161.695 1.00 0.00 ?  65  ALA A N    1  
ATOM 1015   C CA   . ALA A 1 65  ? 16.949  11.534  160.910 1.00 0.00 ?  65  ALA A CA   1  
ATOM 1016   C C    . ALA A 1 65  ? 17.543  10.154  160.865 1.00 0.00 ?  65  ALA A C    1  
ATOM 1017   O O    . ALA A 1 65  ? 18.015  9.707   159.826 1.00 0.00 ?  65  ALA A O    1  
ATOM 1018   C CB   . ALA A 1 65  ? 18.022  12.480  161.472 1.00 0.00 ?  65  ALA A CB   1  
ATOM 1019   H H    . ALA A 1 65  ? 15.751  12.042  162.551 1.00 0.00 ?  65  ALA A H    1  
ATOM 1020   H HA   . ALA A 1 65  ? 16.683  11.834  159.909 1.00 0.00 ?  65  ALA A HA   1  
ATOM 1021   H HB1  . ALA A 1 65  ? 17.643  12.995  162.381 1.00 0.00 ?  65  ALA A HB1  1  
ATOM 1022   H HB2  . ALA A 1 65  ? 18.293  13.249  160.717 1.00 0.00 ?  65  ALA A HB2  1  
ATOM 1023   H HB3  . ALA A 1 65  ? 18.936  11.911  161.743 1.00 0.00 ?  65  ALA A HB3  1  
ATOM 1024   N N    . SER A 1 66  ? 17.532  9.460   162.015 1.00 0.00 ?  66  SER A N    1  
ATOM 1025   C CA   . SER A 1 66  ? 18.108  8.147   162.117 1.00 0.00 ?  66  SER A CA   1  
ATOM 1026   C C    . SER A 1 66  ? 17.381  7.211   161.218 1.00 0.00 ?  66  SER A C    1  
ATOM 1027   O O    . SER A 1 66  ? 17.998  6.386   160.556 1.00 0.00 ?  66  SER A O    1  
ATOM 1028   C CB   . SER A 1 66  ? 18.041  7.568   163.539 1.00 0.00 ?  66  SER A CB   1  
ATOM 1029   O OG   . SER A 1 66  ? 18.622  6.273   163.566 1.00 0.00 ?  66  SER A OG   1  
ATOM 1030   H H    . SER A 1 66  ? 17.134  9.826   162.844 1.00 0.00 ?  66  SER A H    1  
ATOM 1031   H HA   . SER A 1 66  ? 19.135  8.218   161.796 1.00 0.00 ?  66  SER A HA   1  
ATOM 1032   H HB2  . SER A 1 66  ? 18.595  8.225   164.244 1.00 0.00 ?  66  SER A HB2  1  
ATOM 1033   H HB3  . SER A 1 66  ? 16.984  7.493   163.870 1.00 0.00 ?  66  SER A HB3  1  
ATOM 1034   H HG   . SER A 1 66  ? 17.954  5.691   163.931 1.00 0.00 ?  66  SER A HG   1  
ATOM 1035   N N    . LEU A 1 67  ? 16.042  7.305   161.206 1.00 0.00 ?  67  LEU A N    1  
ATOM 1036   C CA   . LEU A 1 67  ? 15.246  6.429   160.401 1.00 0.00 ?  67  LEU A CA   1  
ATOM 1037   C C    . LEU A 1 67  ? 15.600  6.661   158.967 1.00 0.00 ?  67  LEU A C    1  
ATOM 1038   O O    . LEU A 1 67  ? 15.723  5.713   158.205 1.00 0.00 ?  67  LEU A O    1  
ATOM 1039   C CB   . LEU A 1 67  ? 13.732  6.660   160.575 1.00 0.00 ?  67  LEU A CB   1  
ATOM 1040   C CG   . LEU A 1 67  ? 12.867  5.708   159.727 1.00 0.00 ?  67  LEU A CG   1  
ATOM 1041   C CD1  . LEU A 1 67  ? 13.121  4.238   160.102 1.00 0.00 ?  67  LEU A CD1  1  
ATOM 1042   C CD2  . LEU A 1 67  ? 11.374  6.060   159.848 1.00 0.00 ?  67  LEU A CD2  1  
ATOM 1043   H H    . LEU A 1 67  ? 15.552  7.972   161.751 1.00 0.00 ?  67  LEU A H    1  
ATOM 1044   H HA   . LEU A 1 67  ? 15.503  5.416   160.669 1.00 0.00 ?  67  LEU A HA   1  
ATOM 1045   H HB2  . LEU A 1 67  ? 13.470  6.529   161.648 1.00 0.00 ?  67  LEU A HB2  1  
ATOM 1046   H HB3  . LEU A 1 67  ? 13.492  7.705   160.289 1.00 0.00 ?  67  LEU A HB3  1  
ATOM 1047   H HG   . LEU A 1 67  ? 13.154  5.836   158.663 1.00 0.00 ?  67  LEU A HG   1  
ATOM 1048   H HD11 . LEU A 1 67  ? 13.600  4.173   161.102 1.00 0.00 ?  67  LEU A HD11 1  
ATOM 1049   H HD12 . LEU A 1 67  ? 13.792  3.761   159.356 1.00 0.00 ?  67  LEU A HD12 1  
ATOM 1050   H HD13 . LEU A 1 67  ? 12.163  3.676   160.130 1.00 0.00 ?  67  LEU A HD13 1  
ATOM 1051   H HD21 . LEU A 1 67  ? 11.252  7.094   160.237 1.00 0.00 ?  67  LEU A HD21 1  
ATOM 1052   H HD22 . LEU A 1 67  ? 10.867  5.358   160.544 1.00 0.00 ?  67  LEU A HD22 1  
ATOM 1053   H HD23 . LEU A 1 67  ? 10.880  5.994   158.855 1.00 0.00 ?  67  LEU A HD23 1  
ATOM 1054   N N    . ALA A 1 68  ? 15.749  7.938   158.566 1.00 0.00 ?  68  ALA A N    1  
ATOM 1055   C CA   . ALA A 1 68  ? 16.075  8.241   157.196 1.00 0.00 ?  68  ALA A CA   1  
ATOM 1056   C C    . ALA A 1 68  ? 17.416  7.653   156.856 1.00 0.00 ?  68  ALA A C    1  
ATOM 1057   O O    . ALA A 1 68  ? 17.611  7.144   155.754 1.00 0.00 ?  68  ALA A O    1  
ATOM 1058   C CB   . ALA A 1 68  ? 16.143  9.750   156.911 1.00 0.00 ?  68  ALA A CB   1  
ATOM 1059   H H    . ALA A 1 68  ? 15.646  8.713   159.185 1.00 0.00 ?  68  ALA A H    1  
ATOM 1060   H HA   . ALA A 1 68  ? 15.322  7.782   156.575 1.00 0.00 ?  68  ALA A HA   1  
ATOM 1061   H HB1  . ALA A 1 68  ? 16.927  9.964   156.152 1.00 0.00 ?  68  ALA A HB1  1  
ATOM 1062   H HB2  . ALA A 1 68  ? 16.388  10.308  157.840 1.00 0.00 ?  68  ALA A HB2  1  
ATOM 1063   H HB3  . ALA A 1 68  ? 15.168  10.115  156.525 1.00 0.00 ?  68  ALA A HB3  1  
ATOM 1064   N N    . ALA A 1 69  ? 18.385  7.749   157.789 1.00 0.00 ?  69  ALA A N    1  
ATOM 1065   C CA   . ALA A 1 69  ? 19.705  7.228   157.535 1.00 0.00 ?  69  ALA A CA   1  
ATOM 1066   C C    . ALA A 1 69  ? 19.623  5.744   157.338 1.00 0.00 ?  69  ALA A C    1  
ATOM 1067   O O    . ALA A 1 69  ? 20.281  5.191   156.457 1.00 0.00 ?  69  ALA A O    1  
ATOM 1068   C CB   . ALA A 1 69  ? 20.690  7.492   158.685 1.00 0.00 ?  69  ALA A CB   1  
ATOM 1069   H H    . ALA A 1 69  ? 18.240  8.185   158.668 1.00 0.00 ?  69  ALA A H    1  
ATOM 1070   H HA   . ALA A 1 69  ? 20.066  7.684   156.627 1.00 0.00 ?  69  ALA A HA   1  
ATOM 1071   H HB1  . ALA A 1 69  ? 20.774  6.595   159.335 1.00 0.00 ?  69  ALA A HB1  1  
ATOM 1072   H HB2  . ALA A 1 69  ? 20.341  8.347   159.303 1.00 0.00 ?  69  ALA A HB2  1  
ATOM 1073   H HB3  . ALA A 1 69  ? 21.697  7.734   158.283 1.00 0.00 ?  69  ALA A HB3  1  
ATOM 1074   N N    . LEU A 1 70  ? 18.803  5.065   158.166 1.00 0.00 ?  70  LEU A N    1  
ATOM 1075   C CA   . LEU A 1 70  ? 18.671  3.636   158.067 1.00 0.00 ?  70  LEU A CA   1  
ATOM 1076   C C    . LEU A 1 70  ? 18.051  3.302   156.752 1.00 0.00 ?  70  LEU A C    1  
ATOM 1077   O O    . LEU A 1 70  ? 18.405  2.305   156.140 1.00 0.00 ?  70  LEU A O    1  
ATOM 1078   C CB   . LEU A 1 70  ? 17.800  3.018   159.177 1.00 0.00 ?  70  LEU A CB   1  
ATOM 1079   C CG   . LEU A 1 70  ? 18.623  2.479   160.367 1.00 0.00 ?  70  LEU A CG   1  
ATOM 1080   C CD1  . LEU A 1 70  ? 19.166  1.071   160.072 1.00 0.00 ?  70  LEU A CD1  1  
ATOM 1081   C CD2  . LEU A 1 70  ? 19.760  3.434   160.774 1.00 0.00 ?  70  LEU A CD2  1  
ATOM 1082   H H    . LEU A 1 70  ? 18.272  5.512   158.875 1.00 0.00 ?  70  LEU A H    1  
ATOM 1083   H HA   . LEU A 1 70  ? 19.664  3.218   158.098 1.00 0.00 ?  70  LEU A HA   1  
ATOM 1084   H HB2  . LEU A 1 70  ? 17.089  3.790   159.547 1.00 0.00 ?  70  LEU A HB2  1  
ATOM 1085   H HB3  . LEU A 1 70  ? 17.208  2.183   158.748 1.00 0.00 ?  70  LEU A HB3  1  
ATOM 1086   H HG   . LEU A 1 70  ? 17.932  2.393   161.234 1.00 0.00 ?  70  LEU A HG   1  
ATOM 1087   H HD11 . LEU A 1 70  ? 20.015  1.126   159.358 1.00 0.00 ?  70  LEU A HD11 1  
ATOM 1088   H HD12 . LEU A 1 70  ? 18.369  0.436   159.627 1.00 0.00 ?  70  LEU A HD12 1  
ATOM 1089   H HD13 . LEU A 1 70  ? 19.520  0.590   161.009 1.00 0.00 ?  70  LEU A HD13 1  
ATOM 1090   H HD21 . LEU A 1 70  ? 19.430  4.489   160.692 1.00 0.00 ?  70  LEU A HD21 1  
ATOM 1091   H HD22 . LEU A 1 70  ? 20.644  3.287   160.116 1.00 0.00 ?  70  LEU A HD22 1  
ATOM 1092   H HD23 . LEU A 1 70  ? 20.067  3.240   161.824 1.00 0.00 ?  70  LEU A HD23 1  
ATOM 1093   N N    . PHE A 1 71  ? 17.082  4.124   156.310 1.00 0.00 ?  71  PHE A N    1  
ATOM 1094   C CA   . PHE A 1 71  ? 16.429  3.891   155.051 1.00 0.00 ?  71  PHE A CA   1  
ATOM 1095   C C    . PHE A 1 71  ? 17.423  3.917   153.940 1.00 0.00 ?  71  PHE A C    1  
ATOM 1096   O O    . PHE A 1 71  ? 17.416  3.038   153.086 1.00 0.00 ?  71  PHE A O    1  
ATOM 1097   C CB   . PHE A 1 71  ? 15.365  4.937   154.702 1.00 0.00 ?  71  PHE A CB   1  
ATOM 1098   C CG   . PHE A 1 71  ? 15.152  5.032   153.233 1.00 0.00 ?  71  PHE A CG   1  
ATOM 1099   C CD1  . PHE A 1 71  ? 15.603  6.141   152.551 1.00 0.00 ?  71  PHE A CD1  1  
ATOM 1100   C CD2  . PHE A 1 71  ? 14.553  4.011   152.532 1.00 0.00 ?  71  PHE A CD2  1  
ATOM 1101   C CE1  . PHE A 1 71  ? 15.461  6.229   151.190 1.00 0.00 ?  71  PHE A CE1  1  
ATOM 1102   C CE2  . PHE A 1 71  ? 14.404  4.102   151.167 1.00 0.00 ?  71  PHE A CE2  1  
ATOM 1103   C CZ   . PHE A 1 71  ? 14.861  5.212   150.498 1.00 0.00 ?  71  PHE A CZ   1  
ATOM 1104   H H    . PHE A 1 71  ? 16.770  4.906   156.831 1.00 0.00 ?  71  PHE A H    1  
ATOM 1105   H HA   . PHE A 1 71  ? 15.981  2.913   155.097 1.00 0.00 ?  71  PHE A HA   1  
ATOM 1106   H HB2  . PHE A 1 71  ? 14.393  4.665   155.165 1.00 0.00 ?  71  PHE A HB2  1  
ATOM 1107   H HB3  . PHE A 1 71  ? 15.671  5.939   155.065 1.00 0.00 ?  71  PHE A HB3  1  
ATOM 1108   H HD1  . PHE A 1 71  ? 16.075  6.948   153.093 1.00 0.00 ?  71  PHE A HD1  1  
ATOM 1109   H HD2  . PHE A 1 71  ? 14.192  3.137   153.055 1.00 0.00 ?  71  PHE A HD2  1  
ATOM 1110   H HE1  . PHE A 1 71  ? 15.819  7.102   150.665 1.00 0.00 ?  71  PHE A HE1  1  
ATOM 1111   H HE2  . PHE A 1 71  ? 13.930  3.300   150.620 1.00 0.00 ?  71  PHE A HE2  1  
ATOM 1112   H HZ   . PHE A 1 71  ? 14.757  5.281   149.427 1.00 0.00 ?  71  PHE A HZ   1  
ATOM 1113   N N    . VAL A 1 72  ? 18.283  4.948   153.913 1.00 0.00 ?  72  VAL A N    1  
ATOM 1114   C CA   . VAL A 1 72  ? 19.240  5.074   152.849 1.00 0.00 ?  72  VAL A CA   1  
ATOM 1115   C C    . VAL A 1 72  ? 20.175  3.900   152.851 1.00 0.00 ?  72  VAL A C    1  
ATOM 1116   O O    . VAL A 1 72  ? 20.454  3.327   151.800 1.00 0.00 ?  72  VAL A O    1  
ATOM 1117   C CB   . VAL A 1 72  ? 20.077  6.313   152.962 1.00 0.00 ?  72  VAL A CB   1  
ATOM 1118   C CG1  . VAL A 1 72  ? 21.204  6.232   151.917 1.00 0.00 ?  72  VAL A CG1  1  
ATOM 1119   C CG2  . VAL A 1 72  ? 19.164  7.534   152.760 1.00 0.00 ?  72  VAL A CG2  1  
ATOM 1120   H H    . VAL A 1 72  ? 18.291  5.660   154.611 1.00 0.00 ?  72  VAL A H    1  
ATOM 1121   H HA   . VAL A 1 72  ? 18.691  5.082   151.920 1.00 0.00 ?  72  VAL A HA   1  
ATOM 1122   H HB   . VAL A 1 72  ? 20.530  6.372   153.974 1.00 0.00 ?  72  VAL A HB   1  
ATOM 1123   H HG11 . VAL A 1 72  ? 22.074  5.679   152.330 1.00 0.00 ?  72  VAL A HG11 1  
ATOM 1124   H HG12 . VAL A 1 72  ? 21.536  7.252   151.628 1.00 0.00 ?  72  VAL A HG12 1  
ATOM 1125   H HG13 . VAL A 1 72  ? 20.848  5.704   151.006 1.00 0.00 ?  72  VAL A HG13 1  
ATOM 1126   H HG21 . VAL A 1 72  ? 19.699  8.328   152.197 1.00 0.00 ?  72  VAL A HG21 1  
ATOM 1127   H HG22 . VAL A 1 72  ? 18.849  7.947   153.743 1.00 0.00 ?  72  VAL A HG22 1  
ATOM 1128   H HG23 . VAL A 1 72  ? 18.254  7.246   152.190 1.00 0.00 ?  72  VAL A HG23 1  
ATOM 1129   N N    . VAL A 1 73  ? 20.686  3.518   154.037 1.00 0.00 ?  73  VAL A N    1  
ATOM 1130   C CA   . VAL A 1 73  ? 21.632  2.433   154.109 1.00 0.00 ?  73  VAL A CA   1  
ATOM 1131   C C    . VAL A 1 73  ? 21.000  1.142   153.666 1.00 0.00 ?  73  VAL A C    1  
ATOM 1132   O O    . VAL A 1 73  ? 21.588  0.396   152.891 1.00 0.00 ?  73  VAL A O    1  
ATOM 1133   C CB   . VAL A 1 73  ? 22.164  2.217   155.495 1.00 0.00 ?  73  VAL A CB   1  
ATOM 1134   C CG1  . VAL A 1 73  ? 22.984  0.915   155.501 1.00 0.00 ?  73  VAL A CG1  1  
ATOM 1135   C CG2  . VAL A 1 73  ? 22.998  3.448   155.889 1.00 0.00 ?  73  VAL A CG2  1  
ATOM 1136   H H    . VAL A 1 73  ? 20.427  3.946   154.900 1.00 0.00 ?  73  VAL A H    1  
ATOM 1137   H HA   . VAL A 1 73  ? 22.442  2.671   153.438 1.00 0.00 ?  73  VAL A HA   1  
ATOM 1138   H HB   . VAL A 1 73  ? 21.321  2.114   156.211 1.00 0.00 ?  73  VAL A HB   1  
ATOM 1139   H HG11 . VAL A 1 73  ? 22.322  0.042   155.686 1.00 0.00 ?  73  VAL A HG11 1  
ATOM 1140   H HG12 . VAL A 1 73  ? 23.756  0.949   156.299 1.00 0.00 ?  73  VAL A HG12 1  
ATOM 1141   H HG13 . VAL A 1 73  ? 23.491  0.774   154.523 1.00 0.00 ?  73  VAL A HG13 1  
ATOM 1142   H HG21 . VAL A 1 73  ? 23.046  4.168   155.045 1.00 0.00 ?  73  VAL A HG21 1  
ATOM 1143   H HG22 . VAL A 1 73  ? 24.033  3.143   156.154 1.00 0.00 ?  73  VAL A HG22 1  
ATOM 1144   H HG23 . VAL A 1 73  ? 22.544  3.957   156.766 1.00 0.00 ?  73  VAL A HG23 1  
ATOM 1145   N N    . ASN A 1 74  ? 19.788  0.848   154.162 1.00 0.00 ?  74  ASN A N    1  
ATOM 1146   C CA   . ASN A 1 74  ? 19.144  -0.398  153.834 1.00 0.00 ?  74  ASN A CA   1  
ATOM 1147   C C    . ASN A 1 74  ? 18.837  -0.448  152.372 1.00 0.00 ?  74  ASN A C    1  
ATOM 1148   O O    . ASN A 1 74  ? 18.969  -1.491  151.733 1.00 0.00 ?  74  ASN A O    1  
ATOM 1149   C CB   . ASN A 1 74  ? 17.823  -0.607  154.592 1.00 0.00 ?  74  ASN A CB   1  
ATOM 1150   C CG   . ASN A 1 74  ? 18.055  -0.892  156.068 1.00 0.00 ?  74  ASN A CG   1  
ATOM 1151   O OD1  . ASN A 1 74  ? 19.144  -1.298  156.472 1.00 0.00 ?  74  ASN A OD1  1  
ATOM 1152   N ND2  . ASN A 1 74  ? 17.003  -0.673  156.902 1.00 0.00 ?  74  ASN A ND2  1  
ATOM 1153   H H    . ASN A 1 74  ? 19.282  1.472   154.741 1.00 0.00 ?  74  ASN A H    1  
ATOM 1154   H HA   . ASN A 1 74  ? 19.834  -1.191  154.074 1.00 0.00 ?  74  ASN A HA   1  
ATOM 1155   H HB2  . ASN A 1 74  ? 17.194  0.304   154.496 1.00 0.00 ?  74  ASN A HB2  1  
ATOM 1156   H HB3  . ASN A 1 74  ? 17.272  -1.462  154.145 1.00 0.00 ?  74  ASN A HB3  1  
ATOM 1157   H HD21 . ASN A 1 74  ? 16.134  -0.342  156.534 1.00 0.00 ?  74  ASN A HD21 1  
ATOM 1158   H HD22 . ASN A 1 74  ? 17.099  -0.843  157.883 1.00 0.00 ?  74  ASN A HD22 1  
ATOM 1159   N N    . ASN A 1 75  ? 18.399  0.684   151.813 1.00 0.00 ?  75  ASN A N    1  
ATOM 1160   C CA   . ASN A 1 75  ? 18.032  0.711   150.432 1.00 0.00 ?  75  ASN A CA   1  
ATOM 1161   C C    . ASN A 1 75  ? 19.237  0.475   149.571 1.00 0.00 ?  75  ASN A C    1  
ATOM 1162   O O    . ASN A 1 75  ? 19.148  -0.214  148.555 1.00 0.00 ?  75  ASN A O    1  
ATOM 1163   C CB   . ASN A 1 75  ? 17.392  2.028   149.997 1.00 0.00 ?  75  ASN A CB   1  
ATOM 1164   C CG   . ASN A 1 75  ? 16.801  1.897   148.611 1.00 0.00 ?  75  ASN A CG   1  
ATOM 1165   O OD1  . ASN A 1 75  ? 17.496  2.010   147.607 1.00 0.00 ?  75  ASN A OD1  1  
ATOM 1166   N ND2  . ASN A 1 75  ? 15.477  1.615   148.557 1.00 0.00 ?  75  ASN A ND2  1  
ATOM 1167   H H    . ASN A 1 75  ? 18.311  1.534   152.315 1.00 0.00 ?  75  ASN A H    1  
ATOM 1168   H HA   . ASN A 1 75  ? 17.336  -0.098  150.277 1.00 0.00 ?  75  ASN A HA   1  
ATOM 1169   H HB2  . ASN A 1 75  ? 16.587  2.305   150.712 1.00 0.00 ?  75  ASN A HB2  1  
ATOM 1170   H HB3  . ASN A 1 75  ? 18.155  2.834   149.991 1.00 0.00 ?  75  ASN A HB3  1  
ATOM 1171   H HD21 . ASN A 1 75  ? 14.955  1.507   149.403 1.00 0.00 ?  75  ASN A HD21 1  
ATOM 1172   H HD22 . ASN A 1 75  ? 15.021  1.509   147.671 1.00 0.00 ?  75  ASN A HD22 1  
ATOM 1173   N N    . THR A 1 76  ? 20.397  1.054   149.940 1.00 0.00 ?  76  THR A N    1  
ATOM 1174   C CA   . THR A 1 76  ? 21.567  0.894   149.116 1.00 0.00 ?  76  THR A CA   1  
ATOM 1175   C C    . THR A 1 76  ? 22.008  -0.536  149.159 1.00 0.00 ?  76  THR A C    1  
ATOM 1176   O O    . THR A 1 76  ? 22.567  -1.032  148.181 1.00 0.00 ?  76  THR A O    1  
ATOM 1177   C CB   . THR A 1 76  ? 22.729  1.749   149.537 1.00 0.00 ?  76  THR A CB   1  
ATOM 1178   O OG1  . THR A 1 76  ? 23.117  1.434   150.866 1.00 0.00 ?  76  THR A OG1  1  
ATOM 1179   C CG2  . THR A 1 76  ? 22.313  3.225   149.440 1.00 0.00 ?  76  THR A CG2  1  
ATOM 1180   H H    . THR A 1 76  ? 20.491  1.611   150.761 1.00 0.00 ?  76  THR A H    1  
ATOM 1181   H HA   . THR A 1 76  ? 21.278  1.137   148.105 1.00 0.00 ?  76  THR A HA   1  
ATOM 1182   H HB   . THR A 1 76  ? 23.592  1.579   148.862 1.00 0.00 ?  76  THR A HB   1  
ATOM 1183   H HG1  . THR A 1 76  ? 24.007  1.777   150.970 1.00 0.00 ?  76  THR A HG1  1  
ATOM 1184   H HG21 . THR A 1 76  ? 22.942  3.755   148.692 1.00 0.00 ?  76  THR A HG21 1  
ATOM 1185   H HG22 . THR A 1 76  ? 22.437  3.726   150.424 1.00 0.00 ?  76  THR A HG22 1  
ATOM 1186   H HG23 . THR A 1 76  ? 21.250  3.308   149.130 1.00 0.00 ?  76  THR A HG23 1  
ATOM 1187   N N    . LEU A 1 77  ? 21.793  -1.228  150.299 1.00 0.00 ?  77  LEU A N    1  
ATOM 1188   C CA   . LEU A 1 77  ? 22.188  -2.614  150.385 1.00 0.00 ?  77  LEU A CA   1  
ATOM 1189   C C    . LEU A 1 77  ? 21.386  -3.382  149.381 1.00 0.00 ?  77  LEU A C    1  
ATOM 1190   O O    . LEU A 1 77  ? 21.892  -4.301  148.738 1.00 0.00 ?  77  LEU A O    1  
ATOM 1191   C CB   . LEU A 1 77  ? 21.959  -3.249  151.769 1.00 0.00 ?  77  LEU A CB   1  
ATOM 1192   C CG   . LEU A 1 77  ? 22.923  -2.707  152.839 1.00 0.00 ?  77  LEU A CG   1  
ATOM 1193   C CD1  . LEU A 1 77  ? 22.520  -3.176  154.247 1.00 0.00 ?  77  LEU A CD1  1  
ATOM 1194   C CD2  . LEU A 1 77  ? 24.380  -3.086  152.523 1.00 0.00 ?  77  LEU A CD2  1  
ATOM 1195   H H    . LEU A 1 77  ? 21.386  -0.821  151.114 1.00 0.00 ?  77  LEU A H    1  
ATOM 1196   H HA   . LEU A 1 77  ? 23.232  -2.669  150.116 1.00 0.00 ?  77  LEU A HA   1  
ATOM 1197   H HB2  . LEU A 1 77  ? 20.911  -3.052  152.088 1.00 0.00 ?  77  LEU A HB2  1  
ATOM 1198   H HB3  . LEU A 1 77  ? 22.095  -4.347  151.691 1.00 0.00 ?  77  LEU A HB3  1  
ATOM 1199   H HG   . LEU A 1 77  ? 22.856  -1.601  152.822 1.00 0.00 ?  77  LEU A HG   1  
ATOM 1200   H HD11 . LEU A 1 77  ? 23.364  -3.036  154.956 1.00 0.00 ?  77  LEU A HD11 1  
ATOM 1201   H HD12 . LEU A 1 77  ? 22.243  -4.251  154.231 1.00 0.00 ?  77  LEU A HD12 1  
ATOM 1202   H HD13 . LEU A 1 77  ? 21.649  -2.591  154.613 1.00 0.00 ?  77  LEU A HD13 1  
ATOM 1203   H HD21 . LEU A 1 77  ? 24.778  -2.444  151.709 1.00 0.00 ?  77  LEU A HD21 1  
ATOM 1204   H HD22 . LEU A 1 77  ? 24.441  -4.148  152.201 1.00 0.00 ?  77  LEU A HD22 1  
ATOM 1205   H HD23 . LEU A 1 77  ? 25.017  -2.951  153.424 1.00 0.00 ?  77  LEU A HD23 1  
ATOM 1206   N N    . PHE A 1 78  ? 20.096  -3.024  149.247 1.00 0.00 ?  78  PHE A N    1  
ATOM 1207   C CA   . PHE A 1 78  ? 19.241  -3.687  148.298 1.00 0.00 ?  78  PHE A CA   1  
ATOM 1208   C C    . PHE A 1 78  ? 19.782  -3.466  146.918 1.00 0.00 ?  78  PHE A C    1  
ATOM 1209   O O    . PHE A 1 78  ? 19.765  -4.372  146.091 1.00 0.00 ?  78  PHE A O    1  
ATOM 1210   C CB   . PHE A 1 78  ? 17.793  -3.194  148.286 1.00 0.00 ?  78  PHE A CB   1  
ATOM 1211   C CG   . PHE A 1 78  ? 16.957  -3.942  147.306 1.00 0.00 ?  78  PHE A CG   1  
ATOM 1212   C CD1  . PHE A 1 78  ? 16.739  -3.440  146.044 1.00 0.00 ?  78  PHE A CD1  1  
ATOM 1213   C CD2  . PHE A 1 78  ? 16.400  -5.149  147.648 1.00 0.00 ?  78  PHE A CD2  1  
ATOM 1214   C CE1  . PHE A 1 78  ? 15.975  -4.132  145.138 1.00 0.00 ?  78  PHE A CE1  1  
ATOM 1215   C CE2  . PHE A 1 78  ? 15.636  -5.841  146.742 1.00 0.00 ?  78  PHE A CE2  1  
ATOM 1216   C CZ   . PHE A 1 78  ? 15.423  -5.335  145.488 1.00 0.00 ?  78  PHE A CZ   1  
ATOM 1217   H H    . PHE A 1 78  ? 19.676  -2.304  149.799 1.00 0.00 ?  78  PHE A H    1  
ATOM 1218   H HA   . PHE A 1 78  ? 19.272  -4.743  148.521 1.00 0.00 ?  78  PHE A HA   1  
ATOM 1219   H HB2  . PHE A 1 78  ? 17.334  -3.326  149.288 1.00 0.00 ?  78  PHE A HB2  1  
ATOM 1220   H HB3  . PHE A 1 78  ? 17.756  -2.119  148.008 1.00 0.00 ?  78  PHE A HB3  1  
ATOM 1221   H HD1  . PHE A 1 78  ? 17.173  -2.492  145.763 1.00 0.00 ?  78  PHE A HD1  1  
ATOM 1222   H HD2  . PHE A 1 78  ? 16.564  -5.556  148.635 1.00 0.00 ?  78  PHE A HD2  1  
ATOM 1223   H HE1  . PHE A 1 78  ? 15.810  -3.730  144.152 1.00 0.00 ?  78  PHE A HE1  1  
ATOM 1224   H HE2  . PHE A 1 78  ? 15.202  -6.788  147.019 1.00 0.00 ?  78  PHE A HE2  1  
ATOM 1225   H HZ   . PHE A 1 78  ? 14.821  -5.882  144.777 1.00 0.00 ?  78  PHE A HZ   1  
ATOM 1226   N N    . ALA A 1 79  ? 20.213  -2.220  146.631 1.00 0.00 ?  79  ALA A N    1  
ATOM 1227   C CA   . ALA A 1 79  ? 20.715  -1.885  145.319 1.00 0.00 ?  79  ALA A CA   1  
ATOM 1228   C C    . ALA A 1 79  ? 21.894  -2.756  145.008 1.00 0.00 ?  79  ALA A C    1  
ATOM 1229   O O    . ALA A 1 79  ? 22.083  -3.162  143.862 1.00 0.00 ?  79  ALA A O    1  
ATOM 1230   C CB   . ALA A 1 79  ? 21.171  -0.422  145.203 1.00 0.00 ?  79  ALA A CB   1  
ATOM 1231   H H    . ALA A 1 79  ? 20.191  -1.482  147.300 1.00 0.00 ?  79  ALA A H    1  
ATOM 1232   H HA   . ALA A 1 79  ? 19.928  -2.086  144.609 1.00 0.00 ?  79  ALA A HA   1  
ATOM 1233   H HB1  . ALA A 1 79  ? 22.268  -0.346  145.364 1.00 0.00 ?  79  ALA A HB1  1  
ATOM 1234   H HB2  . ALA A 1 79  ? 20.658  0.204   145.963 1.00 0.00 ?  79  ALA A HB2  1  
ATOM 1235   H HB3  . ALA A 1 79  ? 20.933  -0.022  144.194 1.00 0.00 ?  79  ALA A HB3  1  
ATOM 1236   N N    . LEU A 1 80  ? 22.740  -3.028  146.014 1.00 0.00 ?  80  LEU A N    1  
ATOM 1237   C CA   . LEU A 1 80  ? 23.889  -3.864  145.789 1.00 0.00 ?  80  LEU A CA   1  
ATOM 1238   C C    . LEU A 1 80  ? 23.407  -5.233  145.387 1.00 0.00 ?  80  LEU A C    1  
ATOM 1239   O O    . LEU A 1 80  ? 24.004  -5.882  144.528 1.00 0.00 ?  80  LEU A O    1  
ATOM 1240   C CB   . LEU A 1 80  ? 24.781  -4.022  147.033 1.00 0.00 ?  80  LEU A CB   1  
ATOM 1241   C CG   . LEU A 1 80  ? 25.518  -2.723  147.402 1.00 0.00 ?  80  LEU A CG   1  
ATOM 1242   C CD1  . LEU A 1 80  ? 26.219  -2.845  148.765 1.00 0.00 ?  80  LEU A CD1  1  
ATOM 1243   C CD2  . LEU A 1 80  ? 26.509  -2.308  146.301 1.00 0.00 ?  80  LEU A CD2  1  
ATOM 1244   H H    . LEU A 1 80  ? 22.624  -2.655  146.930 1.00 0.00 ?  80  LEU A H    1  
ATOM 1245   H HA   . LEU A 1 80  ? 24.451  -3.434  144.975 1.00 0.00 ?  80  LEU A HA   1  
ATOM 1246   H HB2  . LEU A 1 80  ? 24.151  -4.342  147.892 1.00 0.00 ?  80  LEU A HB2  1  
ATOM 1247   H HB3  . LEU A 1 80  ? 25.533  -4.815  146.843 1.00 0.00 ?  80  LEU A HB3  1  
ATOM 1248   H HG   . LEU A 1 80  ? 24.756  -1.919  147.488 1.00 0.00 ?  80  LEU A HG   1  
ATOM 1249   H HD11 . LEU A 1 80  ? 26.973  -3.661  148.740 1.00 0.00 ?  80  LEU A HD11 1  
ATOM 1250   H HD12 . LEU A 1 80  ? 25.478  -3.070  149.561 1.00 0.00 ?  80  LEU A HD12 1  
ATOM 1251   H HD13 . LEU A 1 80  ? 26.735  -1.894  149.020 1.00 0.00 ?  80  LEU A HD13 1  
ATOM 1252   H HD21 . LEU A 1 80  ? 26.819  -3.194  145.707 1.00 0.00 ?  80  LEU A HD21 1  
ATOM 1253   H HD22 . LEU A 1 80  ? 27.414  -1.848  146.750 1.00 0.00 ?  80  LEU A HD22 1  
ATOM 1254   H HD23 . LEU A 1 80  ? 26.039  -1.570  145.617 1.00 0.00 ?  80  LEU A HD23 1  
ATOM 1255   N N    . LEU A 1 81  ? 22.313  -5.708  146.020 1.00 0.00 ?  81  LEU A N    1  
ATOM 1256   C CA   . LEU A 1 81  ? 21.781  -7.016  145.702 1.00 0.00 ?  81  LEU A CA   1  
ATOM 1257   C C    . LEU A 1 81  ? 21.307  -7.016  144.272 1.00 0.00 ?  81  LEU A C    1  
ATOM 1258   O O    . LEU A 1 81  ? 21.351  -8.035  143.601 1.00 0.00 ?  81  LEU A O    1  
ATOM 1259   C CB   . LEU A 1 81  ? 20.612  -7.457  146.600 1.00 0.00 ?  81  LEU A CB   1  
ATOM 1260   C CG   . LEU A 1 81  ? 21.046  -7.725  148.052 1.00 0.00 ?  81  LEU A CG   1  
ATOM 1261   C CD1  . LEU A 1 81  ? 19.831  -7.954  148.965 1.00 0.00 ?  81  LEU A CD1  1  
ATOM 1262   C CD2  . LEU A 1 81  ? 22.034  -8.902  148.136 1.00 0.00 ?  81  LEU A CD2  1  
ATOM 1263   H H    . LEU A 1 81  ? 21.841  -5.196  146.735 1.00 0.00 ?  81  LEU A H    1  
ATOM 1264   H HA   . LEU A 1 81  ? 22.598  -7.716  145.790 1.00 0.00 ?  81  LEU A HA   1  
ATOM 1265   H HB2  . LEU A 1 81  ? 19.824  -6.677  146.591 1.00 0.00 ?  81  LEU A HB2  1  
ATOM 1266   H HB3  . LEU A 1 81  ? 20.178  -8.390  146.187 1.00 0.00 ?  81  LEU A HB3  1  
ATOM 1267   H HG   . LEU A 1 81  ? 21.573  -6.818  148.417 1.00 0.00 ?  81  LEU A HG   1  
ATOM 1268   H HD11 . LEU A 1 81  ? 19.062  -7.173  148.787 1.00 0.00 ?  81  LEU A HD11 1  
ATOM 1269   H HD12 . LEU A 1 81  ? 20.138  -7.914  150.033 1.00 0.00 ?  81  LEU A HD12 1  
ATOM 1270   H HD13 . LEU A 1 81  ? 19.379  -8.949  148.764 1.00 0.00 ?  81  LEU A HD13 1  
ATOM 1271   H HD21 . LEU A 1 81  ? 21.803  -9.538  149.017 1.00 0.00 ?  81  LEU A HD21 1  
ATOM 1272   H HD22 . LEU A 1 81  ? 23.075  -8.526  148.234 1.00 0.00 ?  81  LEU A HD22 1  
ATOM 1273   H HD23 . LEU A 1 81  ? 21.969  -9.528  147.220 1.00 0.00 ?  81  LEU A HD23 1  
ATOM 1274   N N    . TYR A 1 82  ? 20.748  -5.889  143.808 1.00 0.00 ?  82  TYR A N    1  
ATOM 1275   C CA   . TYR A 1 82  ? 20.279  -5.786  142.440 1.00 0.00 ?  82  TYR A CA   1  
ATOM 1276   C C    . TYR A 1 82  ? 21.424  -6.043  141.486 1.00 0.00 ?  82  TYR A C    1  
ATOM 1277   O O    . TYR A 1 82  ? 21.236  -6.610  140.410 1.00 0.00 ?  82  TYR A O    1  
ATOM 1278   C CB   . TYR A 1 82  ? 19.677  -4.403  142.137 1.00 0.00 ?  82  TYR A CB   1  
ATOM 1279   C CG   . TYR A 1 82  ? 20.037  -3.846  140.803 1.00 0.00 ?  82  TYR A CG   1  
ATOM 1280   C CD1  . TYR A 1 82  ? 20.978  -2.841  140.708 1.00 0.00 ?  82  TYR A CD1  1  
ATOM 1281   C CD2  . TYR A 1 82  ? 19.435  -4.306  139.656 1.00 0.00 ?  82  TYR A CD2  1  
ATOM 1282   C CE1  . TYR A 1 82  ? 21.305  -2.305  139.487 1.00 0.00 ?  82  TYR A CE1  1  
ATOM 1283   C CE2  . TYR A 1 82  ? 19.771  -3.768  138.436 1.00 0.00 ?  82  TYR A CE2  1  
ATOM 1284   C CZ   . TYR A 1 82  ? 20.699  -2.772  138.352 1.00 0.00 ?  82  TYR A CZ   1  
ATOM 1285   O OH   . TYR A 1 82  ? 21.017  -2.223  137.094 1.00 0.00 ?  82  TYR A OH   1  
ATOM 1286   H H    . TYR A 1 82  ? 20.609  -5.090  144.385 1.00 0.00 ?  82  TYR A H    1  
ATOM 1287   H HA   . TYR A 1 82  ? 19.531  -6.552  142.299 1.00 0.00 ?  82  TYR A HA   1  
ATOM 1288   H HB2  . TYR A 1 82  ? 18.569  -4.467  142.167 1.00 0.00 ?  82  TYR A HB2  1  
ATOM 1289   H HB3  . TYR A 1 82  ? 20.002  -3.672  142.903 1.00 0.00 ?  82  TYR A HB3  1  
ATOM 1290   H HD1  . TYR A 1 82  ? 21.457  -2.471  141.602 1.00 0.00 ?  82  TYR A HD1  1  
ATOM 1291   H HD2  . TYR A 1 82  ? 18.698  -5.094  139.713 1.00 0.00 ?  82  TYR A HD2  1  
ATOM 1292   H HE1  . TYR A 1 82  ? 22.043  -1.520  139.421 1.00 0.00 ?  82  TYR A HE1  1  
ATOM 1293   H HE2  . TYR A 1 82  ? 19.304  -4.128  137.542 1.00 0.00 ?  82  TYR A HE2  1  
ATOM 1294   H HH   . TYR A 1 82  ? 20.208  -2.209  136.568 1.00 0.00 ?  82  TYR A HH   1  
ATOM 1295   N N    . GLN A 1 83  ? 22.633  -5.625  141.881 1.00 0.00 ?  83  GLN A N    1  
ATOM 1296   C CA   . GLN A 1 83  ? 23.812  -5.771  141.055 1.00 0.00 ?  83  GLN A CA   1  
ATOM 1297   C C    . GLN A 1 83  ? 24.425  -7.142  141.237 1.00 0.00 ?  83  GLN A C    1  
ATOM 1298   O O    . GLN A 1 83  ? 25.473  -7.410  140.651 1.00 0.00 ?  83  GLN A O    1  
ATOM 1299   C CB   . GLN A 1 83  ? 24.906  -4.742  141.380 1.00 0.00 ?  83  GLN A CB   1  
ATOM 1300   C CG   . GLN A 1 83  ? 24.516  -3.319  140.976 1.00 0.00 ?  83  GLN A CG   1  
ATOM 1301   C CD   . GLN A 1 83  ? 25.567  -2.364  141.522 1.00 0.00 ?  83  GLN A CD   1  
ATOM 1302   O OE1  . GLN A 1 83  ? 26.179  -2.618  142.558 1.00 0.00 ?  83  GLN A OE1  1  
ATOM 1303   N NE2  . GLN A 1 83  ? 25.788  -1.232  140.802 1.00 0.00 ?  83  GLN A NE2  1  
ATOM 1304   H H    . GLN A 1 83  ? 22.772  -5.183  142.764 1.00 0.00 ?  83  GLN A H    1  
ATOM 1305   H HA   . GLN A 1 83  ? 23.500  -5.662  140.029 1.00 0.00 ?  83  GLN A HA   1  
ATOM 1306   H HB2  . GLN A 1 83  ? 25.112  -4.768  142.472 1.00 0.00 ?  83  GLN A HB2  1  
ATOM 1307   H HB3  . GLN A 1 83  ? 25.839  -5.025  140.848 1.00 0.00 ?  83  GLN A HB3  1  
ATOM 1308   H HG2  . GLN A 1 83  ? 24.471  -3.236  139.868 1.00 0.00 ?  83  GLN A HG2  1  
ATOM 1309   H HG3  . GLN A 1 83  ? 23.525  -3.056  141.402 1.00 0.00 ?  83  GLN A HG3  1  
ATOM 1310   H HE21 . GLN A 1 83  ? 25.271  -1.064  139.964 1.00 0.00 ?  83  GLN A HE21 1  
ATOM 1311   H HE22 . GLN A 1 83  ? 26.468  -0.568  141.113 1.00 0.00 ?  83  GLN A HE22 1  
ATOM 1312   N N    . LEU A 1 84  ? 23.795  -8.022  142.067 1.00 0.00 ?  84  LEU A N    1  
ATOM 1313   C CA   . LEU A 1 84  ? 24.368  -9.333  142.409 1.00 0.00 ?  84  LEU A CA   1  
ATOM 1314   C C    . LEU A 1 84  ? 24.833  -10.132 141.212 1.00 0.00 ?  84  LEU A C    1  
ATOM 1315   O O    . LEU A 1 84  ? 25.879  -10.757 141.317 1.00 0.00 ?  84  LEU A O    1  
ATOM 1316   C CB   . LEU A 1 84  ? 23.407  -10.241 143.209 1.00 0.00 ?  84  LEU A CB   1  
ATOM 1317   C CG   . LEU A 1 84  ? 24.094  -11.490 143.791 1.00 0.00 ?  84  LEU A CG   1  
ATOM 1318   C CD1  . LEU A 1 84  ? 23.641  -11.758 145.236 1.00 0.00 ?  84  LEU A CD1  1  
ATOM 1319   C CD2  . LEU A 1 84  ? 23.864  -12.723 142.899 1.00 0.00 ?  84  LEU A CD2  1  
ATOM 1320   H H    . LEU A 1 84  ? 22.922  -7.805  142.497 1.00 0.00 ?  84  LEU A H    1  
ATOM 1321   H HA   . LEU A 1 84  ? 25.232  -9.127  143.019 1.00 0.00 ?  84  LEU A HA   1  
ATOM 1322   H HB2  . LEU A 1 84  ? 22.976  -9.656  144.046 1.00 0.00 ?  84  LEU A HB2  1  
ATOM 1323   H HB3  . LEU A 1 84  ? 22.577  -10.566 142.548 1.00 0.00 ?  84  LEU A HB3  1  
ATOM 1324   H HG   . LEU A 1 84  ? 25.188  -11.292 143.813 1.00 0.00 ?  84  LEU A HG   1  
ATOM 1325   H HD11 . LEU A 1 84  ? 24.345  -12.455 145.739 1.00 0.00 ?  84  LEU A HD11 1  
ATOM 1326   H HD12 . LEU A 1 84  ? 22.627  -12.211 145.244 1.00 0.00 ?  84  LEU A HD12 1  
ATOM 1327   H HD13 . LEU A 1 84  ? 23.609  -10.809 145.811 1.00 0.00 ?  84  LEU A HD13 1  
ATOM 1328   H HD21 . LEU A 1 84  ? 24.821  -13.262 142.730 1.00 0.00 ?  84  LEU A HD21 1  
ATOM 1329   H HD22 . LEU A 1 84  ? 23.452  -12.415 141.915 1.00 0.00 ?  84  LEU A HD22 1  
ATOM 1330   H HD23 . LEU A 1 84  ? 23.146  -13.420 143.382 1.00 0.00 ?  84  LEU A HD23 1  
ATOM 1331   N N    . GLY A 1 85  ? 24.150  -10.131 140.049 1.00 0.00 ?  85  GLY A N    1  
ATOM 1332   C CA   . GLY A 1 85  ? 24.672  -10.920 138.938 1.00 0.00 ?  85  GLY A CA   1  
ATOM 1333   C C    . GLY A 1 85  ? 23.607  -11.778 138.352 1.00 0.00 ?  85  GLY A C    1  
ATOM 1334   O O    . GLY A 1 85  ? 23.870  -12.570 137.454 1.00 0.00 ?  85  GLY A O    1  
ATOM 1335   H H    . GLY A 1 85  ? 23.306  -9.621  139.901 1.00 0.00 ?  85  GLY A H    1  
ATOM 1336   H HA2  . GLY A 1 85  ? 24.999  -10.225 138.183 1.00 0.00 ?  85  GLY A HA2  1  
ATOM 1337   H HA3  . GLY A 1 85  ? 25.457  -11.559 139.310 1.00 0.00 ?  85  GLY A HA3  1  
ATOM 1338   N N    . ASP A 1 86  ? 22.379  -11.648 138.850 1.00 0.00 ?  86  ASP A N    1  
ATOM 1339   C CA   . ASP A 1 86  ? 21.281  -12.342 138.254 1.00 0.00 ?  86  ASP A CA   1  
ATOM 1340   C C    . ASP A 1 86  ? 20.915  -11.436 137.125 1.00 0.00 ?  86  ASP A C    1  
ATOM 1341   O O    . ASP A 1 86  ? 21.567  -10.405 136.956 1.00 0.00 ?  86  ASP A O    1  
ATOM 1342   C CB   . ASP A 1 86  ? 20.055  -12.503 139.161 1.00 0.00 ?  86  ASP A CB   1  
ATOM 1343   C CG   . ASP A 1 86  ? 19.363  -11.175 139.428 1.00 0.00 ?  86  ASP A CG   1  
ATOM 1344   O OD1  . ASP A 1 86  ? 18.105  -11.158 139.427 1.00 0.00 ?  86  ASP A OD1  1  
ATOM 1345   O OD2  . ASP A 1 86  ? 20.082  -10.163 139.648 1.00 0.00 -1 86  ASP A OD2  1  
ATOM 1346   H H    . ASP A 1 86  ? 22.175  -11.078 139.642 1.00 0.00 ?  86  ASP A H    1  
ATOM 1347   H HA   . ASP A 1 86  ? 21.628  -13.291 137.874 1.00 0.00 ?  86  ASP A HA   1  
ATOM 1348   H HB2  . ASP A 1 86  ? 19.335  -13.191 138.676 1.00 0.00 ?  86  ASP A HB2  1  
ATOM 1349   H HB3  . ASP A 1 86  ? 20.368  -12.946 140.131 1.00 0.00 ?  86  ASP A HB3  1  
ATOM 1350   N N    . ALA A 1 87  ? 19.956  -11.807 136.253 1.00 0.00 ?  87  ALA A N    1  
ATOM 1351   C CA   . ALA A 1 87  ? 19.613  -10.887 135.201 1.00 0.00 ?  87  ALA A CA   1  
ATOM 1352   C C    . ALA A 1 87  ? 19.167  -9.627  135.933 1.00 0.00 ?  87  ALA A C    1  
ATOM 1353   O O    . ALA A 1 87  ? 18.302  -9.695  136.802 1.00 0.00 ?  87  ALA A O    1  
ATOM 1354   C CB   . ALA A 1 87  ? 18.453  -11.367 134.314 1.00 0.00 ?  87  ALA A CB   1  
ATOM 1355   H H    . ALA A 1 87  ? 19.470  -12.677 136.293 1.00 0.00 ?  87  ALA A H    1  
ATOM 1356   H HA   . ALA A 1 87  ? 20.503  -10.732 134.622 1.00 0.00 ?  87  ALA A HA   1  
ATOM 1357   H HB1  . ALA A 1 87  ? 17.613  -10.641 134.352 1.00 0.00 ?  87  ALA A HB1  1  
ATOM 1358   H HB2  . ALA A 1 87  ? 18.084  -12.354 134.663 1.00 0.00 ?  87  ALA A HB2  1  
ATOM 1359   H HB3  . ALA A 1 87  ? 18.790  -11.465 133.260 1.00 0.00 ?  87  ALA A HB3  1  
ATOM 1360   N N    . PRO A 1 88  ? 19.745  -8.473  135.618 1.00 0.00 ?  88  PRO A N    1  
ATOM 1361   C CA   . PRO A 1 88  ? 19.436  -7.250  136.347 1.00 0.00 ?  88  PRO A CA   1  
ATOM 1362   C C    . PRO A 1 88  ? 18.100  -6.669  136.059 1.00 0.00 ?  88  PRO A C    1  
ATOM 1363   O O    . PRO A 1 88  ? 17.495  -6.958  135.030 1.00 0.00 ?  88  PRO A O    1  
ATOM 1364   C CB   . PRO A 1 88  ? 20.530  -6.277  135.919 1.00 0.00 ?  88  PRO A CB   1  
ATOM 1365   C CG   . PRO A 1 88  ? 20.858  -6.710  134.499 1.00 0.00 ?  88  PRO A CG   1  
ATOM 1366   C CD   . PRO A 1 88  ? 20.699  -8.229  134.520 1.00 0.00 ?  88  PRO A CD   1  
ATOM 1367   H HA   . PRO A 1 88  ? 19.518  -7.411  137.411 1.00 0.00 ?  88  PRO A HA   1  
ATOM 1368   H HB2  . PRO A 1 88  ? 20.157  -5.231  135.937 1.00 0.00 ?  88  PRO A HB2  1  
ATOM 1369   H HB3  . PRO A 1 88  ? 21.422  -6.371  136.573 1.00 0.00 ?  88  PRO A HB3  1  
ATOM 1370   H HG2  . PRO A 1 88  ? 20.152  -6.245  133.777 1.00 0.00 ?  88  PRO A HG2  1  
ATOM 1371   H HG3  . PRO A 1 88  ? 21.899  -6.429  134.236 1.00 0.00 ?  88  PRO A HG3  1  
ATOM 1372   H HD2  . PRO A 1 88  ? 20.295  -8.590  133.550 1.00 0.00 ?  88  PRO A HD2  1  
ATOM 1373   H HD3  . PRO A 1 88  ? 21.676  -8.719  134.719 1.00 0.00 ?  88  PRO A HD3  1  
ATOM 1374   N N    . ILE A 1 89  ? 17.605  -5.830  137.006 1.00 0.00 ?  89  ILE A N    1  
ATOM 1375   C CA   . ILE A 1 89  ? 16.351  -5.174  136.811 1.00 0.00 ?  89  ILE A CA   1  
ATOM 1376   C C    . ILE A 1 89  ? 16.697  -3.829  136.274 1.00 0.00 ?  89  ILE A C    1  
ATOM 1377   O O    . ILE A 1 89  ? 17.260  -2.977  136.958 1.00 0.00 ?  89  ILE A O    1  
ATOM 1378   C CB   . ILE A 1 89  ? 15.561  -4.985  138.070 1.00 0.00 ?  89  ILE A CB   1  
ATOM 1379   C CG1  . ILE A 1 89  ? 15.245  -6.348  138.707 1.00 0.00 ?  89  ILE A CG1  1  
ATOM 1380   C CG2  . ILE A 1 89  ? 14.286  -4.201  137.715 1.00 0.00 ?  89  ILE A CG2  1  
ATOM 1381   C CD1  . ILE A 1 89  ? 14.652  -6.216  140.108 1.00 0.00 ?  89  ILE A CD1  1  
ATOM 1382   H H    . ILE A 1 89  ? 18.083  -5.640  137.860 1.00 0.00 ?  89  ILE A H    1  
ATOM 1383   H HA   . ILE A 1 89  ? 15.784  -5.725  136.075 1.00 0.00 ?  89  ILE A HA   1  
ATOM 1384   H HB   . ILE A 1 89  ? 16.153  -4.385  138.794 1.00 0.00 ?  89  ILE A HB   1  
ATOM 1385   H HG12 . ILE A 1 89  ? 14.527  -6.893  138.057 1.00 0.00 ?  89  ILE A HG12 1  
ATOM 1386   H HG13 . ILE A 1 89  ? 16.178  -6.946  138.767 1.00 0.00 ?  89  ILE A HG13 1  
ATOM 1387   H HG21 . ILE A 1 89  ? 13.419  -4.595  138.286 1.00 0.00 ?  89  ILE A HG21 1  
ATOM 1388   H HG22 . ILE A 1 89  ? 14.066  -4.291  136.630 1.00 0.00 ?  89  ILE A HG22 1  
ATOM 1389   H HG23 . ILE A 1 89  ? 14.414  -3.125  137.963 1.00 0.00 ?  89  ILE A HG23 1  
ATOM 1390   H HD11 . ILE A 1 89  ? 14.008  -5.315  140.172 1.00 0.00 ?  89  ILE A HD11 1  
ATOM 1391   H HD12 . ILE A 1 89  ? 15.463  -6.127  140.863 1.00 0.00 ?  89  ILE A HD12 1  
ATOM 1392   H HD13 . ILE A 1 89  ? 14.038  -7.110  140.352 1.00 0.00 ?  89  ILE A HD13 1  
ATOM 1393   N N    . ALA A 1 90  ? 16.332  -3.640  135.008 1.00 0.00 ?  90  ALA A N    1  
ATOM 1394   C CA   . ALA A 1 90  ? 16.594  -2.434  134.287 1.00 0.00 ?  90  ALA A CA   1  
ATOM 1395   C C    . ALA A 1 90  ? 15.274  -1.917  133.849 1.00 0.00 ?  90  ALA A C    1  
ATOM 1396   O O    . ALA A 1 90  ? 14.245  -2.306  134.389 1.00 0.00 ?  90  ALA A O    1  
ATOM 1397   C CB   . ALA A 1 90  ? 17.469  -2.640  133.039 1.00 0.00 ?  90  ALA A CB   1  
ATOM 1398   H H    . ALA A 1 90  ? 15.850  -4.347  134.497 1.00 0.00 ?  90  ALA A H    1  
ATOM 1399   H HA   . ALA A 1 90  ? 17.051  -1.726  134.959 1.00 0.00 ?  90  ALA A HA   1  
ATOM 1400   H HB1  . ALA A 1 90  ? 18.415  -3.155  133.312 1.00 0.00 ?  90  ALA A HB1  1  
ATOM 1401   H HB2  . ALA A 1 90  ? 17.720  -1.661  132.577 1.00 0.00 ?  90  ALA A HB2  1  
ATOM 1402   H HB3  . ALA A 1 90  ? 16.933  -3.259  132.288 1.00 0.00 ?  90  ALA A HB3  1  
ATOM 1403   N N    . ASN A 1 91  ? 15.320  -0.931  132.929 1.00 0.00 ?  91  ASN A N    1  
ATOM 1404   C CA   . ASN A 1 91  ? 14.135  -0.349  132.348 1.00 0.00 ?  91  ASN A CA   1  
ATOM 1405   C C    . ASN A 1 91  ? 13.479  0.516   133.355 1.00 0.00 ?  91  ASN A C    1  
ATOM 1406   O O    . ASN A 1 91  ? 12.254  0.548   133.474 1.00 0.00 ?  91  ASN A O    1  
ATOM 1407   C CB   . ASN A 1 91  ? 13.102  -1.362  131.807 1.00 0.00 ?  91  ASN A CB   1  
ATOM 1408   C CG   . ASN A 1 91  ? 12.173  -0.736  130.774 1.00 0.00 ?  91  ASN A CG   1  
ATOM 1409   O OD1  . ASN A 1 91  ? 12.580  0.129   129.997 1.00 0.00 ?  91  ASN A OD1  1  
ATOM 1410   N ND2  . ASN A 1 91  ? 10.891  -1.189  130.752 1.00 0.00 ?  91  ASN A ND2  1  
ATOM 1411   H H    . ASN A 1 91  ? 16.187  -0.558  132.606 1.00 0.00 ?  91  ASN A H    1  
ATOM 1412   H HA   . ASN A 1 91  ? 14.473  0.281   131.539 1.00 0.00 ?  91  ASN A HA   1  
ATOM 1413   H HB2  . ASN A 1 91  ? 13.635  -2.217  131.338 1.00 0.00 ?  91  ASN A HB2  1  
ATOM 1414   H HB3  . ASN A 1 91  ? 12.490  -1.751  132.648 1.00 0.00 ?  91  ASN A HB3  1  
ATOM 1415   H HD21 . ASN A 1 91  ? 10.598  -1.902  131.398 1.00 0.00 ?  91  ASN A HD21 1  
ATOM 1416   H HD22 . ASN A 1 91  ? 10.239  -0.814  130.093 1.00 0.00 ?  91  ASN A HD22 1  
ATOM 1417   N N    . GLN A 1 92  ? 14.326  1.238   134.107 1.00 0.00 ?  92  GLN A N    1  
ATOM 1418   C CA   . GLN A 1 92  ? 13.863  2.187   135.065 1.00 0.00 ?  92  GLN A CA   1  
ATOM 1419   C C    . GLN A 1 92  ? 14.302  3.472   134.442 1.00 0.00 ?  92  GLN A C    1  
ATOM 1420   O O    . GLN A 1 92  ? 15.183  3.437   133.582 1.00 0.00 ?  92  GLN A O    1  
ATOM 1421   C CB   . GLN A 1 92  ? 14.508  2.046   136.458 1.00 0.00 ?  92  GLN A CB   1  
ATOM 1422   C CG   . GLN A 1 92  ? 13.802  2.884   137.530 1.00 0.00 ?  92  GLN A CG   1  
ATOM 1423   C CD   . GLN A 1 92  ? 12.376  2.390   137.673 1.00 0.00 ?  92  GLN A CD   1  
ATOM 1424   O OE1  . GLN A 1 92  ? 12.133  1.211   137.928 1.00 0.00 ?  92  GLN A OE1  1  
ATOM 1425   N NE2  . GLN A 1 92  ? 11.403  3.320   137.496 1.00 0.00 ?  92  GLN A NE2  1  
ATOM 1426   H H    . GLN A 1 92  ? 15.315  1.142   134.029 1.00 0.00 ?  92  GLN A H    1  
ATOM 1427   H HA   . GLN A 1 92  ? 12.787  2.148   135.108 1.00 0.00 ?  92  GLN A HA   1  
ATOM 1428   H HB2  . GLN A 1 92  ? 14.485  0.976   136.759 1.00 0.00 ?  92  GLN A HB2  1  
ATOM 1429   H HB3  . GLN A 1 92  ? 15.571  2.362   136.397 1.00 0.00 ?  92  GLN A HB3  1  
ATOM 1430   H HG2  . GLN A 1 92  ? 14.329  2.789   138.498 1.00 0.00 ?  92  GLN A HG2  1  
ATOM 1431   H HG3  . GLN A 1 92  ? 13.779  3.945   137.232 1.00 0.00 ?  92  GLN A HG3  1  
ATOM 1432   H HE21 . GLN A 1 92  ? 11.647  4.266   137.282 1.00 0.00 ?  92  GLN A HE21 1  
ATOM 1433   H HE22 . GLN A 1 92  ? 10.444  3.058   137.583 1.00 0.00 ?  92  GLN A HE22 1  
ATOM 1434   N N    . SER A 1 93  ? 13.683  4.624   134.809 1.00 0.00 ?  93  SER A N    1  
ATOM 1435   C CA   . SER A 1 93  ? 14.059  5.878   134.183 1.00 0.00 ?  93  SER A CA   1  
ATOM 1436   C C    . SER A 1 93  ? 15.559  6.127   134.309 1.00 0.00 ?  93  SER A C    1  
ATOM 1437   O O    . SER A 1 93  ? 16.197  6.369   133.286 1.00 0.00 ?  93  SER A O    1  
ATOM 1438   C CB   . SER A 1 93  ? 13.282  7.116   134.696 1.00 0.00 ?  93  SER A CB   1  
ATOM 1439   O OG   . SER A 1 93  ? 13.738  8.291   134.036 1.00 0.00 ?  93  SER A OG   1  
ATOM 1440   H H    . SER A 1 93  ? 12.968  4.659   135.502 1.00 0.00 ?  93  SER A H    1  
ATOM 1441   H HA   . SER A 1 93  ? 13.846  5.749   133.131 1.00 0.00 ?  93  SER A HA   1  
ATOM 1442   H HB2  . SER A 1 93  ? 12.197  6.992   134.489 1.00 0.00 ?  93  SER A HB2  1  
ATOM 1443   H HB3  . SER A 1 93  ? 13.422  7.243   135.786 1.00 0.00 ?  93  SER A HB3  1  
ATOM 1444   H HG   . SER A 1 93  ? 13.266  9.023   134.443 1.00 0.00 ?  93  SER A HG   1  
ATOM 1445   N N    . PRO A 1 94  ? 16.188  6.077   135.488 1.00 0.00 ?  94  PRO A N    1  
ATOM 1446   C CA   . PRO A 1 94  ? 17.616  6.270   135.531 1.00 0.00 ?  94  PRO A CA   1  
ATOM 1447   C C    . PRO A 1 94  ? 18.340  4.966   135.274 1.00 0.00 ?  94  PRO A C    1  
ATOM 1448   O O    . PRO A 1 94  ? 18.037  3.980   135.944 1.00 0.00 ?  94  PRO A O    1  
ATOM 1449   C CB   . PRO A 1 94  ? 17.906  6.759   136.958 1.00 0.00 ?  94  PRO A CB   1  
ATOM 1450   C CG   . PRO A 1 94  ? 16.551  6.771   137.672 1.00 0.00 ?  94  PRO A CG   1  
ATOM 1451   C CD   . PRO A 1 94  ? 15.664  5.860   136.837 1.00 0.00 ?  94  PRO A CD   1  
ATOM 1452   H HA   . PRO A 1 94  ? 17.911  7.030   134.832 1.00 0.00 ?  94  PRO A HA   1  
ATOM 1453   H HB2  . PRO A 1 94  ? 18.609  6.067   137.471 1.00 0.00 ?  94  PRO A HB2  1  
ATOM 1454   H HB3  . PRO A 1 94  ? 18.343  7.781   136.938 1.00 0.00 ?  94  PRO A HB3  1  
ATOM 1455   H HG2  . PRO A 1 94  ? 16.651  6.381   138.708 1.00 0.00 ?  94  PRO A HG2  1  
ATOM 1456   H HG3  . PRO A 1 94  ? 16.135  7.801   137.702 1.00 0.00 ?  94  PRO A HG3  1  
ATOM 1457   H HD2  . PRO A 1 94  ? 15.789  4.803   137.155 1.00 0.00 ?  94  PRO A HD2  1  
ATOM 1458   H HD3  . PRO A 1 94  ? 14.607  6.154   136.936 1.00 0.00 ?  94  PRO A HD3  1  
ATOM 1459   N N    . PRO A 1 95  ? 19.280  4.874   134.350 1.00 0.00 ?  95  PRO A N    1  
ATOM 1460   C CA   . PRO A 1 95  ? 19.974  3.623   134.133 1.00 0.00 ?  95  PRO A CA   1  
ATOM 1461   C C    . PRO A 1 95  ? 20.957  3.349   135.218 1.00 0.00 ?  95  PRO A C    1  
ATOM 1462   O O    . PRO A 1 95  ? 21.434  4.272   135.861 1.00 0.00 ?  95  PRO A O    1  
ATOM 1463   C CB   . PRO A 1 95  ? 20.691  3.815   132.800 1.00 0.00 ?  95  PRO A CB   1  
ATOM 1464   C CG   . PRO A 1 95  ? 20.970  5.310   132.760 1.00 0.00 ?  95  PRO A CG   1  
ATOM 1465   C CD   . PRO A 1 95  ? 19.764  5.940   133.456 1.00 0.00 ?  95  PRO A CD   1  
ATOM 1466   H HA   . PRO A 1 95  ? 19.283  2.796   134.058 1.00 0.00 ?  95  PRO A HA   1  
ATOM 1467   H HB2  . PRO A 1 95  ? 21.638  3.232   132.774 1.00 0.00 ?  95  PRO A HB2  1  
ATOM 1468   H HB3  . PRO A 1 95  ? 20.039  3.514   131.952 1.00 0.00 ?  95  PRO A HB3  1  
ATOM 1469   H HG2  . PRO A 1 95  ? 21.912  5.546   133.304 1.00 0.00 ?  95  PRO A HG2  1  
ATOM 1470   H HG3  . PRO A 1 95  ? 21.049  5.666   131.711 1.00 0.00 ?  95  PRO A HG3  1  
ATOM 1471   H HD2  . PRO A 1 95  ? 20.072  6.840   134.031 1.00 0.00 ?  95  PRO A HD2  1  
ATOM 1472   H HD3  . PRO A 1 95  ? 18.990  6.225   132.712 1.00 0.00 ?  95  PRO A HD3  1  
ATOM 1473   N N    . GLY A 1 96  ? 21.285  2.067   135.453 1.00 0.00 ?  96  GLY A N    1  
ATOM 1474   C CA   . GLY A 1 96  ? 22.258  1.748   136.461 1.00 0.00 ?  96  GLY A CA   1  
ATOM 1475   C C    . GLY A 1 96  ? 21.587  1.570   137.788 1.00 0.00 ?  96  GLY A C    1  
ATOM 1476   O O    . GLY A 1 96  ? 20.363  1.512   137.902 1.00 0.00 ?  96  GLY A O    1  
ATOM 1477   H H    . GLY A 1 96  ? 20.882  1.303   134.956 1.00 0.00 ?  96  GLY A H    1  
ATOM 1478   H HA2  . GLY A 1 96  ? 22.716  0.813   136.179 1.00 0.00 ?  96  GLY A HA2  1  
ATOM 1479   H HA3  . GLY A 1 96  ? 22.949  2.576   136.523 1.00 0.00 ?  96  GLY A HA3  1  
ATOM 1480   N N    . PHE A 1 97  ? 22.431  1.505   138.844 1.00 0.00 ?  97  PHE A N    1  
ATOM 1481   C CA   . PHE A 1 97  ? 21.965  1.276   140.189 1.00 0.00 ?  97  PHE A CA   1  
ATOM 1482   C C    . PHE A 1 97  ? 21.082  2.388   140.657 1.00 0.00 ?  97  PHE A C    1  
ATOM 1483   O O    . PHE A 1 97  ? 20.358  2.209   141.633 1.00 0.00 ?  97  PHE A O    1  
ATOM 1484   C CB   . PHE A 1 97  ? 23.118  1.130   141.199 1.00 0.00 ?  97  PHE A CB   1  
ATOM 1485   C CG   . PHE A 1 97  ? 23.845  2.402   141.485 1.00 0.00 ?  97  PHE A CG   1  
ATOM 1486   C CD1  . PHE A 1 97  ? 23.491  3.187   142.562 1.00 0.00 ?  97  PHE A CD1  1  
ATOM 1487   C CD2  . PHE A 1 97  ? 24.883  2.809   140.674 1.00 0.00 ?  97  PHE A CD2  1  
ATOM 1488   C CE1  . PHE A 1 97  ? 24.163  4.358   142.823 1.00 0.00 ?  97  PHE A CE1  1  
ATOM 1489   C CE2  . PHE A 1 97  ? 25.554  3.979   140.936 1.00 0.00 ?  97  PHE A CE2  1  
ATOM 1490   C CZ   . PHE A 1 97  ? 25.194  4.754   142.010 1.00 0.00 ?  97  PHE A CZ   1  
ATOM 1491   H H    . PHE A 1 97  ? 23.416  1.615   138.738 1.00 0.00 ?  97  PHE A H    1  
ATOM 1492   H HA   . PHE A 1 97  ? 21.388  0.366   140.171 1.00 0.00 ?  97  PHE A HA   1  
ATOM 1493   H HB2  . PHE A 1 97  ? 22.725  0.755   142.167 1.00 0.00 ?  97  PHE A HB2  1  
ATOM 1494   H HB3  . PHE A 1 97  ? 23.863  0.402   140.813 1.00 0.00 ?  97  PHE A HB3  1  
ATOM 1495   H HD1  . PHE A 1 97  ? 22.679  2.880   143.205 1.00 0.00 ?  97  PHE A HD1  1  
ATOM 1496   H HD2  . PHE A 1 97  ? 25.170  2.203   139.827 1.00 0.00 ?  97  PHE A HD2  1  
ATOM 1497   H HE1  . PHE A 1 97  ? 23.879  4.965   143.669 1.00 0.00 ?  97  PHE A HE1  1  
ATOM 1498   H HE2  . PHE A 1 97  ? 26.367  4.290   140.296 1.00 0.00 ?  97  PHE A HE2  1  
ATOM 1499   H HZ   . PHE A 1 97  ? 25.723  5.672   142.216 1.00 0.00 ?  97  PHE A HZ   1  
ATOM 1500   N N    . VAL A 1 98  ? 21.143  3.576   140.018 1.00 0.00 ?  98  VAL A N    1  
ATOM 1501   C CA   . VAL A 1 98  ? 20.309  4.665   140.448 1.00 0.00 ?  98  VAL A CA   1  
ATOM 1502   C C    . VAL A 1 98  ? 18.890  4.228   140.241 1.00 0.00 ?  98  VAL A C    1  
ATOM 1503   O O    . VAL A 1 98  ? 18.024  4.495   141.063 1.00 0.00 ?  98  VAL A O    1  
ATOM 1504   C CB   . VAL A 1 98  ? 20.529  5.940   139.683 1.00 0.00 ?  98  VAL A CB   1  
ATOM 1505   C CG1  . VAL A 1 98  ? 19.466  6.965   140.127 1.00 0.00 ?  98  VAL A CG1  1  
ATOM 1506   C CG2  . VAL A 1 98  ? 21.965  6.422   139.947 1.00 0.00 ?  98  VAL A CG2  1  
ATOM 1507   H H    . VAL A 1 98  ? 21.750  3.746   139.245 1.00 0.00 ?  98  VAL A H    1  
ATOM 1508   H HA   . VAL A 1 98  ? 20.484  4.816   141.503 1.00 0.00 ?  98  VAL A HA   1  
ATOM 1509   H HB   . VAL A 1 98  ? 20.411  5.751   138.595 1.00 0.00 ?  98  VAL A HB   1  
ATOM 1510   H HG11 . VAL A 1 98  ? 18.486  6.740   139.664 1.00 0.00 ?  98  VAL A HG11 1  
ATOM 1511   H HG12 . VAL A 1 98  ? 19.771  7.989   139.826 1.00 0.00 ?  98  VAL A HG12 1  
ATOM 1512   H HG13 . VAL A 1 98  ? 19.349  6.942   141.232 1.00 0.00 ?  98  VAL A HG13 1  
ATOM 1513   H HG21 . VAL A 1 98  ? 22.014  7.530   139.898 1.00 0.00 ?  98  VAL A HG21 1  
ATOM 1514   H HG22 . VAL A 1 98  ? 22.658  6.001   139.187 1.00 0.00 ?  98  VAL A HG22 1  
ATOM 1515   H HG23 . VAL A 1 98  ? 22.302  6.096   140.954 1.00 0.00 ?  98  VAL A HG23 1  
ATOM 1516   N N    . GLY A 1 99  ? 18.622  3.566   139.100 1.00 0.00 ?  99  GLY A N    1  
ATOM 1517   C CA   . GLY A 1 99  ? 17.296  3.094   138.814 1.00 0.00 ?  99  GLY A CA   1  
ATOM 1518   C C    . GLY A 1 99  ? 16.896  2.093   139.858 1.00 0.00 ?  99  GLY A C    1  
ATOM 1519   O O    . GLY A 1 99  ? 15.731  2.047   140.262 1.00 0.00 ?  99  GLY A O    1  
ATOM 1520   H H    . GLY A 1 99  ? 19.318  3.383   138.409 1.00 0.00 ?  99  GLY A H    1  
ATOM 1521   H HA2  . GLY A 1 99  ? 16.631  3.942   138.870 1.00 0.00 ?  99  GLY A HA2  1  
ATOM 1522   H HA3  . GLY A 1 99  ? 17.324  2.608   137.849 1.00 0.00 ?  99  GLY A HA3  1  
ATOM 1523   N N    . ALA A 1 100 ? 17.853  1.237   140.284 1.00 0.00 ?  100 ALA A N    1  
ATOM 1524   C CA   . ALA A 1 100 ? 17.551  0.225   141.263 1.00 0.00 ?  100 ALA A CA   1  
ATOM 1525   C C    . ALA A 1 100 ? 17.108  0.895   142.527 1.00 0.00 ?  100 ALA A C    1  
ATOM 1526   O O    . ALA A 1 100 ? 16.172  0.447   143.174 1.00 0.00 ?  100 ALA A O    1  
ATOM 1527   C CB   . ALA A 1 100 ? 18.755  -0.665  141.605 1.00 0.00 ?  100 ALA A CB   1  
ATOM 1528   H H    . ALA A 1 100 ? 18.790  1.266   139.943 1.00 0.00 ?  100 ALA A H    1  
ATOM 1529   H HA   . ALA A 1 100 ? 16.748  -0.370  140.875 1.00 0.00 ?  100 ALA A HA   1  
ATOM 1530   H HB1  . ALA A 1 100 ? 19.119  -0.444  142.631 1.00 0.00 ?  100 ALA A HB1  1  
ATOM 1531   H HB2  . ALA A 1 100 ? 19.584  -0.484  140.887 1.00 0.00 ?  100 ALA A HB2  1  
ATOM 1532   H HB3  . ALA A 1 100 ? 18.470  -1.738  141.554 1.00 0.00 ?  100 ALA A HB3  1  
ATOM 1533   N N    . PHE A 1 101 ? 17.792  1.991   142.886 1.00 0.00 ?  101 PHE A N    1  
ATOM 1534   C CA   . PHE A 1 101 ? 17.475  2.736   144.078 1.00 0.00 ?  101 PHE A CA   1  
ATOM 1535   C C    . PHE A 1 101 ? 16.069  3.251   143.962 1.00 0.00 ?  101 PHE A C    1  
ATOM 1536   O O    . PHE A 1 101 ? 15.286  3.190   144.910 1.00 0.00 ?  101 PHE A O    1  
ATOM 1537   C CB   . PHE A 1 101 ? 18.398  3.958   144.265 1.00 0.00 ?  101 PHE A CB   1  
ATOM 1538   C CG   . PHE A 1 101 ? 18.152  4.740   145.510 1.00 0.00 ?  101 PHE A CG   1  
ATOM 1539   C CD1  . PHE A 1 101 ? 18.821  4.431   146.673 1.00 0.00 ?  101 PHE A CD1  1  
ATOM 1540   C CD2  . PHE A 1 101 ? 17.252  5.782   145.513 1.00 0.00 ?  101 PHE A CD2  1  
ATOM 1541   C CE1  . PHE A 1 101 ? 18.595  5.152   147.820 1.00 0.00 ?  101 PHE A CE1  1  
ATOM 1542   C CE2  . PHE A 1 101 ? 17.024  6.504   146.661 1.00 0.00 ?  101 PHE A CE2  1  
ATOM 1543   C CZ   . PHE A 1 101 ? 17.697  6.189   147.815 1.00 0.00 ?  101 PHE A CZ   1  
ATOM 1544   H H    . PHE A 1 101 ? 18.557  2.331   142.353 1.00 0.00 ?  101 PHE A H    1  
ATOM 1545   H HA   . PHE A 1 101 ? 17.550  2.070   144.922 1.00 0.00 ?  101 PHE A HA   1  
ATOM 1546   H HB2  . PHE A 1 101 ? 19.456  3.626   144.295 1.00 0.00 ?  101 PHE A HB2  1  
ATOM 1547   H HB3  . PHE A 1 101 ? 18.272  4.655   143.411 1.00 0.00 ?  101 PHE A HB3  1  
ATOM 1548   H HD1  . PHE A 1 101 ? 19.531  3.616   146.683 1.00 0.00 ?  101 PHE A HD1  1  
ATOM 1549   H HD2  . PHE A 1 101 ? 16.719  6.034   144.607 1.00 0.00 ?  101 PHE A HD2  1  
ATOM 1550   H HE1  . PHE A 1 101 ? 19.125  4.903   148.728 1.00 0.00 ?  101 PHE A HE1  1  
ATOM 1551   H HE2  . PHE A 1 101 ? 16.317  7.319   146.655 1.00 0.00 ?  101 PHE A HE2  1  
ATOM 1552   H HZ   . PHE A 1 101 ? 17.518  6.756   148.716 1.00 0.00 ?  101 PHE A HZ   1  
ATOM 1553   N N    . PHE A 1 102 ? 15.745  3.795   142.776 1.00 0.00 ?  102 PHE A N    1  
ATOM 1554   C CA   . PHE A 1 102 ? 14.460  4.401   142.542 1.00 0.00 ?  102 PHE A CA   1  
ATOM 1555   C C    . PHE A 1 102 ? 13.322  3.438   142.724 1.00 0.00 ?  102 PHE A C    1  
ATOM 1556   O O    . PHE A 1 102 ? 12.312  3.820   143.303 1.00 0.00 ?  102 PHE A O    1  
ATOM 1557   C CB   . PHE A 1 102 ? 14.340  4.950   141.110 1.00 0.00 ?  102 PHE A CB   1  
ATOM 1558   C CG   . PHE A 1 102 ? 14.726  6.384   140.951 1.00 0.00 ?  102 PHE A CG   1  
ATOM 1559   C CD1  . PHE A 1 102 ? 13.878  7.250   140.296 1.00 0.00 ?  102 PHE A CD1  1  
ATOM 1560   C CD2  . PHE A 1 102 ? 15.924  6.868   141.443 1.00 0.00 ?  102 PHE A CD2  1  
ATOM 1561   C CE1  . PHE A 1 102 ? 14.218  8.569   140.133 1.00 0.00 ?  102 PHE A CE1  1  
ATOM 1562   C CE2  . PHE A 1 102 ? 16.260  8.191   141.280 1.00 0.00 ?  102 PHE A CE2  1  
ATOM 1563   C CZ   . PHE A 1 102 ? 15.407  9.040   140.624 1.00 0.00 ?  102 PHE A CZ   1  
ATOM 1564   H H    . PHE A 1 102 ? 16.384  3.814   142.012 1.00 0.00 ?  102 PHE A H    1  
ATOM 1565   H HA   . PHE A 1 102 ? 14.352  5.208   143.246 1.00 0.00 ?  102 PHE A HA   1  
ATOM 1566   H HB2  . PHE A 1 102 ? 14.993  4.364   140.430 1.00 0.00 ?  102 PHE A HB2  1  
ATOM 1567   H HB3  . PHE A 1 102 ? 13.289  4.850   140.761 1.00 0.00 ?  102 PHE A HB3  1  
ATOM 1568   H HD1  . PHE A 1 102 ? 12.939  6.887   139.907 1.00 0.00 ?  102 PHE A HD1  1  
ATOM 1569   H HD2  . PHE A 1 102 ? 16.602  6.210   141.961 1.00 0.00 ?  102 PHE A HD2  1  
ATOM 1570   H HE1  . PHE A 1 102 ? 13.545  9.239   139.618 1.00 0.00 ?  102 PHE A HE1  1  
ATOM 1571   H HE2  . PHE A 1 102 ? 17.198  8.561   141.667 1.00 0.00 ?  102 PHE A HE2  1  
ATOM 1572   H HZ   . PHE A 1 102 ? 15.672  10.077  140.495 1.00 0.00 ?  102 PHE A HZ   1  
ATOM 1573   N N    . PHE A 1 103 ? 13.408  2.184   142.225 1.00 0.00 ?  103 PHE A N    1  
ATOM 1574   C CA   . PHE A 1 103 ? 12.261  1.307   142.375 1.00 0.00 ?  103 PHE A CA   1  
ATOM 1575   C C    . PHE A 1 103 ? 12.297  0.656   143.721 1.00 0.00 ?  103 PHE A C    1  
ATOM 1576   O O    . PHE A 1 103 ? 11.258  0.377   144.318 1.00 0.00 ?  103 PHE A O    1  
ATOM 1577   C CB   . PHE A 1 103 ? 12.142  0.199   141.300 1.00 0.00 ?  103 PHE A CB   1  
ATOM 1578   C CG   . PHE A 1 103 ? 12.954  -1.032  141.531 1.00 0.00 ?  103 PHE A CG   1  
ATOM 1579   C CD1  . PHE A 1 103 ? 12.408  -2.111  142.198 1.00 0.00 ?  103 PHE A CD1  1  
ATOM 1580   C CD2  . PHE A 1 103 ? 14.238  -1.126  141.051 1.00 0.00 ?  103 PHE A CD2  1  
ATOM 1581   C CE1  . PHE A 1 103 ? 13.140  -3.259  142.385 1.00 0.00 ?  103 PHE A CE1  1  
ATOM 1582   C CE2  . PHE A 1 103 ? 14.971  -2.276  141.242 1.00 0.00 ?  103 PHE A CE2  1  
ATOM 1583   C CZ   . PHE A 1 103 ? 14.421  -3.341  141.908 1.00 0.00 ?  103 PHE A CZ   1  
ATOM 1584   H H    . PHE A 1 103 ? 14.213  1.831   141.749 1.00 0.00 ?  103 PHE A H    1  
ATOM 1585   H HA   . PHE A 1 103 ? 11.382  1.932   142.330 1.00 0.00 ?  103 PHE A HA   1  
ATOM 1586   H HB2  . PHE A 1 103 ? 11.087  -0.130  141.224 1.00 0.00 ?  103 PHE A HB2  1  
ATOM 1587   H HB3  . PHE A 1 103 ? 12.448  0.612   140.313 1.00 0.00 ?  103 PHE A HB3  1  
ATOM 1588   H HD1  . PHE A 1 103 ? 11.400  -2.049  142.580 1.00 0.00 ?  103 PHE A HD1  1  
ATOM 1589   H HD2  . PHE A 1 103 ? 14.674  -0.291  140.525 1.00 0.00 ?  103 PHE A HD2  1  
ATOM 1590   H HE1  . PHE A 1 103 ? 12.703  -4.096  142.909 1.00 0.00 ?  103 PHE A HE1  1  
ATOM 1591   H HE2  . PHE A 1 103 ? 15.980  -2.343  140.865 1.00 0.00 ?  103 PHE A HE2  1  
ATOM 1592   H HZ   . PHE A 1 103 ? 14.995  -4.243  142.055 1.00 0.00 ?  103 PHE A HZ   1  
ATOM 1593   N N    . SER A 1 104 ? 13.502  0.400   144.235 1.00 0.00 ?  104 SER A N    1  
ATOM 1594   C CA   . SER A 1 104 ? 13.628  -0.272  145.494 1.00 0.00 ?  104 SER A CA   1  
ATOM 1595   C C    . SER A 1 104 ? 13.089  0.555   146.628 1.00 0.00 ?  104 SER A C    1  
ATOM 1596   O O    . SER A 1 104 ? 12.730  -0.008  147.665 1.00 0.00 ?  104 SER A O    1  
ATOM 1597   C CB   . SER A 1 104 ? 15.080  -0.613  145.832 1.00 0.00 ?  104 SER A CB   1  
ATOM 1598   O OG   . SER A 1 104 ? 15.854  0.573   145.922 1.00 0.00 ?  104 SER A OG   1  
ATOM 1599   H H    . SER A 1 104 ? 14.347  0.655   143.779 1.00 0.00 ?  104 SER A H    1  
ATOM 1600   H HA   . SER A 1 104 ? 13.053  -1.181  145.425 1.00 0.00 ?  104 SER A HA   1  
ATOM 1601   H HB2  . SER A 1 104 ? 15.129  -1.148  146.804 1.00 0.00 ?  104 SER A HB2  1  
ATOM 1602   H HB3  . SER A 1 104 ? 15.512  -1.262  145.041 1.00 0.00 ?  104 SER A HB3  1  
ATOM 1603   H HG   . SER A 1 104 ? 15.298  1.220   146.363 1.00 0.00 ?  104 SER A HG   1  
ATOM 1604   N N    . VAL A 1 105 ? 13.060  1.904   146.505 1.00 0.00 ?  105 VAL A N    1  
ATOM 1605   C CA   . VAL A 1 105 ? 12.557  2.702   147.602 1.00 0.00 ?  105 VAL A CA   1  
ATOM 1606   C C    . VAL A 1 105 ? 11.108  2.399   147.767 1.00 0.00 ?  105 VAL A C    1  
ATOM 1607   O O    . VAL A 1 105 ? 10.582  2.374   148.877 1.00 0.00 ?  105 VAL A O    1  
ATOM 1608   C CB   . VAL A 1 105 ? 12.750  4.200   147.443 1.00 0.00 ?  105 VAL A CB   1  
ATOM 1609   C CG1  . VAL A 1 105 ? 12.047  4.698   146.168 1.00 0.00 ?  105 VAL A CG1  1  
ATOM 1610   C CG2  . VAL A 1 105 ? 12.192  4.885   148.701 1.00 0.00 ?  105 VAL A CG2  1  
ATOM 1611   H H    . VAL A 1 105 ? 13.382  2.388   145.695 1.00 0.00 ?  105 VAL A H    1  
ATOM 1612   H HA   . VAL A 1 105 ? 13.070  2.360   148.490 1.00 0.00 ?  105 VAL A HA   1  
ATOM 1613   H HB   . VAL A 1 105 ? 13.832  4.434   147.368 1.00 0.00 ?  105 VAL A HB   1  
ATOM 1614   H HG11 . VAL A 1 105 ? 11.125  5.258   146.429 1.00 0.00 ?  105 VAL A HG11 1  
ATOM 1615   H HG12 . VAL A 1 105 ? 11.771  3.845   145.527 1.00 0.00 ?  105 VAL A HG12 1  
ATOM 1616   H HG13 . VAL A 1 105 ? 12.719  5.371   145.594 1.00 0.00 ?  105 VAL A HG13 1  
ATOM 1617   H HG21 . VAL A 1 105 ? 12.287  4.212   149.580 1.00 0.00 ?  105 VAL A HG21 1  
ATOM 1618   H HG22 . VAL A 1 105 ? 11.119  5.136   148.561 1.00 0.00 ?  105 VAL A HG22 1  
ATOM 1619   H HG23 . VAL A 1 105 ? 12.751  5.822   148.910 1.00 0.00 ?  105 VAL A HG23 1  
ATOM 1620   N N    . GLU A 1 106 ? 10.425  2.149   146.656 1.00 0.00 ?  106 GLU A N    1  
ATOM 1621   C CA   . GLU A 1 106 ? 9.041   1.858   146.718 1.00 0.00 ?  106 GLU A CA   1  
ATOM 1622   C C    . GLU A 1 106 ? 8.845   0.518   147.389 1.00 0.00 ?  106 GLU A C    1  
ATOM 1623   O O    . GLU A 1 106 ? 7.937   0.357   148.195 1.00 0.00 ?  106 GLU A O    1  
ATOM 1624   C CB   . GLU A 1 106 ? 8.417   1.907   145.314 1.00 0.00 ?  106 GLU A CB   1  
ATOM 1625   C CG   . GLU A 1 106 ? 8.373   3.367   144.828 1.00 0.00 ?  106 GLU A CG   1  
ATOM 1626   C CD   . GLU A 1 106 ? 8.013   3.437   143.353 1.00 0.00 ?  106 GLU A CD   1  
ATOM 1627   O OE1  . GLU A 1 106 ? 8.101   2.395   142.662 1.00 0.00 ?  106 GLU A OE1  1  
ATOM 1628   O OE2  . GLU A 1 106 ? 7.665   4.553   142.891 1.00 0.00 -1 106 GLU A OE2  1  
ATOM 1629   H H    . GLU A 1 106 ? 10.842  2.171   145.746 1.00 0.00 ?  106 GLU A H    1  
ATOM 1630   H HA   . GLU A 1 106 ? 8.590   2.617   147.340 1.00 0.00 ?  106 GLU A HA   1  
ATOM 1631   H HB2  . GLU A 1 106 ? 9.029   1.295   144.614 1.00 0.00 ?  106 GLU A HB2  1  
ATOM 1632   H HB3  . GLU A 1 106 ? 7.386   1.498   145.340 1.00 0.00 ?  106 GLU A HB3  1  
ATOM 1633   H HG2  . GLU A 1 106 ? 7.615   3.931   145.413 1.00 0.00 ?  106 GLU A HG2  1  
ATOM 1634   H HG3  . GLU A 1 106 ? 9.364   3.842   144.981 1.00 0.00 ?  106 GLU A HG3  1  
ATOM 1635   N N    . THR A 1 107 ? 9.717   -0.470  147.092 1.00 0.00 ?  107 THR A N    1  
ATOM 1636   C CA   . THR A 1 107 ? 9.570   -1.797  147.676 1.00 0.00 ?  107 THR A CA   1  
ATOM 1637   C C    . THR A 1 107 ? 9.832   -1.828  149.180 1.00 0.00 ?  107 THR A C    1  
ATOM 1638   O O    . THR A 1 107 ? 9.064   -2.441  149.922 1.00 0.00 ?  107 THR A O    1  
ATOM 1639   C CB   . THR A 1 107 ? 10.539  -2.790  147.098 1.00 0.00 ?  107 THR A CB   1  
ATOM 1640   O OG1  . THR A 1 107 ? 10.375  -2.908  145.693 1.00 0.00 ?  107 THR A OG1  1  
ATOM 1641   C CG2  . THR A 1 107 ? 10.295  -4.155  147.765 1.00 0.00 ?  107 THR A CG2  1  
ATOM 1642   H H    . THR A 1 107 ? 10.456  -0.353  146.432 1.00 0.00 ?  107 THR A H    1  
ATOM 1643   H HA   . THR A 1 107 ? 8.559   -2.123  147.486 1.00 0.00 ?  107 THR A HA   1  
ATOM 1644   H HB   . THR A 1 107 ? 11.579  -2.475  147.314 1.00 0.00 ?  107 THR A HB   1  
ATOM 1645   H HG1  . THR A 1 107 ? 11.244  -3.152  145.354 1.00 0.00 ?  107 THR A HG1  1  
ATOM 1646   H HG21 . THR A 1 107 ? 9.210   -4.302  147.958 1.00 0.00 ?  107 THR A HG21 1  
ATOM 1647   H HG22 . THR A 1 107 ? 10.837  -4.217  148.730 1.00 0.00 ?  107 THR A HG22 1  
ATOM 1648   H HG23 . THR A 1 107 ? 10.650  -4.975  147.106 1.00 0.00 ?  107 THR A HG23 1  
ATOM 1649   N N    . LEU A 1 108 ? 10.921  -1.172  149.670 1.00 0.00 ?  108 LEU A N    1  
ATOM 1650   C CA   . LEU A 1 108 ? 11.295  -1.277  151.093 1.00 0.00 ?  108 LEU A CA   1  
ATOM 1651   C C    . LEU A 1 108 ? 10.435  -0.400  151.959 1.00 0.00 ?  108 LEU A C    1  
ATOM 1652   O O    . LEU A 1 108 ? 10.607  -0.384  153.221 1.00 0.00 ?  108 LEU A O    1  
ATOM 1653   C CB   . LEU A 1 108 ? 12.769  -0.888  151.364 1.00 0.00 ?  108 LEU A CB   1  
ATOM 1654   C CG   . LEU A 1 108 ? 13.415  -1.699  152.520 1.00 0.00 ?  108 LEU A CG   1  
ATOM 1655   C CD1  . LEU A 1 108 ? 14.830  -2.189  152.161 1.00 0.00 ?  108 LEU A CD1  1  
ATOM 1656   C CD2  . LEU A 1 108 ? 13.450  -0.895  153.835 1.00 0.00 ?  108 LEU A CD2  1  
ATOM 1657   H H    . LEU A 1 108 ? 11.504  -0.601  149.095 1.00 0.00 ?  108 LEU A H    1  
ATOM 1658   H HA   . LEU A 1 108 ? 11.135  -2.304  151.383 1.00 0.00 ?  108 LEU A HA   1  
ATOM 1659   H HB2  . LEU A 1 108 ? 13.354  -1.046  150.433 1.00 0.00 ?  108 LEU A HB2  1  
ATOM 1660   H HB3  . LEU A 1 108 ? 12.815  0.190   151.619 1.00 0.00 ?  108 LEU A HB3  1  
ATOM 1661   H HG   . LEU A 1 108 ? 12.783  -2.596  152.694 1.00 0.00 ?  108 LEU A HG   1  
ATOM 1662   H HD11 . LEU A 1 108 ? 15.084  -1.926  151.113 1.00 0.00 ?  108 LEU A HD11 1  
ATOM 1663   H HD12 . LEU A 1 108 ? 14.896  -3.293  152.275 1.00 0.00 ?  108 LEU A HD12 1  
ATOM 1664   H HD13 . LEU A 1 108 ? 15.581  -1.721  152.835 1.00 0.00 ?  108 LEU A HD13 1  
ATOM 1665   H HD21 . LEU A 1 108 ? 13.460  0.195   153.623 1.00 0.00 ?  108 LEU A HD21 1  
ATOM 1666   H HD22 . LEU A 1 108 ? 14.359  -1.151  154.420 1.00 0.00 ?  108 LEU A HD22 1  
ATOM 1667   H HD23 . LEU A 1 108 ? 12.555  -1.127  154.453 1.00 0.00 ?  108 LEU A HD23 1  
ATOM 1668   N N    . ALA A 1 109 ? 9.523   0.368   151.306 1.00 0.00 ?  109 ALA A N    1  
ATOM 1669   C CA   . ALA A 1 109 ? 8.652   1.257   152.022 1.00 0.00 ?  109 ALA A CA   1  
ATOM 1670   C C    . ALA A 1 109 ? 7.237   0.792   151.843 1.00 0.00 ?  109 ALA A C    1  
ATOM 1671   O O    . ALA A 1 109 ? 6.702   0.112   152.733 1.00 0.00 ?  109 ALA A O    1  
ATOM 1672   C CB   . ALA A 1 109 ? 8.730   2.706   151.517 1.00 0.00 ?  109 ALA A CB   1  
ATOM 1673   H H    . ALA A 1 109 ? 9.424   0.355   150.314 1.00 0.00 ?  109 ALA A H    1  
ATOM 1674   H HA   . ALA A 1 109 ? 8.907   1.215   153.067 1.00 0.00 ?  109 ALA A HA   1  
ATOM 1675   H HB1  . ALA A 1 109 ? 8.586   2.739   150.416 1.00 0.00 ?  109 ALA A HB1  1  
ATOM 1676   H HB2  . ALA A 1 109 ? 9.722   3.145   151.758 1.00 0.00 ?  109 ALA A HB2  1  
ATOM 1677   H HB3  . ALA A 1 109 ? 7.942   3.326   151.996 1.00 0.00 ?  109 ALA A HB3  1  
ATOM 1678   N N    . THR A 1 110 ? 6.623   1.154   150.661 1.00 0.00 ?  110 THR A N    1  
ATOM 1679   C CA   . THR A 1 110 ? 5.236   0.821   150.369 1.00 0.00 ?  110 THR A CA   1  
ATOM 1680   C C    . THR A 1 110 ? 5.214   -0.236  149.277 1.00 0.00 ?  110 THR A C    1  
ATOM 1681   O O    . THR A 1 110 ? 5.315   -1.399  149.655 1.00 0.00 ?  110 THR A O    1  
ATOM 1682   C CB   . THR A 1 110 ? 4.416   2.047   149.994 1.00 0.00 ?  110 THR A CB   1  
ATOM 1683   O OG1  . THR A 1 110 ? 3.171   1.690   149.403 1.00 0.00 ?  110 THR A OG1  1  
ATOM 1684   C CG2  . THR A 1 110 ? 5.232   2.953   149.050 1.00 0.00 ?  110 THR A CG2  1  
ATOM 1685   H H    . THR A 1 110 ? 7.105   1.660   149.953 1.00 0.00 ?  110 THR A H    1  
ATOM 1686   H HA   . THR A 1 110 ? 4.830   0.376   151.267 1.00 0.00 ?  110 THR A HA   1  
ATOM 1687   H HB   . THR A 1 110 ? 4.198   2.630   150.913 1.00 0.00 ?  110 THR A HB   1  
ATOM 1688   H HG1  . THR A 1 110 ? 2.719   2.522   149.213 1.00 0.00 ?  110 THR A HG1  1  
ATOM 1689   H HG21 . THR A 1 110 ? 4.570   3.406   148.282 1.00 0.00 ?  110 THR A HG21 1  
ATOM 1690   H HG22 . THR A 1 110 ? 6.021   2.366   148.534 1.00 0.00 ?  110 THR A HG22 1  
ATOM 1691   H HG23 . THR A 1 110 ? 5.718   3.771   149.624 1.00 0.00 ?  110 THR A HG23 1  
ATOM 1692   N N    . VAL A 1 111 ? 4.982   0.135   147.931 1.00 0.00 ?  111 VAL A N    1  
ATOM 1693   C CA   . VAL A 1 111 ? 5.023   -0.832  146.807 1.00 0.00 ?  111 VAL A CA   1  
ATOM 1694   C C    . VAL A 1 111 ? 4.994   -0.059  145.465 1.00 0.00 ?  111 VAL A C    1  
ATOM 1695   O O    . VAL A 1 111 ? 4.147   0.825   145.234 1.00 0.00 ?  111 VAL A O    1  
ATOM 1696   C CB   . VAL A 1 111 ? 3.952   -1.900  146.808 1.00 0.00 ?  111 VAL A CB   1  
ATOM 1697   C CG1  . VAL A 1 111 ? 2.592   -1.288  146.465 1.00 0.00 ?  111 VAL A CG1  1  
ATOM 1698   C CG2  . VAL A 1 111 ? 4.375   -2.995  145.811 1.00 0.00 ?  111 VAL A CG2  1  
ATOM 1699   H H    . VAL A 1 111 ? 4.780   1.078   147.679 1.00 0.00 ?  111 VAL A H    1  
ATOM 1700   H HA   . VAL A 1 111 ? 5.996   -1.306  146.874 1.00 0.00 ?  111 VAL A HA   1  
ATOM 1701   H HB   . VAL A 1 111 ? 3.886   -2.359  147.815 1.00 0.00 ?  111 VAL A HB   1  
ATOM 1702   H HG11 . VAL A 1 111 ? 2.520   -0.258  146.872 1.00 0.00 ?  111 VAL A HG11 1  
ATOM 1703   H HG12 . VAL A 1 111 ? 1.773   -1.902  146.897 1.00 0.00 ?  111 VAL A HG12 1  
ATOM 1704   H HG13 . VAL A 1 111 ? 2.457   -1.242  145.366 1.00 0.00 ?  111 VAL A HG13 1  
ATOM 1705   H HG21 . VAL A 1 111 ? 5.411   -2.812  145.453 1.00 0.00 ?  111 VAL A HG21 1  
ATOM 1706   H HG22 . VAL A 1 111 ? 3.694   -3.003  144.933 1.00 0.00 ?  111 VAL A HG22 1  
ATOM 1707   H HG23 . VAL A 1 111 ? 4.341   -3.993  146.297 1.00 0.00 ?  111 VAL A HG23 1  
ATOM 1708   N N    . GLY A 1 112 ? 5.874   -0.511  144.499 1.00 0.00 ?  112 GLY A N    1  
ATOM 1709   C CA   . GLY A 1 112 ? 6.104   0.186   143.218 1.00 0.00 ?  112 GLY A CA   1  
ATOM 1710   C C    . GLY A 1 112 ? 5.027   0.053   142.150 1.00 0.00 ?  112 GLY A C    1  
ATOM 1711   O O    . GLY A 1 112 ? 4.643   -1.025  141.690 1.00 0.00 ?  112 GLY A O    1  
ATOM 1712   H H    . GLY A 1 112 ? 6.402   -1.345  144.630 1.00 0.00 ?  112 GLY A H    1  
ATOM 1713   H HA2  . GLY A 1 112 ? 6.175   1.231   143.460 1.00 0.00 ?  112 GLY A HA2  1  
ATOM 1714   H HA3  . GLY A 1 112 ? 7.027   -0.219  142.822 1.00 0.00 ?  112 GLY A HA3  1  
ATOM 1715   N N    . TYR A 1 113 ? 4.738   1.208   141.515 1.00 0.00 ?  113 TYR A N    1  
ATOM 1716   C CA   . TYR A 1 113 ? 3.683   1.242   140.541 1.00 0.00 ?  113 TYR A CA   1  
ATOM 1717   C C    . TYR A 1 113 ? 4.076   0.719   139.170 1.00 0.00 ?  113 TYR A C    1  
ATOM 1718   O O    . TYR A 1 113 ? 3.795   -0.430  138.872 1.00 0.00 ?  113 TYR A O    1  
ATOM 1719   C CB   . TYR A 1 113 ? 3.059   2.629   140.357 1.00 0.00 ?  113 TYR A CB   1  
ATOM 1720   C CG   . TYR A 1 113 ? 3.934   3.773   140.750 1.00 0.00 ?  113 TYR A CG   1  
ATOM 1721   C CD1  . TYR A 1 113 ? 3.927   4.239   142.047 1.00 0.00 ?  113 TYR A CD1  1  
ATOM 1722   C CD2  . TYR A 1 113 ? 4.737   4.400   139.820 1.00 0.00 ?  113 TYR A CD2  1  
ATOM 1723   C CE1  . TYR A 1 113 ? 4.707   5.311   142.409 1.00 0.00 ?  113 TYR A CE1  1  
ATOM 1724   C CE2  . TYR A 1 113 ? 5.521   5.469   140.184 1.00 0.00 ?  113 TYR A CE2  1  
ATOM 1725   C CZ   . TYR A 1 113 ? 5.504   5.927   141.477 1.00 0.00 ?  113 TYR A CZ   1  
ATOM 1726   O OH   . TYR A 1 113 ? 6.304   7.028   141.849 1.00 0.00 ?  113 TYR A OH   1  
ATOM 1727   H H    . TYR A 1 113 ? 5.233   2.061   141.683 1.00 0.00 ?  113 TYR A H    1  
ATOM 1728   H HA   . TYR A 1 113 ? 2.921   0.582   140.924 1.00 0.00 ?  113 TYR A HA   1  
ATOM 1729   H HB2  . TYR A 1 113 ? 2.783   2.781   139.293 1.00 0.00 ?  113 TYR A HB2  1  
ATOM 1730   H HB3  . TYR A 1 113 ? 2.139   2.688   140.969 1.00 0.00 ?  113 TYR A HB3  1  
ATOM 1731   H HD1  . TYR A 1 113 ? 3.303   3.757   142.785 1.00 0.00 ?  113 TYR A HD1  1  
ATOM 1732   H HD2  . TYR A 1 113 ? 4.755   4.047   138.802 1.00 0.00 ?  113 TYR A HD2  1  
ATOM 1733   H HE1  . TYR A 1 113 ? 4.695   5.668   143.428 1.00 0.00 ?  113 TYR A HE1  1  
ATOM 1734   H HE2  . TYR A 1 113 ? 6.149   5.953   139.449 1.00 0.00 ?  113 TYR A HE2  1  
ATOM 1735   H HH   . TYR A 1 113 ? 6.635   6.867   142.736 1.00 0.00 ?  113 TYR A HH   1  
ATOM 1736   N N    . GLY A 1 114 ? 4.741   1.547   138.312 1.00 0.00 ?  114 GLY A N    1  
ATOM 1737   C CA   . GLY A 1 114 ? 5.022   1.164   136.915 1.00 0.00 ?  114 GLY A CA   1  
ATOM 1738   C C    . GLY A 1 114 ? 6.314   0.404   136.759 1.00 0.00 ?  114 GLY A C    1  
ATOM 1739   O O    . GLY A 1 114 ? 6.782   0.146   135.595 1.00 0.00 ?  114 GLY A O    1  
ATOM 1740   H H    . GLY A 1 114 ? 5.063   2.449   138.591 1.00 0.00 ?  114 GLY A H    1  
ATOM 1741   H HA2  . GLY A 1 114 ? 4.218   0.521   136.598 1.00 0.00 ?  114 GLY A HA2  1  
ATOM 1742   H HA3  . GLY A 1 114 ? 5.091   2.083   136.348 1.00 0.00 ?  114 GLY A HA3  1  
ATOM 1743   N N    . ASP A 1 115 ? 6.912   0.050   137.922 1.00 0.00 ?  115 ASP A N    1  
ATOM 1744   C CA   . ASP A 1 115 ? 8.171   -0.662  137.991 1.00 0.00 ?  115 ASP A CA   1  
ATOM 1745   C C    . ASP A 1 115 ? 7.889   -2.139  137.944 1.00 0.00 ?  115 ASP A C    1  
ATOM 1746   O O    . ASP A 1 115 ? 8.461   -2.915  138.703 1.00 0.00 ?  115 ASP A O    1  
ATOM 1747   C CB   . ASP A 1 115 ? 8.933   -0.367  139.285 1.00 0.00 ?  115 ASP A CB   1  
ATOM 1748   C CG   . ASP A 1 115 ? 9.242   1.114   139.398 1.00 0.00 ?  115 ASP A CG   1  
ATOM 1749   O OD1  . ASP A 1 115 ? 9.212   1.797   138.344 1.00 0.00 ?  115 ASP A OD1  1  
ATOM 1750   O OD2  . ASP A 1 115 ? 9.507   1.582   140.533 1.00 0.00 -1 115 ASP A OD2  1  
ATOM 1751   H H    . ASP A 1 115 ? 6.499   0.268   138.802 1.00 0.00 ?  115 ASP A H    1  
ATOM 1752   H HA   . ASP A 1 115 ? 8.759   -0.380  137.132 1.00 0.00 ?  115 ASP A HA   1  
ATOM 1753   H HB2  . ASP A 1 115 ? 8.322   -0.680  140.159 1.00 0.00 ?  115 ASP A HB2  1  
ATOM 1754   H HB3  . ASP A 1 115 ? 9.886   -0.936  139.296 1.00 0.00 ?  115 ASP A HB3  1  
ATOM 1755   N N    . MET A 1 116 ? 6.928   -2.497  137.079 1.00 0.00 ?  116 MET A N    1  
ATOM 1756   C CA   . MET A 1 116 ? 6.431   -3.839  136.849 1.00 0.00 ?  116 MET A CA   1  
ATOM 1757   C C    . MET A 1 116 ? 7.485   -4.800  136.317 1.00 0.00 ?  116 MET A C    1  
ATOM 1758   O O    . MET A 1 116 ? 7.141   -5.603  135.454 1.00 0.00 ?  116 MET A O    1  
ATOM 1759   C CB   . MET A 1 116 ? 5.281   -3.839  135.824 1.00 0.00 ?  116 MET A CB   1  
ATOM 1760   C CG   . MET A 1 116 ? 4.100   -2.972  136.262 1.00 0.00 ?  116 MET A CG   1  
ATOM 1761   S SD   . MET A 1 116 ? 2.809   -2.856  134.987 1.00 0.00 ?  116 MET A SD   1  
ATOM 1762   C CE   . MET A 1 116 ? 1.776   -1.686  135.914 1.00 0.00 ?  116 MET A CE   1  
ATOM 1763   H H    . MET A 1 116 ? 6.485   -1.803  136.517 1.00 0.00 ?  116 MET A H    1  
ATOM 1764   H HA   . MET A 1 116 ? 6.068   -4.210  137.792 1.00 0.00 ?  116 MET A HA   1  
ATOM 1765   H HB2  . MET A 1 116 ? 5.663   -3.467  134.849 1.00 0.00 ?  116 MET A HB2  1  
ATOM 1766   H HB3  . MET A 1 116 ? 4.918   -4.879  135.680 1.00 0.00 ?  116 MET A HB3  1  
ATOM 1767   H HG2  . MET A 1 116 ? 3.671   -3.402  137.192 1.00 0.00 ?  116 MET A HG2  1  
ATOM 1768   H HG3  . MET A 1 116 ? 4.476   -1.956  136.505 1.00 0.00 ?  116 MET A HG3  1  
ATOM 1769   H HE1  . MET A 1 116 ? 1.207   -2.209  136.712 1.00 0.00 ?  116 MET A HE1  1  
ATOM 1770   H HE2  . MET A 1 116 ? 1.047   -1.184  135.244 1.00 0.00 ?  116 MET A HE2  1  
ATOM 1771   H HE3  . MET A 1 116 ? 2.400   -0.901  136.394 1.00 0.00 ?  116 MET A HE3  1  
ATOM 1772   N N    . HIS A 1 117 ? 8.781   -4.778  136.760 1.00 0.00 ?  117 HIS A N    1  
ATOM 1773   C CA   . HIS A 1 117 ? 9.750   -5.674  136.146 1.00 0.00 ?  117 HIS A CA   1  
ATOM 1774   C C    . HIS A 1 117 ? 10.360  -6.688  137.110 1.00 0.00 ?  117 HIS A C    1  
ATOM 1775   O O    . HIS A 1 117 ? 11.505  -6.543  137.535 1.00 0.00 ?  117 HIS A O    1  
ATOM 1776   C CB   . HIS A 1 117 ? 10.942  -4.895  135.565 1.00 0.00 ?  117 HIS A CB   1  
ATOM 1777   C CG   . HIS A 1 117 ? 10.549  -3.855  134.557 1.00 0.00 ?  117 HIS A CG   1  
ATOM 1778   N ND1  . HIS A 1 117 ? 10.145  -4.232  133.285 1.00 0.00 ?  117 HIS A ND1  1  
ATOM 1779   C CD2  . HIS A 1 117 ? 10.522  -2.499  134.683 1.00 0.00 ?  117 HIS A CD2  1  
ATOM 1780   C CE1  . HIS A 1 117 ? 9.883   -3.095  132.672 1.00 0.00 ?  117 HIS A CE1  1  
ATOM 1781   N NE2  . HIS A 1 117 ? 10.096  -2.019  133.469 1.00 0.00 ?  117 HIS A NE2  1  
ATOM 1782   H H    . HIS A 1 117 ? 9.105   -4.176  137.487 1.00 0.00 ?  117 HIS A H    1  
ATOM 1783   H HA   . HIS A 1 117 ? 9.267   -6.209  135.352 1.00 0.00 ?  117 HIS A HA   1  
ATOM 1784   H HB2  . HIS A 1 117 ? 11.484  -4.378  136.385 1.00 0.00 ?  117 HIS A HB2  1  
ATOM 1785   H HB3  . HIS A 1 117 ? 11.643  -5.600  135.069 1.00 0.00 ?  117 HIS A HB3  1  
ATOM 1786   H HD2  . HIS A 1 117 ? 10.773  -1.873  135.530 1.00 0.00 ?  117 HIS A HD2  1  
ATOM 1787   H HE1  . HIS A 1 117 ? 9.533   -3.003  131.643 1.00 0.00 ?  117 HIS A HE1  1  
ATOM 1788   H HE2  . HIS A 1 117 ? 9.976   -1.053  133.232 1.00 0.00 ?  117 HIS A HE2  1  
ATOM 1789   N N    . PRO A 1 118 ? 9.605   -7.717  137.480 1.00 0.00 ?  118 PRO A N    1  
ATOM 1790   C CA   . PRO A 1 118 ? 10.127  -8.828  138.232 1.00 0.00 ?  118 PRO A CA   1  
ATOM 1791   C C    . PRO A 1 118 ? 10.363  -9.936  137.237 1.00 0.00 ?  118 PRO A C    1  
ATOM 1792   O O    . PRO A 1 118 ? 9.925   -11.072 137.413 1.00 0.00 ?  118 PRO A O    1  
ATOM 1793   C CB   . PRO A 1 118 ? 8.983   -9.181  139.159 1.00 0.00 ?  118 PRO A CB   1  
ATOM 1794   C CG   . PRO A 1 118 ? 7.772   -9.017  138.246 1.00 0.00 ?  118 PRO A CG   1  
ATOM 1795   C CD   . PRO A 1 118 ? 8.158   -7.883  137.276 1.00 0.00 ?  118 PRO A CD   1  
ATOM 1796   H HA   . PRO A 1 118 ? 11.028  -8.588  138.778 1.00 0.00 ?  118 PRO A HA   1  
ATOM 1797   H HB2  . PRO A 1 118 ? 9.075   -10.228 139.525 1.00 0.00 ?  118 PRO A HB2  1  
ATOM 1798   H HB3  . PRO A 1 118 ? 8.930   -8.478  140.017 1.00 0.00 ?  118 PRO A HB3  1  
ATOM 1799   H HG2  . PRO A 1 118 ? 7.572   -9.960  137.692 1.00 0.00 ?  118 PRO A HG2  1  
ATOM 1800   H HG3  . PRO A 1 118 ? 6.875   -8.738  138.836 1.00 0.00 ?  118 PRO A HG3  1  
ATOM 1801   H HD2  . PRO A 1 118 ? 7.923   -8.163  136.227 1.00 0.00 ?  118 PRO A HD2  1  
ATOM 1802   H HD3  . PRO A 1 118 ? 7.606   -6.971  137.551 1.00 0.00 ?  118 PRO A HD3  1  
ATOM 1803   N N    . GLN A 1 119 ? 11.087  -9.581  136.153 1.00 0.00 ?  119 GLN A N    1  
ATOM 1804   C CA   . GLN A 1 119 ? 11.313  -10.470 135.035 1.00 0.00 ?  119 GLN A CA   1  
ATOM 1805   C C    . GLN A 1 119 ? 12.054  -11.713 135.415 1.00 0.00 ?  119 GLN A C    1  
ATOM 1806   O O    . GLN A 1 119 ? 11.746  -12.780 134.881 1.00 0.00 ?  119 GLN A O    1  
ATOM 1807   C CB   . GLN A 1 119 ? 12.088  -9.803  133.881 1.00 0.00 ?  119 GLN A CB   1  
ATOM 1808   C CG   . GLN A 1 119 ? 12.181  -10.689 132.629 1.00 0.00 ?  119 GLN A CG   1  
ATOM 1809   C CD   . GLN A 1 119 ? 10.772  -10.964 132.122 1.00 0.00 ?  119 GLN A CD   1  
ATOM 1810   O OE1  . GLN A 1 119 ? 10.014  -10.042 131.822 1.00 0.00 ?  119 GLN A OE1  1  
ATOM 1811   N NE2  . GLN A 1 119 ? 10.403  -12.271 132.040 1.00 0.00 ?  119 GLN A NE2  1  
ATOM 1812   H H    . GLN A 1 119 ? 11.501  -8.677  136.075 1.00 0.00 ?  119 GLN A H    1  
ATOM 1813   H HA   . GLN A 1 119 ? 10.338  -10.759 134.683 1.00 0.00 ?  119 GLN A HA   1  
ATOM 1814   H HB2  . GLN A 1 119 ? 11.585  -8.848  133.613 1.00 0.00 ?  119 GLN A HB2  1  
ATOM 1815   H HB3  . GLN A 1 119 ? 13.115  -9.563  134.227 1.00 0.00 ?  119 GLN A HB3  1  
ATOM 1816   H HG2  . GLN A 1 119 ? 12.765  -10.169 131.838 1.00 0.00 ?  119 GLN A HG2  1  
ATOM 1817   H HG3  . GLN A 1 119 ? 12.678  -11.652 132.869 1.00 0.00 ?  119 GLN A HG3  1  
ATOM 1818   H HE21 . GLN A 1 119 ? 11.049  -12.989 132.302 1.00 0.00 ?  119 GLN A HE21 1  
ATOM 1819   H HE22 . GLN A 1 119 ? 9.483   -12.515 131.733 1.00 0.00 ?  119 GLN A HE22 1  
ATOM 1820   N N    . THR A 1 120 ? 13.028  -11.626 136.341 1.00 0.00 ?  120 THR A N    1  
ATOM 1821   C CA   . THR A 1 120 ? 13.823  -12.787 136.666 1.00 0.00 ?  120 THR A CA   1  
ATOM 1822   C C    . THR A 1 120 ? 13.415  -13.227 138.022 1.00 0.00 ?  120 THR A C    1  
ATOM 1823   O O    . THR A 1 120 ? 13.179  -12.416 138.898 1.00 0.00 ?  120 THR A O    1  
ATOM 1824   C CB   . THR A 1 120 ? 15.291  -12.479 136.708 1.00 0.00 ?  120 THR A CB   1  
ATOM 1825   O OG1  . THR A 1 120 ? 15.708  -11.977 135.448 1.00 0.00 ?  120 THR A OG1  1  
ATOM 1826   C CG2  . THR A 1 120 ? 16.067  -13.763 137.042 1.00 0.00 ?  120 THR A CG2  1  
ATOM 1827   H H    . THR A 1 120 ? 13.239  -10.782 136.829 1.00 0.00 ?  120 THR A H    1  
ATOM 1828   H HA   . THR A 1 120 ? 13.617  -13.569 135.954 1.00 0.00 ?  120 THR A HA   1  
ATOM 1829   H HB   . THR A 1 120 ? 15.503  -11.720 137.489 1.00 0.00 ?  120 THR A HB   1  
ATOM 1830   H HG1  . THR A 1 120 ? 16.196  -11.168 135.634 1.00 0.00 ?  120 THR A HG1  1  
ATOM 1831   H HG21 . THR A 1 120 ? 16.362  -13.767 138.112 1.00 0.00 ?  120 THR A HG21 1  
ATOM 1832   H HG22 . THR A 1 120 ? 16.985  -13.832 136.420 1.00 0.00 ?  120 THR A HG22 1  
ATOM 1833   H HG23 . THR A 1 120 ? 15.437  -14.656 136.844 1.00 0.00 ?  120 THR A HG23 1  
ATOM 1834   N N    . VAL A 1 121 ? 13.300  -14.557 138.207 1.00 0.00 ?  121 VAL A N    1  
ATOM 1835   C CA   . VAL A 1 121 ? 12.866  -15.080 139.466 1.00 0.00 ?  121 VAL A CA   1  
ATOM 1836   C C    . VAL A 1 121 ? 13.888  -14.777 140.517 1.00 0.00 ?  121 VAL A C    1  
ATOM 1837   O O    . VAL A 1 121 ? 13.537  -14.626 141.680 1.00 0.00 ?  121 VAL A O    1  
ATOM 1838   C CB   . VAL A 1 121 ? 12.625  -16.567 139.444 1.00 0.00 ?  121 VAL A CB   1  
ATOM 1839   C CG1  . VAL A 1 121 ? 11.474  -16.844 138.462 1.00 0.00 ?  121 VAL A CG1  1  
ATOM 1840   C CG2  . VAL A 1 121 ? 13.925  -17.289 139.043 1.00 0.00 ?  121 VAL A CG2  1  
ATOM 1841   H H    . VAL A 1 121 ? 13.507  -15.221 137.493 1.00 0.00 ?  121 VAL A H    1  
ATOM 1842   H HA   . VAL A 1 121 ? 11.952  -14.566 139.721 1.00 0.00 ?  121 VAL A HA   1  
ATOM 1843   H HB   . VAL A 1 121 ? 12.322  -16.913 140.455 1.00 0.00 ?  121 VAL A HB   1  
ATOM 1844   H HG11 . VAL A 1 121 ? 10.848  -15.935 138.336 1.00 0.00 ?  121 VAL A HG11 1  
ATOM 1845   H HG12 . VAL A 1 121 ? 10.833  -17.667 138.842 1.00 0.00 ?  121 VAL A HG12 1  
ATOM 1846   H HG13 . VAL A 1 121 ? 11.877  -17.137 137.468 1.00 0.00 ?  121 VAL A HG13 1  
ATOM 1847   H HG21 . VAL A 1 121 ? 14.354  -16.838 138.123 1.00 0.00 ?  121 VAL A HG21 1  
ATOM 1848   H HG22 . VAL A 1 121 ? 13.723  -18.364 138.847 1.00 0.00 ?  121 VAL A HG22 1  
ATOM 1849   H HG23 . VAL A 1 121 ? 14.678  -17.215 139.857 1.00 0.00 ?  121 VAL A HG23 1  
ATOM 1850   N N    . TYR A 1 122 ? 15.182  -14.685 140.152 1.00 0.00 ?  122 TYR A N    1  
ATOM 1851   C CA   . TYR A 1 122 ? 16.172  -14.397 141.152 1.00 0.00 ?  122 TYR A CA   1  
ATOM 1852   C C    . TYR A 1 122 ? 15.955  -12.991 141.620 1.00 0.00 ?  122 TYR A C    1  
ATOM 1853   O O    . TYR A 1 122 ? 16.044  -12.701 142.815 1.00 0.00 ?  122 TYR A O    1  
ATOM 1854   C CB   . TYR A 1 122 ? 17.610  -14.514 140.634 1.00 0.00 ?  122 TYR A CB   1  
ATOM 1855   C CG   . TYR A 1 122 ? 18.019  -15.912 140.313 1.00 0.00 ?  122 TYR A CG   1  
ATOM 1856   C CD1  . TYR A 1 122 ? 17.847  -16.418 139.042 1.00 0.00 ?  122 TYR A CD1  1  
ATOM 1857   C CD2  . TYR A 1 122 ? 18.575  -16.718 141.284 1.00 0.00 ?  122 TYR A CD2  1  
ATOM 1858   C CE1  . TYR A 1 122 ? 18.224  -17.707 138.748 1.00 0.00 ?  122 TYR A CE1  1  
ATOM 1859   C CE2  . TYR A 1 122 ? 18.952  -18.006 140.988 1.00 0.00 ?  122 TYR A CE2  1  
ATOM 1860   C CZ   . TYR A 1 122 ? 18.777  -18.502 139.721 1.00 0.00 ?  122 TYR A CZ   1  
ATOM 1861   O OH   . TYR A 1 122 ? 19.165  -19.823 139.418 1.00 0.00 ?  122 TYR A OH   1  
ATOM 1862   H H    . TYR A 1 122 ? 15.498  -14.807 139.214 1.00 0.00 ?  122 TYR A H    1  
ATOM 1863   H HA   . TYR A 1 122 ? 16.012  -15.074 141.977 1.00 0.00 ?  122 TYR A HA   1  
ATOM 1864   H HB2  . TYR A 1 122 ? 17.719  -13.922 139.706 1.00 0.00 ?  122 TYR A HB2  1  
ATOM 1865   H HB3  . TYR A 1 122 ? 18.321  -14.124 141.394 1.00 0.00 ?  122 TYR A HB3  1  
ATOM 1866   H HD1  . TYR A 1 122 ? 17.412  -15.797 138.272 1.00 0.00 ?  122 TYR A HD1  1  
ATOM 1867   H HD2  . TYR A 1 122 ? 18.716  -16.332 142.283 1.00 0.00 ?  122 TYR A HD2  1  
ATOM 1868   H HE1  . TYR A 1 122 ? 18.085  -18.096 137.749 1.00 0.00 ?  122 TYR A HE1  1  
ATOM 1869   H HE2  . TYR A 1 122 ? 19.387  -18.630 141.755 1.00 0.00 ?  122 TYR A HE2  1  
ATOM 1870   H HH   . TYR A 1 122 ? 19.384  -19.863 138.485 1.00 0.00 ?  122 TYR A HH   1  
ATOM 1871   N N    . ALA A 1 123 ? 15.659  -12.080 140.671 1.00 0.00 ?  123 ALA A N    1  
ATOM 1872   C CA   . ALA A 1 123 ? 15.422  -10.706 141.020 1.00 0.00 ?  123 ALA A CA   1  
ATOM 1873   C C    . ALA A 1 123 ? 14.200  -10.641 141.878 1.00 0.00 ?  123 ALA A C    1  
ATOM 1874   O O    . ALA A 1 123 ? 14.136  -9.869  142.829 1.00 0.00 ?  123 ALA A O    1  
ATOM 1875   C CB   . ALA A 1 123 ? 15.189  -9.802  139.802 1.00 0.00 ?  123 ALA A CB   1  
ATOM 1876   H H    . ALA A 1 123 ? 15.604  -12.311 139.702 1.00 0.00 ?  123 ALA A H    1  
ATOM 1877   H HA   . ALA A 1 123 ? 16.272  -10.360 141.585 1.00 0.00 ?  123 ALA A HA   1  
ATOM 1878   H HB1  . ALA A 1 123 ? 15.539  -8.772  140.019 1.00 0.00 ?  123 ALA A HB1  1  
ATOM 1879   H HB2  . ALA A 1 123 ? 14.108  -9.763  139.549 1.00 0.00 ?  123 ALA A HB2  1  
ATOM 1880   H HB3  . ALA A 1 123 ? 15.746  -10.189 138.922 1.00 0.00 ?  123 ALA A HB3  1  
ATOM 1881   N N    . HIS A 1 124 ? 13.189  -11.448 141.522 1.00 0.00 ?  124 HIS A N    1  
ATOM 1882   C CA   . HIS A 1 124 ? 11.952  -11.465 142.242 1.00 0.00 ?  124 HIS A CA   1  
ATOM 1883   C C    . HIS A 1 124 ? 12.165  -11.877 143.656 1.00 0.00 ?  124 HIS A C    1  
ATOM 1884   O O    . HIS A 1 124 ? 11.572  -11.293 144.540 1.00 0.00 ?  124 HIS A O    1  
ATOM 1885   C CB   . HIS A 1 124 ? 10.901  -12.408 141.659 1.00 0.00 ?  124 HIS A CB   1  
ATOM 1886   C CG   . HIS A 1 124 ? 9.679   -12.497 142.525 1.00 0.00 ?  124 HIS A CG   1  
ATOM 1887   N ND1  . HIS A 1 124 ? 8.825   -11.410 142.633 1.00 0.00 ?  124 HIS A ND1  1  
ATOM 1888   C CD2  . HIS A 1 124 ? 9.240   -13.525 143.303 1.00 0.00 ?  124 HIS A CD2  1  
ATOM 1889   C CE1  . HIS A 1 124 ? 7.890   -11.806 143.477 1.00 0.00 ?  124 HIS A CE1  1  
ATOM 1890   N NE2  . HIS A 1 124 ? 8.094   -13.073 143.913 1.00 0.00 ?  124 HIS A NE2  1  
ATOM 1891   H H    . HIS A 1 124 ? 13.249  -12.056 140.745 1.00 0.00 ?  124 HIS A H    1  
ATOM 1892   H HA   . HIS A 1 124 ? 11.571  -10.456 142.234 1.00 0.00 ?  124 HIS A HA   1  
ATOM 1893   H HB2  . HIS A 1 124 ? 10.585  -12.050 140.656 1.00 0.00 ?  124 HIS A HB2  1  
ATOM 1894   H HB3  . HIS A 1 124 ? 11.323  -13.430 141.559 1.00 0.00 ?  124 HIS A HB3  1  
ATOM 1895   H HD2  . HIS A 1 124 ? 9.658   -14.514 143.454 1.00 0.00 ?  124 HIS A HD2  1  
ATOM 1896   H HE1  . HIS A 1 124 ? 7.042   -11.203 143.801 1.00 0.00 ?  124 HIS A HE1  1  
ATOM 1897   H HE2  . HIS A 1 124 ? 7.535   -13.586 144.562 1.00 0.00 ?  124 HIS A HE2  1  
ATOM 1898   N N    . ALA A 1 125 ? 12.960  -12.938 143.894 1.00 0.00 ?  125 ALA A N    1  
ATOM 1899   C CA   . ALA A 1 125 ? 13.165  -13.409 145.241 1.00 0.00 ?  125 ALA A CA   1  
ATOM 1900   C C    . ALA A 1 125 ? 13.802  -12.322 146.045 1.00 0.00 ?  125 ALA A C    1  
ATOM 1901   O O    . ALA A 1 125 ? 13.454  -12.120 147.207 1.00 0.00 ?  125 ALA A O    1  
ATOM 1902   C CB   . ALA A 1 125 ? 14.080  -14.642 145.320 1.00 0.00 ?  125 ALA A CB   1  
ATOM 1903   H H    . ALA A 1 125 ? 13.425  -13.434 143.172 1.00 0.00 ?  125 ALA A H    1  
ATOM 1904   H HA   . ALA A 1 125 ? 12.198  -13.637 145.658 1.00 0.00 ?  125 ALA A HA   1  
ATOM 1905   H HB1  . ALA A 1 125 ? 14.951  -14.521 144.643 1.00 0.00 ?  125 ALA A HB1  1  
ATOM 1906   H HB2  . ALA A 1 125 ? 13.522  -15.555 145.020 1.00 0.00 ?  125 ALA A HB2  1  
ATOM 1907   H HB3  . ALA A 1 125 ? 14.453  -14.780 146.357 1.00 0.00 ?  125 ALA A HB3  1  
ATOM 1908   N N    . ILE A 1 126 ? 14.756  -11.604 145.437 1.00 0.00 ?  126 ILE A N    1  
ATOM 1909   C CA   . ILE A 1 126 ? 15.435  -10.549 146.129 1.00 0.00 ?  126 ILE A CA   1  
ATOM 1910   C C    . ILE A 1 126 ? 14.427  -9.484  146.495 1.00 0.00 ?  126 ILE A C    1  
ATOM 1911   O O    . ILE A 1 126 ? 14.408  -9.000  147.627 1.00 0.00 ?  126 ILE A O    1  
ATOM 1912   C CB   . ILE A 1 126 ? 16.527  -9.962  145.274 1.00 0.00 ?  126 ILE A CB   1  
ATOM 1913   C CG1  . ILE A 1 126 ? 17.648  -11.000 145.087 1.00 0.00 ?  126 ILE A CG1  1  
ATOM 1914   C CG2  . ILE A 1 126 ? 17.055  -8.669  145.913 1.00 0.00 ?  126 ILE A CG2  1  
ATOM 1915   C CD1  . ILE A 1 126 ? 18.655  -10.592 144.015 1.00 0.00 ?  126 ILE A CD1  1  
ATOM 1916   H H    . ILE A 1 126 ? 15.028  -11.765 144.489 1.00 0.00 ?  126 ILE A H    1  
ATOM 1917   H HA   . ILE A 1 126 ? 15.850  -10.967 147.033 1.00 0.00 ?  126 ILE A HA   1  
ATOM 1918   H HB   . ILE A 1 126 ? 16.116  -9.713  144.273 1.00 0.00 ?  126 ILE A HB   1  
ATOM 1919   H HG12 . ILE A 1 126 ? 18.180  -11.135 146.054 1.00 0.00 ?  126 ILE A HG12 1  
ATOM 1920   H HG13 . ILE A 1 126 ? 17.197  -11.974 144.805 1.00 0.00 ?  126 ILE A HG13 1  
ATOM 1921   H HG21 . ILE A 1 126 ? 18.156  -8.616  145.804 1.00 0.00 ?  126 ILE A HG21 1  
ATOM 1922   H HG22 . ILE A 1 126 ? 16.807  -8.625  146.995 1.00 0.00 ?  126 ILE A HG22 1  
ATOM 1923   H HG23 . ILE A 1 126 ? 16.614  -7.793  145.402 1.00 0.00 ?  126 ILE A HG23 1  
ATOM 1924   H HD11 . ILE A 1 126 ? 19.398  -9.880  144.433 1.00 0.00 ?  126 ILE A HD11 1  
ATOM 1925   H HD12 . ILE A 1 126 ? 18.136  -10.104 143.163 1.00 0.00 ?  126 ILE A HD12 1  
ATOM 1926   H HD13 . ILE A 1 126 ? 19.197  -11.485 143.635 1.00 0.00 ?  126 ILE A HD13 1  
ATOM 1927   N N    . ALA A 1 127 ? 13.558  -9.108  145.538 1.00 0.00 ?  127 ALA A N    1  
ATOM 1928   C CA   . ALA A 1 127 ? 12.569  -8.083  145.784 1.00 0.00 ?  127 ALA A CA   1  
ATOM 1929   C C    . ALA A 1 127 ? 11.611  -8.526  146.858 1.00 0.00 ?  127 ALA A C    1  
ATOM 1930   O O    . ALA A 1 127 ? 11.191  -7.725  147.685 1.00 0.00 ?  127 ALA A O    1  
ATOM 1931   C CB   . ALA A 1 127 ? 11.739  -7.744  144.536 1.00 0.00 ?  127 ALA A CB   1  
ATOM 1932   H H    . ALA A 1 127 ? 13.558  -9.512  144.630 1.00 0.00 ?  127 ALA A H    1  
ATOM 1933   H HA   . ALA A 1 127 ? 13.095  -7.205  146.123 1.00 0.00 ?  127 ALA A HA   1  
ATOM 1934   H HB1  . ALA A 1 127 ? 10.654  -7.817  144.762 1.00 0.00 ?  127 ALA A HB1  1  
ATOM 1935   H HB2  . ALA A 1 127 ? 11.978  -8.448  143.711 1.00 0.00 ?  127 ALA A HB2  1  
ATOM 1936   H HB3  . ALA A 1 127 ? 11.961  -6.709  144.194 1.00 0.00 ?  127 ALA A HB3  1  
ATOM 1937   N N    . THR A 1 128 ? 11.221  -9.812  146.839 1.00 0.00 ?  128 THR A N    1  
ATOM 1938   C CA   . THR A 1 128 ? 10.270  -10.331 147.787 1.00 0.00 ?  128 THR A CA   1  
ATOM 1939   C C    . THR A 1 128 ? 10.823  -10.226 149.174 1.00 0.00 ?  128 THR A C    1  
ATOM 1940   O O    . THR A 1 128 ? 10.097  -9.861  150.102 1.00 0.00 ?  128 THR A O    1  
ATOM 1941   C CB   . THR A 1 128 ? 9.917   -11.771 147.534 1.00 0.00 ?  128 THR A CB   1  
ATOM 1942   O OG1  . THR A 1 128 ? 9.317   -11.913 146.248 1.00 0.00 ?  128 THR A OG1  1  
ATOM 1943   C CG2  . THR A 1 128 ? 8.945   -12.242 148.627 1.00 0.00 ?  128 THR A CG2  1  
ATOM 1944   H H    . THR A 1 128 ? 11.560  -10.453 146.166 1.00 0.00 ?  128 THR A H    1  
ATOM 1945   H HA   . THR A 1 128 ? 9.385   -9.718  147.720 1.00 0.00 ?  128 THR A HA   1  
ATOM 1946   H HB   . THR A 1 128 ? 10.830  -12.401 147.576 1.00 0.00 ?  128 THR A HB   1  
ATOM 1947   H HG1  . THR A 1 128 ? 9.820   -11.356 145.646 1.00 0.00 ?  128 THR A HG1  1  
ATOM 1948   H HG21 . THR A 1 128 ? 9.500   -12.743 149.448 1.00 0.00 ?  128 THR A HG21 1  
ATOM 1949   H HG22 . THR A 1 128 ? 8.211   -12.961 148.205 1.00 0.00 ?  128 THR A HG22 1  
ATOM 1950   H HG23 . THR A 1 128 ? 8.391   -11.377 149.050 1.00 0.00 ?  128 THR A HG23 1  
ATOM 1951   N N    . LEU A 1 129 ? 12.113  -10.581 149.353 1.00 0.00 ?  129 LEU A N    1  
ATOM 1952   C CA   . LEU A 1 129 ? 12.710  -10.514 150.659 1.00 0.00 ?  129 LEU A CA   1  
ATOM 1953   C C    . LEU A 1 129 ? 12.701  -9.086  151.106 1.00 0.00 ?  129 LEU A C    1  
ATOM 1954   O O    . LEU A 1 129 ? 12.484  -8.800  152.283 1.00 0.00 ?  129 LEU A O    1  
ATOM 1955   C CB   . LEU A 1 129 ? 14.164  -11.020 150.697 1.00 0.00 ?  129 LEU A CB   1  
ATOM 1956   C CG   . LEU A 1 129 ? 14.280  -12.505 151.099 1.00 0.00 ?  129 LEU A CG   1  
ATOM 1957   C CD1  . LEU A 1 129 ? 14.226  -12.673 152.627 1.00 0.00 ?  129 LEU A CD1  1  
ATOM 1958   C CD2  . LEU A 1 129 ? 13.214  -13.380 150.410 1.00 0.00 ?  129 LEU A CD2  1  
ATOM 1959   H H    . LEU A 1 129 ? 12.693  -10.899 148.607 1.00 0.00 ?  129 LEU A H    1  
ATOM 1960   H HA   . LEU A 1 129 ? 12.096  -11.096 151.328 1.00 0.00 ?  129 LEU A HA   1  
ATOM 1961   H HB2  . LEU A 1 129 ? 14.620  -10.880 149.691 1.00 0.00 ?  129 LEU A HB2  1  
ATOM 1962   H HB3  . LEU A 1 129 ? 14.742  -10.410 151.423 1.00 0.00 ?  129 LEU A HB3  1  
ATOM 1963   H HG   . LEU A 1 129 ? 15.276  -12.864 150.761 1.00 0.00 ?  129 LEU A HG   1  
ATOM 1964   H HD11 . LEU A 1 129 ? 15.176  -12.326 153.087 1.00 0.00 ?  129 LEU A HD11 1  
ATOM 1965   H HD12 . LEU A 1 129 ? 14.071  -13.740 152.892 1.00 0.00 ?  129 LEU A HD12 1  
ATOM 1966   H HD13 . LEU A 1 129 ? 13.389  -12.077 153.051 1.00 0.00 ?  129 LEU A HD13 1  
ATOM 1967   H HD21 . LEU A 1 129 ? 12.251  -13.324 150.961 1.00 0.00 ?  129 LEU A HD21 1  
ATOM 1968   H HD22 . LEU A 1 129 ? 13.546  -14.439 150.386 1.00 0.00 ?  129 LEU A HD22 1  
ATOM 1969   H HD23 . LEU A 1 129 ? 13.047  -13.041 149.368 1.00 0.00 ?  129 LEU A HD23 1  
ATOM 1970   N N    . GLU A 1 130 ? 12.946  -8.156  150.165 1.00 0.00 ?  130 GLU A N    1  
ATOM 1971   C CA   . GLU A 1 130 ? 12.961  -6.758  150.505 1.00 0.00 ?  130 GLU A CA   1  
ATOM 1972   C C    . GLU A 1 130 ? 11.593  -6.347  150.967 1.00 0.00 ?  130 GLU A C    1  
ATOM 1973   O O    . GLU A 1 130 ? 11.476  -5.569  151.893 1.00 0.00 ?  130 GLU A O    1  
ATOM 1974   C CB   . GLU A 1 130 ? 13.352  -5.841  149.332 1.00 0.00 ?  130 GLU A CB   1  
ATOM 1975   C CG   . GLU A 1 130 ? 13.415  -4.362  149.734 1.00 0.00 ?  130 GLU A CG   1  
ATOM 1976   C CD   . GLU A 1 130 ? 13.788  -3.535  148.511 1.00 0.00 ?  130 GLU A CD   1  
ATOM 1977   O OE1  . GLU A 1 130 ? 13.463  -3.973  147.373 1.00 0.00 ?  130 GLU A OE1  1  
ATOM 1978   O OE2  . GLU A 1 130 ? 14.402  -2.451  148.698 1.00 0.00 -1 130 GLU A OE2  1  
ATOM 1979   H H    . GLU A 1 130 ? 13.135  -8.388  149.212 1.00 0.00 ?  130 GLU A H    1  
ATOM 1980   H HA   . GLU A 1 130 ? 13.657  -6.634  151.319 1.00 0.00 ?  130 GLU A HA   1  
ATOM 1981   H HB2  . GLU A 1 130 ? 14.344  -6.158  148.958 1.00 0.00 ?  130 GLU A HB2  1  
ATOM 1982   H HB3  . GLU A 1 130 ? 12.616  -5.963  148.510 1.00 0.00 ?  130 GLU A HB3  1  
ATOM 1983   H HG2  . GLU A 1 130 ? 12.428  -4.023  150.120 1.00 0.00 ?  130 GLU A HG2  1  
ATOM 1984   H HG3  . GLU A 1 130 ? 14.181  -4.214  150.521 1.00 0.00 ?  130 GLU A HG3  1  
ATOM 1985   N N    . CYS A 1 131 ? 10.530  -6.837  150.298 1.00 0.00 ?  131 CYS A N    1  
ATOM 1986   C CA   . CYS A 1 131 ? 9.178   -6.464  150.657 1.00 0.00 ?  131 CYS A CA   1  
ATOM 1987   C C    . CYS A 1 131 ? 8.889   -6.879  152.068 1.00 0.00 ?  131 CYS A C    1  
ATOM 1988   O O    . CYS A 1 131 ? 8.322   -6.105  152.844 1.00 0.00 ?  131 CYS A O    1  
ATOM 1989   C CB   . CYS A 1 131 ? 8.115   -7.118  149.758 1.00 0.00 ?  131 CYS A CB   1  
ATOM 1990   S SG   . CYS A 1 131 ? 6.439   -6.598  150.226 1.00 0.00 ?  131 CYS A SG   1  
ATOM 1991   H H    . CYS A 1 131 ? 10.628  -7.448  149.523 1.00 0.00 ?  131 CYS A H    1  
ATOM 1992   H HA   . CYS A 1 131 ? 9.109   -5.390  150.586 1.00 0.00 ?  131 CYS A HA   1  
ATOM 1993   H HB2  . CYS A 1 131 ? 8.323   -6.843  148.700 1.00 0.00 ?  131 CYS A HB2  1  
ATOM 1994   H HB3  . CYS A 1 131 ? 8.202   -8.222  149.845 1.00 0.00 ?  131 CYS A HB3  1  
ATOM 1995   H HG   . CYS A 1 131 ? 5.970   -7.830  150.367 1.00 0.00 ?  131 CYS A HG   1  
ATOM 1996   N N    . PHE A 1 132 ? 9.241   -8.132  152.411 1.00 0.00 ?  132 PHE A N    1  
ATOM 1997   C CA   . PHE A 1 132 ? 8.980   -8.643  153.734 1.00 0.00 ?  132 PHE A CA   1  
ATOM 1998   C C    . PHE A 1 132 ? 9.698   -7.806  154.754 1.00 0.00 ?  132 PHE A C    1  
ATOM 1999   O O    . PHE A 1 132 ? 9.117   -7.397  155.760 1.00 0.00 ?  132 PHE A O    1  
ATOM 2000   C CB   . PHE A 1 132 ? 9.457   -10.092 153.912 1.00 0.00 ?  132 PHE A CB   1  
ATOM 2001   C CG   . PHE A 1 132 ? 9.245   -10.626 155.286 1.00 0.00 ?  132 PHE A CG   1  
ATOM 2002   C CD1  . PHE A 1 132 ? 10.283  -10.661 156.192 1.00 0.00 ?  132 PHE A CD1  1  
ATOM 2003   C CD2  . PHE A 1 132 ? 8.009   -11.094 155.664 1.00 0.00 ?  132 PHE A CD2  1  
ATOM 2004   C CE1  . PHE A 1 132 ? 10.083  -11.158 157.459 1.00 0.00 ?  132 PHE A CE1  1  
ATOM 2005   C CE2  . PHE A 1 132 ? 7.809   -11.590 156.928 1.00 0.00 ?  132 PHE A CE2  1  
ATOM 2006   C CZ   . PHE A 1 132 ? 8.846   -11.623 157.827 1.00 0.00 ?  132 PHE A CZ   1  
ATOM 2007   H H    . PHE A 1 132 ? 9.693   -8.754  151.774 1.00 0.00 ?  132 PHE A H    1  
ATOM 2008   H HA   . PHE A 1 132 ? 7.918   -8.578  153.906 1.00 0.00 ?  132 PHE A HA   1  
ATOM 2009   H HB2  . PHE A 1 132 ? 8.909   -10.758 153.214 1.00 0.00 ?  132 PHE A HB2  1  
ATOM 2010   H HB3  . PHE A 1 132 ? 10.545  -10.161 153.692 1.00 0.00 ?  132 PHE A HB3  1  
ATOM 2011   H HD1  . PHE A 1 132 ? 11.257  -10.297 155.907 1.00 0.00 ?  132 PHE A HD1  1  
ATOM 2012   H HD2  . PHE A 1 132 ? 7.188   -11.074 154.962 1.00 0.00 ?  132 PHE A HD2  1  
ATOM 2013   H HE1  . PHE A 1 132 ? 10.900  -11.184 158.164 1.00 0.00 ?  132 PHE A HE1  1  
ATOM 2014   H HE2  . PHE A 1 132 ? 6.836   -11.954 157.214 1.00 0.00 ?  132 PHE A HE2  1  
ATOM 2015   H HZ   . PHE A 1 132 ? 8.688   -12.013 158.822 1.00 0.00 ?  132 PHE A HZ   1  
ATOM 2016   N N    . VAL A 1 133 ? 10.992  -7.544  154.511 1.00 0.00 ?  133 VAL A N    1  
ATOM 2017   C CA   . VAL A 1 133 ? 11.787  -6.800  155.451 1.00 0.00 ?  133 VAL A CA   1  
ATOM 2018   C C    . VAL A 1 133 ? 11.251  -5.406  155.607 1.00 0.00 ?  133 VAL A C    1  
ATOM 2019   O O    . VAL A 1 133 ? 11.158  -4.907  156.715 1.00 0.00 ?  133 VAL A O    1  
ATOM 2020   C CB   . VAL A 1 133 ? 13.225  -6.694  155.029 1.00 0.00 ?  133 VAL A CB   1  
ATOM 2021   C CG1  . VAL A 1 133 ? 13.939  -5.704  155.965 1.00 0.00 ?  133 VAL A CG1  1  
ATOM 2022   C CG2  . VAL A 1 133 ? 13.843  -8.102  155.072 1.00 0.00 ?  133 VAL A CG2  1  
ATOM 2023   H H    . VAL A 1 133 ? 11.447  -7.826  153.670 1.00 0.00 ?  133 VAL A H    1  
ATOM 2024   H HA   . VAL A 1 133 ? 11.718  -7.308  156.400 1.00 0.00 ?  133 VAL A HA   1  
ATOM 2025   H HB   . VAL A 1 133 ? 13.285  -6.312  153.988 1.00 0.00 ?  133 VAL A HB   1  
ATOM 2026   H HG11 . VAL A 1 133 ? 13.840  -4.667  155.578 1.00 0.00 ?  133 VAL A HG11 1  
ATOM 2027   H HG12 . VAL A 1 133 ? 15.020  -5.954  156.038 1.00 0.00 ?  133 VAL A HG12 1  
ATOM 2028   H HG13 . VAL A 1 133 ? 13.496  -5.746  156.983 1.00 0.00 ?  133 VAL A HG13 1  
ATOM 2029   H HG21 . VAL A 1 133 ? 14.548  -8.188  155.927 1.00 0.00 ?  133 VAL A HG21 1  
ATOM 2030   H HG22 . VAL A 1 133 ? 14.398  -8.308  154.132 1.00 0.00 ?  133 VAL A HG22 1  
ATOM 2031   H HG23 . VAL A 1 133 ? 13.048  -8.869  155.190 1.00 0.00 ?  133 VAL A HG23 1  
ATOM 2032   N N    . GLY A 1 134 ? 10.901  -4.751  154.490 1.00 0.00 ?  134 GLY A N    1  
ATOM 2033   C CA   . GLY A 1 134 ? 10.445  -3.387  154.534 1.00 0.00 ?  134 GLY A CA   1  
ATOM 2034   C C    . GLY A 1 134 ? 9.183   -3.252  155.330 1.00 0.00 ?  134 GLY A C    1  
ATOM 2035   O O    . GLY A 1 134 ? 9.057   -2.316  156.114 1.00 0.00 ?  134 GLY A O    1  
ATOM 2036   H H    . GLY A 1 134 ? 10.936  -5.172  153.596 1.00 0.00 ?  134 GLY A H    1  
ATOM 2037   H HA2  . GLY A 1 134 ? 11.215  -2.809  155.019 1.00 0.00 ?  134 GLY A HA2  1  
ATOM 2038   H HA3  . GLY A 1 134 ? 10.248  -3.086  153.514 1.00 0.00 ?  134 GLY A HA3  1  
ATOM 2039   N N    . MET A 1 135 ? 8.211   -4.174  155.170 1.00 0.00 ?  135 MET A N    1  
ATOM 2040   C CA   . MET A 1 135 ? 6.983   -4.010  155.904 1.00 0.00 ?  135 MET A CA   1  
ATOM 2041   C C    . MET A 1 135 ? 7.253   -4.271  157.353 1.00 0.00 ?  135 MET A C    1  
ATOM 2042   O O    . MET A 1 135 ? 6.627   -3.664  158.224 1.00 0.00 ?  135 MET A O    1  
ATOM 2043   C CB   . MET A 1 135 ? 5.822   -4.911  155.425 1.00 0.00 ?  135 MET A CB   1  
ATOM 2044   C CG   . MET A 1 135 ? 6.092   -6.410  155.573 1.00 0.00 ?  135 MET A CG   1  
ATOM 2045   S SD   . MET A 1 135 ? 4.698   -7.427  155.004 1.00 0.00 ?  135 MET A SD   1  
ATOM 2046   C CE   . MET A 1 135 ? 5.466   -9.013  155.437 1.00 0.00 ?  135 MET A CE   1  
ATOM 2047   H H    . MET A 1 135 ? 8.292   -4.966  154.566 1.00 0.00 ?  135 MET A H    1  
ATOM 2048   H HA   . MET A 1 135 ? 6.701   -2.973  155.799 1.00 0.00 ?  135 MET A HA   1  
ATOM 2049   H HB2  . MET A 1 135 ? 4.910   -4.654  156.004 1.00 0.00 ?  135 MET A HB2  1  
ATOM 2050   H HB3  . MET A 1 135 ? 5.618   -4.690  154.355 1.00 0.00 ?  135 MET A HB3  1  
ATOM 2051   H HG2  . MET A 1 135 ? 6.999   -6.660  154.986 1.00 0.00 ?  135 MET A HG2  1  
ATOM 2052   H HG3  . MET A 1 135 ? 6.306   -6.633  156.639 1.00 0.00 ?  135 MET A HG3  1  
ATOM 2053   H HE1  . MET A 1 135 ? 6.434   -8.856  155.958 1.00 0.00 ?  135 MET A HE1  1  
ATOM 2054   H HE2  . MET A 1 135 ? 5.660   -9.622  154.528 1.00 0.00 ?  135 MET A HE2  1  
ATOM 2055   H HE3  . MET A 1 135 ? 4.806   -9.602  156.110 1.00 0.00 ?  135 MET A HE3  1  
ATOM 2056   N N    . SER A 1 136 ? 8.194   -5.190  157.646 1.00 0.00 ?  136 SER A N    1  
ATOM 2057   C CA   . SER A 1 136 ? 8.527   -5.483  159.013 1.00 0.00 ?  136 SER A CA   1  
ATOM 2058   C C    . SER A 1 136 ? 9.112   -4.247  159.630 1.00 0.00 ?  136 SER A C    1  
ATOM 2059   O O    . SER A 1 136 ? 8.821   -3.915  160.774 1.00 0.00 ?  136 SER A O    1  
ATOM 2060   C CB   . SER A 1 136 ? 9.556   -6.613  159.164 1.00 0.00 ?  136 SER A CB   1  
ATOM 2061   O OG   . SER A 1 136 ? 9.829   -6.838  160.538 1.00 0.00 ?  136 SER A OG   1  
ATOM 2062   H H    . SER A 1 136 ? 8.685   -5.703  156.945 1.00 0.00 ?  136 SER A H    1  
ATOM 2063   H HA   . SER A 1 136 ? 7.613   -5.736  159.526 1.00 0.00 ?  136 SER A HA   1  
ATOM 2064   H HB2  . SER A 1 136 ? 9.159   -7.551  158.718 1.00 0.00 ?  136 SER A HB2  1  
ATOM 2065   H HB3  . SER A 1 136 ? 10.501  -6.340  158.648 1.00 0.00 ?  136 SER A HB3  1  
ATOM 2066   H HG   . SER A 1 136 ? 9.405   -7.669  160.760 1.00 0.00 ?  136 SER A HG   1  
ATOM 2067   N N    . GLY A 1 137 ? 9.981   -3.560  158.864 1.00 0.00 ?  137 GLY A N    1  
ATOM 2068   C CA   . GLY A 1 137 ? 10.644  -2.377  159.339 1.00 0.00 ?  137 GLY A CA   1  
ATOM 2069   C C    . GLY A 1 137 ? 9.636   -1.327  159.667 1.00 0.00 ?  137 GLY A C    1  
ATOM 2070   O O    . GLY A 1 137 ? 9.810   -0.593  160.634 1.00 0.00 ?  137 GLY A O    1  
ATOM 2071   H H    . GLY A 1 137 ? 10.214  -3.850  157.947 1.00 0.00 ?  137 GLY A H    1  
ATOM 2072   H HA2  . GLY A 1 137 ? 11.175  -2.644  160.241 1.00 0.00 ?  137 GLY A HA2  1  
ATOM 2073   H HA3  . GLY A 1 137 ? 11.278  -2.020  158.540 1.00 0.00 ?  137 GLY A HA3  1  
ATOM 2074   N N    . ILE A 1 138 ? 8.579   -1.200  158.838 1.00 0.00 ?  138 ILE A N    1  
ATOM 2075   C CA   . ILE A 1 138 ? 7.570   -0.201  159.091 1.00 0.00 ?  138 ILE A CA   1  
ATOM 2076   C C    . ILE A 1 138 ? 6.933   -0.492  160.415 1.00 0.00 ?  138 ILE A C    1  
ATOM 2077   O O    . ILE A 1 138 ? 6.710   0.419   161.211 1.00 0.00 ?  138 ILE A O    1  
ATOM 2078   C CB   . ILE A 1 138 ? 6.481   -0.163  158.049 1.00 0.00 ?  138 ILE A CB   1  
ATOM 2079   C CG1  . ILE A 1 138 ? 7.019   0.353   156.693 1.00 0.00 ?  138 ILE A CG1  1  
ATOM 2080   C CG2  . ILE A 1 138 ? 5.329   0.707   158.585 1.00 0.00 ?  138 ILE A CG2  1  
ATOM 2081   C CD1  . ILE A 1 138 ? 7.555   1.789   156.745 1.00 0.00 ?  138 ILE A CD1  1  
ATOM 2082   H H    . ILE A 1 138 ? 8.463   -1.761  158.022 1.00 0.00 ?  138 ILE A H    1  
ATOM 2083   H HA   . ILE A 1 138 ? 8.070   0.753   159.151 1.00 0.00 ?  138 ILE A HA   1  
ATOM 2084   H HB   . ILE A 1 138 ? 6.091   -1.193  157.898 1.00 0.00 ?  138 ILE A HB   1  
ATOM 2085   H HG12 . ILE A 1 138 ? 7.834   -0.316  156.354 1.00 0.00 ?  138 ILE A HG12 1  
ATOM 2086   H HG13 . ILE A 1 138 ? 6.204   0.303   155.942 1.00 0.00 ?  138 ILE A HG13 1  
ATOM 2087   H HG21 . ILE A 1 138 ? 4.645   0.098   159.215 1.00 0.00 ?  138 ILE A HG21 1  
ATOM 2088   H HG22 . ILE A 1 138 ? 4.746   1.136   157.743 1.00 0.00 ?  138 ILE A HG22 1  
ATOM 2089   H HG23 . ILE A 1 138 ? 5.730   1.540   159.200 1.00 0.00 ?  138 ILE A HG23 1  
ATOM 2090   H HD11 . ILE A 1 138 ? 7.742   2.163   155.716 1.00 0.00 ?  138 ILE A HD11 1  
ATOM 2091   H HD12 . ILE A 1 138 ? 8.508   1.829   157.312 1.00 0.00 ?  138 ILE A HD12 1  
ATOM 2092   H HD13 . ILE A 1 138 ? 6.821   2.463   157.235 1.00 0.00 ?  138 ILE A HD13 1  
ATOM 2093   N N    . ALA A 1 139 ? 6.611   -1.775  160.673 1.00 0.00 ?  139 ALA A N    1  
ATOM 2094   C CA   . ALA A 1 139 ? 5.979   -2.135  161.916 1.00 0.00 ?  139 ALA A CA   1  
ATOM 2095   C C    . ALA A 1 139 ? 6.896   -1.807  163.060 1.00 0.00 ?  139 ALA A C    1  
ATOM 2096   O O    . ALA A 1 139 ? 6.452   -1.324  164.095 1.00 0.00 ?  139 ALA A O    1  
ATOM 2097   C CB   . ALA A 1 139 ? 5.642   -3.632  162.008 1.00 0.00 ?  139 ALA A CB   1  
ATOM 2098   H H    . ALA A 1 139 ? 6.794   -2.518  160.031 1.00 0.00 ?  139 ALA A H    1  
ATOM 2099   H HA   . ALA A 1 139 ? 5.078   -1.547  162.005 1.00 0.00 ?  139 ALA A HA   1  
ATOM 2100   H HB1  . ALA A 1 139 ? 4.929   -3.816  162.839 1.00 0.00 ?  139 ALA A HB1  1  
ATOM 2101   H HB2  . ALA A 1 139 ? 6.563   -4.223  162.193 1.00 0.00 ?  139 ALA A HB2  1  
ATOM 2102   H HB3  . ALA A 1 139 ? 5.179   -3.982  161.060 1.00 0.00 ?  139 ALA A HB3  1  
ATOM 2103   N N    . LEU A 1 140 ? 8.202   -2.077  162.893 1.00 0.00 ?  140 LEU A N    1  
ATOM 2104   C CA   . LEU A 1 140 ? 9.152   -1.825  163.946 1.00 0.00 ?  140 LEU A CA   1  
ATOM 2105   C C    . LEU A 1 140 ? 9.203   -0.354  164.249 1.00 0.00 ?  140 LEU A C    1  
ATOM 2106   O O    . LEU A 1 140 ? 9.209   0.043   165.412 1.00 0.00 ?  140 LEU A O    1  
ATOM 2107   C CB   . LEU A 1 140 ? 10.577  -2.285  163.568 1.00 0.00 ?  140 LEU A CB   1  
ATOM 2108   C CG   . LEU A 1 140 ? 11.627  -2.026  164.667 1.00 0.00 ?  140 LEU A CG   1  
ATOM 2109   C CD1  . LEU A 1 140 ? 11.274  -2.768  165.964 1.00 0.00 ?  140 LEU A CD1  1  
ATOM 2110   C CD2  . LEU A 1 140 ? 13.037  -2.407  164.182 1.00 0.00 ?  140 LEU A CD2  1  
ATOM 2111   H H    . LEU A 1 140 ? 8.561   -2.471  162.055 1.00 0.00 ?  140 LEU A H    1  
ATOM 2112   H HA   . LEU A 1 140 ? 8.815   -2.354  164.823 1.00 0.00 ?  140 LEU A HA   1  
ATOM 2113   H HB2  . LEU A 1 140 ? 10.553  -3.373  163.340 1.00 0.00 ?  140 LEU A HB2  1  
ATOM 2114   H HB3  . LEU A 1 140 ? 10.893  -1.752  162.646 1.00 0.00 ?  140 LEU A HB3  1  
ATOM 2115   H HG   . LEU A 1 140 ? 11.637  -0.939  164.892 1.00 0.00 ?  140 LEU A HG   1  
ATOM 2116   H HD11 . LEU A 1 140 ? 12.197  -2.987  166.542 1.00 0.00 ?  140 LEU A HD11 1  
ATOM 2117   H HD12 . LEU A 1 140 ? 10.763  -3.727  165.734 1.00 0.00 ?  140 LEU A HD12 1  
ATOM 2118   H HD13 . LEU A 1 140 ? 10.600  -2.148  166.593 1.00 0.00 ?  140 LEU A HD13 1  
ATOM 2119   H HD21 . LEU A 1 140 ? 13.075  -3.484  163.916 1.00 0.00 ?  140 LEU A HD21 1  
ATOM 2120   H HD22 . LEU A 1 140 ? 13.784  -2.212  164.981 1.00 0.00 ?  140 LEU A HD22 1  
ATOM 2121   H HD23 . LEU A 1 140 ? 13.311  -1.810  163.287 1.00 0.00 ?  140 LEU A HD23 1  
ATOM 2122   N N    . SER A 1 141 ? 9.257   0.489   163.204 1.00 0.00 ?  141 SER A N    1  
ATOM 2123   C CA   . SER A 1 141 ? 9.364   1.907   163.420 1.00 0.00 ?  141 SER A CA   1  
ATOM 2124   C C    . SER A 1 141 ? 8.122   2.429   164.071 1.00 0.00 ?  141 SER A C    1  
ATOM 2125   O O    . SER A 1 141 ? 8.196   3.300   164.934 1.00 0.00 ?  141 SER A O    1  
ATOM 2126   C CB   . SER A 1 141 ? 9.580   2.705   162.124 1.00 0.00 ?  141 SER A CB   1  
ATOM 2127   O OG   . SER A 1 141 ? 8.459   2.559   161.266 1.00 0.00 ?  141 SER A OG   1  
ATOM 2128   H H    . SER A 1 141 ? 9.230   0.181   162.261 1.00 0.00 ?  141 SER A H    1  
ATOM 2129   H HA   . SER A 1 141 ? 10.197  2.065   164.087 1.00 0.00 ?  141 SER A HA   1  
ATOM 2130   H HB2  . SER A 1 141 ? 9.715   3.783   162.358 1.00 0.00 ?  141 SER A HB2  1  
ATOM 2131   H HB3  . SER A 1 141 ? 10.484  2.335   161.596 1.00 0.00 ?  141 SER A HB3  1  
ATOM 2132   H HG   . SER A 1 141 ? 7.908   3.331   161.417 1.00 0.00 ?  141 SER A HG   1  
ATOM 2133   N N    . THR A 1 142 ? 6.943   1.912   163.687 1.00 0.00 ?  142 THR A N    1  
ATOM 2134   C CA   . THR A 1 142 ? 5.730   2.424   164.266 1.00 0.00 ?  142 THR A CA   1  
ATOM 2135   C C    . THR A 1 142 ? 5.668   2.011   165.701 1.00 0.00 ?  142 THR A C    1  
ATOM 2136   O O    . THR A 1 142 ? 5.172   2.760   166.544 1.00 0.00 ?  142 THR A O    1  
ATOM 2137   C CB   . THR A 1 142 ? 4.487   1.923   163.589 1.00 0.00 ?  142 THR A CB   1  
ATOM 2138   O OG1  . THR A 1 142 ? 4.428   0.506   163.662 1.00 0.00 ?  142 THR A OG1  1  
ATOM 2139   C CG2  . THR A 1 142 ? 4.506   2.380   162.123 1.00 0.00 ?  142 THR A CG2  1  
ATOM 2140   H H    . THR A 1 142 ? 6.856   1.192   163.006 1.00 0.00 ?  142 THR A H    1  
ATOM 2141   H HA   . THR A 1 142 ? 5.777   3.500   164.212 1.00 0.00 ?  142 THR A HA   1  
ATOM 2142   H HB   . THR A 1 142 ? 3.587   2.346   164.081 1.00 0.00 ?  142 THR A HB   1  
ATOM 2143   H HG1  . THR A 1 142 ? 3.612   0.298   164.122 1.00 0.00 ?  142 THR A HG1  1  
ATOM 2144   H HG21 . THR A 1 142 ? 3.581   2.947   161.884 1.00 0.00 ?  142 THR A HG21 1  
ATOM 2145   H HG22 . THR A 1 142 ? 4.568   1.502   161.446 1.00 0.00 ?  142 THR A HG22 1  
ATOM 2146   H HG23 . THR A 1 142 ? 5.383   3.036   161.935 1.00 0.00 ?  142 THR A HG23 1  
ATOM 2147   N N    . GLY A 1 143 ? 6.153   0.793   166.009 1.00 0.00 ?  143 GLY A N    1  
ATOM 2148   C CA   . GLY A 1 143 ? 6.121   0.316   167.363 1.00 0.00 ?  143 GLY A CA   1  
ATOM 2149   C C    . GLY A 1 143 ? 6.986   1.191   168.217 1.00 0.00 ?  143 GLY A C    1  
ATOM 2150   O O    . GLY A 1 143 ? 6.611   1.545   169.332 1.00 0.00 ?  143 GLY A O    1  
ATOM 2151   H H    . GLY A 1 143 ? 6.535   0.178   165.329 1.00 0.00 ?  143 GLY A H    1  
ATOM 2152   H HA2  . GLY A 1 143 ? 5.100   0.388   167.708 1.00 0.00 ?  143 GLY A HA2  1  
ATOM 2153   H HA3  . GLY A 1 143 ? 6.523   -0.687  167.363 1.00 0.00 ?  143 GLY A HA3  1  
ATOM 2154   N N    . LEU A 1 144 ? 8.174   1.560   167.703 1.00 0.00 ?  144 LEU A N    1  
ATOM 2155   C CA   . LEU A 1 144 ? 9.080   2.377   168.465 1.00 0.00 ?  144 LEU A CA   1  
ATOM 2156   C C    . LEU A 1 144 ? 8.465   3.721   168.697 1.00 0.00 ?  144 LEU A C    1  
ATOM 2157   O O    . LEU A 1 144 ? 8.625   4.303   169.769 1.00 0.00 ?  144 LEU A O    1  
ATOM 2158   C CB   . LEU A 1 144 ? 10.435  2.597   167.769 1.00 0.00 ?  144 LEU A CB   1  
ATOM 2159   C CG   . LEU A 1 144 ? 11.290  1.320   167.710 1.00 0.00 ?  144 LEU A CG   1  
ATOM 2160   C CD1  . LEU A 1 144 ? 12.524  1.514   166.815 1.00 0.00 ?  144 LEU A CD1  1  
ATOM 2161   C CD2  . LEU A 1 144 ? 11.693  0.848   169.118 1.00 0.00 ?  144 LEU A CD2  1  
ATOM 2162   H H    . LEU A 1 144 ? 8.475   1.283   166.794 1.00 0.00 ?  144 LEU A H    1  
ATOM 2163   H HA   . LEU A 1 144 ? 9.228   1.892   169.417 1.00 0.00 ?  144 LEU A HA   1  
ATOM 2164   H HB2  . LEU A 1 144 ? 10.253  2.964   166.734 1.00 0.00 ?  144 LEU A HB2  1  
ATOM 2165   H HB3  . LEU A 1 144 ? 11.001  3.380   168.317 1.00 0.00 ?  144 LEU A HB3  1  
ATOM 2166   H HG   . LEU A 1 144 ? 10.668  0.521   167.255 1.00 0.00 ?  144 LEU A HG   1  
ATOM 2167   H HD11 . LEU A 1 144 ? 13.010  0.537   166.609 1.00 0.00 ?  144 LEU A HD11 1  
ATOM 2168   H HD12 . LEU A 1 144 ? 13.262  2.179   167.314 1.00 0.00 ?  144 LEU A HD12 1  
ATOM 2169   H HD13 . LEU A 1 144 ? 12.231  1.976   165.847 1.00 0.00 ?  144 LEU A HD13 1  
ATOM 2170   H HD21 . LEU A 1 144 ? 12.055  1.707   169.723 1.00 0.00 ?  144 LEU A HD21 1  
ATOM 2171   H HD22 . LEU A 1 144 ? 12.504  0.092   169.053 1.00 0.00 ?  144 LEU A HD22 1  
ATOM 2172   H HD23 . LEU A 1 144 ? 10.822  0.392   169.636 1.00 0.00 ?  144 LEU A HD23 1  
ATOM 2173   N N    . VAL A 1 145 ? 7.768   4.254   167.676 1.00 0.00 ?  145 VAL A N    1  
ATOM 2174   C CA   . VAL A 1 145 ? 7.175   5.560   167.789 1.00 0.00 ?  145 VAL A CA   1  
ATOM 2175   C C    . VAL A 1 145 ? 6.158   5.574   168.890 1.00 0.00 ?  145 VAL A C    1  
ATOM 2176   O O    . VAL A 1 145 ? 6.142   6.497   169.705 1.00 0.00 ?  145 VAL A O    1  
ATOM 2177   C CB   . VAL A 1 145 ? 6.485   5.996   166.531 1.00 0.00 ?  145 VAL A CB   1  
ATOM 2178   C CG1  . VAL A 1 145 ? 5.701   7.282   166.835 1.00 0.00 ?  145 VAL A CG1  1  
ATOM 2179   C CG2  . VAL A 1 145 ? 7.549   6.191   165.439 1.00 0.00 ?  145 VAL A CG2  1  
ATOM 2180   H H    . VAL A 1 145 ? 7.642   3.782   166.808 1.00 0.00 ?  145 VAL A H    1  
ATOM 2181   H HA   . VAL A 1 145 ? 7.966   6.251   168.035 1.00 0.00 ?  145 VAL A HA   1  
ATOM 2182   H HB   . VAL A 1 145 ? 5.773   5.212   166.200 1.00 0.00 ?  145 VAL A HB   1  
ATOM 2183   H HG11 . VAL A 1 145 ? 5.585   7.890   165.912 1.00 0.00 ?  145 VAL A HG11 1  
ATOM 2184   H HG12 . VAL A 1 145 ? 6.238   7.891   167.595 1.00 0.00 ?  145 VAL A HG12 1  
ATOM 2185   H HG13 . VAL A 1 145 ? 4.692   7.035   167.227 1.00 0.00 ?  145 VAL A HG13 1  
ATOM 2186   H HG21 . VAL A 1 145 ? 7.569   7.251   165.105 1.00 0.00 ?  145 VAL A HG21 1  
ATOM 2187   H HG22 . VAL A 1 145 ? 7.325   5.548   164.562 1.00 0.00 ?  145 VAL A HG22 1  
ATOM 2188   H HG23 . VAL A 1 145 ? 8.555   5.923   165.827 1.00 0.00 ?  145 VAL A HG23 1  
ATOM 2189   N N    . PHE A 1 146 ? 5.278   4.554   168.939 1.00 0.00 ?  146 PHE A N    1  
ATOM 2190   C CA   . PHE A 1 146 ? 4.260   4.537   169.955 1.00 0.00 ?  146 PHE A CA   1  
ATOM 2191   C C    . PHE A 1 146 ? 4.901   4.398   171.298 1.00 0.00 ?  146 PHE A C    1  
ATOM 2192   O O    . PHE A 1 146 ? 4.427   4.979   172.270 1.00 0.00 ?  146 PHE A O    1  
ATOM 2193   C CB   . PHE A 1 146 ? 3.221   3.417   169.832 1.00 0.00 ?  146 PHE A CB   1  
ATOM 2194   C CG   . PHE A 1 146 ? 2.112   3.591   170.815 1.00 0.00 ?  146 PHE A CG   1  
ATOM 2195   C CD1  . PHE A 1 146 ? 2.171   2.986   172.049 1.00 0.00 ?  146 PHE A CD1  1  
ATOM 2196   C CD2  . PHE A 1 146 ? 1.027   4.380   170.509 1.00 0.00 ?  146 PHE A CD2  1  
ATOM 2197   C CE1  . PHE A 1 146 ? 1.165   3.166   172.964 1.00 0.00 ?  146 PHE A CE1  1  
ATOM 2198   C CE2  . PHE A 1 146 ? 0.018   4.559   171.424 1.00 0.00 ?  146 PHE A CE2  1  
ATOM 2199   C CZ   . PHE A 1 146 ? 0.089   3.952   172.652 1.00 0.00 ?  146 PHE A CZ   1  
ATOM 2200   H H    . PHE A 1 146 ? 5.290   3.792   168.294 1.00 0.00 ?  146 PHE A H    1  
ATOM 2201   H HA   . PHE A 1 146 ? 3.765   5.496   169.914 1.00 0.00 ?  146 PHE A HA   1  
ATOM 2202   H HB2  . PHE A 1 146 ? 2.773   3.417   168.815 1.00 0.00 ?  146 PHE A HB2  1  
ATOM 2203   H HB3  . PHE A 1 146 ? 3.693   2.431   170.025 1.00 0.00 ?  146 PHE A HB3  1  
ATOM 2204   H HD1  . PHE A 1 146 ? 3.016   2.373   172.300 1.00 0.00 ?  146 PHE A HD1  1  
ATOM 2205   H HD2  . PHE A 1 146 ? 0.966   4.860   169.543 1.00 0.00 ?  146 PHE A HD2  1  
ATOM 2206   H HE1  . PHE A 1 146 ? 1.221   2.685   173.930 1.00 0.00 ?  146 PHE A HE1  1  
ATOM 2207   H HE2  . PHE A 1 146 ? -0.831  5.179   171.178 1.00 0.00 ?  146 PHE A HE2  1  
ATOM 2208   H HZ   . PHE A 1 146 ? -0.702  4.094   173.373 1.00 0.00 ?  146 PHE A HZ   1  
ATOM 2209   N N    . ALA A 1 147 ? 5.965   3.577   171.384 1.00 0.00 ?  147 ALA A N    1  
ATOM 2210   C CA   . ALA A 1 147 ? 6.622   3.345   172.645 1.00 0.00 ?  147 ALA A CA   1  
ATOM 2211   C C    . ALA A 1 147 ? 7.142   4.646   173.179 1.00 0.00 ?  147 ALA A C    1  
ATOM 2212   O O    . ALA A 1 147 ? 7.112   4.874   174.389 1.00 0.00 ?  147 ALA A O    1  
ATOM 2213   C CB   . ALA A 1 147 ? 7.811   2.378   172.538 1.00 0.00 ?  147 ALA A CB   1  
ATOM 2214   H H    . ALA A 1 147 ? 6.338   3.097   170.594 1.00 0.00 ?  147 ALA A H    1  
ATOM 2215   H HA   . ALA A 1 147 ? 5.886   2.953   173.328 1.00 0.00 ?  147 ALA A HA   1  
ATOM 2216   H HB1  . ALA A 1 147 ? 7.578   1.558   171.825 1.00 0.00 ?  147 ALA A HB1  1  
ATOM 2217   H HB2  . ALA A 1 147 ? 8.037   1.932   173.530 1.00 0.00 ?  147 ALA A HB2  1  
ATOM 2218   H HB3  . ALA A 1 147 ? 8.714   2.915   172.177 1.00 0.00 ?  147 ALA A HB3  1  
ATOM 2219   N N    . ARG A 1 148 ? 7.673   5.510   172.292 1.00 0.00 ?  148 ARG A N    1  
ATOM 2220   C CA   . ARG A 1 148 ? 8.204   6.771   172.740 1.00 0.00 ?  148 ARG A CA   1  
ATOM 2221   C C    . ARG A 1 148 ? 7.101   7.588   173.351 1.00 0.00 ?  148 ARG A C    1  
ATOM 2222   O O    . ARG A 1 148 ? 7.302   8.235   174.379 1.00 0.00 ?  148 ARG A O    1  
ATOM 2223   C CB   . ARG A 1 148 ? 8.812   7.629   171.623 1.00 0.00 ?  148 ARG A CB   1  
ATOM 2224   C CG   . ARG A 1 148 ? 9.576   8.827   172.189 1.00 0.00 ?  148 ARG A CG   1  
ATOM 2225   C CD   . ARG A 1 148 ? 10.100  9.765   171.107 1.00 0.00 ?  148 ARG A CD   1  
ATOM 2226   N NE   . ARG A 1 148 ? 10.967  10.785  171.766 1.00 0.00 ?  148 ARG A NE   1  
ATOM 2227   C CZ   . ARG A 1 148 ? 10.414  11.848  172.415 1.00 0.00 ?  148 ARG A CZ   1  
ATOM 2228   N NH1  . ARG A 1 148 ? 9.056   11.958  172.521 1.00 0.00 1  148 ARG A NH1  1  
ATOM 2229   N NH2  . ARG A 1 148 ? 11.224  12.792  172.980 1.00 0.00 ?  148 ARG A NH2  1  
ATOM 2230   H H    . ARG A 1 148 ? 7.741   5.311   171.317 1.00 0.00 ?  148 ARG A H    1  
ATOM 2231   H HA   . ARG A 1 148 ? 8.943   6.563   173.492 1.00 0.00 ?  148 ARG A HA   1  
ATOM 2232   H HB2  . ARG A 1 148 ? 9.503   7.003   171.016 1.00 0.00 ?  148 ARG A HB2  1  
ATOM 2233   H HB3  . ARG A 1 148 ? 8.002   7.997   170.960 1.00 0.00 ?  148 ARG A HB3  1  
ATOM 2234   H HG2  . ARG A 1 148 ? 8.911   9.402   172.864 1.00 0.00 ?  148 ARG A HG2  1  
ATOM 2235   H HG3  . ARG A 1 148 ? 10.434  8.455   172.790 1.00 0.00 ?  148 ARG A HG3  1  
ATOM 2236   H HD2  . ARG A 1 148 ? 10.706  9.209   170.363 1.00 0.00 ?  148 ARG A HD2  1  
ATOM 2237   H HD3  . ARG A 1 148 ? 9.268   10.294  170.600 1.00 0.00 ?  148 ARG A HD3  1  
ATOM 2238   H HE   . ARG A 1 148 ? 11.964  10.699  171.717 1.00 0.00 ?  148 ARG A HE   1  
ATOM 2239   H HH11 . ARG A 1 148 ? 8.464   11.258  172.122 1.00 0.00 ?  148 ARG A HH11 1  
ATOM 2240   H HH12 . ARG A 1 148 ? 8.653   12.739  172.999 1.00 0.00 ?  148 ARG A HH12 1  
ATOM 2241   H HH21 . ARG A 1 148 ? 12.220  12.700  172.915 1.00 0.00 ?  148 ARG A HH21 1  
ATOM 2242   H HH22 . ARG A 1 148 ? 10.823  13.574  173.458 1.00 0.00 ?  148 ARG A HH22 1  
ATOM 2243   N N    . PHE A 1 149 ? 5.912   7.598   172.717 1.00 0.00 ?  149 PHE A N    1  
ATOM 2244   C CA   . PHE A 1 149 ? 4.822   8.390   173.234 1.00 0.00 ?  149 PHE A CA   1  
ATOM 2245   C C    . PHE A 1 149 ? 4.398   7.840   174.555 1.00 0.00 ?  149 PHE A C    1  
ATOM 2246   O O    . PHE A 1 149 ? 3.993   8.591   175.441 1.00 0.00 ?  149 PHE A O    1  
ATOM 2247   C CB   . PHE A 1 149 ? 3.592   8.437   172.315 1.00 0.00 ?  149 PHE A CB   1  
ATOM 2248   C CG   . PHE A 1 149 ? 3.755   9.378   171.173 1.00 0.00 ?  149 PHE A CG   1  
ATOM 2249   C CD1  . PHE A 1 149 ? 3.646   10.736  171.380 1.00 0.00 ?  149 PHE A CD1  1  
ATOM 2250   C CD2  . PHE A 1 149 ? 4.021   8.912   169.905 1.00 0.00 ?  149 PHE A CD2  1  
ATOM 2251   C CE1  . PHE A 1 149 ? 3.802   11.614  170.336 1.00 0.00 ?  149 PHE A CE1  1  
ATOM 2252   C CE2  . PHE A 1 149 ? 4.174   9.793   168.860 1.00 0.00 ?  149 PHE A CE2  1  
ATOM 2253   C CZ   . PHE A 1 149 ? 4.066   11.143  169.077 1.00 0.00 ?  149 PHE A CZ   1  
ATOM 2254   H H    . PHE A 1 149 ? 5.739   7.079   171.880 1.00 0.00 ?  149 PHE A H    1  
ATOM 2255   H HA   . PHE A 1 149 ? 5.203   9.389   173.384 1.00 0.00 ?  149 PHE A HA   1  
ATOM 2256   H HB2  . PHE A 1 149 ? 3.397   7.430   171.888 1.00 0.00 ?  149 PHE A HB2  1  
ATOM 2257   H HB3  . PHE A 1 149 ? 2.699   8.760   172.892 1.00 0.00 ?  149 PHE A HB3  1  
ATOM 2258   H HD1  . PHE A 1 149 ? 3.438   11.113  172.370 1.00 0.00 ?  149 PHE A HD1  1  
ATOM 2259   H HD2  . PHE A 1 149 ? 4.107   7.850   169.730 1.00 0.00 ?  149 PHE A HD2  1  
ATOM 2260   H HE1  . PHE A 1 149 ? 3.715   12.677  170.507 1.00 0.00 ?  149 PHE A HE1  1  
ATOM 2261   H HE2  . PHE A 1 149 ? 4.380   9.422   167.868 1.00 0.00 ?  149 PHE A HE2  1  
ATOM 2262   H HZ   . PHE A 1 149 ? 4.191   11.834  168.258 1.00 0.00 ?  149 PHE A HZ   1  
ATOM 2263   N N    . ALA A 1 150 ? 4.471   6.507   174.700 1.00 0.00 ?  150 ALA A N    1  
ATOM 2264   C CA   . ALA A 1 150 ? 4.074   5.862   175.923 1.00 0.00 ?  150 ALA A CA   1  
ATOM 2265   C C    . ALA A 1 150 ? 4.925   6.371   177.051 1.00 0.00 ?  150 ALA A C    1  
ATOM 2266   O O    . ALA A 1 150 ? 4.436   6.529   178.170 1.00 0.00 ?  150 ALA A O    1  
ATOM 2267   C CB   . ALA A 1 150 ? 4.220   4.333   175.871 1.00 0.00 ?  150 ALA A CB   1  
ATOM 2268   H H    . ALA A 1 150 ? 4.776   5.911   173.967 1.00 0.00 ?  150 ALA A H    1  
ATOM 2269   H HA   . ALA A 1 150 ? 3.046   6.129   176.110 1.00 0.00 ?  150 ALA A HA   1  
ATOM 2270   H HB1  . ALA A 1 150 ? 3.234   3.846   176.029 1.00 0.00 ?  150 ALA A HB1  1  
ATOM 2271   H HB2  . ALA A 1 150 ? 4.918   3.984   176.660 1.00 0.00 ?  150 ALA A HB2  1  
ATOM 2272   H HB3  . ALA A 1 150 ? 4.616   4.018   174.882 1.00 0.00 ?  150 ALA A HB3  1  
ATOM 2273   N N    . ARG A 1 151 ? 6.229   6.615   176.790 1.00 0.00 ?  151 ARG A N    1  
ATOM 2274   C CA   . ARG A 1 151 ? 7.108   7.082   177.838 1.00 0.00 ?  151 ARG A CA   1  
ATOM 2275   C C    . ARG A 1 151 ? 6.640   8.455   178.300 1.00 0.00 ?  151 ARG A C    1  
ATOM 2276   O O    . ARG A 1 151 ? 6.601   9.388   177.502 1.00 0.00 ?  151 ARG A O    1  
ATOM 2277   C CB   . ARG A 1 151 ? 8.560   7.265   177.328 1.00 0.00 ?  151 ARG A CB   1  
ATOM 2278   C CG   . ARG A 1 151 ? 9.547   7.743   178.409 1.00 0.00 ?  151 ARG A CG   1  
ATOM 2279   C CD   . ARG A 1 151 ? 9.806   6.688   179.482 1.00 0.00 ?  151 ARG A CD   1  
ATOM 2280   N NE   . ARG A 1 151 ? 10.733  7.253   180.504 1.00 0.00 ?  151 ARG A NE   1  
ATOM 2281   C CZ   . ARG A 1 151 ? 12.077  7.272   180.274 1.00 0.00 ?  151 ARG A CZ   1  
ATOM 2282   N NH1  . ARG A 1 151 ? 12.570  6.848   179.075 1.00 0.00 1  151 ARG A NH1  1  
ATOM 2283   N NH2  . ARG A 1 151 ? 12.926  7.723   181.243 1.00 0.00 ?  151 ARG A NH2  1  
ATOM 2284   H H    . ARG A 1 151 ? 6.636   6.469   175.890 1.00 0.00 ?  151 ARG A H    1  
ATOM 2285   H HA   . ARG A 1 151 ? 7.085   6.355   178.624 1.00 0.00 ?  151 ARG A HA   1  
ATOM 2286   H HB2  . ARG A 1 151 ? 8.918   6.296   176.919 1.00 0.00 ?  151 ARG A HB2  1  
ATOM 2287   H HB3  . ARG A 1 151 ? 8.556   8.003   176.498 1.00 0.00 ?  151 ARG A HB3  1  
ATOM 2288   H HG2  . ARG A 1 151 ? 10.512  7.998   177.922 1.00 0.00 ?  151 ARG A HG2  1  
ATOM 2289   H HG3  . ARG A 1 151 ? 9.158   8.665   178.890 1.00 0.00 ?  151 ARG A HG3  1  
ATOM 2290   H HD2  . ARG A 1 151 ? 8.867   6.403   179.991 1.00 0.00 ?  151 ARG A HD2  1  
ATOM 2291   H HD3  . ARG A 1 151 ? 10.284  5.786   179.046 1.00 0.00 ?  151 ARG A HD3  1  
ATOM 2292   H HE   . ARG A 1 151 ? 10.370  7.588   181.374 1.00 0.00 ?  151 ARG A HE   1  
ATOM 2293   H HH11 . ARG A 1 151 ? 11.946  6.522   178.365 1.00 0.00 ?  151 ARG A HH11 1  
ATOM 2294   H HH12 . ARG A 1 151 ? 13.556  6.862   178.907 1.00 0.00 ?  151 ARG A HH12 1  
ATOM 2295   H HH21 . ARG A 1 151 ? 12.564  8.038   182.120 1.00 0.00 ?  151 ARG A HH21 1  
ATOM 2296   H HH22 . ARG A 1 151 ? 13.914  7.735   181.077 1.00 0.00 ?  151 ARG A HH22 1  
ATOM 2297   N N    . PRO A 1 152 ? 6.279   8.615   179.578 1.00 0.00 ?  152 PRO A N    1  
ATOM 2298   C CA   . PRO A 1 152 ? 5.897   9.916   180.094 1.00 0.00 ?  152 PRO A CA   1  
ATOM 2299   C C    . PRO A 1 152 ? 7.098   10.735  180.442 1.00 0.00 ?  152 PRO A C    1  
ATOM 2300   O O    . PRO A 1 152 ? 8.201   10.199  180.550 1.00 0.00 ?  152 PRO A O    1  
ATOM 2301   C CB   . PRO A 1 152 ? 5.076   9.605   181.336 1.00 0.00 ?  152 PRO A CB   1  
ATOM 2302   C CG   . PRO A 1 152 ? 5.723   8.341   181.872 1.00 0.00 ?  152 PRO A CG   1  
ATOM 2303   C CD   . PRO A 1 152 ? 6.161   7.573   180.622 1.00 0.00 ?  152 PRO A CD   1  
ATOM 2304   H HA   . PRO A 1 152 ? 5.290   10.456  179.382 1.00 0.00 ?  152 PRO A HA   1  
ATOM 2305   H HB2  . PRO A 1 152 ? 5.148   10.434  182.075 1.00 0.00 ?  152 PRO A HB2  1  
ATOM 2306   H HB3  . PRO A 1 152 ? 4.013   9.422   181.074 1.00 0.00 ?  152 PRO A HB3  1  
ATOM 2307   H HG2  . PRO A 1 152 ? 6.598   8.590   182.511 1.00 0.00 ?  152 PRO A HG2  1  
ATOM 2308   H HG3  . PRO A 1 152 ? 4.992   7.746   182.459 1.00 0.00 ?  152 PRO A HG3  1  
ATOM 2309   H HD2  . PRO A 1 152 ? 7.130   7.071   180.801 1.00 0.00 ?  152 PRO A HD2  1  
ATOM 2310   H HD3  . PRO A 1 152 ? 5.398   6.815   180.348 1.00 0.00 ?  152 PRO A HD3  1  
ATOM 2311   N N    . ARG A 1 153 ? 6.904   12.062  180.626 1.00 0.00 ?  153 ARG A N    1  
ATOM 2312   C CA   . ARG A 1 153 ? 8.001   12.934  180.967 1.00 0.00 ?  153 ARG A CA   1  
ATOM 2313   C C    . ARG A 1 153 ? 7.755   13.411  182.362 1.00 0.00 ?  153 ARG A C    1  
ATOM 2314   O O    . ARG A 1 153 ? 6.654   13.864  182.679 1.00 0.00 ?  153 ARG A O    1  
ATOM 2315   C CB   . ARG A 1 153 ? 8.108   14.163  180.043 1.00 0.00 ?  153 ARG A CB   1  
ATOM 2316   C CG   . ARG A 1 153 ? 8.269   13.770  178.570 1.00 0.00 ?  153 ARG A CG   1  
ATOM 2317   C CD   . ARG A 1 153 ? 6.927   13.627  177.843 1.00 0.00 ?  153 ARG A CD   1  
ATOM 2318   N NE   . ARG A 1 153 ? 7.095   12.636  176.741 1.00 0.00 ?  153 ARG A NE   1  
ATOM 2319   C CZ   . ARG A 1 153 ? 5.995   12.103  176.131 1.00 0.00 ?  153 ARG A CZ   1  
ATOM 2320   N NH1  . ARG A 1 153 ? 4.745   12.511  176.501 1.00 0.00 1  153 ARG A NH1  1  
ATOM 2321   N NH2  . ARG A 1 153 ? 6.144   11.163  175.151 1.00 0.00 ?  153 ARG A NH2  1  
ATOM 2322   H H    . ARG A 1 153 ? 6.007   12.490  180.537 1.00 0.00 ?  153 ARG A H    1  
ATOM 2323   H HA   . ARG A 1 153 ? 8.915   12.364  180.944 1.00 0.00 ?  153 ARG A HA   1  
ATOM 2324   H HB2  . ARG A 1 153 ? 7.193   14.784  180.159 1.00 0.00 ?  153 ARG A HB2  1  
ATOM 2325   H HB3  . ARG A 1 153 ? 8.982   14.775  180.350 1.00 0.00 ?  153 ARG A HB3  1  
ATOM 2326   H HG2  . ARG A 1 153 ? 8.878   14.543  178.055 1.00 0.00 ?  153 ARG A HG2  1  
ATOM 2327   H HG3  . ARG A 1 153 ? 8.819   12.806  178.512 1.00 0.00 ?  153 ARG A HG3  1  
ATOM 2328   H HD2  . ARG A 1 153 ? 6.139   13.255  178.533 1.00 0.00 ?  153 ARG A HD2  1  
ATOM 2329   H HD3  . ARG A 1 153 ? 6.612   14.592  177.395 1.00 0.00 ?  153 ARG A HD3  1  
ATOM 2330   H HE   . ARG A 1 153 ? 8.011   12.350  176.461 1.00 0.00 ?  153 ARG A HE   1  
ATOM 2331   H HH11 . ARG A 1 153 ? 4.637   13.198  177.219 1.00 0.00 ?  153 ARG A HH11 1  
ATOM 2332   H HH12 . ARG A 1 153 ? 3.940   12.121  176.055 1.00 0.00 ?  153 ARG A HH12 1  
ATOM 2333   H HH21 . ARG A 1 153 ? 7.059   10.864  174.878 1.00 0.00 ?  153 ARG A HH21 1  
ATOM 2334   H HH22 . ARG A 1 153 ? 5.337   10.770  174.708 1.00 0.00 ?  153 ARG A HH22 1  
ATOM 2335   N N    . ALA A 1 154 ? 8.807   13.336  183.225 1.00 0.00 ?  154 ALA A N    1  
ATOM 2336   C CA   . ALA A 1 154 ? 8.670   13.743  184.604 1.00 0.00 ?  154 ALA A CA   1  
ATOM 2337   C C    . ALA A 1 154 ? 9.563   14.919  184.846 1.00 0.00 ?  154 ALA A C    1  
ATOM 2338   O O    . ALA A 1 154 ? 10.733  14.772  185.197 1.00 0.00 ?  154 ALA A O    1  
ATOM 2339   C CB   . ALA A 1 154 ? 9.078   12.641  185.596 1.00 0.00 ?  154 ALA A CB   1  
ATOM 2340   H H    . ALA A 1 154 ? 9.703   13.001  182.947 1.00 0.00 ?  154 ALA A H    1  
ATOM 2341   H HA   . ALA A 1 154 ? 7.647   14.034  184.774 1.00 0.00 ?  154 ALA A HA   1  
ATOM 2342   H HB1  . ALA A 1 154 ? 10.172  12.457  185.543 1.00 0.00 ?  154 ALA A HB1  1  
ATOM 2343   H HB2  . ALA A 1 154 ? 8.549   11.694  185.359 1.00 0.00 ?  154 ALA A HB2  1  
ATOM 2344   H HB3  . ALA A 1 154 ? 8.819   12.941  186.634 1.00 0.00 ?  154 ALA A HB3  1  
ATOM 2345   N N    . LYS A 1 155 ? 9.008   16.125  184.657 1.00 0.00 ?  155 LYS A N    1  
ATOM 2346   C CA   . LYS A 1 155 ? 9.745   17.336  184.891 1.00 0.00 ?  155 LYS A CA   1  
ATOM 2347   C C    . LYS A 1 155 ? 9.549   17.683  186.335 1.00 0.00 ?  155 LYS A C    1  
ATOM 2348   O O    . LYS A 1 155 ? 10.178  18.592  186.874 1.00 0.00 ?  155 LYS A O    1  
ATOM 2349   C CB   . LYS A 1 155 ? 9.260   18.513  184.030 1.00 0.00 ?  155 LYS A CB   1  
ATOM 2350   C CG   . LYS A 1 155 ? 9.365   18.234  182.524 1.00 0.00 ?  155 LYS A CG   1  
ATOM 2351   C CD   . LYS A 1 155 ? 10.811  18.100  182.025 1.00 0.00 ?  155 LYS A CD   1  
ATOM 2352   C CE   . LYS A 1 155 ? 10.883  17.863  180.515 1.00 0.00 ?  155 LYS A CE   1  
ATOM 2353   N NZ   . LYS A 1 155 ? 10.293  19.008  179.785 1.00 0.00 1  155 LYS A NZ   1  
ATOM 2354   H H    . LYS A 1 155 ? 8.066   16.235  184.348 1.00 0.00 ?  155 LYS A H    1  
ATOM 2355   H HA   . LYS A 1 155 ? 10.789  17.131  184.709 1.00 0.00 ?  155 LYS A HA   1  
ATOM 2356   H HB2  . LYS A 1 155 ? 8.202   18.725  184.284 1.00 0.00 ?  155 LYS A HB2  1  
ATOM 2357   H HB3  . LYS A 1 155 ? 9.862   19.413  184.273 1.00 0.00 ?  155 LYS A HB3  1  
ATOM 2358   H HG2  . LYS A 1 155 ? 8.819   17.295  182.294 1.00 0.00 ?  155 LYS A HG2  1  
ATOM 2359   H HG3  . LYS A 1 155 ? 8.868   19.060  181.972 1.00 0.00 ?  155 LYS A HG3  1  
ATOM 2360   H HD2  . LYS A 1 155 ? 11.370  19.027  182.274 1.00 0.00 ?  155 LYS A HD2  1  
ATOM 2361   H HD3  . LYS A 1 155 ? 11.306  17.252  182.543 1.00 0.00 ?  155 LYS A HD3  1  
ATOM 2362   H HE2  . LYS A 1 155 ? 11.937  17.756  180.187 1.00 0.00 ?  155 LYS A HE2  1  
ATOM 2363   H HE3  . LYS A 1 155 ? 10.315  16.950  180.237 1.00 0.00 ?  155 LYS A HE3  1  
ATOM 2364   H HZ1  . LYS A 1 155 ? 9.362   19.235  180.188 1.00 0.00 ?  155 LYS A HZ1  1  
ATOM 2365   H HZ2  . LYS A 1 155 ? 10.185  18.759  178.781 1.00 0.00 ?  155 LYS A HZ2  1  
ATOM 2366   H HZ3  . LYS A 1 155 ? 10.919  19.834  179.872 1.00 0.00 ?  155 LYS A HZ3  1  
ATOM 2367   N N    . ILE A 1 156 ? 8.632   16.932  186.974 1.00 0.00 ?  156 ILE A N    1  
ATOM 2368   C CA   . ILE A 1 156 ? 8.248   17.134  188.353 1.00 0.00 ?  156 ILE A CA   1  
ATOM 2369   C C    . ILE A 1 156 ? 9.442   17.088  189.295 1.00 0.00 ?  156 ILE A C    1  
ATOM 2370   O O    . ILE A 1 156 ? 9.349   17.584  190.422 1.00 0.00 ?  156 ILE A O    1  
ATOM 2371   C CB   . ILE A 1 156 ? 7.260   16.078  188.782 1.00 0.00 ?  156 ILE A CB   1  
ATOM 2372   C CG1  . ILE A 1 156 ? 6.550   16.460  190.089 1.00 0.00 ?  156 ILE A CG1  1  
ATOM 2373   C CG2  . ILE A 1 156 ? 8.014   14.747  188.910 1.00 0.00 ?  156 ILE A CG2  1  
ATOM 2374   C CD1  . ILE A 1 156 ? 5.321   15.593  190.363 1.00 0.00 ?  156 ILE A CD1  1  
ATOM 2375   H H    . ILE A 1 156 ? 8.167   16.181  186.511 1.00 0.00 ?  156 ILE A H    1  
ATOM 2376   H HA   . ILE A 1 156 ? 7.792   18.109  188.418 1.00 0.00 ?  156 ILE A HA   1  
ATOM 2377   H HB   . ILE A 1 156 ? 6.488   15.960  187.989 1.00 0.00 ?  156 ILE A HB   1  
ATOM 2378   H HG12 . ILE A 1 156 ? 7.265   16.353  190.930 1.00 0.00 ?  156 ILE A HG12 1  
ATOM 2379   H HG13 . ILE A 1 156 ? 6.239   17.517  190.036 1.00 0.00 ?  156 ILE A HG13 1  
ATOM 2380   H HG21 . ILE A 1 156 ? 7.321   13.893  188.755 1.00 0.00 ?  156 ILE A HG21 1  
ATOM 2381   H HG22 . ILE A 1 156 ? 8.466   14.659  189.921 1.00 0.00 ?  156 ILE A HG22 1  
ATOM 2382   H HG23 . ILE A 1 156 ? 8.825   14.689  188.153 1.00 0.00 ?  156 ILE A HG23 1  
ATOM 2383   H HD11 . ILE A 1 156 ? 4.932   15.786  191.386 1.00 0.00 ?  156 ILE A HD11 1  
ATOM 2384   H HD12 . ILE A 1 156 ? 5.582   14.517  190.280 1.00 0.00 ?  156 ILE A HD12 1  
ATOM 2385   H HD13 . ILE A 1 156 ? 4.518   15.821  189.630 1.00 0.00 ?  156 ILE A HD13 1  
ATOM 2386   N N    . MET A 1 157 ? 10.589  16.494  188.886 1.00 0.00 ?  157 MET A N    1  
ATOM 2387   C CA   . MET A 1 157 ? 11.714  16.412  189.791 1.00 0.00 ?  157 MET A CA   1  
ATOM 2388   C C    . MET A 1 157 ? 12.230  17.795  190.125 1.00 0.00 ?  157 MET A C    1  
ATOM 2389   O O    . MET A 1 157 ? 12.569  18.048  191.282 1.00 0.00 ?  157 MET A O    1  
ATOM 2390   C CB   . MET A 1 157 ? 12.878  15.544  189.254 1.00 0.00 ?  157 MET A CB   1  
ATOM 2391   C CG   . MET A 1 157 ? 13.475  16.049  187.936 1.00 0.00 ?  157 MET A CG   1  
ATOM 2392   S SD   . MET A 1 157 ? 14.798  14.972  187.305 1.00 0.00 ?  157 MET A SD   1  
ATOM 2393   C CE   . MET A 1 157 ? 15.163  16.000  185.852 1.00 0.00 ?  157 MET A CE   1  
ATOM 2394   H H    . MET A 1 157 ? 10.707  16.102  187.977 1.00 0.00 ?  157 MET A H    1  
ATOM 2395   H HA   . MET A 1 157 ? 11.336  15.973  190.702 1.00 0.00 ?  157 MET A HA   1  
ATOM 2396   H HB2  . MET A 1 157 ? 13.681  15.510  190.021 1.00 0.00 ?  157 MET A HB2  1  
ATOM 2397   H HB3  . MET A 1 157 ? 12.509  14.507  189.103 1.00 0.00 ?  157 MET A HB3  1  
ATOM 2398   H HG2  . MET A 1 157 ? 12.660  16.123  187.184 1.00 0.00 ?  157 MET A HG2  1  
ATOM 2399   H HG3  . MET A 1 157 ? 13.875  17.072  188.097 1.00 0.00 ?  157 MET A HG3  1  
ATOM 2400   H HE1  . MET A 1 157 ? 16.064  15.626  185.320 1.00 0.00 ?  157 MET A HE1  1  
ATOM 2401   H HE2  . MET A 1 157 ? 15.352  17.053  186.150 1.00 0.00 ?  157 MET A HE2  1  
ATOM 2402   H HE3  . MET A 1 157 ? 14.312  15.992  185.138 1.00 0.00 ?  157 MET A HE3  1  
ATOM 2403   N N    . PHE A 1 158 ? 12.278  18.723  189.128 1.00 0.00 ?  158 PHE A N    1  
ATOM 2404   C CA   . PHE A 1 158 ? 12.751  20.084  189.360 1.00 0.00 ?  158 PHE A CA   1  
ATOM 2405   C C    . PHE A 1 158 ? 14.139  20.057  189.946 1.00 0.00 ?  158 PHE A C    1  
ATOM 2406   O O    . PHE A 1 158 ? 14.841  19.048  189.913 1.00 0.00 ?  158 PHE A O    1  
ATOM 2407   C CB   . PHE A 1 158 ? 11.862  20.887  190.326 1.00 0.00 ?  158 PHE A CB   1  
ATOM 2408   C CG   . PHE A 1 158 ? 11.797  22.349  190.017 1.00 0.00 ?  158 PHE A CG   1  
ATOM 2409   C CD1  . PHE A 1 158 ? 12.286  23.272  190.915 1.00 0.00 ?  158 PHE A CD1  1  
ATOM 2410   C CD2  . PHE A 1 158 ? 11.254  22.792  188.830 1.00 0.00 ?  158 PHE A CD2  1  
ATOM 2411   C CE1  . PHE A 1 158 ? 12.232  24.616  190.632 1.00 0.00 ?  158 PHE A CE1  1  
ATOM 2412   C CE2  . PHE A 1 158 ? 11.200  24.138  188.548 1.00 0.00 ?  158 PHE A CE2  1  
ATOM 2413   C CZ   . PHE A 1 158 ? 11.689  25.048  189.448 1.00 0.00 ?  158 PHE A CZ   1  
ATOM 2414   H H    . PHE A 1 158 ? 11.993  18.513  188.196 1.00 0.00 ?  158 PHE A H    1  
ATOM 2415   H HA   . PHE A 1 158 ? 12.789  20.576  188.401 1.00 0.00 ?  158 PHE A HA   1  
ATOM 2416   H HB2  . PHE A 1 158 ? 10.832  20.497  190.300 1.00 0.00 ?  158 PHE A HB2  1  
ATOM 2417   H HB3  . PHE A 1 158 ? 12.250  20.786  191.363 1.00 0.00 ?  158 PHE A HB3  1  
ATOM 2418   H HD1  . PHE A 1 158 ? 12.714  22.937  191.848 1.00 0.00 ?  158 PHE A HD1  1  
ATOM 2419   H HD2  . PHE A 1 158 ? 10.868  22.080  188.117 1.00 0.00 ?  158 PHE A HD2  1  
ATOM 2420   H HE1  . PHE A 1 158 ? 12.619  25.333  191.341 1.00 0.00 ?  158 PHE A HE1  1  
ATOM 2421   H HE2  . PHE A 1 158 ? 10.771  24.476  187.617 1.00 0.00 ?  158 PHE A HE2  1  
ATOM 2422   H HZ   . PHE A 1 158 ? 11.648  26.104  189.227 1.00 0.00 ?  158 PHE A HZ   1  
ATOM 2423   N N    . ALA A 1 159 ? 14.573  21.223  190.468 1.00 0.00 ?  159 ALA A N    1  
ATOM 2424   C CA   . ALA A 1 159 ? 15.861  21.314  191.083 1.00 0.00 ?  159 ALA A CA   1  
ATOM 2425   C C    . ALA A 1 159 ? 15.836  22.546  191.927 1.00 0.00 ?  159 ALA A C    1  
ATOM 2426   O O    . ALA A 1 159 ? 15.601  23.646  191.429 1.00 0.00 ?  159 ALA A O    1  
ATOM 2427   C CB   . ALA A 1 159 ? 17.015  21.447  190.076 1.00 0.00 ?  159 ALA A CB   1  
ATOM 2428   H H    . ALA A 1 159 ? 14.027  22.057  190.450 1.00 0.00 ?  159 ALA A H    1  
ATOM 2429   H HA   . ALA A 1 159 ? 15.996  20.447  191.710 1.00 0.00 ?  159 ALA A HA   1  
ATOM 2430   H HB1  . ALA A 1 159 ? 17.038  20.568  189.397 1.00 0.00 ?  159 ALA A HB1  1  
ATOM 2431   H HB2  . ALA A 1 159 ? 17.988  21.508  190.610 1.00 0.00 ?  159 ALA A HB2  1  
ATOM 2432   H HB3  . ALA A 1 159 ? 16.889  22.366  189.464 1.00 0.00 ?  159 ALA A HB3  1  
ATOM 2433   N N    . ARG A 1 160 ? 16.080  22.387  193.240 1.00 0.00 ?  160 ARG A N    1  
ATOM 2434   C CA   . ARG A 1 160 ? 16.079  23.527  194.108 1.00 0.00 ?  160 ARG A CA   1  
ATOM 2435   C C    . ARG A 1 160 ? 16.848  23.117  195.318 1.00 0.00 ?  160 ARG A C    1  
ATOM 2436   O O    . ARG A 1 160 ? 16.906  21.941  195.648 1.00 0.00 ?  160 ARG A O    1  
ATOM 2437   C CB   . ARG A 1 160 ? 14.671  23.980  194.538 1.00 0.00 ?  160 ARG A CB   1  
ATOM 2438   C CG   . ARG A 1 160 ? 14.544  25.507  194.611 1.00 0.00 ?  160 ARG A CG   1  
ATOM 2439   C CD   . ARG A 1 160 ? 14.656  26.057  196.035 1.00 0.00 ?  160 ARG A CD   1  
ATOM 2440   N NE   . ARG A 1 160 ? 14.835  27.536  195.948 1.00 0.00 ?  160 ARG A NE   1  
ATOM 2441   C CZ   . ARG A 1 160 ? 13.755  28.357  195.789 1.00 0.00 ?  160 ARG A CZ   1  
ATOM 2442   N NH1  . ARG A 1 160 ? 12.495  27.835  195.727 1.00 0.00 1  160 ARG A NH1  1  
ATOM 2443   N NH2  . ARG A 1 160 ? 13.937  29.705  195.692 1.00 0.00 ?  160 ARG A NH2  1  
ATOM 2444   H H    . ARG A 1 160 ? 16.265  21.501  193.655 1.00 0.00 ?  160 ARG A H    1  
ATOM 2445   H HA   . ARG A 1 160 ? 16.603  24.326  193.605 1.00 0.00 ?  160 ARG A HA   1  
ATOM 2446   H HB2  . ARG A 1 160 ? 13.925  23.586  193.814 1.00 0.00 ?  160 ARG A HB2  1  
ATOM 2447   H HB3  . ARG A 1 160 ? 14.441  23.552  195.537 1.00 0.00 ?  160 ARG A HB3  1  
ATOM 2448   H HG2  . ARG A 1 160 ? 15.340  25.965  193.987 1.00 0.00 ?  160 ARG A HG2  1  
ATOM 2449   H HG3  . ARG A 1 160 ? 13.563  25.807  194.183 1.00 0.00 ?  160 ARG A HG3  1  
ATOM 2450   H HD2  . ARG A 1 160 ? 13.735  25.843  196.619 1.00 0.00 ?  160 ARG A HD2  1  
ATOM 2451   H HD3  . ARG A 1 160 ? 15.535  25.636  196.556 1.00 0.00 ?  160 ARG A HD3  1  
ATOM 2452   H HE   . ARG A 1 160 ? 15.753  27.928  196.000 1.00 0.00 ?  160 ARG A HE   1  
ATOM 2453   H HH11 . ARG A 1 160 ? 12.361  26.847  195.798 1.00 0.00 ?  160 ARG A HH11 1  
ATOM 2454   H HH12 . ARG A 1 160 ? 11.709  28.440  195.610 1.00 0.00 ?  160 ARG A HH12 1  
ATOM 2455   H HH21 . ARG A 1 160 ? 14.860  30.090  195.737 1.00 0.00 ?  160 ARG A HH21 1  
ATOM 2456   H HH22 . ARG A 1 160 ? 13.148  30.309  195.574 1.00 0.00 ?  160 ARG A HH22 1  
ATOM 2457   N N    . HIS A 1 161 ? 17.427  24.090  196.039 1.00 0.00 ?  161 HIS A N    1  
ATOM 2458   C CA   . HIS A 1 161 ? 18.207  23.759  197.196 1.00 0.00 ?  161 HIS A CA   1  
ATOM 2459   C C    . HIS A 1 161 ? 17.298  23.737  198.383 1.00 0.00 ?  161 HIS A C    1  
ATOM 2460   O O    . HIS A 1 161 ? 16.377  24.541  198.506 1.00 0.00 ?  161 HIS A O    1  
ATOM 2461   C CB   . HIS A 1 161 ? 19.334  24.768  197.452 1.00 0.00 ?  161 HIS A CB   1  
ATOM 2462   C CG   . HIS A 1 161 ? 20.596  24.429  196.714 1.00 0.00 ?  161 HIS A CG   1  
ATOM 2463   N ND1  . HIS A 1 161 ? 20.537  24.049  195.382 1.00 0.00 ?  161 HIS A ND1  1  
ATOM 2464   C CD2  . HIS A 1 161 ? 21.887  24.430  197.150 1.00 0.00 ?  161 HIS A CD2  1  
ATOM 2465   C CE1  . HIS A 1 161 ? 21.794  23.824  195.044 1.00 0.00 ?  161 HIS A CE1  1  
ATOM 2466   N NE2  . HIS A 1 161 ? 22.648  24.037  196.074 1.00 0.00 ?  161 HIS A NE2  1  
ATOM 2467   H H    . HIS A 1 161 ? 17.353  25.055  195.805 1.00 0.00 ?  161 HIS A H    1  
ATOM 2468   H HA   . HIS A 1 161 ? 18.620  22.774  197.048 1.00 0.00 ?  161 HIS A HA   1  
ATOM 2469   H HB2  . HIS A 1 161 ? 19.012  25.782  197.129 1.00 0.00 ?  161 HIS A HB2  1  
ATOM 2470   H HB3  . HIS A 1 161 ? 19.571  24.799  198.536 1.00 0.00 ?  161 HIS A HB3  1  
ATOM 2471   H HD2  . HIS A 1 161 ? 22.296  24.697  198.116 1.00 0.00 ?  161 HIS A HD2  1  
ATOM 2472   H HE1  . HIS A 1 161 ? 22.131  23.502  194.059 1.00 0.00 ?  161 HIS A HE1  1  
ATOM 2473   H HE2  . HIS A 1 161 ? 23.643  23.928  196.069 1.00 0.00 ?  161 HIS A HE2  1  
ATOM 2474   N N    . ALA A 1 162 ? 17.558  22.775  199.293 1.00 0.00 ?  162 ALA A N    1  
ATOM 2475   C CA   . ALA A 1 162 ? 16.753  22.625  200.475 1.00 0.00 ?  162 ALA A CA   1  
ATOM 2476   C C    . ALA A 1 162 ? 17.009  23.808  201.347 1.00 0.00 ?  162 ALA A C    1  
ATOM 2477   O O    . ALA A 1 162 ? 18.061  24.425  201.268 1.00 0.00 ?  162 ALA A O    1  
ATOM 2478   C CB   . ALA A 1 162 ? 17.079  21.357  201.279 1.00 0.00 ?  162 ALA A CB   1  
ATOM 2479   H H    . ALA A 1 162 ? 18.318  22.136  199.192 1.00 0.00 ?  162 ALA A H    1  
ATOM 2480   H HA   . ALA A 1 162 ? 15.719  22.623  200.170 1.00 0.00 ?  162 ALA A HA   1  
ATOM 2481   H HB1  . ALA A 1 162 ? 17.997  21.509  201.884 1.00 0.00 ?  162 ALA A HB1  1  
ATOM 2482   H HB2  . ALA A 1 162 ? 17.245  20.498  200.594 1.00 0.00 ?  162 ALA A HB2  1  
ATOM 2483   H HB3  . ALA A 1 162 ? 16.240  21.108  201.963 1.00 0.00 ?  162 ALA A HB3  1  
ATOM 2484   N N    . ILE A 1 163 ? 16.008  24.161  202.186 1.00 0.00 ?  163 ILE A N    1  
ATOM 2485   C CA   . ILE A 1 163 ? 16.139  25.291  203.074 1.00 0.00 ?  163 ILE A CA   1  
ATOM 2486   C C    . ILE A 1 163 ? 15.797  24.833  204.458 1.00 0.00 ?  163 ILE A C    1  
ATOM 2487   O O    . ILE A 1 163 ? 14.739  24.260  204.650 1.00 0.00 ?  163 ILE A O    1  
ATOM 2488   C CB   . ILE A 1 163 ? 15.175  26.384  202.731 1.00 0.00 ?  163 ILE A CB   1  
ATOM 2489   C CG1  . ILE A 1 163 ? 15.262  26.723  201.231 1.00 0.00 ?  163 ILE A CG1  1  
ATOM 2490   C CG2  . ILE A 1 163 ? 15.481  27.590  203.632 1.00 0.00 ?  163 ILE A CG2  1  
ATOM 2491   C CD1  . ILE A 1 163 ? 14.218  25.976  200.401 1.00 0.00 ?  163 ILE A CD1  1  
ATOM 2492   H H    . ILE A 1 163 ? 15.142  23.663  202.224 1.00 0.00 ?  163 ILE A H    1  
ATOM 2493   H HA   . ILE A 1 163 ? 17.155  25.648  203.047 1.00 0.00 ?  163 ILE A HA   1  
ATOM 2494   H HB   . ILE A 1 163 ? 14.141  26.039  202.951 1.00 0.00 ?  163 ILE A HB   1  
ATOM 2495   H HG12 . ILE A 1 163 ? 15.116  27.813  201.098 1.00 0.00 ?  163 ILE A HG12 1  
ATOM 2496   H HG13 . ILE A 1 163 ? 16.275  26.462  200.857 1.00 0.00 ?  163 ILE A HG13 1  
ATOM 2497   H HG21 . ILE A 1 163 ? 16.573  27.792  203.648 1.00 0.00 ?  163 ILE A HG21 1  
ATOM 2498   H HG22 . ILE A 1 163 ? 15.141  27.391  204.671 1.00 0.00 ?  163 ILE A HG22 1  
ATOM 2499   H HG23 . ILE A 1 163 ? 14.958  28.494  203.256 1.00 0.00 ?  163 ILE A HG23 1  
ATOM 2500   H HD11 . ILE A 1 163 ? 14.530  24.920  200.248 1.00 0.00 ?  163 ILE A HD11 1  
ATOM 2501   H HD12 . ILE A 1 163 ? 14.099  26.458  199.406 1.00 0.00 ?  163 ILE A HD12 1  
ATOM 2502   H HD13 . ILE A 1 163 ? 13.235  25.984  200.918 1.00 0.00 ?  163 ILE A HD13 1  
ATOM 2503   N N    . VAL A 1 164 ? 16.681  25.092  205.462 1.00 0.00 ?  164 VAL A N    1  
ATOM 2504   C CA   . VAL A 1 164 ? 16.376  24.702  206.827 1.00 0.00 ?  164 VAL A CA   1  
ATOM 2505   C C    . VAL A 1 164 ? 16.034  25.967  207.560 1.00 0.00 ?  164 VAL A C    1  
ATOM 2506   O O    . VAL A 1 164 ? 16.904  26.753  207.935 1.00 0.00 ?  164 VAL A O    1  
ATOM 2507   C CB   . VAL A 1 164 ? 17.503  23.984  207.540 1.00 0.00 ?  164 VAL A CB   1  
ATOM 2508   C CG1  . VAL A 1 164 ? 18.852  24.648  207.198 1.00 0.00 ?  164 VAL A CG1  1  
ATOM 2509   C CG2  . VAL A 1 164 ? 17.205  23.994  209.050 1.00 0.00 ?  164 VAL A CG2  1  
ATOM 2510   H H    . VAL A 1 164 ? 17.556  25.550  205.308 1.00 0.00 ?  164 VAL A H    1  
ATOM 2511   H HA   . VAL A 1 164 ? 15.497  24.076  206.804 1.00 0.00 ?  164 VAL A HA   1  
ATOM 2512   H HB   . VAL A 1 164 ? 17.539  22.928  207.202 1.00 0.00 ?  164 VAL A HB   1  
ATOM 2513   H HG11 . VAL A 1 164 ? 19.511  24.661  208.092 1.00 0.00 ?  164 VAL A HG11 1  
ATOM 2514   H HG12 . VAL A 1 164 ? 18.701  25.691  206.858 1.00 0.00 ?  164 VAL A HG12 1  
ATOM 2515   H HG13 . VAL A 1 164 ? 19.364  24.084  206.392 1.00 0.00 ?  164 VAL A HG13 1  
ATOM 2516   H HG21 . VAL A 1 164 ? 17.749  23.168  209.556 1.00 0.00 ?  164 VAL A HG21 1  
ATOM 2517   H HG22 . VAL A 1 164 ? 16.117  23.865  209.230 1.00 0.00 ?  164 VAL A HG22 1  
ATOM 2518   H HG23 . VAL A 1 164 ? 17.527  24.957  209.502 1.00 0.00 ?  164 VAL A HG23 1  
ATOM 2519   N N    . ARG A 1 165 ? 14.712  26.178  207.774 1.00 0.00 ?  165 ARG A N    1  
ATOM 2520   C CA   . ARG A 1 165 ? 14.240  27.375  208.422 1.00 0.00 ?  165 ARG A CA   1  
ATOM 2521   C C    . ARG A 1 165 ? 13.327  26.976  209.559 1.00 0.00 ?  165 ARG A C    1  
ATOM 2522   O O    . ARG A 1 165 ? 12.785  25.875  209.563 1.00 0.00 ?  165 ARG A O    1  
ATOM 2523   C CB   . ARG A 1 165 ? 13.459  28.258  207.424 1.00 0.00 ?  165 ARG A CB   1  
ATOM 2524   C CG   . ARG A 1 165 ? 12.299  27.502  206.769 1.00 0.00 ?  165 ARG A CG   1  
ATOM 2525   C CD   . ARG A 1 165 ? 11.515  28.356  205.770 1.00 0.00 ?  165 ARG A CD   1  
ATOM 2526   N NE   . ARG A 1 165 ? 10.765  29.405  206.513 1.00 0.00 ?  165 ARG A NE   1  
ATOM 2527   C CZ   . ARG A 1 165 ? 10.045  30.338  205.824 1.00 0.00 ?  165 ARG A CZ   1  
ATOM 2528   N NH1  . ARG A 1 165 ? 10.031  30.316  204.458 1.00 0.00 1  165 ARG A NH1  1  
ATOM 2529   N NH2  . ARG A 1 165 ? 9.346   31.296  206.498 1.00 0.00 ?  165 ARG A NH2  1  
ATOM 2530   H H    . ARG A 1 165 ? 14.017  25.516  207.506 1.00 0.00 ?  165 ARG A H    1  
ATOM 2531   H HA   . ARG A 1 165 ? 15.094  27.893  208.799 1.00 0.00 ?  165 ARG A HA   1  
ATOM 2532   H HB2  . ARG A 1 165 ? 13.061  29.148  207.957 1.00 0.00 ?  165 ARG A HB2  1  
ATOM 2533   H HB3  . ARG A 1 165 ? 14.152  28.611  206.631 1.00 0.00 ?  165 ARG A HB3  1  
ATOM 2534   H HG2  . ARG A 1 165 ? 12.700  26.610  206.242 1.00 0.00 ?  165 ARG A HG2  1  
ATOM 2535   H HG3  . ARG A 1 165 ? 11.606  27.146  207.561 1.00 0.00 ?  165 ARG A HG3  1  
ATOM 2536   H HD2  . ARG A 1 165 ? 12.205  28.861  205.058 1.00 0.00 ?  165 ARG A HD2  1  
ATOM 2537   H HD3  . ARG A 1 165 ? 10.784  27.740  205.208 1.00 0.00 ?  165 ARG A HD3  1  
ATOM 2538   H HE   . ARG A 1 165 ? 10.785  29.424  207.512 1.00 0.00 ?  165 ARG A HE   1  
ATOM 2539   H HH11 . ARG A 1 165 ? 10.547  29.616  203.964 1.00 0.00 ?  165 ARG A HH11 1  
ATOM 2540   H HH12 . ARG A 1 165 ? 9.506   31.001  203.953 1.00 0.00 ?  165 ARG A HH12 1  
ATOM 2541   H HH21 . ARG A 1 165 ? 9.359   31.315  207.497 1.00 0.00 ?  165 ARG A HH21 1  
ATOM 2542   H HH22 . ARG A 1 165 ? 8.819   31.980  205.992 1.00 0.00 ?  165 ARG A HH22 1  
ATOM 2543   N N    . PRO A 1 166 ? 13.168  27.835  210.563 1.00 0.00 ?  166 PRO A N    1  
ATOM 2544   C CA   . PRO A 1 166 ? 12.280  27.533  211.664 1.00 0.00 ?  166 PRO A CA   1  
ATOM 2545   C C    . PRO A 1 166 ? 10.849  27.773  211.308 1.00 0.00 ?  166 PRO A C    1  
ATOM 2546   O O    . PRO A 1 166 ? 10.532  28.706  210.571 1.00 0.00 ?  166 PRO A O    1  
ATOM 2547   C CB   . PRO A 1 166 ? 12.725  28.480  212.771 1.00 0.00 ?  166 PRO A CB   1  
ATOM 2548   C CG   . PRO A 1 166 ? 13.206  29.709  212.012 1.00 0.00 ?  166 PRO A CG   1  
ATOM 2549   C CD   . PRO A 1 166 ? 13.813  29.155  210.722 1.00 0.00 ?  166 PRO A CD   1  
ATOM 2550   H HA   . PRO A 1 166 ? 12.398  26.512  211.994 1.00 0.00 ?  166 PRO A HA   1  
ATOM 2551   H HB2  . PRO A 1 166 ? 11.874  28.733  213.440 1.00 0.00 ?  166 PRO A HB2  1  
ATOM 2552   H HB3  . PRO A 1 166 ? 13.552  28.037  213.363 1.00 0.00 ?  166 PRO A HB3  1  
ATOM 2553   H HG2  . PRO A 1 166 ? 12.353  30.387  211.790 1.00 0.00 ?  166 PRO A HG2  1  
ATOM 2554   H HG3  . PRO A 1 166 ? 13.971  30.257  212.601 1.00 0.00 ?  166 PRO A HG3  1  
ATOM 2555   H HD2  . PRO A 1 166 ? 13.579  29.822  209.866 1.00 0.00 ?  166 PRO A HD2  1  
ATOM 2556   H HD3  . PRO A 1 166 ? 14.915  29.055  210.822 1.00 0.00 ?  166 PRO A HD3  1  
ATOM 2557   N N    . PHE A 1 167 ? 9.948   26.929  211.835 1.00 0.00 ?  167 PHE A N    1  
ATOM 2558   C CA   . PHE A 1 167 ? 8.551   27.088  211.570 1.00 0.00 ?  167 PHE A CA   1  
ATOM 2559   C C    . PHE A 1 167 ? 7.819   26.606  212.777 1.00 0.00 ?  167 PHE A C    1  
ATOM 2560   O O    . PHE A 1 167 ? 8.103   25.524  213.291 1.00 0.00 ?  167 PHE A O    1  
ATOM 2561   C CB   . PHE A 1 167 ? 8.035   26.278  210.368 1.00 0.00 ?  167 PHE A CB   1  
ATOM 2562   C CG   . PHE A 1 167 ? 7.885   27.076  209.118 1.00 0.00 ?  167 PHE A CG   1  
ATOM 2563   C CD1  . PHE A 1 167 ? 8.529   26.692  207.962 1.00 0.00 ?  167 PHE A CD1  1  
ATOM 2564   C CD2  . PHE A 1 167 ? 7.098   28.208  209.100 1.00 0.00 ?  167 PHE A CD2  1  
ATOM 2565   C CE1  . PHE A 1 167 ? 8.386   27.425  206.810 1.00 0.00 ?  167 PHE A CE1  1  
ATOM 2566   C CE2  . PHE A 1 167 ? 6.959   28.941  207.945 1.00 0.00 ?  167 PHE A CE2  1  
ATOM 2567   C CZ   . PHE A 1 167 ? 7.603   28.549  206.801 1.00 0.00 ?  167 PHE A CZ   1  
ATOM 2568   H H    . PHE A 1 167 ? 10.206  26.168  212.425 1.00 0.00 ?  167 PHE A H    1  
ATOM 2569   H HA   . PHE A 1 167 ? 8.357   28.140  211.431 1.00 0.00 ?  167 PHE A HA   1  
ATOM 2570   H HB2  . PHE A 1 167 ? 8.739   25.449  210.145 1.00 0.00 ?  167 PHE A HB2  1  
ATOM 2571   H HB3  . PHE A 1 167 ? 7.040   25.844  210.609 1.00 0.00 ?  167 PHE A HB3  1  
ATOM 2572   H HD1  . PHE A 1 167 ? 9.147   25.808  207.962 1.00 0.00 ?  167 PHE A HD1  1  
ATOM 2573   H HD2  . PHE A 1 167 ? 6.587   28.522  209.998 1.00 0.00 ?  167 PHE A HD2  1  
ATOM 2574   H HE1  . PHE A 1 167 ? 8.893   27.115  205.910 1.00 0.00 ?  167 PHE A HE1  1  
ATOM 2575   H HE2  . PHE A 1 167 ? 6.345   29.826  207.939 1.00 0.00 ?  167 PHE A HE2  1  
ATOM 2576   H HZ   . PHE A 1 167 ? 7.492   29.124  205.894 1.00 0.00 ?  167 PHE A HZ   1  
ATOM 2577   N N    . ASN A 1 168 ? 6.850   27.425  213.243 1.00 0.00 ?  168 ASN A N    1  
ATOM 2578   C CA   . ASN A 1 168 ? 6.038   27.088  214.388 1.00 0.00 ?  168 ASN A CA   1  
ATOM 2579   C C    . ASN A 1 168 ? 6.924   26.891  215.589 1.00 0.00 ?  168 ASN A C    1  
ATOM 2580   O O    . ASN A 1 168 ? 6.600   26.108  216.481 1.00 0.00 ?  168 ASN A O    1  
ATOM 2581   C CB   . ASN A 1 168 ? 5.206   25.805  214.191 1.00 0.00 ?  168 ASN A CB   1  
ATOM 2582   C CG   . ASN A 1 168 ? 4.010   25.737  215.133 1.00 0.00 ?  168 ASN A CG   1  
ATOM 2583   O OD1  . ASN A 1 168 ? 3.361   26.745  215.409 1.00 0.00 ?  168 ASN A OD1  1  
ATOM 2584   N ND2  . ASN A 1 168 ? 3.712   24.512  215.644 1.00 0.00 ?  168 ASN A ND2  1  
ATOM 2585   H H    . ASN A 1 168 ? 6.652   28.304  212.813 1.00 0.00 ?  168 ASN A H    1  
ATOM 2586   H HA   . ASN A 1 168 ? 5.383   27.926  214.574 1.00 0.00 ?  168 ASN A HA   1  
ATOM 2587   H HB2  . ASN A 1 168 ? 4.839   25.761  213.144 1.00 0.00 ?  168 ASN A HB2  1  
ATOM 2588   H HB3  . ASN A 1 168 ? 5.850   24.918  214.370 1.00 0.00 ?  168 ASN A HB3  1  
ATOM 2589   H HD21 . ASN A 1 168 ? 4.266   23.718  215.395 1.00 0.00 ?  168 ASN A HD21 1  
ATOM 2590   H HD22 . ASN A 1 168 ? 2.937   24.406  216.267 1.00 0.00 ?  168 ASN A HD22 1  
ATOM 2591   N N    . GLY A 1 169 ? 8.068   27.607  215.642 1.00 0.00 ?  169 GLY A N    1  
ATOM 2592   C CA   . GLY A 1 169 ? 8.941   27.507  216.785 1.00 0.00 ?  169 GLY A CA   1  
ATOM 2593   C C    . GLY A 1 169 ? 9.642   26.182  216.780 1.00 0.00 ?  169 GLY A C    1  
ATOM 2594   O O    . GLY A 1 169 ? 10.138  25.749  217.815 1.00 0.00 ?  169 GLY A O    1  
ATOM 2595   H H    . GLY A 1 169 ? 8.353   28.223  214.912 1.00 0.00 ?  169 GLY A H    1  
ATOM 2596   H HA2  . GLY A 1 169 ? 9.679   28.290  216.696 1.00 0.00 ?  169 GLY A HA2  1  
ATOM 2597   H HA3  . GLY A 1 169 ? 8.324   27.576  217.669 1.00 0.00 ?  169 GLY A HA3  1  
ATOM 2598   N N    . ARG A 1 170 ? 9.709   25.513  215.612 1.00 0.00 ?  170 ARG A N    1  
ATOM 2599   C CA   . ARG A 1 170 ? 10.349  24.218  215.531 1.00 0.00 ?  170 ARG A CA   1  
ATOM 2600   C C    . ARG A 1 170 ? 11.225  24.263  214.312 1.00 0.00 ?  170 ARG A C    1  
ATOM 2601   O O    . ARG A 1 170 ? 10.819  24.786  213.291 1.00 0.00 ?  170 ARG A O    1  
ATOM 2602   C CB   . ARG A 1 170 ? 9.296   23.106  215.363 1.00 0.00 ?  170 ARG A CB   1  
ATOM 2603   C CG   . ARG A 1 170 ? 8.399   22.980  216.604 1.00 0.00 ?  170 ARG A CG   1  
ATOM 2604   C CD   . ARG A 1 170 ? 7.072   22.263  216.320 1.00 0.00 ?  170 ARG A CD   1  
ATOM 2605   N NE   . ARG A 1 170 ? 7.334   20.873  215.856 1.00 0.00 ?  170 ARG A NE   1  
ATOM 2606   C CZ   . ARG A 1 170 ? 7.529   19.867  216.755 1.00 0.00 ?  170 ARG A CZ   1  
ATOM 2607   N NH1  . ARG A 1 170 ? 7.583   20.136  218.093 1.00 0.00 1  170 ARG A NH1  1  
ATOM 2608   N NH2  . ARG A 1 170 ? 7.676   18.586  216.308 1.00 0.00 ?  170 ARG A NH2  1  
ATOM 2609   H H    . ARG A 1 170 ? 9.329   25.875  214.765 1.00 0.00 ?  170 ARG A H    1  
ATOM 2610   H HA   . ARG A 1 170 ? 10.951  24.061  216.411 1.00 0.00 ?  170 ARG A HA   1  
ATOM 2611   H HB2  . ARG A 1 170 ? 8.666   23.332  214.475 1.00 0.00 ?  170 ARG A HB2  1  
ATOM 2612   H HB3  . ARG A 1 170 ? 9.810   22.138  215.188 1.00 0.00 ?  170 ARG A HB3  1  
ATOM 2613   H HG2  . ARG A 1 170 ? 8.948   22.420  217.390 1.00 0.00 ?  170 ARG A HG2  1  
ATOM 2614   H HG3  . ARG A 1 170 ? 8.182   23.995  216.998 1.00 0.00 ?  170 ARG A HG3  1  
ATOM 2615   H HD2  . ARG A 1 170 ? 6.450   22.211  217.239 1.00 0.00 ?  170 ARG A HD2  1  
ATOM 2616   H HD3  . ARG A 1 170 ? 6.509   22.789  215.521 1.00 0.00 ?  170 ARG A HD3  1  
ATOM 2617   H HE   . ARG A 1 170 ? 7.332   20.671  214.877 1.00 0.00 ?  170 ARG A HE   1  
ATOM 2618   H HH11 . ARG A 1 170 ? 7.481   21.076  218.418 1.00 0.00 ?  170 ARG A HH11 1  
ATOM 2619   H HH12 . ARG A 1 170 ? 7.725   19.393  218.747 1.00 0.00 ?  170 ARG A HH12 1  
ATOM 2620   H HH21 . ARG A 1 170 ? 7.644   18.395  215.327 1.00 0.00 ?  170 ARG A HH21 1  
ATOM 2621   H HH22 . ARG A 1 170 ? 7.806   17.837  216.958 1.00 0.00 ?  170 ARG A HH22 1  
ATOM 2622   N N    . MET A 1 171 ? 12.450  23.689  214.364 1.00 0.00 ?  171 MET A N    1  
ATOM 2623   C CA   . MET A 1 171 ? 13.303  23.762  213.197 1.00 0.00 ?  171 MET A CA   1  
ATOM 2624   C C    . MET A 1 171 ? 12.757  22.817  212.169 1.00 0.00 ?  171 MET A C    1  
ATOM 2625   O O    . MET A 1 171 ? 12.390  21.685  212.487 1.00 0.00 ?  171 MET A O    1  
ATOM 2626   C CB   . MET A 1 171 ? 14.769  23.394  213.477 1.00 0.00 ?  171 MET A CB   1  
ATOM 2627   C CG   . MET A 1 171 ? 15.423  24.330  214.493 1.00 0.00 ?  171 MET A CG   1  
ATOM 2628   S SD   . MET A 1 171 ? 15.475  26.058  213.931 1.00 0.00 ?  171 MET A SD   1  
ATOM 2629   C CE   . MET A 1 171 ? 16.220  26.701  215.457 1.00 0.00 ?  171 MET A CE   1  
ATOM 2630   H H    . MET A 1 171 ? 12.806  23.215  215.170 1.00 0.00 ?  171 MET A H    1  
ATOM 2631   H HA   . MET A 1 171 ? 13.237  24.769  212.813 1.00 0.00 ?  171 MET A HA   1  
ATOM 2632   H HB2  . MET A 1 171 ? 14.813  22.356  213.862 1.00 0.00 ?  171 MET A HB2  1  
ATOM 2633   H HB3  . MET A 1 171 ? 15.343  23.435  212.527 1.00 0.00 ?  171 MET A HB3  1  
ATOM 2634   H HG2  . MET A 1 171 ? 14.859  24.263  215.448 1.00 0.00 ?  171 MET A HG2  1  
ATOM 2635   H HG3  . MET A 1 171 ? 16.456  23.972  214.689 1.00 0.00 ?  171 MET A HG3  1  
ATOM 2636   H HE1  . MET A 1 171 ? 15.436  26.999  216.186 1.00 0.00 ?  171 MET A HE1  1  
ATOM 2637   H HE2  . MET A 1 171 ? 16.849  27.592  215.246 1.00 0.00 ?  171 MET A HE2  1  
ATOM 2638   H HE3  . MET A 1 171 ? 16.863  25.933  215.938 1.00 0.00 ?  171 MET A HE3  1  
ATOM 2639   N N    . THR A 1 172 ? 12.697  23.281  210.885 1.00 0.00 ?  172 THR A N    1  
ATOM 2640   C CA   . THR A 1 172 ? 12.157  22.464  209.822 1.00 0.00 ?  172 THR A CA   1  
ATOM 2641   C C    . THR A 1 172 ? 12.988  22.636  208.570 1.00 0.00 ?  172 THR A C    1  
ATOM 2642   O O    . THR A 1 172 ? 13.841  23.515  208.485 1.00 0.00 ?  172 THR A O    1  
ATOM 2643   C CB   . THR A 1 172 ? 10.749  22.833  209.471 1.00 0.00 ?  172 THR A CB   1  
ATOM 2644   O OG1  . THR A 1 172 ? 10.709  24.151  208.947 1.00 0.00 ?  172 THR A OG1  1  
ATOM 2645   C CG2  . THR A 1 172 ? 9.869   22.730  210.728 1.00 0.00 ?  172 THR A CG2  1  
ATOM 2646   H H    . THR A 1 172 ? 13.006  24.192  210.629 1.00 0.00 ?  172 THR A H    1  
ATOM 2647   H HA   . THR A 1 172 ? 12.206  21.434  210.136 1.00 0.00 ?  172 THR A HA   1  
ATOM 2648   H HB   . THR A 1 172 ? 10.361  22.133  208.712 1.00 0.00 ?  172 THR A HB   1  
ATOM 2649   H HG1  . THR A 1 172 ? 10.758  24.058  207.993 1.00 0.00 ?  172 THR A HG1  1  
ATOM 2650   H HG21 . THR A 1 172 ? 10.236  21.917  211.390 1.00 0.00 ?  172 THR A HG21 1  
ATOM 2651   H HG22 . THR A 1 172 ? 8.817   22.509  210.446 1.00 0.00 ?  172 THR A HG22 1  
ATOM 2652   H HG23 . THR A 1 172 ? 9.891   23.686  211.293 1.00 0.00 ?  172 THR A HG23 1  
ATOM 2653   N N    . LEU A 1 173 ? 12.713  21.764  207.556 1.00 0.00 ?  173 LEU A N    1  
ATOM 2654   C CA   . LEU A 1 173 ? 13.414  21.791  206.278 1.00 0.00 ?  173 LEU A CA   1  
ATOM 2655   C C    . LEU A 1 173 ? 12.337  21.868  205.224 1.00 0.00 ?  173 LEU A C    1  
ATOM 2656   O O    . LEU A 1 173 ? 11.302  21.270  205.409 1.00 0.00 ?  173 LEU A O    1  
ATOM 2657   C CB   . LEU A 1 173 ? 14.225  20.511  206.023 1.00 0.00 ?  173 LEU A CB   1  
ATOM 2658   C CG   . LEU A 1 173 ? 14.996  20.485  204.688 1.00 0.00 ?  173 LEU A CG   1  
ATOM 2659   C CD1  . LEU A 1 173 ? 16.079  21.572  204.621 1.00 0.00 ?  173 LEU A CD1  1  
ATOM 2660   C CD2  . LEU A 1 173 ? 15.593  19.094  204.425 1.00 0.00 ?  173 LEU A CD2  1  
ATOM 2661   H H    . LEU A 1 173 ? 12.009  21.062  207.649 1.00 0.00 ?  173 LEU A H    1  
ATOM 2662   H HA   . LEU A 1 173 ? 14.035  22.667  206.245 1.00 0.00 ?  173 LEU A HA   1  
ATOM 2663   H HB2  . LEU A 1 173 ? 14.948  20.376  206.857 1.00 0.00 ?  173 LEU A HB2  1  
ATOM 2664   H HB3  . LEU A 1 173 ? 13.527  19.649  206.038 1.00 0.00 ?  173 LEU A HB3  1  
ATOM 2665   H HG   . LEU A 1 173 ? 14.267  20.690  203.875 1.00 0.00 ?  173 LEU A HG   1  
ATOM 2666   H HD11 . LEU A 1 173 ? 17.069  21.114  204.410 1.00 0.00 ?  173 LEU A HD11 1  
ATOM 2667   H HD12 . LEU A 1 173 ? 16.145  22.125  205.581 1.00 0.00 ?  173 LEU A HD12 1  
ATOM 2668   H HD13 . LEU A 1 173 ? 15.845  22.288  203.812 1.00 0.00 ?  173 LEU A HD13 1  
ATOM 2669   H HD21 . LEU A 1 173 ? 16.266  18.799  205.259 1.00 0.00 ?  173 LEU A HD21 1  
ATOM 2670   H HD22 . LEU A 1 173 ? 16.179  19.098  203.482 1.00 0.00 ?  173 LEU A HD22 1  
ATOM 2671   H HD23 . LEU A 1 173 ? 14.786  18.337  204.338 1.00 0.00 ?  173 LEU A HD23 1  
ATOM 2672   N N    . MET A 1 174 ? 12.559  22.604  204.088 1.00 0.00 ?  174 MET A N    1  
ATOM 2673   C CA   . MET A 1 174 ? 11.517  22.744  203.068 1.00 0.00 ?  174 MET A CA   1  
ATOM 2674   C C    . MET A 1 174 ? 12.083  22.452  201.684 1.00 0.00 ?  174 MET A C    1  
ATOM 2675   O O    . MET A 1 174 ? 13.236  22.774  201.391 1.00 0.00 ?  174 MET A O    1  
ATOM 2676   C CB   . MET A 1 174 ? 10.915  24.168  203.051 1.00 0.00 ?  174 MET A CB   1  
ATOM 2677   C CG   . MET A 1 174 ? 9.784   24.347  202.029 1.00 0.00 ?  174 MET A CG   1  
ATOM 2678   S SD   . MET A 1 174 ? 9.060   26.015  202.053 1.00 0.00 ?  174 MET A SD   1  
ATOM 2679   C CE   . MET A 1 174 ? 8.147   25.772  203.604 1.00 0.00 ?  174 MET A CE   1  
ATOM 2680   H H    . MET A 1 174 ? 13.416  23.077  203.918 1.00 0.00 ?  174 MET A H    1  
ATOM 2681   H HA   . MET A 1 174 ? 10.748  22.027  203.282 1.00 0.00 ?  174 MET A HA   1  
ATOM 2682   H HB2  . MET A 1 174 ? 10.526  24.403  204.065 1.00 0.00 ?  174 MET A HB2  1  
ATOM 2683   H HB3  . MET A 1 174 ? 11.722  24.896  202.820 1.00 0.00 ?  174 MET A HB3  1  
ATOM 2684   H HG2  . MET A 1 174 ? 10.183  24.131  201.015 1.00 0.00 ?  174 MET A HG2  1  
ATOM 2685   H HG3  . MET A 1 174 ? 8.994   23.596  202.243 1.00 0.00 ?  174 MET A HG3  1  
ATOM 2686   H HE1  . MET A 1 174 ? 8.840   25.571  204.447 1.00 0.00 ?  174 MET A HE1  1  
ATOM 2687   H HE2  . MET A 1 174 ? 7.448   24.912  203.523 1.00 0.00 ?  174 MET A HE2  1  
ATOM 2688   H HE3  . MET A 1 174 ? 7.550   26.675  203.856 1.00 0.00 ?  174 MET A HE3  1  
ATOM 2689   N N    . VAL A 1 175 ? 11.238  21.798  200.807 1.00 0.00 ?  175 VAL A N    1  
ATOM 2690   C CA   . VAL A 1 175 ? 11.637  21.455  199.440 1.00 0.00 ?  175 VAL A CA   1  
ATOM 2691   C C    . VAL A 1 175 ? 10.562  21.935  198.457 1.00 0.00 ?  175 VAL A C    1  
ATOM 2692   O O    . VAL A 1 175 ? 9.369   21.760  198.707 1.00 0.00 ?  175 VAL A O    1  
ATOM 2693   C CB   . VAL A 1 175 ? 11.806  19.974  199.244 1.00 0.00 ?  175 VAL A CB   1  
ATOM 2694   C CG1  . VAL A 1 175 ? 12.190  19.716  197.777 1.00 0.00 ?  175 VAL A CG1  1  
ATOM 2695   C CG2  . VAL A 1 175 ? 12.872  19.478  200.234 1.00 0.00 ?  175 VAL A CG2  1  
ATOM 2696   H H    . VAL A 1 175 ? 10.319  21.519  201.076 1.00 0.00 ?  175 VAL A H    1  
ATOM 2697   H HA   . VAL A 1 175 ? 12.562  21.971  199.230 1.00 0.00 ?  175 VAL A HA   1  
ATOM 2698   H HB   . VAL A 1 175 ? 10.850  19.454  199.461 1.00 0.00 ?  175 VAL A HB   1  
ATOM 2699   H HG11 . VAL A 1 175 ? 11.283  19.711  197.136 1.00 0.00 ?  175 VAL A HG11 1  
ATOM 2700   H HG12 . VAL A 1 175 ? 12.699  18.733  197.679 1.00 0.00 ?  175 VAL A HG12 1  
ATOM 2701   H HG13 . VAL A 1 175 ? 12.878  20.509  197.413 1.00 0.00 ?  175 VAL A HG13 1  
ATOM 2702   H HG21 . VAL A 1 175 ? 13.659  20.251  200.374 1.00 0.00 ?  175 VAL A HG21 1  
ATOM 2703   H HG22 . VAL A 1 175 ? 13.350  18.551  199.853 1.00 0.00 ?  175 VAL A HG22 1  
ATOM 2704   H HG23 . VAL A 1 175 ? 12.411  19.260  201.221 1.00 0.00 ?  175 VAL A HG23 1  
ATOM 2705   N N    . ARG A 1 176 ? 10.998  22.549  197.295 1.00 0.00 ?  176 ARG A N    1  
ATOM 2706   C CA   . ARG A 1 176 ? 10.077  23.076  196.261 1.00 0.00 ?  176 ARG A CA   1  
ATOM 2707   C C    . ARG A 1 176 ? 9.678   21.973  195.307 1.00 0.00 ?  176 ARG A C    1  
ATOM 2708   O O    . ARG A 1 176 ? 10.529  21.343  194.685 1.00 0.00 ?  176 ARG A O    1  
ATOM 2709   C CB   . ARG A 1 176 ? 10.755  24.196  195.395 1.00 0.00 ?  176 ARG A CB   1  
ATOM 2710   C CG   . ARG A 1 176 ? 9.895   24.783  194.230 1.00 0.00 ?  176 ARG A CG   1  
ATOM 2711   C CD   . ARG A 1 176 ? 10.578  25.989  193.570 1.00 0.00 ?  176 ARG A CD   1  
ATOM 2712   N NE   . ARG A 1 176 ? 9.751   26.462  192.422 1.00 0.00 ?  176 ARG A NE   1  
ATOM 2713   C CZ   . ARG A 1 176 ? 10.086  27.623  191.779 1.00 0.00 ?  176 ARG A CZ   1  
ATOM 2714   N NH1  . ARG A 1 176 ? 11.178  28.333  192.189 1.00 0.00 1  176 ARG A NH1  1  
ATOM 2715   N NH2  . ARG A 1 176 ? 9.336   28.076  190.730 1.00 0.00 ?  176 ARG A NH2  1  
ATOM 2716   H H    . ARG A 1 176 ? 11.969  22.665  197.102 1.00 0.00 ?  176 ARG A H    1  
ATOM 2717   H HA   . ARG A 1 176 ? 9.202   23.461  196.757 1.00 0.00 ?  176 ARG A HA   1  
ATOM 2718   H HB2  . ARG A 1 176 ? 11.044  25.030  196.068 1.00 0.00 ?  176 ARG A HB2  1  
ATOM 2719   H HB3  . ARG A 1 176 ? 11.691  23.781  194.963 1.00 0.00 ?  176 ARG A HB3  1  
ATOM 2720   H HG2  . ARG A 1 176 ? 9.727   23.995  193.465 1.00 0.00 ?  176 ARG A HG2  1  
ATOM 2721   H HG3  . ARG A 1 176 ? 8.905   25.095  194.628 1.00 0.00 ?  176 ARG A HG3  1  
ATOM 2722   H HD2  . ARG A 1 176 ? 10.676  26.828  194.293 1.00 0.00 ?  176 ARG A HD2  1  
ATOM 2723   H HD3  . ARG A 1 176 ? 11.580  25.712  193.181 1.00 0.00 ?  176 ARG A HD3  1  
ATOM 2724   H HE   . ARG A 1 176 ? 8.953   25.935  192.126 1.00 0.00 ?  176 ARG A HE   1  
ATOM 2725   H HH11 . ARG A 1 176 ? 11.729  28.005  192.956 1.00 0.00 ?  176 ARG A HH11 1  
ATOM 2726   H HH12 . ARG A 1 176 ? 11.427  29.182  191.722 1.00 0.00 ?  176 ARG A HH12 1  
ATOM 2727   H HH21 . ARG A 1 176 ? 8.534   27.560  190.427 1.00 0.00 ?  176 ARG A HH21 1  
ATOM 2728   H HH22 . ARG A 1 176 ? 9.591   28.924  190.260 1.00 0.00 ?  176 ARG A HH22 1  
ATOM 2729   N N    . ALA A 1 177 ? 8.341   21.729  195.170 1.00 0.00 ?  177 ALA A N    1  
ATOM 2730   C CA   . ALA A 1 177 ? 7.839   20.720  194.247 1.00 0.00 ?  177 ALA A CA   1  
ATOM 2731   C C    . ALA A 1 177 ? 7.621   21.390  192.912 1.00 0.00 ?  177 ALA A C    1  
ATOM 2732   O O    . ALA A 1 177 ? 7.547   22.615  192.852 1.00 0.00 ?  177 ALA A O    1  
ATOM 2733   C CB   . ALA A 1 177 ? 6.506   20.094  194.685 1.00 0.00 ?  177 ALA A CB   1  
ATOM 2734   H H    . ALA A 1 177 ? 7.652   22.223  195.699 1.00 0.00 ?  177 ALA A H    1  
ATOM 2735   H HA   . ALA A 1 177 ? 8.600   19.961  194.145 1.00 0.00 ?  177 ALA A HA   1  
ATOM 2736   H HB1  . ALA A 1 177 ? 6.491   19.948  195.787 1.00 0.00 ?  177 ALA A HB1  1  
ATOM 2737   H HB2  . ALA A 1 177 ? 6.364   19.107  194.195 1.00 0.00 ?  177 ALA A HB2  1  
ATOM 2738   H HB3  . ALA A 1 177 ? 5.658   20.755  194.404 1.00 0.00 ?  177 ALA A HB3  1  
ATOM 2739   N N    . ALA A 1 178 ? 7.480   20.585  191.802 1.00 0.00 ?  178 ALA A N    1  
ATOM 2740   C CA   . ALA A 1 178 ? 7.297   21.164  190.473 1.00 0.00 ?  178 ALA A CA   1  
ATOM 2741   C C    . ALA A 1 178 ? 5.949   20.814  189.907 1.00 0.00 ?  178 ALA A C    1  
ATOM 2742   O O    . ALA A 1 178 ? 5.442   19.715  190.064 1.00 0.00 ?  178 ALA A O    1  
ATOM 2743   C CB   . ALA A 1 178 ? 8.322   20.670  189.451 1.00 0.00 ?  178 ALA A CB   1  
ATOM 2744   H H    . ALA A 1 178 ? 7.510   19.587  191.853 1.00 0.00 ?  178 ALA A H    1  
ATOM 2745   H HA   . ALA A 1 178 ? 7.367   22.234  190.564 1.00 0.00 ?  178 ALA A HA   1  
ATOM 2746   H HB1  . ALA A 1 178 ? 7.810   20.301  188.537 1.00 0.00 ?  178 ALA A HB1  1  
ATOM 2747   H HB2  . ALA A 1 178 ? 8.920   19.844  189.877 1.00 0.00 ?  178 ALA A HB2  1  
ATOM 2748   H HB3  . ALA A 1 178 ? 9.006   21.493  189.164 1.00 0.00 ?  178 ALA A HB3  1  
ATOM 2749   N N    . ASN A 1 179 ? 5.359   21.818  189.228 1.00 0.00 ?  179 ASN A N    1  
ATOM 2750   C CA   . ASN A 1 179 ? 4.069   21.708  188.588 1.00 0.00 ?  179 ASN A CA   1  
ATOM 2751   C C    . ASN A 1 179 ? 4.244   21.757  187.088 1.00 0.00 ?  179 ASN A C    1  
ATOM 2752   O O    . ASN A 1 179 ? 3.309   22.103  186.380 1.00 0.00 ?  179 ASN A O    1  
ATOM 2753   C CB   . ASN A 1 179 ? 3.113   22.840  188.975 1.00 0.00 ?  179 ASN A CB   1  
ATOM 2754   C CG   . ASN A 1 179 ? 2.795   22.837  190.461 1.00 0.00 ?  179 ASN A CG   1  
ATOM 2755   O OD1  . ASN A 1 179 ? 2.413   21.810  191.021 1.00 0.00 ?  179 ASN A OD1  1  
ATOM 2756   N ND2  . ASN A 1 179 ? 2.963   24.013  191.122 1.00 0.00 ?  179 ASN A ND2  1  
ATOM 2757   H H    . ASN A 1 179 ? 5.801   22.706  189.135 1.00 0.00 ?  179 ASN A H    1  
ATOM 2758   H HA   . ASN A 1 179 ? 3.646   20.754  188.861 1.00 0.00 ?  179 ASN A HA   1  
ATOM 2759   H HB2  . ASN A 1 179 ? 3.570   23.817  188.708 1.00 0.00 ?  179 ASN A HB2  1  
ATOM 2760   H HB3  . ASN A 1 179 ? 2.164   22.731  188.407 1.00 0.00 ?  179 ASN A HB3  1  
ATOM 2761   H HD21 . ASN A 1 179 ? 3.282   24.823  190.629 1.00 0.00 ?  179 ASN A HD21 1  
ATOM 2762   H HD22 . ASN A 1 179 ? 2.766   24.070  192.100 1.00 0.00 ?  179 ASN A HD22 1  
ATOM 2763   N N    . ALA A 1 180 ? 5.441   21.426  186.576 1.00 0.00 ?  180 ALA A N    1  
ATOM 2764   C CA   . ALA A 1 180 ? 5.753   21.614  185.166 1.00 0.00 ?  180 ALA A CA   1  
ATOM 2765   C C    . ALA A 1 180 ? 4.813   20.929  184.183 1.00 0.00 ?  180 ALA A C    1  
ATOM 2766   O O    . ALA A 1 180 ? 4.560   21.519  183.135 1.00 0.00 ?  180 ALA A O    1  
ATOM 2767   C CB   . ALA A 1 180 ? 7.165   21.129  184.834 1.00 0.00 ?  180 ALA A CB   1  
ATOM 2768   H H    . ALA A 1 180 ? 6.168   21.036  187.137 1.00 0.00 ?  180 ALA A H    1  
ATOM 2769   H HA   . ALA A 1 180 ? 5.706   22.675  184.986 1.00 0.00 ?  180 ALA A HA   1  
ATOM 2770   H HB1  . ALA A 1 180 ? 7.864   21.990  184.773 1.00 0.00 ?  180 ALA A HB1  1  
ATOM 2771   H HB2  . ALA A 1 180 ? 7.169   20.598  183.859 1.00 0.00 ?  180 ALA A HB2  1  
ATOM 2772   H HB3  . ALA A 1 180 ? 7.528   20.432  185.619 1.00 0.00 ?  180 ALA A HB3  1  
ATOM 2773   N N    . ARG A 1 181 ? 4.294   19.698  184.440 1.00 0.00 ?  181 ARG A N    1  
ATOM 2774   C CA   . ARG A 1 181 ? 3.411   19.053  183.457 1.00 0.00 ?  181 ARG A CA   1  
ATOM 2775   C C    . ARG A 1 181 ? 2.032   18.913  184.065 1.00 0.00 ?  181 ARG A C    1  
ATOM 2776   O O    . ARG A 1 181 ? 1.483   19.893  184.564 1.00 0.00 ?  181 ARG A O    1  
ATOM 2777   C CB   . ARG A 1 181 ? 3.950   17.668  183.008 1.00 0.00 ?  181 ARG A CB   1  
ATOM 2778   C CG   . ARG A 1 181 ? 3.586   17.341  181.554 1.00 0.00 ?  181 ARG A CG   1  
ATOM 2779   C CD   . ARG A 1 181 ? 2.708   16.091  181.422 1.00 0.00 ?  181 ARG A CD   1  
ATOM 2780   N NE   . ARG A 1 181 ? 3.437   14.941  182.022 1.00 0.00 ?  181 ARG A NE   1  
ATOM 2781   C CZ   . ARG A 1 181 ? 2.781   13.771  182.277 1.00 0.00 ?  181 ARG A CZ   1  
ATOM 2782   N NH1  . ARG A 1 181 ? 1.451   13.645  181.972 1.00 0.00 1  181 ARG A NH1  1  
ATOM 2783   N NH2  . ARG A 1 181 ? 3.455   12.726  182.836 1.00 0.00 ?  181 ARG A NH2  1  
ATOM 2784   H H    . ARG A 1 181 ? 4.482   19.192  185.278 1.00 0.00 ?  181 ARG A H    1  
ATOM 2785   H HA   . ARG A 1 181 ? 3.333   19.703  182.603 1.00 0.00 ?  181 ARG A HA   1  
ATOM 2786   H HB2  . ARG A 1 181 ? 5.058   17.681  183.099 1.00 0.00 ?  181 ARG A HB2  1  
ATOM 2787   H HB3  . ARG A 1 181 ? 3.574   16.866  183.673 1.00 0.00 ?  181 ARG A HB3  1  
ATOM 2788   H HG2  . ARG A 1 181 ? 3.047   18.206  181.113 1.00 0.00 ?  181 ARG A HG2  1  
ATOM 2789   H HG3  . ARG A 1 181 ? 4.523   17.190  180.974 1.00 0.00 ?  181 ARG A HG3  1  
ATOM 2790   H HD2  . ARG A 1 181 ? 1.747   16.218  181.960 1.00 0.00 ?  181 ARG A HD2  1  
ATOM 2791   H HD3  . ARG A 1 181 ? 2.514   15.855  180.354 1.00 0.00 ?  181 ARG A HD3  1  
ATOM 2792   H HE   . ARG A 1 181 ? 4.408   15.026  182.243 1.00 0.00 ?  181 ARG A HE   1  
ATOM 2793   H HH11 . ARG A 1 181 ? 0.960   14.411  181.559 1.00 0.00 ?  181 ARG A HH11 1  
ATOM 2794   H HH12 . ARG A 1 181 ? 0.972   12.784  182.161 1.00 0.00 ?  181 ARG A HH12 1  
ATOM 2795   H HH21 . ARG A 1 181 ? 4.428   12.817  183.056 1.00 0.00 ?  181 ARG A HH21 1  
ATOM 2796   H HH22 . ARG A 1 181 ? 2.977   11.872  183.034 1.00 0.00 ?  181 ARG A HH22 1  
ATOM 2797   N N    . GLN A 1 182 ? 1.398   17.708  183.950 1.00 0.00 ?  182 GLN A N    1  
ATOM 2798   C CA   . GLN A 1 182 ? 0.105   17.478  184.561 1.00 0.00 ?  182 GLN A CA   1  
ATOM 2799   C C    . GLN A 1 182 ? 0.429   16.783  185.854 1.00 0.00 ?  182 GLN A C    1  
ATOM 2800   O O    . GLN A 1 182 ? 0.482   15.558  185.926 1.00 0.00 ?  182 GLN A O    1  
ATOM 2801   C CB   . GLN A 1 182 ? -0.791  16.548  183.718 1.00 0.00 ?  182 GLN A CB   1  
ATOM 2802   C CG   . GLN A 1 182 ? -2.208  16.407  184.277 1.00 0.00 ?  182 GLN A CG   1  
ATOM 2803   C CD   . GLN A 1 182 ? -2.885  17.763  184.232 1.00 0.00 ?  182 GLN A CD   1  
ATOM 2804   O OE1  . GLN A 1 182 ? -3.000  18.380  183.181 1.00 0.00 ?  182 GLN A OE1  1  
ATOM 2805   N NE2  . GLN A 1 182 ? -3.350  18.243  185.407 1.00 0.00 ?  182 GLN A NE2  1  
ATOM 2806   H H    . GLN A 1 182 ? 1.793   16.944  183.445 1.00 0.00 ?  182 GLN A H    1  
ATOM 2807   H HA   . GLN A 1 182 ? -0.371  18.426  184.754 1.00 0.00 ?  182 GLN A HA   1  
ATOM 2808   H HB2  . GLN A 1 182 ? -0.853  16.949  182.684 1.00 0.00 ?  182 GLN A HB2  1  
ATOM 2809   H HB3  . GLN A 1 182 ? -0.324  15.542  183.666 1.00 0.00 ?  182 GLN A HB3  1  
ATOM 2810   H HG2  . GLN A 1 182 ? -2.787  15.679  183.666 1.00 0.00 ?  182 GLN A HG2  1  
ATOM 2811   H HG3  . GLN A 1 182 ? -2.171  16.050  185.328 1.00 0.00 ?  182 GLN A HG3  1  
ATOM 2812   H HE21 . GLN A 1 182 ? -3.235  17.708  186.244 1.00 0.00 ?  182 GLN A HE21 1  
ATOM 2813   H HE22 . GLN A 1 182 ? -3.814  19.125  185.438 1.00 0.00 ?  182 GLN A HE22 1  
ATOM 2814   N N    . ASN A 1 183 ? 0.665   17.595  186.902 1.00 0.00 ?  183 ASN A N    1  
ATOM 2815   C CA   . ASN A 1 183 ? 1.081   17.110  188.214 1.00 0.00 ?  183 ASN A CA   1  
ATOM 2816   C C    . ASN A 1 183 ? -0.053  16.868  189.189 1.00 0.00 ?  183 ASN A C    1  
ATOM 2817   O O    . ASN A 1 183 ? 0.217   16.479  190.309 1.00 0.00 ?  183 ASN A O    1  
ATOM 2818   C CB   . ASN A 1 183 ? 2.003   18.121  188.903 1.00 0.00 ?  183 ASN A CB   1  
ATOM 2819   C CG   . ASN A 1 183 ? 1.228   19.350  189.371 1.00 0.00 ?  183 ASN A CG   1  
ATOM 2820   O OD1  . ASN A 1 183 ? 0.710   19.386  190.485 1.00 0.00 ?  183 ASN A OD1  1  
ATOM 2821   N ND2  . ASN A 1 183 ? 1.113   20.376  188.489 1.00 0.00 ?  183 ASN A ND2  1  
ATOM 2822   H H    . ASN A 1 183 ? 0.562   18.583  186.825 1.00 0.00 ?  183 ASN A H    1  
ATOM 2823   H HA   . ASN A 1 183 ? 1.614   16.188  188.061 1.00 0.00 ?  183 ASN A HA   1  
ATOM 2824   H HB2  . ASN A 1 183 ? 2.489   17.643  189.781 1.00 0.00 ?  183 ASN A HB2  1  
ATOM 2825   H HB3  . ASN A 1 183 ? 2.795   18.446  188.196 1.00 0.00 ?  183 ASN A HB3  1  
ATOM 2826   H HD21 . ASN A 1 183 ? 1.524   20.305  187.579 1.00 0.00 ?  183 ASN A HD21 1  
ATOM 2827   H HD22 . ASN A 1 183 ? 0.628   21.209  188.756 1.00 0.00 ?  183 ASN A HD22 1  
ATOM 2828   N N    . VAL A 1 184 ? -1.311  17.054  188.800 1.00 0.00 ?  184 VAL A N    1  
ATOM 2829   C CA   . VAL A 1 184 ? -2.436  17.078  189.748 1.00 0.00 ?  184 VAL A CA   1  
ATOM 2830   C C    . VAL A 1 184 ? -2.558  16.046  190.887 1.00 0.00 ?  184 VAL A C    1  
ATOM 2831   O O    . VAL A 1 184 ? -3.212  16.416  191.856 1.00 0.00 ?  184 VAL A O    1  
ATOM 2832   C CB   . VAL A 1 184 ? -3.760  17.048  189.047 1.00 0.00 ?  184 VAL A CB   1  
ATOM 2833   C CG1  . VAL A 1 184 ? -3.999  18.432  188.422 1.00 0.00 ?  184 VAL A CG1  1  
ATOM 2834   C CG2  . VAL A 1 184 ? -3.736  15.917  188.004 1.00 0.00 ?  184 VAL A CG2  1  
ATOM 2835   H H    . VAL A 1 184 ? -1.549  17.185  187.841 1.00 0.00 ?  184 VAL A H    1  
ATOM 2836   H HA   . VAL A 1 184 ? -2.360  18.038  190.226 1.00 0.00 ?  184 VAL A HA   1  
ATOM 2837   H HB   . VAL A 1 184 ? -4.569  16.840  189.778 1.00 0.00 ?  184 VAL A HB   1  
ATOM 2838   H HG11 . VAL A 1 184 ? -4.437  19.123  189.174 1.00 0.00 ?  184 VAL A HG11 1  
ATOM 2839   H HG12 . VAL A 1 184 ? -4.700  18.352  187.564 1.00 0.00 ?  184 VAL A HG12 1  
ATOM 2840   H HG13 . VAL A 1 184 ? -3.042  18.863  188.060 1.00 0.00 ?  184 VAL A HG13 1  
ATOM 2841   H HG21 . VAL A 1 184 ? -2.930  15.192  188.237 1.00 0.00 ?  184 VAL A HG21 1  
ATOM 2842   H HG22 . VAL A 1 184 ? -3.560  16.330  186.992 1.00 0.00 ?  184 VAL A HG22 1  
ATOM 2843   H HG23 . VAL A 1 184 ? -4.706  15.378  188.001 1.00 0.00 ?  184 VAL A HG23 1  
ATOM 2844   N N    . ILE A 1 185 ? -2.010  14.784  190.884 1.00 0.00 ?  185 ILE A N    1  
ATOM 2845   C CA   . ILE A 1 185 ? -2.321  13.877  192.032 1.00 0.00 ?  185 ILE A CA   1  
ATOM 2846   C C    . ILE A 1 185 ? -1.105  13.255  192.716 1.00 0.00 ?  185 ILE A C    1  
ATOM 2847   O O    . ILE A 1 185 ? -1.239  12.217  193.363 1.00 0.00 ?  185 ILE A O    1  
ATOM 2848   C CB   . ILE A 1 185 ? -3.270  12.760  191.656 1.00 0.00 ?  185 ILE A CB   1  
ATOM 2849   C CG1  . ILE A 1 185 ? -4.143  13.167  190.458 1.00 0.00 ?  185 ILE A CG1  1  
ATOM 2850   C CG2  . ILE A 1 185 ? -4.142  12.432  192.884 1.00 0.00 ?  185 ILE A CG2  1  
ATOM 2851   C CD1  . ILE A 1 185 ? -5.394  12.303  190.331 1.00 0.00 ?  185 ILE A CD1  1  
ATOM 2852   H H    . ILE A 1 185 ? -1.423  14.431  190.156 1.00 0.00 ?  185 ILE A H    1  
ATOM 2853   H HA   . ILE A 1 185 ? -2.804  14.481  192.779 1.00 0.00 ?  185 ILE A HA   1  
ATOM 2854   H HB   . ILE A 1 185 ? -2.688  11.854  191.380 1.00 0.00 ?  185 ILE A HB   1  
ATOM 2855   H HG12 . ILE A 1 185 ? -4.451  14.229  190.576 1.00 0.00 ?  185 ILE A HG12 1  
ATOM 2856   H HG13 . ILE A 1 185 ? -3.549  13.081  189.524 1.00 0.00 ?  185 ILE A HG13 1  
ATOM 2857   H HG21 . ILE A 1 185 ? -3.572  12.602  193.822 1.00 0.00 ?  185 ILE A HG21 1  
ATOM 2858   H HG22 . ILE A 1 185 ? -4.466  11.369  192.854 1.00 0.00 ?  185 ILE A HG22 1  
ATOM 2859   H HG23 . ILE A 1 185 ? -5.047  13.077  192.897 1.00 0.00 ?  185 ILE A HG23 1  
ATOM 2860   H HD11 . ILE A 1 185 ? -5.736  12.282  189.279 1.00 0.00 ?  185 ILE A HD11 1  
ATOM 2861   H HD12 . ILE A 1 185 ? -6.213  12.715  190.960 1.00 0.00 ?  185 ILE A HD12 1  
ATOM 2862   H HD13 . ILE A 1 185 ? -5.184  11.264  190.660 1.00 0.00 ?  185 ILE A HD13 1  
ATOM 2863   N N    . ALA A 1 186 ? 0.100   13.829  192.614 1.00 0.00 ?  186 ALA A N    1  
ATOM 2864   C CA   . ALA A 1 186 ? 1.265   13.178  193.207 1.00 0.00 ?  186 ALA A CA   1  
ATOM 2865   C C    . ALA A 1 186 ? 1.256   13.153  194.736 1.00 0.00 ?  186 ALA A C    1  
ATOM 2866   O O    . ALA A 1 186 ? 0.549   13.901  195.411 1.00 0.00 ?  186 ALA A O    1  
ATOM 2867   C CB   . ALA A 1 186 ? 2.588   13.798  192.740 1.00 0.00 ?  186 ALA A CB   1  
ATOM 2868   H H    . ALA A 1 186 ? 0.253   14.696  192.145 1.00 0.00 ?  186 ALA A H    1  
ATOM 2869   H HA   . ALA A 1 186 ? 1.234   12.164  192.876 1.00 0.00 ?  186 ALA A HA   1  
ATOM 2870   H HB1  . ALA A 1 186 ? 2.414   14.488  191.890 1.00 0.00 ?  186 ALA A HB1  1  
ATOM 2871   H HB2  . ALA A 1 186 ? 3.285   13.000  192.404 1.00 0.00 ?  186 ALA A HB2  1  
ATOM 2872   H HB3  . ALA A 1 186 ? 3.070   14.361  193.565 1.00 0.00 ?  186 ALA A HB3  1  
ATOM 2873   N N    . GLU A 1 187 ? 2.042   12.169  195.274 1.00 0.00 ?  187 GLU A N    1  
ATOM 2874   C CA   . GLU A 1 187 ? 2.255   11.967  196.698 1.00 0.00 ?  187 GLU A CA   1  
ATOM 2875   C C    . GLU A 1 187 ? 3.750   11.794  196.814 1.00 0.00 ?  187 GLU A C    1  
ATOM 2876   O O    . GLU A 1 187 ? 4.380   11.486  195.813 1.00 0.00 ?  187 GLU A O    1  
ATOM 2877   C CB   . GLU A 1 187 ? 1.563   10.718  197.272 1.00 0.00 ?  187 GLU A CB   1  
ATOM 2878   C CG   . GLU A 1 187 ? 0.037   10.833  197.243 1.00 0.00 ?  187 GLU A CG   1  
ATOM 2879   C CD   . GLU A 1 187 ? -0.548  9.536   197.777 1.00 0.00 ?  187 GLU A CD   1  
ATOM 2880   O OE1  . GLU A 1 187 ? -1.787  9.496   198.006 1.00 0.00 ?  187 GLU A OE1  1  
ATOM 2881   O OE2  . GLU A 1 187 ? 0.234   8.566   197.961 1.00 0.00 -1 187 GLU A OE2  1  
ATOM 2882   H H    . GLU A 1 187 ? 2.510   11.516  194.690 1.00 0.00 ?  187 GLU A H    1  
ATOM 2883   H HA   . GLU A 1 187 ? 1.949   12.862  197.217 1.00 0.00 ?  187 GLU A HA   1  
ATOM 2884   H HB2  . GLU A 1 187 ? 1.874   9.828   196.683 1.00 0.00 ?  187 GLU A HB2  1  
ATOM 2885   H HB3  . GLU A 1 187 ? 1.892   10.570  198.322 1.00 0.00 ?  187 GLU A HB3  1  
ATOM 2886   H HG2  . GLU A 1 187 ? -0.294  11.685  197.877 1.00 0.00 ?  187 GLU A HG2  1  
ATOM 2887   H HG3  . GLU A 1 187 ? -0.317  10.993  196.203 1.00 0.00 ?  187 GLU A HG3  1  
ATOM 2888   N N    . ALA A 1 188 ? 4.375   11.988  198.017 1.00 0.00 ?  188 ALA A N    1  
ATOM 2889   C CA   . ALA A 1 188 ? 5.834   11.897  198.081 1.00 0.00 ?  188 ALA A CA   1  
ATOM 2890   C C    . ALA A 1 188 ? 6.297   11.132  199.293 1.00 0.00 ?  188 ALA A C    1  
ATOM 2891   O O    . ALA A 1 188 ? 5.575   10.965  200.273 1.00 0.00 ?  188 ALA A O    1  
ATOM 2892   C CB   . ALA A 1 188 ? 6.511   13.274  198.113 1.00 0.00 ?  188 ALA A CB   1  
ATOM 2893   H H    . ALA A 1 188 ? 3.890   12.187  198.865 1.00 0.00 ?  188 ALA A H    1  
ATOM 2894   H HA   . ALA A 1 188 ? 6.167   11.360  197.210 1.00 0.00 ?  188 ALA A HA   1  
ATOM 2895   H HB1  . ALA A 1 188 ? 7.552   13.184  198.490 1.00 0.00 ?  188 ALA A HB1  1  
ATOM 2896   H HB2  . ALA A 1 188 ? 5.951   13.965  198.778 1.00 0.00 ?  188 ALA A HB2  1  
ATOM 2897   H HB3  . ALA A 1 188 ? 6.539   13.710  197.096 1.00 0.00 ?  188 ALA A HB3  1  
ATOM 2898   N N    . ARG A 1 189 ? 7.554   10.608  199.185 1.00 0.00 ?  189 ARG A N    1  
ATOM 2899   C CA   . ARG A 1 189 ? 8.171   9.846   200.249 1.00 0.00 ?  189 ARG A CA   1  
ATOM 2900   C C    . ARG A 1 189 ? 9.598   10.355  200.363 1.00 0.00 ?  189 ARG A C    1  
ATOM 2901   O O    . ARG A 1 189 ? 10.237  10.603  199.340 1.00 0.00 ?  189 ARG A O    1  
ATOM 2902   C CB   . ARG A 1 189 ? 8.203   8.344   199.909 1.00 0.00 ?  189 ARG A CB   1  
ATOM 2903   C CG   . ARG A 1 189 ? 6.790   7.772   199.719 1.00 0.00 ?  189 ARG A CG   1  
ATOM 2904   C CD   . ARG A 1 189 ? 6.779   6.354   199.139 1.00 0.00 ?  189 ARG A CD   1  
ATOM 2905   N NE   . ARG A 1 189 ? 7.256   6.407   197.727 1.00 0.00 ?  189 ARG A NE   1  
ATOM 2906   C CZ   . ARG A 1 189 ? 7.372   5.253   197.007 1.00 0.00 ?  189 ARG A CZ   1  
ATOM 2907   N NH1  . ARG A 1 189 ? 7.149   4.049   197.610 1.00 0.00 1  189 ARG A NH1  1  
ATOM 2908   N NH2  . ARG A 1 189 ? 7.713   5.297   195.684 1.00 0.00 ?  189 ARG A NH2  1  
ATOM 2909   H H    . ARG A 1 189 ? 8.105   10.731  198.362 1.00 0.00 ?  189 ARG A H    1  
ATOM 2910   H HA   . ARG A 1 189 ? 7.633   10.033  201.166 1.00 0.00 ?  189 ARG A HA   1  
ATOM 2911   H HB2  . ARG A 1 189 ? 8.788   8.193   198.975 1.00 0.00 ?  189 ARG A HB2  1  
ATOM 2912   H HB3  . ARG A 1 189 ? 8.708   7.791   200.728 1.00 0.00 ?  189 ARG A HB3  1  
ATOM 2913   H HG2  . ARG A 1 189 ? 6.271   7.762   200.701 1.00 0.00 ?  189 ARG A HG2  1  
ATOM 2914   H HG3  . ARG A 1 189 ? 6.221   8.444   199.041 1.00 0.00 ?  189 ARG A HG3  1  
ATOM 2915   H HD2  . ARG A 1 189 ? 7.457   5.687   199.713 1.00 0.00 ?  189 ARG A HD2  1  
ATOM 2916   H HD3  . ARG A 1 189 ? 5.750   5.936   199.139 1.00 0.00 ?  189 ARG A HD3  1  
ATOM 2917   H HE   . ARG A 1 189 ? 7.454   7.289   197.298 1.00 0.00 ?  189 ARG A HE   1  
ATOM 2918   H HH11 . ARG A 1 189 ? 6.902   4.012   198.579 1.00 0.00 ?  189 ARG A HH11 1  
ATOM 2919   H HH12 . ARG A 1 189 ? 7.234   3.203   197.084 1.00 0.00 ?  189 ARG A HH12 1  
ATOM 2920   H HH21 . ARG A 1 189 ? 7.879   6.176   195.237 1.00 0.00 ?  189 ARG A HH21 1  
ATOM 2921   H HH22 . ARG A 1 189 ? 7.785   4.449   195.159 1.00 0.00 ?  189 ARG A HH22 1  
ATOM 2922   N N    . ALA A 1 190 ? 10.136  10.532  201.618 1.00 0.00 ?  190 ALA A N    1  
ATOM 2923   C CA   . ALA A 1 190 ? 11.495  11.049  201.779 1.00 0.00 ?  190 ALA A CA   1  
ATOM 2924   C C    . ALA A 1 190 ? 12.432  9.981   202.280 1.00 0.00 ?  190 ALA A C    1  
ATOM 2925   O O    . ALA A 1 190 ? 12.122  9.241   203.215 1.00 0.00 ?  190 ALA A O    1  
ATOM 2926   C CB   . ALA A 1 190 ? 11.589  12.217  202.762 1.00 0.00 ?  190 ALA A CB   1  
ATOM 2927   H H    . ALA A 1 190 ? 9.639   10.316  202.457 1.00 0.00 ?  190 ALA A H    1  
ATOM 2928   H HA   . ALA A 1 190 ? 11.838  11.373  200.811 1.00 0.00 ?  190 ALA A HA   1  
ATOM 2929   H HB1  . ALA A 1 190 ? 11.642  13.181  202.213 1.00 0.00 ?  190 ALA A HB1  1  
ATOM 2930   H HB2  . ALA A 1 190 ? 12.499  12.117  203.391 1.00 0.00 ?  190 ALA A HB2  1  
ATOM 2931   H HB3  . ALA A 1 190 ? 10.699  12.235  203.426 1.00 0.00 ?  190 ALA A HB3  1  
ATOM 2932   N N    . LYS A 1 191 ? 13.639  9.931   201.657 1.00 0.00 ?  191 LYS A N    1  
ATOM 2933   C CA   . LYS A 1 191 ? 14.676  8.991   202.031 1.00 0.00 ?  191 LYS A CA   1  
ATOM 2934   C C    . LYS A 1 191 ? 15.905  9.833   202.297 1.00 0.00 ?  191 LYS A C    1  
ATOM 2935   O O    . LYS A 1 191 ? 16.072  10.876  201.681 1.00 0.00 ?  191 LYS A O    1  
ATOM 2936   C CB   . LYS A 1 191 ? 15.029  7.994   200.907 1.00 0.00 ?  191 LYS A CB   1  
ATOM 2937   C CG   . LYS A 1 191 ? 15.898  6.819   201.366 1.00 0.00 ?  191 LYS A CG   1  
ATOM 2938   C CD   . LYS A 1 191 ? 15.121  5.788   202.189 1.00 0.00 ?  191 LYS A CD   1  
ATOM 2939   C CE   . LYS A 1 191 ? 15.972  4.567   202.544 1.00 0.00 ?  191 LYS A CE   1  
ATOM 2940   N NZ   . LYS A 1 191 ? 15.163  3.570   203.290 1.00 0.00 1  191 LYS A NZ   1  
ATOM 2941   H H    . LYS A 1 191 ? 13.865  10.547  200.908 1.00 0.00 ?  191 LYS A H    1  
ATOM 2942   H HA   . LYS A 1 191 ? 14.376  8.480   202.933 1.00 0.00 ?  191 LYS A HA   1  
ATOM 2943   H HB2  . LYS A 1 191 ? 14.087  7.594   200.475 1.00 0.00 ?  191 LYS A HB2  1  
ATOM 2944   H HB3  . LYS A 1 191 ? 15.563  8.536   200.104 1.00 0.00 ?  191 LYS A HB3  1  
ATOM 2945   H HG2  . LYS A 1 191 ? 16.331  6.318   200.474 1.00 0.00 ?  191 LYS A HG2  1  
ATOM 2946   H HG3  . LYS A 1 191 ? 16.739  7.211   201.978 1.00 0.00 ?  191 LYS A HG3  1  
ATOM 2947   H HD2  . LYS A 1 191 ? 14.760  6.263   203.124 1.00 0.00 ?  191 LYS A HD2  1  
ATOM 2948   H HD3  . LYS A 1 191 ? 14.235  5.454   201.608 1.00 0.00 ?  191 LYS A HD3  1  
ATOM 2949   H HE2  . LYS A 1 191 ? 16.353  4.078   201.620 1.00 0.00 ?  191 LYS A HE2  1  
ATOM 2950   H HE3  . LYS A 1 191 ? 16.831  4.865   203.183 1.00 0.00 ?  191 LYS A HE3  1  
ATOM 2951   H HZ1  . LYS A 1 191 ? 15.271  2.632   202.844 1.00 0.00 ?  191 LYS A HZ1  1  
ATOM 2952   H HZ2  . LYS A 1 191 ? 14.161  3.852   203.265 1.00 0.00 ?  191 LYS A HZ2  1  
ATOM 2953   H HZ3  . LYS A 1 191 ? 15.482  3.522   204.282 1.00 0.00 ?  191 LYS A HZ3  1  
ATOM 2954   N N    . MET A 1 192 ? 16.769  9.423   203.256 1.00 0.00 ?  192 MET A N    1  
ATOM 2955   C CA   . MET A 1 192 ? 17.974  10.184  203.558 1.00 0.00 ?  192 MET A CA   1  
ATOM 2956   C C    . MET A 1 192 ? 19.123  9.215   203.573 1.00 0.00 ?  192 MET A C    1  
ATOM 2957   O O    . MET A 1 192 ? 18.909  8.016   203.651 1.00 0.00 ?  192 MET A O    1  
ATOM 2958   C CB   . MET A 1 192 ? 17.932  10.912  204.912 1.00 0.00 ?  192 MET A CB   1  
ATOM 2959   C CG   . MET A 1 192 ? 17.592  12.394  204.762 1.00 0.00 ?  192 MET A CG   1  
ATOM 2960   S SD   . MET A 1 192 ? 15.830  12.686  204.426 1.00 0.00 ?  192 MET A SD   1  
ATOM 2961   C CE   . MET A 1 192 ? 15.657  14.016  205.650 1.00 0.00 ?  192 MET A CE   1  
ATOM 2962   H H    . MET A 1 192 ? 16.630  8.584   203.780 1.00 0.00 ?  192 MET A H    1  
ATOM 2963   H HA   . MET A 1 192 ? 18.131  10.890  202.759 1.00 0.00 ?  192 MET A HA   1  
ATOM 2964   H HB2  . MET A 1 192 ? 17.174  10.425  205.563 1.00 0.00 ?  192 MET A HB2  1  
ATOM 2965   H HB3  . MET A 1 192 ? 18.922  10.817  205.406 1.00 0.00 ?  192 MET A HB3  1  
ATOM 2966   H HG2  . MET A 1 192 ? 17.890  12.920  205.695 1.00 0.00 ?  192 MET A HG2  1  
ATOM 2967   H HG3  . MET A 1 192 ? 18.203  12.810  203.934 1.00 0.00 ?  192 MET A HG3  1  
ATOM 2968   H HE1  . MET A 1 192 ? 14.711  14.578  205.492 1.00 0.00 ?  192 MET A HE1  1  
ATOM 2969   H HE2  . MET A 1 192 ? 16.499  14.734  205.578 1.00 0.00 ?  192 MET A HE2  1  
ATOM 2970   H HE3  . MET A 1 192 ? 15.643  13.604  206.682 1.00 0.00 ?  192 MET A HE3  1  
ATOM 2971   N N    . ARG A 1 193 ? 20.373  9.697   203.344 1.00 0.00 ?  193 ARG A N    1  
ATOM 2972   C CA   . ARG A 1 193 ? 21.505  8.793   203.403 1.00 0.00 ?  193 ARG A CA   1  
ATOM 2973   C C    . ARG A 1 193 ? 22.542  9.426   204.281 1.00 0.00 ?  193 ARG A C    1  
ATOM 2974   O O    . ARG A 1 193 ? 23.145  10.424  203.906 1.00 0.00 ?  193 ARG A O    1  
ATOM 2975   C CB   . ARG A 1 193 ? 22.148  8.556   202.029 1.00 0.00 ?  193 ARG A CB   1  
ATOM 2976   C CG   . ARG A 1 193 ? 23.277  7.526   202.065 1.00 0.00 ?  193 ARG A CG   1  
ATOM 2977   C CD   . ARG A 1 193 ? 23.923  7.338   200.693 1.00 0.00 ?  193 ARG A CD   1  
ATOM 2978   N NE   . ARG A 1 193 ? 24.600  8.612   200.321 1.00 0.00 ?  193 ARG A NE   1  
ATOM 2979   C CZ   . ARG A 1 193 ? 25.132  8.762   199.075 1.00 0.00 ?  193 ARG A CZ   1  
ATOM 2980   N NH1  . ARG A 1 193 ? 25.071  7.735   198.178 1.00 0.00 1  193 ARG A NH1  1  
ATOM 2981   N NH2  . ARG A 1 193 ? 25.731  9.939   198.725 1.00 0.00 ?  193 ARG A NH2  1  
ATOM 2982   H H    . ARG A 1 193 ? 20.557  10.650  203.121 1.00 0.00 ?  193 ARG A H    1  
ATOM 2983   H HA   . ARG A 1 193 ? 21.190  7.863   203.843 1.00 0.00 ?  193 ARG A HA   1  
ATOM 2984   H HB2  . ARG A 1 193 ? 21.368  8.216   201.316 1.00 0.00 ?  193 ARG A HB2  1  
ATOM 2985   H HB3  . ARG A 1 193 ? 22.559  9.515   201.658 1.00 0.00 ?  193 ARG A HB3  1  
ATOM 2986   H HG2  . ARG A 1 193 ? 24.052  7.855   202.789 1.00 0.00 ?  193 ARG A HG2  1  
ATOM 2987   H HG3  . ARG A 1 193 ? 22.869  6.552   202.412 1.00 0.00 ?  193 ARG A HG3  1  
ATOM 2988   H HD2  . ARG A 1 193 ? 24.684  6.531   200.719 1.00 0.00 ?  193 ARG A HD2  1  
ATOM 2989   H HD3  . ARG A 1 193 ? 23.158  7.114   199.919 1.00 0.00 ?  193 ARG A HD3  1  
ATOM 2990   H HE   . ARG A 1 193 ? 24.654  9.360   200.984 1.00 0.00 ?  193 ARG A HE   1  
ATOM 2991   H HH11 . ARG A 1 193 ? 24.635  6.873   198.435 1.00 0.00 ?  193 ARG A HH11 1  
ATOM 2992   H HH12 . ARG A 1 193 ? 25.461  7.846   197.264 1.00 0.00 ?  193 ARG A HH12 1  
ATOM 2993   H HH21 . ARG A 1 193 ? 25.779  10.690  199.384 1.00 0.00 ?  193 ARG A HH21 1  
ATOM 2994   H HH22 . ARG A 1 193 ? 26.121  10.050  197.811 1.00 0.00 ?  193 ARG A HH22 1  
ATOM 2995   N N    . LEU A 1 194 ? 22.751  8.837   205.489 1.00 0.00 ?  194 LEU A N    1  
ATOM 2996   C CA   . LEU A 1 194 ? 23.741  9.328   206.424 1.00 0.00 ?  194 LEU A CA   1  
ATOM 2997   C C    . LEU A 1 194 ? 24.753  8.243   206.659 1.00 0.00 ?  194 LEU A C    1  
ATOM 2998   O O    . LEU A 1 194 ? 24.442  7.059   206.527 1.00 0.00 ?  194 LEU A O    1  
ATOM 2999   C CB   . LEU A 1 194 ? 23.158  9.741   207.789 1.00 0.00 ?  194 LEU A CB   1  
ATOM 3000   C CG   . LEU A 1 194 ? 22.114  10.867  207.674 1.00 0.00 ?  194 LEU A CG   1  
ATOM 3001   C CD1  . LEU A 1 194 ? 21.497  11.199  209.043 1.00 0.00 ?  194 LEU A CD1  1  
ATOM 3002   C CD2  . LEU A 1 194 ? 22.715  12.125  207.021 1.00 0.00 ?  194 LEU A CD2  1  
ATOM 3003   H H    . LEU A 1 194 ? 22.228  8.038   205.785 1.00 0.00 ?  194 LEU A H    1  
ATOM 3004   H HA   . LEU A 1 194 ? 24.239  10.167  205.966 1.00 0.00 ?  194 LEU A HA   1  
ATOM 3005   H HB2  . LEU A 1 194 ? 22.685  8.852   208.263 1.00 0.00 ?  194 LEU A HB2  1  
ATOM 3006   H HB3  . LEU A 1 194 ? 23.983  10.085  208.446 1.00 0.00 ?  194 LEU A HB3  1  
ATOM 3007   H HG   . LEU A 1 194 ? 21.297  10.505  207.017 1.00 0.00 ?  194 LEU A HG   1  
ATOM 3008   H HD11 . LEU A 1 194 ? 21.104  10.278  209.525 1.00 0.00 ?  194 LEU A HD11 1  
ATOM 3009   H HD12 . LEU A 1 194 ? 20.661  11.922  208.925 1.00 0.00 ?  194 LEU A HD12 1  
ATOM 3010   H HD13 . LEU A 1 194 ? 22.262  11.649  209.712 1.00 0.00 ?  194 LEU A HD13 1  
ATOM 3011   H HD21 . LEU A 1 194 ? 23.823  12.114  207.109 1.00 0.00 ?  194 LEU A HD21 1  
ATOM 3012   H HD22 . LEU A 1 194 ? 22.328  13.039  207.518 1.00 0.00 ?  194 LEU A HD22 1  
ATOM 3013   H HD23 . LEU A 1 194 ? 22.446  12.166  205.944 1.00 0.00 ?  194 LEU A HD23 1  
ATOM 3014   N N    . MET A 1 195 ? 26.006  8.642   206.989 1.00 0.00 ?  195 MET A N    1  
ATOM 3015   C CA   . MET A 1 195 ? 27.039  7.683   207.303 1.00 0.00 ?  195 MET A CA   1  
ATOM 3016   C C    . MET A 1 195 ? 27.246  7.789   208.783 1.00 0.00 ?  195 MET A C    1  
ATOM 3017   O O    . MET A 1 195 ? 27.197  8.881   209.343 1.00 0.00 ?  195 MET A O    1  
ATOM 3018   C CB   . MET A 1 195 ? 28.387  7.963   206.617 1.00 0.00 ?  195 MET A CB   1  
ATOM 3019   C CG   . MET A 1 195 ? 28.340  7.736   205.105 1.00 0.00 ?  195 MET A CG   1  
ATOM 3020   S SD   . MET A 1 195 ? 29.926  8.097   204.293 1.00 0.00 ?  195 MET A SD   1  
ATOM 3021   C CE   . MET A 1 195 ? 29.434  7.434   202.677 1.00 0.00 ?  195 MET A CE   1  
ATOM 3022   H H    . MET A 1 195 ? 26.266  9.603   207.030 1.00 0.00 ?  195 MET A H    1  
ATOM 3023   H HA   . MET A 1 195 ? 26.682  6.695   207.060 1.00 0.00 ?  195 MET A HA   1  
ATOM 3024   H HB2  . MET A 1 195 ? 28.682  9.016   206.816 1.00 0.00 ?  195 MET A HB2  1  
ATOM 3025   H HB3  . MET A 1 195 ? 29.161  7.300   207.056 1.00 0.00 ?  195 MET A HB3  1  
ATOM 3026   H HG2  . MET A 1 195 ? 28.052  6.678   204.916 1.00 0.00 ?  195 MET A HG2  1  
ATOM 3027   H HG3  . MET A 1 195 ? 27.545  8.381   204.675 1.00 0.00 ?  195 MET A HG3  1  
ATOM 3028   H HE1  . MET A 1 195 ? 29.573  6.333   202.643 1.00 0.00 ?  195 MET A HE1  1  
ATOM 3029   H HE2  . MET A 1 195 ? 30.043  7.880   201.862 1.00 0.00 ?  195 MET A HE2  1  
ATOM 3030   H HE3  . MET A 1 195 ? 28.364  7.653   202.467 1.00 0.00 ?  195 MET A HE3  1  
ATOM 3031   N N    . ARG A 1 196 ? 27.482  6.650   209.465 1.00 0.00 ?  196 ARG A N    1  
ATOM 3032   C CA   . ARG A 1 196 ? 27.656  6.703   210.893 1.00 0.00 ?  196 ARG A CA   1  
ATOM 3033   C C    . ARG A 1 196 ? 29.024  7.238   211.182 1.00 0.00 ?  196 ARG A C    1  
ATOM 3034   O O    . ARG A 1 196 ? 29.894  7.277   210.321 1.00 0.00 ?  196 ARG A O    1  
ATOM 3035   C CB   . ARG A 1 196 ? 27.522  5.347   211.605 1.00 0.00 ?  196 ARG A CB   1  
ATOM 3036   C CG   . ARG A 1 196 ? 26.984  5.493   213.036 1.00 0.00 ?  196 ARG A CG   1  
ATOM 3037   C CD   . ARG A 1 196 ? 25.455  5.525   213.095 1.00 0.00 ?  196 ARG A CD   1  
ATOM 3038   N NE   . ARG A 1 196 ? 24.956  4.121   213.061 1.00 0.00 ?  196 ARG A NE   1  
ATOM 3039   C CZ   . ARG A 1 196 ? 24.937  3.376   214.211 1.00 0.00 ?  196 ARG A CZ   1  
ATOM 3040   N NH1  . ARG A 1 196 ? 25.375  3.918   215.385 1.00 0.00 1  196 ARG A NH1  1  
ATOM 3041   N NH2  . ARG A 1 196 ? 24.486  2.089   214.188 1.00 0.00 ?  196 ARG A NH2  1  
ATOM 3042   H H    . ARG A 1 196 ? 27.545  5.755   209.030 1.00 0.00 ?  196 ARG A H    1  
ATOM 3043   H HA   . ARG A 1 196 ? 26.924  7.396   211.278 1.00 0.00 ?  196 ARG A HA   1  
ATOM 3044   H HB2  . ARG A 1 196 ? 26.837  4.695   211.020 1.00 0.00 ?  196 ARG A HB2  1  
ATOM 3045   H HB3  . ARG A 1 196 ? 28.517  4.856   211.644 1.00 0.00 ?  196 ARG A HB3  1  
ATOM 3046   H HG2  . ARG A 1 196 ? 27.349  4.641   213.647 1.00 0.00 ?  196 ARG A HG2  1  
ATOM 3047   H HG3  . ARG A 1 196 ? 27.381  6.427   213.484 1.00 0.00 ?  196 ARG A HG3  1  
ATOM 3048   H HD2  . ARG A 1 196 ? 25.102  6.007   214.033 1.00 0.00 ?  196 ARG A HD2  1  
ATOM 3049   H HD3  . ARG A 1 196 ? 25.036  6.060   212.217 1.00 0.00 ?  196 ARG A HD3  1  
ATOM 3050   H HE   . ARG A 1 196 ? 24.636  3.723   212.201 1.00 0.00 ?  196 ARG A HE   1  
ATOM 3051   H HH11 . ARG A 1 196 ? 25.710  4.861   215.407 1.00 0.00 ?  196 ARG A HH11 1  
ATOM 3052   H HH12 . ARG A 1 196 ? 25.360  3.373   216.224 1.00 0.00 ?  196 ARG A HH12 1  
ATOM 3053   H HH21 . ARG A 1 196 ? 24.169  1.684   213.333 1.00 0.00 ?  196 ARG A HH21 1  
ATOM 3054   H HH22 . ARG A 1 196 ? 24.474  1.550   215.030 1.00 0.00 ?  196 ARG A HH22 1  
ATOM 3055   N N    . ARG A 1 197 ? 29.214  7.723   212.422 1.00 0.00 ?  197 ARG A N    1  
ATOM 3056   C CA   . ARG A 1 197 ? 30.489  8.246   212.820 1.00 0.00 ?  197 ARG A CA   1  
ATOM 3057   C C    . ARG A 1 197 ? 31.492  7.139   212.769 1.00 0.00 ?  197 ARG A C    1  
ATOM 3058   O O    . ARG A 1 197 ? 32.635  7.339   212.370 1.00 0.00 ?  197 ARG A O    1  
ATOM 3059   C CB   . ARG A 1 197 ? 30.496  8.776   214.262 1.00 0.00 ?  197 ARG A CB   1  
ATOM 3060   C CG   . ARG A 1 197 ? 29.677  10.050  214.444 1.00 0.00 ?  197 ARG A CG   1  
ATOM 3061   C CD   . ARG A 1 197 ? 30.361  11.268  213.825 1.00 0.00 ?  197 ARG A CD   1  
ATOM 3062   N NE   . ARG A 1 197 ? 29.570  12.477  214.175 1.00 0.00 ?  197 ARG A NE   1  
ATOM 3063   C CZ   . ARG A 1 197 ? 30.025  13.712  213.822 1.00 0.00 ?  197 ARG A CZ   1  
ATOM 3064   N NH1  . ARG A 1 197 ? 31.189  13.838  213.121 1.00 0.00 1  197 ARG A NH1  1  
ATOM 3065   N NH2  . ARG A 1 197 ? 29.316  14.821  214.172 1.00 0.00 ?  197 ARG A NH2  1  
ATOM 3066   H H    . ARG A 1 197 ? 28.490  7.742   213.107 1.00 0.00 ?  197 ARG A H    1  
ATOM 3067   H HA   . ARG A 1 197 ? 30.767  9.023   212.127 1.00 0.00 ?  197 ARG A HA   1  
ATOM 3068   H HB2  . ARG A 1 197 ? 30.094  7.989   214.936 1.00 0.00 ?  197 ARG A HB2  1  
ATOM 3069   H HB3  . ARG A 1 197 ? 31.545  8.980   214.565 1.00 0.00 ?  197 ARG A HB3  1  
ATOM 3070   H HG2  . ARG A 1 197 ? 28.680  9.913   213.971 1.00 0.00 ?  197 ARG A HG2  1  
ATOM 3071   H HG3  . ARG A 1 197 ? 29.520  10.232  215.530 1.00 0.00 ?  197 ARG A HG3  1  
ATOM 3072   H HD2  . ARG A 1 197 ? 31.390  11.393  214.231 1.00 0.00 ?  197 ARG A HD2  1  
ATOM 3073   H HD3  . ARG A 1 197 ? 30.398  11.185  212.719 1.00 0.00 ?  197 ARG A HD3  1  
ATOM 3074   H HE   . ARG A 1 197 ? 28.712  12.384  214.679 1.00 0.00 ?  197 ARG A HE   1  
ATOM 3075   H HH11 . ARG A 1 197 ? 31.709  13.023  212.865 1.00 0.00 ?  197 ARG A HH11 1  
ATOM 3076   H HH12 . ARG A 1 197 ? 31.521  14.744  212.862 1.00 0.00 ?  197 ARG A HH12 1  
ATOM 3077   H HH21 . ARG A 1 197 ? 28.463  14.728  214.687 1.00 0.00 ?  197 ARG A HH21 1  
ATOM 3078   H HH22 . ARG A 1 197 ? 29.646  15.729  213.915 1.00 0.00 ?  197 ARG A HH22 1  
ATOM 3079   N N    . GLU A 1 198 ? 31.069  5.941   213.196 1.00 0.00 ?  198 GLU A N    1  
ATOM 3080   C CA   . GLU A 1 198 ? 31.947  4.801   213.240 1.00 0.00 ?  198 GLU A CA   1  
ATOM 3081   C C    . GLU A 1 198 ? 31.955  4.089   211.919 1.00 0.00 ?  198 GLU A C    1  
ATOM 3082   O O    . GLU A 1 198 ? 32.647  3.087   211.790 1.00 0.00 ?  198 GLU A O    1  
ATOM 3083   C CB   . GLU A 1 198 ? 31.554  3.777   214.316 1.00 0.00 ?  198 GLU A CB   1  
ATOM 3084   C CG   . GLU A 1 198 ? 31.757  4.312   215.735 1.00 0.00 ?  198 GLU A CG   1  
ATOM 3085   C CD   . GLU A 1 198 ? 31.265  3.258   216.716 1.00 0.00 ?  198 GLU A CD   1  
ATOM 3086   O OE1  . GLU A 1 198 ? 30.638  2.267   216.253 1.00 0.00 ?  198 GLU A OE1  1  
ATOM 3087   O OE2  . GLU A 1 198 ? 31.515  3.424   217.941 1.00 0.00 -1 198 GLU A OE2  1  
ATOM 3088   H H    . GLU A 1 198 ? 30.133  5.787   213.501 1.00 0.00 ?  198 GLU A H    1  
ATOM 3089   H HA   . GLU A 1 198 ? 32.939  5.173   213.438 1.00 0.00 ?  198 GLU A HA   1  
ATOM 3090   H HB2  . GLU A 1 198 ? 30.485  3.501   214.179 1.00 0.00 ?  198 GLU A HB2  1  
ATOM 3091   H HB3  . GLU A 1 198 ? 32.166  2.861   214.185 1.00 0.00 ?  198 GLU A HB3  1  
ATOM 3092   H HG2  . GLU A 1 198 ? 32.835  4.520   215.915 1.00 0.00 ?  198 GLU A HG2  1  
ATOM 3093   H HG3  . GLU A 1 198 ? 31.177  5.247   215.880 1.00 0.00 ?  198 GLU A HG3  1  
ATOM 3094   N N    . HIS A 1 199 ? 31.139  4.558   210.943 1.00 0.00 ?  199 HIS A N    1  
ATOM 3095   C CA   . HIS A 1 199 ? 31.009  3.901   209.643 1.00 0.00 ?  199 HIS A CA   1  
ATOM 3096   C C    . HIS A 1 199 ? 32.272  3.908   208.822 1.00 0.00 ?  199 HIS A C    1  
ATOM 3097   O O    . HIS A 1 199 ? 32.440  4.719   207.911 1.00 0.00 ?  199 HIS A O    1  
ATOM 3098   C CB   . HIS A 1 199 ? 29.862  4.415   208.742 1.00 0.00 ?  199 HIS A CB   1  
ATOM 3099   C CG   . HIS A 1 199 ? 28.544  3.718   208.963 1.00 0.00 ?  199 HIS A CG   1  
ATOM 3100   N ND1  . HIS A 1 199 ? 27.484  3.981   208.108 1.00 0.00 ?  199 HIS A ND1  1  
ATOM 3101   C CD2  . HIS A 1 199 ? 28.181  2.783   209.894 1.00 0.00 ?  199 HIS A CD2  1  
ATOM 3102   C CE1  . HIS A 1 199 ? 26.507  3.204   208.539 1.00 0.00 ?  199 HIS A CE1  1  
ATOM 3103   N NE2  . HIS A 1 199 ? 26.873  2.461   209.611 1.00 0.00 ?  199 HIS A NE2  1  
ATOM 3104   H H    . HIS A 1 199 ? 30.589  5.379   211.069 1.00 0.00 ?  199 HIS A H    1  
ATOM 3105   H HA   . HIS A 1 199 ? 30.803  2.868   209.878 1.00 0.00 ?  199 HIS A HA   1  
ATOM 3106   H HB2  . HIS A 1 199 ? 29.701  5.491   208.907 1.00 0.00 ?  199 HIS A HB2  1  
ATOM 3107   H HB3  . HIS A 1 199 ? 30.135  4.265   207.675 1.00 0.00 ?  199 HIS A HB3  1  
ATOM 3108   H HD2  . HIS A 1 199 ? 28.744  2.345   210.710 1.00 0.00 ?  199 HIS A HD2  1  
ATOM 3109   H HE1  . HIS A 1 199 ? 25.512  3.147   208.098 1.00 0.00 ?  199 HIS A HE1  1  
ATOM 3110   N N    . SER A 1 200 ? 33.221  3.009   209.172 1.00 0.00 ?  200 SER A N    1  
ATOM 3111   C CA   . SER A 1 200 ? 34.429  2.845   208.406 1.00 0.00 ?  200 SER A CA   1  
ATOM 3112   C C    . SER A 1 200 ? 34.029  2.155   207.118 1.00 0.00 ?  200 SER A C    1  
ATOM 3113   O O    . SER A 1 200 ? 34.846  2.020   206.206 1.00 0.00 ?  200 SER A O    1  
ATOM 3114   C CB   . SER A 1 200 ? 35.474  1.963   209.111 1.00 0.00 ?  200 SER A CB   1  
ATOM 3115   O OG   . SER A 1 200 ? 34.970  0.643   209.254 1.00 0.00 ?  200 SER A OG   1  
ATOM 3116   H H    . SER A 1 200 ? 33.127  2.426   209.975 1.00 0.00 ?  200 SER A H    1  
ATOM 3117   H HA   . SER A 1 200 ? 34.829  3.823   208.189 1.00 0.00 ?  200 SER A HA   1  
ATOM 3118   H HB2  . SER A 1 200 ? 36.408  1.926   208.511 1.00 0.00 ?  200 SER A HB2  1  
ATOM 3119   H HB3  . SER A 1 200 ? 35.705  2.370   210.117 1.00 0.00 ?  200 SER A HB3  1  
ATOM 3120   H HG   . SER A 1 200 ? 34.280  0.695   209.920 1.00 0.00 ?  200 SER A HG   1  
ATOM 3121   N N    . SER A 1 201 ? 32.751  1.660   207.092 1.00 0.00 ?  201 SER A N    1  
ATOM 3122   C CA   . SER A 1 201 ? 32.138  1.005   205.956 1.00 0.00 ?  201 SER A CA   1  
ATOM 3123   C C    . SER A 1 201 ? 32.615  -0.405  205.857 1.00 0.00 ?  201 SER A C    1  
ATOM 3124   O O    . SER A 1 201 ? 32.529  -1.016  204.791 1.00 0.00 ?  201 SER A O    1  
ATOM 3125   C CB   . SER A 1 201 ? 32.365  1.698   204.593 1.00 0.00 ?  201 SER A CB   1  
ATOM 3126   O OG   . SER A 1 201 ? 31.924  3.048   204.653 1.00 0.00 ?  201 SER A OG   1  
ATOM 3127   H H    . SER A 1 201 ? 32.164  1.729   207.896 1.00 0.00 ?  201 SER A H    1  
ATOM 3128   H HA   . SER A 1 201 ? 31.078  0.979   206.165 1.00 0.00 ?  201 SER A HA   1  
ATOM 3129   H HB2  . SER A 1 201 ? 33.442  1.682   204.325 1.00 0.00 ?  201 SER A HB2  1  
ATOM 3130   H HB3  . SER A 1 201 ? 31.792  1.172   203.800 1.00 0.00 ?  201 SER A HB3  1  
ATOM 3131   H HG   . SER A 1 201 ? 31.093  3.074   204.173 1.00 0.00 ?  201 SER A HG   1  
ATOM 3132   N N    . GLU A 1 202 ? 33.121  -0.966  206.975 1.00 0.00 ?  202 GLU A N    1  
ATOM 3133   C CA   . GLU A 1 202 ? 33.559  -2.337  206.966 1.00 0.00 ?  202 GLU A CA   1  
ATOM 3134   C C    . GLU A 1 202 ? 32.386  -3.184  207.359 1.00 0.00 ?  202 GLU A C    1  
ATOM 3135   O O    . GLU A 1 202 ? 32.366  -4.386  207.091 1.00 0.00 ?  202 GLU A O    1  
ATOM 3136   C CB   . GLU A 1 202 ? 34.697  -2.625  207.966 1.00 0.00 ?  202 GLU A CB   1  
ATOM 3137   C CG   . GLU A 1 202 ? 36.020  -1.948  207.589 1.00 0.00 ?  202 GLU A CG   1  
ATOM 3138   C CD   . GLU A 1 202 ? 36.467  -2.473  206.233 1.00 0.00 ?  202 GLU A CD   1  
ATOM 3139   O OE1  . GLU A 1 202 ? 36.465  -3.721  206.052 1.00 0.00 ?  202 GLU A OE1  1  
ATOM 3140   O OE2  . GLU A 1 202 ? 36.818  -1.635  205.360 1.00 0.00 -1 202 GLU A OE2  1  
ATOM 3141   H H    . GLU A 1 202 ? 33.212  -0.469  207.835 1.00 0.00 ?  202 GLU A H    1  
ATOM 3142   H HA   . GLU A 1 202 ? 33.861  -2.588  205.963 1.00 0.00 ?  202 GLU A HA   1  
ATOM 3143   H HB2  . GLU A 1 202 ? 34.387  -2.278  208.975 1.00 0.00 ?  202 GLU A HB2  1  
ATOM 3144   H HB3  . GLU A 1 202 ? 34.861  -3.723  208.018 1.00 0.00 ?  202 GLU A HB3  1  
ATOM 3145   H HG2  . GLU A 1 202 ? 35.881  -0.846  207.532 1.00 0.00 ?  202 GLU A HG2  1  
ATOM 3146   H HG3  . GLU A 1 202 ? 36.799  -2.177  208.346 1.00 0.00 ?  202 GLU A HG3  1  
ATOM 3147   N N    . GLY A 1 203 ? 31.368  -2.552  207.996 1.00 0.00 ?  203 GLY A N    1  
ATOM 3148   C CA   . GLY A 1 203 ? 30.206  -3.276  208.454 1.00 0.00 ?  203 GLY A CA   1  
ATOM 3149   C C    . GLY A 1 203 ? 29.051  -2.893  207.593 1.00 0.00 ?  203 GLY A C    1  
ATOM 3150   O O    . GLY A 1 203 ? 29.094  -3.041  206.373 1.00 0.00 ?  203 GLY A O    1  
ATOM 3151   H H    . GLY A 1 203 ? 31.379  -1.571  208.178 1.00 0.00 ?  203 GLY A H    1  
ATOM 3152   H HA2  . GLY A 1 203 ? 30.397  -4.328  208.342 1.00 0.00 ?  203 GLY A HA2  1  
ATOM 3153   H HA3  . GLY A 1 203 ? 30.007  -2.963  209.468 1.00 0.00 ?  203 GLY A HA3  1  
ATOM 3154   N N    . TYR A 1 204 ? 27.959  -2.413  208.229 1.00 0.00 ?  204 TYR A N    1  
ATOM 3155   C CA   . TYR A 1 204 ? 26.803  -2.025  207.479 1.00 0.00 ?  204 TYR A CA   1  
ATOM 3156   C C    . TYR A 1 204 ? 27.053  -0.641  206.977 1.00 0.00 ?  204 TYR A C    1  
ATOM 3157   O O    . TYR A 1 204 ? 26.564  0.340   207.523 1.00 0.00 ?  204 TYR A O    1  
ATOM 3158   C CB   . TYR A 1 204 ? 25.495  -2.053  208.296 1.00 0.00 ?  204 TYR A CB   1  
ATOM 3159   C CG   . TYR A 1 204 ? 25.652  -1.630  209.718 1.00 0.00 ?  204 TYR A CG   1  
ATOM 3160   C CD1  . TYR A 1 204 ? 26.068  -2.538  210.667 1.00 0.00 ?  204 TYR A CD1  1  
ATOM 3161   C CD2  . TYR A 1 204 ? 25.361  -0.340  210.109 1.00 0.00 ?  204 TYR A CD2  1  
ATOM 3162   C CE1  . TYR A 1 204 ? 26.199  -2.163  211.982 1.00 0.00 ?  204 TYR A CE1  1  
ATOM 3163   C CE2  . TYR A 1 204 ? 25.493  0.034   211.424 1.00 0.00 ?  204 TYR A CE2  1  
ATOM 3164   C CZ   . TYR A 1 204 ? 25.912  -0.877  212.359 1.00 0.00 ?  204 TYR A CZ   1  
ATOM 3165   O OH   . TYR A 1 204 ? 26.041  -0.490  213.707 1.00 0.00 ?  204 TYR A OH   1  
ATOM 3166   H H    . TYR A 1 204 ? 27.913  -2.306  209.220 1.00 0.00 ?  204 TYR A H    1  
ATOM 3167   H HA   . TYR A 1 204 ? 26.727  -2.694  206.634 1.00 0.00 ?  204 TYR A HA   1  
ATOM 3168   H HB2  . TYR A 1 204 ? 24.749  -1.372  207.835 1.00 0.00 ?  204 TYR A HB2  1  
ATOM 3169   H HB3  . TYR A 1 204 ? 25.080  -3.084  208.300 1.00 0.00 ?  204 TYR A HB3  1  
ATOM 3170   H HD1  . TYR A 1 204 ? 26.300  -3.552  210.373 1.00 0.00 ?  204 TYR A HD1  1  
ATOM 3171   H HD2  . TYR A 1 204 ? 25.026  0.381   209.379 1.00 0.00 ?  204 TYR A HD2  1  
ATOM 3172   H HE1  . TYR A 1 204 ? 26.526  -2.880  212.719 1.00 0.00 ?  204 TYR A HE1  1  
ATOM 3173   H HE2  . TYR A 1 204 ? 25.267  1.047   211.722 1.00 0.00 ?  204 TYR A HE2  1  
ATOM 3174   H HH   . TYR A 1 204 ? 26.722  -1.037  214.109 1.00 0.00 ?  204 TYR A HH   1  
ATOM 3175   N N    . SER A 1 205 ? 27.828  -0.562  205.884 1.00 0.00 ?  205 SER A N    1  
ATOM 3176   C CA   . SER A 1 205 ? 28.183  0.697   205.292 1.00 0.00 ?  205 SER A CA   1  
ATOM 3177   C C    . SER A 1 205 ? 26.942  1.366   204.801 1.00 0.00 ?  205 SER A C    1  
ATOM 3178   O O    . SER A 1 205 ? 26.005  0.694   204.391 1.00 0.00 ?  205 SER A O    1  
ATOM 3179   C CB   . SER A 1 205 ? 29.098  0.532   204.071 1.00 0.00 ?  205 SER A CB   1  
ATOM 3180   O OG   . SER A 1 205 ? 29.412  1.801   203.519 1.00 0.00 ?  205 SER A OG   1  
ATOM 3181   H H    . SER A 1 205 ? 28.192  -1.374  205.435 1.00 0.00 ?  205 SER A H    1  
ATOM 3182   H HA   . SER A 1 205 ? 28.656  1.307   206.045 1.00 0.00 ?  205 SER A HA   1  
ATOM 3183   H HB2  . SER A 1 205 ? 30.034  0.017   204.356 1.00 0.00 ?  205 SER A HB2  1  
ATOM 3184   H HB3  . SER A 1 205 ? 28.584  -0.073  203.295 1.00 0.00 ?  205 SER A HB3  1  
ATOM 3185   H HG   . SER A 1 205 ? 29.257  2.439   204.218 1.00 0.00 ?  205 SER A HG   1  
ATOM 3186   N N    . LEU A 1 206 ? 26.916  2.726   204.883 1.00 0.00 ?  206 LEU A N    1  
ATOM 3187   C CA   . LEU A 1 206 ? 25.799  3.507   204.383 1.00 0.00 ?  206 LEU A CA   1  
ATOM 3188   C C    . LEU A 1 206 ? 24.550  3.137   205.155 1.00 0.00 ?  206 LEU A C    1  
ATOM 3189   O O    . LEU A 1 206 ? 23.851  2.190   204.797 1.00 0.00 ?  206 LEU A O    1  
ATOM 3190   C CB   . LEU A 1 206 ? 25.505  3.293   202.881 1.00 0.00 ?  206 LEU A CB   1  
ATOM 3191   C CG   . LEU A 1 206 ? 26.125  4.378   201.985 1.00 0.00 ?  206 LEU A CG   1  
ATOM 3192   C CD1  . LEU A 1 206 ? 27.635  4.514   202.227 1.00 0.00 ?  206 LEU A CD1  1  
ATOM 3193   C CD2  . LEU A 1 206 ? 25.822  4.110   200.500 1.00 0.00 ?  206 LEU A CD2  1  
ATOM 3194   H H    . LEU A 1 206 ? 27.659  3.244   205.304 1.00 0.00 ?  206 LEU A H    1  
ATOM 3195   H HA   . LEU A 1 206 ? 26.027  4.545   204.572 1.00 0.00 ?  206 LEU A HA   1  
ATOM 3196   H HB2  . LEU A 1 206 ? 25.894  2.299   202.570 1.00 0.00 ?  206 LEU A HB2  1  
ATOM 3197   H HB3  . LEU A 1 206 ? 24.407  3.294   202.726 1.00 0.00 ?  206 LEU A HB3  1  
ATOM 3198   H HG   . LEU A 1 206 ? 25.654  5.347   202.254 1.00 0.00 ?  206 LEU A HG   1  
ATOM 3199   H HD11 . LEU A 1 206 ? 28.118  5.026   201.368 1.00 0.00 ?  206 LEU A HD11 1  
ATOM 3200   H HD12 . LEU A 1 206 ? 28.098  3.513   202.348 1.00 0.00 ?  206 LEU A HD12 1  
ATOM 3201   H HD13 . LEU A 1 206 ? 27.827  5.109   203.146 1.00 0.00 ?  206 LEU A HD13 1  
ATOM 3202   H HD21 . LEU A 1 206 ? 24.729  4.177   200.311 1.00 0.00 ?  206 LEU A HD21 1  
ATOM 3203   H HD22 . LEU A 1 206 ? 26.169  3.094   200.213 1.00 0.00 ?  206 LEU A HD22 1  
ATOM 3204   H HD23 . LEU A 1 206 ? 26.339  4.855   199.860 1.00 0.00 ?  206 LEU A HD23 1  
ATOM 3205   N N    . MET A 1 207 ? 24.207  3.911   206.224 1.00 0.00 ?  207 MET A N    1  
ATOM 3206   C CA   . MET A 1 207 ? 23.023  3.591   206.997 1.00 0.00 ?  207 MET A CA   1  
ATOM 3207   C C    . MET A 1 207 ? 21.855  4.202   206.289 1.00 0.00 ?  207 MET A C    1  
ATOM 3208   O O    . MET A 1 207 ? 21.781  5.420   206.102 1.00 0.00 ?  207 MET A O    1  
ATOM 3209   C CB   . MET A 1 207 ? 23.044  4.139   208.458 1.00 0.00 ?  207 MET A CB   1  
ATOM 3210   C CG   . MET A 1 207 ? 21.801  3.747   209.305 1.00 0.00 ?  207 MET A CG   1  
ATOM 3211   S SD   . MET A 1 207 ? 21.919  4.303   211.032 1.00 0.00 ?  207 MET A SD   1  
ATOM 3212   C CE   . MET A 1 207 ? 20.315  3.614   211.534 1.00 0.00 ?  207 MET A CE   1  
ATOM 3213   H H    . MET A 1 207 ? 24.729  4.714   206.506 1.00 0.00 ?  207 MET A H    1  
ATOM 3214   H HA   . MET A 1 207 ? 22.914  2.517   206.999 1.00 0.00 ?  207 MET A HA   1  
ATOM 3215   H HB2  . MET A 1 207 ? 23.956  3.760   208.966 1.00 0.00 ?  207 MET A HB2  1  
ATOM 3216   H HB3  . MET A 1 207 ? 23.113  5.248   208.422 1.00 0.00 ?  207 MET A HB3  1  
ATOM 3217   H HG2  . MET A 1 207 ? 20.900  4.187   208.832 1.00 0.00 ?  207 MET A HG2  1  
ATOM 3218   H HG3  . MET A 1 207 ? 21.689  2.642   209.275 1.00 0.00 ?  207 MET A HG3  1  
ATOM 3219   H HE1  . MET A 1 207 ? 20.335  3.298   212.599 1.00 0.00 ?  207 MET A HE1  1  
ATOM 3220   H HE2  . MET A 1 207 ? 20.054  2.726   210.918 1.00 0.00 ?  207 MET A HE2  1  
ATOM 3221   H HE3  . MET A 1 207 ? 19.506  4.366   211.414 1.00 0.00 ?  207 MET A HE3  1  
ATOM 3222   N N    . LYS A 1 208 ? 20.905  3.333   205.879 1.00 0.00 ?  208 LYS A N    1  
ATOM 3223   C CA   . LYS A 1 208 ? 19.720  3.782   205.208 1.00 0.00 ?  208 LYS A CA   1  
ATOM 3224   C C    . LYS A 1 208 ? 18.971  4.565   206.217 1.00 0.00 ?  208 LYS A C    1  
ATOM 3225   O O    . LYS A 1 208 ? 18.991  4.231   207.396 1.00 0.00 ?  208 LYS A O    1  
ATOM 3226   C CB   . LYS A 1 208 ? 18.823  2.632   204.729 1.00 0.00 ?  208 LYS A CB   1  
ATOM 3227   C CG   . LYS A 1 208 ? 18.855  1.433   205.680 1.00 0.00 ?  208 LYS A CG   1  
ATOM 3228   C CD   . LYS A 1 208 ? 19.880  0.377   205.257 1.00 0.00 ?  208 LYS A CD   1  
ATOM 3229   C CE   . LYS A 1 208 ? 20.632  -0.223  206.448 1.00 0.00 ?  208 LYS A CE   1  
ATOM 3230   N NZ   . LYS A 1 208 ? 21.646  -1.195  205.981 1.00 0.00 1  208 LYS A NZ   1  
ATOM 3231   H H    . LYS A 1 208 ? 20.988  2.349   206.018 1.00 0.00 ?  208 LYS A H    1  
ATOM 3232   H HA   . LYS A 1 208 ? 20.011  4.420   204.388 1.00 0.00 ?  208 LYS A HA   1  
ATOM 3233   H HB2  . LYS A 1 208 ? 17.778  2.999   204.639 1.00 0.00 ?  208 LYS A HB2  1  
ATOM 3234   H HB3  . LYS A 1 208 ? 19.161  2.303   203.723 1.00 0.00 ?  208 LYS A HB3  1  
ATOM 3235   H HG2  . LYS A 1 208 ? 19.100  1.785   206.704 1.00 0.00 ?  208 LYS A HG2  1  
ATOM 3236   H HG3  . LYS A 1 208 ? 17.847  0.967   205.711 1.00 0.00 ?  208 LYS A HG3  1  
ATOM 3237   H HD2  . LYS A 1 208 ? 19.357  -0.437  204.712 1.00 0.00 ?  208 LYS A HD2  1  
ATOM 3238   H HD3  . LYS A 1 208 ? 20.613  0.840   204.560 1.00 0.00 ?  208 LYS A HD3  1  
ATOM 3239   H HE2  . LYS A 1 208 ? 21.159  0.572   207.016 1.00 0.00 ?  208 LYS A HE2  1  
ATOM 3240   H HE3  . LYS A 1 208 ? 19.931  -0.756  207.124 1.00 0.00 ?  208 LYS A HE3  1  
ATOM 3241   H HZ1  . LYS A 1 208 ? 22.346  -1.353  206.733 1.00 0.00 ?  208 LYS A HZ1  1  
ATOM 3242   H HZ2  . LYS A 1 208 ? 22.122  -0.819  205.137 1.00 0.00 ?  208 LYS A HZ2  1  
ATOM 3243   H HZ3  . LYS A 1 208 ? 21.181  -2.094  205.745 1.00 0.00 ?  208 LYS A HZ3  1  
ATOM 3244   N N    . ILE A 1 209 ? 18.256  5.608   205.768 1.00 0.00 ?  209 ILE A N    1  
ATOM 3245   C CA   . ILE A 1 209 ? 17.579  6.459   206.693 1.00 0.00 ?  209 ILE A CA   1  
ATOM 3246   C C    . ILE A 1 209 ? 16.143  6.569   206.339 1.00 0.00 ?  209 ILE A C    1  
ATOM 3247   O O    . ILE A 1 209 ? 15.802  6.895   205.204 1.00 0.00 ?  209 ILE A O    1  
ATOM 3248   C CB   . ILE A 1 209 ? 18.115  7.823   206.630 1.00 0.00 ?  209 ILE A CB   1  
ATOM 3249   C CG1  . ILE A 1 209 ? 19.644  7.822   206.839 1.00 0.00 ?  209 ILE A CG1  1  
ATOM 3250   C CG2  . ILE A 1 209 ? 17.380  8.659   207.693 1.00 0.00 ?  209 ILE A CG2  1  
ATOM 3251   C CD1  . ILE A 1 209 ? 20.076  7.192   208.170 1.00 0.00 ?  209 ILE A CD1  1  
ATOM 3252   H H    . ILE A 1 209 ? 18.174  5.835   204.801 1.00 0.00 ?  209 ILE A H    1  
ATOM 3253   H HA   . ILE A 1 209 ? 17.675  6.061   207.687 1.00 0.00 ?  209 ILE A HA   1  
ATOM 3254   H HB   . ILE A 1 209 ? 17.884  8.251   205.652 1.00 0.00 ?  209 ILE A HB   1  
ATOM 3255   H HG12 . ILE A 1 209 ? 20.125  7.269   206.004 1.00 0.00 ?  209 ILE A HG12 1  
ATOM 3256   H HG13 . ILE A 1 209 ? 20.009  8.870   206.807 1.00 0.00 ?  209 ILE A HG13 1  
ATOM 3257   H HG21 . ILE A 1 209 ? 17.025  8.006   208.519 1.00 0.00 ?  209 ILE A HG21 1  
ATOM 3258   H HG22 . ILE A 1 209 ? 16.503  9.170   207.243 1.00 0.00 ?  209 ILE A HG22 1  
ATOM 3259   H HG23 . ILE A 1 209 ? 18.061  9.428   208.116 1.00 0.00 ?  209 ILE A HG23 1  
ATOM 3260   H HD11 . ILE A 1 209 ? 19.240  7.193   208.900 1.00 0.00 ?  209 ILE A HD11 1  
ATOM 3261   H HD12 . ILE A 1 209 ? 20.924  7.761   208.607 1.00 0.00 ?  209 ILE A HD12 1  
ATOM 3262   H HD13 . ILE A 1 209 ? 20.403  6.142   208.009 1.00 0.00 ?  209 ILE A HD13 1  
ATOM 3263   N N    . HIS A 1 210 ? 15.267  6.354   207.342 1.00 0.00 ?  210 HIS A N    1  
ATOM 3264   C CA   . HIS A 1 210 ? 13.862  6.473   207.109 1.00 0.00 ?  210 HIS A CA   1  
ATOM 3265   C C    . HIS A 1 210 ? 13.463  7.815   207.637 1.00 0.00 ?  210 HIS A C    1  
ATOM 3266   O O    . HIS A 1 210 ? 13.471  8.044   208.847 1.00 0.00 ?  210 HIS A O    1  
ATOM 3267   C CB   . HIS A 1 210 ? 13.034  5.408   207.851 1.00 0.00 ?  210 HIS A CB   1  
ATOM 3268   C CG   . HIS A 1 210 ? 13.386  3.995   207.468 1.00 0.00 ?  210 HIS A CG   1  
ATOM 3269   N ND1  . HIS A 1 210 ? 13.079  3.522   206.200 1.00 0.00 ?  210 HIS A ND1  1  
ATOM 3270   C CD2  . HIS A 1 210 ? 13.961  3.008   208.216 1.00 0.00 ?  210 HIS A CD2  1  
ATOM 3271   C CE1  . HIS A 1 210 ? 13.467  2.258   206.214 1.00 0.00 ?  210 HIS A CE1  1  
ATOM 3272   N NE2  . HIS A 1 210 ? 14.005  1.897   207.404 1.00 0.00 ?  210 HIS A NE2  1  
ATOM 3273   H H    . HIS A 1 210 ? 15.551  6.113   208.267 1.00 0.00 ?  210 HIS A H    1  
ATOM 3274   H HA   . HIS A 1 210 ? 13.678  6.427   206.048 1.00 0.00 ?  210 HIS A HA   1  
ATOM 3275   H HB2  . HIS A 1 210 ? 13.195  5.509   208.946 1.00 0.00 ?  210 HIS A HB2  1  
ATOM 3276   H HB3  . HIS A 1 210 ? 11.955  5.559   207.638 1.00 0.00 ?  210 HIS A HB3  1  
ATOM 3277   H HD2  . HIS A 1 210 ? 14.330  3.030   209.235 1.00 0.00 ?  210 HIS A HD2  1  
ATOM 3278   H HE1  . HIS A 1 210 ? 13.365  1.564   205.382 1.00 0.00 ?  210 HIS A HE1  1  
ATOM 3279   H HE2  . HIS A 1 210 ? 14.368  0.995   207.659 1.00 0.00 ?  210 HIS A HE2  1  
ATOM 3280   N N    . ASP A 1 211 ? 13.088  8.731   206.713 1.00 0.00 ?  211 ASP A N    1  
ATOM 3281   C CA   . ASP A 1 211 ? 12.665  10.050  207.100 1.00 0.00 ?  211 ASP A CA   1  
ATOM 3282   C C    . ASP A 1 211 ? 11.352  10.239  206.435 1.00 0.00 ?  211 ASP A C    1  
ATOM 3283   O O    . ASP A 1 211 ? 11.268  10.736  205.317 1.00 0.00 ?  211 ASP A O    1  
ATOM 3284   C CB   . ASP A 1 211 ? 13.608  11.168  206.623 1.00 0.00 ?  211 ASP A CB   1  
ATOM 3285   C CG   . ASP A 1 211 ? 13.123  12.546  207.053 1.00 0.00 ?  211 ASP A CG   1  
ATOM 3286   O OD1  . ASP A 1 211 ? 13.148  12.827  208.281 1.00 0.00 ?  211 ASP A OD1  1  
ATOM 3287   O OD2  . ASP A 1 211 ? 12.721  13.336  206.157 1.00 0.00 -1 211 ASP A OD2  1  
ATOM 3288   H H    . ASP A 1 211 ? 13.088  8.536   205.733 1.00 0.00 ?  211 ASP A H    1  
ATOM 3289   H HA   . ASP A 1 211 ? 12.537  10.078  208.170 1.00 0.00 ?  211 ASP A HA   1  
ATOM 3290   H HB2  . ASP A 1 211 ? 14.624  10.998  207.043 1.00 0.00 ?  211 ASP A HB2  1  
ATOM 3291   H HB3  . ASP A 1 211 ? 13.679  11.143  205.515 1.00 0.00 ?  211 ASP A HB3  1  
ATOM 3292   N N    . LEU A 1 212 ? 10.286  9.834   207.127 1.00 0.00 ?  212 LEU A N    1  
ATOM 3293   C CA   . LEU A 1 212 ? 8.970   9.939   206.578 1.00 0.00 ?  212 LEU A CA   1  
ATOM 3294   C C    . LEU A 1 212 ? 8.436   11.267  206.950 1.00 0.00 ?  212 LEU A C    1  
ATOM 3295   O O    . LEU A 1 212 ? 7.387   11.677  206.488 1.00 0.00 ?  212 LEU A O    1  
ATOM 3296   C CB   . LEU A 1 212 ? 8.006   8.871   207.120 1.00 0.00 ?  212 LEU A CB   1  
ATOM 3297   C CG   . LEU A 1 212 ? 8.481   7.440   206.816 1.00 0.00 ?  212 LEU A CG   1  
ATOM 3298   C CD1  . LEU A 1 212 ? 7.537   6.394   207.431 1.00 0.00 ?  212 LEU A CD1  1  
ATOM 3299   C CD2  . LEU A 1 212 ? 8.654   7.214   205.304 1.00 0.00 ?  212 LEU A CD2  1  
ATOM 3300   H H    . LEU A 1 212 ? 10.357  9.447   208.043 1.00 0.00 ?  212 LEU A H    1  
ATOM 3301   H HA   . LEU A 1 212 ? 9.046   9.870   205.505 1.00 0.00 ?  212 LEU A HA   1  
ATOM 3302   H HB2  . LEU A 1 212 ? 7.906   8.998   208.221 1.00 0.00 ?  212 LEU A HB2  1  
ATOM 3303   H HB3  . LEU A 1 212 ? 7.005   9.018   206.663 1.00 0.00 ?  212 LEU A HB3  1  
ATOM 3304   H HG   . LEU A 1 212 ? 9.478   7.311   207.291 1.00 0.00 ?  212 LEU A HG   1  
ATOM 3305   H HD11 . LEU A 1 212 ? 7.588   6.434   208.540 1.00 0.00 ?  212 LEU A HD11 1  
ATOM 3306   H HD12 . LEU A 1 212 ? 7.826   5.372   207.101 1.00 0.00 ?  212 LEU A HD12 1  
ATOM 3307   H HD13 . LEU A 1 212 ? 6.489   6.585   207.116 1.00 0.00 ?  212 LEU A HD13 1  
ATOM 3308   H HD21 . LEU A 1 212 ? 7.847   7.729   204.742 1.00 0.00 ?  212 LEU A HD21 1  
ATOM 3309   H HD22 . LEU A 1 212 ? 8.614   6.128   205.069 1.00 0.00 ?  212 LEU A HD22 1  
ATOM 3310   H HD23 . LEU A 1 212 ? 9.633   7.614   204.964 1.00 0.00 ?  212 LEU A HD23 1  
ATOM 3311   N N    . LYS A 1 213 ? 9.164   11.962  207.812 1.00 0.00 ?  213 LYS A N    1  
ATOM 3312   C CA   . LYS A 1 213 ? 8.706   13.213  208.323 1.00 0.00 ?  213 LYS A CA   1  
ATOM 3313   C C    . LYS A 1 213 ? 8.573   14.272  207.263 1.00 0.00 ?  213 LYS A C    1  
ATOM 3314   O O    . LYS A 1 213 ? 7.765   15.185  207.437 1.00 0.00 ?  213 LYS A O    1  
ATOM 3315   C CB   . LYS A 1 213 ? 9.623   13.758  209.422 1.00 0.00 ?  213 LYS A CB   1  
ATOM 3316   C CG   . LYS A 1 213 ? 9.561   12.902  210.688 1.00 0.00 ?  213 LYS A CG   1  
ATOM 3317   C CD   . LYS A 1 213 ? 10.454  13.432  211.807 1.00 0.00 ?  213 LYS A CD   1  
ATOM 3318   C CE   . LYS A 1 213 ? 10.355  12.587  213.079 1.00 0.00 ?  213 LYS A CE   1  
ATOM 3319   N NZ   . LYS A 1 213 ? 10.850  11.214  212.828 1.00 0.00 1  213 LYS A NZ   1  
ATOM 3320   H H    . LYS A 1 213 ? 10.052  11.648  208.138 1.00 0.00 ?  213 LYS A H    1  
ATOM 3321   H HA   . LYS A 1 213 ? 7.741   13.035  208.743 1.00 0.00 ?  213 LYS A HA   1  
ATOM 3322   H HB2  . LYS A 1 213 ? 10.670  13.783  209.046 1.00 0.00 ?  213 LYS A HB2  1  
ATOM 3323   H HB3  . LYS A 1 213 ? 9.319   14.796  209.673 1.00 0.00 ?  213 LYS A HB3  1  
ATOM 3324   H HG2  . LYS A 1 213 ? 8.511   12.868  211.049 1.00 0.00 ?  213 LYS A HG2  1  
ATOM 3325   H HG3  . LYS A 1 213 ? 9.868   11.863  210.437 1.00 0.00 ?  213 LYS A HG3  1  
ATOM 3326   H HD2  . LYS A 1 213 ? 11.509  13.440  211.458 1.00 0.00 ?  213 LYS A HD2  1  
ATOM 3327   H HD3  . LYS A 1 213 ? 10.161  14.477  212.042 1.00 0.00 ?  213 LYS A HD3  1  
ATOM 3328   H HE2  . LYS A 1 213 ? 10.971  13.027  213.890 1.00 0.00 ?  213 LYS A HE2  1  
ATOM 3329   H HE3  . LYS A 1 213 ? 9.299   12.512  213.414 1.00 0.00 ?  213 LYS A HE3  1  
ATOM 3330   H HZ1  . LYS A 1 213 ? 10.113  10.528  213.086 1.00 0.00 ?  213 LYS A HZ1  1  
ATOM 3331   H HZ2  . LYS A 1 213 ? 11.701  11.041  213.402 1.00 0.00 ?  213 LYS A HZ2  1  
ATOM 3332   H HZ3  . LYS A 1 213 ? 11.083  11.108  211.820 1.00 0.00 ?  213 LYS A HZ3  1  
ATOM 3333   N N    . LEU A 1 214 ? 9.343   14.200  206.156 1.00 0.00 ?  214 LEU A N    1  
ATOM 3334   C CA   . LEU A 1 214 ? 9.281   15.256  205.166 1.00 0.00 ?  214 LEU A CA   1  
ATOM 3335   C C    . LEU A 1 214 ? 7.890   15.316  204.612 1.00 0.00 ?  214 LEU A C    1  
ATOM 3336   O O    . LEU A 1 214 ? 7.364   16.390  204.339 1.00 0.00 ?  214 LEU A O    1  
ATOM 3337   C CB   . LEU A 1 214 ? 10.249  15.035  203.997 1.00 0.00 ?  214 LEU A CB   1  
ATOM 3338   C CG   . LEU A 1 214 ? 10.391  16.269  203.097 1.00 0.00 ?  214 LEU A CG   1  
ATOM 3339   C CD1  . LEU A 1 214 ? 11.212  17.384  203.772 1.00 0.00 ?  214 LEU A CD1  1  
ATOM 3340   C CD2  . LEU A 1 214 ? 10.961  15.899  201.723 1.00 0.00 ?  214 LEU A CD2  1  
ATOM 3341   H H    . LEU A 1 214 ? 9.970   13.446  205.977 1.00 0.00 ?  214 LEU A H    1  
ATOM 3342   H HA   . LEU A 1 214 ? 9.503   16.185  205.663 1.00 0.00 ?  214 LEU A HA   1  
ATOM 3343   H HB2  . LEU A 1 214 ? 11.248  14.761  204.401 1.00 0.00 ?  214 LEU A HB2  1  
ATOM 3344   H HB3  . LEU A 1 214 ? 9.881   14.190  203.383 1.00 0.00 ?  214 LEU A HB3  1  
ATOM 3345   H HG   . LEU A 1 214 ? 9.381   16.669  202.943 1.00 0.00 ?  214 LEU A HG   1  
ATOM 3346   H HD11 . LEU A 1 214 ? 12.264  17.053  203.913 1.00 0.00 ?  214 LEU A HD11 1  
ATOM 3347   H HD12 . LEU A 1 214 ? 10.785  17.641  204.763 1.00 0.00 ?  214 LEU A HD12 1  
ATOM 3348   H HD13 . LEU A 1 214 ? 11.212  18.296  203.138 1.00 0.00 ?  214 LEU A HD13 1  
ATOM 3349   H HD21 . LEU A 1 214 ? 10.231  15.282  201.156 1.00 0.00 ?  214 LEU A HD21 1  
ATOM 3350   H HD22 . LEU A 1 214 ? 11.899  15.319  201.843 1.00 0.00 ?  214 LEU A HD22 1  
ATOM 3351   H HD23 . LEU A 1 214 ? 11.183  16.815  201.136 1.00 0.00 ?  214 LEU A HD23 1  
ATOM 3352   N N    . VAL A 1 215 ? 7.304   14.143  204.375 1.00 0.00 ?  215 VAL A N    1  
ATOM 3353   C CA   . VAL A 1 215 ? 5.975   14.056  203.837 1.00 0.00 ?  215 VAL A CA   1  
ATOM 3354   C C    . VAL A 1 215 ? 4.943   13.843  204.915 1.00 0.00 ?  215 VAL A C    1  
ATOM 3355   O O    . VAL A 1 215 ? 3.757   13.946  204.635 1.00 0.00 ?  215 VAL A O    1  
ATOM 3356   C CB   . VAL A 1 215 ? 5.840   12.945  202.847 1.00 0.00 ?  215 VAL A CB   1  
ATOM 3357   C CG1  . VAL A 1 215 ? 6.806   13.246  201.694 1.00 0.00 ?  215 VAL A CG1  1  
ATOM 3358   C CG2  . VAL A 1 215 ? 6.141   11.601  203.540 1.00 0.00 ?  215 VAL A CG2  1  
ATOM 3359   H H    . VAL A 1 215 ? 7.760   13.276  204.560 1.00 0.00 ?  215 VAL A H    1  
ATOM 3360   H HA   . VAL A 1 215 ? 5.766   14.994  203.348 1.00 0.00 ?  215 VAL A HA   1  
ATOM 3361   H HB   . VAL A 1 215 ? 4.803   12.920  202.449 1.00 0.00 ?  215 VAL A HB   1  
ATOM 3362   H HG11 . VAL A 1 215 ? 7.359   14.192  201.880 1.00 0.00 ?  215 VAL A HG11 1  
ATOM 3363   H HG12 . VAL A 1 215 ? 6.242   13.350  200.751 1.00 0.00 ?  215 VAL A HG12 1  
ATOM 3364   H HG13 . VAL A 1 215 ? 7.542   12.421  201.581 1.00 0.00 ?  215 VAL A HG13 1  
ATOM 3365   H HG21 . VAL A 1 215 ? 5.325   11.334  204.246 1.00 0.00 ?  215 VAL A HG21 1  
ATOM 3366   H HG22 . VAL A 1 215 ? 7.095   11.658  204.104 1.00 0.00 ?  215 VAL A HG22 1  
ATOM 3367   H HG23 . VAL A 1 215 ? 6.228   10.792  202.783 1.00 0.00 ?  215 VAL A HG23 1  
ATOM 3368   N N    . ARG A 1 216 ? 5.359   13.507  206.159 1.00 0.00 ?  216 ARG A N    1  
ATOM 3369   C CA   . ARG A 1 216 ? 4.399   13.122  207.187 1.00 0.00 ?  216 ARG A CA   1  
ATOM 3370   C C    . ARG A 1 216 ? 3.372   14.173  207.469 1.00 0.00 ?  216 ARG A C    1  
ATOM 3371   O O    . ARG A 1 216 ? 2.186   13.852  207.491 1.00 0.00 ?  216 ARG A O    1  
ATOM 3372   C CB   . ARG A 1 216 ? 5.064   12.768  208.532 1.00 0.00 ?  216 ARG A CB   1  
ATOM 3373   C CG   . ARG A 1 216 ? 4.079   12.402  209.661 1.00 0.00 ?  216 ARG A CG   1  
ATOM 3374   C CD   . ARG A 1 216 ? 3.214   11.173  209.346 1.00 0.00 ?  216 ARG A CD   1  
ATOM 3375   N NE   . ARG A 1 216 ? 4.117   10.004  209.152 1.00 0.00 ?  216 ARG A NE   1  
ATOM 3376   C CZ   . ARG A 1 216 ? 3.607   8.812   208.726 1.00 0.00 ?  216 ARG A CZ   1  
ATOM 3377   N NH1  . ARG A 1 216 ? 2.269   8.690   208.483 1.00 0.00 1  216 ARG A NH1  1  
ATOM 3378   N NH2  . ARG A 1 216 ? 4.436   7.742   208.546 1.00 0.00 ?  216 ARG A NH2  1  
ATOM 3379   H H    . ARG A 1 216 ? 6.319   13.502  206.421 1.00 0.00 ?  216 ARG A H    1  
ATOM 3380   H HA   . ARG A 1 216 ? 3.888   12.250  206.813 1.00 0.00 ?  216 ARG A HA   1  
ATOM 3381   H HB2  . ARG A 1 216 ? 5.753   11.911  208.372 1.00 0.00 ?  216 ARG A HB2  1  
ATOM 3382   H HB3  . ARG A 1 216 ? 5.675   13.634  208.864 1.00 0.00 ?  216 ARG A HB3  1  
ATOM 3383   H HG2  . ARG A 1 216 ? 4.662   12.192  210.582 1.00 0.00 ?  216 ARG A HG2  1  
ATOM 3384   H HG3  . ARG A 1 216 ? 3.418   13.267  209.877 1.00 0.00 ?  216 ARG A HG3  1  
ATOM 3385   H HD2  . ARG A 1 216 ? 2.532   10.946  210.195 1.00 0.00 ?  216 ARG A HD2  1  
ATOM 3386   H HD3  . ARG A 1 216 ? 2.621   11.313  208.419 1.00 0.00 ?  216 ARG A HD3  1  
ATOM 3387   H HE   . ARG A 1 216 ? 5.096   10.094  209.333 1.00 0.00 ?  216 ARG A HE   1  
ATOM 3388   H HH11 . ARG A 1 216 ? 1.664   9.474   208.617 1.00 0.00 ?  216 ARG A HH11 1  
ATOM 3389   H HH12 . ARG A 1 216 ? 1.896   7.817   208.171 1.00 0.00 ?  216 ARG A HH12 1  
ATOM 3390   H HH21 . ARG A 1 216 ? 5.414   7.833   208.725 1.00 0.00 ?  216 ARG A HH21 1  
ATOM 3391   H HH22 . ARG A 1 216 ? 4.062   6.869   208.234 1.00 0.00 ?  216 ARG A HH22 1  
ATOM 3392   N N    . ASN A 1 217 ? 3.756   15.432  207.697 1.00 0.00 ?  217 ASN A N    1  
ATOM 3393   C CA   . ASN A 1 217 ? 2.742   16.414  207.983 1.00 0.00 ?  217 ASN A CA   1  
ATOM 3394   C C    . ASN A 1 217 ? 2.328   17.011  206.688 1.00 0.00 ?  217 ASN A C    1  
ATOM 3395   O O    . ASN A 1 217 ? 1.293   17.654  206.588 1.00 0.00 ?  217 ASN A O    1  
ATOM 3396   C CB   . ASN A 1 217 ? 3.251   17.561  208.870 1.00 0.00 ?  217 ASN A CB   1  
ATOM 3397   C CG   . ASN A 1 217 ? 3.528   17.103  210.296 1.00 0.00 ?  217 ASN A CG   1  
ATOM 3398   O OD1  . ASN A 1 217 ? 3.017   16.079  210.743 1.00 0.00 ?  217 ASN A OD1  1  
ATOM 3399   N ND2  . ASN A 1 217 ? 4.361   17.886  211.031 1.00 0.00 ?  217 ASN A ND2  1  
ATOM 3400   H H    . ASN A 1 217 ? 4.709   15.734  207.681 1.00 0.00 ?  217 ASN A H    1  
ATOM 3401   H HA   . ASN A 1 217 ? 1.900   15.925  208.446 1.00 0.00 ?  217 ASN A HA   1  
ATOM 3402   H HB2  . ASN A 1 217 ? 4.189   17.973  208.438 1.00 0.00 ?  217 ASN A HB2  1  
ATOM 3403   H HB3  . ASN A 1 217 ? 2.493   18.373  208.896 1.00 0.00 ?  217 ASN A HB3  1  
ATOM 3404   H HD21 . ASN A 1 217 ? 4.755   18.713  210.629 1.00 0.00 ?  217 ASN A HD21 1  
ATOM 3405   H HD22 . ASN A 1 217 ? 4.580   17.636  211.974 1.00 0.00 ?  217 ASN A HD22 1  
ATOM 3406   N N    . GLU A 1 218 ? 3.132   16.733  205.659 1.00 0.00 ?  218 GLU A N    1  
ATOM 3407   C CA   . GLU A 1 218 ? 2.966   17.333  204.367 1.00 0.00 ?  218 GLU A CA   1  
ATOM 3408   C C    . GLU A 1 218 ? 2.147   16.579  203.353 1.00 0.00 ?  218 GLU A C    1  
ATOM 3409   O O    . GLU A 1 218 ? 2.084   17.115  202.256 1.00 0.00 ?  218 GLU A O    1  
ATOM 3410   C CB   . GLU A 1 218 ? 4.303   17.764  203.752 1.00 0.00 ?  218 GLU A CB   1  
ATOM 3411   C CG   . GLU A 1 218 ? 4.543   19.262  203.973 1.00 0.00 ?  218 GLU A CG   1  
ATOM 3412   C CD   . GLU A 1 218 ? 4.513   19.546  205.469 1.00 0.00 ?  218 GLU A CD   1  
ATOM 3413   O OE1  . GLU A 1 218 ? 5.092   18.740  206.240 1.00 0.00 ?  218 GLU A OE1  1  
ATOM 3414   O OE2  . GLU A 1 218 ? 3.913   20.582  205.860 1.00 0.00 -1 218 GLU A OE2  1  
ATOM 3415   H H    . GLU A 1 218 ? 3.890   16.091  205.744 1.00 0.00 ?  218 GLU A H    1  
ATOM 3416   H HA   . GLU A 1 218 ? 2.413   18.236  204.565 1.00 0.00 ?  218 GLU A HA   1  
ATOM 3417   H HB2  . GLU A 1 218 ? 5.122   17.188  204.231 1.00 0.00 ?  218 GLU A HB2  1  
ATOM 3418   H HB3  . GLU A 1 218 ? 4.318   17.549  202.665 1.00 0.00 ?  218 GLU A HB3  1  
ATOM 3419   H HG2  . GLU A 1 218 ? 5.522   19.562  203.555 1.00 0.00 ?  218 GLU A HG2  1  
ATOM 3420   H HG3  . GLU A 1 218 ? 3.746   19.852  203.477 1.00 0.00 ?  218 GLU A HG3  1  
ATOM 3421   N N    . HIS A 1 219 ? 1.568   15.344  203.645 1.00 0.00 ?  219 HIS A N    1  
ATOM 3422   C CA   . HIS A 1 219 ? 0.803   14.557  202.634 1.00 0.00 ?  219 HIS A CA   1  
ATOM 3423   C C    . HIS A 1 219 ? 0.165   15.563  201.658 1.00 0.00 ?  219 HIS A C    1  
ATOM 3424   O O    . HIS A 1 219 ? -0.821  16.203  201.982 1.00 0.00 ?  219 HIS A O    1  
ATOM 3425   C CB   . HIS A 1 219 ? -0.327  13.738  203.292 1.00 0.00 ?  219 HIS A CB   1  
ATOM 3426   C CG   . HIS A 1 219 ? -0.961  12.708  202.400 1.00 0.00 ?  219 HIS A CG   1  
ATOM 3427   N ND1  . HIS A 1 219 ? -2.236  12.916  201.909 1.00 0.00 ?  219 HIS A ND1  1  
ATOM 3428   C CD2  . HIS A 1 219 ? -0.474  11.510  201.964 1.00 0.00 ?  219 HIS A CD2  1  
ATOM 3429   C CE1  . HIS A 1 219 ? -2.498  11.840  201.186 1.00 0.00 ?  219 HIS A CE1  1  
ATOM 3430   N NE2  . HIS A 1 219 ? -1.468  10.960  201.185 1.00 0.00 ?  219 HIS A NE2  1  
ATOM 3431   H H    . HIS A 1 219 ? 1.645   14.931  204.548 1.00 0.00 ?  219 HIS A H    1  
ATOM 3432   H HA   . HIS A 1 219 ? 1.499   13.900  202.151 1.00 0.00 ?  219 HIS A HA   1  
ATOM 3433   H HB2  . HIS A 1 219 ? 0.070   13.208  204.181 1.00 0.00 ?  219 HIS A HB2  1  
ATOM 3434   H HB3  . HIS A 1 219 ? -1.131  14.428  203.628 1.00 0.00 ?  219 HIS A HB3  1  
ATOM 3435   H HD2  . HIS A 1 219 ? 0.480   11.034  202.154 1.00 0.00 ?  219 HIS A HD2  1  
ATOM 3436   H HE1  . HIS A 1 219 ? -3.427  11.657  200.645 1.00 0.00 ?  219 HIS A HE1  1  
ATOM 3437   H HE2  . HIS A 1 219 ? -1.425  10.077  200.713 1.00 0.00 ?  219 HIS A HE2  1  
ATOM 3438   N N    . PRO A 1 220 ? 0.721   15.664  200.437 1.00 0.00 ?  220 PRO A N    1  
ATOM 3439   C CA   . PRO A 1 220 ? 0.429   16.716  199.435 1.00 0.00 ?  220 PRO A CA   1  
ATOM 3440   C C    . PRO A 1 220 ? -0.789  16.709  198.516 1.00 0.00 ?  220 PRO A C    1  
ATOM 3441   O O    . PRO A 1 220 ? -0.780  17.520  197.605 1.00 0.00 ?  220 PRO A O    1  
ATOM 3442   C CB   . PRO A 1 220 ? 1.714   16.780  198.639 1.00 0.00 ?  220 PRO A CB   1  
ATOM 3443   C CG   . PRO A 1 220 ? 2.090   15.324  198.506 1.00 0.00 ?  220 PRO A CG   1  
ATOM 3444   C CD   . PRO A 1 220 ? 1.713   14.718  199.858 1.00 0.00 ?  220 PRO A CD   1  
ATOM 3445   H HA   . PRO A 1 220 ? 0.370   17.653  199.965 1.00 0.00 ?  220 PRO A HA   1  
ATOM 3446   H HB2  . PRO A 1 220 ? 1.554   17.258  197.661 1.00 0.00 ?  220 PRO A HB2  1  
ATOM 3447   H HB3  . PRO A 1 220 ? 2.495   17.334  199.201 1.00 0.00 ?  220 PRO A HB3  1  
ATOM 3448   H HG2  . PRO A 1 220 ? 1.520   14.850  197.680 1.00 0.00 ?  220 PRO A HG2  1  
ATOM 3449   H HG3  . PRO A 1 220 ? 3.175   15.215  198.321 1.00 0.00 ?  220 PRO A HG3  1  
ATOM 3450   H HD2  . PRO A 1 220 ? 1.273   13.707  199.721 1.00 0.00 ?  220 PRO A HD2  1  
ATOM 3451   H HD3  . PRO A 1 220 ? 2.620   14.643  200.495 1.00 0.00 ?  220 PRO A HD3  1  
ATOM 3452   N N    . ILE A 1 221 ? -1.812  15.832  198.685 1.00 0.00 ?  221 ILE A N    1  
ATOM 3453   C CA   . ILE A 1 221 ? -2.949  15.678  197.719 1.00 0.00 ?  221 ILE A CA   1  
ATOM 3454   C C    . ILE A 1 221 ? -3.406  16.944  196.944 1.00 0.00 ?  221 ILE A C    1  
ATOM 3455   O O    . ILE A 1 221 ? -3.670  16.820  195.749 1.00 0.00 ?  221 ILE A O    1  
ATOM 3456   C CB   . ILE A 1 221 ? -4.183  15.165  198.427 1.00 0.00 ?  221 ILE A CB   1  
ATOM 3457   C CG1  . ILE A 1 221 ? -3.893  13.826  199.130 1.00 0.00 ?  221 ILE A CG1  1  
ATOM 3458   C CG2  . ILE A 1 221 ? -5.342  15.047  197.420 1.00 0.00 ?  221 ILE A CG2  1  
ATOM 3459   C CD1  . ILE A 1 221 ? -3.467  12.703  198.175 1.00 0.00 ?  221 ILE A CD1  1  
ATOM 3460   H H    . ILE A 1 221 ? -1.853  15.235  199.483 1.00 0.00 ?  221 ILE A H    1  
ATOM 3461   H HA   . ILE A 1 221 ? -2.633  14.948  196.995 1.00 0.00 ?  221 ILE A HA   1  
ATOM 3462   H HB   . ILE A 1 221 ? -4.483  15.901  199.204 1.00 0.00 ?  221 ILE A HB   1  
ATOM 3463   H HG12 . ILE A 1 221 ? -3.087  13.989  199.869 1.00 0.00 ?  221 ILE A HG12 1  
ATOM 3464   H HG13 . ILE A 1 221 ? -4.802  13.502  199.680 1.00 0.00 ?  221 ILE A HG13 1  
ATOM 3465   H HG21 . ILE A 1 221 ? -5.840  16.031  197.280 1.00 0.00 ?  221 ILE A HG21 1  
ATOM 3466   H HG22 . ILE A 1 221 ? -6.096  14.324  197.791 1.00 0.00 ?  221 ILE A HG22 1  
ATOM 3467   H HG23 . ILE A 1 221 ? -4.966  14.695  196.436 1.00 0.00 ?  221 ILE A HG23 1  
ATOM 3468   H HD11 . ILE A 1 221 ? -4.136  12.667  197.290 1.00 0.00 ?  221 ILE A HD11 1  
ATOM 3469   H HD12 . ILE A 1 221 ? -3.515  11.722  198.693 1.00 0.00 ?  221 ILE A HD12 1  
ATOM 3470   H HD13 . ILE A 1 221 ? -2.425  12.866  197.826 1.00 0.00 ?  221 ILE A HD13 1  
ATOM 3471   N N    . PHE A 1 222 ? -3.505  18.170  197.535 1.00 0.00 ?  222 PHE A N    1  
ATOM 3472   C CA   . PHE A 1 222 ? -3.941  19.380  196.767 1.00 0.00 ?  222 PHE A CA   1  
ATOM 3473   C C    . PHE A 1 222 ? -2.687  19.892  195.987 1.00 0.00 ?  222 PHE A C    1  
ATOM 3474   O O    . PHE A 1 222 ? -2.437  21.090  195.944 1.00 0.00 ?  222 PHE A O    1  
ATOM 3475   C CB   . PHE A 1 222 ? -4.415  20.527  197.688 1.00 0.00 ?  222 PHE A CB   1  
ATOM 3476   C CG   . PHE A 1 222 ? -4.849  20.061  199.025 1.00 0.00 ?  222 PHE A CG   1  
ATOM 3477   C CD1  . PHE A 1 222 ? -6.100  19.529  199.219 1.00 0.00 ?  222 PHE A CD1  1  
ATOM 3478   C CD2  . PHE A 1 222 ? -3.981  20.149  200.090 1.00 0.00 ?  222 PHE A CD2  1  
ATOM 3479   C CE1  . PHE A 1 222 ? -6.478  19.089  200.464 1.00 0.00 ?  222 PHE A CE1  1  
ATOM 3480   C CE2  . PHE A 1 222 ? -4.358  19.712  201.333 1.00 0.00 ?  222 PHE A CE2  1  
ATOM 3481   C CZ   . PHE A 1 222 ? -5.604  19.182  201.520 1.00 0.00 ?  222 PHE A CZ   1  
ATOM 3482   H H    . PHE A 1 222 ? -3.292  18.313  198.498 1.00 0.00 ?  222 PHE A H    1  
ATOM 3483   H HA   . PHE A 1 222 ? -4.713  19.085  196.071 1.00 0.00 ?  222 PHE A HA   1  
ATOM 3484   H HB2  . PHE A 1 222 ? -3.598  21.256  197.863 1.00 0.00 ?  222 PHE A HB2  1  
ATOM 3485   H HB3  . PHE A 1 222 ? -5.274  21.056  197.224 1.00 0.00 ?  222 PHE A HB3  1  
ATOM 3486   H HD1  . PHE A 1 222 ? -6.789  19.457  198.390 1.00 0.00 ?  222 PHE A HD1  1  
ATOM 3487   H HD2  . PHE A 1 222 ? -2.994  20.568  199.946 1.00 0.00 ?  222 PHE A HD2  1  
ATOM 3488   H HE1  . PHE A 1 222 ? -7.463  18.671  200.613 1.00 0.00 ?  222 PHE A HE1  1  
ATOM 3489   H HE2  . PHE A 1 222 ? -3.671  19.785  202.162 1.00 0.00 ?  222 PHE A HE2  1  
ATOM 3490   H HZ   . PHE A 1 222 ? -5.892  18.835  202.495 1.00 0.00 ?  222 PHE A HZ   1  
ATOM 3491   N N    . LEU A 1 223 ? -1.868  18.932  195.418 1.00 0.00 ?  223 LEU A N    1  
ATOM 3492   C CA   . LEU A 1 223 ? -0.567  19.123  194.704 1.00 0.00 ?  223 LEU A CA   1  
ATOM 3493   C C    . LEU A 1 223 ? -0.430  20.301  193.728 1.00 0.00 ?  223 LEU A C    1  
ATOM 3494   O O    . LEU A 1 223 ? 0.559   20.356  193.001 1.00 0.00 ?  223 LEU A O    1  
ATOM 3495   C CB   . LEU A 1 223 ? -0.141  17.868  193.915 1.00 0.00 ?  223 LEU A CB   1  
ATOM 3496   C CG   . LEU A 1 223 ? 1.375   17.587  194.020 1.00 0.00 ?  223 LEU A CG   1  
ATOM 3497   C CD1  . LEU A 1 223 ? 1.703   16.644  195.171 1.00 0.00 ?  223 LEU A CD1  1  
ATOM 3498   C CD2  . LEU A 1 223 ? 1.940   17.060  192.698 1.00 0.00 ?  223 LEU A CD2  1  
ATOM 3499   H H    . LEU A 1 223 ? -2.146  17.974  195.465 1.00 0.00 ?  223 LEU A H    1  
ATOM 3500   H HA   . LEU A 1 223 ? 0.159   19.278  195.483 1.00 0.00 ?  223 LEU A HA   1  
ATOM 3501   H HB2  . LEU A 1 223 ? -0.705  16.989  194.300 1.00 0.00 ?  223 LEU A HB2  1  
ATOM 3502   H HB3  . LEU A 1 223 ? -0.403  18.005  192.846 1.00 0.00 ?  223 LEU A HB3  1  
ATOM 3503   H HG   . LEU A 1 223 ? 1.877   18.555  194.233 1.00 0.00 ?  223 LEU A HG   1  
ATOM 3504   H HD11 . LEU A 1 223 ? 0.815   16.508  195.825 1.00 0.00 ?  223 LEU A HD11 1  
ATOM 3505   H HD12 . LEU A 1 223 ? 2.536   17.054  195.782 1.00 0.00 ?  223 LEU A HD12 1  
ATOM 3506   H HD13 . LEU A 1 223 ? 2.007   15.662  194.778 1.00 0.00 ?  223 LEU A HD13 1  
ATOM 3507   H HD21 . LEU A 1 223 ? 1.880   17.844  191.912 1.00 0.00 ?  223 LEU A HD21 1  
ATOM 3508   H HD22 . LEU A 1 223 ? 1.361   16.179  192.364 1.00 0.00 ?  223 LEU A HD22 1  
ATOM 3509   H HD23 . LEU A 1 223 ? 3.004   16.763  192.823 1.00 0.00 ?  223 LEU A HD23 1  
ATOM 3510   N N    . LEU A 1 224 ? -1.392  21.211  193.587 1.00 0.00 ?  224 LEU A N    1  
ATOM 3511   C CA   . LEU A 1 224 ? -1.242  22.333  192.669 1.00 0.00 ?  224 LEU A CA   1  
ATOM 3512   C C    . LEU A 1 224 ? -0.022  23.224  192.983 1.00 0.00 ?  224 LEU A C    1  
ATOM 3513   O O    . LEU A 1 224 ? 0.147   24.248  192.324 1.00 0.00 ?  224 LEU A O    1  
ATOM 3514   C CB   . LEU A 1 224 ? -2.477  23.248  192.683 1.00 0.00 ?  224 LEU A CB   1  
ATOM 3515   C CG   . LEU A 1 224 ? -2.725  23.877  194.063 1.00 0.00 ?  224 LEU A CG   1  
ATOM 3516   C CD1  . LEU A 1 224 ? -2.254  25.340  194.105 1.00 0.00 ?  224 LEU A CD1  1  
ATOM 3517   C CD2  . LEU A 1 224 ? -4.201  23.754  194.477 1.00 0.00 ?  224 LEU A CD2  1  
ATOM 3518   H H    . LEU A 1 224 ? -2.247  21.169  194.099 1.00 0.00 ?  224 LEU A H    1  
ATOM 3519   H HA   . LEU A 1 224 ? -1.118  21.917  191.683 1.00 0.00 ?  224 LEU A HA   1  
ATOM 3520   H HB2  . LEU A 1 224 ? -2.337  24.056  191.933 1.00 0.00 ?  224 LEU A HB2  1  
ATOM 3521   H HB3  . LEU A 1 224 ? -3.371  22.658  192.394 1.00 0.00 ?  224 LEU A HB3  1  
ATOM 3522   H HG   . LEU A 1 224 ? -2.122  23.309  194.804 1.00 0.00 ?  224 LEU A HG   1  
ATOM 3523   H HD11 . LEU A 1 224 ? -2.772  25.890  194.920 1.00 0.00 ?  224 LEU A HD11 1  
ATOM 3524   H HD12 . LEU A 1 224 ? -2.476  25.844  193.141 1.00 0.00 ?  224 LEU A HD12 1  
ATOM 3525   H HD13 . LEU A 1 224 ? -1.158  25.387  194.286 1.00 0.00 ?  224 LEU A HD13 1  
ATOM 3526   H HD21 . LEU A 1 224 ? -4.389  24.320  195.414 1.00 0.00 ?  224 LEU A HD21 1  
ATOM 3527   H HD22 . LEU A 1 224 ? -4.467  22.688  194.647 1.00 0.00 ?  224 LEU A HD22 1  
ATOM 3528   H HD23 . LEU A 1 224 ? -4.861  24.160  193.680 1.00 0.00 ?  224 LEU A HD23 1  
ATOM 3529   N N    . GLY A 1 225 ? 0.854   22.897  193.982 1.00 0.00 ?  225 GLY A N    1  
ATOM 3530   C CA   . GLY A 1 225 ? 1.996   23.746  194.251 1.00 0.00 ?  225 GLY A CA   1  
ATOM 3531   C C    . GLY A 1 225 ? 2.378   23.564  195.690 1.00 0.00 ?  225 GLY A C    1  
ATOM 3532   O O    . GLY A 1 225 ? 2.523   24.540  196.420 1.00 0.00 ?  225 GLY A O    1  
ATOM 3533   H H    . GLY A 1 225 ? 0.750   22.084  194.551 1.00 0.00 ?  225 GLY A H    1  
ATOM 3534   H HA2  . GLY A 1 225 ? 2.808   23.413  193.623 1.00 0.00 ?  225 GLY A HA2  1  
ATOM 3535   H HA3  . GLY A 1 225 ? 1.691   24.769  194.092 1.00 0.00 ?  225 GLY A HA3  1  
ATOM 3536   N N    . TRP A 1 226 ? 2.550   22.297  196.131 1.00 0.00 ?  226 TRP A N    1  
ATOM 3537   C CA   . TRP A 1 226 ? 2.852   22.040  197.521 1.00 0.00 ?  226 TRP A CA   1  
ATOM 3538   C C    . TRP A 1 226 ? 4.338   21.931  197.749 1.00 0.00 ?  226 TRP A C    1  
ATOM 3539   O O    . TRP A 1 226 ? 5.117   21.644  196.838 1.00 0.00 ?  226 TRP A O    1  
ATOM 3540   C CB   . TRP A 1 226 ? 2.203   20.745  198.030 1.00 0.00 ?  226 TRP A CB   1  
ATOM 3541   C CG   . TRP A 1 226 ? 1.961   20.774  199.515 1.00 0.00 ?  226 TRP A CG   1  
ATOM 3542   C CD1  . TRP A 1 226 ? 2.481   19.963  200.480 1.00 0.00 ?  226 TRP A CD1  1  
ATOM 3543   C CD2  . TRP A 1 226 ? 1.125   21.728  200.198 1.00 0.00 ?  226 TRP A CD2  1  
ATOM 3544   N NE1  . TRP A 1 226 ? 2.009   20.333  201.709 1.00 0.00 ?  226 TRP A NE1  1  
ATOM 3545   C CE2  . TRP A 1 226 ? 1.181   21.420  201.554 1.00 0.00 ?  226 TRP A CE2  1  
ATOM 3546   C CE3  . TRP A 1 226 ? 0.366   22.774  199.757 1.00 0.00 ?  226 TRP A CE3  1  
ATOM 3547   C CZ2  . TRP A 1 226 ? 0.487   22.146  202.475 1.00 0.00 ?  226 TRP A CZ2  1  
ATOM 3548   C CZ3  . TRP A 1 226 ? -0.338  23.512  200.686 1.00 0.00 ?  226 TRP A CZ3  1  
ATOM 3549   C CH2  . TRP A 1 226 ? -0.276  23.202  202.030 1.00 0.00 ?  226 TRP A CH2  1  
ATOM 3550   H H    . TRP A 1 226 ? 2.480   21.503  195.533 1.00 0.00 ?  226 TRP A H    1  
ATOM 3551   H HA   . TRP A 1 226 ? 2.477   22.873  198.092 1.00 0.00 ?  226 TRP A HA   1  
ATOM 3552   H HB2  . TRP A 1 226 ? 1.231   20.593  197.511 1.00 0.00 ?  226 TRP A HB2  1  
ATOM 3553   H HB3  . TRP A 1 226 ? 2.862   19.885  197.794 1.00 0.00 ?  226 TRP A HB3  1  
ATOM 3554   H HD1  . TRP A 1 226 ? 3.153   19.137  200.299 1.00 0.00 ?  226 TRP A HD1  1  
ATOM 3555   H HE1  . TRP A 1 226 ? 2.229   19.901  202.557 1.00 0.00 ?  226 TRP A HE1  1  
ATOM 3556   H HE3  . TRP A 1 226 ? 0.305   23.032  198.710 1.00 0.00 ?  226 TRP A HE3  1  
ATOM 3557   H HZ2  . TRP A 1 226 ? 0.527   21.919  203.526 1.00 0.00 ?  226 TRP A HZ2  1  
ATOM 3558   H HZ3  . TRP A 1 226 ? -0.942  24.344  200.358 1.00 0.00 ?  226 TRP A HZ3  1  
ATOM 3559   H HH2  . TRP A 1 226 ? -0.836  23.793  202.740 1.00 0.00 ?  226 TRP A HH2  1  
ATOM 3560   N N    . ASN A 1 227 ? 4.740   22.203  199.025 1.00 0.00 ?  227 ASN A N    1  
ATOM 3561   C CA   . ASN A 1 227 ? 6.123   22.117  199.433 1.00 0.00 ?  227 ASN A CA   1  
ATOM 3562   C C    . ASN A 1 227 ? 6.183   21.041  200.481 1.00 0.00 ?  227 ASN A C    1  
ATOM 3563   O O    . ASN A 1 227 ? 5.260   20.901  201.282 1.00 0.00 ?  227 ASN A O    1  
ATOM 3564   C CB   . ASN A 1 227 ? 6.666   23.415  200.057 1.00 0.00 ?  227 ASN A CB   1  
ATOM 3565   C CG   . ASN A 1 227 ? 6.543   24.600  199.109 1.00 0.00 ?  227 ASN A CG   1  
ATOM 3566   O OD1  . ASN A 1 227 ? 5.888   25.594  199.420 1.00 0.00 ?  227 ASN A OD1  1  
ATOM 3567   N ND2  . ASN A 1 227 ? 7.192   24.495  197.919 1.00 0.00 ?  227 ASN A ND2  1  
ATOM 3568   H H    . ASN A 1 227 ? 4.094   22.470  199.734 1.00 0.00 ?  227 ASN A H    1  
ATOM 3569   H HA   . ASN A 1 227 ? 6.715   21.823  198.580 1.00 0.00 ?  227 ASN A HA   1  
ATOM 3570   H HB2  . ASN A 1 227 ? 6.102   23.641  200.988 1.00 0.00 ?  227 ASN A HB2  1  
ATOM 3571   H HB3  . ASN A 1 227 ? 7.736   23.278  200.321 1.00 0.00 ?  227 ASN A HB3  1  
ATOM 3572   H HD21 . ASN A 1 227 ? 7.714   23.670  197.705 1.00 0.00 ?  227 ASN A HD21 1  
ATOM 3573   H HD22 . ASN A 1 227 ? 7.147   25.244  197.258 1.00 0.00 ?  227 ASN A HD22 1  
ATOM 3574   N N    . MET A 1 228 ? 7.299   20.274  200.515 1.00 0.00 ?  228 MET A N    1  
ATOM 3575   C CA   . MET A 1 228 ? 7.424   19.185  201.463 1.00 0.00 ?  228 MET A CA   1  
ATOM 3576   C C    . MET A 1 228 ? 8.196   19.699  202.654 1.00 0.00 ?  228 MET A C    1  
ATOM 3577   O O    . MET A 1 228 ? 9.032   20.586  202.504 1.00 0.00 ?  228 MET A O    1  
ATOM 3578   C CB   . MET A 1 228 ? 8.161   17.982  200.861 1.00 0.00 ?  228 MET A CB   1  
ATOM 3579   C CG   . MET A 1 228 ? 7.573   17.558  199.515 1.00 0.00 ?  228 MET A CG   1  
ATOM 3580   S SD   . MET A 1 228 ? 5.826   17.074  199.627 1.00 0.00 ?  228 MET A SD   1  
ATOM 3581   C CE   . MET A 1 228 ? 5.611   16.896  197.834 1.00 0.00 ?  228 MET A CE   1  
ATOM 3582   H H    . MET A 1 228 ? 8.073   20.429  199.903 1.00 0.00 ?  228 MET A H    1  
ATOM 3583   H HA   . MET A 1 228 ? 6.433   18.899  201.777 1.00 0.00 ?  228 MET A HA   1  
ATOM 3584   H HB2  . MET A 1 228 ? 9.236   18.233  200.734 1.00 0.00 ?  228 MET A HB2  1  
ATOM 3585   H HB3  . MET A 1 228 ? 8.080   17.130  201.559 1.00 0.00 ?  228 MET A HB3  1  
ATOM 3586   H HG2  . MET A 1 228 ? 7.683   18.402  198.801 1.00 0.00 ?  228 MET A HG2  1  
ATOM 3587   H HG3  . MET A 1 228 ? 8.170   16.708  199.122 1.00 0.00 ?  228 MET A HG3  1  
ATOM 3588   H HE1  . MET A 1 228 ? 6.528   16.479  197.365 1.00 0.00 ?  228 MET A HE1  1  
ATOM 3589   H HE2  . MET A 1 228 ? 5.400   17.879  197.362 1.00 0.00 ?  228 MET A HE2  1  
ATOM 3590   H HE3  . MET A 1 228 ? 4.769   16.217  197.601 1.00 0.00 ?  228 MET A HE3  1  
ATOM 3591   N N    . MET A 1 229 ? 7.944   19.137  203.884 1.00 0.00 ?  229 MET A N    1  
ATOM 3592   C CA   . MET A 1 229 ? 8.618   19.657  205.061 1.00 0.00 ?  229 MET A CA   1  
ATOM 3593   C C    . MET A 1 229 ? 8.640   18.650  206.203 1.00 0.00 ?  229 MET A C    1  
ATOM 3594   O O    . MET A 1 229 ? 7.645   17.985  206.471 1.00 0.00 ?  229 MET A O    1  
ATOM 3595   C CB   . MET A 1 229 ? 7.920   20.946  205.557 1.00 0.00 ?  229 MET A CB   1  
ATOM 3596   C CG   . MET A 1 229 ? 8.426   21.471  206.902 1.00 0.00 ?  229 MET A CG   1  
ATOM 3597   S SD   . MET A 1 229 ? 7.717   23.089  207.333 1.00 0.00 ?  229 MET A SD   1  
ATOM 3598   C CE   . MET A 1 229 ? 6.036   22.463  207.614 1.00 0.00 ?  229 MET A CE   1  
ATOM 3599   H H    . MET A 1 229 ? 7.331   18.366  204.016 1.00 0.00 ?  229 MET A H    1  
ATOM 3600   H HA   . MET A 1 229 ? 9.623   19.873  204.770 1.00 0.00 ?  229 MET A HA   1  
ATOM 3601   H HB2  . MET A 1 229 ? 8.059   21.740  204.793 1.00 0.00 ?  229 MET A HB2  1  
ATOM 3602   H HB3  . MET A 1 229 ? 6.833   20.751  205.641 1.00 0.00 ?  229 MET A HB3  1  
ATOM 3603   H HG2  . MET A 1 229 ? 8.166   20.735  207.693 1.00 0.00 ?  229 MET A HG2  1  
ATOM 3604   H HG3  . MET A 1 229 ? 9.527   21.547  206.870 1.00 0.00 ?  229 MET A HG3  1  
ATOM 3605   H HE1  . MET A 1 229 ? 5.501   23.087  208.362 1.00 0.00 ?  229 MET A HE1  1  
ATOM 3606   H HE2  . MET A 1 229 ? 6.060   21.419  207.993 1.00 0.00 ?  229 MET A HE2  1  
ATOM 3607   H HE3  . MET A 1 229 ? 5.447   22.474  206.672 1.00 0.00 ?  229 MET A HE3  1  
ATOM 3608   N N    . HIS A 1 230 ? 9.818   18.540  206.917 1.00 0.00 ?  230 HIS A N    1  
ATOM 3609   C CA   . HIS A 1 230 ? 9.935   17.648  208.076 1.00 0.00 ?  230 HIS A CA   1  
ATOM 3610   C C    . HIS A 1 230 ? 10.209  18.510  209.267 1.00 0.00 ?  230 HIS A C    1  
ATOM 3611   O O    . HIS A 1 230 ? 10.436  19.707  209.124 1.00 0.00 ?  230 HIS A O    1  
ATOM 3612   C CB   . HIS A 1 230 ? 11.090  16.609  208.054 1.00 0.00 ?  230 HIS A CB   1  
ATOM 3613   C CG   . HIS A 1 230 ? 12.459  17.180  207.870 1.00 0.00 ?  230 HIS A CG   1  
ATOM 3614   N ND1  . HIS A 1 230 ? 13.163  16.923  206.705 1.00 0.00 ?  230 HIS A ND1  1  
ATOM 3615   C CD2  . HIS A 1 230 ? 13.212  17.912  208.734 1.00 0.00 ?  230 HIS A CD2  1  
ATOM 3616   C CE1  . HIS A 1 230 ? 14.337  17.497  206.897 1.00 0.00 ?  230 HIS A CE1  1  
ATOM 3617   N NE2  . HIS A 1 230 ? 14.418  18.109  208.105 1.00 0.00 ?  230 HIS A NE2  1  
ATOM 3618   H H    . HIS A 1 230 ? 10.633  19.064  206.678 1.00 0.00 ?  230 HIS A H    1  
ATOM 3619   H HA   . HIS A 1 230 ? 8.987   17.152  208.213 1.00 0.00 ?  230 HIS A HA   1  
ATOM 3620   H HB2  . HIS A 1 230 ? 11.103  16.059  209.014 1.00 0.00 ?  230 HIS A HB2  1  
ATOM 3621   H HB3  . HIS A 1 230 ? 10.929  15.878  207.250 1.00 0.00 ?  230 HIS A HB3  1  
ATOM 3622   H HD2  . HIS A 1 230 ? 12.964  18.301  209.714 1.00 0.00 ?  230 HIS A HD2  1  
ATOM 3623   H HE1  . HIS A 1 230 ? 15.159  17.493  206.183 1.00 0.00 ?  230 HIS A HE1  1  
ATOM 3624   H HE2  . HIS A 1 230 ? 15.202  18.607  208.481 1.00 0.00 ?  230 HIS A HE2  1  
ATOM 3625   N N    . VAL A 1 231 ? 10.221  17.887  210.483 1.00 0.00 ?  231 VAL A N    1  
ATOM 3626   C CA   . VAL A 1 231 ? 10.511  18.620  211.691 1.00 0.00 ?  231 VAL A CA   1  
ATOM 3627   C C    . VAL A 1 231 ? 11.738  17.977  212.289 1.00 0.00 ?  231 VAL A C    1  
ATOM 3628   O O    . VAL A 1 231 ? 11.904  16.757  212.280 1.00 0.00 ?  231 VAL A O    1  
ATOM 3629   C CB   . VAL A 1 231 ? 9.385   18.602  212.694 1.00 0.00 ?  231 VAL A CB   1  
ATOM 3630   C CG1  . VAL A 1 231 ? 9.117   17.155  213.144 1.00 0.00 ?  231 VAL A CG1  1  
ATOM 3631   C CG2  . VAL A 1 231 ? 9.760   19.534  213.858 1.00 0.00 ?  231 VAL A CG2  1  
ATOM 3632   H H    . VAL A 1 231 ? 10.034  16.913  210.587 1.00 0.00 ?  231 VAL A H    1  
ATOM 3633   H HA   . VAL A 1 231 ? 10.755  19.635  211.416 1.00 0.00 ?  231 VAL A HA   1  
ATOM 3634   H HB   . VAL A 1 231 ? 8.462   18.997  212.218 1.00 0.00 ?  231 VAL A HB   1  
ATOM 3635   H HG11 . VAL A 1 231 ? 9.905   16.819  213.851 1.00 0.00 ?  231 VAL A HG11 1  
ATOM 3636   H HG12 . VAL A 1 231 ? 9.111   16.473  212.268 1.00 0.00 ?  231 VAL A HG12 1  
ATOM 3637   H HG13 . VAL A 1 231 ? 8.132   17.087  213.653 1.00 0.00 ?  231 VAL A HG13 1  
ATOM 3638   H HG21 . VAL A 1 231 ? 9.940   18.946  214.783 1.00 0.00 ?  231 VAL A HG21 1  
ATOM 3639   H HG22 . VAL A 1 231 ? 8.940   20.254  214.049 1.00 0.00 ?  231 VAL A HG22 1  
ATOM 3640   H HG23 . VAL A 1 231 ? 10.678  20.108  213.616 1.00 0.00 ?  231 VAL A HG23 1  
ATOM 3641   N N    . ILE A 1 232 ? 12.656  18.834  212.779 1.00 0.00 ?  232 ILE A N    1  
ATOM 3642   C CA   . ILE A 1 232 ? 13.915  18.391  213.335 1.00 0.00 ?  232 ILE A CA   1  
ATOM 3643   C C    . ILE A 1 232 ? 13.800  18.015  214.791 1.00 0.00 ?  232 ILE A C    1  
ATOM 3644   O O    . ILE A 1 232 ? 14.424  17.056  215.245 1.00 0.00 ?  232 ILE A O    1  
ATOM 3645   C CB   . ILE A 1 232 ? 14.952  19.475  213.259 1.00 0.00 ?  232 ILE A CB   1  
ATOM 3646   C CG1  . ILE A 1 232 ? 15.142  19.970  211.808 1.00 0.00 ?  232 ILE A CG1  1  
ATOM 3647   C CG2  . ILE A 1 232 ? 16.261  18.938  213.861 1.00 0.00 ?  232 ILE A CG2  1  
ATOM 3648   C CD1  . ILE A 1 232 ? 15.659  18.889  210.855 1.00 0.00 ?  232 ILE A CD1  1  
ATOM 3649   H H    . ILE A 1 232 ? 12.502  19.819  212.787 1.00 0.00 ?  232 ILE A H    1  
ATOM 3650   H HA   . ILE A 1 232 ? 14.239  17.532  212.771 1.00 0.00 ?  232 ILE A HA   1  
ATOM 3651   H HB   . ILE A 1 232 ? 14.618  20.331  213.878 1.00 0.00 ?  232 ILE A HB   1  
ATOM 3652   H HG12 . ILE A 1 232 ? 14.169  20.349  211.427 1.00 0.00 ?  232 ILE A HG12 1  
ATOM 3653   H HG13 . ILE A 1 232 ? 15.860  20.817  211.809 1.00 0.00 ?  232 ILE A HG13 1  
ATOM 3654   H HG21 . ILE A 1 232 ? 17.135  19.356  213.319 1.00 0.00 ?  232 ILE A HG21 1  
ATOM 3655   H HG22 . ILE A 1 232 ? 16.293  17.829  213.786 1.00 0.00 ?  232 ILE A HG22 1  
ATOM 3656   H HG23 . ILE A 1 232 ? 16.338  19.223  214.932 1.00 0.00 ?  232 ILE A HG23 1  
ATOM 3657   H HD11 . ILE A 1 232 ? 16.584  18.434  211.259 1.00 0.00 ?  232 ILE A HD11 1  
ATOM 3658   H HD12 . ILE A 1 232 ? 15.892  19.333  209.864 1.00 0.00 ?  232 ILE A HD12 1  
ATOM 3659   H HD13 . ILE A 1 232 ? 14.904  18.090  210.711 1.00 0.00 ?  232 ILE A HD13 1  
ATOM 3660   N N    . ASP A 1 233 ? 12.976  18.769  215.544 1.00 0.00 ?  233 ASP A N    1  
ATOM 3661   C CA   . ASP A 1 233 ? 12.909  18.624  216.987 1.00 0.00 ?  233 ASP A CA   1  
ATOM 3662   C C    . ASP A 1 233 ? 12.499  17.250  217.428 1.00 0.00 ?  233 ASP A C    1  
ATOM 3663   O O    . ASP A 1 233 ? 12.919  16.800  218.488 1.00 0.00 ?  233 ASP A O    1  
ATOM 3664   C CB   . ASP A 1 233 ? 11.905  19.606  217.610 1.00 0.00 ?  233 ASP A CB   1  
ATOM 3665   C CG   . ASP A 1 233 ? 12.397  21.048  217.549 1.00 0.00 ?  233 ASP A CG   1  
ATOM 3666   O OD1  . ASP A 1 233 ? 11.573  21.964  217.809 1.00 0.00 ?  233 ASP A OD1  1  
ATOM 3667   O OD2  . ASP A 1 233 ? 13.596  21.253  217.220 1.00 0.00 -1 233 ASP A OD2  1  
ATOM 3668   H H    . ASP A 1 233 ? 12.375  19.457  215.145 1.00 0.00 ?  233 ASP A H    1  
ATOM 3669   H HA   . ASP A 1 233 ? 13.894  18.831  217.371 1.00 0.00 ?  233 ASP A HA   1  
ATOM 3670   H HB2  . ASP A 1 233 ? 10.936  19.536  217.069 1.00 0.00 ?  233 ASP A HB2  1  
ATOM 3671   H HB3  . ASP A 1 233 ? 11.732  19.333  218.672 1.00 0.00 ?  233 ASP A HB3  1  
ATOM 3672   N N    . GLU A 1 234 ? 11.711  16.526  216.638 1.00 0.00 ?  234 GLU A N    1  
ATOM 3673   C CA   . GLU A 1 234 ? 11.267  15.231  217.081 1.00 0.00 ?  234 GLU A CA   1  
ATOM 3674   C C    . GLU A 1 234 ? 12.416  14.279  217.034 1.00 0.00 ?  234 GLU A C    1  
ATOM 3675   O O    . GLU A 1 234 ? 13.547  14.648  216.708 1.00 0.00 ?  234 GLU A O    1  
ATOM 3676   C CB   . GLU A 1 234 ? 10.115  14.676  216.232 1.00 0.00 ?  234 GLU A CB   1  
ATOM 3677   C CG   . GLU A 1 234 ? 8.884   15.575  216.325 1.00 0.00 ?  234 GLU A CG   1  
ATOM 3678   C CD   . GLU A 1 234 ? 7.765   14.979  215.489 1.00 0.00 ?  234 GLU A CD   1  
ATOM 3679   O OE1  . GLU A 1 234 ? 8.002   13.925  214.844 1.00 0.00 ?  234 GLU A OE1  1  
ATOM 3680   O OE2  . GLU A 1 234 ? 6.656   15.576  215.486 1.00 0.00 -1 234 GLU A OE2  1  
ATOM 3681   H H    . GLU A 1 234 ? 11.406  16.832  215.740 1.00 0.00 ?  234 GLU A H    1  
ATOM 3682   H HA   . GLU A 1 234 ? 10.949  15.337  218.106 1.00 0.00 ?  234 GLU A HA   1  
ATOM 3683   H HB2  . GLU A 1 234 ? 10.442  14.605  215.171 1.00 0.00 ?  234 GLU A HB2  1  
ATOM 3684   H HB3  . GLU A 1 234 ? 9.847   13.658  216.585 1.00 0.00 ?  234 GLU A HB3  1  
ATOM 3685   H HG2  . GLU A 1 234 ? 8.553   15.659  217.384 1.00 0.00 ?  234 GLU A HG2  1  
ATOM 3686   H HG3  . GLU A 1 234 ? 9.127   16.585  215.940 1.00 0.00 ?  234 GLU A HG3  1  
ATOM 3687   N N    . SER A 1 235 ? 12.150  12.997  217.340 1.00 0.00 ?  235 SER A N    1  
ATOM 3688   C CA   . SER A 1 235 ? 13.224  12.074  217.330 1.00 0.00 ?  235 SER A CA   1  
ATOM 3689   C C    . SER A 1 235 ? 13.394  11.710  215.907 1.00 0.00 ?  235 SER A C    1  
ATOM 3690   O O    . SER A 1 235 ? 12.540  11.081  215.284 1.00 0.00 ?  235 SER A O    1  
ATOM 3691   C CB   . SER A 1 235 ? 12.944  10.788  218.129 1.00 0.00 ?  235 SER A CB   1  
ATOM 3692   O OG   . SER A 1 235 ? 12.783  11.096  219.507 1.00 0.00 ?  235 SER A OG   1  
ATOM 3693   H H    . SER A 1 235 ? 11.243  12.656  217.573 1.00 0.00 ?  235 SER A H    1  
ATOM 3694   H HA   . SER A 1 235 ? 14.112  12.569  217.693 1.00 0.00 ?  235 SER A HA   1  
ATOM 3695   H HB2  . SER A 1 235 ? 12.015  10.304  217.758 1.00 0.00 ?  235 SER A HB2  1  
ATOM 3696   H HB3  . SER A 1 235 ? 13.791  10.078  218.017 1.00 0.00 ?  235 SER A HB3  1  
ATOM 3697   H HG   . SER A 1 235 ? 12.862  10.261  219.975 1.00 0.00 ?  235 SER A HG   1  
ATOM 3698   N N    . SER A 1 236 ? 14.550  12.114  215.373 1.00 0.00 ?  236 SER A N    1  
ATOM 3699   C CA   . SER A 1 236 ? 14.855  11.855  214.013 1.00 0.00 ?  236 SER A CA   1  
ATOM 3700   C C    . SER A 1 236 ? 16.350  11.978  213.921 1.00 0.00 ?  236 SER A C    1  
ATOM 3701   O O    . SER A 1 236 ? 16.958  12.645  214.756 1.00 0.00 ?  236 SER A O    1  
ATOM 3702   C CB   . SER A 1 236 ? 14.213  12.883  213.060 1.00 0.00 ?  236 SER A CB   1  
ATOM 3703   O OG   . SER A 1 236 ? 14.728  14.182  213.325 1.00 0.00 ?  236 SER A OG   1  
ATOM 3704   H H    . SER A 1 236 ? 15.240  12.607  215.897 1.00 0.00 ?  236 SER A H    1  
ATOM 3705   H HA   . SER A 1 236 ? 14.533  10.850  213.789 1.00 0.00 ?  236 SER A HA   1  
ATOM 3706   H HB2  . SER A 1 236 ? 14.438  12.616  212.005 1.00 0.00 ?  236 SER A HB2  1  
ATOM 3707   H HB3  . SER A 1 236 ? 13.114  12.899  213.202 1.00 0.00 ?  236 SER A HB3  1  
ATOM 3708   H HG   . SER A 1 236 ? 14.192  14.540  214.038 1.00 0.00 ?  236 SER A HG   1  
ATOM 3709   N N    . PRO A 1 237 ? 16.984  11.365  212.926 1.00 0.00 ?  237 PRO A N    1  
ATOM 3710   C CA   . PRO A 1 237 ? 18.436  11.474  212.771 1.00 0.00 ?  237 PRO A CA   1  
ATOM 3711   C C    . PRO A 1 237 ? 18.886  12.877  212.503 1.00 0.00 ?  237 PRO A C    1  
ATOM 3712   O O    . PRO A 1 237 ? 20.050  13.226  212.682 1.00 0.00 ?  237 PRO A O    1  
ATOM 3713   C CB   . PRO A 1 237 ? 18.775  10.612  211.552 1.00 0.00 ?  237 PRO A CB   1  
ATOM 3714   C CG   . PRO A 1 237 ? 17.567  9.704   211.367 1.00 0.00 ?  237 PRO A CG   1  
ATOM 3715   C CD   . PRO A 1 237 ? 16.388  10.524  211.865 1.00 0.00 ?  237 PRO A CD   1  
ATOM 3716   H HA   . PRO A 1 237 ? 18.954  11.091  213.638 1.00 0.00 ?  237 PRO A HA   1  
ATOM 3717   H HB2  . PRO A 1 237 ? 18.928  11.247  210.654 1.00 0.00 ?  237 PRO A HB2  1  
ATOM 3718   H HB3  . PRO A 1 237 ? 19.689  10.009  211.741 1.00 0.00 ?  237 PRO A HB3  1  
ATOM 3719   H HG2  . PRO A 1 237 ? 17.441  9.440   210.295 1.00 0.00 ?  237 PRO A HG2  1  
ATOM 3720   H HG3  . PRO A 1 237 ? 17.680  8.776   211.967 1.00 0.00 ?  237 PRO A HG3  1  
ATOM 3721   H HD2  . PRO A 1 237 ? 15.968  11.142  211.041 1.00 0.00 ?  237 PRO A HD2  1  
ATOM 3722   H HD3  . PRO A 1 237 ? 15.603  9.846   212.261 1.00 0.00 ?  237 PRO A HD3  1  
ATOM 3723   N N    . LEU A 1 238 ? 17.936  13.698  212.053 1.00 0.00 ?  238 LEU A N    1  
ATOM 3724   C CA   . LEU A 1 238 ? 18.189  15.049  211.663 1.00 0.00 ?  238 LEU A CA   1  
ATOM 3725   C C    . LEU A 1 238 ? 18.424  15.930  212.865 1.00 0.00 ?  238 LEU A C    1  
ATOM 3726   O O    . LEU A 1 238 ? 18.694  17.100  212.705 1.00 0.00 ?  238 LEU A O    1  
ATOM 3727   C CB   . LEU A 1 238 ? 17.033  15.619  210.835 1.00 0.00 ?  238 LEU A CB   1  
ATOM 3728   C CG   . LEU A 1 238 ? 16.776  14.782  209.564 1.00 0.00 ?  238 LEU A CG   1  
ATOM 3729   C CD1  . LEU A 1 238 ? 15.572  15.310  208.775 1.00 0.00 ?  238 LEU A CD1  1  
ATOM 3730   C CD2  . LEU A 1 238 ? 18.027  14.695  208.671 1.00 0.00 ?  238 LEU A CD2  1  
ATOM 3731   H H    . LEU A 1 238 ? 16.989  13.399  211.967 1.00 0.00 ?  238 LEU A H    1  
ATOM 3732   H HA   . LEU A 1 238 ? 19.090  15.042  211.074 1.00 0.00 ?  238 LEU A HA   1  
ATOM 3733   H HB2  . LEU A 1 238 ? 16.111  15.644  211.458 1.00 0.00 ?  238 LEU A HB2  1  
ATOM 3734   H HB3  . LEU A 1 238 ? 17.280  16.654  210.531 1.00 0.00 ?  238 LEU A HB3  1  
ATOM 3735   H HG   . LEU A 1 238 ? 16.529  13.749  209.893 1.00 0.00 ?  238 LEU A HG   1  
ATOM 3736   H HD11 . LEU A 1 238 ? 14.981  16.012  209.400 1.00 0.00 ?  238 LEU A HD11 1  
ATOM 3737   H HD12 . LEU A 1 238 ? 14.914  14.470  208.466 1.00 0.00 ?  238 LEU A HD12 1  
ATOM 3738   H HD13 . LEU A 1 238 ? 15.914  15.845  207.865 1.00 0.00 ?  238 LEU A HD13 1  
ATOM 3739   H HD21 . LEU A 1 238 ? 18.697  15.559  208.861 1.00 0.00 ?  238 LEU A HD21 1  
ATOM 3740   H HD22 . LEU A 1 238 ? 17.737  14.699  207.599 1.00 0.00 ?  238 LEU A HD22 1  
ATOM 3741   H HD23 . LEU A 1 238 ? 18.587  13.758  208.883 1.00 0.00 ?  238 LEU A HD23 1  
ATOM 3742   N N    . PHE A 1 239 ? 18.207  15.439  214.094 1.00 0.00 ?  239 PHE A N    1  
ATOM 3743   C CA   . PHE A 1 239 ? 18.419  16.282  215.262 1.00 0.00 ?  239 PHE A CA   1  
ATOM 3744   C C    . PHE A 1 239 ? 19.858  16.777  215.307 1.00 0.00 ?  239 PHE A C    1  
ATOM 3745   O O    . PHE A 1 239 ? 20.116  17.957  215.513 1.00 0.00 ?  239 PHE A O    1  
ATOM 3746   C CB   . PHE A 1 239 ? 18.146  15.551  216.586 1.00 0.00 ?  239 PHE A CB   1  
ATOM 3747   C CG   . PHE A 1 239 ? 18.419  16.385  217.792 1.00 0.00 ?  239 PHE A CG   1  
ATOM 3748   C CD1  . PHE A 1 239 ? 19.579  16.211  218.515 1.00 0.00 ?  239 PHE A CD1  1  
ATOM 3749   C CD2  . PHE A 1 239 ? 17.515  17.342  218.196 1.00 0.00 ?  239 PHE A CD2  1  
ATOM 3750   C CE1  . PHE A 1 239 ? 19.830  16.981  219.626 1.00 0.00 ?  239 PHE A CE1  1  
ATOM 3751   C CE2  . PHE A 1 239 ? 17.766  18.113  219.307 1.00 0.00 ?  239 PHE A CE2  1  
ATOM 3752   C CZ   . PHE A 1 239 ? 18.923  17.932  220.022 1.00 0.00 ?  239 PHE A CZ   1  
ATOM 3753   H H    . PHE A 1 239 ? 17.902  14.505  214.259 1.00 0.00 ?  239 PHE A H    1  
ATOM 3754   H HA   . PHE A 1 239 ? 17.763  17.130  215.169 1.00 0.00 ?  239 PHE A HA   1  
ATOM 3755   H HB2  . PHE A 1 239 ? 17.081  15.242  216.635 1.00 0.00 ?  239 PHE A HB2  1  
ATOM 3756   H HB3  . PHE A 1 239 ? 18.786  14.644  216.656 1.00 0.00 ?  239 PHE A HB3  1  
ATOM 3757   H HD1  . PHE A 1 239 ? 20.295  15.463  218.208 1.00 0.00 ?  239 PHE A HD1  1  
ATOM 3758   H HD2  . PHE A 1 239 ? 16.601  17.488  217.637 1.00 0.00 ?  239 PHE A HD2  1  
ATOM 3759   H HE1  . PHE A 1 239 ? 20.740  16.839  220.188 1.00 0.00 ?  239 PHE A HE1  1  
ATOM 3760   H HE2  . PHE A 1 239 ? 17.051  18.861  219.617 1.00 0.00 ?  239 PHE A HE2  1  
ATOM 3761   H HZ   . PHE A 1 239 ? 19.120  18.538  220.894 1.00 0.00 ?  239 PHE A HZ   1  
ATOM 3762   N N    . GLY A 1 240 ? 20.813  15.865  215.094 1.00 0.00 ?  240 GLY A N    1  
ATOM 3763   C CA   . GLY A 1 240 ? 22.235  16.163  215.167 1.00 0.00 ?  240 GLY A CA   1  
ATOM 3764   C C    . GLY A 1 240 ? 22.741  16.757  213.869 1.00 0.00 ?  240 GLY A C    1  
ATOM 3765   O O    . GLY A 1 240 ? 23.948  16.836  213.674 1.00 0.00 ?  240 GLY A O    1  
ATOM 3766   H H    . GLY A 1 240 ? 20.587  14.920  214.872 1.00 0.00 ?  240 GLY A H    1  
ATOM 3767   H HA2  . GLY A 1 240 ? 22.368  16.893  215.951 1.00 0.00 ?  240 GLY A HA2  1  
ATOM 3768   H HA3  . GLY A 1 240 ? 22.747  15.228  215.345 1.00 0.00 ?  240 GLY A HA3  1  
ATOM 3769   N N    . GLU A 1 241 ? 21.815  17.122  212.950 1.00 0.00 ?  241 GLU A N    1  
ATOM 3770   C CA   . GLU A 1 241 ? 22.130  17.594  211.588 1.00 0.00 ?  241 GLU A CA   1  
ATOM 3771   C C    . GLU A 1 241 ? 23.024  18.824  211.466 1.00 0.00 ?  241 GLU A C    1  
ATOM 3772   O O    . GLU A 1 241 ? 23.011  19.413  210.386 1.00 0.00 ?  241 GLU A O    1  
ATOM 3773   C CB   . GLU A 1 241 ? 20.870  17.923  210.744 1.00 0.00 ?  241 GLU A CB   1  
ATOM 3774   C CG   . GLU A 1 241 ? 20.140  19.215  211.179 1.00 0.00 ?  241 GLU A CG   1  
ATOM 3775   C CD   . GLU A 1 241 ? 18.882  19.364  210.333 1.00 0.00 ?  241 GLU A CD   1  
ATOM 3776   O OE1  . GLU A 1 241 ? 18.580  18.430  209.541 1.00 0.00 ?  241 GLU A OE1  1  
ATOM 3777   O OE2  . GLU A 1 241 ? 18.208  20.421  210.463 1.00 0.00 -1 241 GLU A OE2  1  
ATOM 3778   H H    . GLU A 1 241 ? 20.842  17.085  213.163 1.00 0.00 ?  241 GLU A H    1  
ATOM 3779   H HA   . GLU A 1 241 ? 22.644  16.776  211.111 1.00 0.00 ?  241 GLU A HA   1  
ATOM 3780   H HB2  . GLU A 1 241 ? 21.170  18.024  209.680 1.00 0.00 ?  241 GLU A HB2  1  
ATOM 3781   H HB3  . GLU A 1 241 ? 20.161  17.072  210.813 1.00 0.00 ?  241 GLU A HB3  1  
ATOM 3782   H HG2  . GLU A 1 241 ? 19.863  19.155  212.254 1.00 0.00 ?  241 GLU A HG2  1  
ATOM 3783   H HG3  . GLU A 1 241 ? 20.788  20.100  211.021 1.00 0.00 ?  241 GLU A HG3  1  
ATOM 3784   N N    . THR A 1 242 ? 23.781  19.285  212.498 1.00 0.00 ?  242 THR A N    1  
ATOM 3785   C CA   . THR A 1 242 ? 24.591  20.493  212.320 1.00 0.00 ?  242 THR A CA   1  
ATOM 3786   C C    . THR A 1 242 ? 25.448  20.318  211.055 1.00 0.00 ?  242 THR A C    1  
ATOM 3787   O O    . THR A 1 242 ? 25.840  19.200  210.732 1.00 0.00 ?  242 THR A O    1  
ATOM 3788   C CB   . THR A 1 242 ? 25.520  20.731  213.481 1.00 0.00 ?  242 THR A CB   1  
ATOM 3789   O OG1  . THR A 1 242 ? 26.494  19.698  213.544 1.00 0.00 ?  242 THR A OG1  1  
ATOM 3790   C CG2  . THR A 1 242 ? 24.692  20.762  214.776 1.00 0.00 ?  242 THR A CG2  1  
ATOM 3791   H H    . THR A 1 242 ? 23.819  18.840  213.389 1.00 0.00 ?  242 THR A H    1  
ATOM 3792   H HA   . THR A 1 242 ? 23.901  21.310  212.205 1.00 0.00 ?  242 THR A HA   1  
ATOM 3793   H HB   . THR A 1 242 ? 26.035  21.707  213.366 1.00 0.00 ?  242 THR A HB   1  
ATOM 3794   H HG1  . THR A 1 242 ? 26.194  19.092  214.226 1.00 0.00 ?  242 THR A HG1  1  
ATOM 3795   H HG21 . THR A 1 242 ? 24.749  19.780  215.295 1.00 0.00 ?  242 THR A HG21 1  
ATOM 3796   H HG22 . THR A 1 242 ? 23.627  20.980  214.547 1.00 0.00 ?  242 THR A HG22 1  
ATOM 3797   H HG23 . THR A 1 242 ? 25.075  21.547  215.461 1.00 0.00 ?  242 THR A HG23 1  
ATOM 3798   N N    . PRO A 1 243 ? 25.740  21.410  210.323 1.00 0.00 ?  243 PRO A N    1  
ATOM 3799   C CA   . PRO A 1 243 ? 26.462  21.323  209.042 1.00 0.00 ?  243 PRO A CA   1  
ATOM 3800   C C    . PRO A 1 243 ? 27.752  20.574  209.055 1.00 0.00 ?  243 PRO A C    1  
ATOM 3801   O O    . PRO A 1 243 ? 28.061  19.875  208.095 1.00 0.00 ?  243 PRO A O    1  
ATOM 3802   C CB   . PRO A 1 243 ? 26.751  22.776  208.674 1.00 0.00 ?  243 PRO A CB   1  
ATOM 3803   C CG   . PRO A 1 243 ? 25.621  23.544  209.327 1.00 0.00 ?  243 PRO A CG   1  
ATOM 3804   C CD   . PRO A 1 243 ? 25.402  22.818  210.648 1.00 0.00 ?  243 PRO A CD   1  
ATOM 3805   H HA   . PRO A 1 243 ? 25.829  20.899  208.279 1.00 0.00 ?  243 PRO A HA   1  
ATOM 3806   H HB2  . PRO A 1 243 ? 27.736  23.096  209.079 1.00 0.00 ?  243 PRO A HB2  1  
ATOM 3807   H HB3  . PRO A 1 243 ? 26.735  22.915  207.572 1.00 0.00 ?  243 PRO A HB3  1  
ATOM 3808   H HG2  . PRO A 1 243 ? 25.914  24.604  209.497 1.00 0.00 ?  243 PRO A HG2  1  
ATOM 3809   H HG3  . PRO A 1 243 ? 24.706  23.504  208.701 1.00 0.00 ?  243 PRO A HG3  1  
ATOM 3810   H HD2  . PRO A 1 243 ? 26.073  23.228  211.434 1.00 0.00 ?  243 PRO A HD2  1  
ATOM 3811   H HD3  . PRO A 1 243 ? 24.344  22.928  210.965 1.00 0.00 ?  243 PRO A HD3  1  
ATOM 3812   N N    . GLU A 1 244 ? 28.553  20.719  210.121 1.00 0.00 ?  244 GLU A N    1  
ATOM 3813   C CA   . GLU A 1 244 ? 29.815  20.034  210.159 1.00 0.00 ?  244 GLU A CA   1  
ATOM 3814   C C    . GLU A 1 244 ? 29.585  18.549  210.202 1.00 0.00 ?  244 GLU A C    1  
ATOM 3815   O O    . GLU A 1 244 ? 30.303  17.792  209.548 1.00 0.00 ?  244 GLU A O    1  
ATOM 3816   C CB   . GLU A 1 244 ? 30.677  20.410  211.382 1.00 0.00 ?  244 GLU A CB   1  
ATOM 3817   C CG   . GLU A 1 244 ? 31.219  21.846  211.324 1.00 0.00 ?  244 GLU A CG   1  
ATOM 3818   C CD   . GLU A 1 244 ? 32.096  21.991  210.086 1.00 0.00 ?  244 GLU A CD   1  
ATOM 3819   O OE1  . GLU A 1 244 ? 32.975  21.113  209.877 1.00 0.00 ?  244 GLU A OE1  1  
ATOM 3820   O OE2  . GLU A 1 244 ? 31.898  22.982  209.332 1.00 0.00 -1 244 GLU A OE2  1  
ATOM 3821   H H    . GLU A 1 244 ? 28.318  21.285  210.907 1.00 0.00 ?  244 GLU A H    1  
ATOM 3822   H HA   . GLU A 1 244 ? 30.335  20.274  209.248 1.00 0.00 ?  244 GLU A HA   1  
ATOM 3823   H HB2  . GLU A 1 244 ? 30.066  20.292  212.303 1.00 0.00 ?  244 GLU A HB2  1  
ATOM 3824   H HB3  . GLU A 1 244 ? 31.534  19.707  211.448 1.00 0.00 ?  244 GLU A HB3  1  
ATOM 3825   H HG2  . GLU A 1 244 ? 30.376  22.570  211.271 1.00 0.00 ?  244 GLU A HG2  1  
ATOM 3826   H HG3  . GLU A 1 244 ? 31.826  22.062  212.228 1.00 0.00 ?  244 GLU A HG3  1  
ATOM 3827   N N    . SER A 1 245 ? 28.580  18.089  210.977 1.00 0.00 ?  245 SER A N    1  
ATOM 3828   C CA   . SER A 1 245 ? 28.356  16.668  211.077 1.00 0.00 ?  245 SER A CA   1  
ATOM 3829   C C    . SER A 1 245 ? 27.867  16.149  209.763 1.00 0.00 ?  245 SER A C    1  
ATOM 3830   O O    . SER A 1 245 ? 28.228  15.041  209.356 1.00 0.00 ?  245 SER A O    1  
ATOM 3831   C CB   . SER A 1 245 ? 27.318  16.266  212.142 1.00 0.00 ?  245 SER A CB   1  
ATOM 3832   O OG   . SER A 1 245 ? 26.025  16.717  211.779 1.00 0.00 ?  245 SER A OG   1  
ATOM 3833   H H    . SER A 1 245 ? 27.972  18.685  211.494 1.00 0.00 ?  245 SER A H    1  
ATOM 3834   H HA   . SER A 1 245 ? 29.308  16.210  211.300 1.00 0.00 ?  245 SER A HA   1  
ATOM 3835   H HB2  . SER A 1 245 ? 27.292  15.160  212.246 1.00 0.00 ?  245 SER A HB2  1  
ATOM 3836   H HB3  . SER A 1 245 ? 27.590  16.712  213.122 1.00 0.00 ?  245 SER A HB3  1  
ATOM 3837   H HG   . SER A 1 245 ? 25.437  16.425  212.478 1.00 0.00 ?  245 SER A HG   1  
ATOM 3838   N N    . LEU A 1 246 ? 27.014  16.936  209.076 1.00 0.00 ?  246 LEU A N    1  
ATOM 3839   C CA   . LEU A 1 246 ? 26.470  16.495  207.820 1.00 0.00 ?  246 LEU A CA   1  
ATOM 3840   C C    . LEU A 1 246 ? 27.581  16.354  206.830 1.00 0.00 ?  246 LEU A C    1  
ATOM 3841   O O    . LEU A 1 246 ? 27.594  15.421  206.038 1.00 0.00 ?  246 LEU A O    1  
ATOM 3842   C CB   . LEU A 1 246 ? 25.452  17.477  207.219 1.00 0.00 ?  246 LEU A CB   1  
ATOM 3843   C CG   . LEU A 1 246 ? 24.149  17.568  208.028 1.00 0.00 ?  246 LEU A CG   1  
ATOM 3844   C CD1  . LEU A 1 246 ? 23.249  18.694  207.493 1.00 0.00 ?  246 LEU A CD1  1  
ATOM 3845   C CD2  . LEU A 1 246 ? 23.405  16.223  208.062 1.00 0.00 ?  246 LEU A CD2  1  
ATOM 3846   H H    . LEU A 1 246 ? 26.717  17.830  209.409 1.00 0.00 ?  246 LEU A H    1  
ATOM 3847   H HA   . LEU A 1 246 ? 26.012  15.533  207.981 1.00 0.00 ?  246 LEU A HA   1  
ATOM 3848   H HB2  . LEU A 1 246 ? 25.916  18.487  207.162 1.00 0.00 ?  246 LEU A HB2  1  
ATOM 3849   H HB3  . LEU A 1 246 ? 25.206  17.153  206.187 1.00 0.00 ?  246 LEU A HB3  1  
ATOM 3850   H HG   . LEU A 1 246 ? 24.422  17.827  209.074 1.00 0.00 ?  246 LEU A HG   1  
ATOM 3851   H HD11 . LEU A 1 246 ? 22.305  18.744  208.075 1.00 0.00 ?  246 LEU A HD11 1  
ATOM 3852   H HD12 . LEU A 1 246 ? 22.998  18.514  206.427 1.00 0.00 ?  246 LEU A HD12 1  
ATOM 3853   H HD13 . LEU A 1 246 ? 23.767  19.673  207.575 1.00 0.00 ?  246 LEU A HD13 1  
ATOM 3854   H HD21 . LEU A 1 246 ? 22.324  16.374  207.855 1.00 0.00 ?  246 LEU A HD21 1  
ATOM 3855   H HD22 . LEU A 1 246 ? 23.511  15.748  209.061 1.00 0.00 ?  246 LEU A HD22 1  
ATOM 3856   H HD23 . LEU A 1 246 ? 23.818  15.532  207.298 1.00 0.00 ?  246 LEU A HD23 1  
ATOM 3857   N N    . ALA A 1 247 ? 28.532  17.301  206.861 1.00 0.00 ?  247 ALA A N    1  
ATOM 3858   C CA   . ALA A 1 247 ? 29.633  17.297  205.934 1.00 0.00 ?  247 ALA A CA   1  
ATOM 3859   C C    . ALA A 1 247 ? 30.462  16.061  206.113 1.00 0.00 ?  247 ALA A C    1  
ATOM 3860   O O    . ALA A 1 247 ? 30.954  15.507  205.128 1.00 0.00 ?  247 ALA A O    1  
ATOM 3861   C CB   . ALA A 1 247 ? 30.565  18.507  206.102 1.00 0.00 ?  247 ALA A CB   1  
ATOM 3862   H H    . ALA A 1 247 ? 28.514  18.048  207.516 1.00 0.00 ?  247 ALA A H    1  
ATOM 3863   H HA   . ALA A 1 247 ? 29.215  17.295  204.941 1.00 0.00 ?  247 ALA A HA   1  
ATOM 3864   H HB1  . ALA A 1 247 ? 30.736  19.001  205.122 1.00 0.00 ?  247 ALA A HB1  1  
ATOM 3865   H HB2  . ALA A 1 247 ? 31.546  18.184  206.512 1.00 0.00 ?  247 ALA A HB2  1  
ATOM 3866   H HB3  . ALA A 1 247 ? 30.115  19.246  206.799 1.00 0.00 ?  247 ALA A HB3  1  
ATOM 3867   N N    . GLU A 1 248 ? 30.662  15.623  207.382 1.00 0.00 ?  248 GLU A N    1  
ATOM 3868   C CA   . GLU A 1 248 ? 31.495  14.466  207.644 1.00 0.00 ?  248 GLU A CA   1  
ATOM 3869   C C    . GLU A 1 248 ? 30.921  13.281  206.940 1.00 0.00 ?  248 GLU A C    1  
ATOM 3870   O O    . GLU A 1 248 ? 31.650  12.532  206.289 1.00 0.00 ?  248 GLU A O    1  
ATOM 3871   C CB   . GLU A 1 248 ? 31.586  14.111  209.147 1.00 0.00 ?  248 GLU A CB   1  
ATOM 3872   C CG   . GLU A 1 248 ? 32.489  12.899  209.444 1.00 0.00 ?  248 GLU A CG   1  
ATOM 3873   C CD   . GLU A 1 248 ? 33.933  13.237  209.075 1.00 0.00 ?  248 GLU A CD   1  
ATOM 3874   O OE1  . GLU A 1 248 ? 34.283  14.450  209.054 1.00 0.00 ?  248 GLU A OE1  1  
ATOM 3875   O OE2  . GLU A 1 248 ? 34.710  12.281  208.809 1.00 0.00 -1 248 GLU A OE2  1  
ATOM 3876   H H    . GLU A 1 248 ? 30.268  16.081  208.177 1.00 0.00 ?  248 GLU A H    1  
ATOM 3877   H HA   . GLU A 1 248 ? 32.477  14.673  207.249 1.00 0.00 ?  248 GLU A HA   1  
ATOM 3878   H HB2  . GLU A 1 248 ? 31.975  14.993  209.700 1.00 0.00 ?  248 GLU A HB2  1  
ATOM 3879   H HB3  . GLU A 1 248 ? 30.565  13.895  209.526 1.00 0.00 ?  248 GLU A HB3  1  
ATOM 3880   H HG2  . GLU A 1 248 ? 32.435  12.649  210.526 1.00 0.00 ?  248 GLU A HG2  1  
ATOM 3881   H HG3  . GLU A 1 248 ? 32.161  12.016  208.858 1.00 0.00 ?  248 GLU A HG3  1  
ATOM 3882   N N    . GLY A 1 249 ? 29.599  13.077  207.047 1.00 0.00 ?  249 GLY A N    1  
ATOM 3883   C CA   . GLY A 1 249 ? 29.003  11.962  206.374 1.00 0.00 ?  249 GLY A CA   1  
ATOM 3884   C C    . GLY A 1 249 ? 28.701  12.434  204.996 1.00 0.00 ?  249 GLY A C    1  
ATOM 3885   O O    . GLY A 1 249 ? 28.917  13.591  204.679 1.00 0.00 ?  249 GLY A O    1  
ATOM 3886   H H    . GLY A 1 249 ? 28.993  13.672  207.575 1.00 0.00 ?  249 GLY A H    1  
ATOM 3887   H HA2  . GLY A 1 249 ? 29.724  11.158  206.336 1.00 0.00 ?  249 GLY A HA2  1  
ATOM 3888   H HA3  . GLY A 1 249 ? 28.080  11.724  206.879 1.00 0.00 ?  249 GLY A HA3  1  
ATOM 3889   N N    . ARG A 1 250 ? 28.224  11.531  204.130 1.00 0.00 ?  250 ARG A N    1  
ATOM 3890   C CA   . ARG A 1 250 ? 27.847  11.928  202.804 1.00 0.00 ?  250 ARG A CA   1  
ATOM 3891   C C    . ARG A 1 250 ? 26.380  12.130  202.884 1.00 0.00 ?  250 ARG A C    1  
ATOM 3892   O O    . ARG A 1 250 ? 25.612  11.394  202.262 1.00 0.00 ?  250 ARG A O    1  
ATOM 3893   C CB   . ARG A 1 250 ? 28.139  10.880  201.716 1.00 0.00 ?  250 ARG A CB   1  
ATOM 3894   C CG   . ARG A 1 250 ? 29.634  10.614  201.539 1.00 0.00 ?  250 ARG A CG   1  
ATOM 3895   C CD   . ARG A 1 250 ? 30.376  11.830  200.973 1.00 0.00 ?  250 ARG A CD   1  
ATOM 3896   N NE   . ARG A 1 250 ? 31.777  11.430  200.657 1.00 0.00 ?  250 ARG A NE   1  
ATOM 3897   C CZ   . ARG A 1 250 ? 32.653  12.350  200.153 1.00 0.00 ?  250 ARG A CZ   1  
ATOM 3898   N NH1  . ARG A 1 250 ? 32.270  13.652  200.000 1.00 0.00 1  250 ARG A NH1  1  
ATOM 3899   N NH2  . ARG A 1 250 ? 33.918  11.969  199.811 1.00 0.00 ?  250 ARG A NH2  1  
ATOM 3900   H H    . ARG A 1 250 ? 28.112  10.567  204.360 1.00 0.00 ?  250 ARG A H    1  
ATOM 3901   H HA   . ARG A 1 250 ? 28.328  12.865  202.571 1.00 0.00 ?  250 ARG A HA   1  
ATOM 3902   H HB2  . ARG A 1 250 ? 27.629  9.930   201.984 1.00 0.00 ?  250 ARG A HB2  1  
ATOM 3903   H HB3  . ARG A 1 250 ? 27.720  11.235  200.750 1.00 0.00 ?  250 ARG A HB3  1  
ATOM 3904   H HG2  . ARG A 1 250 ? 30.076  10.345  202.523 1.00 0.00 ?  250 ARG A HG2  1  
ATOM 3905   H HG3  . ARG A 1 250 ? 29.772  9.751   200.852 1.00 0.00 ?  250 ARG A HG3  1  
ATOM 3906   H HD2  . ARG A 1 250 ? 29.894  12.186  200.037 1.00 0.00 ?  250 ARG A HD2  1  
ATOM 3907   H HD3  . ARG A 1 250 ? 30.411  12.655  201.716 1.00 0.00 ?  250 ARG A HD3  1  
ATOM 3908   H HE   . ARG A 1 250 ? 32.068  10.484  200.792 1.00 0.00 ?  250 ARG A HE   1  
ATOM 3909   H HH11 . ARG A 1 250 ? 31.345  13.934  200.256 1.00 0.00 ?  250 ARG A HH11 1  
ATOM 3910   H HH12 . ARG A 1 250 ? 32.914  14.324  199.631 1.00 0.00 ?  250 ARG A HH12 1  
ATOM 3911   H HH21 . ARG A 1 250 ? 34.204  11.018  199.931 1.00 0.00 ?  250 ARG A HH21 1  
ATOM 3912   H HH22 . ARG A 1 250 ? 34.556  12.638  199.430 1.00 0.00 ?  250 ARG A HH22 1  
ATOM 3913   N N    . ALA A 1 251 ? 25.963  13.145  203.685 1.00 0.00 ?  251 ALA A N    1  
ATOM 3914   C CA   . ALA A 1 251 ? 24.563  13.400  203.879 1.00 0.00 ?  251 ALA A CA   1  
ATOM 3915   C C    . ALA A 1 251 ? 23.945  13.711  202.558 1.00 0.00 ?  251 ALA A C    1  
ATOM 3916   O O    . ALA A 1 251 ? 24.366  14.626  201.851 1.00 0.00 ?  251 ALA A O    1  
ATOM 3917   C CB   . ALA A 1 251 ? 24.283  14.582  204.818 1.00 0.00 ?  251 ALA A CB   1  
ATOM 3918   H H    . ALA A 1 251 ? 26.600  13.752  204.162 1.00 0.00 ?  251 ALA A H    1  
ATOM 3919   H HA   . ALA A 1 251 ? 24.123  12.506  204.275 1.00 0.00 ?  251 ALA A HA   1  
ATOM 3920   H HB1  . ALA A 1 251 ? 23.607  14.268  205.641 1.00 0.00 ?  251 ALA A HB1  1  
ATOM 3921   H HB2  . ALA A 1 251 ? 23.799  15.412  204.259 1.00 0.00 ?  251 ALA A HB2  1  
ATOM 3922   H HB3  . ALA A 1 251 ? 25.230  14.958  205.260 1.00 0.00 ?  251 ALA A HB3  1  
ATOM 3923   N N    . MET A 1 252 ? 22.927  12.903  202.198 1.00 0.00 ?  252 MET A N    1  
ATOM 3924   C CA   . MET A 1 252 ? 22.222  13.088  200.961 1.00 0.00 ?  252 MET A CA   1  
ATOM 3925   C C    . MET A 1 252 ? 20.768  13.134  201.308 1.00 0.00 ?  252 MET A C    1  
ATOM 3926   O O    . MET A 1 252 ? 20.295  12.306  202.086 1.00 0.00 ?  252 MET A O    1  
ATOM 3927   C CB   . MET A 1 252 ? 22.429  11.925  199.971 1.00 0.00 ?  252 MET A CB   1  
ATOM 3928   C CG   . MET A 1 252 ? 21.809  12.183  198.596 1.00 0.00 ?  252 MET A CG   1  
ATOM 3929   S SD   . MET A 1 252 ? 22.612  13.542  197.697 1.00 0.00 ?  252 MET A SD   1  
ATOM 3930   C CE   . MET A 1 252 ? 24.096  12.590  197.261 1.00 0.00 ?  252 MET A CE   1  
ATOM 3931   H H    . MET A 1 252 ? 22.631  12.138  202.766 1.00 0.00 ?  252 MET A H    1  
ATOM 3932   H HA   . MET A 1 252 ? 22.521  14.026  200.524 1.00 0.00 ?  252 MET A HA   1  
ATOM 3933   H HB2  . MET A 1 252 ? 23.518  11.743  199.849 1.00 0.00 ?  252 MET A HB2  1  
ATOM 3934   H HB3  . MET A 1 252 ? 21.975  11.009  200.396 1.00 0.00 ?  252 MET A HB3  1  
ATOM 3935   H HG2  . MET A 1 252 ? 21.877  11.247  197.999 1.00 0.00 ?  252 MET A HG2  1  
ATOM 3936   H HG3  . MET A 1 252 ? 20.731  12.413  198.733 1.00 0.00 ?  252 MET A HG3  1  
ATOM 3937   H HE1  . MET A 1 252 ? 24.357  12.733  196.190 1.00 0.00 ?  252 MET A HE1  1  
ATOM 3938   H HE2  . MET A 1 252 ? 23.936  11.506  197.434 1.00 0.00 ?  252 MET A HE2  1  
ATOM 3939   H HE3  . MET A 1 252 ? 24.966  12.912  197.872 1.00 0.00 ?  252 MET A HE3  1  
ATOM 3940   N N    . LEU A 1 253 ? 20.028  14.114  200.743 1.00 0.00 ?  253 LEU A N    1  
ATOM 3941   C CA   . LEU A 1 253 ? 18.612  14.201  200.997 1.00 0.00 ?  253 LEU A CA   1  
ATOM 3942   C C    . LEU A 1 253 ? 17.970  13.754  199.726 1.00 0.00 ?  253 LEU A C    1  
ATOM 3943   O O    . LEU A 1 253 ? 18.235  14.328  198.678 1.00 0.00 ?  253 LEU A O    1  
ATOM 3944   C CB   . LEU A 1 253 ? 18.125  15.635  201.284 1.00 0.00 ?  253 LEU A CB   1  
ATOM 3945   C CG   . LEU A 1 253 ? 18.837  16.284  202.483 1.00 0.00 ?  253 LEU A CG   1  
ATOM 3946   C CD1  . LEU A 1 253 ? 18.367  17.733  202.689 1.00 0.00 ?  253 LEU A CD1  1  
ATOM 3947   C CD2  . LEU A 1 253 ? 18.652  15.455  203.764 1.00 0.00 ?  253 LEU A CD2  1  
ATOM 3948   H H    . LEU A 1 253 ? 20.416  14.809  200.139 1.00 0.00 ?  253 LEU A H    1  
ATOM 3949   H HA   . LEU A 1 253 ? 18.349  13.531  201.799 1.00 0.00 ?  253 LEU A HA   1  
ATOM 3950   H HB2  . LEU A 1 253 ? 18.292  16.259  200.379 1.00 0.00 ?  253 LEU A HB2  1  
ATOM 3951   H HB3  . LEU A 1 253 ? 17.035  15.611  201.489 1.00 0.00 ?  253 LEU A HB3  1  
ATOM 3952   H HG   . LEU A 1 253 ? 19.924  16.312  202.255 1.00 0.00 ?  253 LEU A HG   1  
ATOM 3953   H HD11 . LEU A 1 253 ? 19.183  18.443  202.437 1.00 0.00 ?  253 LEU A HD11 1  
ATOM 3954   H HD12 . LEU A 1 253 ? 18.069  17.896  203.746 1.00 0.00 ?  253 LEU A HD12 1  
ATOM 3955   H HD13 . LEU A 1 253 ? 17.494  17.951  202.037 1.00 0.00 ?  253 LEU A HD13 1  
ATOM 3956   H HD21 . LEU A 1 253 ? 19.353  14.594  203.772 1.00 0.00 ?  253 LEU A HD21 1  
ATOM 3957   H HD22 . LEU A 1 253 ? 17.613  15.067  203.824 1.00 0.00 ?  253 LEU A HD22 1  
ATOM 3958   H HD23 . LEU A 1 253 ? 18.849  16.082  204.661 1.00 0.00 ?  253 LEU A HD23 1  
ATOM 3959   N N    . LEU A 1 254 ? 17.108  12.711  199.791 1.00 0.00 ?  254 LEU A N    1  
ATOM 3960   C CA   . LEU A 1 254 ? 16.465  12.212  198.598 1.00 0.00 ?  254 LEU A CA   1  
ATOM 3961   C C    . LEU A 1 254 ? 14.984  12.314  198.794 1.00 0.00 ?  254 LEU A C    1  
ATOM 3962   O O    . LEU A 1 254 ? 14.462  11.974  199.851 1.00 0.00 ?  254 LEU A O    1  
ATOM 3963   C CB   . LEU A 1 254 ? 16.796  10.739  198.295 1.00 0.00 ?  254 LEU A CB   1  
ATOM 3964   C CG   . LEU A 1 254 ? 18.306  10.435  198.350 1.00 0.00 ?  254 LEU A CG   1  
ATOM 3965   C CD1  . LEU A 1 254 ? 18.764  10.090  199.778 1.00 0.00 ?  254 LEU A CD1  1  
ATOM 3966   C CD2  . LEU A 1 254 ? 18.688  9.319   197.362 1.00 0.00 ?  254 LEU A CD2  1  
ATOM 3967   H H    . LEU A 1 254 ? 16.887  12.245  200.643 1.00 0.00 ?  254 LEU A H    1  
ATOM 3968   H HA   . LEU A 1 254 ? 16.750  12.836  197.767 1.00 0.00 ?  254 LEU A HA   1  
ATOM 3969   H HB2  . LEU A 1 254 ? 16.269  10.098  199.028 1.00 0.00 ?  254 LEU A HB2  1  
ATOM 3970   H HB3  . LEU A 1 254 ? 16.419  10.485  197.283 1.00 0.00 ?  254 LEU A HB3  1  
ATOM 3971   H HG   . LEU A 1 254 ? 18.843  11.356  198.040 1.00 0.00 ?  254 LEU A HG   1  
ATOM 3972   H HD11 . LEU A 1 254 ? 17.984  9.500   200.303 1.00 0.00 ?  254 LEU A HD11 1  
ATOM 3973   H HD12 . LEU A 1 254 ? 18.955  11.020  200.357 1.00 0.00 ?  254 LEU A HD12 1  
ATOM 3974   H HD13 . LEU A 1 254 ? 19.701  9.493   199.750 1.00 0.00 ?  254 LEU A HD13 1  
ATOM 3975   H HD21 . LEU A 1 254 ? 18.135  8.385   197.602 1.00 0.00 ?  254 LEU A HD21 1  
ATOM 3976   H HD22 . LEU A 1 254 ? 19.778  9.110   197.419 1.00 0.00 ?  254 LEU A HD22 1  
ATOM 3977   H HD23 . LEU A 1 254 ? 18.438  9.621   196.322 1.00 0.00 ?  254 LEU A HD23 1  
ATOM 3978   N N    . VAL A 1 255 ? 14.277  12.797  197.750 1.00 0.00 ?  255 VAL A N    1  
ATOM 3979   C CA   . VAL A 1 255 ? 12.844  12.927  197.816 1.00 0.00 ?  255 VAL A CA   1  
ATOM 3980   C C    . VAL A 1 255 ? 12.299  12.377  196.540 1.00 0.00 ?  255 VAL A C    1  
ATOM 3981   O O    . VAL A 1 255 ? 12.842  12.650  195.468 1.00 0.00 ?  255 VAL A O    1  
ATOM 3982   C CB   . VAL A 1 255 ? 12.376  14.347  197.968 1.00 0.00 ?  255 VAL A CB   1  
ATOM 3983   C CG1  . VAL A 1 255 ? 10.837  14.367  197.937 1.00 0.00 ?  255 VAL A CG1  1  
ATOM 3984   C CG2  . VAL A 1 255 ? 12.930  14.883  199.296 1.00 0.00 ?  255 VAL A CG2  1  
ATOM 3985   H H    . VAL A 1 255 ? 14.708  13.074  196.889 1.00 0.00 ?  255 VAL A H    1  
ATOM 3986   H HA   . VAL A 1 255 ? 12.489  12.321  198.635 1.00 0.00 ?  255 VAL A HA   1  
ATOM 3987   H HB   . VAL A 1 255 ? 12.766  14.972  197.138 1.00 0.00 ?  255 VAL A HB   1  
ATOM 3988   H HG11 . VAL A 1 255 ? 10.475  14.595  196.911 1.00 0.00 ?  255 VAL A HG11 1  
ATOM 3989   H HG12 . VAL A 1 255 ? 10.448  15.143  198.630 1.00 0.00 ?  255 VAL A HG12 1  
ATOM 3990   H HG13 . VAL A 1 255 ? 10.432  13.381  198.245 1.00 0.00 ?  255 VAL A HG13 1  
ATOM 3991   H HG21 . VAL A 1 255 ? 12.507  14.309  200.145 1.00 0.00 ?  255 VAL A HG21 1  
ATOM 3992   H HG22 . VAL A 1 255 ? 12.662  15.954  199.423 1.00 0.00 ?  255 VAL A HG22 1  
ATOM 3993   H HG23 . VAL A 1 255 ? 14.035  14.788  199.320 1.00 0.00 ?  255 VAL A HG23 1  
ATOM 3994   N N    . MET A 1 256 ? 11.208  11.570  196.634 1.00 0.00 ?  256 MET A N    1  
ATOM 3995   C CA   . MET A 1 256 ? 10.612  11.010  195.448 1.00 0.00 ?  256 MET A CA   1  
ATOM 3996   C C    . MET A 1 256 ? 9.179   11.419  195.461 1.00 0.00 ?  256 MET A C    1  
ATOM 3997   O O    . MET A 1 256 ? 8.541   11.477  196.510 1.00 0.00 ?  256 MET A O    1  
ATOM 3998   C CB   . MET A 1 256 ? 10.696  9.472   195.365 1.00 0.00 ?  256 MET A CB   1  
ATOM 3999   C CG   . MET A 1 256 ? 9.986   8.759   196.518 1.00 0.00 ?  256 MET A CG   1  
ATOM 4000   S SD   . MET A 1 256 ? 10.172  6.955   196.446 1.00 0.00 ?  256 MET A SD   1  
ATOM 4001   C CE   . MET A 1 256 ? 11.922  6.966   196.922 1.00 0.00 ?  256 MET A CE   1  
ATOM 4002   H H    . MET A 1 256 ? 10.773  11.347  197.507 1.00 0.00 ?  256 MET A H    1  
ATOM 4003   H HA   . MET A 1 256 ? 11.087  11.455  194.589 1.00 0.00 ?  256 MET A HA   1  
ATOM 4004   H HB2  . MET A 1 256 ? 10.245  9.141   194.405 1.00 0.00 ?  256 MET A HB2  1  
ATOM 4005   H HB3  . MET A 1 256 ? 11.764  9.170   195.362 1.00 0.00 ?  256 MET A HB3  1  
ATOM 4006   H HG2  . MET A 1 256 ? 10.401  9.138   197.473 1.00 0.00 ?  256 MET A HG2  1  
ATOM 4007   H HG3  . MET A 1 256 ? 8.907   9.021   196.492 1.00 0.00 ?  256 MET A HG3  1  
ATOM 4008   H HE1  . MET A 1 256 ? 12.099  6.304   197.796 1.00 0.00 ?  256 MET A HE1  1  
ATOM 4009   H HE2  . MET A 1 256 ? 12.251  7.990   197.195 1.00 0.00 ?  256 MET A HE2  1  
ATOM 4010   H HE3  . MET A 1 256 ? 12.561  6.610   196.086 1.00 0.00 ?  256 MET A HE3  1  
ATOM 4011   N N    . ILE A 1 257 ? 8.660   11.720  194.255 1.00 0.00 ?  257 ILE A N    1  
ATOM 4012   C CA   . ILE A 1 257 ? 7.304   12.170  194.102 1.00 0.00 ?  257 ILE A CA   1  
ATOM 4013   C C    . ILE A 1 257 ? 6.671   11.289  193.069 1.00 0.00 ?  257 ILE A C    1  
ATOM 4014   O O    . ILE A 1 257 ? 7.256   11.083  192.010 1.00 0.00 ?  257 ILE A O    1  
ATOM 4015   C CB   . ILE A 1 257 ? 7.244   13.578  193.583 1.00 0.00 ?  257 ILE A CB   1  
ATOM 4016   C CG1  . ILE A 1 257 ? 7.962   14.555  194.535 1.00 0.00 ?  257 ILE A CG1  1  
ATOM 4017   C CG2  . ILE A 1 257 ? 5.769   13.943  193.398 1.00 0.00 ?  257 ILE A CG2  1  
ATOM 4018   C CD1  . ILE A 1 257 ? 8.154   15.936  193.913 1.00 0.00 ?  257 ILE A CD1  1  
ATOM 4019   H H    . ILE A 1 257 ? 9.194   11.640  193.416 1.00 0.00 ?  257 ILE A H    1  
ATOM 4020   H HA   . ILE A 1 257 ? 6.787   12.074  195.042 1.00 0.00 ?  257 ILE A HA   1  
ATOM 4021   H HB   . ILE A 1 257 ? 7.741   13.626  192.589 1.00 0.00 ?  257 ILE A HB   1  
ATOM 4022   H HG12 . ILE A 1 257 ? 7.366   14.659  195.465 1.00 0.00 ?  257 ILE A HG12 1  
ATOM 4023   H HG13 . ILE A 1 257 ? 8.957   14.144  194.807 1.00 0.00 ?  257 ILE A HG13 1  
ATOM 4024   H HG21 . ILE A 1 257 ? 5.455   13.762  192.348 1.00 0.00 ?  257 ILE A HG21 1  
ATOM 4025   H HG22 . ILE A 1 257 ? 5.603   15.015  193.639 1.00 0.00 ?  257 ILE A HG22 1  
ATOM 4026   H HG23 . ILE A 1 257 ? 5.134   13.326  194.070 1.00 0.00 ?  257 ILE A HG23 1  
ATOM 4027   H HD11 . ILE A 1 257 ? 7.684   15.974  192.910 1.00 0.00 ?  257 ILE A HD11 1  
ATOM 4028   H HD12 . ILE A 1 257 ? 9.236   16.165  193.806 1.00 0.00 ?  257 ILE A HD12 1  
ATOM 4029   H HD13 . ILE A 1 257 ? 7.689   16.716  194.551 1.00 0.00 ?  257 ILE A HD13 1  
ATOM 4030   N N    . GLU A 1 258 ? 5.467   10.725  193.338 1.00 0.00 ?  258 GLU A N    1  
ATOM 4031   C CA   . GLU A 1 258 ? 4.854   9.894   192.334 1.00 0.00 ?  258 GLU A CA   1  
ATOM 4032   C C    . GLU A 1 258 ? 3.366   9.873   192.536 1.00 0.00 ?  258 GLU A C    1  
ATOM 4033   O O    . GLU A 1 258 ? 2.877   10.033  193.647 1.00 0.00 ?  258 GLU A O    1  
ATOM 4034   C CB   . GLU A 1 258 ? 5.363   8.442   192.352 1.00 0.00 ?  258 GLU A CB   1  
ATOM 4035   C CG   . GLU A 1 258 ? 4.971   7.684   193.625 1.00 0.00 ?  258 GLU A CG   1  
ATOM 4036   C CD   . GLU A 1 258 ? 5.623   6.309   193.585 1.00 0.00 ?  258 GLU A CD   1  
ATOM 4037   O OE1  . GLU A 1 258 ? 6.520   6.101   192.725 1.00 0.00 ?  258 GLU A OE1  1  
ATOM 4038   O OE2  . GLU A 1 258 ? 5.222   5.440   194.406 1.00 0.00 -1 258 GLU A OE2  1  
ATOM 4039   H H    . GLU A 1 258 ? 4.975   10.856  194.192 1.00 0.00 ?  258 GLU A H    1  
ATOM 4040   H HA   . GLU A 1 258 ? 5.065   10.348  191.386 1.00 0.00 ?  258 GLU A HA   1  
ATOM 4041   H HB2  . GLU A 1 258 ? 4.954   7.904   191.469 1.00 0.00 ?  258 GLU A HB2  1  
ATOM 4042   H HB3  . GLU A 1 258 ? 6.470   8.450   192.266 1.00 0.00 ?  258 GLU A HB3  1  
ATOM 4043   H HG2  . GLU A 1 258 ? 5.321   8.239   194.523 1.00 0.00 ?  258 GLU A HG2  1  
ATOM 4044   H HG3  . GLU A 1 258 ? 3.869   7.561   193.679 1.00 0.00 ?  258 GLU A HG3  1  
ATOM 4045   N N    . GLY A 1 259 ? 2.608   9.659   191.426 1.00 0.00 ?  259 GLY A N    1  
ATOM 4046   C CA   . GLY A 1 259 ? 1.168   9.600   191.519 1.00 0.00 ?  259 GLY A CA   1  
ATOM 4047   C C    . GLY A 1 259 ? 0.613   9.502   190.128 1.00 0.00 ?  259 GLY A C    1  
ATOM 4048   O O    . GLY A 1 259 ? 1.358   9.503   189.147 1.00 0.00 ?  259 GLY A O    1  
ATOM 4049   H H    . GLY A 1 259 ? 3.004   9.536   190.520 1.00 0.00 ?  259 GLY A H    1  
ATOM 4050   H HA2  . GLY A 1 259 ? 0.912   8.703   192.063 1.00 0.00 ?  259 GLY A HA2  1  
ATOM 4051   H HA3  . GLY A 1 259 ? 0.822   10.508  191.970 1.00 0.00 ?  259 GLY A HA3  1  
ATOM 4052   N N    . SER A 1 260 ? -0.740  9.415   190.019 1.00 0.00 ?  260 SER A N    1  
ATOM 4053   C CA   . SER A 1 260 ? -1.365  9.307   188.724 1.00 0.00 ?  260 SER A CA   1  
ATOM 4054   C C    . SER A 1 260 ? -1.291  10.645  188.063 1.00 0.00 ?  260 SER A C    1  
ATOM 4055   O O    . SER A 1 260 ? -1.177  11.675  188.730 1.00 0.00 ?  260 SER A O    1  
ATOM 4056   C CB   . SER A 1 260 ? -2.840  8.895   188.786 1.00 0.00 ?  260 SER A CB   1  
ATOM 4057   O OG   . SER A 1 260 ? -3.611  9.947   189.336 1.00 0.00 ?  260 SER A OG   1  
ATOM 4058   H H    . SER A 1 260 ? -1.346  9.426   190.812 1.00 0.00 ?  260 SER A H    1  
ATOM 4059   H HA   . SER A 1 260 ? -0.798  8.594   188.146 1.00 0.00 ?  260 SER A HA   1  
ATOM 4060   H HB2  . SER A 1 260 ? -3.215  8.671   187.765 1.00 0.00 ?  260 SER A HB2  1  
ATOM 4061   H HB3  . SER A 1 260 ? -2.958  7.992   189.422 1.00 0.00 ?  260 SER A HB3  1  
ATOM 4062   H HG   . SER A 1 260 ? -4.290  10.141  188.684 1.00 0.00 ?  260 SER A HG   1  
ATOM 4063   N N    . ASP A 1 261 ? -1.387  10.644  186.711 1.00 0.00 ?  261 ASP A N    1  
ATOM 4064   C CA   . ASP A 1 261 ? -1.284  11.872  185.963 1.00 0.00 ?  261 ASP A CA   1  
ATOM 4065   C C    . ASP A 1 261 ? -2.628  12.388  185.493 1.00 0.00 ?  261 ASP A C    1  
ATOM 4066   O O    . ASP A 1 261 ? -2.632  13.405  184.813 1.00 0.00 ?  261 ASP A O    1  
ATOM 4067   C CB   . ASP A 1 261 ? -0.404  11.702  184.717 1.00 0.00 ?  261 ASP A CB   1  
ATOM 4068   C CG   . ASP A 1 261 ? 1.054   11.462  185.082 1.00 0.00 ?  261 ASP A CG   1  
ATOM 4069   O OD1  . ASP A 1 261 ? 1.444   11.812  186.228 1.00 0.00 ?  261 ASP A OD1  1  
ATOM 4070   O OD2  . ASP A 1 261 ? 1.792   10.907  184.226 1.00 0.00 -1 261 ASP A OD2  1  
ATOM 4071   H H    . ASP A 1 261 ? -1.515  9.807   186.181 1.00 0.00 ?  261 ASP A H    1  
ATOM 4072   H HA   . ASP A 1 261 ? -0.841  12.610  186.609 1.00 0.00 ?  261 ASP A HA   1  
ATOM 4073   H HB2  . ASP A 1 261 ? -0.770  10.837  184.124 1.00 0.00 ?  261 ASP A HB2  1  
ATOM 4074   H HB3  . ASP A 1 261 ? -0.470  12.614  184.088 1.00 0.00 ?  261 ASP A HB3  1  
ATOM 4075   N N    . GLU A 1 262 ? -3.787  11.686  185.780 1.00 0.00 ?  262 GLU A N    1  
ATOM 4076   C CA   . GLU A 1 262 ? -5.146  12.124  185.327 1.00 0.00 ?  262 GLU A CA   1  
ATOM 4077   C C    . GLU A 1 262 ? -5.302  11.797  183.847 1.00 0.00 ?  262 GLU A C    1  
ATOM 4078   O O    . GLU A 1 262 ? -6.400  11.551  183.346 1.00 0.00 ?  262 GLU A O    1  
ATOM 4079   C CB   . GLU A 1 262 ? -5.479  13.622  185.538 1.00 0.00 ?  262 GLU A CB   1  
ATOM 4080   C CG   . GLU A 1 262 ? -6.966  13.938  185.336 1.00 0.00 ?  262 GLU A CG   1  
ATOM 4081   C CD   . GLU A 1 262 ? -7.774  13.268  186.441 1.00 0.00 ?  262 GLU A CD   1  
ATOM 4082   O OE1  . GLU A 1 262 ? -8.986  13.015  186.211 1.00 0.00 ?  262 GLU A OE1  1  
ATOM 4083   O OE2  . GLU A 1 262 ? -7.202  13.022  187.536 1.00 0.00 -1 262 GLU A OE2  1  
ATOM 4084   H H    . GLU A 1 262 ? -3.766  10.842  186.312 1.00 0.00 ?  262 GLU A H    1  
ATOM 4085   H HA   . GLU A 1 262 ? -5.854  11.515  185.874 1.00 0.00 ?  262 GLU A HA   1  
ATOM 4086   H HB2  . GLU A 1 262 ? -5.182  13.915  186.568 1.00 0.00 ?  262 GLU A HB2  1  
ATOM 4087   H HB3  . GLU A 1 262 ? -4.885  14.229  184.825 1.00 0.00 ?  262 GLU A HB3  1  
ATOM 4088   H HG2  . GLU A 1 262 ? -7.127  15.038  185.371 1.00 0.00 ?  262 GLU A HG2  1  
ATOM 4089   H HG3  . GLU A 1 262 ? -7.306  13.555  184.351 1.00 0.00 ?  262 GLU A HG3  1  
ATOM 4090   N N    . THR A 1 263 ? -4.152  11.778  183.159 1.00 0.00 ?  263 THR A N    1  
ATOM 4091   C CA   . THR A 1 263 ? -3.965  11.418  181.777 1.00 0.00 ?  263 THR A CA   1  
ATOM 4092   C C    . THR A 1 263 ? -4.018  9.934   181.808 1.00 0.00 ?  263 THR A C    1  
ATOM 4093   O O    . THR A 1 263 ? -4.432  9.394   182.829 1.00 0.00 ?  263 THR A O    1  
ATOM 4094   C CB   . THR A 1 263 ? -2.655  11.859  181.183 1.00 0.00 ?  263 THR A CB   1  
ATOM 4095   O OG1  . THR A 1 263 ? -1.568  11.219  181.837 1.00 0.00 ?  263 THR A OG1  1  
ATOM 4096   C CG2  . THR A 1 263 ? -2.543  13.383  181.334 1.00 0.00 ?  263 THR A CG2  1  
ATOM 4097   H H    . THR A 1 263 ? -3.304  12.033  183.618 1.00 0.00 ?  263 THR A H    1  
ATOM 4098   H HA   . THR A 1 263 ? -4.805  11.799  181.215 1.00 0.00 ?  263 THR A HA   1  
ATOM 4099   H HB   . THR A 1 263 ? -2.623  11.608  180.103 1.00 0.00 ?  263 THR A HB   1  
ATOM 4100   H HG1  . THR A 1 263 ? -1.277  11.825  182.521 1.00 0.00 ?  263 THR A HG1  1  
ATOM 4101   H HG21 . THR A 1 263 ? -3.553  13.836  181.423 1.00 0.00 ?  263 THR A HG21 1  
ATOM 4102   H HG22 . THR A 1 263 ? -2.034  13.822  180.449 1.00 0.00 ?  263 THR A HG22 1  
ATOM 4103   H HG23 . THR A 1 263 ? -1.959  13.640  182.243 1.00 0.00 ?  263 THR A HG23 1  
ATOM 4104   N N    . THR A 1 264 ? -3.768  9.222   180.673 1.00 0.00 ?  264 THR A N    1  
ATOM 4105   C CA   . THR A 1 264 ? -3.853  7.781   180.741 1.00 0.00 ?  264 THR A CA   1  
ATOM 4106   C C    . THR A 1 264 ? -2.984  7.475   181.905 1.00 0.00 ?  264 THR A C    1  
ATOM 4107   O O    . THR A 1 264 ? -1.824  7.865   181.974 1.00 0.00 ?  264 THR A O    1  
ATOM 4108   C CB   . THR A 1 264 ? -3.276  7.085   179.540 1.00 0.00 ?  264 THR A CB   1  
ATOM 4109   O OG1  . THR A 1 264 ? -3.920  7.535   178.358 1.00 0.00 ?  264 THR A OG1  1  
ATOM 4110   C CG2  . THR A 1 264 ? -3.468  5.572   179.710 1.00 0.00 ?  264 THR A CG2  1  
ATOM 4111   H H    . THR A 1 264 ? -3.531  9.636   179.798 1.00 0.00 ?  264 THR A H    1  
ATOM 4112   H HA   . THR A 1 264 ? -4.875  7.491   180.938 1.00 0.00 ?  264 THR A HA   1  
ATOM 4113   H HB   . THR A 1 264 ? -2.189  7.298   179.462 1.00 0.00 ?  264 THR A HB   1  
ATOM 4114   H HG1  . THR A 1 264 ? -3.643  8.446   178.235 1.00 0.00 ?  264 THR A HG1  1  
ATOM 4115   H HG21 . THR A 1 264 ? -2.518  5.096   180.036 1.00 0.00 ?  264 THR A HG21 1  
ATOM 4116   H HG22 . THR A 1 264 ? -3.784  5.113   178.750 1.00 0.00 ?  264 THR A HG22 1  
ATOM 4117   H HG23 . THR A 1 264 ? -4.247  5.369   180.474 1.00 0.00 ?  264 THR A HG23 1  
ATOM 4118   N N    . ALA A 1 265 ? -3.574  6.721   182.854 1.00 0.00 ?  265 ALA A N    1  
ATOM 4119   C CA   . ALA A 1 265 ? -2.965  6.578   184.134 1.00 0.00 ?  265 ALA A CA   1  
ATOM 4120   C C    . ALA A 1 265 ? -1.818  5.662   184.133 1.00 0.00 ?  265 ALA A C    1  
ATOM 4121   O O    . ALA A 1 265 ? -1.920  4.458   183.918 1.00 0.00 ?  265 ALA A O    1  
ATOM 4122   C CB   . ALA A 1 265 ? -3.946  6.076   185.202 1.00 0.00 ?  265 ALA A CB   1  
ATOM 4123   H H    . ALA A 1 265 ? -4.435  6.235   182.704 1.00 0.00 ?  265 ALA A H    1  
ATOM 4124   H HA   . ALA A 1 265 ? -2.615  7.555   184.419 1.00 0.00 ?  265 ALA A HA   1  
ATOM 4125   H HB1  . ALA A 1 265 ? -4.071  4.975   185.124 1.00 0.00 ?  265 ALA A HB1  1  
ATOM 4126   H HB2  . ALA A 1 265 ? -4.940  6.556   185.070 1.00 0.00 ?  265 ALA A HB2  1  
ATOM 4127   H HB3  . ALA A 1 265 ? -3.568  6.319   186.218 1.00 0.00 ?  265 ALA A HB3  1  
ATOM 4128   N N    . GLN A 1 266 ? -0.676  6.291   184.429 1.00 0.00 ?  266 GLN A N    1  
ATOM 4129   C CA   . GLN A 1 266 ? 0.553   5.613   184.590 1.00 0.00 ?  266 GLN A CA   1  
ATOM 4130   C C    . GLN A 1 266 ? 1.079   6.224   185.840 1.00 0.00 ?  266 GLN A C    1  
ATOM 4131   O O    . GLN A 1 266 ? 0.808   7.401   186.104 1.00 0.00 ?  266 GLN A O    1  
ATOM 4132   C CB   . GLN A 1 266 ? 1.595   5.854   183.480 1.00 0.00 ?  266 GLN A CB   1  
ATOM 4133   C CG   . GLN A 1 266 ? 1.163   5.336   182.108 1.00 0.00 ?  266 GLN A CG   1  
ATOM 4134   C CD   . GLN A 1 266 ? 2.307   5.597   181.136 1.00 0.00 ?  266 GLN A CD   1  
ATOM 4135   O OE1  . GLN A 1 266 ? 3.475   5.370   181.459 1.00 0.00 ?  266 GLN A OE1  1  
ATOM 4136   N NE2  . GLN A 1 266 ? 1.971   6.092   179.913 1.00 0.00 ?  266 GLN A NE2  1  
ATOM 4137   H H    . GLN A 1 266 ? -0.642  7.281   184.550 1.00 0.00 ?  266 GLN A H    1  
ATOM 4138   H HA   . GLN A 1 266 ? 0.356   4.562   184.740 1.00 0.00 ?  266 GLN A HA   1  
ATOM 4139   H HB2  . GLN A 1 266 ? 1.794   6.945   183.406 1.00 0.00 ?  266 GLN A HB2  1  
ATOM 4140   H HB3  . GLN A 1 266 ? 2.544   5.354   183.767 1.00 0.00 ?  266 GLN A HB3  1  
ATOM 4141   H HG2  . GLN A 1 266 ? 0.951   4.244   182.158 1.00 0.00 ?  266 GLN A HG2  1  
ATOM 4142   H HG3  . GLN A 1 266 ? 0.255   5.871   181.760 1.00 0.00 ?  266 GLN A HG3  1  
ATOM 4143   H HE21 . GLN A 1 266 ? 1.012   6.267   179.691 1.00 0.00 ?  266 GLN A HE21 1  
ATOM 4144   H HE22 . GLN A 1 266 ? 2.684   6.283   179.233 1.00 0.00 ?  266 GLN A HE22 1  
ATOM 4145   N N    . VAL A 1 267 ? 1.842   5.461   186.643 1.00 0.00 ?  267 VAL A N    1  
ATOM 4146   C CA   . VAL A 1 267 ? 2.378   6.022   187.851 1.00 0.00 ?  267 VAL A CA   1  
ATOM 4147   C C    . VAL A 1 267 ? 3.705   6.584   187.471 1.00 0.00 ?  267 VAL A C    1  
ATOM 4148   O O    . VAL A 1 267 ? 4.652   5.853   187.188 1.00 0.00 ?  267 VAL A O    1  
ATOM 4149   C CB   . VAL A 1 267 ? 2.555   5.023   188.976 1.00 0.00 ?  267 VAL A CB   1  
ATOM 4150   C CG1  . VAL A 1 267 ? 3.012   3.665   188.401 1.00 0.00 ?  267 VAL A CG1  1  
ATOM 4151   C CG2  . VAL A 1 267 ? 3.554   5.605   190.000 1.00 0.00 ?  267 VAL A CG2  1  
ATOM 4152   H H    . VAL A 1 267 ? 2.060   4.508   186.446 1.00 0.00 ?  267 VAL A H    1  
ATOM 4153   H HA   . VAL A 1 267 ? 1.730   6.828   188.162 1.00 0.00 ?  267 VAL A HA   1  
ATOM 4154   H HB   . VAL A 1 267 ? 1.582   4.873   189.489 1.00 0.00 ?  267 VAL A HB   1  
ATOM 4155   H HG11 . VAL A 1 267 ? 3.709   3.164   189.107 1.00 0.00 ?  267 VAL A HG11 1  
ATOM 4156   H HG12 . VAL A 1 267 ? 3.530   3.797   187.430 1.00 0.00 ?  267 VAL A HG12 1  
ATOM 4157   H HG13 . VAL A 1 267 ? 2.135   3.001   188.244 1.00 0.00 ?  267 VAL A HG13 1  
ATOM 4158   H HG21 . VAL A 1 267 ? 4.599   5.413   189.672 1.00 0.00 ?  267 VAL A HG21 1  
ATOM 4159   H HG22 . VAL A 1 267 ? 3.404   5.134   190.994 1.00 0.00 ?  267 VAL A HG22 1  
ATOM 4160   H HG23 . VAL A 1 267 ? 3.409   6.702   190.102 1.00 0.00 ?  267 VAL A HG23 1  
ATOM 4161   N N    . MET A 1 268 ? 3.791   7.930   187.462 1.00 0.00 ?  268 MET A N    1  
ATOM 4162   C CA   . MET A 1 268 ? 5.010   8.586   187.081 1.00 0.00 ?  268 MET A CA   1  
ATOM 4163   C C    . MET A 1 268 ? 5.702   8.969   188.340 1.00 0.00 ?  268 MET A C    1  
ATOM 4164   O O    . MET A 1 268 ? 5.114   9.619   189.191 1.00 0.00 ?  268 MET A O    1  
ATOM 4165   C CB   . MET A 1 268 ? 4.762   9.860   186.259 1.00 0.00 ?  268 MET A CB   1  
ATOM 4166   C CG   . MET A 1 268 ? 6.056   10.550  185.835 1.00 0.00 ?  268 MET A CG   1  
ATOM 4167   S SD   . MET A 1 268 ? 5.759   11.967  184.738 1.00 0.00 ?  268 MET A SD   1  
ATOM 4168   C CE   . MET A 1 268 ? 5.044   13.026  186.028 1.00 0.00 ?  268 MET A CE   1  
ATOM 4169   H H    . MET A 1 268 ? 3.024   8.520   187.712 1.00 0.00 ?  268 MET A H    1  
ATOM 4170   H HA   . MET A 1 268 ? 5.620   7.890   186.530 1.00 0.00 ?  268 MET A HA   1  
ATOM 4171   H HB2  . MET A 1 268 ? 4.177   9.596   185.352 1.00 0.00 ?  268 MET A HB2  1  
ATOM 4172   H HB3  . MET A 1 268 ? 4.158   10.569  186.863 1.00 0.00 ?  268 MET A HB3  1  
ATOM 4173   H HG2  . MET A 1 268 ? 6.593   10.888  186.747 1.00 0.00 ?  268 MET A HG2  1  
ATOM 4174   H HG3  . MET A 1 268 ? 6.701   9.809   185.319 1.00 0.00 ?  268 MET A HG3  1  
ATOM 4175   H HE1  . MET A 1 268 ? 3.939   12.916  186.064 1.00 0.00 ?  268 MET A HE1  1  
ATOM 4176   H HE2  . MET A 1 268 ? 5.277   14.096  185.837 1.00 0.00 ?  268 MET A HE2  1  
ATOM 4177   H HE3  . MET A 1 268 ? 5.449   12.760  187.028 1.00 0.00 ?  268 MET A HE3  1  
ATOM 4178   N N    . GLN A 1 269 ? 6.993   8.579   188.455 1.00 0.00 ?  269 GLN A N    1  
ATOM 4179   C CA   . GLN A 1 269 ? 7.768   8.855   189.643 1.00 0.00 ?  269 GLN A CA   1  
ATOM 4180   C C    . GLN A 1 269 ? 8.900   9.751   189.250 1.00 0.00 ?  269 GLN A C    1  
ATOM 4181   O O    . GLN A 1 269 ? 9.171   9.940   188.066 1.00 0.00 ?  269 GLN A O    1  
ATOM 4182   C CB   . GLN A 1 269 ? 8.418   7.603   190.270 1.00 0.00 ?  269 GLN A CB   1  
ATOM 4183   C CG   . GLN A 1 269 ? 7.993   6.281   189.603 1.00 0.00 ?  269 GLN A CG   1  
ATOM 4184   C CD   . GLN A 1 269 ? 8.705   6.139   188.255 1.00 0.00 ?  269 GLN A CD   1  
ATOM 4185   O OE1  . GLN A 1 269 ? 8.073   5.891   187.233 1.00 0.00 ?  269 GLN A OE1  1  
ATOM 4186   N NE2  . GLN A 1 269 ? 10.053  6.288   188.251 1.00 0.00 ?  269 GLN A NE2  1  
ATOM 4187   H H    . GLN A 1 269 ? 7.465   8.086   187.729 1.00 0.00 ?  269 GLN A H    1  
ATOM 4188   H HA   . GLN A 1 269 ? 7.139   9.356   190.358 1.00 0.00 ?  269 GLN A HA   1  
ATOM 4189   H HB2  . GLN A 1 269 ? 9.521   7.706   190.215 1.00 0.00 ?  269 GLN A HB2  1  
ATOM 4190   H HB3  . GLN A 1 269 ? 8.139   7.560   191.345 1.00 0.00 ?  269 GLN A HB3  1  
ATOM 4191   H HG2  . GLN A 1 269 ? 8.269   5.424   190.257 1.00 0.00 ?  269 GLN A HG2  1  
ATOM 4192   H HG3  . GLN A 1 269 ? 6.896   6.268   189.440 1.00 0.00 ?  269 GLN A HG3  1  
ATOM 4193   H HE21 . GLN A 1 269 ? 10.537  6.477   189.104 1.00 0.00 ?  269 GLN A HE21 1  
ATOM 4194   H HE22 . GLN A 1 269 ? 10.563  6.210   187.393 1.00 0.00 ?  269 GLN A HE22 1  
ATOM 4195   N N    . ALA A 1 270 ? 9.601   10.319  190.262 1.00 0.00 ?  270 ALA A N    1  
ATOM 4196   C CA   . ALA A 1 270 ? 10.722  11.181  189.983 1.00 0.00 ?  270 ALA A CA   1  
ATOM 4197   C C    . ALA A 1 270 ? 11.722  10.983  191.086 1.00 0.00 ?  270 ALA A C    1  
ATOM 4198   O O    . ALA A 1 270 ? 11.341  10.787  192.241 1.00 0.00 ?  270 ALA A O    1  
ATOM 4199   C CB   . ALA A 1 270 ? 10.349  12.670  189.947 1.00 0.00 ?  270 ALA A CB   1  
ATOM 4200   H H    . ALA A 1 270 ? 9.374   10.176  191.221 1.00 0.00 ?  270 ALA A H    1  
ATOM 4201   H HA   . ALA A 1 270 ? 11.157  10.873  189.045 1.00 0.00 ?  270 ALA A HA   1  
ATOM 4202   H HB1  . ALA A 1 270 ? 9.350   12.825  190.407 1.00 0.00 ?  270 ALA A HB1  1  
ATOM 4203   H HB2  . ALA A 1 270 ? 10.319  13.036  188.898 1.00 0.00 ?  270 ALA A HB2  1  
ATOM 4204   H HB3  . ALA A 1 270 ? 11.096  13.269  190.511 1.00 0.00 ?  270 ALA A HB3  1  
ATOM 4205   N N    . ARG A 1 271 ? 13.039  11.063  190.735 1.00 0.00 ?  271 ARG A N    1  
ATOM 4206   C CA   . ARG A 1 271 ? 14.103  10.879  191.706 1.00 0.00 ?  271 ARG A CA   1  
ATOM 4207   C C    . ARG A 1 271 ? 14.958  12.098  191.684 1.00 0.00 ?  271 ARG A C    1  
ATOM 4208   O O    . ARG A 1 271 ? 15.395  12.540  190.623 1.00 0.00 ?  271 ARG A O    1  
ATOM 4209   C CB   . ARG A 1 271 ? 14.992  9.655   191.408 1.00 0.00 ?  271 ARG A CB   1  
ATOM 4210   C CG   . ARG A 1 271 ? 16.133  9.470   192.420 1.00 0.00 ?  271 ARG A CG   1  
ATOM 4211   C CD   . ARG A 1 271 ? 17.043  8.290   192.069 1.00 0.00 ?  271 ARG A CD   1  
ATOM 4212   N NE   . ARG A 1 271 ? 16.273  7.024   192.238 1.00 0.00 ?  271 ARG A NE   1  
ATOM 4213   C CZ   . ARG A 1 271 ? 16.181  6.430   193.467 1.00 0.00 ?  271 ARG A CZ   1  
ATOM 4214   N NH1  . ARG A 1 271 ? 16.765  7.008   194.558 1.00 0.00 1  271 ARG A NH1  1  
ATOM 4215   N NH2  . ARG A 1 271 ? 15.498  5.258   193.607 1.00 0.00 ?  271 ARG A NH2  1  
ATOM 4216   H H    . ARG A 1 271 ? 13.327  11.250  189.799 1.00 0.00 ?  271 ARG A H    1  
ATOM 4217   H HA   . ARG A 1 271 ? 13.654  10.785  192.682 1.00 0.00 ?  271 ARG A HA   1  
ATOM 4218   H HB2  . ARG A 1 271 ? 14.357  8.741   191.412 1.00 0.00 ?  271 ARG A HB2  1  
ATOM 4219   H HB3  . ARG A 1 271 ? 15.422  9.762   190.396 1.00 0.00 ?  271 ARG A HB3  1  
ATOM 4220   H HG2  . ARG A 1 271 ? 16.749  10.392  192.458 1.00 0.00 ?  271 ARG A HG2  1  
ATOM 4221   H HG3  . ARG A 1 271 ? 15.700  9.306   193.430 1.00 0.00 ?  271 ARG A HG3  1  
ATOM 4222   H HD2  . ARG A 1 271 ? 17.378  8.354   191.011 1.00 0.00 ?  271 ARG A HD2  1  
ATOM 4223   H HD3  . ARG A 1 271 ? 17.928  8.254   192.739 1.00 0.00 ?  271 ARG A HD3  1  
ATOM 4224   H HE   . ARG A 1 271 ? 15.831  6.601   191.446 1.00 0.00 ?  271 ARG A HE   1  
ATOM 4225   H HH11 . ARG A 1 271 ? 17.263  7.871   194.460 1.00 0.00 ?  271 ARG A HH11 1  
ATOM 4226   H HH12 . ARG A 1 271 ? 16.694  6.571   195.454 1.00 0.00 ?  271 ARG A HH12 1  
ATOM 4227   H HH21 . ARG A 1 271 ? 15.062  4.835   192.813 1.00 0.00 ?  271 ARG A HH21 1  
ATOM 4228   H HH22 . ARG A 1 271 ? 15.444  4.815   194.502 1.00 0.00 ?  271 ARG A HH22 1  
ATOM 4229   N N    . HIS A 1 272 ? 15.210  12.690  192.876 1.00 0.00 ?  272 HIS A N    1  
ATOM 4230   C CA   . HIS A 1 272 ? 16.055  13.845  192.921 1.00 0.00 ?  272 HIS A CA   1  
ATOM 4231   C C    . HIS A 1 272 ? 16.723  13.843  194.265 1.00 0.00 ?  272 HIS A C    1  
ATOM 4232   O O    . HIS A 1 272 ? 16.058  13.749  195.304 1.00 0.00 ?  272 HIS A O    1  
ATOM 4233   C CB   . HIS A 1 272 ? 15.299  15.166  192.748 1.00 0.00 ?  272 HIS A CB   1  
ATOM 4234   C CG   . HIS A 1 272 ? 16.180  16.287  192.285 1.00 0.00 ?  272 HIS A CG   1  
ATOM 4235   N ND1  . HIS A 1 272 ? 17.110  16.847  193.143 1.00 0.00 ?  272 HIS A ND1  1  
ATOM 4236   C CD2  . HIS A 1 272 ? 16.226  16.893  191.068 1.00 0.00 ?  272 HIS A CD2  1  
ATOM 4237   C CE1  . HIS A 1 272 ? 17.699  17.787  192.424 1.00 0.00 ?  272 HIS A CE1  1  
ATOM 4238   N NE2  . HIS A 1 272 ? 17.202  17.857  191.165 1.00 0.00 ?  272 HIS A NE2  1  
ATOM 4239   H H    . HIS A 1 272 ? 14.828  12.366  193.741 1.00 0.00 ?  272 HIS A H    1  
ATOM 4240   H HA   . HIS A 1 272 ? 16.806  13.734  192.154 1.00 0.00 ?  272 HIS A HA   1  
ATOM 4241   H HB2  . HIS A 1 272 ? 14.489  15.040  191.997 1.00 0.00 ?  272 HIS A HB2  1  
ATOM 4242   H HB3  . HIS A 1 272 ? 14.844  15.469  193.715 1.00 0.00 ?  272 HIS A HB3  1  
ATOM 4243   H HD2  . HIS A 1 272 ? 15.658  16.692  190.168 1.00 0.00 ?  272 HIS A HD2  1  
ATOM 4244   H HE1  . HIS A 1 272 ? 18.493  18.443  192.779 1.00 0.00 ?  272 HIS A HE1  1  
ATOM 4245   H HE2  . HIS A 1 272 ? 17.478  18.484  190.437 1.00 0.00 ?  272 HIS A HE2  1  
ATOM 4246   N N    . ALA A 1 273 ? 18.074  13.964  194.258 1.00 0.00 ?  273 ALA A N    1  
ATOM 4247   C CA   . ALA A 1 273 ? 18.838  13.957  195.483 1.00 0.00 ?  273 ALA A CA   1  
ATOM 4248   C C    . ALA A 1 273 ? 19.582  15.251  195.568 1.00 0.00 ?  273 ALA A C    1  
ATOM 4249   O O    . ALA A 1 273 ? 19.928  15.843  194.546 1.00 0.00 ?  273 ALA A O    1  
ATOM 4250   C CB   . ALA A 1 273 ? 19.874  12.822  195.539 1.00 0.00 ?  273 ALA A CB   1  
ATOM 4251   H H    . ALA A 1 273 ? 18.595  14.063  193.414 1.00 0.00 ?  273 ALA A H    1  
ATOM 4252   H HA   . ALA A 1 273 ? 18.156  13.883  196.312 1.00 0.00 ?  273 ALA A HA   1  
ATOM 4253   H HB1  . ALA A 1 273 ? 20.883  13.208  195.276 1.00 0.00 ?  273 ALA A HB1  1  
ATOM 4254   H HB2  . ALA A 1 273 ? 19.604  12.018  194.823 1.00 0.00 ?  273 ALA A HB2  1  
ATOM 4255   H HB3  . ALA A 1 273 ? 19.915  12.389  196.560 1.00 0.00 ?  273 ALA A HB3  1  
ATOM 4256   N N    . TRP A 1 274 ? 19.831  15.721  196.816 1.00 0.00 ?  274 TRP A N    1  
ATOM 4257   C CA   . TRP A 1 274 ? 20.550  16.949  197.015 1.00 0.00 ?  274 TRP A CA   1  
ATOM 4258   C C    . TRP A 1 274 ? 21.653  16.680  197.992 1.00 0.00 ?  274 TRP A C    1  
ATOM 4259   O O    . TRP A 1 274 ? 21.490  15.936  198.961 1.00 0.00 ?  274 TRP A O    1  
ATOM 4260   C CB   . TRP A 1 274 ? 19.669  18.084  197.545 1.00 0.00 ?  274 TRP A CB   1  
ATOM 4261   C CG   . TRP A 1 274 ? 18.569  18.433  196.573 1.00 0.00 ?  274 TRP A CG   1  
ATOM 4262   C CD1  . TRP A 1 274 ? 18.603  19.326  195.543 1.00 0.00 ?  274 TRP A CD1  1  
ATOM 4263   C CD2  . TRP A 1 274 ? 17.248  17.859  196.558 1.00 0.00 ?  274 TRP A CD2  1  
ATOM 4264   N NE1  . TRP A 1 274 ? 17.405  19.333  194.886 1.00 0.00 ?  274 TRP A NE1  1  
ATOM 4265   C CE2  . TRP A 1 274 ? 16.559  18.450  195.502 1.00 0.00 ?  274 TRP A CE2  1  
ATOM 4266   C CE3  . TRP A 1 274 ? 16.638  16.925  197.340 1.00 0.00 ?  274 TRP A CE3  1  
ATOM 4267   C CZ2  . TRP A 1 274 ? 15.268  18.119  195.218 1.00 0.00 ?  274 TRP A CZ2  1  
ATOM 4268   C CZ3  . TRP A 1 274 ? 15.334  16.586  197.057 1.00 0.00 ?  274 TRP A CZ3  1  
ATOM 4269   C CH2  . TRP A 1 274 ? 14.655  17.175  196.009 1.00 0.00 ?  274 TRP A CH2  1  
ATOM 4270   H H    . TRP A 1 274 ? 19.522  15.247  197.634 1.00 0.00 ?  274 TRP A H    1  
ATOM 4271   H HA   . TRP A 1 274 ? 20.992  17.232  196.074 1.00 0.00 ?  274 TRP A HA   1  
ATOM 4272   H HB2  . TRP A 1 274 ? 19.214  17.779  198.512 1.00 0.00 ?  274 TRP A HB2  1  
ATOM 4273   H HB3  . TRP A 1 274 ? 20.290  18.986  197.718 1.00 0.00 ?  274 TRP A HB3  1  
ATOM 4274   H HD1  . TRP A 1 274 ? 19.459  19.928  195.275 1.00 0.00 ?  274 TRP A HD1  1  
ATOM 4275   H HE1  . TRP A 1 274 ? 17.183  19.888  194.114 1.00 0.00 ?  274 TRP A HE1  1  
ATOM 4276   H HE3  . TRP A 1 274 ? 17.150  16.452  198.165 1.00 0.00 ?  274 TRP A HE3  1  
ATOM 4277   H HZ2  . TRP A 1 274 ? 14.726  18.572  194.401 1.00 0.00 ?  274 TRP A HZ2  1  
ATOM 4278   H HZ3  . TRP A 1 274 ? 14.838  15.850  197.661 1.00 0.00 ?  274 TRP A HZ3  1  
ATOM 4279   H HH2  . TRP A 1 274 ? 13.633  16.892  195.808 1.00 0.00 ?  274 TRP A HH2  1  
ATOM 4280   N N    . GLU A 1 275 ? 22.809  17.330  197.748 1.00 0.00 ?  275 GLU A N    1  
ATOM 4281   C CA   . GLU A 1 275 ? 23.971  17.141  198.571 1.00 0.00 ?  275 GLU A CA   1  
ATOM 4282   C C    . GLU A 1 275 ? 23.782  17.856  199.872 1.00 0.00 ?  275 GLU A C    1  
ATOM 4283   O O    . GLU A 1 275 ? 22.918  18.714  200.020 1.00 0.00 ?  275 GLU A O    1  
ATOM 4284   C CB   . GLU A 1 275 ? 25.254  17.675  197.915 1.00 0.00 ?  275 GLU A CB   1  
ATOM 4285   C CG   . GLU A 1 275 ? 25.576  16.984  196.585 1.00 0.00 ?  275 GLU A CG   1  
ATOM 4286   C CD   . GLU A 1 275 ? 25.949  15.529  196.854 1.00 0.00 ?  275 GLU A CD   1  
ATOM 4287   O OE1  . GLU A 1 275 ? 25.823  14.706  195.907 1.00 0.00 ?  275 GLU A OE1  1  
ATOM 4288   O OE2  . GLU A 1 275 ? 26.393  15.223  197.994 1.00 0.00 -1 275 GLU A OE2  1  
ATOM 4289   H H    . GLU A 1 275 ? 22.907  17.967  196.988 1.00 0.00 ?  275 GLU A H    1  
ATOM 4290   H HA   . GLU A 1 275 ? 24.066  16.085  198.761 1.00 0.00 ?  275 GLU A HA   1  
ATOM 4291   H HB2  . GLU A 1 275 ? 25.129  18.763  197.732 1.00 0.00 ?  275 GLU A HB2  1  
ATOM 4292   H HB3  . GLU A 1 275 ? 26.108  17.536  198.612 1.00 0.00 ?  275 GLU A HB3  1  
ATOM 4293   H HG2  . GLU A 1 275 ? 24.690  17.024  195.913 1.00 0.00 ?  275 GLU A HG2  1  
ATOM 4294   H HG3  . GLU A 1 275 ? 26.428  17.493  196.088 1.00 0.00 ?  275 GLU A HG3  1  
ATOM 4295   N N    . HIS A 1 276 ? 24.605  17.475  200.868 1.00 0.00 ?  276 HIS A N    1  
ATOM 4296   C CA   . HIS A 1 276 ? 24.516  18.071  202.169 1.00 0.00 ?  276 HIS A CA   1  
ATOM 4297   C C    . HIS A 1 276 ? 24.858  19.526  202.081 1.00 0.00 ?  276 HIS A C    1  
ATOM 4298   O O    . HIS A 1 276 ? 24.388  20.310  202.897 1.00 0.00 ?  276 HIS A O    1  
ATOM 4299   C CB   . HIS A 1 276 ? 25.497  17.449  203.172 1.00 0.00 ?  276 HIS A CB   1  
ATOM 4300   C CG   . HIS A 1 276 ? 26.927  17.793  202.880 1.00 0.00 ?  276 HIS A CG   1  
ATOM 4301   N ND1  . HIS A 1 276 ? 27.608  17.119  201.879 1.00 0.00 ?  276 HIS A ND1  1  
ATOM 4302   C CD2  . HIS A 1 276 ? 27.735  18.724  203.462 1.00 0.00 ?  276 HIS A CD2  1  
ATOM 4303   C CE1  . HIS A 1 276 ? 28.813  17.659  201.876 1.00 0.00 ?  276 HIS A CE1  1  
ATOM 4304   N NE2  . HIS A 1 276 ? 28.942  18.631  202.811 1.00 0.00 ?  276 HIS A NE2  1  
ATOM 4305   H H    . HIS A 1 276 ? 25.297  16.767  200.750 1.00 0.00 ?  276 HIS A H    1  
ATOM 4306   H HA   . HIS A 1 276 ? 23.503  17.959  202.518 1.00 0.00 ?  276 HIS A HA   1  
ATOM 4307   H HB2  . HIS A 1 276 ? 25.264  17.807  204.197 1.00 0.00 ?  276 HIS A HB2  1  
ATOM 4308   H HB3  . HIS A 1 276 ? 25.405  16.346  203.151 1.00 0.00 ?  276 HIS A HB3  1  
ATOM 4309   H HD2  . HIS A 1 276 ? 27.530  19.418  204.267 1.00 0.00 ?  276 HIS A HD2  1  
ATOM 4310   H HE1  . HIS A 1 276 ? 29.627  17.373  201.209 1.00 0.00 ?  276 HIS A HE1  1  
ATOM 4311   H HE2  . HIS A 1 276 ? 29.754  19.184  203.001 1.00 0.00 ?  276 HIS A HE2  1  
ATOM 4312   N N    . ASP A 1 277 ? 25.681  19.933  201.086 1.00 0.00 ?  277 ASP A N    1  
ATOM 4313   C CA   . ASP A 1 277 ? 26.047  21.322  200.994 1.00 0.00 ?  277 ASP A CA   1  
ATOM 4314   C C    . ASP A 1 277 ? 25.029  22.029  200.158 1.00 0.00 ?  277 ASP A C    1  
ATOM 4315   O O    . ASP A 1 277 ? 25.145  23.232  199.923 1.00 0.00 ?  277 ASP A O    1  
ATOM 4316   C CB   . ASP A 1 277 ? 27.450  21.569  200.392 1.00 0.00 ?  277 ASP A CB   1  
ATOM 4317   C CG   . ASP A 1 277 ? 27.597  21.087  198.950 1.00 0.00 ?  277 ASP A CG   1  
ATOM 4318   O OD1  . ASP A 1 277 ? 26.687  20.375  198.456 1.00 0.00 ?  277 ASP A OD1  1  
ATOM 4319   O OD2  . ASP A 1 277 ? 28.632  21.434  198.320 1.00 0.00 -1 277 ASP A OD2  1  
ATOM 4320   H H    . ASP A 1 277 ? 26.058  19.314  200.401 1.00 0.00 ?  277 ASP A H    1  
ATOM 4321   H HA   . ASP A 1 277 ? 26.010  21.731  201.992 1.00 0.00 ?  277 ASP A HA   1  
ATOM 4322   H HB2  . ASP A 1 277 ? 27.671  22.656  200.421 1.00 0.00 ?  277 ASP A HB2  1  
ATOM 4323   H HB3  . ASP A 1 277 ? 28.209  21.048  201.016 1.00 0.00 ?  277 ASP A HB3  1  
ATOM 4324   N N    . ASP A 1 278 ? 23.993  21.294  199.697 1.00 0.00 ?  278 ASP A N    1  
ATOM 4325   C CA   . ASP A 1 278 ? 22.973  21.911  198.898 1.00 0.00 ?  278 ASP A CA   1  
ATOM 4326   C C    . ASP A 1 278 ? 21.927  22.407  199.836 1.00 0.00 ?  278 ASP A C    1  
ATOM 4327   O O    . ASP A 1 278 ? 20.948  23.022  199.419 1.00 0.00 ?  278 ASP A O    1  
ATOM 4328   C CB   . ASP A 1 278 ? 22.303  20.980  197.873 1.00 0.00 ?  278 ASP A CB   1  
ATOM 4329   C CG   . ASP A 1 278 ? 23.252  20.611  196.742 1.00 0.00 ?  278 ASP A CG   1  
ATOM 4330   O OD1  . ASP A 1 278 ? 24.299  21.298  196.602 1.00 0.00 ?  278 ASP A OD1  1  
ATOM 4331   O OD2  . ASP A 1 278 ? 22.944  19.636  196.006 1.00 0.00 -1 278 ASP A OD2  1  
ATOM 4332   H H    . ASP A 1 278 ? 23.893  20.320  199.886 1.00 0.00 ?  278 ASP A H    1  
ATOM 4333   H HA   . ASP A 1 278 ? 23.418  22.755  198.394 1.00 0.00 ?  278 ASP A HA   1  
ATOM 4334   H HB2  . ASP A 1 278 ? 21.959  20.057  198.374 1.00 0.00 ?  278 ASP A HB2  1  
ATOM 4335   H HB3  . ASP A 1 278 ? 21.417  21.490  197.439 1.00 0.00 ?  278 ASP A HB3  1  
ATOM 4336   N N    . ILE A 1 279 ? 22.101  22.130  201.143 1.00 0.00 ?  279 ILE A N    1  
ATOM 4337   C CA   . ILE A 1 279 ? 21.149  22.616  202.092 1.00 0.00 ?  279 ILE A CA   1  
ATOM 4338   C C    . ILE A 1 279 ? 21.532  24.045  202.321 1.00 0.00 ?  279 ILE A C    1  
ATOM 4339   O O    . ILE A 1 279 ? 22.714  24.393  202.276 1.00 0.00 ?  279 ILE A O    1  
ATOM 4340   C CB   . ILE A 1 279 ? 21.140  21.873  203.409 1.00 0.00 ?  279 ILE A CB   1  
ATOM 4341   C CG1  . ILE A 1 279 ? 19.903  22.268  204.229 1.00 0.00 ?  279 ILE A CG1  1  
ATOM 4342   C CG2  . ILE A 1 279 ? 22.446  22.166  204.169 1.00 0.00 ?  279 ILE A CG2  1  
ATOM 4343   C CD1  . ILE A 1 279 ? 19.682  21.353  205.433 1.00 0.00 ?  279 ILE A CD1  1  
ATOM 4344   H H    . ILE A 1 279 ? 22.859  21.580  201.490 1.00 0.00 ?  279 ILE A H    1  
ATOM 4345   H HA   . ILE A 1 279 ? 20.173  22.582  201.628 1.00 0.00 ?  279 ILE A HA   1  
ATOM 4346   H HB   . ILE A 1 279 ? 21.092  20.780  203.212 1.00 0.00 ?  279 ILE A HB   1  
ATOM 4347   H HG12 . ILE A 1 279 ? 20.024  23.313  204.581 1.00 0.00 ?  279 ILE A HG12 1  
ATOM 4348   H HG13 . ILE A 1 279 ? 19.006  22.227  203.577 1.00 0.00 ?  279 ILE A HG13 1  
ATOM 4349   H HG21 . ILE A 1 279 ? 22.318  23.050  204.829 1.00 0.00 ?  279 ILE A HG21 1  
ATOM 4350   H HG22 . ILE A 1 279 ? 23.271  22.371  203.456 1.00 0.00 ?  279 ILE A HG22 1  
ATOM 4351   H HG23 . ILE A 1 279 ? 22.729  21.294  204.797 1.00 0.00 ?  279 ILE A HG23 1  
ATOM 4352   H HD11 . ILE A 1 279 ? 20.526  21.448  206.150 1.00 0.00 ?  279 ILE A HD11 1  
ATOM 4353   H HD12 . ILE A 1 279 ? 19.612  20.293  205.105 1.00 0.00 ?  279 ILE A HD12 1  
ATOM 4354   H HD13 . ILE A 1 279 ? 18.740  21.625  205.956 1.00 0.00 ?  279 ILE A HD13 1  
ATOM 4355   N N    . ARG A 1 280 ? 20.522  24.916  202.528 1.00 0.00 ?  280 ARG A N    1  
ATOM 4356   C CA   . ARG A 1 280 ? 20.777  26.317  202.729 1.00 0.00 ?  280 ARG A CA   1  
ATOM 4357   C C    . ARG A 1 280 ? 20.245  26.700  204.060 1.00 0.00 ?  280 ARG A C    1  
ATOM 4358   O O    . ARG A 1 280 ? 19.333  26.074  204.597 1.00 0.00 ?  280 ARG A O    1  
ATOM 4359   C CB   . ARG A 1 280 ? 20.110  27.227  201.685 1.00 0.00 ?  280 ARG A CB   1  
ATOM 4360   C CG   . ARG A 1 280 ? 20.620  26.975  200.267 1.00 0.00 ?  280 ARG A CG   1  
ATOM 4361   C CD   . ARG A 1 280 ? 22.079  27.407  200.090 1.00 0.00 ?  280 ARG A CD   1  
ATOM 4362   N NE   . ARG A 1 280 ? 22.441  27.277  198.652 1.00 0.00 ?  280 ARG A NE   1  
ATOM 4363   C CZ   . ARG A 1 280 ? 23.704  27.584  198.236 1.00 0.00 ?  280 ARG A CZ   1  
ATOM 4364   N NH1  . ARG A 1 280 ? 24.632  28.020  199.137 1.00 0.00 1  280 ARG A NH1  1  
ATOM 4365   N NH2  . ARG A 1 280 ? 24.040  27.457  196.919 1.00 0.00 ?  280 ARG A NH2  1  
ATOM 4366   H H    . ARG A 1 280 ? 19.570  24.634  202.537 1.00 0.00 ?  280 ARG A H    1  
ATOM 4367   H HA   . ARG A 1 280 ? 21.843  26.473  202.726 1.00 0.00 ?  280 ARG A HA   1  
ATOM 4368   H HB2  . ARG A 1 280 ? 19.011  27.064  201.711 1.00 0.00 ?  280 ARG A HB2  1  
ATOM 4369   H HB3  . ARG A 1 280 ? 20.306  28.287  201.953 1.00 0.00 ?  280 ARG A HB3  1  
ATOM 4370   H HG2  . ARG A 1 280 ? 20.533  25.892  200.038 1.00 0.00 ?  280 ARG A HG2  1  
ATOM 4371   H HG3  . ARG A 1 280 ? 19.985  27.532  199.546 1.00 0.00 ?  280 ARG A HG3  1  
ATOM 4372   H HD2  . ARG A 1 280 ? 22.218  28.468  200.392 1.00 0.00 ?  280 ARG A HD2  1  
ATOM 4373   H HD3  . ARG A 1 280 ? 22.759  26.754  200.677 1.00 0.00 ?  280 ARG A HD3  1  
ATOM 4374   H HE   . ARG A 1 280 ? 21.759  26.962  197.991 1.00 0.00 ?  280 ARG A HE   1  
ATOM 4375   H HH11 . ARG A 1 280 ? 24.385  28.116  200.102 1.00 0.00 ?  280 ARG A HH11 1  
ATOM 4376   H HH12 . ARG A 1 280 ? 25.557  28.246  198.833 1.00 0.00 ?  280 ARG A HH12 1  
ATOM 4377   H HH21 . ARG A 1 280 ? 23.360  27.139  196.258 1.00 0.00 ?  280 ARG A HH21 1  
ATOM 4378   H HH22 . ARG A 1 280 ? 24.966  27.682  196.615 1.00 0.00 ?  280 ARG A HH22 1  
ATOM 4379   N N    . TRP A 1 281 ? 20.828  27.781  204.603 1.00 0.00 ?  281 TRP A N    1  
ATOM 4380   C CA   . TRP A 1 281 ? 20.458  28.279  205.892 1.00 0.00 ?  281 TRP A CA   1  
ATOM 4381   C C    . TRP A 1 281 ? 19.067  28.839  205.815 1.00 0.00 ?  281 TRP A C    1  
ATOM 4382   O O    . TRP A 1 281 ? 18.460  28.926  204.752 1.00 0.00 ?  281 TRP A O    1  
ATOM 4383   C CB   . TRP A 1 281 ? 21.393  29.399  206.385 1.00 0.00 ?  281 TRP A CB   1  
ATOM 4384   C CG   . TRP A 1 281 ? 22.793  28.915  206.679 1.00 0.00 ?  281 TRP A CG   1  
ATOM 4385   C CD1  . TRP A 1 281 ? 23.878  28.913  205.851 1.00 0.00 ?  281 TRP A CD1  1  
ATOM 4386   C CD2  . TRP A 1 281 ? 23.247  28.357  207.931 1.00 0.00 ?  281 TRP A CD2  1  
ATOM 4387   N NE1  . TRP A 1 281 ? 24.966  28.395  206.497 1.00 0.00 ?  281 TRP A NE1  1  
ATOM 4388   C CE2  . TRP A 1 281 ? 24.598  28.049  207.773 1.00 0.00 ?  281 TRP A CE2  1  
ATOM 4389   C CE3  . TRP A 1 281 ? 22.619  28.111  209.119 1.00 0.00 ?  281 TRP A CE3  1  
ATOM 4390   C CZ2  . TRP A 1 281 ? 25.327  27.501  208.785 1.00 0.00 ?  281 TRP A CZ2  1  
ATOM 4391   C CZ3  . TRP A 1 281 ? 23.353  27.556  210.147 1.00 0.00 ?  281 TRP A CZ3  1  
ATOM 4392   C CH2  . TRP A 1 281 ? 24.692  27.255  209.982 1.00 0.00 ?  281 TRP A CH2  1  
ATOM 4393   H H    . TRP A 1 281 ? 21.546  28.285  204.130 1.00 0.00 ?  281 TRP A H    1  
ATOM 4394   H HA   . TRP A 1 281 ? 20.471  27.451  206.581 1.00 0.00 ?  281 TRP A HA   1  
ATOM 4395   H HB2  . TRP A 1 281 ? 21.450  30.193  205.611 1.00 0.00 ?  281 TRP A HB2  1  
ATOM 4396   H HB3  . TRP A 1 281 ? 20.976  29.848  207.311 1.00 0.00 ?  281 TRP A HB3  1  
ATOM 4397   H HD1  . TRP A 1 281 ? 23.878  29.268  204.831 1.00 0.00 ?  281 TRP A HD1  1  
ATOM 4398   H HE1  . TRP A 1 281 ? 25.858  28.289  206.115 1.00 0.00 ?  281 TRP A HE1  1  
ATOM 4399   H HE3  . TRP A 1 281 ? 21.573  28.339  209.268 1.00 0.00 ?  281 TRP A HE3  1  
ATOM 4400   H HZ2  . TRP A 1 281 ? 26.373  27.259  208.671 1.00 0.00 ?  281 TRP A HZ2  1  
ATOM 4401   H HZ3  . TRP A 1 281 ? 22.875  27.355  211.094 1.00 0.00 ?  281 TRP A HZ3  1  
ATOM 4402   H HH2  . TRP A 1 281 ? 25.246  26.821  210.801 1.00 0.00 ?  281 TRP A HH2  1  
ATOM 4403   N N    . HIS A 1 282 ? 18.564  29.261  206.988 1.00 0.00 ?  282 HIS A N    1  
ATOM 4404   C CA   . HIS A 1 282 ? 17.229  29.791  207.139 1.00 0.00 ?  282 HIS A CA   1  
ATOM 4405   C C    . HIS A 1 282 ? 17.061  31.112  206.428 1.00 0.00 ?  282 HIS A C    1  
ATOM 4406   O O    . HIS A 1 282 ? 15.939  31.594  206.308 1.00 0.00 ?  282 HIS A O    1  
ATOM 4407   C CB   . HIS A 1 282 ? 16.861  29.985  208.617 1.00 0.00 ?  282 HIS A CB   1  
ATOM 4408   C CG   . HIS A 1 282 ? 17.756  30.948  209.335 1.00 0.00 ?  282 HIS A CG   1  
ATOM 4409   N ND1  . HIS A 1 282 ? 19.058  30.579  209.638 1.00 0.00 ?  282 HIS A ND1  1  
ATOM 4410   C CD2  . HIS A 1 282 ? 17.494  32.197  209.799 1.00 0.00 ?  282 HIS A CD2  1  
ATOM 4411   C CE1  . HIS A 1 282 ? 19.555  31.619  210.281 1.00 0.00 ?  282 HIS A CE1  1  
ATOM 4412   N NE2  . HIS A 1 282 ? 18.653  32.622  210.405 1.00 0.00 ?  282 HIS A NE2  1  
ATOM 4413   H H    . HIS A 1 282 ? 19.098  29.213  207.827 1.00 0.00 ?  282 HIS A H    1  
ATOM 4414   H HA   . HIS A 1 282 ? 16.556  29.076  206.694 1.00 0.00 ?  282 HIS A HA   1  
ATOM 4415   H HB2  . HIS A 1 282 ? 15.822  30.369  208.696 1.00 0.00 ?  282 HIS A HB2  1  
ATOM 4416   H HB3  . HIS A 1 282 ? 16.919  29.010  209.146 1.00 0.00 ?  282 HIS A HB3  1  
ATOM 4417   H HD2  . HIS A 1 282 ? 16.584  32.782  209.749 1.00 0.00 ?  282 HIS A HD2  1  
ATOM 4418   H HE1  . HIS A 1 282 ? 20.569  31.688  210.674 1.00 0.00 ?  282 HIS A HE1  1  
ATOM 4419   H HE2  . HIS A 1 282 ? 18.790  33.507  210.849 1.00 0.00 ?  282 HIS A HE2  1  
ATOM 4420   N N    . HIS A 1 283 ? 18.159  31.739  205.950 1.00 0.00 ?  283 HIS A N    1  
ATOM 4421   C CA   . HIS A 1 283 ? 18.062  33.036  205.291 1.00 0.00 ?  283 HIS A CA   1  
ATOM 4422   C C    . HIS A 1 283 ? 17.198  32.961  204.045 1.00 0.00 ?  283 HIS A C    1  
ATOM 4423   O O    . HIS A 1 283 ? 16.725  33.986  203.558 1.00 0.00 ?  283 HIS A O    1  
ATOM 4424   C CB   . HIS A 1 283 ? 19.429  33.589  204.852 1.00 0.00 ?  283 HIS A CB   1  
ATOM 4425   C CG   . HIS A 1 283 ? 20.312  34.043  205.983 1.00 0.00 ?  283 HIS A CG   1  
ATOM 4426   N ND1  . HIS A 1 283 ? 21.646  34.328  205.732 1.00 0.00 ?  283 HIS A ND1  1  
ATOM 4427   C CD2  . HIS A 1 283 ? 20.017  34.274  207.297 1.00 0.00 ?  283 HIS A CD2  1  
ATOM 4428   C CE1  . HIS A 1 283 ? 22.126  34.727  206.896 1.00 0.00 ?  283 HIS A CE1  1  
ATOM 4429   N NE2  . HIS A 1 283 ? 21.188  34.713  207.871 1.00 0.00 ?  283 HIS A NE2  1  
ATOM 4430   H H    . HIS A 1 283 ? 19.073  31.349  206.029 1.00 0.00 ?  283 HIS A H    1  
ATOM 4431   H HA   . HIS A 1 283 ? 17.602  33.715  205.990 1.00 0.00 ?  283 HIS A HA   1  
ATOM 4432   H HB2  . HIS A 1 283 ? 19.983  32.805  204.294 1.00 0.00 ?  283 HIS A HB2  1  
ATOM 4433   H HB3  . HIS A 1 283 ? 19.275  34.457  204.175 1.00 0.00 ?  283 HIS A HB3  1  
ATOM 4434   H HD2  . HIS A 1 283 ? 19.086  34.158  207.837 1.00 0.00 ?  283 HIS A HD2  1  
ATOM 4435   H HE1  . HIS A 1 283 ? 23.157  35.035  207.076 1.00 0.00 ?  283 HIS A HE1  1  
ATOM 4436   H HE2  . HIS A 1 283 ? 21.308  34.976  208.829 1.00 0.00 ?  283 HIS A HE2  1  
ATOM 4437   N N    . ARG A 1 284 ? 16.982  31.754  203.491 1.00 0.00 ?  284 ARG A N    1  
ATOM 4438   C CA   . ARG A 1 284 ? 16.183  31.599  202.290 1.00 0.00 ?  284 ARG A CA   1  
ATOM 4439   C C    . ARG A 1 284 ? 14.709  31.756  202.592 1.00 0.00 ?  284 ARG A C    1  
ATOM 4440   O O    . ARG A 1 284 ? 13.887  31.677  201.678 1.00 0.00 ?  284 ARG A O    1  
ATOM 4441   C CB   . ARG A 1 284 ? 16.374  30.241  201.605 1.00 0.00 ?  284 ARG A CB   1  
ATOM 4442   C CG   . ARG A 1 284 ? 17.306  30.313  200.399 1.00 0.00 ?  284 ARG A CG   1  
ATOM 4443   C CD   . ARG A 1 284 ? 18.744  30.664  200.777 1.00 0.00 ?  284 ARG A CD   1  
ATOM 4444   N NE   . ARG A 1 284 ? 19.597  30.481  199.567 1.00 0.00 ?  284 ARG A NE   1  
ATOM 4445   C CZ   . ARG A 1 284 ? 20.911  30.852  199.593 1.00 0.00 ?  284 ARG A CZ   1  
ATOM 4446   N NH1  . ARG A 1 284 ? 21.412  31.489  200.691 1.00 0.00 1  284 ARG A NH1  1  
ATOM 4447   N NH2  . ARG A 1 284 ? 21.709  30.628  198.507 1.00 0.00 ?  284 ARG A NH2  1  
ATOM 4448   H H    . ARG A 1 284 ? 17.357  30.916  203.881 1.00 0.00 ?  284 ARG A H    1  
ATOM 4449   H HA   . ARG A 1 284 ? 16.477  32.387  201.615 1.00 0.00 ?  284 ARG A HA   1  
ATOM 4450   H HB2  . ARG A 1 284 ? 16.796  29.525  202.341 1.00 0.00 ?  284 ARG A HB2  1  
ATOM 4451   H HB3  . ARG A 1 284 ? 15.388  29.859  201.274 1.00 0.00 ?  284 ARG A HB3  1  
ATOM 4452   H HG2  . ARG A 1 284 ? 17.301  29.331  199.882 1.00 0.00 ?  284 ARG A HG2  1  
ATOM 4453   H HG3  . ARG A 1 284 ? 16.919  31.075  199.690 1.00 0.00 ?  284 ARG A HG3  1  
ATOM 4454   H HD2  . ARG A 1 284 ? 18.820  31.719  201.114 1.00 0.00 ?  284 ARG A HD2  1  
ATOM 4455   H HD3  . ARG A 1 284 ? 19.122  29.987  201.570 1.00 0.00 ?  284 ARG A HD3  1  
ATOM 4456   H HE   . ARG A 1 284 ? 19.209  30.074  198.740 1.00 0.00 ?  284 ARG A HE   1  
ATOM 4457   H HH11 . ARG A 1 284 ? 20.816  31.687  201.472 1.00 0.00 ?  284 ARG A HH11 1  
ATOM 4458   H HH12 . ARG A 1 284 ? 22.375  31.760  200.715 1.00 0.00 ?  284 ARG A HH12 1  
ATOM 4459   H HH21 . ARG A 1 284 ? 21.329  30.194  197.688 1.00 0.00 ?  284 ARG A HH21 1  
ATOM 4460   H HH22 . ARG A 1 284 ? 22.670  30.900  198.529 1.00 0.00 ?  284 ARG A HH22 1  
ATOM 4461   N N    . TYR A 1 285 ? 14.348  31.975  203.882 1.00 0.00 ?  285 TYR A N    1  
ATOM 4462   C CA   . TYR A 1 285 ? 12.954  32.078  204.312 1.00 0.00 ?  285 TYR A CA   1  
ATOM 4463   C C    . TYR A 1 285 ? 12.167  33.101  203.516 1.00 0.00 ?  285 TYR A C    1  
ATOM 4464   O O    . TYR A 1 285 ? 10.939  33.059  203.544 1.00 0.00 ?  285 TYR A O    1  
ATOM 4465   C CB   . TYR A 1 285 ? 12.814  32.496  205.795 1.00 0.00 ?  285 TYR A CB   1  
ATOM 4466   C CG   . TYR A 1 285 ? 13.011  33.960  206.041 1.00 0.00 ?  285 TYR A CG   1  
ATOM 4467   C CD1  . TYR A 1 285 ? 11.919  34.805  206.156 1.00 0.00 ?  285 TYR A CD1  1  
ATOM 4468   C CD2  . TYR A 1 285 ? 14.277  34.495  206.156 1.00 0.00 ?  285 TYR A CD2  1  
ATOM 4469   C CE1  . TYR A 1 285 ? 12.098  36.150  206.377 1.00 0.00 ?  285 TYR A CE1  1  
ATOM 4470   C CE2  . TYR A 1 285 ? 14.447  35.840  206.382 1.00 0.00 ?  285 TYR A CE2  1  
ATOM 4471   C CZ   . TYR A 1 285 ? 13.359  36.665  206.492 1.00 0.00 ?  285 TYR A CZ   1  
ATOM 4472   O OH   . TYR A 1 285 ? 13.539  38.041  206.707 1.00 0.00 ?  285 TYR A OH   1  
ATOM 4473   H H    . TYR A 1 285 ? 15.027  32.084  204.601 1.00 0.00 ?  285 TYR A H    1  
ATOM 4474   H HA   . TYR A 1 285 ? 12.506  31.104  204.167 1.00 0.00 ?  285 TYR A HA   1  
ATOM 4475   H HB2  . TYR A 1 285 ? 11.800  32.242  206.162 1.00 0.00 ?  285 TYR A HB2  1  
ATOM 4476   H HB3  . TYR A 1 285 ? 13.560  31.950  206.414 1.00 0.00 ?  285 TYR A HB3  1  
ATOM 4477   H HD1  . TYR A 1 285 ? 10.919  34.406  206.066 1.00 0.00 ?  285 TYR A HD1  1  
ATOM 4478   H HD2  . TYR A 1 285 ? 15.141  33.858  206.068 1.00 0.00 ?  285 TYR A HD2  1  
ATOM 4479   H HE1  . TYR A 1 285 ? 11.241  36.801  206.467 1.00 0.00 ?  285 TYR A HE1  1  
ATOM 4480   H HE2  . TYR A 1 285 ? 15.441  36.249  206.478 1.00 0.00 ?  285 TYR A HE2  1  
ATOM 4481   H HH   . TYR A 1 285 ? 13.307  38.240  207.617 1.00 0.00 ?  285 TYR A HH   1  
ATOM 4482   N N    . VAL A 1 286 ? 12.842  34.063  202.832 1.00 0.00 ?  286 VAL A N    1  
ATOM 4483   C CA   . VAL A 1 286 ? 12.143  35.093  202.077 1.00 0.00 ?  286 VAL A CA   1  
ATOM 4484   C C    . VAL A 1 286 ? 11.200  34.464  201.059 1.00 0.00 ?  286 VAL A C    1  
ATOM 4485   O O    . VAL A 1 286 ? 10.202  35.081  200.693 1.00 0.00 ?  286 VAL A O    1  
ATOM 4486   C CB   . VAL A 1 286 ? 13.093  36.045  201.391 1.00 0.00 ?  286 VAL A CB   1  
ATOM 4487   C CG1  . VAL A 1 286 ? 13.854  35.279  200.293 1.00 0.00 ?  286 VAL A CG1  1  
ATOM 4488   C CG2  . VAL A 1 286 ? 12.290  37.232  200.840 1.00 0.00 ?  286 VAL A CG2  1  
ATOM 4489   H H    . VAL A 1 286 ? 13.839  34.114  202.826 1.00 0.00 ?  286 VAL A H    1  
ATOM 4490   H HA   . VAL A 1 286 ? 11.544  35.639  202.794 1.00 0.00 ?  286 VAL A HA   1  
ATOM 4491   H HB   . VAL A 1 286 ? 13.828  36.427  202.131 1.00 0.00 ?  286 VAL A HB   1  
ATOM 4492   H HG11 . VAL A 1 286 ? 13.256  35.249  199.358 1.00 0.00 ?  286 VAL A HG11 1  
ATOM 4493   H HG12 . VAL A 1 286 ? 14.054  34.237  200.621 1.00 0.00 ?  286 VAL A HG12 1  
ATOM 4494   H HG13 . VAL A 1 286 ? 14.824  35.775  200.076 1.00 0.00 ?  286 VAL A HG13 1  
ATOM 4495   H HG21 . VAL A 1 286 ? 12.275  37.205  199.729 1.00 0.00 ?  286 VAL A HG21 1  
ATOM 4496   H HG22 . VAL A 1 286 ? 12.748  38.190  201.164 1.00 0.00 ?  286 VAL A HG22 1  
ATOM 4497   H HG23 . VAL A 1 286 ? 11.243  37.197  201.211 1.00 0.00 ?  286 VAL A HG23 1  
ATOM 4498   N N    . ASP A 1 287 ? 11.523  33.235  200.563 1.00 0.00 ?  287 ASP A N    1  
ATOM 4499   C CA   . ASP A 1 287 ? 10.649  32.510  199.648 1.00 0.00 ?  287 ASP A CA   1  
ATOM 4500   C C    . ASP A 1 287 ? 10.471  33.278  198.360 1.00 0.00 ?  287 ASP A C    1  
ATOM 4501   O O    . ASP A 1 287 ? 11.131  34.292  198.125 1.00 0.00 ?  287 ASP A O    1  
ATOM 4502   C CB   . ASP A 1 287 ? 9.247   32.237  200.237 1.00 0.00 ?  287 ASP A CB   1  
ATOM 4503   C CG   . ASP A 1 287 ? 8.647   30.906  199.784 1.00 0.00 ?  287 ASP A CG   1  
ATOM 4504   O OD1  . ASP A 1 287 ? 9.270   30.221  198.926 1.00 0.00 ?  287 ASP A OD1  1  
ATOM 4505   O OD2  . ASP A 1 287 ? 7.550   30.556  200.294 1.00 0.00 -1 287 ASP A OD2  1  
ATOM 4506   H H    . ASP A 1 287 ? 12.378  32.784  200.795 1.00 0.00 ?  287 ASP A H    1  
ATOM 4507   H HA   . ASP A 1 287 ? 11.145  31.577  199.429 1.00 0.00 ?  287 ASP A HA   1  
ATOM 4508   H HB2  . ASP A 1 287 ? 9.314   32.237  201.347 1.00 0.00 ?  287 ASP A HB2  1  
ATOM 4509   H HB3  . ASP A 1 287 ? 8.561   33.056  199.933 1.00 0.00 ?  287 ASP A HB3  1  
ATOM 4510   N N    . LEU A 1 288 ? 9.565   32.757  197.469 1.00 0.00 ?  288 LEU A N    1  
ATOM 4511   C CA   . LEU A 1 288 ? 9.315   33.397  196.195 1.00 0.00 ?  288 LEU A CA   1  
ATOM 4512   C C    . LEU A 1 288 ? 8.716   34.734  196.496 1.00 0.00 ?  288 LEU A C    1  
ATOM 4513   O O    . LEU A 1 288 ? 9.138   35.741  195.937 1.00 0.00 ?  288 LEU A O    1  
ATOM 4514   C CB   . LEU A 1 288 ? 8.313   32.635  195.294 1.00 0.00 ?  288 LEU A CB   1  
ATOM 4515   C CG   . LEU A 1 288 ? 8.135   33.272  193.893 1.00 0.00 ?  288 LEU A CG   1  
ATOM 4516   C CD1  . LEU A 1 288 ? 9.402   33.088  193.030 1.00 0.00 ?  288 LEU A CD1  1  
ATOM 4517   C CD2  . LEU A 1 288 ? 6.876   32.743  193.184 1.00 0.00 ?  288 LEU A CD2  1  
ATOM 4518   H H    . LEU A 1 288 ? 9.047   31.928  197.656 1.00 0.00 ?  288 LEU A H    1  
ATOM 4519   H HA   . LEU A 1 288 ? 10.264  33.533  195.698 1.00 0.00 ?  288 LEU A HA   1  
ATOM 4520   H HB2  . LEU A 1 288 ? 8.659   31.582  195.175 1.00 0.00 ?  288 LEU A HB2  1  
ATOM 4521   H HB3  . LEU A 1 288 ? 7.325   32.615  195.798 1.00 0.00 ?  288 LEU A HB3  1  
ATOM 4522   H HG   . LEU A 1 288 ? 7.995   34.366  194.035 1.00 0.00 ?  288 LEU A HG   1  
ATOM 4523   H HD11 . LEU A 1 288 ? 10.221  33.721  193.417 1.00 0.00 ?  288 LEU A HD11 1  
ATOM 4524   H HD12 . LEU A 1 288 ? 9.203   33.375  191.976 1.00 0.00 ?  288 LEU A HD12 1  
ATOM 4525   H HD13 . LEU A 1 288 ? 9.739   32.027  193.051 1.00 0.00 ?  288 LEU A HD13 1  
ATOM 4526   H HD21 . LEU A 1 288 ? 6.022   33.431  193.365 1.00 0.00 ?  288 LEU A HD21 1  
ATOM 4527   H HD22 . LEU A 1 288 ? 6.608   31.736  193.567 1.00 0.00 ?  288 LEU A HD22 1  
ATOM 4528   H HD23 . LEU A 1 288 ? 7.045   32.673  192.088 1.00 0.00 ?  288 LEU A HD23 1  
ATOM 4529   N N    . MET A 1 289 ? 7.736   34.747  197.441 1.00 0.00 ?  289 MET A N    1  
ATOM 4530   C CA   . MET A 1 289 ? 7.035   35.959  197.808 1.00 0.00 ?  289 MET A CA   1  
ATOM 4531   C C    . MET A 1 289 ? 6.339   36.518  196.589 1.00 0.00 ?  289 MET A C    1  
ATOM 4532   O O    . MET A 1 289 ? 6.964   37.119  195.713 1.00 0.00 ?  289 MET A O    1  
ATOM 4533   C CB   . MET A 1 289 ? 7.944   37.043  198.423 1.00 0.00 ?  289 MET A CB   1  
ATOM 4534   C CG   . MET A 1 289 ? 7.902   37.024  199.957 1.00 0.00 ?  289 MET A CG   1  
ATOM 4535   S SD   . MET A 1 289 ? 6.324   37.618  200.631 1.00 0.00 ?  289 MET A SD   1  
ATOM 4536   C CE   . MET A 1 289 ? 6.793   37.407  202.374 1.00 0.00 ?  289 MET A CE   1  
ATOM 4537   H H    . MET A 1 289 ? 7.476   33.924  197.939 1.00 0.00 ?  289 MET A H    1  
ATOM 4538   H HA   . MET A 1 289 ? 6.277   35.672  198.523 1.00 0.00 ?  289 MET A HA   1  
ATOM 4539   H HB2  . MET A 1 289 ? 8.997   36.873  198.091 1.00 0.00 ?  289 MET A HB2  1  
ATOM 4540   H HB3  . MET A 1 289 ? 7.623   38.043  198.065 1.00 0.00 ?  289 MET A HB3  1  
ATOM 4541   H HG2  . MET A 1 289 ? 8.075   35.981  200.299 1.00 0.00 ?  289 MET A HG2  1  
ATOM 4542   H HG3  . MET A 1 289 ? 8.735   37.649  200.346 1.00 0.00 ?  289 MET A HG3  1  
ATOM 4543   H HE1  . MET A 1 289 ? 6.427   36.434  202.768 1.00 0.00 ?  289 MET A HE1  1  
ATOM 4544   H HE2  . MET A 1 289 ? 6.358   38.213  203.000 1.00 0.00 ?  289 MET A HE2  1  
ATOM 4545   H HE3  . MET A 1 289 ? 7.899   37.437  202.492 1.00 0.00 ?  289 MET A HE3  1  
ATOM 4546   N N    . SER A 1 290 ? 4.990   36.345  196.539 1.00 0.00 ?  290 SER A N    1  
ATOM 4547   C CA   . SER A 1 290 ? 4.212   36.827  195.416 1.00 0.00 ?  290 SER A CA   1  
ATOM 4548   C C    . SER A 1 290 ? 4.375   38.315  195.318 1.00 0.00 ?  290 SER A C    1  
ATOM 4549   O O    . SER A 1 290 ? 4.320   39.022  196.321 1.00 0.00 ?  290 SER A O    1  
ATOM 4550   C CB   . SER A 1 290 ? 2.699   36.558  195.545 1.00 0.00 ?  290 SER A CB   1  
ATOM 4551   O OG   . SER A 1 290 ? 2.428   35.170  195.484 1.00 0.00 ?  290 SER A OG   1  
ATOM 4552   H H    . SER A 1 290 ? 4.487   35.884  197.263 1.00 0.00 ?  290 SER A H    1  
ATOM 4553   H HA   . SER A 1 290 ? 4.602   36.363  194.534 1.00 0.00 ?  290 SER A HA   1  
ATOM 4554   H HB2  . SER A 1 290 ? 2.328   36.945  196.519 1.00 0.00 ?  290 SER A HB2  1  
ATOM 4555   H HB3  . SER A 1 290 ? 2.149   37.066  194.724 1.00 0.00 ?  290 SER A HB3  1  
ATOM 4556   H HG   . SER A 1 290 ? 1.492   35.080  195.689 1.00 0.00 ?  290 SER A HG   1  
ATOM 4557   N N    . ASP A 1 291 ? 4.542   38.818  194.067 1.00 0.00 ?  291 ASP A N    1  
ATOM 4558   C CA   . ASP A 1 291 ? 4.727   40.230  193.857 1.00 0.00 ?  291 ASP A CA   1  
ATOM 4559   C C    . ASP A 1 291 ? 3.380   40.838  193.626 1.00 0.00 ?  291 ASP A C    1  
ATOM 4560   O O    . ASP A 1 291 ? 3.166   42.018  193.901 1.00 0.00 ?  291 ASP A O    1  
ATOM 4561   C CB   . ASP A 1 291 ? 5.603   40.565  192.625 1.00 0.00 ?  291 ASP A CB   1  
ATOM 4562   C CG   . ASP A 1 291 ? 7.051   40.125  192.797 1.00 0.00 ?  291 ASP A CG   1  
ATOM 4563   O OD1  . ASP A 1 291 ? 7.769   40.042  191.765 1.00 0.00 ?  291 ASP A OD1  1  
ATOM 4564   O OD2  . ASP A 1 291 ? 7.462   39.870  193.961 1.00 0.00 -1 291 ASP A OD2  1  
ATOM 4565   H H    . ASP A 1 291 ? 4.528   38.247  193.250 1.00 0.00 ?  291 ASP A H    1  
ATOM 4566   H HA   . ASP A 1 291 ? 5.159   40.644  194.755 1.00 0.00 ?  291 ASP A HA   1  
ATOM 4567   H HB2  . ASP A 1 291 ? 5.181   40.063  191.730 1.00 0.00 ?  291 ASP A HB2  1  
ATOM 4568   H HB3  . ASP A 1 291 ? 5.583   41.664  192.446 1.00 0.00 ?  291 ASP A HB3  1  
ATOM 4569   N N    . VAL A 1 292 ? 2.431   40.036  193.097 1.00 0.00 ?  292 VAL A N    1  
ATOM 4570   C CA   . VAL A 1 292 ? 1.123   40.556  192.827 1.00 0.00 ?  292 VAL A CA   1  
ATOM 4571   C C    . VAL A 1 292 ? 0.363   40.551  194.109 1.00 0.00 ?  292 VAL A C    1  
ATOM 4572   O O    . VAL A 1 292 ? 0.299   39.540  194.807 1.00 0.00 ?  292 VAL A O    1  
ATOM 4573   C CB   . VAL A 1 292 ? 0.354   39.753  191.820 1.00 0.00 ?  292 VAL A CB   1  
ATOM 4574   C CG1  . VAL A 1 292 ? -1.059  40.343  191.703 1.00 0.00 ?  292 VAL A CG1  1  
ATOM 4575   C CG2  . VAL A 1 292 ? 1.124   39.780  190.490 1.00 0.00 ?  292 VAL A CG2  1  
ATOM 4576   H H    . VAL A 1 292 ? 2.588   39.076  192.880 1.00 0.00 ?  292 VAL A H    1  
ATOM 4577   H HA   . VAL A 1 292 ? 1.242   41.575  192.489 1.00 0.00 ?  292 VAL A HA   1  
ATOM 4578   H HB   . VAL A 1 292 ? 0.271   38.702  192.159 1.00 0.00 ?  292 VAL A HB   1  
ATOM 4579   H HG11 . VAL A 1 292 ? -1.458  40.189  190.677 1.00 0.00 ?  292 VAL A HG11 1  
ATOM 4580   H HG12 . VAL A 1 292 ? -1.045  41.434  191.918 1.00 0.00 ?  292 VAL A HG12 1  
ATOM 4581   H HG13 . VAL A 1 292 ? -1.741  39.848  192.426 1.00 0.00 ?  292 VAL A HG13 1  
ATOM 4582   H HG21 . VAL A 1 292 ? 1.189   40.819  190.100 1.00 0.00 ?  292 VAL A HG21 1  
ATOM 4583   H HG22 . VAL A 1 292 ? 0.610   39.148  189.735 1.00 0.00 ?  292 VAL A HG22 1  
ATOM 4584   H HG23 . VAL A 1 292 ? 2.153   39.393  190.636 1.00 0.00 ?  292 VAL A HG23 1  
ATOM 4585   N N    . ASP A 1 293 ? -0.225  41.718  194.442 1.00 0.00 ?  293 ASP A N    1  
ATOM 4586   C CA   . ASP A 1 293 ? -0.982  41.850  195.653 1.00 0.00 ?  293 ASP A CA   1  
ATOM 4587   C C    . ASP A 1 293 ? -2.164  40.938  195.563 1.00 0.00 ?  293 ASP A C    1  
ATOM 4588   O O    . ASP A 1 293 ? -2.722  40.725  194.489 1.00 0.00 ?  293 ASP A O    1  
ATOM 4589   C CB   . ASP A 1 293 ? -1.503  43.276  195.902 1.00 0.00 ?  293 ASP A CB   1  
ATOM 4590   C CG   . ASP A 1 293 ? -2.023  43.450  197.323 1.00 0.00 ?  293 ASP A CG   1  
ATOM 4591   O OD1  . ASP A 1 293 ? -1.666  42.611  198.192 1.00 0.00 ?  293 ASP A OD1  1  
ATOM 4592   O OD2  . ASP A 1 293 ? -2.785  44.426  197.559 1.00 0.00 -1 293 ASP A OD2  1  
ATOM 4593   H H    . ASP A 1 293 ? -0.156  42.534  193.873 1.00 0.00 ?  293 ASP A H    1  
ATOM 4594   H HA   . ASP A 1 293 ? -0.350  41.534  196.471 1.00 0.00 ?  293 ASP A HA   1  
ATOM 4595   H HB2  . ASP A 1 293 ? -0.681  44.005  195.733 1.00 0.00 ?  293 ASP A HB2  1  
ATOM 4596   H HB3  . ASP A 1 293 ? -2.324  43.501  195.191 1.00 0.00 ?  293 ASP A HB3  1  
ATOM 4597   N N    . GLY A 1 294 ? -2.559  40.364  196.723 1.00 0.00 ?  294 GLY A N    1  
ATOM 4598   C CA   . GLY A 1 294 ? -3.681  39.468  196.762 1.00 0.00 ?  294 GLY A CA   1  
ATOM 4599   C C    . GLY A 1 294 ? -3.134  38.089  196.647 1.00 0.00 ?  294 GLY A C    1  
ATOM 4600   O O    . GLY A 1 294 ? -1.944  37.903  196.401 1.00 0.00 ?  294 GLY A O    1  
ATOM 4601   H H    . GLY A 1 294 ? -2.097  40.532  197.590 1.00 0.00 ?  294 GLY A H    1  
ATOM 4602   H HA2  . GLY A 1 294 ? -4.162  39.582  197.723 1.00 0.00 ?  294 GLY A HA2  1  
ATOM 4603   H HA3  . GLY A 1 294 ? -4.312  39.677  195.912 1.00 0.00 ?  294 GLY A HA3  1  
ATOM 4604   N N    . MET A 1 295 ? -4.004  37.077  196.821 1.00 0.00 ?  295 MET A N    1  
ATOM 4605   C CA   . MET A 1 295 ? -3.541  35.728  196.730 1.00 0.00 ?  295 MET A CA   1  
ATOM 4606   C C    . MET A 1 295 ? -3.524  35.385  195.283 1.00 0.00 ?  295 MET A C    1  
ATOM 4607   O O    . MET A 1 295 ? -4.573  35.278  194.647 1.00 0.00 ?  295 MET A O    1  
ATOM 4608   C CB   . MET A 1 295 ? -4.455  34.721  197.453 1.00 0.00 ?  295 MET A CB   1  
ATOM 4609   C CG   . MET A 1 295 ? -3.940  33.282  197.369 1.00 0.00 ?  295 MET A CG   1  
ATOM 4610   S SD   . MET A 1 295 ? -4.961  32.112  198.311 1.00 0.00 ?  295 MET A SD   1  
ATOM 4611   C CE   . MET A 1 295 ? -6.374  32.187  197.173 1.00 0.00 ?  295 MET A CE   1  
ATOM 4612   H H    . MET A 1 295 ? -4.973  37.215  197.014 1.00 0.00 ?  295 MET A H    1  
ATOM 4613   H HA   . MET A 1 295 ? -2.538  35.688  197.126 1.00 0.00 ?  295 MET A HA   1  
ATOM 4614   H HB2  . MET A 1 295 ? -4.542  35.014  198.522 1.00 0.00 ?  295 MET A HB2  1  
ATOM 4615   H HB3  . MET A 1 295 ? -5.469  34.765  197.002 1.00 0.00 ?  295 MET A HB3  1  
ATOM 4616   H HG2  . MET A 1 295 ? -3.911  32.978  196.300 1.00 0.00 ?  295 MET A HG2  1  
ATOM 4617   H HG3  . MET A 1 295 ? -2.897  33.258  197.750 1.00 0.00 ?  295 MET A HG3  1  
ATOM 4618   H HE1  . MET A 1 295 ? -6.032  32.210  196.116 1.00 0.00 ?  295 MET A HE1  1  
ATOM 4619   H HE2  . MET A 1 295 ? -6.982  33.099  197.356 1.00 0.00 ?  295 MET A HE2  1  
ATOM 4620   H HE3  . MET A 1 295 ? -7.034  31.303  197.302 1.00 0.00 ?  295 MET A HE3  1  
ATOM 4621   N N    . THR A 1 296 ? -2.305  35.216  194.731 1.00 0.00 ?  296 THR A N    1  
ATOM 4622   C CA   . THR A 1 296 ? -2.166  34.880  193.347 1.00 0.00 ?  296 THR A CA   1  
ATOM 4623   C C    . THR A 1 296 ? -1.124  33.820  193.265 1.00 0.00 ?  296 THR A C    1  
ATOM 4624   O O    . THR A 1 296 ? -0.249  33.733  194.128 1.00 0.00 ?  296 THR A O    1  
ATOM 4625   C CB   . THR A 1 296 ? -1.723  36.038  192.501 1.00 0.00 ?  296 THR A CB   1  
ATOM 4626   O OG1  . THR A 1 296 ? -0.446  36.489  192.934 1.00 0.00 ?  296 THR A OG1  1  
ATOM 4627   C CG2  . THR A 1 296 ? -2.760  37.166  192.628 1.00 0.00 ?  296 THR A CG2  1  
ATOM 4628   H H    . THR A 1 296 ? -1.461  35.317  195.252 1.00 0.00 ?  296 THR A H    1  
ATOM 4629   H HA   . THR A 1 296 ? -3.105  34.482  192.994 1.00 0.00 ?  296 THR A HA   1  
ATOM 4630   H HB   . THR A 1 296 ? -1.657  35.732  191.437 1.00 0.00 ?  296 THR A HB   1  
ATOM 4631   H HG1  . THR A 1 296 ? -0.592  37.347  193.344 1.00 0.00 ?  296 THR A HG1  1  
ATOM 4632   H HG21 . THR A 1 296 ? -2.690  37.644  193.628 1.00 0.00 ?  296 THR A HG21 1  
ATOM 4633   H HG22 . THR A 1 296 ? -3.787  36.764  192.496 1.00 0.00 ?  296 THR A HG22 1  
ATOM 4634   H HG23 . THR A 1 296 ? -2.581  37.942  191.852 1.00 0.00 ?  296 THR A HG23 1  
ATOM 4635   N N    . HIS A 1 297 ? -1.204  32.988  192.203 1.00 0.00 ?  297 HIS A N    1  
ATOM 4636   C CA   . HIS A 1 297 ? -0.242  31.942  192.009 1.00 0.00 ?  297 HIS A CA   1  
ATOM 4637   C C    . HIS A 1 297 ? 0.556   32.335  190.817 1.00 0.00 ?  297 HIS A C    1  
ATOM 4638   O O    . HIS A 1 297 ? 0.006   32.504  189.728 1.00 0.00 ?  297 HIS A O    1  
ATOM 4639   C CB   . HIS A 1 297 ? -0.865  30.568  191.721 1.00 0.00 ?  297 HIS A CB   1  
ATOM 4640   C CG   . HIS A 1 297 ? 0.160   29.496  191.508 1.00 0.00 ?  297 HIS A CG   1  
ATOM 4641   N ND1  . HIS A 1 297 ? 0.878   29.004  192.585 1.00 0.00 ?  297 HIS A ND1  1  
ATOM 4642   C CD2  . HIS A 1 297 ? 0.550   28.884  190.355 1.00 0.00 ?  297 HIS A CD2  1  
ATOM 4643   C CE1  . HIS A 1 297 ? 1.688   28.103  192.061 1.00 0.00 ?  297 HIS A CE1  1  
ATOM 4644   N NE2  . HIS A 1 297 ? 1.532   27.989  190.719 1.00 0.00 ?  297 HIS A NE2  1  
ATOM 4645   H H    . HIS A 1 297 ? -1.923  33.063  191.517 1.00 0.00 ?  297 HIS A H    1  
ATOM 4646   H HA   . HIS A 1 297 ? 0.403   31.895  192.873 1.00 0.00 ?  297 HIS A HA   1  
ATOM 4647   H HB2  . HIS A 1 297 ? -1.506  30.261  192.575 1.00 0.00 ?  297 HIS A HB2  1  
ATOM 4648   H HB3  . HIS A 1 297 ? -1.494  30.626  190.807 1.00 0.00 ?  297 HIS A HB3  1  
ATOM 4649   H HD2  . HIS A 1 297 ? 0.203   29.024  189.339 1.00 0.00 ?  297 HIS A HD2  1  
ATOM 4650   H HE1  . HIS A 1 297 ? 2.410   27.508  192.620 1.00 0.00 ?  297 HIS A HE1  1  
ATOM 4651   N N    . ILE A 1 298 ? 1.882   32.498  191.009 1.00 0.00 ?  298 ILE A N    1  
ATOM 4652   C CA   . ILE A 1 298 ? 2.739   32.885  189.923 1.00 0.00 ?  298 ILE A CA   1  
ATOM 4653   C C    . ILE A 1 298 ? 3.893   31.942  189.893 1.00 0.00 ?  298 ILE A C    1  
ATOM 4654   O O    . ILE A 1 298 ? 4.321   31.440  190.932 1.00 0.00 ?  298 ILE A O    1  
ATOM 4655   C CB   . ILE A 1 298 ? 3.242   34.294  190.069 1.00 0.00 ?  298 ILE A CB   1  
ATOM 4656   C CG1  . ILE A 1 298 ? 3.984   34.494  191.413 1.00 0.00 ?  298 ILE A CG1  1  
ATOM 4657   C CG2  . ILE A 1 298 ? 2.034   35.235  189.930 1.00 0.00 ?  298 ILE A CG2  1  
ATOM 4658   C CD1  . ILE A 1 298 ? 4.632   35.875  191.527 1.00 0.00 ?  298 ILE A CD1  1  
ATOM 4659   H H    . ILE A 1 298 ? 2.319   32.358  191.894 1.00 0.00 ?  298 ILE A H    1  
ATOM 4660   H HA   . ILE A 1 298 ? 2.184   32.779  189.005 1.00 0.00 ?  298 ILE A HA   1  
ATOM 4661   H HB   . ILE A 1 298 ? 3.949   34.511  189.242 1.00 0.00 ?  298 ILE A HB   1  
ATOM 4662   H HG12 . ILE A 1 298 ? 3.260   34.365  192.247 1.00 0.00 ?  298 ILE A HG12 1  
ATOM 4663   H HG13 . ILE A 1 298 ? 4.774   33.725  191.525 1.00 0.00 ?  298 ILE A HG13 1  
ATOM 4664   H HG21 . ILE A 1 298 ? 1.258   34.773  189.282 1.00 0.00 ?  298 ILE A HG21 1  
ATOM 4665   H HG22 . ILE A 1 298 ? 2.347   36.200  189.477 1.00 0.00 ?  298 ILE A HG22 1  
ATOM 4666   H HG23 . ILE A 1 298 ? 1.587   35.440  190.927 1.00 0.00 ?  298 ILE A HG23 1  
ATOM 4667   H HD11 . ILE A 1 298 ? 4.455   36.298  192.532 1.00 0.00 ?  298 ILE A HD11 1  
ATOM 4668   H HD12 . ILE A 1 298 ? 4.203   36.568  190.777 1.00 0.00 ?  298 ILE A HD12 1  
ATOM 4669   H HD13 . ILE A 1 298 ? 5.727   35.803  191.362 1.00 0.00 ?  298 ILE A HD13 1  
ATOM 4670   N N    . ASP A 1 299 ? 4.414   31.679  188.668 1.00 0.00 ?  299 ASP A N    1  
ATOM 4671   C CA   . ASP A 1 299 ? 5.525   30.782  188.517 1.00 0.00 ?  299 ASP A CA   1  
ATOM 4672   C C    . ASP A 1 299 ? 6.661   31.555  187.924 1.00 0.00 ?  299 ASP A C    1  
ATOM 4673   O O    . ASP A 1 299 ? 6.616   31.937  186.755 1.00 0.00 ?  299 ASP A O    1  
ATOM 4674   C CB   . ASP A 1 299 ? 5.219   29.602  187.577 1.00 0.00 ?  299 ASP A CB   1  
ATOM 4675   C CG   . ASP A 1 299 ? 6.359   28.587  187.519 1.00 0.00 ?  299 ASP A CG   1  
ATOM 4676   O OD1  . ASP A 1 299 ? 6.257   27.636  186.701 1.00 0.00 ?  299 ASP A OD1  1  
ATOM 4677   O OD2  . ASP A 1 299 ? 7.332   28.733  188.309 1.00 0.00 -1 299 ASP A OD2  1  
ATOM 4678   H H    . ASP A 1 299 ? 4.056   32.091  187.834 1.00 0.00 ?  299 ASP A H    1  
ATOM 4679   H HA   . ASP A 1 299 ? 5.813   30.421  189.490 1.00 0.00 ?  299 ASP A HA   1  
ATOM 4680   H HB2  . ASP A 1 299 ? 4.299   29.084  187.925 1.00 0.00 ?  299 ASP A HB2  1  
ATOM 4681   H HB3  . ASP A 1 299 ? 5.035   29.988  186.552 1.00 0.00 ?  299 ASP A HB3  1  
ATOM 4682   N N    . TYR A 1 300 ? 7.707   31.806  188.737 1.00 0.00 ?  300 TYR A N    1  
ATOM 4683   C CA   . TYR A 1 300 ? 8.878   32.489  188.257 1.00 0.00 ?  300 TYR A CA   1  
ATOM 4684   C C    . TYR A 1 300 ? 10.049  31.740  188.776 1.00 0.00 ?  300 TYR A C    1  
ATOM 4685   O O    . TYR A 1 300 ? 9.967   31.090  189.820 1.00 0.00 ?  300 TYR A O    1  
ATOM 4686   C CB   . TYR A 1 300 ? 9.028   33.957  188.695 1.00 0.00 ?  300 TYR A CB   1  
ATOM 4687   C CG   . TYR A 1 300 ? 7.994   34.876  188.141 1.00 0.00 ?  300 TYR A CG   1  
ATOM 4688   C CD1  . TYR A 1 300 ? 8.185   35.457  186.904 1.00 0.00 ?  300 TYR A CD1  1  
ATOM 4689   C CD2  . TYR A 1 300 ? 6.854   35.174  188.849 1.00 0.00 ?  300 TYR A CD2  1  
ATOM 4690   C CE1  . TYR A 1 300 ? 7.251   36.319  186.385 1.00 0.00 ?  300 TYR A CE1  1  
ATOM 4691   C CE2  . TYR A 1 300 ? 5.918   36.038  188.324 1.00 0.00 ?  300 TYR A CE2  1  
ATOM 4692   C CZ   . TYR A 1 300 ? 6.118   36.609  187.096 1.00 0.00 ?  300 TYR A CZ   1  
ATOM 4693   O OH   . TYR A 1 300 ? 5.156   37.494  186.566 1.00 0.00 ?  300 TYR A OH   1  
ATOM 4694   H H    . TYR A 1 300 ? 7.714   31.533  189.696 1.00 0.00 ?  300 TYR A H    1  
ATOM 4695   H HA   . TYR A 1 300 ? 8.878   32.420  187.180 1.00 0.00 ?  300 TYR A HA   1  
ATOM 4696   H HB2  . TYR A 1 300 ? 8.965   34.027  189.801 1.00 0.00 ?  300 TYR A HB2  1  
ATOM 4697   H HB3  . TYR A 1 300 ? 10.021  34.342  188.373 1.00 0.00 ?  300 TYR A HB3  1  
ATOM 4698   H HD1  . TYR A 1 300 ? 9.077   35.230  186.339 1.00 0.00 ?  300 TYR A HD1  1  
ATOM 4699   H HD2  . TYR A 1 300 ? 6.692   34.725  189.817 1.00 0.00 ?  300 TYR A HD2  1  
ATOM 4700   H HE1  . TYR A 1 300 ? 7.410   36.768  185.416 1.00 0.00 ?  300 TYR A HE1  1  
ATOM 4701   H HE2  . TYR A 1 300 ? 5.028   36.270  188.878 1.00 0.00 ?  300 TYR A HE2  1  
ATOM 4702   H HH   . TYR A 1 300 ? 4.339   37.004  186.442 1.00 0.00 ?  300 TYR A HH   1  
ATOM 4703   N N    . THR A 1 301 ? 11.175  31.812  188.034 1.00 0.00 ?  301 THR A N    1  
ATOM 4704   C CA   . THR A 1 301 ? 12.361  31.129  188.450 1.00 0.00 ?  301 THR A CA   1  
ATOM 4705   C C    . THR A 1 301 ? 13.283  32.161  189.013 1.00 0.00 ?  301 THR A C    1  
ATOM 4706   C CB   . THR A 1 301 ? 13.067  30.471  187.298 1.00 0.00 ?  301 THR A CB   1  
ATOM 4707   O OG1  . THR A 1 301 ? 12.210  29.517  186.682 1.00 0.00 ?  301 THR A OG1  1  
ATOM 4708   C CG2  . THR A 1 301 ? 14.342  29.785  187.813 1.00 0.00 ?  301 THR A CG2  1  
ATOM 4709   H H    . THR A 1 301 ? 11.226  32.322  187.175 1.00 0.00 ?  301 THR A H    1  
ATOM 4710   H HA   . THR A 1 301 ? 12.108  30.409  189.210 1.00 0.00 ?  301 THR A HA   1  
ATOM 4711   H HB   . THR A 1 301 ? 13.354  31.232  186.544 1.00 0.00 ?  301 THR A HB   1  
ATOM 4712   H HG1  . THR A 1 301 ? 12.580  29.352  185.809 1.00 0.00 ?  301 THR A HG1  1  
ATOM 4713   H HG21 . THR A 1 301 ? 14.709  29.047  187.068 1.00 0.00 ?  301 THR A HG21 1  
ATOM 4714   H HG22 . THR A 1 301 ? 14.139  29.256  188.767 1.00 0.00 ?  301 THR A HG22 1  
ATOM 4715   H HG23 . THR A 1 301 ? 15.140  30.539  187.986 1.00 0.00 ?  301 THR A HG23 1  
ATOM 4716   N N    . MET B 1 1   ? 32.558  14.967  183.077 1.00 0.00 ?  1   MET B N    1  
ATOM 4717   C CA   . MET B 1 1   ? 33.463  14.320  184.054 1.00 0.00 ?  1   MET B CA   1  
ATOM 4718   C C    . MET B 1 1   ? 32.767  14.175  185.370 1.00 0.00 ?  1   MET B C    1  
ATOM 4719   O O    . MET B 1 1   ? 33.209  14.713  186.385 1.00 0.00 ?  1   MET B O    1  
ATOM 4720   C CB   . MET B 1 1   ? 34.726  15.172  184.251 1.00 0.00 ?  1   MET B CB   1  
ATOM 4721   C CG   . MET B 1 1   ? 35.591  15.225  182.989 1.00 0.00 ?  1   MET B CG   1  
ATOM 4722   S SD   . MET B 1 1   ? 37.310  14.719  183.286 1.00 0.00 ?  1   MET B SD   1  
ATOM 4723   C CE   . MET B 1 1   ? 37.530  13.946  181.657 1.00 0.00 ?  1   MET B CE   1  
ATOM 4724   H H1   . MET B 1 1   ? 32.225  14.259  182.391 1.00 0.00 ?  1   MET B H1   1  
ATOM 4725   H HA   . MET B 1 1   ? 33.717  13.345  183.669 1.00 0.00 ?  1   MET B HA   1  
ATOM 4726   H HB2  . MET B 1 1   ? 34.427  16.204  184.533 1.00 0.00 ?  1   MET B HB2  1  
ATOM 4727   H HB3  . MET B 1 1   ? 35.328  14.747  185.082 1.00 0.00 ?  1   MET B HB3  1  
ATOM 4728   H HG2  . MET B 1 1   ? 35.134  14.564  182.221 1.00 0.00 ?  1   MET B HG2  1  
ATOM 4729   H HG3  . MET B 1 1   ? 35.571  16.262  182.590 1.00 0.00 ?  1   MET B HG3  1  
ATOM 4730   H HE1  . MET B 1 1   ? 37.383  12.846  181.717 1.00 0.00 ?  1   MET B HE1  1  
ATOM 4731   H HE2  . MET B 1 1   ? 38.550  14.135  181.262 1.00 0.00 ?  1   MET B HE2  1  
ATOM 4732   H HE3  . MET B 1 1   ? 36.798  14.351  180.924 1.00 0.00 ?  1   MET B HE3  1  
ATOM 4733   N N    . ASN B 1 2   ? 31.641  13.434  185.370 1.00 0.00 ?  2   ASN B N    1  
ATOM 4734   C CA   . ASN B 1 2   ? 30.897  13.235  186.580 1.00 0.00 ?  2   ASN B CA   1  
ATOM 4735   C C    . ASN B 1 2   ? 31.536  12.083  187.308 1.00 0.00 ?  2   ASN B C    1  
ATOM 4736   O O    . ASN B 1 2   ? 32.324  11.347  186.726 1.00 0.00 ?  2   ASN B O    1  
ATOM 4737   C CB   . ASN B 1 2   ? 29.413  12.935  186.342 1.00 0.00 ?  2   ASN B CB   1  
ATOM 4738   C CG   . ASN B 1 2   ? 28.649  14.149  185.832 1.00 0.00 ?  2   ASN B CG   1  
ATOM 4739   O OD1  . ASN B 1 2   ? 29.089  15.287  185.984 1.00 0.00 ?  2   ASN B OD1  1  
ATOM 4740   N ND2  . ASN B 1 2   ? 27.460  13.898  185.214 1.00 0.00 ?  2   ASN B ND2  1  
ATOM 4741   H H    . ASN B 1 2   ? 31.280  13.001  184.547 1.00 0.00 ?  2   ASN B H    1  
ATOM 4742   H HA   . ASN B 1 2   ? 31.007  14.128  187.177 1.00 0.00 ?  2   ASN B HA   1  
ATOM 4743   H HB2  . ASN B 1 2   ? 29.319  12.116  185.597 1.00 0.00 ?  2   ASN B HB2  1  
ATOM 4744   H HB3  . ASN B 1 2   ? 28.950  12.595  187.293 1.00 0.00 ?  2   ASN B HB3  1  
ATOM 4745   H HD21 . ASN B 1 2   ? 27.136  12.957  185.117 1.00 0.00 ?  2   ASN B HD21 1  
ATOM 4746   H HD22 . ASN B 1 2   ? 26.909  14.656  184.862 1.00 0.00 ?  2   ASN B HD22 1  
ATOM 4747   N N    . VAL B 1 3   ? 31.190  11.887  188.610 1.00 0.00 ?  3   VAL B N    1  
ATOM 4748   C CA   . VAL B 1 3   ? 31.847  10.856  189.387 1.00 0.00 ?  3   VAL B CA   1  
ATOM 4749   C C    . VAL B 1 3   ? 31.564  9.458   188.874 1.00 0.00 ?  3   VAL B C    1  
ATOM 4750   O O    . VAL B 1 3   ? 32.506  8.702   188.658 1.00 0.00 ?  3   VAL B O    1  
ATOM 4751   C CB   . VAL B 1 3   ? 31.511  10.917  190.878 1.00 0.00 ?  3   VAL B CB   1  
ATOM 4752   C CG1  . VAL B 1 3   ? 29.978  10.778  191.126 1.00 0.00 ?  3   VAL B CG1  1  
ATOM 4753   C CG2  . VAL B 1 3   ? 32.315  9.814   191.585 1.00 0.00 ?  3   VAL B CG2  1  
ATOM 4754   H H    . VAL B 1 3   ? 30.492  12.428  189.074 1.00 0.00 ?  3   VAL B H    1  
ATOM 4755   H HA   . VAL B 1 3   ? 32.904  11.032  189.267 1.00 0.00 ?  3   VAL B HA   1  
ATOM 4756   H HB   . VAL B 1 3   ? 31.839  11.895  191.286 1.00 0.00 ?  3   VAL B HB   1  
ATOM 4757   H HG11 . VAL B 1 3   ? 29.712  11.183  192.126 1.00 0.00 ?  3   VAL B HG11 1  
ATOM 4758   H HG12 . VAL B 1 3   ? 29.676  9.709   191.087 1.00 0.00 ?  3   VAL B HG12 1  
ATOM 4759   H HG13 . VAL B 1 3   ? 29.409  11.336  190.353 1.00 0.00 ?  3   VAL B HG13 1  
ATOM 4760   H HG21 . VAL B 1 3   ? 31.823  8.828   191.442 1.00 0.00 ?  3   VAL B HG21 1  
ATOM 4761   H HG22 . VAL B 1 3   ? 32.380  10.023  192.674 1.00 0.00 ?  3   VAL B HG22 1  
ATOM 4762   H HG23 . VAL B 1 3   ? 33.344  9.761   191.171 1.00 0.00 ?  3   VAL B HG23 1  
ATOM 4763   N N    . ASP B 1 4   ? 30.285  9.052   188.722 1.00 0.00 ?  4   ASP B N    1  
ATOM 4764   C CA   . ASP B 1 4   ? 29.983  7.720   188.232 1.00 0.00 ?  4   ASP B CA   1  
ATOM 4765   C C    . ASP B 1 4   ? 29.889  7.679   186.708 1.00 0.00 ?  4   ASP B C    1  
ATOM 4766   O O    . ASP B 1 4   ? 30.497  6.804   186.099 1.00 0.00 ?  4   ASP B O    1  
ATOM 4767   C CB   . ASP B 1 4   ? 28.725  7.068   188.862 1.00 0.00 ?  4   ASP B CB   1  
ATOM 4768   C CG   . ASP B 1 4   ? 28.863  5.555   188.971 1.00 0.00 ?  4   ASP B CG   1  
ATOM 4769   O OD1  . ASP B 1 4   ? 29.765  4.989   188.296 1.00 0.00 ?  4   ASP B OD1  1  
ATOM 4770   O OD2  . ASP B 1 4   ? 28.073  4.945   189.739 1.00 0.00 -1 4   ASP B OD2  1  
ATOM 4771   H H    . ASP B 1 4   ? 29.505  9.636   188.936 1.00 0.00 ?  4   ASP B H    1  
ATOM 4772   H HA   . ASP B 1 4   ? 30.836  7.117   188.502 1.00 0.00 ?  4   ASP B HA   1  
ATOM 4773   H HB2  . ASP B 1 4   ? 28.559  7.488   189.877 1.00 0.00 ?  4   ASP B HB2  1  
ATOM 4774   H HB3  . ASP B 1 4   ? 27.837  7.296   188.240 1.00 0.00 ?  4   ASP B HB3  1  
ATOM 4775   N N    . PRO B 1 5   ? 29.118  8.577   186.058 1.00 0.00 ?  5   PRO B N    1  
ATOM 4776   C CA   . PRO B 1 5   ? 28.976  8.557   184.594 1.00 0.00 ?  5   PRO B CA   1  
ATOM 4777   C C    . PRO B 1 5   ? 30.239  8.538   183.749 1.00 0.00 ?  5   PRO B C    1  
ATOM 4778   O O    . PRO B 1 5   ? 30.119  8.381   182.540 1.00 0.00 ?  5   PRO B O    1  
ATOM 4779   C CB   . PRO B 1 5   ? 28.145  9.810   184.278 1.00 0.00 ?  5   PRO B CB   1  
ATOM 4780   C CG   . PRO B 1 5   ? 27.270  9.998   185.520 1.00 0.00 ?  5   PRO B CG   1  
ATOM 4781   C CD   . PRO B 1 5   ? 28.202  9.594   186.660 1.00 0.00 ?  5   PRO B CD   1  
ATOM 4782   H HA   . PRO B 1 5   ? 28.392  7.700   184.306 1.00 0.00 ?  5   PRO B HA   1  
ATOM 4783   H HB2  . PRO B 1 5   ? 28.804  10.691  184.121 1.00 0.00 ?  5   PRO B HB2  1  
ATOM 4784   H HB3  . PRO B 1 5   ? 27.515  9.647   183.377 1.00 0.00 ?  5   PRO B HB3  1  
ATOM 4785   H HG2  . PRO B 1 5   ? 26.946  11.058  185.618 1.00 0.00 ?  5   PRO B HG2  1  
ATOM 4786   H HG3  . PRO B 1 5   ? 26.382  9.334   185.481 1.00 0.00 ?  5   PRO B HG3  1  
ATOM 4787   H HD2  . PRO B 1 5   ? 28.764  10.459  187.040 1.00 0.00 ?  5   PRO B HD2  1  
ATOM 4788   H HD3  . PRO B 1 5   ? 27.609  9.163   187.485 1.00 0.00 ?  5   PRO B HD3  1  
ATOM 4789   N N    . PHE B 1 6   ? 31.459  8.776   184.305 1.00 0.00 ?  6   PHE B N    1  
ATOM 4790   C CA   . PHE B 1 6   ? 32.654  8.720   183.459 1.00 0.00 ?  6   PHE B CA   1  
ATOM 4791   C C    . PHE B 1 6   ? 33.065  7.276   183.315 1.00 0.00 ?  6   PHE B C    1  
ATOM 4792   O O    . PHE B 1 6   ? 33.872  6.931   182.452 1.00 0.00 ?  6   PHE B O    1  
ATOM 4793   C CB   . PHE B 1 6   ? 33.875  9.503   183.990 1.00 0.00 ?  6   PHE B CB   1  
ATOM 4794   C CG   . PHE B 1 6   ? 34.710  8.767   184.982 1.00 0.00 ?  6   PHE B CG   1  
ATOM 4795   C CD1  . PHE B 1 6   ? 35.856  8.108   184.585 1.00 0.00 ?  6   PHE B CD1  1  
ATOM 4796   C CD2  . PHE B 1 6   ? 34.356  8.748   186.302 1.00 0.00 ?  6   PHE B CD2  1  
ATOM 4797   C CE1  . PHE B 1 6   ? 36.629  7.440   185.506 1.00 0.00 ?  6   PHE B CE1  1  
ATOM 4798   C CE2  . PHE B 1 6   ? 35.125  8.080   187.226 1.00 0.00 ?  6   PHE B CE2  1  
ATOM 4799   C CZ   . PHE B 1 6   ? 36.263  7.427   186.828 1.00 0.00 ?  6   PHE B CZ   1  
ATOM 4800   H H    . PHE B 1 6   ? 31.591  8.993   185.271 1.00 0.00 ?  6   PHE B H    1  
ATOM 4801   H HA   . PHE B 1 6   ? 32.375  9.097   182.486 1.00 0.00 ?  6   PHE B HA   1  
ATOM 4802   H HB2  . PHE B 1 6   ? 34.541  9.772   183.144 1.00 0.00 ?  6   PHE B HB2  1  
ATOM 4803   H HB3  . PHE B 1 6   ? 33.531  10.442  184.478 1.00 0.00 ?  6   PHE B HB3  1  
ATOM 4804   H HD1  . PHE B 1 6   ? 36.147  8.115   183.545 1.00 0.00 ?  6   PHE B HD1  1  
ATOM 4805   H HD2  . PHE B 1 6   ? 33.469  9.258   186.612 1.00 0.00 ?  6   PHE B HD2  1  
ATOM 4806   H HE1  . PHE B 1 6   ? 37.525  6.927   185.189 1.00 0.00 ?  6   PHE B HE1  1  
ATOM 4807   H HE2  . PHE B 1 6   ? 34.834  8.072   188.266 1.00 0.00 ?  6   PHE B HE2  1  
ATOM 4808   H HZ   . PHE B 1 6   ? 36.869  6.903   187.553 1.00 0.00 ?  6   PHE B HZ   1  
ATOM 4809   N N    . SER B 1 7   ? 32.511  6.413   184.190 1.00 0.00 ?  7   SER B N    1  
ATOM 4810   C CA   . SER B 1 7   ? 32.840  4.991   184.231 1.00 0.00 ?  7   SER B CA   1  
ATOM 4811   C C    . SER B 1 7   ? 32.780  4.255   182.882 1.00 0.00 ?  7   SER B C    1  
ATOM 4812   O O    . SER B 1 7   ? 33.668  3.452   182.631 1.00 0.00 ?  7   SER B O    1  
ATOM 4813   C CB   . SER B 1 7   ? 31.944  4.210   185.207 1.00 0.00 ?  7   SER B CB   1  
ATOM 4814   O OG   . SER B 1 7   ? 32.319  2.841   185.219 1.00 0.00 ?  7   SER B OG   1  
ATOM 4815   H H    . SER B 1 7   ? 31.839  6.715   184.862 1.00 0.00 ?  7   SER B H    1  
ATOM 4816   H HA   . SER B 1 7   ? 33.855  4.935   184.585 1.00 0.00 ?  7   SER B HA   1  
ATOM 4817   H HB2  . SER B 1 7   ? 32.052  4.620   186.234 1.00 0.00 ?  7   SER B HB2  1  
ATOM 4818   H HB3  . SER B 1 7   ? 30.880  4.285   184.901 1.00 0.00 ?  7   SER B HB3  1  
ATOM 4819   H HG   . SER B 1 7   ? 31.915  2.462   186.003 1.00 0.00 ?  7   SER B HG   1  
ATOM 4820   N N    . PRO B 1 8   ? 31.777  4.437   182.018 1.00 0.00 ?  8   PRO B N    1  
ATOM 4821   C CA   . PRO B 1 8   ? 31.709  3.704   180.739 1.00 0.00 ?  8   PRO B CA   1  
ATOM 4822   C C    . PRO B 1 8   ? 32.912  3.820   179.840 1.00 0.00 ?  8   PRO B C    1  
ATOM 4823   O O    . PRO B 1 8   ? 33.073  3.012   178.925 1.00 0.00 ?  8   PRO B O    1  
ATOM 4824   C CB   . PRO B 1 8   ? 30.490  4.287   180.027 1.00 0.00 ?  8   PRO B CB   1  
ATOM 4825   C CG   . PRO B 1 8   ? 29.608  4.759   181.164 1.00 0.00 ?  8   PRO B CG   1  
ATOM 4826   C CD   . PRO B 1 8   ? 30.598  5.295   182.186 1.00 0.00 ?  8   PRO B CD   1  
ATOM 4827   H HA   . PRO B 1 8   ? 31.527  2.655   180.921 1.00 0.00 ?  8   PRO B HA   1  
ATOM 4828   H HB2  . PRO B 1 8   ? 30.785  5.136   179.374 1.00 0.00 ?  8   PRO B HB2  1  
ATOM 4829   H HB3  . PRO B 1 8   ? 29.973  3.514   179.424 1.00 0.00 ?  8   PRO B HB3  1  
ATOM 4830   H HG2  . PRO B 1 8   ? 28.918  5.559   180.818 1.00 0.00 ?  8   PRO B HG2  1  
ATOM 4831   H HG3  . PRO B 1 8   ? 29.023  3.915   181.587 1.00 0.00 ?  8   PRO B HG3  1  
ATOM 4832   H HD2  . PRO B 1 8   ? 30.852  6.342   181.957 1.00 0.00 ?  8   PRO B HD2  1  
ATOM 4833   H HD3  . PRO B 1 8   ? 30.179  5.225   183.209 1.00 0.00 ?  8   PRO B HD3  1  
ATOM 4834   N N    . HIS B 1 9   ? 33.795  4.817   180.066 1.00 0.00 ?  9   HIS B N    1  
ATOM 4835   C CA   . HIS B 1 9   ? 34.947  4.970   179.207 1.00 0.00 ?  9   HIS B CA   1  
ATOM 4836   C C    . HIS B 1 9   ? 36.041  4.074   179.718 1.00 0.00 ?  9   HIS B C    1  
ATOM 4837   O O    . HIS B 1 9   ? 37.151  4.067   179.187 1.00 0.00 ?  9   HIS B O    1  
ATOM 4838   C CB   . HIS B 1 9   ? 35.503  6.405   179.172 1.00 0.00 ?  9   HIS B CB   1  
ATOM 4839   C CG   . HIS B 1 9   ? 34.522  7.414   178.653 1.00 0.00 ?  9   HIS B CG   1  
ATOM 4840   N ND1  . HIS B 1 9   ? 34.171  7.409   177.313 1.00 0.00 ?  9   HIS B ND1  1  
ATOM 4841   C CD2  . HIS B 1 9   ? 33.876  8.415   179.312 1.00 0.00 ?  9   HIS B CD2  1  
ATOM 4842   C CE1  . HIS B 1 9   ? 33.316  8.410   177.191 1.00 0.00 ?  9   HIS B CE1  1  
ATOM 4843   N NE2  . HIS B 1 9   ? 33.103  9.051   178.367 1.00 0.00 ?  9   HIS B NE2  1  
ATOM 4844   H H    . HIS B 1 9   ? 33.695  5.472   180.811 1.00 0.00 ?  9   HIS B H    1  
ATOM 4845   H HA   . HIS B 1 9   ? 34.663  4.655   178.215 1.00 0.00 ?  9   HIS B HA   1  
ATOM 4846   H HB2  . HIS B 1 9   ? 35.795  6.717   180.197 1.00 0.00 ?  9   HIS B HB2  1  
ATOM 4847   H HB3  . HIS B 1 9   ? 36.403  6.441   178.521 1.00 0.00 ?  9   HIS B HB3  1  
ATOM 4848   H HD2  . HIS B 1 9   ? 33.920  8.705   180.355 1.00 0.00 ?  9   HIS B HD2  1  
ATOM 4849   H HE1  . HIS B 1 9   ? 32.827  8.707   176.264 1.00 0.00 ?  9   HIS B HE1  1  
ATOM 4850   N N    . SER B 1 10  ? 35.742  3.291   180.769 1.00 0.00 ?  10  SER B N    1  
ATOM 4851   C CA   . SER B 1 10  ? 36.714  2.403   181.343 1.00 0.00 ?  10  SER B CA   1  
ATOM 4852   C C    . SER B 1 10  ? 36.837  1.189   180.457 1.00 0.00 ?  10  SER B C    1  
ATOM 4853   O O    . SER B 1 10  ? 36.403  1.183   179.307 1.00 0.00 ?  10  SER B O    1  
ATOM 4854   C CB   . SER B 1 10  ? 36.345  1.935   182.766 1.00 0.00 ?  10  SER B CB   1  
ATOM 4855   O OG   . SER B 1 10  ? 36.218  3.058   183.626 1.00 0.00 ?  10  SER B OG   1  
ATOM 4856   H H    . SER B 1 10  ? 34.841  3.294   181.195 1.00 0.00 ?  10  SER B H    1  
ATOM 4857   H HA   . SER B 1 10  ? 37.658  2.924   181.357 1.00 0.00 ?  10  SER B HA   1  
ATOM 4858   H HB2  . SER B 1 10  ? 35.380  1.385   182.750 1.00 0.00 ?  10  SER B HB2  1  
ATOM 4859   H HB3  . SER B 1 10  ? 37.134  1.268   183.174 1.00 0.00 ?  10  SER B HB3  1  
ATOM 4860   H HG   . SER B 1 10  ? 36.849  2.918   184.337 1.00 0.00 ?  10  SER B HG   1  
ATOM 4861   N N    . SER B 1 11  ? 37.450  0.122   181.014 1.00 0.00 ?  11  SER B N    1  
ATOM 4862   C CA   . SER B 1 11  ? 37.686  -1.096  180.285 1.00 0.00 ?  11  SER B CA   1  
ATOM 4863   C C    . SER B 1 11  ? 36.377  -1.771  180.004 1.00 0.00 ?  11  SER B C    1  
ATOM 4864   O O    . SER B 1 11  ? 35.322  -1.349  180.478 1.00 0.00 ?  11  SER B O    1  
ATOM 4865   C CB   . SER B 1 11  ? 38.572  -2.092  181.048 1.00 0.00 ?  11  SER B CB   1  
ATOM 4866   O OG   . SER B 1 11  ? 37.873  -2.608  182.171 1.00 0.00 ?  11  SER B OG   1  
ATOM 4867   H H    . SER B 1 11  ? 37.768  0.133   181.959 1.00 0.00 ?  11  SER B H    1  
ATOM 4868   H HA   . SER B 1 11  ? 38.150  -0.829  179.350 1.00 0.00 ?  11  SER B HA   1  
ATOM 4869   H HB2  . SER B 1 11  ? 38.857  -2.936  180.383 1.00 0.00 ?  11  SER B HB2  1  
ATOM 4870   H HB3  . SER B 1 11  ? 39.496  -1.585  181.403 1.00 0.00 ?  11  SER B HB3  1  
ATOM 4871   H HG   . SER B 1 11  ? 37.349  -3.341  181.841 1.00 0.00 ?  11  SER B HG   1  
ATOM 4872   N N    . ASP B 1 12  ? 36.456  -2.853  179.187 1.00 0.00 ?  12  ASP B N    1  
ATOM 4873   C CA   . ASP B 1 12  ? 35.291  -3.586  178.753 1.00 0.00 ?  12  ASP B CA   1  
ATOM 4874   C C    . ASP B 1 12  ? 34.503  -4.098  179.925 1.00 0.00 ?  12  ASP B C    1  
ATOM 4875   O O    . ASP B 1 12  ? 35.033  -4.500  180.959 1.00 0.00 ?  12  ASP B O    1  
ATOM 4876   C CB   . ASP B 1 12  ? 35.638  -4.795  177.876 1.00 0.00 ?  12  ASP B CB   1  
ATOM 4877   C CG   . ASP B 1 12  ? 36.113  -4.373  176.494 1.00 0.00 ?  12  ASP B CG   1  
ATOM 4878   O OD1  . ASP B 1 12  ? 35.937  -3.174  176.149 1.00 0.00 ?  12  ASP B OD1  1  
ATOM 4879   O OD2  . ASP B 1 12  ? 36.655  -5.244  175.765 1.00 0.00 -1 12  ASP B OD2  1  
ATOM 4880   H H    . ASP B 1 12  ? 37.331  -3.191  178.848 1.00 0.00 ?  12  ASP B H    1  
ATOM 4881   H HA   . ASP B 1 12  ? 34.674  -2.900  178.195 1.00 0.00 ?  12  ASP B HA   1  
ATOM 4882   H HB2  . ASP B 1 12  ? 36.440  -5.389  178.366 1.00 0.00 ?  12  ASP B HB2  1  
ATOM 4883   H HB3  . ASP B 1 12  ? 34.741  -5.438  177.767 1.00 0.00 ?  12  ASP B HB3  1  
ATOM 4884   N N    . SER B 1 13  ? 33.171  -4.068  179.720 1.00 0.00 ?  13  SER B N    1  
ATOM 4885   C CA   . SER B 1 13  ? 32.190  -4.472  180.693 1.00 0.00 ?  13  SER B CA   1  
ATOM 4886   C C    . SER B 1 13  ? 31.930  -5.960  180.607 1.00 0.00 ?  13  SER B C    1  
ATOM 4887   O O    . SER B 1 13  ? 31.115  -6.487  181.363 1.00 0.00 ?  13  SER B O    1  
ATOM 4888   C CB   . SER B 1 13  ? 30.852  -3.758  180.496 1.00 0.00 ?  13  SER B CB   1  
ATOM 4889   O OG   . SER B 1 13  ? 30.215  -4.229  179.318 1.00 0.00 ?  13  SER B OG   1  
ATOM 4890   H H    . SER B 1 13  ? 32.795  -3.753  178.852 1.00 0.00 ?  13  SER B H    1  
ATOM 4891   H HA   . SER B 1 13  ? 32.588  -4.241  181.668 1.00 0.00 ?  13  SER B HA   1  
ATOM 4892   H HB2  . SER B 1 13  ? 30.193  -3.938  181.365 1.00 0.00 ?  13  SER B HB2  1  
ATOM 4893   H HB3  . SER B 1 13  ? 31.020  -2.666  180.394 1.00 0.00 ?  13  SER B HB3  1  
ATOM 4894   H HG   . SER B 1 13  ? 29.479  -4.772  179.614 1.00 0.00 ?  13  SER B HG   1  
ATOM 4895   N N    . PHE B 1 14  ? 32.580  -6.652  179.641 1.00 0.00 ?  14  PHE B N    1  
ATOM 4896   C CA   . PHE B 1 14  ? 32.363  -8.082  179.385 1.00 0.00 ?  14  PHE B CA   1  
ATOM 4897   C C    . PHE B 1 14  ? 32.507  -8.985  180.609 1.00 0.00 ?  14  PHE B C    1  
ATOM 4898   O O    . PHE B 1 14  ? 32.191  -10.174 180.515 1.00 0.00 ?  14  PHE B O    1  
ATOM 4899   C CB   . PHE B 1 14  ? 33.306  -8.652  178.311 1.00 0.00 ?  14  PHE B CB   1  
ATOM 4900   C CG   . PHE B 1 14  ? 32.916  -8.287  176.919 1.00 0.00 ?  14  PHE B CG   1  
ATOM 4901   C CD1  . PHE B 1 14  ? 31.726  -8.739  176.388 1.00 0.00 ?  14  PHE B CD1  1  
ATOM 4902   C CD2  . PHE B 1 14  ? 33.741  -7.506  176.140 1.00 0.00 ?  14  PHE B CD2  1  
ATOM 4903   C CE1  . PHE B 1 14  ? 31.367  -8.411  175.102 1.00 0.00 ?  14  PHE B CE1  1  
ATOM 4904   C CE2  . PHE B 1 14  ? 33.380  -7.178  174.854 1.00 0.00 ?  14  PHE B CE2  1  
ATOM 4905   C CZ   . PHE B 1 14  ? 32.193  -7.630  174.336 1.00 0.00 ?  14  PHE B CZ   1  
ATOM 4906   H H    . PHE B 1 14  ? 33.248  -6.211  179.047 1.00 0.00 ?  14  PHE B H    1  
ATOM 4907   H HA   . PHE B 1 14  ? 31.358  -8.171  179.032 1.00 0.00 ?  14  PHE B HA   1  
ATOM 4908   H HB2  . PHE B 1 14  ? 34.337  -8.273  178.473 1.00 0.00 ?  14  PHE B HB2  1  
ATOM 4909   H HB3  . PHE B 1 14  ? 33.320  -9.762  178.373 1.00 0.00 ?  14  PHE B HB3  1  
ATOM 4910   H HD1  . PHE B 1 14  ? 31.070  -9.353  176.988 1.00 0.00 ?  14  PHE B HD1  1  
ATOM 4911   H HD2  . PHE B 1 14  ? 34.678  -7.151  176.541 1.00 0.00 ?  14  PHE B HD2  1  
ATOM 4912   H HE1  . PHE B 1 14  ? 30.433  -8.770  174.695 1.00 0.00 ?  14  PHE B HE1  1  
ATOM 4913   H HE2  . PHE B 1 14  ? 34.032  -6.563  174.252 1.00 0.00 ?  14  PHE B HE2  1  
ATOM 4914   H HZ   . PHE B 1 14  ? 31.910  -7.372  173.326 1.00 0.00 ?  14  PHE B HZ   1  
ATOM 4915   N N    . ALA B 1 15  ? 32.990  -8.477  181.759 1.00 0.00 ?  15  ALA B N    1  
ATOM 4916   C CA   . ALA B 1 15  ? 33.212  -9.302  182.932 1.00 0.00 ?  15  ALA B CA   1  
ATOM 4917   C C    . ALA B 1 15  ? 31.956  -10.032 183.406 1.00 0.00 ?  15  ALA B C    1  
ATOM 4918   O O    . ALA B 1 15  ? 32.090  -11.002 184.158 1.00 0.00 ?  15  ALA B O    1  
ATOM 4919   C CB   . ALA B 1 15  ? 33.724  -8.484  184.128 1.00 0.00 ?  15  ALA B CB   1  
ATOM 4920   H H    . ALA B 1 15  ? 33.217  -7.510  181.855 1.00 0.00 ?  15  ALA B H    1  
ATOM 4921   H HA   . ALA B 1 15  ? 33.952  -10.036 182.663 1.00 0.00 ?  15  ALA B HA   1  
ATOM 4922   H HB1  . ALA B 1 15  ? 34.823  -8.342  184.057 1.00 0.00 ?  15  ALA B HB1  1  
ATOM 4923   H HB2  . ALA B 1 15  ? 33.495  -9.008  185.081 1.00 0.00 ?  15  ALA B HB2  1  
ATOM 4924   H HB3  . ALA B 1 15  ? 33.238  -7.484  184.148 1.00 0.00 ?  15  ALA B HB3  1  
ATOM 4925   N N    . GLN B 1 16  ? 30.717  -9.584  183.050 1.00 0.00 ?  16  GLN B N    1  
ATOM 4926   C CA   . GLN B 1 16  ? 29.520  -10.296 183.518 1.00 0.00 ?  16  GLN B CA   1  
ATOM 4927   C C    . GLN B 1 16  ? 29.556  -11.691 182.950 1.00 0.00 ?  16  GLN B C    1  
ATOM 4928   O O    . GLN B 1 16  ? 29.308  -12.650 183.682 1.00 0.00 ?  16  GLN B O    1  
ATOM 4929   C CB   . GLN B 1 16  ? 28.211  -9.629  183.056 1.00 0.00 ?  16  GLN B CB   1  
ATOM 4930   C CG   . GLN B 1 16  ? 26.959  -10.273 183.664 1.00 0.00 ?  16  GLN B CG   1  
ATOM 4931   C CD   . GLN B 1 16  ? 27.017  -10.111 185.177 1.00 0.00 ?  16  GLN B CD   1  
ATOM 4932   O OE1  . GLN B 1 16  ? 27.151  -9.002  185.692 1.00 0.00 ?  16  GLN B OE1  1  
ATOM 4933   N NE2  . GLN B 1 16  ? 26.902  -11.249 185.911 1.00 0.00 ?  16  GLN B NE2  1  
ATOM 4934   H H    . GLN B 1 16  ? 30.573  -8.783  182.473 1.00 0.00 ?  16  GLN B H    1  
ATOM 4935   H HA   . GLN B 1 16  ? 29.567  -10.347 184.594 1.00 0.00 ?  16  GLN B HA   1  
ATOM 4936   H HB2  . GLN B 1 16  ? 28.237  -8.552  183.333 1.00 0.00 ?  16  GLN B HB2  1  
ATOM 4937   H HB3  . GLN B 1 16  ? 28.145  -9.695  181.949 1.00 0.00 ?  16  GLN B HB3  1  
ATOM 4938   H HG2  . GLN B 1 16  ? 26.046  -9.775  183.270 1.00 0.00 ?  16  GLN B HG2  1  
ATOM 4939   H HG3  . GLN B 1 16  ? 26.924  -11.353 183.412 1.00 0.00 ?  16  GLN B HG3  1  
ATOM 4940   H HE21 . GLN B 1 16  ? 26.783  -12.130 185.454 1.00 0.00 ?  16  GLN B HE21 1  
ATOM 4941   H HE22 . GLN B 1 16  ? 26.947  -11.207 186.909 1.00 0.00 ?  16  GLN B HE22 1  
ATOM 4942   N N    . ALA B 1 17  ? 29.913  -11.833 181.634 1.00 0.00 ?  17  ALA B N    1  
ATOM 4943   C CA   . ALA B 1 17  ? 29.977  -13.150 181.024 1.00 0.00 ?  17  ALA B CA   1  
ATOM 4944   C C    . ALA B 1 17  ? 30.251  -12.991 179.557 1.00 0.00 ?  17  ALA B C    1  
ATOM 4945   O O    . ALA B 1 17  ? 29.325  -12.804 178.766 1.00 0.00 ?  17  ALA B O    1  
ATOM 4946   C CB   . ALA B 1 17  ? 28.671  -13.959 181.144 1.00 0.00 ?  17  ALA B CB   1  
ATOM 4947   H H    . ALA B 1 17  ? 30.139  -11.057 181.050 1.00 0.00 ?  17  ALA B H    1  
ATOM 4948   H HA   . ALA B 1 17  ? 30.793  -13.685 181.484 1.00 0.00 ?  17  ALA B HA   1  
ATOM 4949   H HB1  . ALA B 1 17  ? 27.809  -13.277 181.301 1.00 0.00 ?  17  ALA B HB1  1  
ATOM 4950   H HB2  . ALA B 1 17  ? 28.730  -14.662 182.003 1.00 0.00 ?  17  ALA B HB2  1  
ATOM 4951   H HB3  . ALA B 1 17  ? 28.495  -14.547 180.217 1.00 0.00 ?  17  ALA B HB3  1  
ATOM 4952   N N    . ALA B 1 18  ? 31.538  -13.080 179.149 1.00 0.00 ?  18  ALA B N    1  
ATOM 4953   C CA   . ALA B 1 18  ? 31.861  -12.959 177.748 1.00 0.00 ?  18  ALA B CA   1  
ATOM 4954   C C    . ALA B 1 18  ? 31.743  -14.318 177.113 1.00 0.00 ?  18  ALA B C    1  
ATOM 4955   O O    . ALA B 1 18  ? 31.008  -14.503 176.143 1.00 0.00 ?  18  ALA B O    1  
ATOM 4956   C CB   . ALA B 1 18  ? 33.291  -12.449 177.498 1.00 0.00 ?  18  ALA B CB   1  
ATOM 4957   H H    . ALA B 1 18  ? 32.299  -13.215 179.780 1.00 0.00 ?  18  ALA B H    1  
ATOM 4958   H HA   . ALA B 1 18  ? 31.142  -12.292 177.300 1.00 0.00 ?  18  ALA B HA   1  
ATOM 4959   H HB1  . ALA B 1 18  ? 33.894  -13.228 176.987 1.00 0.00 ?  18  ALA B HB1  1  
ATOM 4960   H HB2  . ALA B 1 18  ? 33.783  -12.193 178.460 1.00 0.00 ?  18  ALA B HB2  1  
ATOM 4961   H HB3  . ALA B 1 18  ? 33.269  -11.541 176.858 1.00 0.00 ?  18  ALA B HB3  1  
ATOM 4962   N N    . SER B 1 19  ? 32.478  -15.307 177.663 1.00 0.00 ?  19  SER B N    1  
ATOM 4963   C CA   . SER B 1 19  ? 32.460  -16.651 177.118 1.00 0.00 ?  19  SER B CA   1  
ATOM 4964   C C    . SER B 1 19  ? 31.073  -17.300 177.169 1.00 0.00 ?  19  SER B C    1  
ATOM 4965   O O    . SER B 1 19  ? 30.658  -17.886 176.166 1.00 0.00 ?  19  SER B O    1  
ATOM 4966   C CB   . SER B 1 19  ? 33.476  -17.606 177.780 1.00 0.00 ?  19  SER B CB   1  
ATOM 4967   O OG   . SER B 1 19  ? 34.797  -17.234 177.414 1.00 0.00 ?  19  SER B OG   1  
ATOM 4968   H H    . SER B 1 19  ? 33.059  -15.160 178.459 1.00 0.00 ?  19  SER B H    1  
ATOM 4969   H HA   . SER B 1 19  ? 32.723  -16.544 176.076 1.00 0.00 ?  19  SER B HA   1  
ATOM 4970   H HB2  . SER B 1 19  ? 33.390  -17.559 178.884 1.00 0.00 ?  19  SER B HB2  1  
ATOM 4971   H HB3  . SER B 1 19  ? 33.294  -18.649 177.447 1.00 0.00 ?  19  SER B HB3  1  
ATOM 4972   H HG   . SER B 1 19  ? 34.707  -16.649 176.659 1.00 0.00 ?  19  SER B HG   1  
ATOM 4973   N N    . PRO B 1 20  ? 30.328  -17.250 178.288 1.00 0.00 ?  20  PRO B N    1  
ATOM 4974   C CA   . PRO B 1 20  ? 29.003  -17.882 178.350 1.00 0.00 ?  20  PRO B CA   1  
ATOM 4975   C C    . PRO B 1 20  ? 28.016  -17.438 177.313 1.00 0.00 ?  20  PRO B C    1  
ATOM 4976   O O    . PRO B 1 20  ? 26.986  -18.092 177.137 1.00 0.00 ?  20  PRO B O    1  
ATOM 4977   C CB   . PRO B 1 20  ? 28.467  -17.532 179.736 1.00 0.00 ?  20  PRO B CB   1  
ATOM 4978   C CG   . PRO B 1 20  ? 29.717  -17.338 180.570 1.00 0.00 ?  20  PRO B CG   1  
ATOM 4979   C CD   . PRO B 1 20  ? 30.703  -16.692 179.607 1.00 0.00 ?  20  PRO B CD   1  
ATOM 4980   H HA   . PRO B 1 20  ? 29.098  -18.950 178.281 1.00 0.00 ?  20  PRO B HA   1  
ATOM 4981   H HB2  . PRO B 1 20  ? 27.865  -16.598 179.701 1.00 0.00 ?  20  PRO B HB2  1  
ATOM 4982   H HB3  . PRO B 1 20  ? 27.849  -18.362 180.142 1.00 0.00 ?  20  PRO B HB3  1  
ATOM 4983   H HG2  . PRO B 1 20  ? 29.511  -16.674 181.437 1.00 0.00 ?  20  PRO B HG2  1  
ATOM 4984   H HG3  . PRO B 1 20  ? 30.104  -18.315 180.931 1.00 0.00 ?  20  PRO B HG3  1  
ATOM 4985   H HD2  . PRO B 1 20  ? 30.593  -15.590 179.623 1.00 0.00 ?  20  PRO B HD2  1  
ATOM 4986   H HD3  . PRO B 1 20  ? 31.740  -16.961 179.882 1.00 0.00 ?  20  PRO B HD3  1  
ATOM 4987   N N    . ALA B 1 21  ? 28.276  -16.300 176.639 1.00 0.00 ?  21  ALA B N    1  
ATOM 4988   C CA   . ALA B 1 21  ? 27.363  -15.818 175.639 1.00 0.00 ?  21  ALA B CA   1  
ATOM 4989   C C    . ALA B 1 21  ? 27.232  -16.849 174.556 1.00 0.00 ?  21  ALA B C    1  
ATOM 4990   O O    . ALA B 1 21  ? 26.137  -17.074 174.043 1.00 0.00 ?  21  ALA B O    1  
ATOM 4991   C CB   . ALA B 1 21  ? 27.820  -14.506 174.984 1.00 0.00 ?  21  ALA B CB   1  
ATOM 4992   H H    . ALA B 1 21  ? 29.092  -15.750 176.806 1.00 0.00 ?  21  ALA B H    1  
ATOM 4993   H HA   . ALA B 1 21  ? 26.405  -15.682 176.114 1.00 0.00 ?  21  ALA B HA   1  
ATOM 4994   H HB1  . ALA B 1 21  ? 28.350  -14.715 174.030 1.00 0.00 ?  21  ALA B HB1  1  
ATOM 4995   H HB2  . ALA B 1 21  ? 28.510  -13.956 175.660 1.00 0.00 ?  21  ALA B HB2  1  
ATOM 4996   H HB3  . ALA B 1 21  ? 26.945  -13.857 174.768 1.00 0.00 ?  21  ALA B HB3  1  
ATOM 4997   N N    . ARG B 1 22  ? 28.342  -17.509 174.173 1.00 0.00 ?  22  ARG B N    1  
ATOM 4998   C CA   . ARG B 1 22  ? 28.248  -18.494 173.129 1.00 0.00 ?  22  ARG B CA   1  
ATOM 4999   C C    . ARG B 1 22  ? 27.573  -19.712 173.687 1.00 0.00 ?  22  ARG B C    1  
ATOM 5000   O O    . ARG B 1 22  ? 27.025  -20.518 172.937 1.00 0.00 ?  22  ARG B O    1  
ATOM 5001   C CB   . ARG B 1 22  ? 29.610  -18.927 172.560 1.00 0.00 ?  22  ARG B CB   1  
ATOM 5002   C CG   . ARG B 1 22  ? 30.313  -17.800 171.801 1.00 0.00 ?  22  ARG B CG   1  
ATOM 5003   C CD   . ARG B 1 22  ? 31.738  -18.174 171.387 1.00 0.00 ?  22  ARG B CD   1  
ATOM 5004   N NE   . ARG B 1 22  ? 32.563  -18.331 172.616 1.00 0.00 ?  22  ARG B NE   1  
ATOM 5005   C CZ   . ARG B 1 22  ? 33.856  -18.756 172.518 1.00 0.00 ?  22  ARG B CZ   1  
ATOM 5006   N NH1  . ARG B 1 22  ? 34.391  -19.036 171.294 1.00 0.00 1  22  ARG B NH1  1  
ATOM 5007   N NH2  . ARG B 1 22  ? 34.613  -18.903 173.644 1.00 0.00 ?  22  ARG B NH2  1  
ATOM 5008   H H    . ARG B 1 22  ? 29.242  -17.350 174.576 1.00 0.00 ?  22  ARG B H    1  
ATOM 5009   H HA   . ARG B 1 22  ? 27.633  -18.078 172.347 1.00 0.00 ?  22  ARG B HA   1  
ATOM 5010   H HB2  . ARG B 1 22  ? 30.260  -19.266 173.396 1.00 0.00 ?  22  ARG B HB2  1  
ATOM 5011   H HB3  . ARG B 1 22  ? 29.459  -19.786 171.872 1.00 0.00 ?  22  ARG B HB3  1  
ATOM 5012   H HG2  . ARG B 1 22  ? 29.725  -17.553 170.892 1.00 0.00 ?  22  ARG B HG2  1  
ATOM 5013   H HG3  . ARG B 1 22  ? 30.347  -16.895 172.444 1.00 0.00 ?  22  ARG B HG3  1  
ATOM 5014   H HD2  . ARG B 1 22  ? 31.750  -19.137 170.831 1.00 0.00 ?  22  ARG B HD2  1  
ATOM 5015   H HD3  . ARG B 1 22  ? 32.193  -17.374 170.766 1.00 0.00 ?  22  ARG B HD3  1  
ATOM 5016   H HE   . ARG B 1 22  ? 32.169  -18.127 173.513 1.00 0.00 ?  22  ARG B HE   1  
ATOM 5017   H HH11 . ARG B 1 22  ? 33.835  -18.929 170.469 1.00 0.00 ?  22  ARG B HH11 1  
ATOM 5018   H HH12 . ARG B 1 22  ? 35.338  -19.347 171.221 1.00 0.00 ?  22  ARG B HH12 1  
ATOM 5019   H HH21 . ARG B 1 22  ? 34.221  -18.700 174.541 1.00 0.00 ?  22  ARG B HH21 1  
ATOM 5020   H HH22 . ARG B 1 22  ? 35.561  -19.214 173.571 1.00 0.00 ?  22  ARG B HH22 1  
ATOM 5021   N N    . LYS B 1 23  ? 27.591  -19.881 175.026 1.00 0.00 ?  23  LYS B N    1  
ATOM 5022   C CA   . LYS B 1 23  ? 26.953  -21.036 175.607 1.00 0.00 ?  23  LYS B CA   1  
ATOM 5023   C C    . LYS B 1 23  ? 25.454  -20.775 175.621 1.00 0.00 ?  23  LYS B C    1  
ATOM 5024   O O    . LYS B 1 23  ? 25.033  -19.619 175.581 1.00 0.00 ?  23  LYS B O    1  
ATOM 5025   C CB   . LYS B 1 23  ? 27.425  -21.355 177.048 1.00 0.00 ?  23  LYS B CB   1  
ATOM 5026   C CG   . LYS B 1 23  ? 28.882  -21.822 177.099 1.00 0.00 ?  23  LYS B CG   1  
ATOM 5027   C CD   . LYS B 1 23  ? 29.272  -22.403 178.464 1.00 0.00 ?  23  LYS B CD   1  
ATOM 5028   C CE   . LYS B 1 23  ? 29.303  -21.359 179.580 1.00 0.00 ?  23  LYS B CE   1  
ATOM 5029   N NZ   . LYS B 1 23  ? 29.742  -21.975 180.851 1.00 0.00 1  23  LYS B NZ   1  
ATOM 5030   H H    . LYS B 1 23  ? 28.037  -19.241 175.652 1.00 0.00 ?  23  LYS B H    1  
ATOM 5031   H HA   . LYS B 1 23  ? 27.171  -21.863 174.950 1.00 0.00 ?  23  LYS B HA   1  
ATOM 5032   H HB2  . LYS B 1 23  ? 27.313  -20.444 177.676 1.00 0.00 ?  23  LYS B HB2  1  
ATOM 5033   H HB3  . LYS B 1 23  ? 26.778  -22.148 177.477 1.00 0.00 ?  23  LYS B HB3  1  
ATOM 5034   H HG2  . LYS B 1 23  ? 29.040  -22.596 176.318 1.00 0.00 ?  23  LYS B HG2  1  
ATOM 5035   H HG3  . LYS B 1 23  ? 29.546  -20.962 176.867 1.00 0.00 ?  23  LYS B HG3  1  
ATOM 5036   H HD2  . LYS B 1 23  ? 28.546  -23.198 178.737 1.00 0.00 ?  23  LYS B HD2  1  
ATOM 5037   H HD3  . LYS B 1 23  ? 30.276  -22.873 178.381 1.00 0.00 ?  23  LYS B HD3  1  
ATOM 5038   H HE2  . LYS B 1 23  ? 30.015  -20.544 179.332 1.00 0.00 ?  23  LYS B HE2  1  
ATOM 5039   H HE3  . LYS B 1 23  ? 28.291  -20.928 179.738 1.00 0.00 ?  23  LYS B HE3  1  
ATOM 5040   H HZ1  . LYS B 1 23  ? 29.580  -21.310 181.634 1.00 0.00 ?  23  LYS B HZ1  1  
ATOM 5041   H HZ2  . LYS B 1 23  ? 30.755  -22.204 180.794 1.00 0.00 ?  23  LYS B HZ2  1  
ATOM 5042   H HZ3  . LYS B 1 23  ? 29.199  -22.846 181.020 1.00 0.00 ?  23  LYS B HZ3  1  
ATOM 5043   N N    . PRO B 1 24  ? 24.622  -21.830 175.667 1.00 0.00 ?  24  PRO B N    1  
ATOM 5044   C CA   . PRO B 1 24  ? 23.166  -21.660 175.687 1.00 0.00 ?  24  PRO B CA   1  
ATOM 5045   C C    . PRO B 1 24  ? 22.672  -20.820 176.853 1.00 0.00 ?  24  PRO B C    1  
ATOM 5046   O O    . PRO B 1 24  ? 23.366  -20.717 177.863 1.00 0.00 ?  24  PRO B O    1  
ATOM 5047   C CB   . PRO B 1 24  ? 22.607  -23.083 175.810 1.00 0.00 ?  24  PRO B CB   1  
ATOM 5048   C CG   . PRO B 1 24  ? 23.703  -23.964 175.238 1.00 0.00 ?  24  PRO B CG   1  
ATOM 5049   C CD   . PRO B 1 24  ? 24.995  -23.265 175.644 1.00 0.00 ?  24  PRO B CD   1  
ATOM 5050   H HA   . PRO B 1 24  ? 22.841  -21.229 174.755 1.00 0.00 ?  24  PRO B HA   1  
ATOM 5051   H HB2  . PRO B 1 24  ? 22.411  -23.337 176.873 1.00 0.00 ?  24  PRO B HB2  1  
ATOM 5052   H HB3  . PRO B 1 24  ? 21.673  -23.190 175.220 1.00 0.00 ?  24  PRO B HB3  1  
ATOM 5053   H HG2  . PRO B 1 24  ? 23.649  -24.986 175.674 1.00 0.00 ?  24  PRO B HG2  1  
ATOM 5054   H HG3  . PRO B 1 24  ? 23.621  -24.025 174.133 1.00 0.00 ?  24  PRO B HG3  1  
ATOM 5055   H HD2  . PRO B 1 24  ? 25.329  -23.615 176.645 1.00 0.00 ?  24  PRO B HD2  1  
ATOM 5056   H HD3  . PRO B 1 24  ? 25.785  -23.474 174.893 1.00 0.00 ?  24  PRO B HD3  1  
ATOM 5057   N N    . PRO B 1 25  ? 21.491  -20.208 176.759 1.00 0.00 ?  25  PRO B N    1  
ATOM 5058   C CA   . PRO B 1 25  ? 20.967  -19.345 177.817 1.00 0.00 ?  25  PRO B CA   1  
ATOM 5059   C C    . PRO B 1 25  ? 20.530  -20.068 179.062 1.00 0.00 ?  25  PRO B C    1  
ATOM 5060   O O    . PRO B 1 25  ? 20.353  -21.285 179.069 1.00 0.00 ?  25  PRO B O    1  
ATOM 5061   C CB   . PRO B 1 25  ? 19.775  -18.641 177.177 1.00 0.00 ?  25  PRO B CB   1  
ATOM 5062   C CG   . PRO B 1 25  ? 19.274  -19.644 176.153 1.00 0.00 ?  25  PRO B CG   1  
ATOM 5063   C CD   . PRO B 1 25  ? 20.539  -20.325 175.636 1.00 0.00 ?  25  PRO B CD   1  
ATOM 5064   H HA   . PRO B 1 25  ? 21.699  -18.601 178.094 1.00 0.00 ?  25  PRO B HA   1  
ATOM 5065   H HB2  . PRO B 1 25  ? 18.992  -18.422 177.935 1.00 0.00 ?  25  PRO B HB2  1  
ATOM 5066   H HB3  . PRO B 1 25  ? 20.092  -17.700 176.680 1.00 0.00 ?  25  PRO B HB3  1  
ATOM 5067   H HG2  . PRO B 1 25  ? 18.593  -20.382 176.633 1.00 0.00 ?  25  PRO B HG2  1  
ATOM 5068   H HG3  . PRO B 1 25  ? 18.741  -19.128 175.327 1.00 0.00 ?  25  PRO B HG3  1  
ATOM 5069   H HD2  . PRO B 1 25  ? 20.333  -21.388 175.392 1.00 0.00 ?  25  PRO B HD2  1  
ATOM 5070   H HD3  . PRO B 1 25  ? 20.918  -19.804 174.731 1.00 0.00 ?  25  PRO B HD3  1  
ATOM 5071   N N    . ARG B 1 26  ? 20.350  -19.286 180.161 1.00 0.00 ?  26  ARG B N    1  
ATOM 5072   C CA   . ARG B 1 26  ? 19.959  -19.842 181.437 1.00 0.00 ?  26  ARG B CA   1  
ATOM 5073   C C    . ARG B 1 26  ? 18.486  -20.219 181.350 1.00 0.00 ?  26  ARG B C    1  
ATOM 5074   O O    . ARG B 1 26  ? 17.593  -19.411 181.602 1.00 0.00 ?  26  ARG B O    1  
ATOM 5075   C CB   . ARG B 1 26  ? 20.157  -18.818 182.589 1.00 0.00 ?  26  ARG B CB   1  
ATOM 5076   C CG   . ARG B 1 26  ? 21.560  -18.142 182.588 1.00 0.00 ?  26  ARG B CG   1  
ATOM 5077   C CD   . ARG B 1 26  ? 22.709  -19.149 182.719 1.00 0.00 ?  26  ARG B CD   1  
ATOM 5078   N NE   . ARG B 1 26  ? 23.984  -18.390 182.850 1.00 0.00 ?  26  ARG B NE   1  
ATOM 5079   C CZ   . ARG B 1 26  ? 25.177  -19.056 182.848 1.00 0.00 ?  26  ARG B CZ   1  
ATOM 5080   N NH1  . ARG B 1 26  ? 25.201  -20.415 182.723 1.00 0.00 1  26  ARG B NH1  1  
ATOM 5081   N NH2  . ARG B 1 26  ? 26.346  -18.361 182.969 1.00 0.00 ?  26  ARG B NH2  1  
ATOM 5082   H H    . ARG B 1 26  ? 20.478  -18.298 180.134 1.00 0.00 ?  26  ARG B H    1  
ATOM 5083   H HA   . ARG B 1 26  ? 20.549  -20.729 181.610 1.00 0.00 ?  26  ARG B HA   1  
ATOM 5084   H HB2  . ARG B 1 26  ? 19.377  -18.031 182.506 1.00 0.00 ?  26  ARG B HB2  1  
ATOM 5085   H HB3  . ARG B 1 26  ? 20.013  -19.339 183.559 1.00 0.00 ?  26  ARG B HB3  1  
ATOM 5086   H HG2  . ARG B 1 26  ? 21.686  -17.573 181.643 1.00 0.00 ?  26  ARG B HG2  1  
ATOM 5087   H HG3  . ARG B 1 26  ? 21.612  -17.419 183.431 1.00 0.00 ?  26  ARG B HG3  1  
ATOM 5088   H HD2  . ARG B 1 26  ? 22.582  -19.781 183.625 1.00 0.00 ?  26  ARG B HD2  1  
ATOM 5089   H HD3  . ARG B 1 26  ? 22.784  -19.792 181.817 1.00 0.00 ?  26  ARG B HD3  1  
ATOM 5090   H HE   . ARG B 1 26  ? 23.967  -17.395 182.940 1.00 0.00 ?  26  ARG B HE   1  
ATOM 5091   H HH11 . ARG B 1 26  ? 24.344  -20.924 182.633 1.00 0.00 ?  26  ARG B HH11 1  
ATOM 5092   H HH12 . ARG B 1 26  ? 26.075  -20.901 182.721 1.00 0.00 ?  26  ARG B HH12 1  
ATOM 5093   H HH21 . ARG B 1 26  ? 26.328  -17.365 183.059 1.00 0.00 ?  26  ARG B HH21 1  
ATOM 5094   H HH22 . ARG B 1 26  ? 27.219  -18.848 182.967 1.00 0.00 ?  26  ARG B HH22 1  
ATOM 5095   N N    . GLY B 1 27  ? 18.250  -21.500 180.979 1.00 0.00 ?  27  GLY B N    1  
ATOM 5096   C CA   . GLY B 1 27  ? 16.926  -22.076 180.764 1.00 0.00 ?  27  GLY B CA   1  
ATOM 5097   C C    . GLY B 1 27  ? 16.234  -22.615 182.018 1.00 0.00 ?  27  GLY B C    1  
ATOM 5098   O O    . GLY B 1 27  ? 15.096  -23.057 181.906 1.00 0.00 ?  27  GLY B O    1  
ATOM 5099   H H    . GLY B 1 27  ? 19.006  -22.132 180.830 1.00 0.00 ?  27  GLY B H    1  
ATOM 5100   H HA2  . GLY B 1 27  ? 16.310  -21.286 180.370 1.00 0.00 ?  27  GLY B HA2  1  
ATOM 5101   H HA3  . GLY B 1 27  ? 17.062  -22.896 180.070 1.00 0.00 ?  27  GLY B HA3  1  
ATOM 5102   N N    . GLY B 1 28  ? 16.889  -22.640 183.210 1.00 0.00 ?  28  GLY B N    1  
ATOM 5103   C CA   . GLY B 1 28  ? 16.339  -23.347 184.386 1.00 0.00 ?  28  GLY B CA   1  
ATOM 5104   C C    . GLY B 1 28  ? 14.842  -23.158 184.701 1.00 0.00 ?  28  GLY B C    1  
ATOM 5105   O O    . GLY B 1 28  ? 14.163  -24.181 184.799 1.00 0.00 ?  28  GLY B O    1  
ATOM 5106   H H    . GLY B 1 28  ? 17.765  -22.184 183.343 1.00 0.00 ?  28  GLY B H    1  
ATOM 5107   H HA2  . GLY B 1 28  ? 16.489  -24.396 184.198 1.00 0.00 ?  28  GLY B HA2  1  
ATOM 5108   H HA3  . GLY B 1 28  ? 16.908  -22.989 185.236 1.00 0.00 ?  28  GLY B HA3  1  
ATOM 5109   N N    . ARG B 1 29  ? 14.266  -21.921 184.868 1.00 0.00 ?  29  ARG B N    1  
ATOM 5110   C CA   . ARG B 1 29  ? 12.807  -21.827 185.126 1.00 0.00 ?  29  ARG B CA   1  
ATOM 5111   C C    . ARG B 1 29  ? 12.202  -21.320 183.853 1.00 0.00 ?  29  ARG B C    1  
ATOM 5112   O O    . ARG B 1 29  ? 10.991  -21.111 183.775 1.00 0.00 ?  29  ARG B O    1  
ATOM 5113   C CB   . ARG B 1 29  ? 12.320  -20.889 186.325 1.00 0.00 ?  29  ARG B CB   1  
ATOM 5114   C CG   . ARG B 1 29  ? 11.844  -21.658 187.627 1.00 0.00 ?  29  ARG B CG   1  
ATOM 5115   C CD   . ARG B 1 29  ? 10.606  -21.027 188.410 1.00 0.00 ?  29  ARG B CD   1  
ATOM 5116   N NE   . ARG B 1 29  ? 10.864  -19.573 188.594 1.00 0.00 ?  29  ARG B NE   1  
ATOM 5117   C CZ   . ARG B 1 29  ? 9.826   -18.702 188.763 1.00 0.00 ?  29  ARG B CZ   1  
ATOM 5118   N NH1  . ARG B 1 29  ? 8.531   -19.151 188.768 1.00 0.00 1  29  ARG B NH1  1  
ATOM 5119   N NH2  . ARG B 1 29  ? 10.084  -17.374 188.922 1.00 0.00 ?  29  ARG B NH2  1  
ATOM 5120   H H    . ARG B 1 29  ? 14.778  -21.067 184.825 1.00 0.00 ?  29  ARG B H    1  
ATOM 5121   H HA   . ARG B 1 29  ? 12.441  -22.829 185.286 1.00 0.00 ?  29  ARG B HA   1  
ATOM 5122   H HB2  . ARG B 1 29  ? 13.155  -20.211 186.602 1.00 0.00 ?  29  ARG B HB2  1  
ATOM 5123   H HB3  . ARG B 1 29  ? 11.481  -20.257 185.963 1.00 0.00 ?  29  ARG B HB3  1  
ATOM 5124   H HG2  . ARG B 1 29  ? 11.575  -22.696 187.339 1.00 0.00 ?  29  ARG B HG2  1  
ATOM 5125   H HG3  . ARG B 1 29  ? 12.707  -21.725 188.325 1.00 0.00 ?  29  ARG B HG3  1  
ATOM 5126   H HD2  . ARG B 1 29  ? 9.670   -21.151 187.827 1.00 0.00 ?  29  ARG B HD2  1  
ATOM 5127   H HD3  . ARG B 1 29  ? 10.491  -21.490 189.413 1.00 0.00 ?  29  ARG B HD3  1  
ATOM 5128   H HE   . ARG B 1 29  ? 11.804  -19.231 188.590 1.00 0.00 ?  29  ARG B HE   1  
ATOM 5129   H HH11 . ARG B 1 29  ? 8.337   -20.127 188.644 1.00 0.00 ?  29  ARG B HH11 1  
ATOM 5130   H HH12 . ARG B 1 29  ? 7.780   -18.504 188.896 1.00 0.00 ?  29  ARG B HH12 1  
ATOM 5131   H HH21 . ARG B 1 29  ? 11.029  -17.043 188.913 1.00 0.00 ?  29  ARG B HH21 1  
ATOM 5132   H HH22 . ARG B 1 29  ? 9.330   -16.730 189.046 1.00 0.00 ?  29  ARG B HH22 1  
ATOM 5133   N N    . ARG B 1 30  ? 13.055  -21.117 182.809 1.00 0.00 ?  30  ARG B N    1  
ATOM 5134   C CA   . ARG B 1 30  ? 12.573  -20.611 181.543 1.00 0.00 ?  30  ARG B CA   1  
ATOM 5135   C C    . ARG B 1 30  ? 13.168  -21.424 180.435 1.00 0.00 ?  30  ARG B C    1  
ATOM 5136   O O    . ARG B 1 30  ? 13.972  -20.916 179.654 1.00 0.00 ?  30  ARG B O    1  
ATOM 5137   C CB   . ARG B 1 30  ? 12.973  -19.149 181.291 1.00 0.00 ?  30  ARG B CB   1  
ATOM 5138   C CG   . ARG B 1 30  ? 12.461  -18.192 182.369 1.00 0.00 ?  30  ARG B CG   1  
ATOM 5139   C CD   . ARG B 1 30  ? 10.936  -18.071 182.382 1.00 0.00 ?  30  ARG B CD   1  
ATOM 5140   N NE   . ARG B 1 30  ? 10.564  -17.034 183.388 1.00 0.00 ?  30  ARG B NE   1  
ATOM 5141   C CZ   . ARG B 1 30  ? 10.610  -15.709 183.056 1.00 0.00 ?  30  ARG B CZ   1  
ATOM 5142   N NH1  . ARG B 1 30  ? 11.007  -15.327 181.806 1.00 0.00 1  30  ARG B NH1  1  
ATOM 5143   N NH2  . ARG B 1 30  ? 10.267  -14.761 183.978 1.00 0.00 ?  30  ARG B NH2  1  
ATOM 5144   H H    . ARG B 1 30  ? 14.033  -21.305 182.870 1.00 0.00 ?  30  ARG B H    1  
ATOM 5145   H HA   . ARG B 1 30  ? 11.501  -20.716 181.520 1.00 0.00 ?  30  ARG B HA   1  
ATOM 5146   H HB2  . ARG B 1 30  ? 14.083  -19.082 181.245 1.00 0.00 ?  30  ARG B HB2  1  
ATOM 5147   H HB3  . ARG B 1 30  ? 12.570  -18.828 180.307 1.00 0.00 ?  30  ARG B HB3  1  
ATOM 5148   H HG2  . ARG B 1 30  ? 12.802  -18.552 183.363 1.00 0.00 ?  30  ARG B HG2  1  
ATOM 5149   H HG3  . ARG B 1 30  ? 12.904  -17.186 182.199 1.00 0.00 ?  30  ARG B HG3  1  
ATOM 5150   H HD2  . ARG B 1 30  ? 10.551  -17.758 181.387 1.00 0.00 ?  30  ARG B HD2  1  
ATOM 5151   H HD3  . ARG B 1 30  ? 10.464  -19.028 182.684 1.00 0.00 ?  30  ARG B HD3  1  
ATOM 5152   H HE   . ARG B 1 30  ? 10.280  -17.310 184.306 1.00 0.00 ?  30  ARG B HE   1  
ATOM 5153   H HH11 . ARG B 1 30  ? 11.263  -16.018 181.131 1.00 0.00 ?  30  ARG B HH11 1  
ATOM 5154   H HH12 . ARG B 1 30  ? 11.041  -14.356 181.567 1.00 0.00 ?  30  ARG B HH12 1  
ATOM 5155   H HH21 . ARG B 1 30  ? 9.982   -15.037 184.896 1.00 0.00 ?  30  ARG B HH21 1  
ATOM 5156   H HH22 . ARG B 1 30  ? 10.303  -13.793 183.736 1.00 0.00 ?  30  ARG B HH22 1  
ATOM 5157   N N    . ILE B 1 31  ? 12.778  -22.712 180.342 1.00 0.00 ?  31  ILE B N    1  
ATOM 5158   C CA   . ILE B 1 31  ? 13.278  -23.560 179.290 1.00 0.00 ?  31  ILE B CA   1  
ATOM 5159   C C    . ILE B 1 31  ? 12.277  -23.473 178.195 1.00 0.00 ?  31  ILE B C    1  
ATOM 5160   O O    . ILE B 1 31  ? 11.178  -22.955 178.403 1.00 0.00 ?  31  ILE B O    1  
ATOM 5161   C CB   . ILE B 1 31  ? 13.429  -25.019 179.668 1.00 0.00 ?  31  ILE B CB   1  
ATOM 5162   C CG1  . ILE B 1 31  ? 12.540  -25.395 180.875 1.00 0.00 ?  31  ILE B CG1  1  
ATOM 5163   C CG2  . ILE B 1 31  ? 14.918  -25.307 179.945 1.00 0.00 ?  31  ILE B CG2  1  
ATOM 5164   C CD1  . ILE B 1 31  ? 11.046  -25.291 180.568 1.00 0.00 ?  31  ILE B CD1  1  
ATOM 5165   H H    . ILE B 1 31  ? 12.146  -23.129 180.989 1.00 0.00 ?  31  ILE B H    1  
ATOM 5166   H HA   . ILE B 1 31  ? 14.215  -23.151 178.943 1.00 0.00 ?  31  ILE B HA   1  
ATOM 5167   H HB   . ILE B 1 31  ? 13.118  -25.645 178.803 1.00 0.00 ?  31  ILE B HB   1  
ATOM 5168   H HG12 . ILE B 1 31  ? 12.770  -26.442 181.173 1.00 0.00 ?  31  ILE B HG12 1  
ATOM 5169   H HG13 . ILE B 1 31  ? 12.782  -24.740 181.737 1.00 0.00 ?  31  ILE B HG13 1  
ATOM 5170   H HG21 . ILE B 1 31  ? 15.511  -24.369 179.927 1.00 0.00 ?  31  ILE B HG21 1  
ATOM 5171   H HG22 . ILE B 1 31  ? 15.326  -25.997 179.178 1.00 0.00 ?  31  ILE B HG22 1  
ATOM 5172   H HG23 . ILE B 1 31  ? 15.037  -25.780 180.944 1.00 0.00 ?  31  ILE B HG23 1  
ATOM 5173   H HD11 . ILE B 1 31  ? 10.725  -24.228 180.569 1.00 0.00 ?  31  ILE B HD11 1  
ATOM 5174   H HD12 . ILE B 1 31  ? 10.456  -25.841 181.332 1.00 0.00 ?  31  ILE B HD12 1  
ATOM 5175   H HD13 . ILE B 1 31  ? 10.829  -25.726 179.570 1.00 0.00 ?  31  ILE B HD13 1  
ATOM 5176   N N    . TRP B 1 32  ? 12.644  -23.947 176.982 1.00 0.00 ?  32  TRP B N    1  
ATOM 5177   C CA   . TRP B 1 32  ? 11.713  -23.901 175.893 1.00 0.00 ?  32  TRP B CA   1  
ATOM 5178   C C    . TRP B 1 32  ? 10.605  -24.820 176.274 1.00 0.00 ?  32  TRP B C    1  
ATOM 5179   O O    . TRP B 1 32  ? 10.827  -25.992 176.574 1.00 0.00 ?  32  TRP B O    1  
ATOM 5180   C CB   . TRP B 1 32  ? 12.306  -24.378 174.554 1.00 0.00 ?  32  TRP B CB   1  
ATOM 5181   C CG   . TRP B 1 32  ? 11.331  -24.281 173.402 1.00 0.00 ?  32  TRP B CG   1  
ATOM 5182   C CD1  . TRP B 1 32  ? 11.097  -23.216 172.581 1.00 0.00 ?  32  TRP B CD1  1  
ATOM 5183   C CD2  . TRP B 1 32  ? 10.459  -25.336 172.944 1.00 0.00 ?  32  TRP B CD2  1  
ATOM 5184   N NE1  . TRP B 1 32  ? 10.140  -23.532 171.657 1.00 0.00 ?  32  TRP B NE1  1  
ATOM 5185   C CE2  . TRP B 1 32  ? 9.739   -24.828 171.864 1.00 0.00 ?  32  TRP B CE2  1  
ATOM 5186   C CE3  . TRP B 1 32  ? 10.253  -26.619 173.366 1.00 0.00 ?  32  TRP B CE3  1  
ATOM 5187   C CZ2  . TRP B 1 32  ? 8.818   -25.584 171.201 1.00 0.00 ?  32  TRP B CZ2  1  
ATOM 5188   C CZ3  . TRP B 1 32  ? 9.323   -27.389 172.698 1.00 0.00 ?  32  TRP B CZ3  1  
ATOM 5189   C CH2  . TRP B 1 32  ? 8.613   -26.877 171.629 1.00 0.00 ?  32  TRP B CH2  1  
ATOM 5190   H H    . TRP B 1 32  ? 13.543  -24.335 176.797 1.00 0.00 ?  32  TRP B H    1  
ATOM 5191   H HA   . TRP B 1 32  ? 11.338  -22.893 175.813 1.00 0.00 ?  32  TRP B HA   1  
ATOM 5192   H HB2  . TRP B 1 32  ? 13.200  -23.764 174.313 1.00 0.00 ?  32  TRP B HB2  1  
ATOM 5193   H HB3  . TRP B 1 32  ? 12.629  -25.435 174.654 1.00 0.00 ?  32  TRP B HB3  1  
ATOM 5194   H HD1  . TRP B 1 32  ? 11.591  -22.258 172.655 1.00 0.00 ?  32  TRP B HD1  1  
ATOM 5195   H HE1  . TRP B 1 32  ? 9.799   -22.936 170.964 1.00 0.00 ?  32  TRP B HE1  1  
ATOM 5196   H HE3  . TRP B 1 32  ? 10.798  -27.039 174.199 1.00 0.00 ?  32  TRP B HE3  1  
ATOM 5197   H HZ2  . TRP B 1 32  ? 8.256   -25.197 170.364 1.00 0.00 ?  32  TRP B HZ2  1  
ATOM 5198   H HZ3  . TRP B 1 32  ? 9.147   -28.406 173.016 1.00 0.00 ?  32  TRP B HZ3  1  
ATOM 5199   H HH2  . TRP B 1 32  ? 7.890   -27.498 171.121 1.00 0.00 ?  32  TRP B HH2  1  
ATOM 5200   N N    . SER B 1 33  ? 9.370   -24.295 176.267 1.00 0.00 ?  33  SER B N    1  
ATOM 5201   C CA   . SER B 1 33  ? 8.257   -25.100 176.652 1.00 0.00 ?  33  SER B CA   1  
ATOM 5202   C C    . SER B 1 33  ? 7.052   -24.507 176.023 1.00 0.00 ?  33  SER B C    1  
ATOM 5203   O O    . SER B 1 33  ? 7.079   -23.366 175.569 1.00 0.00 ?  33  SER B O    1  
ATOM 5204   C CB   . SER B 1 33  ? 8.018   -25.113 178.172 1.00 0.00 ?  33  SER B CB   1  
ATOM 5205   O OG   . SER B 1 33  ? 7.605   -23.822 178.619 1.00 0.00 ?  33  SER B OG   1  
ATOM 5206   H H    . SER B 1 33  ? 9.180   -23.353 176.004 1.00 0.00 ?  33  SER B H    1  
ATOM 5207   H HA   . SER B 1 33  ? 8.413   -26.099 176.278 1.00 0.00 ?  33  SER B HA   1  
ATOM 5208   H HB2  . SER B 1 33  ? 7.228   -25.851 178.427 1.00 0.00 ?  33  SER B HB2  1  
ATOM 5209   H HB3  . SER B 1 33  ? 8.954   -25.390 178.700 1.00 0.00 ?  33  SER B HB3  1  
ATOM 5210   H HG   . SER B 1 33  ? 8.068   -23.181 178.071 1.00 0.00 ?  33  SER B HG   1  
ATOM 5211   N N    . GLY B 1 34  ? 5.968   -25.304 175.955 1.00 0.00 ?  34  GLY B N    1  
ATOM 5212   C CA   . GLY B 1 34  ? 4.740   -24.823 175.401 1.00 0.00 ?  34  GLY B CA   1  
ATOM 5213   C C    . GLY B 1 34  ? 3.864   -24.470 176.556 1.00 0.00 ?  34  GLY B C    1  
ATOM 5214   O O    . GLY B 1 34  ? 2.737   -24.011 176.374 1.00 0.00 ?  34  GLY B O    1  
ATOM 5215   H H    . GLY B 1 34  ? 5.972   -26.247 176.283 1.00 0.00 ?  34  GLY B H    1  
ATOM 5216   H HA2  . GLY B 1 34  ? 4.946   -23.939 174.819 1.00 0.00 ?  34  GLY B HA2  1  
ATOM 5217   H HA3  . GLY B 1 34  ? 4.287   -25.634 174.850 1.00 0.00 ?  34  GLY B HA3  1  
ATOM 5218   N N    . THR B 1 35  ? 4.380   -24.676 177.789 1.00 0.00 ?  35  THR B N    1  
ATOM 5219   C CA   . THR B 1 35  ? 3.602   -24.386 178.962 1.00 0.00 ?  35  THR B CA   1  
ATOM 5220   C C    . THR B 1 35  ? 3.917   -22.994 179.391 1.00 0.00 ?  35  THR B C    1  
ATOM 5221   O O    . THR B 1 35  ? 4.979   -22.461 179.079 1.00 0.00 ?  35  THR B O    1  
ATOM 5222   C CB   . THR B 1 35  ? 3.927   -25.291 180.114 1.00 0.00 ?  35  THR B CB   1  
ATOM 5223   O OG1  . THR B 1 35  ? 5.271   -25.084 180.527 1.00 0.00 ?  35  THR B OG1  1  
ATOM 5224   C CG2  . THR B 1 35  ? 3.731   -26.745 179.661 1.00 0.00 ?  35  THR B CG2  1  
ATOM 5225   H H    . THR B 1 35  ? 5.301   -25.028 177.936 1.00 0.00 ?  35  THR B H    1  
ATOM 5226   H HA   . THR B 1 35  ? 2.558   -24.458 178.703 1.00 0.00 ?  35  THR B HA   1  
ATOM 5227   H HB   . THR B 1 35  ? 3.248   -25.088 180.967 1.00 0.00 ?  35  THR B HB   1  
ATOM 5228   H HG1  . THR B 1 35  ? 5.304   -24.192 180.882 1.00 0.00 ?  35  THR B HG1  1  
ATOM 5229   H HG21 . THR B 1 35  ? 4.712   -27.207 179.418 1.00 0.00 ?  35  THR B HG21 1  
ATOM 5230   H HG22 . THR B 1 35  ? 3.086   -26.785 178.758 1.00 0.00 ?  35  THR B HG22 1  
ATOM 5231   H HG23 . THR B 1 35  ? 3.251   -27.339 180.468 1.00 0.00 ?  35  THR B HG23 1  
ATOM 5232   N N    . ARG B 1 36  ? 2.984   -22.380 180.149 1.00 0.00 ?  36  ARG B N    1  
ATOM 5233   C CA   . ARG B 1 36  ? 3.199   -21.046 180.630 1.00 0.00 ?  36  ARG B CA   1  
ATOM 5234   C C    . ARG B 1 36  ? 3.799   -21.211 181.981 1.00 0.00 ?  36  ARG B C    1  
ATOM 5235   O O    . ARG B 1 36  ? 4.688   -20.468 182.394 1.00 0.00 ?  36  ARG B O    1  
ATOM 5236   C CB   . ARG B 1 36  ? 1.895   -20.256 180.803 1.00 0.00 ?  36  ARG B CB   1  
ATOM 5237   C CG   . ARG B 1 36  ? 1.095   -20.173 179.512 1.00 0.00 ?  36  ARG B CG   1  
ATOM 5238   C CD   . ARG B 1 36  ? -0.257  -19.479 179.703 1.00 0.00 ?  36  ARG B CD   1  
ATOM 5239   N NE   . ARG B 1 36  ? -1.044  -20.243 180.720 1.00 0.00 ?  36  ARG B NE   1  
ATOM 5240   C CZ   . ARG B 1 36  ? -1.692  -21.395 180.371 1.00 0.00 ?  36  ARG B CZ   1  
ATOM 5241   N NH1  . ARG B 1 36  ? -1.513  -21.936 179.133 1.00 0.00 1  36  ARG B NH1  1  
ATOM 5242   N NH2  . ARG B 1 36  ? -2.495  -22.026 181.272 1.00 0.00 ?  36  ARG B NH2  1  
ATOM 5243   H H    . ARG B 1 36  ? 2.123   -22.815 180.402 1.00 0.00 ?  36  ARG B H    1  
ATOM 5244   H HA   . ARG B 1 36  ? 3.886   -20.537 179.973 1.00 0.00 ?  36  ARG B HA   1  
ATOM 5245   H HB2  . ARG B 1 36  ? 1.277   -20.740 181.589 1.00 0.00 ?  36  ARG B HB2  1  
ATOM 5246   H HB3  . ARG B 1 36  ? 2.135   -19.228 181.137 1.00 0.00 ?  36  ARG B HB3  1  
ATOM 5247   H HG2  . ARG B 1 36  ? 1.684   -19.615 178.754 1.00 0.00 ?  36  ARG B HG2  1  
ATOM 5248   H HG3  . ARG B 1 36  ? 0.924   -21.201 179.125 1.00 0.00 ?  36  ARG B HG3  1  
ATOM 5249   H HD2  . ARG B 1 36  ? -0.121  -18.441 180.073 1.00 0.00 ?  36  ARG B HD2  1  
ATOM 5250   H HD3  . ARG B 1 36  ? -0.836  -19.470 178.756 1.00 0.00 ?  36  ARG B HD3  1  
ATOM 5251   H HE   . ARG B 1 36  ? -1.134  -19.882 181.653 1.00 0.00 ?  36  ARG B HE   1  
ATOM 5252   H HH11 . ARG B 1 36  ? -0.908  -21.490 178.474 1.00 0.00 ?  36  ARG B HH11 1  
ATOM 5253   H HH12 . ARG B 1 36  ? -1.982  -22.785 178.887 1.00 0.00 ?  36  ARG B HH12 1  
ATOM 5254   H HH21 . ARG B 1 36  ? -2.613  -21.645 182.190 1.00 0.00 ?  36  ARG B HH21 1  
ATOM 5255   H HH22 . ARG B 1 36  ? -2.968  -22.869 181.018 1.00 0.00 ?  36  ARG B HH22 1  
ATOM 5256   N N    . GLU B 1 37  ? 3.294   -22.227 182.699 1.00 0.00 ?  37  GLU B N    1  
ATOM 5257   C CA   . GLU B 1 37  ? 3.773   -22.529 184.007 1.00 0.00 ?  37  GLU B CA   1  
ATOM 5258   C C    . GLU B 1 37  ? 3.515   -23.989 184.150 1.00 0.00 ?  37  GLU B C    1  
ATOM 5259   O O    . GLU B 1 37  ? 2.650   -24.542 183.467 1.00 0.00 ?  37  GLU B O    1  
ATOM 5260   C CB   . GLU B 1 37  ? 3.067   -21.754 185.148 1.00 0.00 ?  37  GLU B CB   1  
ATOM 5261   C CG   . GLU B 1 37  ? 3.791   -21.854 186.506 1.00 0.00 ?  37  GLU B CG   1  
ATOM 5262   C CD   . GLU B 1 37  ? 5.157   -21.169 186.408 1.00 0.00 ?  37  GLU B CD   1  
ATOM 5263   O OE1  . GLU B 1 37  ? 6.057   -21.524 187.219 1.00 0.00 ?  37  GLU B OE1  1  
ATOM 5264   O OE2  . GLU B 1 37  ? 5.314   -20.269 185.542 1.00 0.00 -1 37  GLU B OE2  1  
ATOM 5265   H H    . GLU B 1 37  ? 2.565   -22.813 182.351 1.00 0.00 ?  37  GLU B H    1  
ATOM 5266   H HA   . GLU B 1 37  ? 4.839   -22.351 184.019 1.00 0.00 ?  37  GLU B HA   1  
ATOM 5267   H HB2  . GLU B 1 37  ? 2.989   -20.684 184.860 1.00 0.00 ?  37  GLU B HB2  1  
ATOM 5268   H HB3  . GLU B 1 37  ? 2.038   -22.150 185.269 1.00 0.00 ?  37  GLU B HB3  1  
ATOM 5269   H HG2  . GLU B 1 37  ? 3.184   -21.353 187.293 1.00 0.00 ?  37  GLU B HG2  1  
ATOM 5270   H HG3  . GLU B 1 37  ? 3.936   -22.916 186.789 1.00 0.00 ?  37  GLU B HG3  1  
ATOM 5271   N N    . VAL B 1 38  ? 4.275   -24.651 185.028 1.00 0.00 ?  38  VAL B N    1  
ATOM 5272   C CA   . VAL B 1 38  ? 4.144   -26.065 185.204 1.00 0.00 ?  38  VAL B CA   1  
ATOM 5273   C C    . VAL B 1 38  ? 2.772   -26.392 185.727 1.00 0.00 ?  38  VAL B C    1  
ATOM 5274   O O    . VAL B 1 38  ? 2.263   -27.489 185.497 1.00 0.00 ?  38  VAL B O    1  
ATOM 5275   C CB   . VAL B 1 38  ? 5.172   -26.601 186.152 1.00 0.00 ?  38  VAL B CB   1  
ATOM 5276   C CG1  . VAL B 1 38  ? 6.546   -26.225 185.582 1.00 0.00 ?  38  VAL B CG1  1  
ATOM 5277   C CG2  . VAL B 1 38  ? 4.946   -26.004 187.553 1.00 0.00 ?  38  VAL B CG2  1  
ATOM 5278   H H    . VAL B 1 38  ? 4.959   -24.195 185.594 1.00 0.00 ?  38  VAL B H    1  
ATOM 5279   H HA   . VAL B 1 38  ? 4.263   -26.521 184.233 1.00 0.00 ?  38  VAL B HA   1  
ATOM 5280   H HB   . VAL B 1 38  ? 5.096   -27.707 186.213 1.00 0.00 ?  38  VAL B HB   1  
ATOM 5281   H HG11 . VAL B 1 38  ? 7.343   -26.676 186.193 1.00 0.00 ?  38  VAL B HG11 1  
ATOM 5282   H HG12 . VAL B 1 38  ? 6.679   -25.122 185.590 1.00 0.00 ?  38  VAL B HG12 1  
ATOM 5283   H HG13 . VAL B 1 38  ? 6.645   -26.586 184.538 1.00 0.00 ?  38  VAL B HG13 1  
ATOM 5284   H HG21 . VAL B 1 38  ? 4.073   -26.485 188.040 1.00 0.00 ?  38  VAL B HG21 1  
ATOM 5285   H HG22 . VAL B 1 38  ? 4.758   -24.912 187.484 1.00 0.00 ?  38  VAL B HG22 1  
ATOM 5286   H HG23 . VAL B 1 38  ? 5.841   -26.169 188.191 1.00 0.00 ?  38  VAL B HG23 1  
ATOM 5287   N N    . ILE B 1 39  ? 2.138   -25.448 186.443 1.00 0.00 ?  39  ILE B N    1  
ATOM 5288   C CA   . ILE B 1 39  ? 0.829   -25.694 186.971 1.00 0.00 ?  39  ILE B CA   1  
ATOM 5289   C C    . ILE B 1 39  ? -0.170  -25.363 185.896 1.00 0.00 ?  39  ILE B C    1  
ATOM 5290   O O    . ILE B 1 39  ? -1.247  -25.954 185.823 1.00 0.00 ?  39  ILE B O    1  
ATOM 5291   C CB   . ILE B 1 39  ? 0.513   -24.855 188.174 1.00 0.00 ?  39  ILE B CB   1  
ATOM 5292   C CG1  . ILE B 1 39  ? 1.631   -24.971 189.236 1.00 0.00 ?  39  ILE B CG1  1  
ATOM 5293   C CG2  . ILE B 1 39  ? -0.849  -25.315 188.722 1.00 0.00 ?  39  ILE B CG2  1  
ATOM 5294   C CD1  . ILE B 1 39  ? 1.838   -26.397 189.764 1.00 0.00 ?  39  ILE B CD1  1  
ATOM 5295   H H    . ILE B 1 39  ? 2.539   -24.555 186.635 1.00 0.00 ?  39  ILE B H    1  
ATOM 5296   H HA   . ILE B 1 39  ? 0.760   -26.745 187.212 1.00 0.00 ?  39  ILE B HA   1  
ATOM 5297   H HB   . ILE B 1 39  ? 0.427   -23.790 187.868 1.00 0.00 ?  39  ILE B HB   1  
ATOM 5298   H HG12 . ILE B 1 39  ? 2.584   -24.611 188.792 1.00 0.00 ?  39  ILE B HG12 1  
ATOM 5299   H HG13 . ILE B 1 39  ? 1.381   -24.308 190.089 1.00 0.00 ?  39  ILE B HG13 1  
ATOM 5300   H HG21 . ILE B 1 39  ? -1.665  -25.017 188.032 1.00 0.00 ?  39  ILE B HG21 1  
ATOM 5301   H HG22 . ILE B 1 39  ? -1.038  -24.855 189.714 1.00 0.00 ?  39  ILE B HG22 1  
ATOM 5302   H HG23 . ILE B 1 39  ? -0.866  -26.421 188.834 1.00 0.00 ?  39  ILE B HG23 1  
ATOM 5303   H HD11 . ILE B 1 39  ? 2.295   -27.044 188.986 1.00 0.00 ?  39  ILE B HD11 1  
ATOM 5304   H HD12 . ILE B 1 39  ? 0.870   -26.843 190.071 1.00 0.00 ?  39  ILE B HD12 1  
ATOM 5305   H HD13 . ILE B 1 39  ? 2.511   -26.382 190.647 1.00 0.00 ?  39  ILE B HD13 1  
ATOM 5306   N N    . ALA B 1 40  ? 0.190   -24.398 185.021 1.00 0.00 ?  40  ALA B N    1  
ATOM 5307   C CA   . ALA B 1 40  ? -0.699  -23.941 183.972 1.00 0.00 ?  40  ALA B CA   1  
ATOM 5308   C C    . ALA B 1 40  ? -0.950  -25.022 182.958 1.00 0.00 ?  40  ALA B C    1  
ATOM 5309   O O    . ALA B 1 40  ? -1.850  -24.886 182.128 1.00 0.00 ?  40  ALA B O    1  
ATOM 5310   C CB   . ALA B 1 40  ? -0.155  -22.725 183.206 1.00 0.00 ?  40  ALA B CB   1  
ATOM 5311   H H    . ALA B 1 40  ? 1.085   -23.958 185.058 1.00 0.00 ?  40  ALA B H    1  
ATOM 5312   H HA   . ALA B 1 40  ? -1.635  -23.684 184.440 1.00 0.00 ?  40  ALA B HA   1  
ATOM 5313   H HB1  . ALA B 1 40  ? 0.814   -22.401 183.633 1.00 0.00 ?  40  ALA B HB1  1  
ATOM 5314   H HB2  . ALA B 1 40  ? -0.871  -21.878 183.269 1.00 0.00 ?  40  ALA B HB2  1  
ATOM 5315   H HB3  . ALA B 1 40  ? -0.001  -22.981 182.136 1.00 0.00 ?  40  ALA B HB3  1  
ATOM 5316   N N    . TYR B 1 41  ? -0.144  -26.100 182.981 1.00 0.00 ?  41  TYR B N    1  
ATOM 5317   C CA   . TYR B 1 41  ? -0.289  -27.178 182.028 1.00 0.00 ?  41  TYR B CA   1  
ATOM 5318   C C    . TYR B 1 41  ? -1.672  -27.772 182.096 1.00 0.00 ?  41  TYR B C    1  
ATOM 5319   O O    . TYR B 1 41  ? -2.162  -28.287 181.097 1.00 0.00 ?  41  TYR B O    1  
ATOM 5320   C CB   . TYR B 1 41  ? 0.710   -28.323 182.249 1.00 0.00 ?  41  TYR B CB   1  
ATOM 5321   C CG   . TYR B 1 41  ? 0.584   -29.413 181.240 1.00 0.00 ?  41  TYR B CG   1  
ATOM 5322   C CD1  . TYR B 1 41  ? 0.010   -30.618 181.580 1.00 0.00 ?  41  TYR B CD1  1  
ATOM 5323   C CD2  . TYR B 1 41  ? 1.033   -29.226 179.952 1.00 0.00 ?  41  TYR B CD2  1  
ATOM 5324   C CE1  . TYR B 1 41  ? -0.108  -31.621 180.646 1.00 0.00 ?  41  TYR B CE1  1  
ATOM 5325   C CE2  . TYR B 1 41  ? 0.914   -30.229 179.019 1.00 0.00 ?  41  TYR B CE2  1  
ATOM 5326   C CZ   . TYR B 1 41  ? 0.344   -31.426 179.366 1.00 0.00 ?  41  TYR B CZ   1  
ATOM 5327   O OH   . TYR B 1 41  ? 0.224   -32.455 178.410 1.00 0.00 ?  41  TYR B OH   1  
ATOM 5328   H H    . TYR B 1 41  ? 0.586   -26.202 183.653 1.00 0.00 ?  41  TYR B H    1  
ATOM 5329   H HA   . TYR B 1 41  ? -0.143  -26.754 181.047 1.00 0.00 ?  41  TYR B HA   1  
ATOM 5330   H HB2  . TYR B 1 41  ? 1.749   -27.937 182.190 1.00 0.00 ?  41  TYR B HB2  1  
ATOM 5331   H HB3  . TYR B 1 41  ? 0.552   -28.775 183.252 1.00 0.00 ?  41  TYR B HB3  1  
ATOM 5332   H HD1  . TYR B 1 41  ? -0.347  -30.777 182.587 1.00 0.00 ?  41  TYR B HD1  1  
ATOM 5333   H HD2  . TYR B 1 41  ? 1.482   -28.285 179.672 1.00 0.00 ?  41  TYR B HD2  1  
ATOM 5334   H HE1  . TYR B 1 41  ? -0.561  -32.562 180.921 1.00 0.00 ?  41  TYR B HE1  1  
ATOM 5335   H HE2  . TYR B 1 41  ? 1.271   -30.074 178.011 1.00 0.00 ?  41  TYR B HE2  1  
ATOM 5336   H HH   . TYR B 1 41  ? 1.006   -33.010 178.473 1.00 0.00 ?  41  TYR B HH   1  
ATOM 5337   N N    . GLY B 1 42  ? -2.325  -27.704 183.273 1.00 0.00 ?  42  GLY B N    1  
ATOM 5338   C CA   . GLY B 1 42  ? -3.624  -28.312 183.458 1.00 0.00 ?  42  GLY B CA   1  
ATOM 5339   C C    . GLY B 1 42  ? -4.662  -27.762 182.501 1.00 0.00 ?  42  GLY B C    1  
ATOM 5340   O O    . GLY B 1 42  ? -5.510  -28.518 182.029 1.00 0.00 ?  42  GLY B O    1  
ATOM 5341   H H    . GLY B 1 42  ? -1.943  -27.236 184.066 1.00 0.00 ?  42  GLY B H    1  
ATOM 5342   H HA2  . GLY B 1 42  ? -3.510  -29.366 183.265 1.00 0.00 ?  42  GLY B HA2  1  
ATOM 5343   H HA3  . GLY B 1 42  ? -3.932  -28.084 184.470 1.00 0.00 ?  42  GLY B HA3  1  
ATOM 5344   N N    . MET B 1 43  ? -4.669  -26.449 182.189 1.00 0.00 ?  43  MET B N    1  
ATOM 5345   C CA   . MET B 1 43  ? -5.712  -25.958 181.310 1.00 0.00 ?  43  MET B CA   1  
ATOM 5346   C C    . MET B 1 43  ? -5.458  -26.472 179.893 1.00 0.00 ?  43  MET B C    1  
ATOM 5347   O O    . MET B 1 43  ? -4.407  -26.195 179.316 1.00 0.00 ?  43  MET B O    1  
ATOM 5348   C CB   . MET B 1 43  ? -5.792  -24.424 181.242 1.00 0.00 ?  43  MET B CB   1  
ATOM 5349   C CG   . MET B 1 43  ? -6.911  -23.946 180.310 1.00 0.00 ?  43  MET B CG   1  
ATOM 5350   S SD   . MET B 1 43  ? -7.188  -22.156 180.388 1.00 0.00 ?  43  MET B SD   1  
ATOM 5351   C CE   . MET B 1 43  ? -8.155  -22.231 181.921 1.00 0.00 ?  43  MET B CE   1  
ATOM 5352   H H    . MET B 1 43  ? -3.997  -25.794 182.526 1.00 0.00 ?  43  MET B H    1  
ATOM 5353   H HA   . MET B 1 43  ? -6.629  -26.342 181.707 1.00 0.00 ?  43  MET B HA   1  
ATOM 5354   H HB2  . MET B 1 43  ? -5.968  -24.022 182.263 1.00 0.00 ?  43  MET B HB2  1  
ATOM 5355   H HB3  . MET B 1 43  ? -4.824  -24.022 180.875 1.00 0.00 ?  43  MET B HB3  1  
ATOM 5356   H HG2  . MET B 1 43  ? -6.655  -24.234 179.267 1.00 0.00 ?  43  MET B HG2  1  
ATOM 5357   H HG3  . MET B 1 43  ? -7.846  -24.479 180.582 1.00 0.00 ?  43  MET B HG3  1  
ATOM 5358   H HE1  . MET B 1 43  ? -9.105  -22.783 181.764 1.00 0.00 ?  43  MET B HE1  1  
ATOM 5359   H HE2  . MET B 1 43  ? -8.407  -21.213 182.282 1.00 0.00 ?  43  MET B HE2  1  
ATOM 5360   H HE3  . MET B 1 43  ? -7.586  -22.751 182.722 1.00 0.00 ?  43  MET B HE3  1  
ATOM 5361   N N    . PRO B 1 44  ? -6.404  -27.225 179.308 1.00 0.00 ?  44  PRO B N    1  
ATOM 5362   C CA   . PRO B 1 44  ? -6.250  -27.762 177.957 1.00 0.00 ?  44  PRO B CA   1  
ATOM 5363   C C    . PRO B 1 44  ? -6.703  -26.855 176.837 1.00 0.00 ?  44  PRO B C    1  
ATOM 5364   O O    . PRO B 1 44  ? -6.245  -26.983 175.703 1.00 0.00 ?  44  PRO B O    1  
ATOM 5365   C CB   . PRO B 1 44  ? -7.136  -28.995 177.989 1.00 0.00 ?  44  PRO B CB   1  
ATOM 5366   C CG   . PRO B 1 44  ? -8.321  -28.542 178.837 1.00 0.00 ?  44  PRO B CG   1  
ATOM 5367   C CD   . PRO B 1 44  ? -7.714  -27.596 179.875 1.00 0.00 ?  44  PRO B CD   1  
ATOM 5368   H HA   . PRO B 1 44  ? -5.233  -28.068 177.773 1.00 0.00 ?  44  PRO B HA   1  
ATOM 5369   H HB2  . PRO B 1 44  ? -7.463  -29.276 176.964 1.00 0.00 ?  44  PRO B HB2  1  
ATOM 5370   H HB3  . PRO B 1 44  ? -6.614  -29.848 178.470 1.00 0.00 ?  44  PRO B HB3  1  
ATOM 5371   H HG2  . PRO B 1 44  ? -9.066  -28.009 178.207 1.00 0.00 ?  44  PRO B HG2  1  
ATOM 5372   H HG3  . PRO B 1 44  ? -8.808  -29.403 179.333 1.00 0.00 ?  44  PRO B HG3  1  
ATOM 5373   H HD2  . PRO B 1 44  ? -8.359  -26.702 180.010 1.00 0.00 ?  44  PRO B HD2  1  
ATOM 5374   H HD3  . PRO B 1 44  ? -7.596  -28.116 180.850 1.00 0.00 ?  44  PRO B HD3  1  
ATOM 5375   N N    . ALA B 1 45  ? -7.623  -25.915 177.142 1.00 0.00 ?  45  ALA B N    1  
ATOM 5376   C CA   . ALA B 1 45  ? -8.174  -25.026 176.135 1.00 0.00 ?  45  ALA B CA   1  
ATOM 5377   C C    . ALA B 1 45  ? -7.158  -23.995 175.771 1.00 0.00 ?  45  ALA B C    1  
ATOM 5378   O O    . ALA B 1 45  ? -7.302  -23.272 174.786 1.00 0.00 ?  45  ALA B O    1  
ATOM 5379   C CB   . ALA B 1 45  ? -9.434  -24.286 176.609 1.00 0.00 ?  45  ALA B CB   1  
ATOM 5380   H H    . ALA B 1 45  ? -7.965  -25.789 178.070 1.00 0.00 ?  45  ALA B H    1  
ATOM 5381   H HA   . ALA B 1 45  ? -8.399  -25.621 175.265 1.00 0.00 ?  45  ALA B HA   1  
ATOM 5382   H HB1  . ALA B 1 45  ? -10.266 -25.005 176.769 1.00 0.00 ?  45  ALA B HB1  1  
ATOM 5383   H HB2  . ALA B 1 45  ? -9.752  -23.540 175.850 1.00 0.00 ?  45  ALA B HB2  1  
ATOM 5384   H HB3  . ALA B 1 45  ? -9.234  -23.757 177.565 1.00 0.00 ?  45  ALA B HB3  1  
ATOM 5385   N N    . SER B 1 46  ? -6.115  -23.905 176.584 1.00 0.00 ?  46  SER B N    1  
ATOM 5386   C CA   . SER B 1 46  ? -5.100  -22.919 176.412 1.00 0.00 ?  46  SER B CA   1  
ATOM 5387   C C    . SER B 1 46  ? -4.292  -23.137 175.166 1.00 0.00 ?  46  SER B C    1  
ATOM 5388   O O    . SER B 1 46  ? -3.509  -22.266 174.846 1.00 0.00 ?  46  SER B O    1  
ATOM 5389   C CB   . SER B 1 46  ? -4.119  -22.874 177.584 1.00 0.00 ?  46  SER B CB   1  
ATOM 5390   O OG   . SER B 1 46  ? -3.378  -24.082 177.651 1.00 0.00 ?  46  SER B OG   1  
ATOM 5391   H H    . SER B 1 46  ? -5.994  -24.524 177.355 1.00 0.00 ?  46  SER B H    1  
ATOM 5392   H HA   . SER B 1 46  ? -5.599  -21.968 176.332 1.00 0.00 ?  46  SER B HA   1  
ATOM 5393   H HB2  . SER B 1 46  ? -3.412  -22.026 177.453 1.00 0.00 ?  46  SER B HB2  1  
ATOM 5394   H HB3  . SER B 1 46  ? -4.671  -22.739 178.538 1.00 0.00 ?  46  SER B HB3  1  
ATOM 5395   H HG   . SER B 1 46  ? -2.611  -23.954 177.085 1.00 0.00 ?  46  SER B HG   1  
ATOM 5396   N N    . VAL B 1 47  ? -4.407  -24.308 174.485 1.00 0.00 ?  47  VAL B N    1  
ATOM 5397   C CA   . VAL B 1 47  ? -3.578  -24.599 173.318 1.00 0.00 ?  47  VAL B CA   1  
ATOM 5398   C C    . VAL B 1 47  ? -3.477  -23.420 172.349 1.00 0.00 ?  47  VAL B C    1  
ATOM 5399   O O    . VAL B 1 47  ? -2.397  -23.165 171.813 1.00 0.00 ?  47  VAL B O    1  
ATOM 5400   C CB   . VAL B 1 47  ? -4.050  -25.804 172.541 1.00 0.00 ?  47  VAL B CB   1  
ATOM 5401   C CG1  . VAL B 1 47  ? -3.867  -27.043 173.434 1.00 0.00 ?  47  VAL B CG1  1  
ATOM 5402   C CG2  . VAL B 1 47  ? -5.519  -25.608 172.112 1.00 0.00 ?  47  VAL B CG2  1  
ATOM 5403   H H    . VAL B 1 47  ? -5.057  -25.016 174.750 1.00 0.00 ?  47  VAL B H    1  
ATOM 5404   H HA   . VAL B 1 47  ? -2.588  -24.794 173.697 1.00 0.00 ?  47  VAL B HA   1  
ATOM 5405   H HB   . VAL B 1 47  ? -3.427  -25.929 171.630 1.00 0.00 ?  47  VAL B HB   1  
ATOM 5406   H HG11 . VAL B 1 47  ? -4.794  -27.656 173.436 1.00 0.00 ?  47  VAL B HG11 1  
ATOM 5407   H HG12 . VAL B 1 47  ? -3.642  -26.737 174.478 1.00 0.00 ?  47  VAL B HG12 1  
ATOM 5408   H HG13 . VAL B 1 47  ? -3.030  -27.669 173.059 1.00 0.00 ?  47  VAL B HG13 1  
ATOM 5409   H HG21 . VAL B 1 47  ? -6.140  -25.290 172.975 1.00 0.00 ?  47  VAL B HG21 1  
ATOM 5410   H HG22 . VAL B 1 47  ? -5.931  -26.558 171.712 1.00 0.00 ?  47  VAL B HG22 1  
ATOM 5411   H HG23 . VAL B 1 47  ? -5.589  -24.833 171.320 1.00 0.00 ?  47  VAL B HG23 1  
ATOM 5412   N N    . TRP B 1 48  ? -4.569  -22.668 172.098 1.00 0.00 ?  48  TRP B N    1  
ATOM 5413   C CA   . TRP B 1 48  ? -4.482  -21.542 171.185 1.00 0.00 ?  48  TRP B CA   1  
ATOM 5414   C C    . TRP B 1 48  ? -3.581  -20.477 171.762 1.00 0.00 ?  48  TRP B C    1  
ATOM 5415   O O    . TRP B 1 48  ? -2.693  -19.946 171.091 1.00 0.00 ?  48  TRP B O    1  
ATOM 5416   C CB   . TRP B 1 48  ? -5.844  -20.886 170.907 1.00 0.00 ?  48  TRP B CB   1  
ATOM 5417   C CG   . TRP B 1 48  ? -5.753  -19.714 169.959 1.00 0.00 ?  48  TRP B CG   1  
ATOM 5418   C CD1  . TRP B 1 48  ? -5.848  -18.383 170.247 1.00 0.00 ?  48  TRP B CD1  1  
ATOM 5419   C CD2  . TRP B 1 48  ? -5.537  -19.799 168.534 1.00 0.00 ?  48  TRP B CD2  1  
ATOM 5420   N NE1  . TRP B 1 48  ? -5.710  -17.641 169.106 1.00 0.00 ?  48  TRP B NE1  1  
ATOM 5421   C CE2  . TRP B 1 48  ? -5.519  -18.493 168.047 1.00 0.00 ?  48  TRP B CE2  1  
ATOM 5422   C CE3  . TRP B 1 48  ? -5.367  -20.854 167.684 1.00 0.00 ?  48  TRP B CE3  1  
ATOM 5423   C CZ2  . TRP B 1 48  ? -5.334  -18.229 166.723 1.00 0.00 ?  48  TRP B CZ2  1  
ATOM 5424   C CZ3  . TRP B 1 48  ? -5.179  -20.592 166.343 1.00 0.00 ?  48  TRP B CZ3  1  
ATOM 5425   C CH2  . TRP B 1 48  ? -5.162  -19.295 165.868 1.00 0.00 ?  48  TRP B CH2  1  
ATOM 5426   H H    . TRP B 1 48  ? -5.458  -22.846 172.514 1.00 0.00 ?  48  TRP B H    1  
ATOM 5427   H HA   . TRP B 1 48  ? -4.052  -21.904 170.265 1.00 0.00 ?  48  TRP B HA   1  
ATOM 5428   H HB2  . TRP B 1 48  ? -6.531  -21.643 170.472 1.00 0.00 ?  48  TRP B HB2  1  
ATOM 5429   H HB3  . TRP B 1 48  ? -6.280  -20.532 171.865 1.00 0.00 ?  48  TRP B HB3  1  
ATOM 5430   H HD1  . TRP B 1 48  ? -6.011  -17.974 171.233 1.00 0.00 ?  48  TRP B HD1  1  
ATOM 5431   H HE1  . TRP B 1 48  ? -5.743  -16.667 169.053 1.00 0.00 ?  48  TRP B HE1  1  
ATOM 5432   H HE3  . TRP B 1 48  ? -5.378  -21.875 168.036 1.00 0.00 ?  48  TRP B HE3  1  
ATOM 5433   H HZ2  . TRP B 1 48  ? -5.318  -17.220 166.338 1.00 0.00 ?  48  TRP B HZ2  1  
ATOM 5434   H HZ3  . TRP B 1 48  ? -5.043  -21.413 165.655 1.00 0.00 ?  48  TRP B HZ3  1  
ATOM 5435   H HH2  . TRP B 1 48  ? -5.012  -19.115 164.814 1.00 0.00 ?  48  TRP B HH2  1  
ATOM 5436   N N    . ARG B 1 49  ? -3.799  -20.163 173.047 1.00 0.00 ?  49  ARG B N    1  
ATOM 5437   C CA   . ARG B 1 49  ? -3.063  -19.120 173.717 1.00 0.00 ?  49  ARG B CA   1  
ATOM 5438   C C    . ARG B 1 49  ? -1.641  -19.535 173.952 1.00 0.00 ?  49  ARG B C    1  
ATOM 5439   O O    . ARG B 1 49  ? -0.799  -18.691 174.267 1.00 0.00 ?  49  ARG B O    1  
ATOM 5440   C CB   . ARG B 1 49  ? -3.713  -18.769 175.060 1.00 0.00 ?  49  ARG B CB   1  
ATOM 5441   C CG   . ARG B 1 49  ? -5.051  -18.056 174.857 1.00 0.00 ?  49  ARG B CG   1  
ATOM 5442   C CD   . ARG B 1 49  ? -5.909  -18.024 176.120 1.00 0.00 ?  49  ARG B CD   1  
ATOM 5443   N NE   . ARG B 1 49  ? -6.386  -19.413 176.362 1.00 0.00 ?  49  ARG B NE   1  
ATOM 5444   C CZ   . ARG B 1 49  ? -7.185  -19.694 177.427 1.00 0.00 ?  49  ARG B CZ   1  
ATOM 5445   N NH1  . ARG B 1 49  ? -7.517  -18.712 178.314 1.00 0.00 1  49  ARG B NH1  1  
ATOM 5446   N NH2  . ARG B 1 49  ? -7.648  -20.966 177.607 1.00 0.00 ?  49  ARG B NH2  1  
ATOM 5447   H H    . ARG B 1 49  ? -4.480  -20.639 173.597 1.00 0.00 ?  49  ARG B H    1  
ATOM 5448   H HA   . ARG B 1 49  ? -3.072  -18.257 173.072 1.00 0.00 ?  49  ARG B HA   1  
ATOM 5449   H HB2  . ARG B 1 49  ? -3.874  -19.701 175.645 1.00 0.00 ?  49  ARG B HB2  1  
ATOM 5450   H HB3  . ARG B 1 49  ? -3.034  -18.107 175.637 1.00 0.00 ?  49  ARG B HB3  1  
ATOM 5451   H HG2  . ARG B 1 49  ? -4.858  -17.013 174.527 1.00 0.00 ?  49  ARG B HG2  1  
ATOM 5452   H HG3  . ARG B 1 49  ? -5.615  -18.570 174.049 1.00 0.00 ?  49  ARG B HG3  1  
ATOM 5453   H HD2  . ARG B 1 49  ? -5.315  -17.692 177.000 1.00 0.00 ?  49  ARG B HD2  1  
ATOM 5454   H HD3  . ARG B 1 49  ? -6.796  -17.370 175.987 1.00 0.00 ?  49  ARG B HD3  1  
ATOM 5455   H HE   . ARG B 1 49  ? -6.131  -20.144 175.727 1.00 0.00 ?  49  ARG B HE   1  
ATOM 5456   H HH11 . ARG B 1 49  ? -7.174  -17.781 178.182 1.00 0.00 ?  49  ARG B HH11 1  
ATOM 5457   H HH12 . ARG B 1 49  ? -8.105  -18.921 179.095 1.00 0.00 ?  49  ARG B HH12 1  
ATOM 5458   H HH21 . ARG B 1 49  ? -7.397  -21.686 176.960 1.00 0.00 ?  49  ARG B HH21 1  
ATOM 5459   H HH22 . ARG B 1 49  ? -8.239  -21.176 178.387 1.00 0.00 ?  49  ARG B HH22 1  
ATOM 5460   N N    . ASP B 1 50  ? -1.348  -20.846 173.843 1.00 0.00 ?  50  ASP B N    1  
ATOM 5461   C CA   . ASP B 1 50  ? -0.007  -21.317 174.048 1.00 0.00 ?  50  ASP B CA   1  
ATOM 5462   C C    . ASP B 1 50  ? 0.855   -20.686 173.002 1.00 0.00 ?  50  ASP B C    1  
ATOM 5463   O O    . ASP B 1 50  ? 2.004   -20.351 173.260 1.00 0.00 ?  50  ASP B O    1  
ATOM 5464   C CB   . ASP B 1 50  ? 0.152   -22.844 173.936 1.00 0.00 ?  50  ASP B CB   1  
ATOM 5465   C CG   . ASP B 1 50  ? -0.474  -23.575 175.118 1.00 0.00 ?  50  ASP B CG   1  
ATOM 5466   O OD1  . ASP B 1 50  ? -0.822  -22.896 176.121 1.00 0.00 ?  50  ASP B OD1  1  
ATOM 5467   O OD2  . ASP B 1 50  ? -0.603  -24.826 175.039 1.00 0.00 -1 50  ASP B OD2  1  
ATOM 5468   H H    . ASP B 1 50  ? -2.035  -21.533 173.626 1.00 0.00 ?  50  ASP B H    1  
ATOM 5469   H HA   . ASP B 1 50  ? 0.312   -20.976 175.022 1.00 0.00 ?  50  ASP B HA   1  
ATOM 5470   H HB2  . ASP B 1 50  ? -0.326  -23.200 173.000 1.00 0.00 ?  50  ASP B HB2  1  
ATOM 5471   H HB3  . ASP B 1 50  ? 1.232   -23.098 173.894 1.00 0.00 ?  50  ASP B HB3  1  
ATOM 5472   N N    . LEU B 1 51  ? 0.307   -20.537 171.778 1.00 0.00 ?  51  LEU B N    1  
ATOM 5473   C CA   . LEU B 1 51  ? 1.053   -19.945 170.691 1.00 0.00 ?  51  LEU B CA   1  
ATOM 5474   C C    . LEU B 1 51  ? 1.395   -18.533 171.046 1.00 0.00 ?  51  LEU B C    1  
ATOM 5475   O O    . LEU B 1 51  ? 2.474   -18.065 170.704 1.00 0.00 ?  51  LEU B O    1  
ATOM 5476   C CB   . LEU B 1 51  ? 0.272   -19.915 169.366 1.00 0.00 ?  51  LEU B CB   1  
ATOM 5477   C CG   . LEU B 1 51  ? 0.061   -21.315 168.767 1.00 0.00 ?  51  LEU B CG   1  
ATOM 5478   C CD1  . LEU B 1 51  ? -0.904  -21.271 167.570 1.00 0.00 ?  51  LEU B CD1  1  
ATOM 5479   C CD2  . LEU B 1 51  ? 1.399   -21.969 168.380 1.00 0.00 ?  51  LEU B CD2  1  
ATOM 5480   H H    . LEU B 1 51  ? -0.627  -20.831 171.570 1.00 0.00 ?  51  LEU B H    1  
ATOM 5481   H HA   . LEU B 1 51  ? 1.963   -20.511 170.575 1.00 0.00 ?  51  LEU B HA   1  
ATOM 5482   H HB2  . LEU B 1 51  ? -0.719  -19.440 169.543 1.00 0.00 ?  51  LEU B HB2  1  
ATOM 5483   H HB3  . LEU B 1 51  ? 0.826   -19.294 168.633 1.00 0.00 ?  51  LEU B HB3  1  
ATOM 5484   H HG   . LEU B 1 51  ? -0.407  -21.949 169.551 1.00 0.00 ?  51  LEU B HG   1  
ATOM 5485   H HD11 . LEU B 1 51  ? -1.488  -22.214 167.510 1.00 0.00 ?  51  LEU B HD11 1  
ATOM 5486   H HD12 . LEU B 1 51  ? -0.338  -21.143 166.623 1.00 0.00 ?  51  LEU B HD12 1  
ATOM 5487   H HD13 . LEU B 1 51  ? -1.612  -20.422 167.677 1.00 0.00 ?  51  LEU B HD13 1  
ATOM 5488   H HD21 . LEU B 1 51  ? 2.147   -21.191 168.116 1.00 0.00 ?  51  LEU B HD21 1  
ATOM 5489   H HD22 . LEU B 1 51  ? 1.261   -22.640 167.506 1.00 0.00 ?  51  LEU B HD22 1  
ATOM 5490   H HD23 . LEU B 1 51  ? 1.795   -22.568 169.228 1.00 0.00 ?  51  LEU B HD23 1  
ATOM 5491   N N    . TYR B 1 52  ? 0.460   -17.810 171.703 1.00 0.00 ?  52  TYR B N    1  
ATOM 5492   C CA   . TYR B 1 52  ? 0.712   -16.432 172.072 1.00 0.00 ?  52  TYR B CA   1  
ATOM 5493   C C    . TYR B 1 52  ? 1.910   -16.392 172.976 1.00 0.00 ?  52  TYR B C    1  
ATOM 5494   O O    . TYR B 1 52  ? 2.815   -15.579 172.793 1.00 0.00 ?  52  TYR B O    1  
ATOM 5495   C CB   . TYR B 1 52  ? -0.460  -15.772 172.813 1.00 0.00 ?  52  TYR B CB   1  
ATOM 5496   C CG   . TYR B 1 52  ? -0.180  -14.371 173.234 1.00 0.00 ?  52  TYR B CG   1  
ATOM 5497   C CD1  . TYR B 1 52  ? 0.149   -14.085 174.541 1.00 0.00 ?  52  TYR B CD1  1  
ATOM 5498   C CD2  . TYR B 1 52  ? -0.243  -13.344 172.319 1.00 0.00 ?  52  TYR B CD2  1  
ATOM 5499   C CE1  . TYR B 1 52  ? 0.409   -12.791 174.925 1.00 0.00 ?  52  TYR B CE1  1  
ATOM 5500   C CE2  . TYR B 1 52  ? 0.017   -12.049 172.703 1.00 0.00 ?  52  TYR B CE2  1  
ATOM 5501   C CZ   . TYR B 1 52  ? 0.343   -11.773 174.007 1.00 0.00 ?  52  TYR B CZ   1  
ATOM 5502   O OH   . TYR B 1 52  ? 0.611   -10.445 174.402 1.00 0.00 ?  52  TYR B OH   1  
ATOM 5503   H H    . TYR B 1 52  ? -0.431  -18.187 171.957 1.00 0.00 ?  52  TYR B H    1  
ATOM 5504   H HA   . TYR B 1 52  ? 0.936   -15.889 171.166 1.00 0.00 ?  52  TYR B HA   1  
ATOM 5505   H HB2  . TYR B 1 52  ? -1.356  -15.745 172.158 1.00 0.00 ?  52  TYR B HB2  1  
ATOM 5506   H HB3  . TYR B 1 52  ? -0.704  -16.352 173.728 1.00 0.00 ?  52  TYR B HB3  1  
ATOM 5507   H HD1  . TYR B 1 52  ? 0.201   -14.883 175.267 1.00 0.00 ?  52  TYR B HD1  1  
ATOM 5508   H HD2  . TYR B 1 52  ? -0.500  -13.555 171.291 1.00 0.00 ?  52  TYR B HD2  1  
ATOM 5509   H HE1  . TYR B 1 52  ? 0.665   -12.575 175.952 1.00 0.00 ?  52  TYR B HE1  1  
ATOM 5510   H HE2  . TYR B 1 52  ? -0.035  -11.250 171.979 1.00 0.00 ?  52  TYR B HE2  1  
ATOM 5511   H HH   . TYR B 1 52  ? 0.287   -9.860  173.714 1.00 0.00 ?  52  TYR B HH   1  
ATOM 5512   N N    . TYR B 1 53  ? 1.917   -17.281 173.985 1.00 0.00 ?  53  TYR B N    1  
ATOM 5513   C CA   . TYR B 1 53  ? 3.006   -17.359 174.932 1.00 0.00 ?  53  TYR B CA   1  
ATOM 5514   C C    . TYR B 1 53  ? 4.296   -17.644 174.219 1.00 0.00 ?  53  TYR B C    1  
ATOM 5515   O O    . TYR B 1 53  ? 5.316   -17.005 174.483 1.00 0.00 ?  53  TYR B O    1  
ATOM 5516   C CB   . TYR B 1 53  ? 2.776   -18.481 175.957 1.00 0.00 ?  53  TYR B CB   1  
ATOM 5517   C CG   . TYR B 1 53  ? 3.999   -18.915 176.686 1.00 0.00 ?  53  TYR B CG   1  
ATOM 5518   C CD1  . TYR B 1 53  ? 4.598   -20.102 176.335 1.00 0.00 ?  53  TYR B CD1  1  
ATOM 5519   C CD2  . TYR B 1 53  ? 4.545   -18.165 177.707 1.00 0.00 ?  53  TYR B CD2  1  
ATOM 5520   C CE1  . TYR B 1 53  ? 5.719   -20.539 176.987 1.00 0.00 ?  53  TYR B CE1  1  
ATOM 5521   C CE2  . TYR B 1 53  ? 5.676   -18.608 178.363 1.00 0.00 ?  53  TYR B CE2  1  
ATOM 5522   C CZ   . TYR B 1 53  ? 6.261   -19.799 177.999 1.00 0.00 ?  53  TYR B CZ   1  
ATOM 5523   O OH   . TYR B 1 53  ? 7.417   -20.270 178.664 1.00 0.00 ?  53  TYR B OH   1  
ATOM 5524   H H    . TYR B 1 53  ? 1.168   -17.929 174.123 1.00 0.00 ?  53  TYR B H    1  
ATOM 5525   H HA   . TYR B 1 53  ? 3.077   -16.407 175.431 1.00 0.00 ?  53  TYR B HA   1  
ATOM 5526   H HB2  . TYR B 1 53  ? 2.047   -18.142 176.723 1.00 0.00 ?  53  TYR B HB2  1  
ATOM 5527   H HB3  . TYR B 1 53  ? 2.359   -19.376 175.445 1.00 0.00 ?  53  TYR B HB3  1  
ATOM 5528   H HD1  . TYR B 1 53  ? 4.179   -20.696 175.537 1.00 0.00 ?  53  TYR B HD1  1  
ATOM 5529   H HD2  . TYR B 1 53  ? 4.087   -17.230 177.993 1.00 0.00 ?  53  TYR B HD2  1  
ATOM 5530   H HE1  . TYR B 1 53  ? 6.175   -21.470 176.703 1.00 0.00 ?  53  TYR B HE1  1  
ATOM 5531   H HE2  . TYR B 1 53  ? 6.102   -18.019 179.162 1.00 0.00 ?  53  TYR B HE2  1  
ATOM 5532   H HH   . TYR B 1 53  ? 7.708   -21.072 178.221 1.00 0.00 ?  53  TYR B HH   1  
ATOM 5533   N N    . TRP B 1 54  ? 4.258   -18.624 173.309 1.00 0.00 ?  54  TRP B N    1  
ATOM 5534   C CA   . TRP B 1 54  ? 5.423   -19.049 172.583 1.00 0.00 ?  54  TRP B CA   1  
ATOM 5535   C C    . TRP B 1 54  ? 5.990   -17.900 171.787 1.00 0.00 ?  54  TRP B C    1  
ATOM 5536   O O    . TRP B 1 54  ? 7.204   -17.679 171.766 1.00 0.00 ?  54  TRP B O    1  
ATOM 5537   C CB   . TRP B 1 54  ? 5.076   -20.198 171.614 1.00 0.00 ?  54  TRP B CB   1  
ATOM 5538   C CG   . TRP B 1 54  ? 6.256   -20.694 170.816 1.00 0.00 ?  54  TRP B CG   1  
ATOM 5539   C CD1  . TRP B 1 54  ? 7.180   -21.636 171.170 1.00 0.00 ?  54  TRP B CD1  1  
ATOM 5540   C CD2  . TRP B 1 54  ? 6.612   -20.266 169.486 1.00 0.00 ?  54  TRP B CD2  1  
ATOM 5541   N NE1  . TRP B 1 54  ? 8.086   -21.810 170.162 1.00 0.00 ?  54  TRP B NE1  1  
ATOM 5542   C CE2  . TRP B 1 54  ? 7.752   -20.981 169.121 1.00 0.00 ?  54  TRP B CE2  1  
ATOM 5543   C CE3  . TRP B 1 54  ? 6.061   -19.361 168.626 1.00 0.00 ?  54  TRP B CE3  1  
ATOM 5544   C CZ2  . TRP B 1 54  ? 8.347   -20.802 167.908 1.00 0.00 ?  54  TRP B CZ2  1  
ATOM 5545   C CZ3  . TRP B 1 54  ? 6.658   -19.177 167.396 1.00 0.00 ?  54  TRP B CZ3  1  
ATOM 5546   C CH2  . TRP B 1 54  ? 7.788   -19.889 167.042 1.00 0.00 ?  54  TRP B CH2  1  
ATOM 5547   H H    . TRP B 1 54  ? 3.418   -19.104 173.094 1.00 0.00 ?  54  TRP B H    1  
ATOM 5548   H HA   . TRP B 1 54  ? 6.155   -19.379 173.302 1.00 0.00 ?  54  TRP B HA   1  
ATOM 5549   H HB2  . TRP B 1 54  ? 4.660   -21.049 172.196 1.00 0.00 ?  54  TRP B HB2  1  
ATOM 5550   H HB3  . TRP B 1 54  ? 4.292   -19.851 170.906 1.00 0.00 ?  54  TRP B HB3  1  
ATOM 5551   H HD1  . TRP B 1 54  ? 7.196   -22.160 172.114 1.00 0.00 ?  54  TRP B HD1  1  
ATOM 5552   H HE1  . TRP B 1 54  ? 8.844   -22.425 170.179 1.00 0.00 ?  54  TRP B HE1  1  
ATOM 5553   H HE3  . TRP B 1 54  ? 5.178   -18.795 168.884 1.00 0.00 ?  54  TRP B HE3  1  
ATOM 5554   H HZ2  . TRP B 1 54  ? 9.229   -21.351 167.618 1.00 0.00 ?  54  TRP B HZ2  1  
ATOM 5555   H HZ3  . TRP B 1 54  ? 6.237   -18.467 166.701 1.00 0.00 ?  54  TRP B HZ3  1  
ATOM 5556   H HH2  . TRP B 1 54  ? 8.238   -19.728 166.073 1.00 0.00 ?  54  TRP B HH2  1  
ATOM 5557   N N    . ALA B 1 55  ? 5.116   -17.139 171.118 1.00 0.00 ?  55  ALA B N    1  
ATOM 5558   C CA   . ALA B 1 55  ? 5.554   -16.046 170.292 1.00 0.00 ?  55  ALA B CA   1  
ATOM 5559   C C    . ALA B 1 55  ? 6.102   -14.927 171.133 1.00 0.00 ?  55  ALA B C    1  
ATOM 5560   O O    . ALA B 1 55  ? 6.712   -14.014 170.601 1.00 0.00 ?  55  ALA B O    1  
ATOM 5561   C CB   . ALA B 1 55  ? 4.426   -15.461 169.428 1.00 0.00 ?  55  ALA B CB   1  
ATOM 5562   H H    . ALA B 1 55  ? 4.139   -17.297 171.158 1.00 0.00 ?  55  ALA B H    1  
ATOM 5563   H HA   . ALA B 1 55  ? 6.340   -16.420 169.657 1.00 0.00 ?  55  ALA B HA   1  
ATOM 5564   H HB1  . ALA B 1 55  ? 4.455   -15.899 168.407 1.00 0.00 ?  55  ALA B HB1  1  
ATOM 5565   H HB2  . ALA B 1 55  ? 4.537   -14.358 169.342 1.00 0.00 ?  55  ALA B HB2  1  
ATOM 5566   H HB3  . ALA B 1 55  ? 3.436   -15.684 169.881 1.00 0.00 ?  55  ALA B HB3  1  
ATOM 5567   N N    . LEU B 1 56  ? 5.851   -14.932 172.453 1.00 0.00 ?  56  LEU B N    1  
ATOM 5568   C CA   . LEU B 1 56  ? 6.305   -13.838 173.281 1.00 0.00 ?  56  LEU B CA   1  
ATOM 5569   C C    . LEU B 1 56  ? 7.717   -14.015 173.816 1.00 0.00 ?  56  LEU B C    1  
ATOM 5570   O O    . LEU B 1 56  ? 8.397   -13.011 174.025 1.00 0.00 ?  56  LEU B O    1  
ATOM 5571   C CB   . LEU B 1 56  ? 5.396   -13.634 174.507 1.00 0.00 ?  56  LEU B CB   1  
ATOM 5572   C CG   . LEU B 1 56  ? 4.572   -12.336 174.445 1.00 0.00 ?  56  LEU B CG   1  
ATOM 5573   C CD1  . LEU B 1 56  ? 5.467   -11.103 174.638 1.00 0.00 ?  56  LEU B CD1  1  
ATOM 5574   C CD2  . LEU B 1 56  ? 3.754   -12.237 173.145 1.00 0.00 ?  56  LEU B CD2  1  
ATOM 5575   H H    . LEU B 1 56  ? 5.355   -15.665 172.908 1.00 0.00 ?  56  LEU B H    1  
ATOM 5576   H HA   . LEU B 1 56  ? 6.284   -12.949 172.675 1.00 0.00 ?  56  LEU B HA   1  
ATOM 5577   H HB2  . LEU B 1 56  ? 4.704   -14.500 174.588 1.00 0.00 ?  56  LEU B HB2  1  
ATOM 5578   H HB3  . LEU B 1 56  ? 6.025   -13.611 175.422 1.00 0.00 ?  56  LEU B HB3  1  
ATOM 5579   H HG   . LEU B 1 56  ? 3.853   -12.359 175.292 1.00 0.00 ?  56  LEU B HG   1  
ATOM 5580   H HD11 . LEU B 1 56  ? 4.848   -10.186 174.733 1.00 0.00 ?  56  LEU B HD11 1  
ATOM 5581   H HD12 . LEU B 1 56  ? 6.150   -10.982 173.769 1.00 0.00 ?  56  LEU B HD12 1  
ATOM 5582   H HD13 . LEU B 1 56  ? 6.082   -11.212 175.558 1.00 0.00 ?  56  LEU B HD13 1  
ATOM 5583   H HD21 . LEU B 1 56  ? 3.381   -13.240 172.847 1.00 0.00 ?  56  LEU B HD21 1  
ATOM 5584   H HD22 . LEU B 1 56  ? 4.384   -11.835 172.322 1.00 0.00 ?  56  LEU B HD22 1  
ATOM 5585   H HD23 . LEU B 1 56  ? 2.883   -11.563 173.287 1.00 0.00 ?  56  LEU B HD23 1  
ATOM 5586   N N    . LYS B 1 57  ? 8.211   -15.259 174.062 1.00 0.00 ?  57  LYS B N    1  
ATOM 5587   C CA   . LYS B 1 57  ? 9.520   -15.386 174.714 1.00 0.00 ?  57  LYS B CA   1  
ATOM 5588   C C    . LYS B 1 57  ? 10.727  -15.506 173.788 1.00 0.00 ?  57  LYS B C    1  
ATOM 5589   O O    . LYS B 1 57  ? 11.619  -14.660 173.816 1.00 0.00 ?  57  LYS B O    1  
ATOM 5590   C CB   . LYS B 1 57  ? 9.575   -16.628 175.622 1.00 0.00 ?  57  LYS B CB   1  
ATOM 5591   C CG   . LYS B 1 57  ? 8.486   -16.646 176.701 1.00 0.00 ?  57  LYS B CG   1  
ATOM 5592   C CD   . LYS B 1 57  ? 8.626   -15.512 177.718 1.00 0.00 ?  57  LYS B CD   1  
ATOM 5593   C CE   . LYS B 1 57  ? 7.650   -15.661 178.885 1.00 0.00 ?  57  LYS B CE   1  
ATOM 5594   N NZ   . LYS B 1 57  ? 6.253   -15.556 178.406 1.00 0.00 1  57  LYS B NZ   1  
ATOM 5595   H H    . LYS B 1 57  ? 7.730   -16.101 173.824 1.00 0.00 ?  57  LYS B H    1  
ATOM 5596   H HA   . LYS B 1 57  ? 9.652   -14.512 175.326 1.00 0.00 ?  57  LYS B HA   1  
ATOM 5597   H HB2  . LYS B 1 57  ? 9.474   -17.538 174.992 1.00 0.00 ?  57  LYS B HB2  1  
ATOM 5598   H HB3  . LYS B 1 57  ? 10.568  -16.666 176.117 1.00 0.00 ?  57  LYS B HB3  1  
ATOM 5599   H HG2  . LYS B 1 57  ? 7.491   -16.567 176.211 1.00 0.00 ?  57  LYS B HG2  1  
ATOM 5600   H HG3  . LYS B 1 57  ? 8.524   -17.620 177.236 1.00 0.00 ?  57  LYS B HG3  1  
ATOM 5601   H HD2  . LYS B 1 57  ? 9.664   -15.502 178.112 1.00 0.00 ?  57  LYS B HD2  1  
ATOM 5602   H HD3  . LYS B 1 57  ? 8.440   -14.539 177.214 1.00 0.00 ?  57  LYS B HD3  1  
ATOM 5603   H HE2  . LYS B 1 57  ? 7.770   -16.652 179.371 1.00 0.00 ?  57  LYS B HE2  1  
ATOM 5604   H HE3  . LYS B 1 57  ? 7.816   -14.860 179.636 1.00 0.00 ?  57  LYS B HE3  1  
ATOM 5605   H HZ1  . LYS B 1 57  ? 5.736   -14.872 178.992 1.00 0.00 ?  57  LYS B HZ1  1  
ATOM 5606   H HZ2  . LYS B 1 57  ? 5.794   -16.486 178.471 1.00 0.00 ?  57  LYS B HZ2  1  
ATOM 5607   H HZ3  . LYS B 1 57  ? 6.250   -15.236 177.415 1.00 0.00 ?  57  LYS B HZ3  1  
ATOM 5608   N N    . VAL B 1 58  ? 10.775  -16.566 172.963 1.00 0.00 ?  58  VAL B N    1  
ATOM 5609   C CA   . VAL B 1 58  ? 11.941  -16.861 172.122 1.00 0.00 ?  58  VAL B CA   1  
ATOM 5610   C C    . VAL B 1 58  ? 12.009  -15.959 170.911 1.00 0.00 ?  58  VAL B C    1  
ATOM 5611   O O    . VAL B 1 58  ? 13.000  -15.927 170.197 1.00 0.00 ?  58  VAL B O    1  
ATOM 5612   C CB   . VAL B 1 58  ? 11.983  -18.313 171.709 1.00 0.00 ?  58  VAL B CB   1  
ATOM 5613   C CG1  . VAL B 1 58  ? 10.835  -18.580 170.720 1.00 0.00 ?  58  VAL B CG1  1  
ATOM 5614   C CG2  . VAL B 1 58  ? 13.378  -18.663 171.146 1.00 0.00 ?  58  VAL B CG2  1  
ATOM 5615   H H    . VAL B 1 58  ? 10.008  -17.204 172.882 1.00 0.00 ?  58  VAL B H    1  
ATOM 5616   H HA   . VAL B 1 58  ? 12.806  -16.646 172.732 1.00 0.00 ?  58  VAL B HA   1  
ATOM 5617   H HB   . VAL B 1 58  ? 11.810  -18.945 172.607 1.00 0.00 ?  58  VAL B HB   1  
ATOM 5618   H HG11 . VAL B 1 58  ? 10.719  -19.671 170.552 1.00 0.00 ?  58  VAL B HG11 1  
ATOM 5619   H HG12 . VAL B 1 58  ? 11.036  -18.094 169.750 1.00 0.00 ?  58  VAL B HG12 1  
ATOM 5620   H HG13 . VAL B 1 58  ? 9.881   -18.182 171.124 1.00 0.00 ?  58  VAL B HG13 1  
ATOM 5621   H HG21 . VAL B 1 58  ? 14.173  -18.225 171.785 1.00 0.00 ?  58  VAL B HG21 1  
ATOM 5622   H HG22 . VAL B 1 58  ? 13.490  -18.264 170.118 1.00 0.00 ?  58  VAL B HG22 1  
ATOM 5623   H HG23 . VAL B 1 58  ? 13.514  -19.765 171.115 1.00 0.00 ?  58  VAL B HG23 1  
ATOM 5624   N N    . SER B 1 59  ? 10.917  -15.256 170.670 1.00 0.00 ?  59  SER B N    1  
ATOM 5625   C CA   . SER B 1 59  ? 10.694  -14.410 169.509 1.00 0.00 ?  59  SER B CA   1  
ATOM 5626   C C    . SER B 1 59  ? 11.836  -13.571 168.937 1.00 0.00 ?  59  SER B C    1  
ATOM 5627   O O    . SER B 1 59  ? 11.615  -13.067 167.849 1.00 0.00 ?  59  SER B O    1  
ATOM 5628   C CB   . SER B 1 59  ? 9.586   -13.403 169.788 1.00 0.00 ?  59  SER B CB   1  
ATOM 5629   O OG   . SER B 1 59  ? 9.328   -13.333 171.181 1.00 0.00 ?  59  SER B OG   1  
ATOM 5630   H H    . SER B 1 59  ? 10.154  -15.277 171.313 1.00 0.00 ?  59  SER B H    1  
ATOM 5631   H HA   . SER B 1 59  ? 10.350  -15.065 168.730 1.00 0.00 ?  59  SER B HA   1  
ATOM 5632   H HB2  . SER B 1 59  ? 9.891   -12.400 169.426 1.00 0.00 ?  59  SER B HB2  1  
ATOM 5633   H HB3  . SER B 1 59  ? 8.657   -13.707 169.263 1.00 0.00 ?  59  SER B HB3  1  
ATOM 5634   H HG   . SER B 1 59  ? 8.374   -13.313 171.271 1.00 0.00 ?  59  SER B HG   1  
ATOM 5635   N N    . TRP B 1 60  ? 13.018  -13.320 169.564 1.00 0.00 ?  60  TRP B N    1  
ATOM 5636   C CA   . TRP B 1 60  ? 13.966  -12.439 168.878 1.00 0.00 ?  60  TRP B CA   1  
ATOM 5637   C C    . TRP B 1 60  ? 14.288  -12.967 167.459 1.00 0.00 ?  60  TRP B C    1  
ATOM 5638   O O    . TRP B 1 60  ? 13.867  -12.315 166.500 1.00 0.00 ?  60  TRP B O    1  
ATOM 5639   C CB   . TRP B 1 60  ? 15.264  -12.115 169.674 1.00 0.00 ?  60  TRP B CB   1  
ATOM 5640   C CG   . TRP B 1 60  ? 15.178  -10.898 170.567 1.00 0.00 ?  60  TRP B CG   1  
ATOM 5641   C CD1  . TRP B 1 60  ? 14.431  -9.766  170.401 1.00 0.00 ?  60  TRP B CD1  1  
ATOM 5642   C CD2  . TRP B 1 60  ? 15.903  -10.717 171.804 1.00 0.00 ?  60  TRP B CD2  1  
ATOM 5643   N NE1  . TRP B 1 60  ? 14.658  -8.896  171.432 1.00 0.00 ?  60  TRP B NE1  1  
ATOM 5644   C CE2  . TRP B 1 60  ? 15.549  -9.467  172.305 1.00 0.00 ?  60  TRP B CE2  1  
ATOM 5645   C CE3  . TRP B 1 60  ? 16.789  -11.506 172.482 1.00 0.00 ?  60  TRP B CE3  1  
ATOM 5646   C CZ2  . TRP B 1 60  ? 16.068  -8.992  173.472 1.00 0.00 ?  60  TRP B CZ2  1  
ATOM 5647   C CZ3  . TRP B 1 60  ? 17.316  -11.031 173.666 1.00 0.00 ?  60  TRP B CZ3  1  
ATOM 5648   C CH2  . TRP B 1 60  ? 16.960  -9.789  174.155 1.00 0.00 ?  60  TRP B CH2  1  
ATOM 5649   H H    . TRP B 1 60  ? 13.275  -13.693 170.452 1.00 0.00 ?  60  TRP B H    1  
ATOM 5650   H HA   . TRP B 1 60  ? 13.420  -11.517 168.735 1.00 0.00 ?  60  TRP B HA   1  
ATOM 5651   H HB2  . TRP B 1 60  ? 15.523  -12.991 170.307 1.00 0.00 ?  60  TRP B HB2  1  
ATOM 5652   H HB3  . TRP B 1 60  ? 16.096  -11.961 168.954 1.00 0.00 ?  60  TRP B HB3  1  
ATOM 5653   H HD1  . TRP B 1 60  ? 13.772  -9.578  169.567 1.00 0.00 ?  60  TRP B HD1  1  
ATOM 5654   H HE1  . TRP B 1 60  ? 14.244  -8.019  171.535 1.00 0.00 ?  60  TRP B HE1  1  
ATOM 5655   H HE3  . TRP B 1 60  ? 17.080  -12.479 172.117 1.00 0.00 ?  60  TRP B HE3  1  
ATOM 5656   H HZ2  . TRP B 1 60  ? 15.799  -8.024  173.866 1.00 0.00 ?  60  TRP B HZ2  1  
ATOM 5657   H HZ3  . TRP B 1 60  ? 18.018  -11.640 174.218 1.00 0.00 ?  60  TRP B HZ3  1  
ATOM 5658   H HH2  . TRP B 1 60  ? 17.386  -9.439  175.084 1.00 0.00 ?  60  TRP B HH2  1  
ATOM 5659   N N    . PRO B 1 61  ? 14.982  -14.094 167.231 1.00 0.00 ?  61  PRO B N    1  
ATOM 5660   C CA   . PRO B 1 61  ? 15.183  -14.541 165.856 1.00 0.00 ?  61  PRO B CA   1  
ATOM 5661   C C    . PRO B 1 61  ? 14.081  -15.435 165.334 1.00 0.00 ?  61  PRO B C    1  
ATOM 5662   O O    . PRO B 1 61  ? 13.758  -15.437 164.142 1.00 0.00 ?  61  PRO B O    1  
ATOM 5663   C CB   . PRO B 1 61  ? 16.497  -15.306 165.930 1.00 0.00 ?  61  PRO B CB   1  
ATOM 5664   C CG   . PRO B 1 61  ? 16.465  -15.964 167.311 1.00 0.00 ?  61  PRO B CG   1  
ATOM 5665   C CD   . PRO B 1 61  ? 15.633  -15.022 168.196 1.00 0.00 ?  61  PRO B CD   1  
ATOM 5666   H HA   . PRO B 1 61  ? 15.302  -13.703 165.187 1.00 0.00 ?  61  PRO B HA   1  
ATOM 5667   H HB2  . PRO B 1 61  ? 16.552  -16.073 165.127 1.00 0.00 ?  61  PRO B HB2  1  
ATOM 5668   H HB3  . PRO B 1 61  ? 17.362  -14.615 165.848 1.00 0.00 ?  61  PRO B HB3  1  
ATOM 5669   H HG2  . PRO B 1 61  ? 15.992  -16.967 167.249 1.00 0.00 ?  61  PRO B HG2  1  
ATOM 5670   H HG3  . PRO B 1 61  ? 17.495  -16.068 167.713 1.00 0.00 ?  61  PRO B HG3  1  
ATOM 5671   H HD2  . PRO B 1 61  ? 14.880  -15.599 168.771 1.00 0.00 ?  61  PRO B HD2  1  
ATOM 5672   H HD3  . PRO B 1 61  ? 16.299  -14.485 168.896 1.00 0.00 ?  61  PRO B HD3  1  
ATOM 5673   N N    . VAL B 1 62  ? 13.472  -16.200 166.261 1.00 0.00 ?  62  VAL B N    1  
ATOM 5674   C CA   . VAL B 1 62  ? 12.465  -17.164 165.933 1.00 0.00 ?  62  VAL B CA   1  
ATOM 5675   C C    . VAL B 1 62  ? 11.241  -16.518 165.366 1.00 0.00 ?  62  VAL B C    1  
ATOM 5676   O O    . VAL B 1 62  ? 10.660  -17.066 164.449 1.00 0.00 ?  62  VAL B O    1  
ATOM 5677   C CB   . VAL B 1 62  ? 12.072  -17.991 167.123 1.00 0.00 ?  62  VAL B CB   1  
ATOM 5678   C CG1  . VAL B 1 62  ? 10.840  -18.844 166.774 1.00 0.00 ?  62  VAL B CG1  1  
ATOM 5679   C CG2  . VAL B 1 62  ? 13.283  -18.851 167.517 1.00 0.00 ?  62  VAL B CG2  1  
ATOM 5680   H H    . VAL B 1 62  ? 13.700  -16.127 167.232 1.00 0.00 ?  62  VAL B H    1  
ATOM 5681   H HA   . VAL B 1 62  ? 12.887  -17.806 165.178 1.00 0.00 ?  62  VAL B HA   1  
ATOM 5682   H HB   . VAL B 1 62  ? 11.820  -17.326 167.974 1.00 0.00 ?  62  VAL B HB   1  
ATOM 5683   H HG11 . VAL B 1 62  ? 10.872  -19.149 165.706 1.00 0.00 ?  62  VAL B HG11 1  
ATOM 5684   H HG12 . VAL B 1 62  ? 9.908   -18.265 166.950 1.00 0.00 ?  62  VAL B HG12 1  
ATOM 5685   H HG13 . VAL B 1 62  ? 10.813  -19.759 167.404 1.00 0.00 ?  62  VAL B HG13 1  
ATOM 5686   H HG21 . VAL B 1 62  ? 13.002  -19.566 168.320 1.00 0.00 ?  62  VAL B HG21 1  
ATOM 5687   H HG22 . VAL B 1 62  ? 14.109  -18.208 167.887 1.00 0.00 ?  62  VAL B HG22 1  
ATOM 5688   H HG23 . VAL B 1 62  ? 13.647  -19.428 166.640 1.00 0.00 ?  62  VAL B HG23 1  
ATOM 5689   N N    . PHE B 1 63  ? 10.797  -15.363 165.910 1.00 0.00 ?  63  PHE B N    1  
ATOM 5690   C CA   . PHE B 1 63  ? 9.572   -14.749 165.424 1.00 0.00 ?  63  PHE B CA   1  
ATOM 5691   C C    . PHE B 1 63  ? 9.663   -14.427 163.972 1.00 0.00 ?  63  PHE B C    1  
ATOM 5692   O O    . PHE B 1 63  ? 8.720   -14.697 163.242 1.00 0.00 ?  63  PHE B O    1  
ATOM 5693   C CB   . PHE B 1 63  ? 9.167   -13.448 166.122 1.00 0.00 ?  63  PHE B CB   1  
ATOM 5694   C CG   . PHE B 1 63  ? 7.987   -12.783 165.501 1.00 0.00 ?  63  PHE B CG   1  
ATOM 5695   C CD1  . PHE B 1 63  ? 8.156   -11.701 164.666 1.00 0.00 ?  63  PHE B CD1  1  
ATOM 5696   C CD2  . PHE B 1 63  ? 6.713   -13.242 165.753 1.00 0.00 ?  63  PHE B CD2  1  
ATOM 5697   C CE1  . PHE B 1 63  ? 7.069   -11.086 164.092 1.00 0.00 ?  63  PHE B CE1  1  
ATOM 5698   C CE2  . PHE B 1 63  ? 5.625   -12.627 165.178 1.00 0.00 ?  63  PHE B CE2  1  
ATOM 5699   C CZ   . PHE B 1 63  ? 5.804   -11.550 164.348 1.00 0.00 ?  63  PHE B CZ   1  
ATOM 5700   H H    . PHE B 1 63  ? 11.276  -14.891 166.647 1.00 0.00 ?  63  PHE B H    1  
ATOM 5701   H HA   . PHE B 1 63  ? 8.791   -15.480 165.557 1.00 0.00 ?  63  PHE B HA   1  
ATOM 5702   H HB2  . PHE B 1 63  ? 8.901   -13.658 167.171 1.00 0.00 ?  63  PHE B HB2  1  
ATOM 5703   H HB3  . PHE B 1 63  ? 10.009  -12.724 166.100 1.00 0.00 ?  63  PHE B HB3  1  
ATOM 5704   H HD1  . PHE B 1 63  ? 9.151   -11.331 164.461 1.00 0.00 ?  63  PHE B HD1  1  
ATOM 5705   H HD2  . PHE B 1 63  ? 6.566   -14.090 166.405 1.00 0.00 ?  63  PHE B HD2  1  
ATOM 5706   H HE1  . PHE B 1 63  ? 7.211   -10.238 163.439 1.00 0.00 ?  63  PHE B HE1  1  
ATOM 5707   H HE2  . PHE B 1 63  ? 4.629   -12.993 165.380 1.00 0.00 ?  63  PHE B HE2  1  
ATOM 5708   H HZ   . PHE B 1 63  ? 4.949   -11.067 163.897 1.00 0.00 ?  63  PHE B HZ   1  
ATOM 5709   N N    . PHE B 1 64  ? 10.767  -13.802 163.525 1.00 0.00 ?  64  PHE B N    1  
ATOM 5710   C CA   . PHE B 1 64  ? 10.869  -13.430 162.136 1.00 0.00 ?  64  PHE B CA   1  
ATOM 5711   C C    . PHE B 1 64  ? 10.813  -14.664 161.283 1.00 0.00 ?  64  PHE B C    1  
ATOM 5712   O O    . PHE B 1 64  ? 10.137  -14.678 160.254 1.00 0.00 ?  64  PHE B O    1  
ATOM 5713   C CB   . PHE B 1 64  ? 12.187  -12.716 161.799 1.00 0.00 ?  64  PHE B CB   1  
ATOM 5714   C CG   . PHE B 1 64  ? 12.293  -11.339 162.356 1.00 0.00 ?  64  PHE B CG   1  
ATOM 5715   C CD1  . PHE B 1 64  ? 12.785  -11.138 163.626 1.00 0.00 ?  64  PHE B CD1  1  
ATOM 5716   C CD2  . PHE B 1 64  ? 11.912  -10.248 161.605 1.00 0.00 ?  64  PHE B CD2  1  
ATOM 5717   C CE1  . PHE B 1 64  ? 12.893  -9.868  164.140 1.00 0.00 ?  64  PHE B CE1  1  
ATOM 5718   C CE2  . PHE B 1 64  ? 12.021  -8.978  162.120 1.00 0.00 ?  64  PHE B CE2  1  
ATOM 5719   C CZ   . PHE B 1 64  ? 12.511  -8.788  163.387 1.00 0.00 ?  64  PHE B CZ   1  
ATOM 5720   H H    . PHE B 1 64  ? 11.541  -13.574 164.114 1.00 0.00 ?  64  PHE B H    1  
ATOM 5721   H HA   . PHE B 1 64  ? 10.029  -12.795 161.902 1.00 0.00 ?  64  PHE B HA   1  
ATOM 5722   H HB2  . PHE B 1 64  ? 13.044  -13.297 162.201 1.00 0.00 ?  64  PHE B HB2  1  
ATOM 5723   H HB3  . PHE B 1 64  ? 12.299  -12.637 160.695 1.00 0.00 ?  64  PHE B HB3  1  
ATOM 5724   H HD1  . PHE B 1 64  ? 13.086  -11.986 164.222 1.00 0.00 ?  64  PHE B HD1  1  
ATOM 5725   H HD2  . PHE B 1 64  ? 11.525  -10.392 160.608 1.00 0.00 ?  64  PHE B HD2  1  
ATOM 5726   H HE1  . PHE B 1 64  ? 13.281  -9.720  165.137 1.00 0.00 ?  64  PHE B HE1  1  
ATOM 5727   H HE2  . PHE B 1 64  ? 11.721  -8.129  161.526 1.00 0.00 ?  64  PHE B HE2  1  
ATOM 5728   H HZ   . PHE B 1 64  ? 12.597  -7.789  163.790 1.00 0.00 ?  64  PHE B HZ   1  
ATOM 5729   N N    . ALA B 1 65  ? 11.519  -15.734 161.697 1.00 0.00 ?  65  ALA B N    1  
ATOM 5730   C CA   . ALA B 1 65  ? 11.531  -16.943 160.912 1.00 0.00 ?  65  ALA B CA   1  
ATOM 5731   C C    . ALA B 1 65  ? 10.151  -17.537 160.868 1.00 0.00 ?  65  ALA B C    1  
ATOM 5732   O O    . ALA B 1 65  ? 9.704   -18.009 159.829 1.00 0.00 ?  65  ALA B O    1  
ATOM 5733   C CB   . ALA B 1 65  ? 12.477  -18.016 161.476 1.00 0.00 ?  65  ALA B CB   1  
ATOM 5734   H H    . ALA B 1 65  ? 12.039  -15.745 162.553 1.00 0.00 ?  65  ALA B H    1  
ATOM 5735   H HA   . ALA B 1 65  ? 11.831  -16.677 159.911 1.00 0.00 ?  65  ALA B HA   1  
ATOM 5736   H HB1  . ALA B 1 65  ? 12.991  -17.637 162.384 1.00 0.00 ?  65  ALA B HB1  1  
ATOM 5737   H HB2  . ALA B 1 65  ? 13.246  -18.287 160.721 1.00 0.00 ?  65  ALA B HB2  1  
ATOM 5738   H HB3  . ALA B 1 65  ? 11.907  -18.930 161.747 1.00 0.00 ?  65  ALA B HB3  1  
ATOM 5739   N N    . SER B 1 66  ? 9.457   -17.526 162.018 1.00 0.00 ?  66  SER B N    1  
ATOM 5740   C CA   . SER B 1 66  ? 8.144   -18.102 162.120 1.00 0.00 ?  66  SER B CA   1  
ATOM 5741   C C    . SER B 1 66  ? 7.208   -17.375 161.221 1.00 0.00 ?  66  SER B C    1  
ATOM 5742   O O    . SER B 1 66  ? 6.383   -17.992 160.559 1.00 0.00 ?  66  SER B O    1  
ATOM 5743   C CB   . SER B 1 66  ? 7.565   -18.035 163.542 1.00 0.00 ?  66  SER B CB   1  
ATOM 5744   O OG   . SER B 1 66  ? 6.270   -18.616 163.569 1.00 0.00 ?  66  SER B OG   1  
ATOM 5745   H H    . SER B 1 66  ? 9.822   -17.128 162.847 1.00 0.00 ?  66  SER B H    1  
ATOM 5746   H HA   . SER B 1 66  ? 8.215   -19.129 161.799 1.00 0.00 ?  66  SER B HA   1  
ATOM 5747   H HB2  . SER B 1 66  ? 8.222   -18.588 164.247 1.00 0.00 ?  66  SER B HB2  1  
ATOM 5748   H HB3  . SER B 1 66  ? 7.490   -16.977 163.873 1.00 0.00 ?  66  SER B HB3  1  
ATOM 5749   H HG   . SER B 1 66  ? 5.688   -17.947 163.934 1.00 0.00 ?  66  SER B HG   1  
ATOM 5750   N N    . LEU B 1 67  ? 7.302   -16.036 161.209 1.00 0.00 ?  67  LEU B N    1  
ATOM 5751   C CA   . LEU B 1 67  ? 6.426   -15.240 160.403 1.00 0.00 ?  67  LEU B CA   1  
ATOM 5752   C C    . LEU B 1 67  ? 6.658   -15.594 158.970 1.00 0.00 ?  67  LEU B C    1  
ATOM 5753   O O    . LEU B 1 67  ? 5.710   -15.717 158.208 1.00 0.00 ?  67  LEU B O    1  
ATOM 5754   C CB   . LEU B 1 67  ? 6.657   -13.726 160.577 1.00 0.00 ?  67  LEU B CB   1  
ATOM 5755   C CG   . LEU B 1 67  ? 5.705   -12.861 159.729 1.00 0.00 ?  67  LEU B CG   1  
ATOM 5756   C CD1  . LEU B 1 67  ? 4.235   -13.115 160.104 1.00 0.00 ?  67  LEU B CD1  1  
ATOM 5757   C CD2  . LEU B 1 67  ? 6.057   -11.368 159.850 1.00 0.00 ?  67  LEU B CD2  1  
ATOM 5758   H H    . LEU B 1 67  ? 7.969   -15.546 161.753 1.00 0.00 ?  67  LEU B H    1  
ATOM 5759   H HA   . LEU B 1 67  ? 5.413   -15.497 160.672 1.00 0.00 ?  67  LEU B HA   1  
ATOM 5760   H HB2  . LEU B 1 67  ? 6.526   -13.464 161.650 1.00 0.00 ?  67  LEU B HB2  1  
ATOM 5761   H HB3  . LEU B 1 67  ? 7.702   -13.486 160.291 1.00 0.00 ?  67  LEU B HB3  1  
ATOM 5762   H HG   . LEU B 1 67  ? 5.833   -13.148 158.665 1.00 0.00 ?  67  LEU B HG   1  
ATOM 5763   H HD11 . LEU B 1 67  ? 4.170   -13.594 161.104 1.00 0.00 ?  67  LEU B HD11 1  
ATOM 5764   H HD12 . LEU B 1 67  ? 3.758   -13.786 159.358 1.00 0.00 ?  67  LEU B HD12 1  
ATOM 5765   H HD13 . LEU B 1 67  ? 3.673   -12.157 160.132 1.00 0.00 ?  67  LEU B HD13 1  
ATOM 5766   H HD21 . LEU B 1 67  ? 7.091   -11.246 160.239 1.00 0.00 ?  67  LEU B HD21 1  
ATOM 5767   H HD22 . LEU B 1 67  ? 5.355   -10.861 160.546 1.00 0.00 ?  67  LEU B HD22 1  
ATOM 5768   H HD23 . LEU B 1 67  ? 5.991   -10.874 158.857 1.00 0.00 ?  67  LEU B HD23 1  
ATOM 5769   N N    . ALA B 1 68  ? 7.935   -15.744 158.568 1.00 0.00 ?  68  ALA B N    1  
ATOM 5770   C CA   . ALA B 1 68  ? 8.238   -16.069 157.199 1.00 0.00 ?  68  ALA B CA   1  
ATOM 5771   C C    . ALA B 1 68  ? 7.651   -17.411 156.859 1.00 0.00 ?  68  ALA B C    1  
ATOM 5772   O O    . ALA B 1 68  ? 7.141   -17.605 155.757 1.00 0.00 ?  68  ALA B O    1  
ATOM 5773   C CB   . ALA B 1 68  ? 9.747   -16.137 156.913 1.00 0.00 ?  68  ALA B CB   1  
ATOM 5774   H H    . ALA B 1 68  ? 8.710   -15.640 159.187 1.00 0.00 ?  68  ALA B H    1  
ATOM 5775   H HA   . ALA B 1 68  ? 7.779   -15.317 156.577 1.00 0.00 ?  68  ALA B HA   1  
ATOM 5776   H HB1  . ALA B 1 68  ? 9.961   -16.921 156.155 1.00 0.00 ?  68  ALA B HB1  1  
ATOM 5777   H HB2  . ALA B 1 68  ? 10.305  -16.383 157.842 1.00 0.00 ?  68  ALA B HB2  1  
ATOM 5778   H HB3  . ALA B 1 68  ? 10.112  -15.162 156.527 1.00 0.00 ?  68  ALA B HB3  1  
ATOM 5779   N N    . ALA B 1 69  ? 7.746   -18.379 157.792 1.00 0.00 ?  69  ALA B N    1  
ATOM 5780   C CA   . ALA B 1 69  ? 7.225   -19.700 157.538 1.00 0.00 ?  69  ALA B CA   1  
ATOM 5781   C C    . ALA B 1 69  ? 5.741   -19.618 157.341 1.00 0.00 ?  69  ALA B C    1  
ATOM 5782   O O    . ALA B 1 69  ? 5.188   -20.276 156.460 1.00 0.00 ?  69  ALA B O    1  
ATOM 5783   C CB   . ALA B 1 69  ? 7.489   -20.684 158.688 1.00 0.00 ?  69  ALA B CB   1  
ATOM 5784   H H    . ALA B 1 69  ? 8.182   -18.234 158.671 1.00 0.00 ?  69  ALA B H    1  
ATOM 5785   H HA   . ALA B 1 69  ? 7.681   -20.060 156.630 1.00 0.00 ?  69  ALA B HA   1  
ATOM 5786   H HB1  . ALA B 1 69  ? 6.592   -20.768 159.338 1.00 0.00 ?  69  ALA B HB1  1  
ATOM 5787   H HB2  . ALA B 1 69  ? 8.344   -20.335 159.306 1.00 0.00 ?  69  ALA B HB2  1  
ATOM 5788   H HB3  . ALA B 1 69  ? 7.731   -21.691 158.286 1.00 0.00 ?  69  ALA B HB3  1  
ATOM 5789   N N    . LEU B 1 70  ? 5.062   -18.798 158.169 1.00 0.00 ?  70  LEU B N    1  
ATOM 5790   C CA   . LEU B 1 70  ? 3.633   -18.665 158.070 1.00 0.00 ?  70  LEU B CA   1  
ATOM 5791   C C    . LEU B 1 70  ? 3.300   -18.045 156.755 1.00 0.00 ?  70  LEU B C    1  
ATOM 5792   O O    . LEU B 1 70  ? 2.302   -18.400 156.143 1.00 0.00 ?  70  LEU B O    1  
ATOM 5793   C CB   . LEU B 1 70  ? 3.015   -17.794 159.180 1.00 0.00 ?  70  LEU B CB   1  
ATOM 5794   C CG   . LEU B 1 70  ? 2.476   -18.617 160.370 1.00 0.00 ?  70  LEU B CG   1  
ATOM 5795   C CD1  . LEU B 1 70  ? 1.068   -19.160 160.075 1.00 0.00 ?  70  LEU B CD1  1  
ATOM 5796   C CD2  . LEU B 1 70  ? 3.431   -19.754 160.777 1.00 0.00 ?  70  LEU B CD2  1  
ATOM 5797   H H    . LEU B 1 70  ? 5.510   -18.266 158.878 1.00 0.00 ?  70  LEU B H    1  
ATOM 5798   H HA   . LEU B 1 70  ? 3.215   -19.659 158.101 1.00 0.00 ?  70  LEU B HA   1  
ATOM 5799   H HB2  . LEU B 1 70  ? 3.787   -17.083 159.550 1.00 0.00 ?  70  LEU B HB2  1  
ATOM 5800   H HB3  . LEU B 1 70  ? 2.180   -17.202 158.751 1.00 0.00 ?  70  LEU B HB3  1  
ATOM 5801   H HG   . LEU B 1 70  ? 2.390   -17.926 161.237 1.00 0.00 ?  70  LEU B HG   1  
ATOM 5802   H HD11 . LEU B 1 70  ? 1.123   -20.009 159.361 1.00 0.00 ?  70  LEU B HD11 1  
ATOM 5803   H HD12 . LEU B 1 70  ? 0.433   -18.363 159.629 1.00 0.00 ?  70  LEU B HD12 1  
ATOM 5804   H HD13 . LEU B 1 70  ? 0.587   -19.514 161.011 1.00 0.00 ?  70  LEU B HD13 1  
ATOM 5805   H HD21 . LEU B 1 70  ? 4.486   -19.424 160.695 1.00 0.00 ?  70  LEU B HD21 1  
ATOM 5806   H HD22 . LEU B 1 70  ? 3.284   -20.638 160.119 1.00 0.00 ?  70  LEU B HD22 1  
ATOM 5807   H HD23 . LEU B 1 70  ? 3.237   -20.061 161.827 1.00 0.00 ?  70  LEU B HD23 1  
ATOM 5808   N N    . PHE B 1 71  ? 4.121   -17.077 156.313 1.00 0.00 ?  71  PHE B N    1  
ATOM 5809   C CA   . PHE B 1 71  ? 3.889   -16.424 155.054 1.00 0.00 ?  71  PHE B CA   1  
ATOM 5810   C C    . PHE B 1 71  ? 3.915   -17.418 153.943 1.00 0.00 ?  71  PHE B C    1  
ATOM 5811   O O    . PHE B 1 71  ? 3.036   -17.411 153.089 1.00 0.00 ?  71  PHE B O    1  
ATOM 5812   C CB   . PHE B 1 71  ? 4.934   -15.360 154.705 1.00 0.00 ?  71  PHE B CB   1  
ATOM 5813   C CG   . PHE B 1 71  ? 5.030   -15.147 153.236 1.00 0.00 ?  71  PHE B CG   1  
ATOM 5814   C CD1  . PHE B 1 71  ? 6.138   -15.598 152.554 1.00 0.00 ?  71  PHE B CD1  1  
ATOM 5815   C CD2  . PHE B 1 71  ? 4.008   -14.548 152.535 1.00 0.00 ?  71  PHE B CD2  1  
ATOM 5816   C CE1  . PHE B 1 71  ? 6.226   -15.456 151.193 1.00 0.00 ?  71  PHE B CE1  1  
ATOM 5817   C CE2  . PHE B 1 71  ? 4.100   -14.399 151.169 1.00 0.00 ?  71  PHE B CE2  1  
ATOM 5818   C CZ   . PHE B 1 71  ? 5.210   -14.856 150.500 1.00 0.00 ?  71  PHE B CZ   1  
ATOM 5819   H H    . PHE B 1 71  ? 4.903   -16.764 156.834 1.00 0.00 ?  71  PHE B H    1  
ATOM 5820   H HA   . PHE B 1 71  ? 2.910   -15.975 155.100 1.00 0.00 ?  71  PHE B HA   1  
ATOM 5821   H HB2  . PHE B 1 71  ? 4.662   -14.388 155.167 1.00 0.00 ?  71  PHE B HB2  1  
ATOM 5822   H HB3  . PHE B 1 71  ? 5.936   -15.666 155.068 1.00 0.00 ?  71  PHE B HB3  1  
ATOM 5823   H HD1  . PHE B 1 71  ? 6.945   -16.070 153.096 1.00 0.00 ?  71  PHE B HD1  1  
ATOM 5824   H HD2  . PHE B 1 71  ? 3.135   -14.187 153.057 1.00 0.00 ?  71  PHE B HD2  1  
ATOM 5825   H HE1  . PHE B 1 71  ? 7.100   -15.814 150.668 1.00 0.00 ?  71  PHE B HE1  1  
ATOM 5826   H HE2  . PHE B 1 71  ? 3.298   -13.926 150.622 1.00 0.00 ?  71  PHE B HE2  1  
ATOM 5827   H HZ   . PHE B 1 71  ? 5.279   -14.753 149.429 1.00 0.00 ?  71  PHE B HZ   1  
ATOM 5828   N N    . VAL B 1 72  ? 4.946   -18.278 153.916 1.00 0.00 ?  72  VAL B N    1  
ATOM 5829   C CA   . VAL B 1 72  ? 5.071   -19.235 152.852 1.00 0.00 ?  72  VAL B CA   1  
ATOM 5830   C C    . VAL B 1 72  ? 3.897   -20.170 152.854 1.00 0.00 ?  72  VAL B C    1  
ATOM 5831   O O    . VAL B 1 72  ? 3.324   -20.449 151.803 1.00 0.00 ?  72  VAL B O    1  
ATOM 5832   C CB   . VAL B 1 72  ? 6.311   -20.072 152.965 1.00 0.00 ?  72  VAL B CB   1  
ATOM 5833   C CG1  . VAL B 1 72  ? 6.230   -21.199 151.920 1.00 0.00 ?  72  VAL B CG1  1  
ATOM 5834   C CG2  . VAL B 1 72  ? 7.532   -19.159 152.763 1.00 0.00 ?  72  VAL B CG2  1  
ATOM 5835   H H    . VAL B 1 72  ? 5.657   -18.285 154.614 1.00 0.00 ?  72  VAL B H    1  
ATOM 5836   H HA   . VAL B 1 72  ? 5.080   -18.686 151.923 1.00 0.00 ?  72  VAL B HA   1  
ATOM 5837   H HB   . VAL B 1 72  ? 6.369   -20.525 153.977 1.00 0.00 ?  72  VAL B HB   1  
ATOM 5838   H HG11 . VAL B 1 72  ? 5.677   -22.069 152.333 1.00 0.00 ?  72  VAL B HG11 1  
ATOM 5839   H HG12 . VAL B 1 72  ? 7.250   -21.531 151.631 1.00 0.00 ?  72  VAL B HG12 1  
ATOM 5840   H HG13 . VAL B 1 72  ? 5.702   -20.843 151.009 1.00 0.00 ?  72  VAL B HG13 1  
ATOM 5841   H HG21 . VAL B 1 72  ? 8.326   -19.694 152.200 1.00 0.00 ?  72  VAL B HG21 1  
ATOM 5842   H HG22 . VAL B 1 72  ? 7.944   -18.844 153.746 1.00 0.00 ?  72  VAL B HG22 1  
ATOM 5843   H HG23 . VAL B 1 72  ? 7.243   -18.249 152.193 1.00 0.00 ?  72  VAL B HG23 1  
ATOM 5844   N N    . VAL B 1 73  ? 3.516   -20.681 154.040 1.00 0.00 ?  73  VAL B N    1  
ATOM 5845   C CA   . VAL B 1 73  ? 2.431   -21.627 154.112 1.00 0.00 ?  73  VAL B CA   1  
ATOM 5846   C C    . VAL B 1 73  ? 1.140   -20.995 153.669 1.00 0.00 ?  73  VAL B C    1  
ATOM 5847   O O    . VAL B 1 73  ? 0.393   -21.583 152.894 1.00 0.00 ?  73  VAL B O    1  
ATOM 5848   C CB   . VAL B 1 73  ? 2.214   -22.159 155.498 1.00 0.00 ?  73  VAL B CB   1  
ATOM 5849   C CG1  . VAL B 1 73  ? 0.912   -22.979 155.504 1.00 0.00 ?  73  VAL B CG1  1  
ATOM 5850   C CG2  . VAL B 1 73  ? 3.445   -22.992 155.892 1.00 0.00 ?  73  VAL B CG2  1  
ATOM 5851   H H    . VAL B 1 73  ? 3.943   -20.422 154.903 1.00 0.00 ?  73  VAL B H    1  
ATOM 5852   H HA   . VAL B 1 73  ? 2.668   -22.437 153.441 1.00 0.00 ?  73  VAL B HA   1  
ATOM 5853   H HB   . VAL B 1 73  ? 2.111   -21.315 156.214 1.00 0.00 ?  73  VAL B HB   1  
ATOM 5854   H HG11 . VAL B 1 73  ? 0.039   -22.316 155.689 1.00 0.00 ?  73  VAL B HG11 1  
ATOM 5855   H HG12 . VAL B 1 73  ? 0.946   -23.750 156.302 1.00 0.00 ?  73  VAL B HG12 1  
ATOM 5856   H HG13 . VAL B 1 73  ? 0.771   -23.486 154.526 1.00 0.00 ?  73  VAL B HG13 1  
ATOM 5857   H HG21 . VAL B 1 73  ? 4.166   -23.040 155.048 1.00 0.00 ?  73  VAL B HG21 1  
ATOM 5858   H HG22 . VAL B 1 73  ? 3.140   -24.028 156.157 1.00 0.00 ?  73  VAL B HG22 1  
ATOM 5859   H HG23 . VAL B 1 73  ? 3.954   -22.538 156.769 1.00 0.00 ?  73  VAL B HG23 1  
ATOM 5860   N N    . ASN B 1 74  ? 0.845   -19.783 154.165 1.00 0.00 ?  74  ASN B N    1  
ATOM 5861   C CA   . ASN B 1 74  ? -0.401  -19.139 153.836 1.00 0.00 ?  74  ASN B CA   1  
ATOM 5862   C C    . ASN B 1 74  ? -0.451  -18.832 152.374 1.00 0.00 ?  74  ASN B C    1  
ATOM 5863   O O    . ASN B 1 74  ? -1.494  -18.964 151.735 1.00 0.00 ?  74  ASN B O    1  
ATOM 5864   C CB   . ASN B 1 74  ? -0.610  -17.818 154.594 1.00 0.00 ?  74  ASN B CB   1  
ATOM 5865   C CG   . ASN B 1 74  ? -0.895  -18.050 156.070 1.00 0.00 ?  74  ASN B CG   1  
ATOM 5866   O OD1  . ASN B 1 74  ? -1.300  -19.139 156.474 1.00 0.00 ?  74  ASN B OD1  1  
ATOM 5867   N ND2  . ASN B 1 74  ? -0.676  -16.998 156.904 1.00 0.00 ?  74  ASN B ND2  1  
ATOM 5868   H H    . ASN B 1 74  ? 1.470   -19.276 154.744 1.00 0.00 ?  74  ASN B H    1  
ATOM 5869   H HA   . ASN B 1 74  ? -1.194  -19.829 154.076 1.00 0.00 ?  74  ASN B HA   1  
ATOM 5870   H HB2  . ASN B 1 74  ? 0.301   -17.189 154.498 1.00 0.00 ?  74  ASN B HB2  1  
ATOM 5871   H HB3  . ASN B 1 74  ? -1.464  -17.267 154.147 1.00 0.00 ?  74  ASN B HB3  1  
ATOM 5872   H HD21 . ASN B 1 74  ? -0.345  -16.128 156.536 1.00 0.00 ?  74  ASN B HD21 1  
ATOM 5873   H HD22 . ASN B 1 74  ? -0.846  -17.093 157.885 1.00 0.00 ?  74  ASN B HD22 1  
ATOM 5874   N N    . ASN B 1 75  ? 0.682   -18.394 151.815 1.00 0.00 ?  75  ASN B N    1  
ATOM 5875   C CA   . ASN B 1 75  ? 0.708   -18.027 150.434 1.00 0.00 ?  75  ASN B CA   1  
ATOM 5876   C C    . ASN B 1 75  ? 0.473   -19.232 149.573 1.00 0.00 ?  75  ASN B C    1  
ATOM 5877   O O    . ASN B 1 75  ? -0.216  -19.143 148.557 1.00 0.00 ?  75  ASN B O    1  
ATOM 5878   C CB   . ASN B 1 75  ? 2.025   -17.387 150.000 1.00 0.00 ?  75  ASN B CB   1  
ATOM 5879   C CG   . ASN B 1 75  ? 1.895   -16.796 148.613 1.00 0.00 ?  75  ASN B CG   1  
ATOM 5880   O OD1  . ASN B 1 75  ? 2.007   -17.492 147.610 1.00 0.00 ?  75  ASN B OD1  1  
ATOM 5881   N ND2  . ASN B 1 75  ? 1.613   -15.472 148.559 1.00 0.00 ?  75  ASN B ND2  1  
ATOM 5882   H H    . ASN B 1 75  ? 1.531   -18.306 152.318 1.00 0.00 ?  75  ASN B H    1  
ATOM 5883   H HA   . ASN B 1 75  ? -0.100  -17.332 150.279 1.00 0.00 ?  75  ASN B HA   1  
ATOM 5884   H HB2  . ASN B 1 75  ? 2.303   -16.582 150.715 1.00 0.00 ?  75  ASN B HB2  1  
ATOM 5885   H HB3  . ASN B 1 75  ? 2.831   -18.151 149.994 1.00 0.00 ?  75  ASN B HB3  1  
ATOM 5886   H HD21 . ASN B 1 75  ? 1.505   -14.950 149.405 1.00 0.00 ?  75  ASN B HD21 1  
ATOM 5887   H HD22 . ASN B 1 75  ? 1.507   -15.016 147.673 1.00 0.00 ?  75  ASN B HD22 1  
ATOM 5888   N N    . THR B 1 76  ? 1.052   -20.392 149.943 1.00 0.00 ?  76  THR B N    1  
ATOM 5889   C CA   . THR B 1 76  ? 0.892   -21.562 149.119 1.00 0.00 ?  76  THR B CA   1  
ATOM 5890   C C    . THR B 1 76  ? -0.538  -22.004 149.161 1.00 0.00 ?  76  THR B C    1  
ATOM 5891   O O    . THR B 1 76  ? -1.034  -22.563 148.183 1.00 0.00 ?  76  THR B O    1  
ATOM 5892   C CB   . THR B 1 76  ? 1.747   -22.725 149.540 1.00 0.00 ?  76  THR B CB   1  
ATOM 5893   O OG1  . THR B 1 76  ? 1.432   -23.112 150.869 1.00 0.00 ?  76  THR B OG1  1  
ATOM 5894   C CG2  . THR B 1 76  ? 3.223   -22.309 149.443 1.00 0.00 ?  76  THR B CG2  1  
ATOM 5895   H H    . THR B 1 76  ? 1.609   -20.486 150.764 1.00 0.00 ?  76  THR B H    1  
ATOM 5896   H HA   . THR B 1 76  ? 1.134   -21.274 148.108 1.00 0.00 ?  76  THR B HA   1  
ATOM 5897   H HB   . THR B 1 76  ? 1.577   -23.587 148.865 1.00 0.00 ?  76  THR B HB   1  
ATOM 5898   H HG1  . THR B 1 76  ? 1.775   -24.002 150.973 1.00 0.00 ?  76  THR B HG1  1  
ATOM 5899   H HG21 . THR B 1 76  ? 3.752   -22.938 148.695 1.00 0.00 ?  76  THR B HG21 1  
ATOM 5900   H HG22 . THR B 1 76  ? 3.724   -22.432 150.427 1.00 0.00 ?  76  THR B HG22 1  
ATOM 5901   H HG23 . THR B 1 76  ? 3.306   -21.245 149.133 1.00 0.00 ?  76  THR B HG23 1  
ATOM 5902   N N    . LEU B 1 77  ? -1.231  -21.789 150.301 1.00 0.00 ?  77  LEU B N    1  
ATOM 5903   C CA   . LEU B 1 77  ? -2.616  -22.183 150.387 1.00 0.00 ?  77  LEU B CA   1  
ATOM 5904   C C    . LEU B 1 77  ? -3.384  -21.382 149.383 1.00 0.00 ?  77  LEU B C    1  
ATOM 5905   O O    . LEU B 1 77  ? -4.303  -21.888 148.740 1.00 0.00 ?  77  LEU B O    1  
ATOM 5906   C CB   . LEU B 1 77  ? -3.251  -21.954 151.771 1.00 0.00 ?  77  LEU B CB   1  
ATOM 5907   C CG   . LEU B 1 77  ? -2.710  -22.918 152.842 1.00 0.00 ?  77  LEU B CG   1  
ATOM 5908   C CD1  . LEU B 1 77  ? -3.178  -22.515 154.249 1.00 0.00 ?  77  LEU B CD1  1  
ATOM 5909   C CD2  . LEU B 1 77  ? -3.089  -24.375 152.526 1.00 0.00 ?  77  LEU B CD2  1  
ATOM 5910   H H    . LEU B 1 77  ? -0.823  -21.381 151.116 1.00 0.00 ?  77  LEU B H    1  
ATOM 5911   H HA   . LEU B 1 77  ? -2.672  -23.227 150.119 1.00 0.00 ?  77  LEU B HA   1  
ATOM 5912   H HB2  . LEU B 1 77  ? -3.055  -20.906 152.090 1.00 0.00 ?  77  LEU B HB2  1  
ATOM 5913   H HB3  . LEU B 1 77  ? -4.350  -22.090 151.693 1.00 0.00 ?  77  LEU B HB3  1  
ATOM 5914   H HG   . LEU B 1 77  ? -1.603  -22.851 152.824 1.00 0.00 ?  77  LEU B HG   1  
ATOM 5915   H HD11 . LEU B 1 77  ? -3.038  -23.358 154.959 1.00 0.00 ?  77  LEU B HD11 1  
ATOM 5916   H HD12 . LEU B 1 77  ? -4.254  -22.238 154.234 1.00 0.00 ?  77  LEU B HD12 1  
ATOM 5917   H HD13 . LEU B 1 77  ? -2.594  -21.644 154.615 1.00 0.00 ?  77  LEU B HD13 1  
ATOM 5918   H HD21 . LEU B 1 77  ? -2.447  -24.773 151.712 1.00 0.00 ?  77  LEU B HD21 1  
ATOM 5919   H HD22 . LEU B 1 77  ? -4.150  -24.436 152.204 1.00 0.00 ?  77  LEU B HD22 1  
ATOM 5920   H HD23 . LEU B 1 77  ? -2.954  -25.012 153.427 1.00 0.00 ?  77  LEU B HD23 1  
ATOM 5921   N N    . PHE B 1 78  ? -3.026  -20.091 149.249 1.00 0.00 ?  78  PHE B N    1  
ATOM 5922   C CA   . PHE B 1 78  ? -3.689  -19.237 148.300 1.00 0.00 ?  78  PHE B CA   1  
ATOM 5923   C C    . PHE B 1 78  ? -3.468  -19.777 146.920 1.00 0.00 ?  78  PHE B C    1  
ATOM 5924   O O    . PHE B 1 78  ? -4.374  -19.761 146.093 1.00 0.00 ?  78  PHE B O    1  
ATOM 5925   C CB   . PHE B 1 78  ? -3.196  -17.788 148.288 1.00 0.00 ?  78  PHE B CB   1  
ATOM 5926   C CG   . PHE B 1 78  ? -3.944  -16.953 147.308 1.00 0.00 ?  78  PHE B CG   1  
ATOM 5927   C CD1  . PHE B 1 78  ? -3.442  -16.734 146.046 1.00 0.00 ?  78  PHE B CD1  1  
ATOM 5928   C CD2  . PHE B 1 78  ? -5.151  -16.396 147.650 1.00 0.00 ?  78  PHE B CD2  1  
ATOM 5929   C CE1  . PHE B 1 78  ? -4.134  -15.971 145.140 1.00 0.00 ?  78  PHE B CE1  1  
ATOM 5930   C CE2  . PHE B 1 78  ? -5.844  -15.631 146.744 1.00 0.00 ?  78  PHE B CE2  1  
ATOM 5931   C CZ   . PHE B 1 78  ? -5.337  -15.418 145.490 1.00 0.00 ?  78  PHE B CZ   1  
ATOM 5932   H H    . PHE B 1 78  ? -2.306  -19.672 149.801 1.00 0.00 ?  78  PHE B H    1  
ATOM 5933   H HA   . PHE B 1 78  ? -4.745  -19.268 148.523 1.00 0.00 ?  78  PHE B HA   1  
ATOM 5934   H HB2  . PHE B 1 78  ? -3.328  -17.329 149.290 1.00 0.00 ?  78  PHE B HB2  1  
ATOM 5935   H HB3  . PHE B 1 78  ? -2.121  -17.752 148.010 1.00 0.00 ?  78  PHE B HB3  1  
ATOM 5936   H HD1  . PHE B 1 78  ? -2.494  -17.169 145.765 1.00 0.00 ?  78  PHE B HD1  1  
ATOM 5937   H HD2  . PHE B 1 78  ? -5.559  -16.560 148.637 1.00 0.00 ?  78  PHE B HD2  1  
ATOM 5938   H HE1  . PHE B 1 78  ? -3.732  -15.806 144.154 1.00 0.00 ?  78  PHE B HE1  1  
ATOM 5939   H HE2  . PHE B 1 78  ? -6.790  -15.197 147.021 1.00 0.00 ?  78  PHE B HE2  1  
ATOM 5940   H HZ   . PHE B 1 78  ? -5.884  -14.817 144.779 1.00 0.00 ?  78  PHE B HZ   1  
ATOM 5941   N N    . ALA B 1 79  ? -2.223  -20.209 146.633 1.00 0.00 ?  79  ALA B N    1  
ATOM 5942   C CA   . ALA B 1 79  ? -1.887  -20.711 145.321 1.00 0.00 ?  79  ALA B CA   1  
ATOM 5943   C C    . ALA B 1 79  ? -2.758  -21.890 145.010 1.00 0.00 ?  79  ALA B C    1  
ATOM 5944   O O    . ALA B 1 79  ? -3.164  -22.079 143.864 1.00 0.00 ?  79  ALA B O    1  
ATOM 5945   C CB   . ALA B 1 79  ? -0.424  -21.167 145.205 1.00 0.00 ?  79  ALA B CB   1  
ATOM 5946   H H    . ALA B 1 79  ? -1.484  -20.187 147.302 1.00 0.00 ?  79  ALA B H    1  
ATOM 5947   H HA   . ALA B 1 79  ? -2.088  -19.924 144.611 1.00 0.00 ?  79  ALA B HA   1  
ATOM 5948   H HB1  . ALA B 1 79  ? -0.348  -22.264 145.366 1.00 0.00 ?  79  ALA B HB1  1  
ATOM 5949   H HB2  . ALA B 1 79  ? 0.202   -20.653 145.965 1.00 0.00 ?  79  ALA B HB2  1  
ATOM 5950   H HB3  . ALA B 1 79  ? -0.024  -20.929 144.196 1.00 0.00 ?  79  ALA B HB3  1  
ATOM 5951   N N    . LEU B 1 80  ? -3.030  -22.736 146.017 1.00 0.00 ?  80  LEU B N    1  
ATOM 5952   C CA   . LEU B 1 80  ? -3.866  -23.885 145.792 1.00 0.00 ?  80  LEU B CA   1  
ATOM 5953   C C    . LEU B 1 80  ? -5.235  -23.403 145.390 1.00 0.00 ?  80  LEU B C    1  
ATOM 5954   O O    . LEU B 1 80  ? -5.884  -24.000 144.531 1.00 0.00 ?  80  LEU B O    1  
ATOM 5955   C CB   . LEU B 1 80  ? -4.025  -24.777 147.036 1.00 0.00 ?  80  LEU B CB   1  
ATOM 5956   C CG   . LEU B 1 80  ? -2.726  -25.513 147.405 1.00 0.00 ?  80  LEU B CG   1  
ATOM 5957   C CD1  . LEU B 1 80  ? -2.847  -26.215 148.768 1.00 0.00 ?  80  LEU B CD1  1  
ATOM 5958   C CD2  . LEU B 1 80  ? -2.310  -26.505 146.304 1.00 0.00 ?  80  LEU B CD2  1  
ATOM 5959   H H    . LEU B 1 80  ? -2.657  -22.620 146.932 1.00 0.00 ?  80  LEU B H    1  
ATOM 5960   H HA   . LEU B 1 80  ? -3.436  -24.447 144.978 1.00 0.00 ?  80  LEU B HA   1  
ATOM 5961   H HB2  . LEU B 1 80  ? -4.344  -24.147 147.895 1.00 0.00 ?  80  LEU B HB2  1  
ATOM 5962   H HB3  . LEU B 1 80  ? -4.818  -25.529 146.846 1.00 0.00 ?  80  LEU B HB3  1  
ATOM 5963   H HG   . LEU B 1 80  ? -1.921  -24.751 147.491 1.00 0.00 ?  80  LEU B HG   1  
ATOM 5964   H HD11 . LEU B 1 80  ? -3.663  -26.968 148.743 1.00 0.00 ?  80  LEU B HD11 1  
ATOM 5965   H HD12 . LEU B 1 80  ? -3.073  -25.474 149.564 1.00 0.00 ?  80  LEU B HD12 1  
ATOM 5966   H HD13 . LEU B 1 80  ? -1.897  -26.730 149.023 1.00 0.00 ?  80  LEU B HD13 1  
ATOM 5967   H HD21 . LEU B 1 80  ? -3.196  -26.815 145.710 1.00 0.00 ?  80  LEU B HD21 1  
ATOM 5968   H HD22 . LEU B 1 80  ? -1.850  -27.410 146.754 1.00 0.00 ?  80  LEU B HD22 1  
ATOM 5969   H HD23 . LEU B 1 80  ? -1.572  -26.034 145.620 1.00 0.00 ?  80  LEU B HD23 1  
ATOM 5970   N N    . LEU B 1 81  ? -5.710  -22.309 146.023 1.00 0.00 ?  81  LEU B N    1  
ATOM 5971   C CA   . LEU B 1 81  ? -7.018  -21.777 145.705 1.00 0.00 ?  81  LEU B CA   1  
ATOM 5972   C C    . LEU B 1 81  ? -7.018  -21.303 144.275 1.00 0.00 ?  81  LEU B C    1  
ATOM 5973   O O    . LEU B 1 81  ? -8.037  -21.347 143.604 1.00 0.00 ?  81  LEU B O    1  
ATOM 5974   C CB   . LEU B 1 81  ? -7.459  -20.608 146.602 1.00 0.00 ?  81  LEU B CB   1  
ATOM 5975   C CG   . LEU B 1 81  ? -7.727  -21.042 148.055 1.00 0.00 ?  81  LEU B CG   1  
ATOM 5976   C CD1  . LEU B 1 81  ? -7.956  -19.827 148.967 1.00 0.00 ?  81  LEU B CD1  1  
ATOM 5977   C CD2  . LEU B 1 81  ? -8.904  -22.030 148.139 1.00 0.00 ?  81  LEU B CD2  1  
ATOM 5978   H H    . LEU B 1 81  ? -5.198  -21.837 146.738 1.00 0.00 ?  81  LEU B H    1  
ATOM 5979   H HA   . LEU B 1 81  ? -7.718  -22.594 145.793 1.00 0.00 ?  81  LEU B HA   1  
ATOM 5980   H HB2  . LEU B 1 81  ? -6.679  -19.820 146.593 1.00 0.00 ?  81  LEU B HB2  1  
ATOM 5981   H HB3  . LEU B 1 81  ? -8.392  -20.174 146.189 1.00 0.00 ?  81  LEU B HB3  1  
ATOM 5982   H HG   . LEU B 1 81  ? -6.820  -21.569 148.420 1.00 0.00 ?  81  LEU B HG   1  
ATOM 5983   H HD11 . LEU B 1 81  ? -7.176  -19.058 148.789 1.00 0.00 ?  81  LEU B HD11 1  
ATOM 5984   H HD12 . LEU B 1 81  ? -7.916  -20.133 150.035 1.00 0.00 ?  81  LEU B HD12 1  
ATOM 5985   H HD13 . LEU B 1 81  ? -8.951  -19.375 148.766 1.00 0.00 ?  81  LEU B HD13 1  
ATOM 5986   H HD21 . LEU B 1 81  ? -9.540  -21.799 149.020 1.00 0.00 ?  81  LEU B HD21 1  
ATOM 5987   H HD22 . LEU B 1 81  ? -8.528  -23.071 148.237 1.00 0.00 ?  81  LEU B HD22 1  
ATOM 5988   H HD23 . LEU B 1 81  ? -9.530  -21.964 147.223 1.00 0.00 ?  81  LEU B HD23 1  
ATOM 5989   N N    . TYR B 1 82  ? -5.891  -20.744 143.810 1.00 0.00 ?  82  TYR B N    1  
ATOM 5990   C CA   . TYR B 1 82  ? -5.788  -20.275 142.442 1.00 0.00 ?  82  TYR B CA   1  
ATOM 5991   C C    . TYR B 1 82  ? -6.045  -21.420 141.488 1.00 0.00 ?  82  TYR B C    1  
ATOM 5992   O O    . TYR B 1 82  ? -6.612  -21.232 140.412 1.00 0.00 ?  82  TYR B O    1  
ATOM 5993   C CB   . TYR B 1 82  ? -4.405  -19.673 142.139 1.00 0.00 ?  82  TYR B CB   1  
ATOM 5994   C CG   . TYR B 1 82  ? -3.848  -20.033 140.805 1.00 0.00 ?  82  TYR B CG   1  
ATOM 5995   C CD1  . TYR B 1 82  ? -2.843  -20.974 140.710 1.00 0.00 ?  82  TYR B CD1  1  
ATOM 5996   C CD2  . TYR B 1 82  ? -4.307  -19.431 139.658 1.00 0.00 ?  82  TYR B CD2  1  
ATOM 5997   C CE1  . TYR B 1 82  ? -2.306  -21.302 139.489 1.00 0.00 ?  82  TYR B CE1  1  
ATOM 5998   C CE2  . TYR B 1 82  ? -3.770  -19.768 138.438 1.00 0.00 ?  82  TYR B CE2  1  
ATOM 5999   C CZ   . TYR B 1 82  ? -2.774  -20.696 138.354 1.00 0.00 ?  82  TYR B CZ   1  
ATOM 6000   O OH   . TYR B 1 82  ? -2.224  -21.014 137.096 1.00 0.00 ?  82  TYR B OH   1  
ATOM 6001   H H    . TYR B 1 82  ? -5.093  -20.605 144.387 1.00 0.00 ?  82  TYR B H    1  
ATOM 6002   H HA   . TYR B 1 82  ? -6.554  -19.528 142.301 1.00 0.00 ?  82  TYR B HA   1  
ATOM 6003   H HB2  . TYR B 1 82  ? -4.469  -18.565 142.169 1.00 0.00 ?  82  TYR B HB2  1  
ATOM 6004   H HB3  . TYR B 1 82  ? -3.674  -19.999 142.905 1.00 0.00 ?  82  TYR B HB3  1  
ATOM 6005   H HD1  . TYR B 1 82  ? -2.473  -21.454 141.604 1.00 0.00 ?  82  TYR B HD1  1  
ATOM 6006   H HD2  . TYR B 1 82  ? -5.096  -18.694 139.715 1.00 0.00 ?  82  TYR B HD2  1  
ATOM 6007   H HE1  . TYR B 1 82  ? -1.522  -22.040 139.423 1.00 0.00 ?  82  TYR B HE1  1  
ATOM 6008   H HE2  . TYR B 1 82  ? -4.130  -19.301 137.544 1.00 0.00 ?  82  TYR B HE2  1  
ATOM 6009   H HH   . TYR B 1 82  ? -2.210  -20.205 136.570 1.00 0.00 ?  82  TYR B HH   1  
ATOM 6010   N N    . GLN B 1 83  ? -5.627  -22.629 141.884 1.00 0.00 ?  83  GLN B N    1  
ATOM 6011   C CA   . GLN B 1 83  ? -5.773  -23.808 141.058 1.00 0.00 ?  83  GLN B CA   1  
ATOM 6012   C C    . GLN B 1 83  ? -7.144  -24.421 141.240 1.00 0.00 ?  83  GLN B C    1  
ATOM 6013   O O    . GLN B 1 83  ? -7.411  -25.469 140.654 1.00 0.00 ?  83  GLN B O    1  
ATOM 6014   C CB   . GLN B 1 83  ? -4.744  -24.902 141.383 1.00 0.00 ?  83  GLN B CB   1  
ATOM 6015   C CG   . GLN B 1 83  ? -3.321  -24.513 140.979 1.00 0.00 ?  83  GLN B CG   1  
ATOM 6016   C CD   . GLN B 1 83  ? -2.366  -25.563 141.525 1.00 0.00 ?  83  GLN B CD   1  
ATOM 6017   O OE1  . GLN B 1 83  ? -2.620  -26.175 142.561 1.00 0.00 ?  83  GLN B OE1  1  
ATOM 6018   N NE2  . GLN B 1 83  ? -1.234  -25.785 140.806 1.00 0.00 ?  83  GLN B NE2  1  
ATOM 6019   H H    . GLN B 1 83  ? -5.185  -22.768 142.767 1.00 0.00 ?  83  GLN B H    1  
ATOM 6020   H HA   . GLN B 1 83  ? -5.664  -23.497 140.032 1.00 0.00 ?  83  GLN B HA   1  
ATOM 6021   H HB2  . GLN B 1 83  ? -4.770  -25.108 142.475 1.00 0.00 ?  83  GLN B HB2  1  
ATOM 6022   H HB3  . GLN B 1 83  ? -5.027  -25.835 140.851 1.00 0.00 ?  83  GLN B HB3  1  
ATOM 6023   H HG2  . GLN B 1 83  ? -3.237  -24.467 139.871 1.00 0.00 ?  83  GLN B HG2  1  
ATOM 6024   H HG3  . GLN B 1 83  ? -3.058  -23.522 141.405 1.00 0.00 ?  83  GLN B HG3  1  
ATOM 6025   H HE21 . GLN B 1 83  ? -1.066  -25.267 139.967 1.00 0.00 ?  83  GLN B HE21 1  
ATOM 6026   H HE22 . GLN B 1 83  ? -0.569  -26.464 141.117 1.00 0.00 ?  83  GLN B HE22 1  
ATOM 6027   N N    . LEU B 1 84  ? -8.024  -23.792 142.070 1.00 0.00 ?  84  LEU B N    1  
ATOM 6028   C CA   . LEU B 1 84  ? -9.335  -24.364 142.412 1.00 0.00 ?  84  LEU B CA   1  
ATOM 6029   C C    . LEU B 1 84  ? -10.134 -24.829 141.215 1.00 0.00 ?  84  LEU B C    1  
ATOM 6030   O O    . LEU B 1 84  ? -10.759 -25.875 141.320 1.00 0.00 ?  84  LEU B O    1  
ATOM 6031   C CB   . LEU B 1 84  ? -10.243 -23.403 143.212 1.00 0.00 ?  84  LEU B CB   1  
ATOM 6032   C CG   . LEU B 1 84  ? -11.492 -24.090 143.793 1.00 0.00 ?  84  LEU B CG   1  
ATOM 6033   C CD1  . LEU B 1 84  ? -11.760 -23.637 145.238 1.00 0.00 ?  84  LEU B CD1  1  
ATOM 6034   C CD2  . LEU B 1 84  ? -12.725 -23.860 142.901 1.00 0.00 ?  84  LEU B CD2  1  
ATOM 6035   H H    . LEU B 1 84  ? -7.807  -22.918 142.500 1.00 0.00 ?  84  LEU B H    1  
ATOM 6036   H HA   . LEU B 1 84  ? -9.129  -25.229 143.022 1.00 0.00 ?  84  LEU B HA   1  
ATOM 6037   H HB2  . LEU B 1 84  ? -9.658  -22.972 144.049 1.00 0.00 ?  84  LEU B HB2  1  
ATOM 6038   H HB3  . LEU B 1 84  ? -10.567 -22.573 142.551 1.00 0.00 ?  84  LEU B HB3  1  
ATOM 6039   H HG   . LEU B 1 84  ? -11.294 -25.184 143.816 1.00 0.00 ?  84  LEU B HG   1  
ATOM 6040   H HD11 . LEU B 1 84  ? -12.457 -24.341 145.741 1.00 0.00 ?  84  LEU B HD11 1  
ATOM 6041   H HD12 . LEU B 1 84  ? -12.213 -22.623 145.246 1.00 0.00 ?  84  LEU B HD12 1  
ATOM 6042   H HD13 . LEU B 1 84  ? -10.811 -23.605 145.814 1.00 0.00 ?  84  LEU B HD13 1  
ATOM 6043   H HD21 . LEU B 1 84  ? -13.263 -24.817 142.732 1.00 0.00 ?  84  LEU B HD21 1  
ATOM 6044   H HD22 . LEU B 1 84  ? -12.417 -23.448 141.917 1.00 0.00 ?  84  LEU B HD22 1  
ATOM 6045   H HD23 . LEU B 1 84  ? -13.422 -23.142 143.384 1.00 0.00 ?  84  LEU B HD23 1  
ATOM 6046   N N    . GLY B 1 85  ? -10.133 -24.146 140.052 1.00 0.00 ?  85  GLY B N    1  
ATOM 6047   C CA   . GLY B 1 85  ? -10.922 -24.668 138.941 1.00 0.00 ?  85  GLY B CA   1  
ATOM 6048   C C    . GLY B 1 85  ? -11.779 -23.604 138.354 1.00 0.00 ?  85  GLY B C    1  
ATOM 6049   O O    . GLY B 1 85  ? -12.571 -23.867 137.456 1.00 0.00 ?  85  GLY B O    1  
ATOM 6050   H H    . GLY B 1 85  ? -9.623  -23.302 139.904 1.00 0.00 ?  85  GLY B H    1  
ATOM 6051   H HA2  . GLY B 1 85  ? -10.227 -24.995 138.186 1.00 0.00 ?  85  GLY B HA2  1  
ATOM 6052   H HA3  . GLY B 1 85  ? -11.561 -25.453 139.312 1.00 0.00 ?  85  GLY B HA3  1  
ATOM 6053   N N    . ASP B 1 86  ? -11.650 -22.376 138.852 1.00 0.00 ?  86  ASP B N    1  
ATOM 6054   C CA   . ASP B 1 86  ? -12.343 -21.277 138.256 1.00 0.00 ?  86  ASP B CA   1  
ATOM 6055   C C    . ASP B 1 86  ? -11.437 -20.912 137.127 1.00 0.00 ?  86  ASP B C    1  
ATOM 6056   O O    . ASP B 1 86  ? -10.406 -21.564 136.958 1.00 0.00 ?  86  ASP B O    1  
ATOM 6057   C CB   . ASP B 1 86  ? -12.505 -20.052 139.163 1.00 0.00 ?  86  ASP B CB   1  
ATOM 6058   C CG   . ASP B 1 86  ? -11.177 -19.360 139.429 1.00 0.00 ?  86  ASP B CG   1  
ATOM 6059   O OD1  . ASP B 1 86  ? -11.159 -18.102 139.428 1.00 0.00 ?  86  ASP B OD1  1  
ATOM 6060   O OD2  . ASP B 1 86  ? -10.165 -20.079 139.650 1.00 0.00 -1 86  ASP B OD2  1  
ATOM 6061   H H    . ASP B 1 86  ? -11.080 -22.172 139.644 1.00 0.00 ?  86  ASP B H    1  
ATOM 6062   H HA   . ASP B 1 86  ? -13.292 -21.625 137.876 1.00 0.00 ?  86  ASP B HA   1  
ATOM 6063   H HB2  . ASP B 1 86  ? -13.193 -19.331 138.678 1.00 0.00 ?  86  ASP B HB2  1  
ATOM 6064   H HB3  . ASP B 1 86  ? -12.948 -20.364 140.133 1.00 0.00 ?  86  ASP B HB3  1  
ATOM 6065   N N    . ALA B 1 87  ? -11.809 -19.953 136.255 1.00 0.00 ?  87  ALA B N    1  
ATOM 6066   C CA   . ALA B 1 87  ? -10.889 -19.610 135.202 1.00 0.00 ?  87  ALA B CA   1  
ATOM 6067   C C    . ALA B 1 87  ? -9.628  -19.164 135.934 1.00 0.00 ?  87  ALA B C    1  
ATOM 6068   O O    . ALA B 1 87  ? -9.697  -18.299 136.803 1.00 0.00 ?  87  ALA B O    1  
ATOM 6069   C CB   . ALA B 1 87  ? -11.368 -18.451 134.315 1.00 0.00 ?  87  ALA B CB   1  
ATOM 6070   H H    . ALA B 1 87  ? -12.679 -19.467 136.295 1.00 0.00 ?  87  ALA B H    1  
ATOM 6071   H HA   . ALA B 1 87  ? -10.733 -20.500 134.624 1.00 0.00 ?  87  ALA B HA   1  
ATOM 6072   H HB1  . ALA B 1 87  ? -10.642 -17.611 134.353 1.00 0.00 ?  87  ALA B HB1  1  
ATOM 6073   H HB2  . ALA B 1 87  ? -12.356 -18.081 134.664 1.00 0.00 ?  87  ALA B HB2  1  
ATOM 6074   H HB3  . ALA B 1 87  ? -11.466 -18.787 133.261 1.00 0.00 ?  87  ALA B HB3  1  
ATOM 6075   N N    . PRO B 1 88  ? -8.474  -19.742 135.620 1.00 0.00 ?  88  PRO B N    1  
ATOM 6076   C CA   . PRO B 1 88  ? -7.251  -19.433 136.349 1.00 0.00 ?  88  PRO B CA   1  
ATOM 6077   C C    . PRO B 1 88  ? -6.670  -18.097 136.061 1.00 0.00 ?  88  PRO B C    1  
ATOM 6078   O O    . PRO B 1 88  ? -6.959  -17.493 135.032 1.00 0.00 ?  88  PRO B O    1  
ATOM 6079   C CB   . PRO B 1 88  ? -6.279  -20.527 135.921 1.00 0.00 ?  88  PRO B CB   1  
ATOM 6080   C CG   . PRO B 1 88  ? -6.711  -20.856 134.501 1.00 0.00 ?  88  PRO B CG   1  
ATOM 6081   C CD   . PRO B 1 88  ? -8.230  -20.696 134.522 1.00 0.00 ?  88  PRO B CD   1  
ATOM 6082   H HA   . PRO B 1 88  ? -7.412  -19.515 137.413 1.00 0.00 ?  88  PRO B HA   1  
ATOM 6083   H HB2  . PRO B 1 88  ? -5.232  -20.155 135.939 1.00 0.00 ?  88  PRO B HB2  1  
ATOM 6084   H HB3  . PRO B 1 88  ? -6.373  -21.419 136.576 1.00 0.00 ?  88  PRO B HB3  1  
ATOM 6085   H HG2  . PRO B 1 88  ? -6.247  -20.149 133.779 1.00 0.00 ?  88  PRO B HG2  1  
ATOM 6086   H HG3  . PRO B 1 88  ? -6.431  -21.896 134.239 1.00 0.00 ?  88  PRO B HG3  1  
ATOM 6087   H HD2  . PRO B 1 88  ? -8.592  -20.293 133.552 1.00 0.00 ?  88  PRO B HD2  1  
ATOM 6088   H HD3  . PRO B 1 88  ? -8.720  -21.673 134.722 1.00 0.00 ?  88  PRO B HD3  1  
ATOM 6089   N N    . ILE B 1 89  ? -5.832  -17.602 137.008 1.00 0.00 ?  89  ILE B N    1  
ATOM 6090   C CA   . ILE B 1 89  ? -5.175  -16.348 136.813 1.00 0.00 ?  89  ILE B CA   1  
ATOM 6091   C C    . ILE B 1 89  ? -3.830  -16.694 136.276 1.00 0.00 ?  89  ILE B C    1  
ATOM 6092   O O    . ILE B 1 89  ? -2.978  -17.257 136.960 1.00 0.00 ?  89  ILE B O    1  
ATOM 6093   C CB   . ILE B 1 89  ? -4.987  -15.557 138.072 1.00 0.00 ?  89  ILE B CB   1  
ATOM 6094   C CG1  . ILE B 1 89  ? -6.350  -15.242 138.709 1.00 0.00 ?  89  ILE B CG1  1  
ATOM 6095   C CG2  . ILE B 1 89  ? -4.203  -14.283 137.717 1.00 0.00 ?  89  ILE B CG2  1  
ATOM 6096   C CD1  . ILE B 1 89  ? -6.218  -14.649 140.110 1.00 0.00 ?  89  ILE B CD1  1  
ATOM 6097   H H    . ILE B 1 89  ? -5.641  -18.080 137.862 1.00 0.00 ?  89  ILE B H    1  
ATOM 6098   H HA   . ILE B 1 89  ? -5.726  -15.781 136.077 1.00 0.00 ?  89  ILE B HA   1  
ATOM 6099   H HB   . ILE B 1 89  ? -4.386  -16.150 138.796 1.00 0.00 ?  89  ILE B HB   1  
ATOM 6100   H HG12 . ILE B 1 89  ? -6.895  -14.523 138.059 1.00 0.00 ?  89  ILE B HG12 1  
ATOM 6101   H HG13 . ILE B 1 89  ? -6.948  -16.174 138.769 1.00 0.00 ?  89  ILE B HG13 1  
ATOM 6102   H HG21 . ILE B 1 89  ? -4.597  -13.416 138.288 1.00 0.00 ?  89  ILE B HG21 1  
ATOM 6103   H HG22 . ILE B 1 89  ? -4.293  -14.063 136.632 1.00 0.00 ?  89  ILE B HG22 1  
ATOM 6104   H HG23 . ILE B 1 89  ? -3.126  -14.411 137.965 1.00 0.00 ?  89  ILE B HG23 1  
ATOM 6105   H HD11 . ILE B 1 89  ? -5.317  -14.004 140.174 1.00 0.00 ?  89  ILE B HD11 1  
ATOM 6106   H HD12 . ILE B 1 89  ? -6.129  -15.460 140.865 1.00 0.00 ?  89  ILE B HD12 1  
ATOM 6107   H HD13 . ILE B 1 89  ? -7.112  -14.034 140.354 1.00 0.00 ?  89  ILE B HD13 1  
ATOM 6108   N N    . ALA B 1 90  ? -3.641  -16.330 135.010 1.00 0.00 ?  90  ALA B N    1  
ATOM 6109   C CA   . ALA B 1 90  ? -2.435  -16.591 134.289 1.00 0.00 ?  90  ALA B CA   1  
ATOM 6110   C C    . ALA B 1 90  ? -1.918  -15.271 133.851 1.00 0.00 ?  90  ALA B C    1  
ATOM 6111   O O    . ALA B 1 90  ? -2.307  -14.242 134.391 1.00 0.00 ?  90  ALA B O    1  
ATOM 6112   C CB   . ALA B 1 90  ? -2.641  -17.467 133.041 1.00 0.00 ?  90  ALA B CB   1  
ATOM 6113   H H    . ALA B 1 90  ? -4.349  -15.847 134.499 1.00 0.00 ?  90  ALA B H    1  
ATOM 6114   H HA   . ALA B 1 90  ? -1.728  -17.048 134.961 1.00 0.00 ?  90  ALA B HA   1  
ATOM 6115   H HB1  . ALA B 1 90  ? -3.156  -18.412 133.314 1.00 0.00 ?  90  ALA B HB1  1  
ATOM 6116   H HB2  . ALA B 1 90  ? -1.663  -17.718 132.579 1.00 0.00 ?  90  ALA B HB2  1  
ATOM 6117   H HB3  . ALA B 1 90  ? -3.261  -16.930 132.290 1.00 0.00 ?  90  ALA B HB3  1  
ATOM 6118   N N    . ASN B 1 91  ? -0.933  -15.318 132.931 1.00 0.00 ?  91  ASN B N    1  
ATOM 6119   C CA   . ASN B 1 91  ? -0.350  -14.133 132.350 1.00 0.00 ?  91  ASN B CA   1  
ATOM 6120   C C    . ASN B 1 91  ? 0.515   -13.477 133.357 1.00 0.00 ?  91  ASN B C    1  
ATOM 6121   O O    . ASN B 1 91  ? 0.547   -12.252 133.475 1.00 0.00 ?  91  ASN B O    1  
ATOM 6122   C CB   . ASN B 1 91  ? -1.363  -13.099 131.809 1.00 0.00 ?  91  ASN B CB   1  
ATOM 6123   C CG   . ASN B 1 91  ? -0.737  -12.171 130.775 1.00 0.00 ?  91  ASN B CG   1  
ATOM 6124   O OD1  . ASN B 1 91  ? 0.128   -12.577 129.998 1.00 0.00 ?  91  ASN B OD1  1  
ATOM 6125   N ND2  . ASN B 1 91  ? -1.190  -10.888 130.753 1.00 0.00 ?  91  ASN B ND2  1  
ATOM 6126   H H    . ASN B 1 91  ? -0.559  -16.184 132.608 1.00 0.00 ?  91  ASN B H    1  
ATOM 6127   H HA   . ASN B 1 91  ? 0.280   -14.471 131.541 1.00 0.00 ?  91  ASN B HA   1  
ATOM 6128   H HB2  . ASN B 1 91  ? -2.218  -13.632 131.340 1.00 0.00 ?  91  ASN B HB2  1  
ATOM 6129   H HB3  . ASN B 1 91  ? -1.753  -12.488 132.649 1.00 0.00 ?  91  ASN B HB3  1  
ATOM 6130   H HD21 . ASN B 1 91  ? -1.903  -10.596 131.399 1.00 0.00 ?  91  ASN B HD21 1  
ATOM 6131   H HD22 . ASN B 1 91  ? -0.815  -10.236 130.094 1.00 0.00 ?  91  ASN B HD22 1  
ATOM 6132   N N    . GLN B 1 92  ? 1.237   -14.323 134.109 1.00 0.00 ?  92  GLN B N    1  
ATOM 6133   C CA   . GLN B 1 92  ? 2.186   -13.860 135.066 1.00 0.00 ?  92  GLN B CA   1  
ATOM 6134   C C    . GLN B 1 92  ? 3.471   -14.299 134.444 1.00 0.00 ?  92  GLN B C    1  
ATOM 6135   O O    . GLN B 1 92  ? 3.436   -15.180 133.585 1.00 0.00 ?  92  GLN B O    1  
ATOM 6136   C CB   . GLN B 1 92  ? 2.044   -14.505 136.460 1.00 0.00 ?  92  GLN B CB   1  
ATOM 6137   C CG   . GLN B 1 92  ? 2.882   -13.799 137.531 1.00 0.00 ?  92  GLN B CG   1  
ATOM 6138   C CD   . GLN B 1 92  ? 2.388   -12.373 137.674 1.00 0.00 ?  92  GLN B CD   1  
ATOM 6139   O OE1  . GLN B 1 92  ? 1.210   -12.129 137.929 1.00 0.00 ?  92  GLN B OE1  1  
ATOM 6140   N NE2  . GLN B 1 92  ? 3.318   -11.400 137.497 1.00 0.00 ?  92  GLN B NE2  1  
ATOM 6141   H H    . GLN B 1 92  ? 1.140   -15.313 134.031 1.00 0.00 ?  92  GLN B H    1  
ATOM 6142   H HA   . GLN B 1 92  ? 2.146   -12.784 135.109 1.00 0.00 ?  92  GLN B HA   1  
ATOM 6143   H HB2  . GLN B 1 92  ? 0.974   -14.482 136.761 1.00 0.00 ?  92  GLN B HB2  1  
ATOM 6144   H HB3  . GLN B 1 92  ? 2.361   -15.568 136.400 1.00 0.00 ?  92  GLN B HB3  1  
ATOM 6145   H HG2  . GLN B 1 92  ? 2.788   -14.326 138.501 1.00 0.00 ?  92  GLN B HG2  1  
ATOM 6146   H HG3  . GLN B 1 92  ? 3.944   -13.776 137.234 1.00 0.00 ?  92  GLN B HG3  1  
ATOM 6147   H HE21 . GLN B 1 92  ? 4.264   -11.644 137.284 1.00 0.00 ?  92  GLN B HE21 1  
ATOM 6148   H HE22 . GLN B 1 92  ? 3.056   -10.441 137.584 1.00 0.00 ?  92  GLN B HE22 1  
ATOM 6149   N N    . SER B 1 93  ? 4.622   -13.681 134.811 1.00 0.00 ?  93  SER B N    1  
ATOM 6150   C CA   . SER B 1 93  ? 5.877   -14.056 134.185 1.00 0.00 ?  93  SER B CA   1  
ATOM 6151   C C    . SER B 1 93  ? 6.125   -15.557 134.312 1.00 0.00 ?  93  SER B C    1  
ATOM 6152   O O    . SER B 1 93  ? 6.367   -16.195 133.289 1.00 0.00 ?  93  SER B O    1  
ATOM 6153   C CB   . SER B 1 93  ? 7.114   -13.279 134.698 1.00 0.00 ?  93  SER B CB   1  
ATOM 6154   O OG   . SER B 1 93  ? 8.289   -13.735 134.038 1.00 0.00 ?  93  SER B OG   1  
ATOM 6155   H H    . SER B 1 93  ? 4.658   -12.966 135.504 1.00 0.00 ?  93  SER B H    1  
ATOM 6156   H HA   . SER B 1 93  ? 5.748   -13.844 133.133 1.00 0.00 ?  93  SER B HA   1  
ATOM 6157   H HB2  . SER B 1 93  ? 6.991   -12.194 134.491 1.00 0.00 ?  93  SER B HB2  1  
ATOM 6158   H HB3  . SER B 1 93  ? 7.242   -13.419 135.788 1.00 0.00 ?  93  SER B HB3  1  
ATOM 6159   H HG   . SER B 1 93  ? 9.022   -13.263 134.445 1.00 0.00 ?  93  SER B HG   1  
ATOM 6160   N N    . PRO B 1 94  ? 6.076   -16.185 135.491 1.00 0.00 ?  94  PRO B N    1  
ATOM 6161   C CA   . PRO B 1 94  ? 6.268   -17.613 135.534 1.00 0.00 ?  94  PRO B CA   1  
ATOM 6162   C C    . PRO B 1 94  ? 4.964   -18.337 135.277 1.00 0.00 ?  94  PRO B C    1  
ATOM 6163   O O    . PRO B 1 94  ? 3.978   -18.035 135.947 1.00 0.00 ?  94  PRO B O    1  
ATOM 6164   C CB   . PRO B 1 94  ? 6.757   -17.903 136.961 1.00 0.00 ?  94  PRO B CB   1  
ATOM 6165   C CG   . PRO B 1 94  ? 6.769   -16.547 137.675 1.00 0.00 ?  94  PRO B CG   1  
ATOM 6166   C CD   . PRO B 1 94  ? 5.859   -15.661 136.840 1.00 0.00 ?  94  PRO B CD   1  
ATOM 6167   H HA   . PRO B 1 94  ? 7.028   -17.909 134.835 1.00 0.00 ?  94  PRO B HA   1  
ATOM 6168   H HB2  . PRO B 1 94  ? 6.066   -18.606 137.474 1.00 0.00 ?  94  PRO B HB2  1  
ATOM 6169   H HB3  . PRO B 1 94  ? 7.779   -18.340 136.941 1.00 0.00 ?  94  PRO B HB3  1  
ATOM 6170   H HG2  . PRO B 1 94  ? 6.380   -16.648 138.711 1.00 0.00 ?  94  PRO B HG2  1  
ATOM 6171   H HG3  . PRO B 1 94  ? 7.799   -16.132 137.705 1.00 0.00 ?  94  PRO B HG3  1  
ATOM 6172   H HD2  . PRO B 1 94  ? 4.801   -15.786 137.158 1.00 0.00 ?  94  PRO B HD2  1  
ATOM 6173   H HD3  . PRO B 1 94  ? 6.152   -14.604 136.938 1.00 0.00 ?  94  PRO B HD3  1  
ATOM 6174   N N    . PRO B 1 95  ? 4.873   -19.277 134.353 1.00 0.00 ?  95  PRO B N    1  
ATOM 6175   C CA   . PRO B 1 95  ? 3.621   -19.971 134.136 1.00 0.00 ?  95  PRO B CA   1  
ATOM 6176   C C    . PRO B 1 95  ? 3.348   -20.954 135.221 1.00 0.00 ?  95  PRO B C    1  
ATOM 6177   O O    . PRO B 1 95  ? 4.270   -21.431 135.864 1.00 0.00 ?  95  PRO B O    1  
ATOM 6178   C CB   . PRO B 1 95  ? 3.813   -20.689 132.803 1.00 0.00 ?  95  PRO B CB   1  
ATOM 6179   C CG   . PRO B 1 95  ? 5.308   -20.968 132.763 1.00 0.00 ?  95  PRO B CG   1  
ATOM 6180   C CD   . PRO B 1 95  ? 5.939   -19.762 133.459 1.00 0.00 ?  95  PRO B CD   1  
ATOM 6181   H HA   . PRO B 1 95  ? 2.795   -19.280 134.061 1.00 0.00 ?  95  PRO B HA   1  
ATOM 6182   H HB2  . PRO B 1 95  ? 3.231   -21.636 132.777 1.00 0.00 ?  95  PRO B HB2  1  
ATOM 6183   H HB3  . PRO B 1 95  ? 3.513   -20.037 131.955 1.00 0.00 ?  95  PRO B HB3  1  
ATOM 6184   H HG2  . PRO B 1 95  ? 5.544   -21.909 133.307 1.00 0.00 ?  95  PRO B HG2  1  
ATOM 6185   H HG3  . PRO B 1 95  ? 5.665   -21.046 131.714 1.00 0.00 ?  95  PRO B HG3  1  
ATOM 6186   H HD2  . PRO B 1 95  ? 6.838   -20.069 134.034 1.00 0.00 ?  95  PRO B HD2  1  
ATOM 6187   H HD3  . PRO B 1 95  ? 6.224   -18.988 132.715 1.00 0.00 ?  95  PRO B HD3  1  
ATOM 6188   N N    . GLY B 1 96  ? 2.065   -21.282 135.456 1.00 0.00 ?  96  GLY B N    1  
ATOM 6189   C CA   . GLY B 1 96  ? 1.747   -22.255 136.464 1.00 0.00 ?  96  GLY B CA   1  
ATOM 6190   C C    . GLY B 1 96  ? 1.568   -21.584 137.791 1.00 0.00 ?  96  GLY B C    1  
ATOM 6191   O O    . GLY B 1 96  ? 1.510   -20.360 137.905 1.00 0.00 ?  96  GLY B O    1  
ATOM 6192   H H    . GLY B 1 96  ? 1.302   -20.879 134.959 1.00 0.00 ?  96  GLY B H    1  
ATOM 6193   H HA2  . GLY B 1 96  ? 0.811   -22.713 136.182 1.00 0.00 ?  96  GLY B HA2  1  
ATOM 6194   H HA3  . GLY B 1 96  ? 2.575   -22.946 136.526 1.00 0.00 ?  96  GLY B HA3  1  
ATOM 6195   N N    . PHE B 1 97  ? 1.504   -22.428 138.847 1.00 0.00 ?  97  PHE B N    1  
ATOM 6196   C CA   . PHE B 1 97  ? 1.274   -21.962 140.192 1.00 0.00 ?  97  PHE B CA   1  
ATOM 6197   C C    . PHE B 1 97  ? 2.387   -21.079 140.660 1.00 0.00 ?  97  PHE B C    1  
ATOM 6198   O O    . PHE B 1 97  ? 2.207   -20.354 141.636 1.00 0.00 ?  97  PHE B O    1  
ATOM 6199   C CB   . PHE B 1 97  ? 1.128   -23.115 141.202 1.00 0.00 ?  97  PHE B CB   1  
ATOM 6200   C CG   . PHE B 1 97  ? 2.400   -23.841 141.488 1.00 0.00 ?  97  PHE B CG   1  
ATOM 6201   C CD1  . PHE B 1 97  ? 3.185   -23.487 142.565 1.00 0.00 ?  97  PHE B CD1  1  
ATOM 6202   C CD2  . PHE B 1 97  ? 2.807   -24.880 140.678 1.00 0.00 ?  97  PHE B CD2  1  
ATOM 6203   C CE1  . PHE B 1 97  ? 4.356   -24.159 142.826 1.00 0.00 ?  97  PHE B CE1  1  
ATOM 6204   C CE2  . PHE B 1 97  ? 3.977   -25.551 140.940 1.00 0.00 ?  97  PHE B CE2  1  
ATOM 6205   C CZ   . PHE B 1 97  ? 4.752   -25.191 142.013 1.00 0.00 ?  97  PHE B CZ   1  
ATOM 6206   H H    . PHE B 1 97  ? 1.613   -23.413 138.741 1.00 0.00 ?  97  PHE B H    1  
ATOM 6207   H HA   . PHE B 1 97  ? 0.364   -21.385 140.173 1.00 0.00 ?  97  PHE B HA   1  
ATOM 6208   H HB2  . PHE B 1 97  ? 0.753   -22.721 142.170 1.00 0.00 ?  97  PHE B HB2  1  
ATOM 6209   H HB3  . PHE B 1 97  ? 0.400   -23.859 140.816 1.00 0.00 ?  97  PHE B HB3  1  
ATOM 6210   H HD1  . PHE B 1 97  ? 2.878   -22.675 143.208 1.00 0.00 ?  97  PHE B HD1  1  
ATOM 6211   H HD2  . PHE B 1 97  ? 2.201   -25.167 139.831 1.00 0.00 ?  97  PHE B HD2  1  
ATOM 6212   H HE1  . PHE B 1 97  ? 4.963   -23.875 143.672 1.00 0.00 ?  97  PHE B HE1  1  
ATOM 6213   H HE2  . PHE B 1 97  ? 4.288   -26.363 140.300 1.00 0.00 ?  97  PHE B HE2  1  
ATOM 6214   H HZ   . PHE B 1 97  ? 5.671   -25.719 142.219 1.00 0.00 ?  97  PHE B HZ   1  
ATOM 6215   N N    . VAL B 1 98  ? 3.574   -21.140 140.021 1.00 0.00 ?  98  VAL B N    1  
ATOM 6216   C CA   . VAL B 1 98  ? 4.663   -20.306 140.451 1.00 0.00 ?  98  VAL B CA   1  
ATOM 6217   C C    . VAL B 1 98  ? 4.226   -18.887 140.244 1.00 0.00 ?  98  VAL B C    1  
ATOM 6218   O O    . VAL B 1 98  ? 4.494   -18.020 141.066 1.00 0.00 ?  98  VAL B O    1  
ATOM 6219   C CB   . VAL B 1 98  ? 5.938   -20.526 139.686 1.00 0.00 ?  98  VAL B CB   1  
ATOM 6220   C CG1  . VAL B 1 98  ? 6.963   -19.463 140.130 1.00 0.00 ?  98  VAL B CG1  1  
ATOM 6221   C CG2  . VAL B 1 98  ? 6.420   -21.962 139.950 1.00 0.00 ?  98  VAL B CG2  1  
ATOM 6222   H H    . VAL B 1 98  ? 3.744   -21.747 139.248 1.00 0.00 ?  98  VAL B H    1  
ATOM 6223   H HA   . VAL B 1 98  ? 4.815   -20.481 141.506 1.00 0.00 ?  98  VAL B HA   1  
ATOM 6224   H HB   . VAL B 1 98  ? 5.750   -20.408 138.598 1.00 0.00 ?  98  VAL B HB   1  
ATOM 6225   H HG11 . VAL B 1 98  ? 6.738   -18.482 139.667 1.00 0.00 ?  98  VAL B HG11 1  
ATOM 6226   H HG12 . VAL B 1 98  ? 7.988   -19.767 139.829 1.00 0.00 ?  98  VAL B HG12 1  
ATOM 6227   H HG13 . VAL B 1 98  ? 6.940   -19.345 141.235 1.00 0.00 ?  98  VAL B HG13 1  
ATOM 6228   H HG21 . VAL B 1 98  ? 7.528   -22.011 139.901 1.00 0.00 ?  98  VAL B HG21 1  
ATOM 6229   H HG22 . VAL B 1 98  ? 6.000   -22.654 139.190 1.00 0.00 ?  98  VAL B HG22 1  
ATOM 6230   H HG23 . VAL B 1 98  ? 6.094   -22.299 140.957 1.00 0.00 ?  98  VAL B HG23 1  
ATOM 6231   N N    . GLY B 1 99  ? 3.564   -18.619 139.103 1.00 0.00 ?  99  GLY B N    1  
ATOM 6232   C CA   . GLY B 1 99  ? 3.092   -17.293 138.817 1.00 0.00 ?  99  GLY B CA   1  
ATOM 6233   C C    . GLY B 1 99  ? 2.091   -16.892 139.861 1.00 0.00 ?  99  GLY B C    1  
ATOM 6234   O O    . GLY B 1 99  ? 2.045   -15.727 140.264 1.00 0.00 ?  99  GLY B O    1  
ATOM 6235   H H    . GLY B 1 99  ? 3.382   -19.314 138.412 1.00 0.00 ?  99  GLY B H    1  
ATOM 6236   H HA2  . GLY B 1 99  ? 3.940   -16.628 138.873 1.00 0.00 ?  99  GLY B HA2  1  
ATOM 6237   H HA3  . GLY B 1 99  ? 2.607   -17.321 137.852 1.00 0.00 ?  99  GLY B HA3  1  
ATOM 6238   N N    . ALA B 1 100 ? 1.236   -17.849 140.286 1.00 0.00 ?  100 ALA B N    1  
ATOM 6239   C CA   . ALA B 1 100 ? 0.223   -17.547 141.265 1.00 0.00 ?  100 ALA B CA   1  
ATOM 6240   C C    . ALA B 1 100 ? 0.893   -17.105 142.529 1.00 0.00 ?  100 ALA B C    1  
ATOM 6241   O O    . ALA B 1 100 ? 0.445   -16.168 143.176 1.00 0.00 ?  100 ALA B O    1  
ATOM 6242   C CB   . ALA B 1 100 ? -0.667  -18.752 141.607 1.00 0.00 ?  100 ALA B CB   1  
ATOM 6243   H H    . ALA B 1 100 ? 1.264   -18.787 139.946 1.00 0.00 ?  100 ALA B H    1  
ATOM 6244   H HA   . ALA B 1 100 ? -0.372  -16.745 140.877 1.00 0.00 ?  100 ALA B HA   1  
ATOM 6245   H HB1  . ALA B 1 100 ? -0.446  -19.115 142.633 1.00 0.00 ?  100 ALA B HB1  1  
ATOM 6246   H HB2  . ALA B 1 100 ? -0.485  -19.580 140.889 1.00 0.00 ?  100 ALA B HB2  1  
ATOM 6247   H HB3  . ALA B 1 100 ? -1.740  -18.466 141.556 1.00 0.00 ?  100 ALA B HB3  1  
ATOM 6248   N N    . PHE B 1 101 ? 1.989   -17.789 142.889 1.00 0.00 ?  101 PHE B N    1  
ATOM 6249   C CA   . PHE B 1 101 ? 2.734   -17.471 144.081 1.00 0.00 ?  101 PHE B CA   1  
ATOM 6250   C C    . PHE B 1 101 ? 3.249   -16.065 143.965 1.00 0.00 ?  101 PHE B C    1  
ATOM 6251   O O    . PHE B 1 101 ? 3.187   -15.282 144.913 1.00 0.00 ?  101 PHE B O    1  
ATOM 6252   C CB   . PHE B 1 101 ? 3.956   -18.394 144.268 1.00 0.00 ?  101 PHE B CB   1  
ATOM 6253   C CG   . PHE B 1 101 ? 4.738   -18.148 145.513 1.00 0.00 ?  101 PHE B CG   1  
ATOM 6254   C CD1  . PHE B 1 101 ? 4.429   -18.817 146.676 1.00 0.00 ?  101 PHE B CD1  1  
ATOM 6255   C CD2  . PHE B 1 101 ? 5.780   -17.248 145.516 1.00 0.00 ?  101 PHE B CD2  1  
ATOM 6256   C CE1  . PHE B 1 101 ? 5.150   -18.590 147.823 1.00 0.00 ?  101 PHE B CE1  1  
ATOM 6257   C CE2  . PHE B 1 101 ? 6.501   -17.020 146.664 1.00 0.00 ?  101 PHE B CE2  1  
ATOM 6258   C CZ   . PHE B 1 101 ? 6.187   -17.692 147.818 1.00 0.00 ?  101 PHE B CZ   1  
ATOM 6259   H H    . PHE B 1 101 ? 2.330   -18.553 142.356 1.00 0.00 ?  101 PHE B H    1  
ATOM 6260   H HA   . PHE B 1 101 ? 2.068   -17.545 144.925 1.00 0.00 ?  101 PHE B HA   1  
ATOM 6261   H HB2  . PHE B 1 101 ? 3.624   -19.452 144.298 1.00 0.00 ?  101 PHE B HB2  1  
ATOM 6262   H HB3  . PHE B 1 101 ? 4.653   -18.268 143.414 1.00 0.00 ?  101 PHE B HB3  1  
ATOM 6263   H HD1  . PHE B 1 101 ? 3.614   -19.526 146.686 1.00 0.00 ?  101 PHE B HD1  1  
ATOM 6264   H HD2  . PHE B 1 101 ? 6.032   -16.715 144.610 1.00 0.00 ?  101 PHE B HD2  1  
ATOM 6265   H HE1  . PHE B 1 101 ? 4.901   -19.120 148.731 1.00 0.00 ?  101 PHE B HE1  1  
ATOM 6266   H HE2  . PHE B 1 101 ? 7.317   -16.312 146.658 1.00 0.00 ?  101 PHE B HE2  1  
ATOM 6267   H HZ   . PHE B 1 101 ? 6.753   -17.514 148.719 1.00 0.00 ?  101 PHE B HZ   1  
ATOM 6268   N N    . PHE B 1 102 ? 3.793   -15.741 142.779 1.00 0.00 ?  102 PHE B N    1  
ATOM 6269   C CA   . PHE B 1 102 ? 4.399   -14.457 142.544 1.00 0.00 ?  102 PHE B CA   1  
ATOM 6270   C C    . PHE B 1 102 ? 3.436   -13.318 142.726 1.00 0.00 ?  102 PHE B C    1  
ATOM 6271   O O    . PHE B 1 102 ? 3.818   -12.308 143.305 1.00 0.00 ?  102 PHE B O    1  
ATOM 6272   C CB   . PHE B 1 102 ? 4.948   -14.337 141.112 1.00 0.00 ?  102 PHE B CB   1  
ATOM 6273   C CG   . PHE B 1 102 ? 6.383   -14.723 140.953 1.00 0.00 ?  102 PHE B CG   1  
ATOM 6274   C CD1  . PHE B 1 102 ? 7.248   -13.875 140.298 1.00 0.00 ?  102 PHE B CD1  1  
ATOM 6275   C CD2  . PHE B 1 102 ? 6.866   -15.921 141.446 1.00 0.00 ?  102 PHE B CD2  1  
ATOM 6276   C CE1  . PHE B 1 102 ? 8.568   -14.215 140.135 1.00 0.00 ?  102 PHE B CE1  1  
ATOM 6277   C CE2  . PHE B 1 102 ? 8.189   -16.256 141.283 1.00 0.00 ?  102 PHE B CE2  1  
ATOM 6278   C CZ   . PHE B 1 102 ? 9.038   -15.404 140.626 1.00 0.00 ?  102 PHE B CZ   1  
ATOM 6279   H H    . PHE B 1 102 ? 3.812   -16.380 142.015 1.00 0.00 ?  102 PHE B H    1  
ATOM 6280   H HA   . PHE B 1 102 ? 5.206   -14.349 143.248 1.00 0.00 ?  102 PHE B HA   1  
ATOM 6281   H HB2  . PHE B 1 102 ? 4.362   -14.989 140.433 1.00 0.00 ?  102 PHE B HB2  1  
ATOM 6282   H HB3  . PHE B 1 102 ? 4.848   -13.285 140.763 1.00 0.00 ?  102 PHE B HB3  1  
ATOM 6283   H HD1  . PHE B 1 102 ? 6.885   -12.935 139.909 1.00 0.00 ?  102 PHE B HD1  1  
ATOM 6284   H HD2  . PHE B 1 102 ? 6.209   -16.599 141.964 1.00 0.00 ?  102 PHE B HD2  1  
ATOM 6285   H HE1  . PHE B 1 102 ? 9.237   -13.542 139.620 1.00 0.00 ?  102 PHE B HE1  1  
ATOM 6286   H HE2  . PHE B 1 102 ? 8.559   -17.194 141.670 1.00 0.00 ?  102 PHE B HE2  1  
ATOM 6287   H HZ   . PHE B 1 102 ? 10.075  -15.669 140.497 1.00 0.00 ?  102 PHE B HZ   1  
ATOM 6288   N N    . PHE B 1 103 ? 2.182   -13.404 142.226 1.00 0.00 ?  103 PHE B N    1  
ATOM 6289   C CA   . PHE B 1 103 ? 1.305   -12.257 142.376 1.00 0.00 ?  103 PHE B CA   1  
ATOM 6290   C C    . PHE B 1 103 ? 0.654   -12.293 143.722 1.00 0.00 ?  103 PHE B C    1  
ATOM 6291   O O    . PHE B 1 103 ? 0.375   -11.254 144.319 1.00 0.00 ?  103 PHE B O    1  
ATOM 6292   C CB   . PHE B 1 103 ? 0.197   -12.139 141.301 1.00 0.00 ?  103 PHE B CB   1  
ATOM 6293   C CG   . PHE B 1 103 ? -1.034  -12.951 141.533 1.00 0.00 ?  103 PHE B CG   1  
ATOM 6294   C CD1  . PHE B 1 103 ? -2.113  -12.405 142.199 1.00 0.00 ?  103 PHE B CD1  1  
ATOM 6295   C CD2  . PHE B 1 103 ? -1.128  -14.235 141.053 1.00 0.00 ?  103 PHE B CD2  1  
ATOM 6296   C CE1  . PHE B 1 103 ? -3.261  -13.136 142.387 1.00 0.00 ?  103 PHE B CE1  1  
ATOM 6297   C CE2  . PHE B 1 103 ? -2.278  -14.967 141.244 1.00 0.00 ?  103 PHE B CE2  1  
ATOM 6298   C CZ   . PHE B 1 103 ? -3.342  -14.417 141.910 1.00 0.00 ?  103 PHE B CZ   1  
ATOM 6299   H H    . PHE B 1 103 ? 1.829   -14.209 141.751 1.00 0.00 ?  103 PHE B H    1  
ATOM 6300   H HA   . PHE B 1 103 ? 1.930   -11.378 142.331 1.00 0.00 ?  103 PHE B HA   1  
ATOM 6301   H HB2  . PHE B 1 103 ? -0.131  -11.083 141.225 1.00 0.00 ?  103 PHE B HB2  1  
ATOM 6302   H HB3  . PHE B 1 103 ? 0.610   -12.445 140.314 1.00 0.00 ?  103 PHE B HB3  1  
ATOM 6303   H HD1  . PHE B 1 103 ? -2.051  -11.397 142.581 1.00 0.00 ?  103 PHE B HD1  1  
ATOM 6304   H HD2  . PHE B 1 103 ? -0.293  -14.670 140.527 1.00 0.00 ?  103 PHE B HD2  1  
ATOM 6305   H HE1  . PHE B 1 103 ? -4.098  -12.699 142.911 1.00 0.00 ?  103 PHE B HE1  1  
ATOM 6306   H HE2  . PHE B 1 103 ? -2.345  -15.976 140.867 1.00 0.00 ?  103 PHE B HE2  1  
ATOM 6307   H HZ   . PHE B 1 103 ? -4.245  -14.992 142.057 1.00 0.00 ?  103 PHE B HZ   1  
ATOM 6308   N N    . SER B 1 104 ? 0.398   -13.498 144.237 1.00 0.00 ?  104 SER B N    1  
ATOM 6309   C CA   . SER B 1 104 ? -0.275  -13.624 145.496 1.00 0.00 ?  104 SER B CA   1  
ATOM 6310   C C    . SER B 1 104 ? 0.553   -13.084 146.629 1.00 0.00 ?  104 SER B C    1  
ATOM 6311   O O    . SER B 1 104 ? -0.010  -12.726 147.666 1.00 0.00 ?  104 SER B O    1  
ATOM 6312   C CB   . SER B 1 104 ? -0.615  -15.076 145.834 1.00 0.00 ?  104 SER B CB   1  
ATOM 6313   O OG   . SER B 1 104 ? 0.571   -15.849 145.924 1.00 0.00 ?  104 SER B OG   1  
ATOM 6314   H H    . SER B 1 104 ? 0.653   -14.343 143.781 1.00 0.00 ?  104 SER B H    1  
ATOM 6315   H HA   . SER B 1 104 ? -1.183  -13.049 145.427 1.00 0.00 ?  104 SER B HA   1  
ATOM 6316   H HB2  . SER B 1 104 ? -1.150  -15.125 146.806 1.00 0.00 ?  104 SER B HB2  1  
ATOM 6317   H HB3  . SER B 1 104 ? -1.264  -15.508 145.043 1.00 0.00 ?  104 SER B HB3  1  
ATOM 6318   H HG   . SER B 1 104 ? 1.217   -15.294 146.365 1.00 0.00 ?  104 SER B HG   1  
ATOM 6319   N N    . VAL B 1 105 ? 1.902   -13.056 146.506 1.00 0.00 ?  105 VAL B N    1  
ATOM 6320   C CA   . VAL B 1 105 ? 2.699   -12.552 147.603 1.00 0.00 ?  105 VAL B CA   1  
ATOM 6321   C C    . VAL B 1 105 ? 2.397   -11.103 147.768 1.00 0.00 ?  105 VAL B C    1  
ATOM 6322   O O    . VAL B 1 105 ? 2.372   -10.578 148.878 1.00 0.00 ?  105 VAL B O    1  
ATOM 6323   C CB   . VAL B 1 105 ? 4.198   -12.746 147.445 1.00 0.00 ?  105 VAL B CB   1  
ATOM 6324   C CG1  . VAL B 1 105 ? 4.696   -12.043 146.170 1.00 0.00 ?  105 VAL B CG1  1  
ATOM 6325   C CG2  . VAL B 1 105 ? 4.883   -12.188 148.703 1.00 0.00 ?  105 VAL B CG2  1  
ATOM 6326   H H    . VAL B 1 105 ? 2.386   -13.378 145.696 1.00 0.00 ?  105 VAL B H    1  
ATOM 6327   H HA   . VAL B 1 105 ? 2.358   -13.065 148.491 1.00 0.00 ?  105 VAL B HA   1  
ATOM 6328   H HB   . VAL B 1 105 ? 4.431   -13.828 147.370 1.00 0.00 ?  105 VAL B HB   1  
ATOM 6329   H HG11 . VAL B 1 105 ? 5.256   -11.121 146.431 1.00 0.00 ?  105 VAL B HG11 1  
ATOM 6330   H HG12 . VAL B 1 105 ? 3.843   -11.767 145.529 1.00 0.00 ?  105 VAL B HG12 1  
ATOM 6331   H HG13 . VAL B 1 105 ? 5.369   -12.715 145.596 1.00 0.00 ?  105 VAL B HG13 1  
ATOM 6332   H HG21 . VAL B 1 105 ? 4.210   -12.282 149.582 1.00 0.00 ?  105 VAL B HG21 1  
ATOM 6333   H HG22 . VAL B 1 105 ? 5.134   -11.115 148.563 1.00 0.00 ?  105 VAL B HG22 1  
ATOM 6334   H HG23 . VAL B 1 105 ? 5.820   -12.747 148.912 1.00 0.00 ?  105 VAL B HG23 1  
ATOM 6335   N N    . GLU B 1 106 ? 2.147   -10.421 146.657 1.00 0.00 ?  106 GLU B N    1  
ATOM 6336   C CA   . GLU B 1 106 ? 1.856   -9.037  146.719 1.00 0.00 ?  106 GLU B CA   1  
ATOM 6337   C C    . GLU B 1 106 ? 0.516   -8.840  147.390 1.00 0.00 ?  106 GLU B C    1  
ATOM 6338   O O    . GLU B 1 106 ? 0.355   -7.932  148.196 1.00 0.00 ?  106 GLU B O    1  
ATOM 6339   C CB   . GLU B 1 106 ? 1.905   -8.413  145.315 1.00 0.00 ?  106 GLU B CB   1  
ATOM 6340   C CG   . GLU B 1 106 ? 3.365   -8.369  144.829 1.00 0.00 ?  106 GLU B CG   1  
ATOM 6341   C CD   . GLU B 1 106 ? 3.435   -8.009  143.354 1.00 0.00 ?  106 GLU B CD   1  
ATOM 6342   O OE1  . GLU B 1 106 ? 2.394   -8.097  142.663 1.00 0.00 ?  106 GLU B OE1  1  
ATOM 6343   O OE2  . GLU B 1 106 ? 4.551   -7.661  142.892 1.00 0.00 -1 106 GLU B OE2  1  
ATOM 6344   H H    . GLU B 1 106 ? 2.169   -10.837 145.747 1.00 0.00 ?  106 GLU B H    1  
ATOM 6345   H HA   . GLU B 1 106 ? 2.614   -8.586  147.341 1.00 0.00 ?  106 GLU B HA   1  
ATOM 6346   H HB2  . GLU B 1 106 ? 1.293   -9.025  144.615 1.00 0.00 ?  106 GLU B HB2  1  
ATOM 6347   H HB3  . GLU B 1 106 ? 1.495   -7.382  145.341 1.00 0.00 ?  106 GLU B HB3  1  
ATOM 6348   H HG2  . GLU B 1 106 ? 3.929   -7.611  145.414 1.00 0.00 ?  106 GLU B HG2  1  
ATOM 6349   H HG3  . GLU B 1 106 ? 3.840   -9.360  144.982 1.00 0.00 ?  106 GLU B HG3  1  
ATOM 6350   N N    . THR B 1 107 ? -0.473  -9.713  147.093 1.00 0.00 ?  107 THR B N    1  
ATOM 6351   C CA   . THR B 1 107 ? -1.799  -9.565  147.677 1.00 0.00 ?  107 THR B CA   1  
ATOM 6352   C C    . THR B 1 107 ? -1.831  -9.827  149.181 1.00 0.00 ?  107 THR B C    1  
ATOM 6353   O O    . THR B 1 107 ? -2.443  -9.059  149.923 1.00 0.00 ?  107 THR B O    1  
ATOM 6354   C CB   . THR B 1 107 ? -2.792  -10.535 147.099 1.00 0.00 ?  107 THR B CB   1  
ATOM 6355   O OG1  . THR B 1 107 ? -2.910  -10.371 145.694 1.00 0.00 ?  107 THR B OG1  1  
ATOM 6356   C CG2  . THR B 1 107 ? -4.157  -10.290 147.766 1.00 0.00 ?  107 THR B CG2  1  
ATOM 6357   H H    . THR B 1 107 ? -0.355  -10.452 146.433 1.00 0.00 ?  107 THR B H    1  
ATOM 6358   H HA   . THR B 1 107 ? -2.125  -8.554  147.487 1.00 0.00 ?  107 THR B HA   1  
ATOM 6359   H HB   . THR B 1 107 ? -2.477  -11.575 147.315 1.00 0.00 ?  107 THR B HB   1  
ATOM 6360   H HG1  . THR B 1 107 ? -3.154  -11.240 145.355 1.00 0.00 ?  107 THR B HG1  1  
ATOM 6361   H HG21 . THR B 1 107 ? -4.304  -9.205  147.959 1.00 0.00 ?  107 THR B HG21 1  
ATOM 6362   H HG22 . THR B 1 107 ? -4.219  -10.833 148.731 1.00 0.00 ?  107 THR B HG22 1  
ATOM 6363   H HG23 . THR B 1 107 ? -4.977  -10.646 147.107 1.00 0.00 ?  107 THR B HG23 1  
ATOM 6364   N N    . LEU B 1 108 ? -1.174  -10.917 149.671 1.00 0.00 ?  108 LEU B N    1  
ATOM 6365   C CA   . LEU B 1 108 ? -1.279  -11.290 151.094 1.00 0.00 ?  108 LEU B CA   1  
ATOM 6366   C C    . LEU B 1 108 ? -0.403  -10.430 151.960 1.00 0.00 ?  108 LEU B C    1  
ATOM 6367   O O    . LEU B 1 108 ? -0.387  -10.602 153.222 1.00 0.00 ?  108 LEU B O    1  
ATOM 6368   C CB   . LEU B 1 108 ? -0.891  -12.764 151.365 1.00 0.00 ?  108 LEU B CB   1  
ATOM 6369   C CG   . LEU B 1 108 ? -1.701  -13.410 152.522 1.00 0.00 ?  108 LEU B CG   1  
ATOM 6370   C CD1  . LEU B 1 108 ? -2.192  -14.825 152.163 1.00 0.00 ?  108 LEU B CD1  1  
ATOM 6371   C CD2  . LEU B 1 108 ? -0.898  -13.444 153.837 1.00 0.00 ?  108 LEU B CD2  1  
ATOM 6372   H H    . LEU B 1 108 ? -0.603  -11.499 149.096 1.00 0.00 ?  108 LEU B H    1  
ATOM 6373   H HA   . LEU B 1 108 ? -2.306  -11.130 151.384 1.00 0.00 ?  108 LEU B HA   1  
ATOM 6374   H HB2  . LEU B 1 108 ? -1.048  -13.349 150.435 1.00 0.00 ?  108 LEU B HB2  1  
ATOM 6375   H HB3  . LEU B 1 108 ? 0.188   -12.810 151.620 1.00 0.00 ?  108 LEU B HB3  1  
ATOM 6376   H HG   . LEU B 1 108 ? -2.599  -12.778 152.696 1.00 0.00 ?  108 LEU B HG   1  
ATOM 6377   H HD11 . LEU B 1 108 ? -1.928  -15.080 151.115 1.00 0.00 ?  108 LEU B HD11 1  
ATOM 6378   H HD12 . LEU B 1 108 ? -3.295  -14.891 152.277 1.00 0.00 ?  108 LEU B HD12 1  
ATOM 6379   H HD13 . LEU B 1 108 ? -1.723  -15.576 152.837 1.00 0.00 ?  108 LEU B HD13 1  
ATOM 6380   H HD21 . LEU B 1 108 ? 0.192   -13.455 153.625 1.00 0.00 ?  108 LEU B HD21 1  
ATOM 6381   H HD22 . LEU B 1 108 ? -1.153  -14.354 154.422 1.00 0.00 ?  108 LEU B HD22 1  
ATOM 6382   H HD23 . LEU B 1 108 ? -1.130  -12.550 154.454 1.00 0.00 ?  108 LEU B HD23 1  
ATOM 6383   N N    . ALA B 1 109 ? 0.366   -9.518  151.307 1.00 0.00 ?  109 ALA B N    1  
ATOM 6384   C CA   . ALA B 1 109 ? 1.254   -8.647  152.023 1.00 0.00 ?  109 ALA B CA   1  
ATOM 6385   C C    . ALA B 1 109 ? 0.790   -7.232  151.844 1.00 0.00 ?  109 ALA B C    1  
ATOM 6386   O O    . ALA B 1 109 ? 0.109   -6.697  152.734 1.00 0.00 ?  109 ALA B O    1  
ATOM 6387   C CB   . ALA B 1 109 ? 2.704   -8.725  151.518 1.00 0.00 ?  109 ALA B CB   1  
ATOM 6388   H H    . ALA B 1 109 ? 0.352   -9.420  150.315 1.00 0.00 ?  109 ALA B H    1  
ATOM 6389   H HA   . ALA B 1 109 ? 1.213   -8.902  153.068 1.00 0.00 ?  109 ALA B HA   1  
ATOM 6390   H HB1  . ALA B 1 109 ? 2.736   -8.581  150.417 1.00 0.00 ?  109 ALA B HB1  1  
ATOM 6391   H HB2  . ALA B 1 109 ? 3.143   -9.717  151.759 1.00 0.00 ?  109 ALA B HB2  1  
ATOM 6392   H HB3  . ALA B 1 109 ? 3.323   -7.937  151.997 1.00 0.00 ?  109 ALA B HB3  1  
ATOM 6393   N N    . THR B 1 110 ? 1.151   -6.618  150.662 1.00 0.00 ?  110 THR B N    1  
ATOM 6394   C CA   . THR B 1 110 ? 0.819   -5.231  150.370 1.00 0.00 ?  110 THR B CA   1  
ATOM 6395   C C    . THR B 1 110 ? -0.238  -5.210  149.278 1.00 0.00 ?  110 THR B C    1  
ATOM 6396   O O    . THR B 1 110 ? -1.402  -5.310  149.656 1.00 0.00 ?  110 THR B O    1  
ATOM 6397   C CB   . THR B 1 110 ? 2.045   -4.411  149.995 1.00 0.00 ?  110 THR B CB   1  
ATOM 6398   O OG1  . THR B 1 110 ? 1.688   -3.166  149.403 1.00 0.00 ?  110 THR B OG1  1  
ATOM 6399   C CG2  . THR B 1 110 ? 2.951   -5.227  149.051 1.00 0.00 ?  110 THR B CG2  1  
ATOM 6400   H H    . THR B 1 110 ? 1.657   -7.100  149.954 1.00 0.00 ?  110 THR B H    1  
ATOM 6401   H HA   . THR B 1 110 ? 0.374   -4.825  151.268 1.00 0.00 ?  110 THR B HA   1  
ATOM 6402   H HB   . THR B 1 110 ? 2.628   -4.193  150.914 1.00 0.00 ?  110 THR B HB   1  
ATOM 6403   H HG1  . THR B 1 110 ? 2.520   -2.714  149.213 1.00 0.00 ?  110 THR B HG1  1  
ATOM 6404   H HG21 . THR B 1 110 ? 3.404   -4.565  148.283 1.00 0.00 ?  110 THR B HG21 1  
ATOM 6405   H HG22 . THR B 1 110 ? 2.363   -6.016  148.535 1.00 0.00 ?  110 THR B HG22 1  
ATOM 6406   H HG23 . THR B 1 110 ? 3.769   -5.713  149.625 1.00 0.00 ?  110 THR B HG23 1  
ATOM 6407   N N    . VAL B 1 111 ? 0.133   -4.977  147.932 1.00 0.00 ?  111 VAL B N    1  
ATOM 6408   C CA   . VAL B 1 111 ? -0.834  -5.019  146.808 1.00 0.00 ?  111 VAL B CA   1  
ATOM 6409   C C    . VAL B 1 111 ? -0.061  -4.990  145.466 1.00 0.00 ?  111 VAL B C    1  
ATOM 6410   O O    . VAL B 1 111 ? 0.823   -4.143  145.235 1.00 0.00 ?  111 VAL B O    1  
ATOM 6411   C CB   . VAL B 1 111 ? -1.902  -3.947  146.809 1.00 0.00 ?  111 VAL B CB   1  
ATOM 6412   C CG1  . VAL B 1 111 ? -1.290  -2.588  146.466 1.00 0.00 ?  111 VAL B CG1  1  
ATOM 6413   C CG2  . VAL B 1 111 ? -2.997  -4.371  145.812 1.00 0.00 ?  111 VAL B CG2  1  
ATOM 6414   H H    . VAL B 1 111 ? 1.076   -4.776  147.680 1.00 0.00 ?  111 VAL B H    1  
ATOM 6415   H HA   . VAL B 1 111 ? -1.308  -5.991  146.875 1.00 0.00 ?  111 VAL B HA   1  
ATOM 6416   H HB   . VAL B 1 111 ? -2.362  -3.882  147.816 1.00 0.00 ?  111 VAL B HB   1  
ATOM 6417   H HG11 . VAL B 1 111 ? -0.260  -2.516  146.872 1.00 0.00 ?  111 VAL B HG11 1  
ATOM 6418   H HG12 . VAL B 1 111 ? -1.904  -1.769  146.897 1.00 0.00 ?  111 VAL B HG12 1  
ATOM 6419   H HG13 . VAL B 1 111 ? -1.244  -2.453  145.367 1.00 0.00 ?  111 VAL B HG13 1  
ATOM 6420   H HG21 . VAL B 1 111 ? -2.814  -5.407  145.454 1.00 0.00 ?  111 VAL B HG21 1  
ATOM 6421   H HG22 . VAL B 1 111 ? -3.006  -3.690  144.934 1.00 0.00 ?  111 VAL B HG22 1  
ATOM 6422   H HG23 . VAL B 1 111 ? -3.995  -4.337  146.298 1.00 0.00 ?  111 VAL B HG23 1  
ATOM 6423   N N    . GLY B 1 112 ? -0.513  -5.870  144.500 1.00 0.00 ?  112 GLY B N    1  
ATOM 6424   C CA   . GLY B 1 112 ? 0.184   -6.100  143.219 1.00 0.00 ?  112 GLY B CA   1  
ATOM 6425   C C    . GLY B 1 112 ? 0.051   -5.023  142.151 1.00 0.00 ?  112 GLY B C    1  
ATOM 6426   O O    . GLY B 1 112 ? -1.027  -4.639  141.691 1.00 0.00 ?  112 GLY B O    1  
ATOM 6427   H H    . GLY B 1 112 ? -1.347  -6.398  144.631 1.00 0.00 ?  112 GLY B H    1  
ATOM 6428   H HA2  . GLY B 1 112 ? 1.229   -6.171  143.461 1.00 0.00 ?  112 GLY B HA2  1  
ATOM 6429   H HA3  . GLY B 1 112 ? -0.221  -7.024  142.823 1.00 0.00 ?  112 GLY B HA3  1  
ATOM 6430   N N    . TYR B 1 113 ? 1.206   -4.734  141.516 1.00 0.00 ?  113 TYR B N    1  
ATOM 6431   C CA   . TYR B 1 113 ? 1.240   -3.679  140.542 1.00 0.00 ?  113 TYR B CA   1  
ATOM 6432   C C    . TYR B 1 113 ? 0.717   -4.072  139.171 1.00 0.00 ?  113 TYR B C    1  
ATOM 6433   O O    . TYR B 1 113 ? -0.432  -3.792  138.873 1.00 0.00 ?  113 TYR B O    1  
ATOM 6434   C CB   . TYR B 1 113 ? 2.627   -3.056  140.357 1.00 0.00 ?  113 TYR B CB   1  
ATOM 6435   C CG   . TYR B 1 113 ? 3.771   -3.931  140.750 1.00 0.00 ?  113 TYR B CG   1  
ATOM 6436   C CD1  . TYR B 1 113 ? 4.237   -3.923  142.047 1.00 0.00 ?  113 TYR B CD1  1  
ATOM 6437   C CD2  . TYR B 1 113 ? 4.399   -4.734  139.821 1.00 0.00 ?  113 TYR B CD2  1  
ATOM 6438   C CE1  . TYR B 1 113 ? 5.309   -4.704  142.410 1.00 0.00 ?  113 TYR B CE1  1  
ATOM 6439   C CE2  . TYR B 1 113 ? 5.468   -5.518  140.185 1.00 0.00 ?  113 TYR B CE2  1  
ATOM 6440   C CZ   . TYR B 1 113 ? 5.925   -5.500  141.478 1.00 0.00 ?  113 TYR B CZ   1  
ATOM 6441   O OH   . TYR B 1 113 ? 7.026   -6.300  141.851 1.00 0.00 ?  113 TYR B OH   1  
ATOM 6442   H H    . TYR B 1 113 ? 2.059   -5.229  141.684 1.00 0.00 ?  113 TYR B H    1  
ATOM 6443   H HA   . TYR B 1 113 ? 0.580   -2.917  140.924 1.00 0.00 ?  113 TYR B HA   1  
ATOM 6444   H HB2  . TYR B 1 113 ? 2.779   -2.779  139.293 1.00 0.00 ?  113 TYR B HB2  1  
ATOM 6445   H HB3  . TYR B 1 113 ? 2.686   -2.135  140.969 1.00 0.00 ?  113 TYR B HB3  1  
ATOM 6446   H HD1  . TYR B 1 113 ? 3.755   -3.299  142.785 1.00 0.00 ?  113 TYR B HD1  1  
ATOM 6447   H HD2  . TYR B 1 113 ? 4.045   -4.752  138.803 1.00 0.00 ?  113 TYR B HD2  1  
ATOM 6448   H HE1  . TYR B 1 113 ? 5.666   -4.691  143.428 1.00 0.00 ?  113 TYR B HE1  1  
ATOM 6449   H HE2  . TYR B 1 113 ? 5.952   -6.145  139.451 1.00 0.00 ?  113 TYR B HE2  1  
ATOM 6450   H HH   . TYR B 1 113 ? 6.865   -6.632  142.738 1.00 0.00 ?  113 TYR B HH   1  
ATOM 6451   N N    . GLY B 1 114 ? 1.545   -4.738  138.313 1.00 0.00 ?  114 GLY B N    1  
ATOM 6452   C CA   . GLY B 1 114 ? 1.163   -5.019  136.916 1.00 0.00 ?  114 GLY B CA   1  
ATOM 6453   C C    . GLY B 1 114 ? 0.403   -6.311  136.760 1.00 0.00 ?  114 GLY B C    1  
ATOM 6454   O O    . GLY B 1 114 ? 0.144   -6.779  135.596 1.00 0.00 ?  114 GLY B O    1  
ATOM 6455   H H    . GLY B 1 114 ? 2.447   -5.060  138.592 1.00 0.00 ?  114 GLY B H    1  
ATOM 6456   H HA2  . GLY B 1 114 ? 0.519   -4.215  136.599 1.00 0.00 ?  114 GLY B HA2  1  
ATOM 6457   H HA3  . GLY B 1 114 ? 2.082   -5.088  136.349 1.00 0.00 ?  114 GLY B HA3  1  
ATOM 6458   N N    . ASP B 1 115 ? 0.048   -6.909  137.923 1.00 0.00 ?  115 ASP B N    1  
ATOM 6459   C CA   . ASP B 1 115 ? -0.663  -8.168  137.992 1.00 0.00 ?  115 ASP B CA   1  
ATOM 6460   C C    . ASP B 1 115 ? -2.141  -7.886  137.945 1.00 0.00 ?  115 ASP B C    1  
ATOM 6461   O O    . ASP B 1 115 ? -2.917  -8.457  138.704 1.00 0.00 ?  115 ASP B O    1  
ATOM 6462   C CB   . ASP B 1 115 ? -0.368  -8.930  139.286 1.00 0.00 ?  115 ASP B CB   1  
ATOM 6463   C CG   . ASP B 1 115 ? 1.112   -9.239  139.399 1.00 0.00 ?  115 ASP B CG   1  
ATOM 6464   O OD1  . ASP B 1 115 ? 1.796   -9.209  138.345 1.00 0.00 ?  115 ASP B OD1  1  
ATOM 6465   O OD2  . ASP B 1 115 ? 1.580   -9.503  140.534 1.00 0.00 -1 115 ASP B OD2  1  
ATOM 6466   H H    . ASP B 1 115 ? 0.267   -6.495  138.803 1.00 0.00 ?  115 ASP B H    1  
ATOM 6467   H HA   . ASP B 1 115 ? -0.382  -8.756  137.133 1.00 0.00 ?  115 ASP B HA   1  
ATOM 6468   H HB2  . ASP B 1 115 ? -0.682  -8.318  140.160 1.00 0.00 ?  115 ASP B HB2  1  
ATOM 6469   H HB3  . ASP B 1 115 ? -0.938  -9.883  139.297 1.00 0.00 ?  115 ASP B HB3  1  
ATOM 6470   N N    . MET B 1 116 ? -2.498  -6.925  137.080 1.00 0.00 ?  116 MET B N    1  
ATOM 6471   C CA   . MET B 1 116 ? -3.841  -6.428  136.850 1.00 0.00 ?  116 MET B CA   1  
ATOM 6472   C C    . MET B 1 116 ? -4.801  -7.482  136.318 1.00 0.00 ?  116 MET B C    1  
ATOM 6473   O O    . MET B 1 116 ? -5.604  -7.138  135.454 1.00 0.00 ?  116 MET B O    1  
ATOM 6474   C CB   . MET B 1 116 ? -3.840  -5.278  135.825 1.00 0.00 ?  116 MET B CB   1  
ATOM 6475   C CG   . MET B 1 116 ? -2.973  -4.097  136.263 1.00 0.00 ?  116 MET B CG   1  
ATOM 6476   S SD   . MET B 1 116 ? -2.857  -2.806  134.988 1.00 0.00 ?  116 MET B SD   1  
ATOM 6477   C CE   . MET B 1 116 ? -1.688  -1.773  135.914 1.00 0.00 ?  116 MET B CE   1  
ATOM 6478   H H    . MET B 1 116 ? -1.805  -6.482  136.518 1.00 0.00 ?  116 MET B H    1  
ATOM 6479   H HA   . MET B 1 116 ? -4.211  -6.065  137.793 1.00 0.00 ?  116 MET B HA   1  
ATOM 6480   H HB2  . MET B 1 116 ? -3.469  -5.660  134.850 1.00 0.00 ?  116 MET B HB2  1  
ATOM 6481   H HB3  . MET B 1 116 ? -4.881  -4.915  135.680 1.00 0.00 ?  116 MET B HB3  1  
ATOM 6482   H HG2  . MET B 1 116 ? -3.404  -3.668  137.193 1.00 0.00 ?  116 MET B HG2  1  
ATOM 6483   H HG3  . MET B 1 116 ? -1.958  -4.473  136.506 1.00 0.00 ?  116 MET B HG3  1  
ATOM 6484   H HE1  . MET B 1 116 ? -2.210  -1.204  136.712 1.00 0.00 ?  116 MET B HE1  1  
ATOM 6485   H HE2  . MET B 1 116 ? -1.186  -1.044  135.244 1.00 0.00 ?  116 MET B HE2  1  
ATOM 6486   H HE3  . MET B 1 116 ? -0.903  -2.397  136.395 1.00 0.00 ?  116 MET B HE3  1  
ATOM 6487   N N    . HIS B 1 117 ? -4.779  -8.778  136.761 1.00 0.00 ?  117 HIS B N    1  
ATOM 6488   C CA   . HIS B 1 117 ? -5.676  -9.748  136.147 1.00 0.00 ?  117 HIS B CA   1  
ATOM 6489   C C    . HIS B 1 117 ? -6.690  -10.357 137.110 1.00 0.00 ?  117 HIS B C    1  
ATOM 6490   O O    . HIS B 1 117 ? -6.544  -11.502 137.537 1.00 0.00 ?  117 HIS B O    1  
ATOM 6491   C CB   . HIS B 1 117 ? -4.896  -10.939 135.566 1.00 0.00 ?  117 HIS B CB   1  
ATOM 6492   C CG   . HIS B 1 117 ? -3.857  -10.546 134.558 1.00 0.00 ?  117 HIS B CG   1  
ATOM 6493   N ND1  . HIS B 1 117 ? -4.233  -10.142 133.286 1.00 0.00 ?  117 HIS B ND1  1  
ATOM 6494   C CD2  . HIS B 1 117 ? -2.501  -10.520 134.684 1.00 0.00 ?  117 HIS B CD2  1  
ATOM 6495   C CE1  . HIS B 1 117 ? -3.096  -9.880  132.673 1.00 0.00 ?  117 HIS B CE1  1  
ATOM 6496   N NE2  . HIS B 1 117 ? -2.020  -10.093 133.470 1.00 0.00 ?  117 HIS B NE2  1  
ATOM 6497   H H    . HIS B 1 117 ? -4.177  -9.102  137.488 1.00 0.00 ?  117 HIS B H    1  
ATOM 6498   H HA   . HIS B 1 117 ? -6.210  -9.265  135.352 1.00 0.00 ?  117 HIS B HA   1  
ATOM 6499   H HB2  . HIS B 1 117 ? -4.380  -11.481 136.386 1.00 0.00 ?  117 HIS B HB2  1  
ATOM 6500   H HB3  . HIS B 1 117 ? -5.602  -11.641 135.071 1.00 0.00 ?  117 HIS B HB3  1  
ATOM 6501   H HD2  . HIS B 1 117 ? -1.874  -10.770 135.531 1.00 0.00 ?  117 HIS B HD2  1  
ATOM 6502   H HE1  . HIS B 1 117 ? -3.004  -9.531  131.644 1.00 0.00 ?  117 HIS B HE1  1  
ATOM 6503   H HE2  . HIS B 1 117 ? -1.055  -9.973  133.233 1.00 0.00 ?  117 HIS B HE2  1  
ATOM 6504   N N    . PRO B 1 118 ? -7.718  -9.601  137.480 1.00 0.00 ?  118 PRO B N    1  
ATOM 6505   C CA   . PRO B 1 118 ? -8.829  -10.124 138.233 1.00 0.00 ?  118 PRO B CA   1  
ATOM 6506   C C    . PRO B 1 118 ? -9.937  -10.360 137.238 1.00 0.00 ?  118 PRO B C    1  
ATOM 6507   O O    . PRO B 1 118 ? -11.074 -9.922  137.414 1.00 0.00 ?  118 PRO B O    1  
ATOM 6508   C CB   . PRO B 1 118 ? -9.183  -8.980  139.159 1.00 0.00 ?  118 PRO B CB   1  
ATOM 6509   C CG   . PRO B 1 118 ? -9.019  -7.769  138.246 1.00 0.00 ?  118 PRO B CG   1  
ATOM 6510   C CD   . PRO B 1 118 ? -7.884  -8.155  137.276 1.00 0.00 ?  118 PRO B CD   1  
ATOM 6511   H HA   . PRO B 1 118 ? -8.590  -11.025 138.779 1.00 0.00 ?  118 PRO B HA   1  
ATOM 6512   H HB2  . PRO B 1 118 ? -10.230 -9.072  139.525 1.00 0.00 ?  118 PRO B HB2  1  
ATOM 6513   H HB3  . PRO B 1 118 ? -8.480  -8.926  140.017 1.00 0.00 ?  118 PRO B HB3  1  
ATOM 6514   H HG2  . PRO B 1 118 ? -9.962  -7.569  137.692 1.00 0.00 ?  118 PRO B HG2  1  
ATOM 6515   H HG3  . PRO B 1 118 ? -8.739  -6.871  138.836 1.00 0.00 ?  118 PRO B HG3  1  
ATOM 6516   H HD2  . PRO B 1 118 ? -8.164  -7.920  136.227 1.00 0.00 ?  118 PRO B HD2  1  
ATOM 6517   H HD3  . PRO B 1 118 ? -6.972  -7.603  137.551 1.00 0.00 ?  118 PRO B HD3  1  
ATOM 6518   N N    . GLN B 1 119 ? -9.582  -11.084 136.154 1.00 0.00 ?  119 GLN B N    1  
ATOM 6519   C CA   . GLN B 1 119 ? -10.471 -11.310 135.036 1.00 0.00 ?  119 GLN B CA   1  
ATOM 6520   C C    . GLN B 1 119 ? -11.715 -12.051 135.416 1.00 0.00 ?  119 GLN B C    1  
ATOM 6521   O O    . GLN B 1 119 ? -12.782 -11.743 134.882 1.00 0.00 ?  119 GLN B O    1  
ATOM 6522   C CB   . GLN B 1 119 ? -9.804  -12.085 133.882 1.00 0.00 ?  119 GLN B CB   1  
ATOM 6523   C CG   . GLN B 1 119 ? -10.691 -12.178 132.630 1.00 0.00 ?  119 GLN B CG   1  
ATOM 6524   C CD   . GLN B 1 119 ? -10.965 -10.769 132.123 1.00 0.00 ?  119 GLN B CD   1  
ATOM 6525   O OE1  . GLN B 1 119 ? -10.043 -10.012 131.823 1.00 0.00 ?  119 GLN B OE1  1  
ATOM 6526   N NE2  . GLN B 1 119 ? -12.272 -10.401 132.041 1.00 0.00 ?  119 GLN B NE2  1  
ATOM 6527   H H    . GLN B 1 119 ? -8.678  -11.498 136.076 1.00 0.00 ?  119 GLN B H    1  
ATOM 6528   H HA   . GLN B 1 119 ? -10.761 -10.335 134.684 1.00 0.00 ?  119 GLN B HA   1  
ATOM 6529   H HB2  . GLN B 1 119 ? -8.849  -11.583 133.614 1.00 0.00 ?  119 GLN B HB2  1  
ATOM 6530   H HB3  . GLN B 1 119 ? -9.565  -13.113 134.228 1.00 0.00 ?  119 GLN B HB3  1  
ATOM 6531   H HG2  . GLN B 1 119 ? -10.170 -12.763 131.839 1.00 0.00 ?  119 GLN B HG2  1  
ATOM 6532   H HG3  . GLN B 1 119 ? -11.653 -12.675 132.870 1.00 0.00 ?  119 GLN B HG3  1  
ATOM 6533   H HE21 . GLN B 1 119 ? -12.990 -11.046 132.303 1.00 0.00 ?  119 GLN B HE21 1  
ATOM 6534   H HE22 . GLN B 1 119 ? -12.516 -9.481  131.734 1.00 0.00 ?  119 GLN B HE22 1  
ATOM 6535   N N    . THR B 1 120 ? -11.628 -13.025 136.342 1.00 0.00 ?  120 THR B N    1  
ATOM 6536   C CA   . THR B 1 120 ? -12.788 -13.820 136.667 1.00 0.00 ?  120 THR B CA   1  
ATOM 6537   C C    . THR B 1 120 ? -13.228 -13.411 138.023 1.00 0.00 ?  120 THR B C    1  
ATOM 6538   O O    . THR B 1 120 ? -12.417 -13.176 138.899 1.00 0.00 ?  120 THR B O    1  
ATOM 6539   C CB   . THR B 1 120 ? -12.481 -15.288 136.709 1.00 0.00 ?  120 THR B CB   1  
ATOM 6540   O OG1  . THR B 1 120 ? -11.979 -15.706 135.449 1.00 0.00 ?  120 THR B OG1  1  
ATOM 6541   C CG2  . THR B 1 120 ? -13.764 -16.064 137.043 1.00 0.00 ?  120 THR B CG2  1  
ATOM 6542   H H    . THR B 1 120 ? -10.784 -13.236 136.830 1.00 0.00 ?  120 THR B H    1  
ATOM 6543   H HA   . THR B 1 120 ? -13.571 -13.614 135.955 1.00 0.00 ?  120 THR B HA   1  
ATOM 6544   H HB   . THR B 1 120 ? -11.722 -15.500 137.490 1.00 0.00 ?  120 THR B HB   1  
ATOM 6545   H HG1  . THR B 1 120 ? -11.170 -16.193 135.635 1.00 0.00 ?  120 THR B HG1  1  
ATOM 6546   H HG21 . THR B 1 120 ? -13.768 -16.359 138.113 1.00 0.00 ?  120 THR B HG21 1  
ATOM 6547   H HG22 . THR B 1 120 ? -13.833 -16.982 136.421 1.00 0.00 ?  120 THR B HG22 1  
ATOM 6548   H HG23 . THR B 1 120 ? -14.658 -15.434 136.845 1.00 0.00 ?  120 THR B HG23 1  
ATOM 6549   N N    . VAL B 1 121 ? -14.558 -13.297 138.208 1.00 0.00 ?  121 VAL B N    1  
ATOM 6550   C CA   . VAL B 1 121 ? -15.082 -12.862 139.467 1.00 0.00 ?  121 VAL B CA   1  
ATOM 6551   C C    . VAL B 1 121 ? -14.779 -13.885 140.518 1.00 0.00 ?  121 VAL B C    1  
ATOM 6552   O O    . VAL B 1 121 ? -14.628 -13.533 141.681 1.00 0.00 ?  121 VAL B O    1  
ATOM 6553   C CB   . VAL B 1 121 ? -16.569 -12.622 139.445 1.00 0.00 ?  121 VAL B CB   1  
ATOM 6554   C CG1  . VAL B 1 121 ? -16.846 -11.471 138.463 1.00 0.00 ?  121 VAL B CG1  1  
ATOM 6555   C CG2  . VAL B 1 121 ? -17.291 -13.922 139.044 1.00 0.00 ?  121 VAL B CG2  1  
ATOM 6556   H H    . VAL B 1 121 ? -15.222 -13.504 137.494 1.00 0.00 ?  121 VAL B H    1  
ATOM 6557   H HA   . VAL B 1 121 ? -14.568 -11.949 139.722 1.00 0.00 ?  121 VAL B HA   1  
ATOM 6558   H HB   . VAL B 1 121 ? -16.915 -12.319 140.456 1.00 0.00 ?  121 VAL B HB   1  
ATOM 6559   H HG11 . VAL B 1 121 ? -15.937 -10.845 138.337 1.00 0.00 ?  121 VAL B HG11 1  
ATOM 6560   H HG12 . VAL B 1 121 ? -17.669 -10.830 138.842 1.00 0.00 ?  121 VAL B HG12 1  
ATOM 6561   H HG13 . VAL B 1 121 ? -17.139 -11.874 137.469 1.00 0.00 ?  121 VAL B HG13 1  
ATOM 6562   H HG21 . VAL B 1 121 ? -16.839 -14.350 138.124 1.00 0.00 ?  121 VAL B HG21 1  
ATOM 6563   H HG22 . VAL B 1 121 ? -18.366 -13.720 138.847 1.00 0.00 ?  121 VAL B HG22 1  
ATOM 6564   H HG23 . VAL B 1 121 ? -17.216 -14.674 139.858 1.00 0.00 ?  121 VAL B HG23 1  
ATOM 6565   N N    . TYR B 1 122 ? -14.687 -15.179 140.153 1.00 0.00 ?  122 TYR B N    1  
ATOM 6566   C CA   . TYR B 1 122 ? -14.399 -16.168 141.153 1.00 0.00 ?  122 TYR B CA   1  
ATOM 6567   C C    . TYR B 1 122 ? -12.993 -15.951 141.621 1.00 0.00 ?  122 TYR B C    1  
ATOM 6568   O O    . TYR B 1 122 ? -12.703 -16.040 142.816 1.00 0.00 ?  122 TYR B O    1  
ATOM 6569   C CB   . TYR B 1 122 ? -14.516 -17.607 140.635 1.00 0.00 ?  122 TYR B CB   1  
ATOM 6570   C CG   . TYR B 1 122 ? -15.914 -18.015 140.314 1.00 0.00 ?  122 TYR B CG   1  
ATOM 6571   C CD1  . TYR B 1 122 ? -16.420 -17.843 139.043 1.00 0.00 ?  122 TYR B CD1  1  
ATOM 6572   C CD2  . TYR B 1 122 ? -16.719 -18.571 141.286 1.00 0.00 ?  122 TYR B CD2  1  
ATOM 6573   C CE1  . TYR B 1 122 ? -17.709 -18.220 138.750 1.00 0.00 ?  122 TYR B CE1  1  
ATOM 6574   C CE2  . TYR B 1 122 ? -18.008 -18.949 140.990 1.00 0.00 ?  122 TYR B CE2  1  
ATOM 6575   C CZ   . TYR B 1 122 ? -18.503 -18.774 139.723 1.00 0.00 ?  122 TYR B CZ   1  
ATOM 6576   O OH   . TYR B 1 122 ? -19.825 -19.161 139.420 1.00 0.00 ?  122 TYR B OH   1  
ATOM 6577   H H    . TYR B 1 122 ? -14.808 -15.495 139.215 1.00 0.00 ?  122 TYR B H    1  
ATOM 6578   H HA   . TYR B 1 122 ? -15.076 -16.008 141.978 1.00 0.00 ?  122 TYR B HA   1  
ATOM 6579   H HB2  . TYR B 1 122 ? -13.924 -17.715 139.707 1.00 0.00 ?  122 TYR B HB2  1  
ATOM 6580   H HB3  . TYR B 1 122 ? -14.125 -18.317 141.395 1.00 0.00 ?  122 TYR B HB3  1  
ATOM 6581   H HD1  . TYR B 1 122 ? -15.799 -17.409 138.273 1.00 0.00 ?  122 TYR B HD1  1  
ATOM 6582   H HD2  . TYR B 1 122 ? -16.334 -18.712 142.285 1.00 0.00 ?  122 TYR B HD2  1  
ATOM 6583   H HE1  . TYR B 1 122 ? -18.098 -18.082 137.751 1.00 0.00 ?  122 TYR B HE1  1  
ATOM 6584   H HE2  . TYR B 1 122 ? -18.632 -19.383 141.757 1.00 0.00 ?  122 TYR B HE2  1  
ATOM 6585   H HH   . TYR B 1 122 ? -19.864 -19.381 138.487 1.00 0.00 ?  122 TYR B HH   1  
ATOM 6586   N N    . ALA B 1 123 ? -12.082 -15.656 140.672 1.00 0.00 ?  123 ALA B N    1  
ATOM 6587   C CA   . ALA B 1 123 ? -10.708 -15.419 141.021 1.00 0.00 ?  123 ALA B CA   1  
ATOM 6588   C C    . ALA B 1 123 ? -10.643 -14.197 141.879 1.00 0.00 ?  123 ALA B C    1  
ATOM 6589   O O    . ALA B 1 123 ? -9.871  -14.133 142.830 1.00 0.00 ?  123 ALA B O    1  
ATOM 6590   C CB   . ALA B 1 123 ? -9.803  -15.186 139.803 1.00 0.00 ?  123 ALA B CB   1  
ATOM 6591   H H    . ALA B 1 123 ? -12.313 -15.601 139.703 1.00 0.00 ?  123 ALA B H    1  
ATOM 6592   H HA   . ALA B 1 123 ? -10.362 -16.268 141.586 1.00 0.00 ?  123 ALA B HA   1  
ATOM 6593   H HB1  . ALA B 1 123 ? -8.774  -15.536 140.020 1.00 0.00 ?  123 ALA B HB1  1  
ATOM 6594   H HB2  . ALA B 1 123 ? -9.765  -14.105 139.550 1.00 0.00 ?  123 ALA B HB2  1  
ATOM 6595   H HB3  . ALA B 1 123 ? -10.190 -15.743 138.923 1.00 0.00 ?  123 ALA B HB3  1  
ATOM 6596   N N    . HIS B 1 124 ? -11.449 -13.185 141.523 1.00 0.00 ?  124 HIS B N    1  
ATOM 6597   C CA   . HIS B 1 124 ? -11.466 -11.948 142.243 1.00 0.00 ?  124 HIS B CA   1  
ATOM 6598   C C    . HIS B 1 124 ? -11.879 -12.161 143.657 1.00 0.00 ?  124 HIS B C    1  
ATOM 6599   O O    . HIS B 1 124 ? -11.295 -11.568 144.541 1.00 0.00 ?  124 HIS B O    1  
ATOM 6600   C CB   . HIS B 1 124 ? -12.410 -10.897 141.660 1.00 0.00 ?  124 HIS B CB   1  
ATOM 6601   C CG   . HIS B 1 124 ? -12.499 -9.675  142.526 1.00 0.00 ?  124 HIS B CG   1  
ATOM 6602   N ND1  . HIS B 1 124 ? -11.412 -8.821  142.633 1.00 0.00 ?  124 HIS B ND1  1  
ATOM 6603   C CD2  . HIS B 1 124 ? -13.527 -9.236  143.304 1.00 0.00 ?  124 HIS B CD2  1  
ATOM 6604   C CE1  . HIS B 1 124 ? -11.808 -7.886  143.477 1.00 0.00 ?  124 HIS B CE1  1  
ATOM 6605   N NE2  . HIS B 1 124 ? -13.075 -8.090  143.913 1.00 0.00 ?  124 HIS B NE2  1  
ATOM 6606   H H    . HIS B 1 124 ? -12.058 -13.246 140.746 1.00 0.00 ?  124 HIS B H    1  
ATOM 6607   H HA   . HIS B 1 124 ? -10.458 -11.568 142.235 1.00 0.00 ?  124 HIS B HA   1  
ATOM 6608   H HB2  . HIS B 1 124 ? -12.051 -10.581 140.657 1.00 0.00 ?  124 HIS B HB2  1  
ATOM 6609   H HB3  . HIS B 1 124 ? -13.432 -11.320 141.560 1.00 0.00 ?  124 HIS B HB3  1  
ATOM 6610   H HD2  . HIS B 1 124 ? -14.516 -9.654  143.455 1.00 0.00 ?  124 HIS B HD2  1  
ATOM 6611   H HE1  . HIS B 1 124 ? -11.205 -7.038  143.801 1.00 0.00 ?  124 HIS B HE1  1  
ATOM 6612   H HE2  . HIS B 1 124 ? -13.588 -7.531  144.562 1.00 0.00 ?  124 HIS B HE2  1  
ATOM 6613   N N    . ALA B 1 125 ? -12.940 -12.956 143.895 1.00 0.00 ?  125 ALA B N    1  
ATOM 6614   C CA   . ALA B 1 125 ? -13.411 -13.161 145.242 1.00 0.00 ?  125 ALA B CA   1  
ATOM 6615   C C    . ALA B 1 125 ? -12.324 -13.798 146.046 1.00 0.00 ?  125 ALA B C    1  
ATOM 6616   O O    . ALA B 1 125 ? -12.122 -13.450 147.208 1.00 0.00 ?  125 ALA B O    1  
ATOM 6617   C CB   . ALA B 1 125 ? -14.644 -14.076 145.321 1.00 0.00 ?  125 ALA B CB   1  
ATOM 6618   H H    . ALA B 1 125 ? -13.436 -13.421 143.173 1.00 0.00 ?  125 ALA B H    1  
ATOM 6619   H HA   . ALA B 1 125 ? -13.639 -12.194 145.659 1.00 0.00 ?  125 ALA B HA   1  
ATOM 6620   H HB1  . ALA B 1 125 ? -14.523 -14.947 144.644 1.00 0.00 ?  125 ALA B HB1  1  
ATOM 6621   H HB2  . ALA B 1 125 ? -15.557 -13.518 145.021 1.00 0.00 ?  125 ALA B HB2  1  
ATOM 6622   H HB3  . ALA B 1 125 ? -14.782 -14.448 146.358 1.00 0.00 ?  125 ALA B HB3  1  
ATOM 6623   N N    . ILE B 1 126 ? -11.606 -14.752 145.438 1.00 0.00 ?  126 ILE B N    1  
ATOM 6624   C CA   . ILE B 1 126 ? -10.551 -15.431 146.130 1.00 0.00 ?  126 ILE B CA   1  
ATOM 6625   C C    . ILE B 1 126 ? -9.486  -14.422 146.496 1.00 0.00 ?  126 ILE B C    1  
ATOM 6626   O O    . ILE B 1 126 ? -9.002  -14.404 147.628 1.00 0.00 ?  126 ILE B O    1  
ATOM 6627   C CB   . ILE B 1 126 ? -9.964  -16.523 145.275 1.00 0.00 ?  126 ILE B CB   1  
ATOM 6628   C CG1  . ILE B 1 126 ? -11.002 -17.644 145.088 1.00 0.00 ?  126 ILE B CG1  1  
ATOM 6629   C CG2  . ILE B 1 126 ? -8.671  -17.051 145.914 1.00 0.00 ?  126 ILE B CG2  1  
ATOM 6630   C CD1  . ILE B 1 126 ? -10.594 -18.651 144.016 1.00 0.00 ?  126 ILE B CD1  1  
ATOM 6631   H H    . ILE B 1 126 ? -11.767 -15.024 144.490 1.00 0.00 ?  126 ILE B H    1  
ATOM 6632   H HA   . ILE B 1 126 ? -10.969 -15.846 147.034 1.00 0.00 ?  126 ILE B HA   1  
ATOM 6633   H HB   . ILE B 1 126 ? -9.715  -16.112 144.274 1.00 0.00 ?  126 ILE B HB   1  
ATOM 6634   H HG12 . ILE B 1 126 ? -11.137 -18.176 146.055 1.00 0.00 ?  126 ILE B HG12 1  
ATOM 6635   H HG13 . ILE B 1 126 ? -11.976 -17.193 144.806 1.00 0.00 ?  126 ILE B HG13 1  
ATOM 6636   H HG21 . ILE B 1 126 ? -8.618  -18.152 145.806 1.00 0.00 ?  126 ILE B HG21 1  
ATOM 6637   H HG22 . ILE B 1 126 ? -8.627  -16.803 146.996 1.00 0.00 ?  126 ILE B HG22 1  
ATOM 6638   H HG23 . ILE B 1 126 ? -7.795  -16.610 145.404 1.00 0.00 ?  126 ILE B HG23 1  
ATOM 6639   H HD11 . ILE B 1 126 ? -9.882  -19.394 144.434 1.00 0.00 ?  126 ILE B HD11 1  
ATOM 6640   H HD12 . ILE B 1 126 ? -10.106 -18.132 143.164 1.00 0.00 ?  126 ILE B HD12 1  
ATOM 6641   H HD13 . ILE B 1 126 ? -11.487 -19.193 143.636 1.00 0.00 ?  126 ILE B HD13 1  
ATOM 6642   N N    . ALA B 1 127 ? -9.110  -13.554 145.539 1.00 0.00 ?  127 ALA B N    1  
ATOM 6643   C CA   . ALA B 1 127 ? -8.085  -12.565 145.785 1.00 0.00 ?  127 ALA B CA   1  
ATOM 6644   C C    . ALA B 1 127 ? -8.528  -11.606 146.859 1.00 0.00 ?  127 ALA B C    1  
ATOM 6645   O O    . ALA B 1 127 ? -7.727  -11.187 147.686 1.00 0.00 ?  127 ALA B O    1  
ATOM 6646   C CB   . ALA B 1 127 ? -7.746  -11.735 144.537 1.00 0.00 ?  127 ALA B CB   1  
ATOM 6647   H H    . ALA B 1 127 ? -9.514  -13.554 144.631 1.00 0.00 ?  127 ALA B H    1  
ATOM 6648   H HA   . ALA B 1 127 ? -7.207  -13.091 146.125 1.00 0.00 ?  127 ALA B HA   1  
ATOM 6649   H HB1  . ALA B 1 127 ? -7.819  -10.650 144.763 1.00 0.00 ?  127 ALA B HB1  1  
ATOM 6650   H HB2  . ALA B 1 127 ? -8.450  -11.974 143.712 1.00 0.00 ?  127 ALA B HB2  1  
ATOM 6651   H HB3  . ALA B 1 127 ? -6.711  -11.957 144.196 1.00 0.00 ?  127 ALA B HB3  1  
ATOM 6652   N N    . THR B 1 128 ? -9.814  -11.217 146.840 1.00 0.00 ?  128 THR B N    1  
ATOM 6653   C CA   . THR B 1 128 ? -10.333 -10.265 147.788 1.00 0.00 ?  128 THR B CA   1  
ATOM 6654   C C    . THR B 1 128 ? -10.228 -10.819 149.175 1.00 0.00 ?  128 THR B C    1  
ATOM 6655   O O    . THR B 1 128 ? -9.863  -10.092 150.103 1.00 0.00 ?  128 THR B O    1  
ATOM 6656   C CB   . THR B 1 128 ? -11.773 -9.913  147.535 1.00 0.00 ?  128 THR B CB   1  
ATOM 6657   O OG1  . THR B 1 128 ? -11.915 -9.312  146.249 1.00 0.00 ?  128 THR B OG1  1  
ATOM 6658   C CG2  . THR B 1 128 ? -12.244 -8.941  148.628 1.00 0.00 ?  128 THR B CG2  1  
ATOM 6659   H H    . THR B 1 128 ? -10.455 -11.556 146.167 1.00 0.00 ?  128 THR B H    1  
ATOM 6660   H HA   . THR B 1 128 ? -9.720  -9.380  147.720 1.00 0.00 ?  128 THR B HA   1  
ATOM 6661   H HB   . THR B 1 128 ? -12.403 -10.826 147.577 1.00 0.00 ?  128 THR B HB   1  
ATOM 6662   H HG1  . THR B 1 128 ? -11.358 -9.816  145.647 1.00 0.00 ?  128 THR B HG1  1  
ATOM 6663   H HG21 . THR B 1 128 ? -12.745 -9.495  149.449 1.00 0.00 ?  128 THR B HG21 1  
ATOM 6664   H HG22 . THR B 1 128 ? -12.963 -8.206  148.205 1.00 0.00 ?  128 THR B HG22 1  
ATOM 6665   H HG23 . THR B 1 128 ? -11.379 -8.387  149.050 1.00 0.00 ?  128 THR B HG23 1  
ATOM 6666   N N    . LEU B 1 129 ? -10.583 -12.108 149.354 1.00 0.00 ?  129 LEU B N    1  
ATOM 6667   C CA   . LEU B 1 129 ? -10.516 -12.706 150.660 1.00 0.00 ?  129 LEU B CA   1  
ATOM 6668   C C    . LEU B 1 129 ? -9.089  -12.696 151.107 1.00 0.00 ?  129 LEU B C    1  
ATOM 6669   O O    . LEU B 1 129 ? -8.803  -12.479 152.284 1.00 0.00 ?  129 LEU B O    1  
ATOM 6670   C CB   . LEU B 1 129 ? -11.022 -14.159 150.698 1.00 0.00 ?  129 LEU B CB   1  
ATOM 6671   C CG   . LEU B 1 129 ? -12.508 -14.275 151.100 1.00 0.00 ?  129 LEU B CG   1  
ATOM 6672   C CD1  . LEU B 1 129 ? -12.675 -14.221 152.628 1.00 0.00 ?  129 LEU B CD1  1  
ATOM 6673   C CD2  . LEU B 1 129 ? -13.382 -13.210 150.411 1.00 0.00 ?  129 LEU B CD2  1  
ATOM 6674   H H    . LEU B 1 129 ? -10.901 -12.689 148.608 1.00 0.00 ?  129 LEU B H    1  
ATOM 6675   H HA   . LEU B 1 129 ? -11.099 -12.091 151.329 1.00 0.00 ?  129 LEU B HA   1  
ATOM 6676   H HB2  . LEU B 1 129 ? -10.883 -14.615 149.692 1.00 0.00 ?  129 LEU B HB2  1  
ATOM 6677   H HB3  . LEU B 1 129 ? -10.413 -14.737 151.424 1.00 0.00 ?  129 LEU B HB3  1  
ATOM 6678   H HG   . LEU B 1 129 ? -12.867 -15.271 150.762 1.00 0.00 ?  129 LEU B HG   1  
ATOM 6679   H HD11 . LEU B 1 129 ? -12.329 -15.170 153.088 1.00 0.00 ?  129 LEU B HD11 1  
ATOM 6680   H HD12 . LEU B 1 129 ? -13.743 -14.066 152.893 1.00 0.00 ?  129 LEU B HD12 1  
ATOM 6681   H HD13 . LEU B 1 129 ? -12.080 -13.384 153.052 1.00 0.00 ?  129 LEU B HD13 1  
ATOM 6682   H HD21 . LEU B 1 129 ? -13.327 -12.246 150.962 1.00 0.00 ?  129 LEU B HD21 1  
ATOM 6683   H HD22 . LEU B 1 129 ? -14.442 -13.541 150.387 1.00 0.00 ?  129 LEU B HD22 1  
ATOM 6684   H HD23 . LEU B 1 129 ? -13.043 -13.043 149.369 1.00 0.00 ?  129 LEU B HD23 1  
ATOM 6685   N N    . GLU B 1 130 ? -8.158  -12.941 150.166 1.00 0.00 ?  130 GLU B N    1  
ATOM 6686   C CA   . GLU B 1 130 ? -6.761  -12.956 150.507 1.00 0.00 ?  130 GLU B CA   1  
ATOM 6687   C C    . GLU B 1 130 ? -6.350  -11.588 150.969 1.00 0.00 ?  130 GLU B C    1  
ATOM 6688   O O    . GLU B 1 130 ? -5.571  -11.471 151.895 1.00 0.00 ?  130 GLU B O    1  
ATOM 6689   C CB   . GLU B 1 130 ? -5.844  -13.347 149.334 1.00 0.00 ?  130 GLU B CB   1  
ATOM 6690   C CG   . GLU B 1 130 ? -4.364  -13.411 149.736 1.00 0.00 ?  130 GLU B CG   1  
ATOM 6691   C CD   . GLU B 1 130 ? -3.537  -13.784 148.513 1.00 0.00 ?  130 GLU B CD   1  
ATOM 6692   O OE1  . GLU B 1 130 ? -3.975  -13.459 147.375 1.00 0.00 ?  130 GLU B OE1  1  
ATOM 6693   O OE2  . GLU B 1 130 ? -2.453  -14.397 148.700 1.00 0.00 -1 130 GLU B OE2  1  
ATOM 6694   H H    . GLU B 1 130 ? -8.390  -13.130 149.213 1.00 0.00 ?  130 GLU B H    1  
ATOM 6695   H HA   . GLU B 1 130 ? -6.636  -13.652 151.321 1.00 0.00 ?  130 GLU B HA   1  
ATOM 6696   H HB2  . GLU B 1 130 ? -6.161  -14.340 148.960 1.00 0.00 ?  130 GLU B HB2  1  
ATOM 6697   H HB3  . GLU B 1 130 ? -5.965  -12.612 148.512 1.00 0.00 ?  130 GLU B HB3  1  
ATOM 6698   H HG2  . GLU B 1 130 ? -4.026  -12.423 150.122 1.00 0.00 ?  130 GLU B HG2  1  
ATOM 6699   H HG3  . GLU B 1 130 ? -4.216  -14.176 150.523 1.00 0.00 ?  130 GLU B HG3  1  
ATOM 6700   N N    . CYS B 1 131 ? -6.840  -10.525 150.298 1.00 0.00 ?  131 CYS B N    1  
ATOM 6701   C CA   . CYS B 1 131 ? -6.466  -9.173  150.657 1.00 0.00 ?  131 CYS B CA   1  
ATOM 6702   C C    . CYS B 1 131 ? -6.882  -8.884  152.068 1.00 0.00 ?  131 CYS B C    1  
ATOM 6703   O O    . CYS B 1 131 ? -6.108  -8.317  152.844 1.00 0.00 ?  131 CYS B O    1  
ATOM 6704   C CB   . CYS B 1 131 ? -7.121  -8.110  149.758 1.00 0.00 ?  131 CYS B CB   1  
ATOM 6705   S SG   . CYS B 1 131 ? -6.600  -6.434  150.226 1.00 0.00 ?  131 CYS B SG   1  
ATOM 6706   H H    . CYS B 1 131 ? -7.451  -10.624 149.524 1.00 0.00 ?  131 CYS B H    1  
ATOM 6707   H HA   . CYS B 1 131 ? -5.392  -9.104  150.587 1.00 0.00 ?  131 CYS B HA   1  
ATOM 6708   H HB2  . CYS B 1 131 ? -6.845  -8.319  148.700 1.00 0.00 ?  131 CYS B HB2  1  
ATOM 6709   H HB3  . CYS B 1 131 ? -8.224  -8.197  149.845 1.00 0.00 ?  131 CYS B HB3  1  
ATOM 6710   H HG   . CYS B 1 131 ? -7.832  -5.965  150.367 1.00 0.00 ?  131 CYS B HG   1  
ATOM 6711   N N    . PHE B 1 132 ? -8.134  -9.236  152.411 1.00 0.00 ?  132 PHE B N    1  
ATOM 6712   C CA   . PHE B 1 132 ? -8.645  -8.975  153.734 1.00 0.00 ?  132 PHE B CA   1  
ATOM 6713   C C    . PHE B 1 132 ? -7.809  -9.693  154.754 1.00 0.00 ?  132 PHE B C    1  
ATOM 6714   O O    . PHE B 1 132 ? -7.400  -9.112  155.760 1.00 0.00 ?  132 PHE B O    1  
ATOM 6715   C CB   . PHE B 1 132 ? -10.095 -9.452  153.912 1.00 0.00 ?  132 PHE B CB   1  
ATOM 6716   C CG   . PHE B 1 132 ? -10.629 -9.240  155.286 1.00 0.00 ?  132 PHE B CG   1  
ATOM 6717   C CD1  . PHE B 1 132 ? -10.664 -10.277 156.193 1.00 0.00 ?  132 PHE B CD1  1  
ATOM 6718   C CD2  . PHE B 1 132 ? -11.097 -8.003  155.664 1.00 0.00 ?  132 PHE B CD2  1  
ATOM 6719   C CE1  . PHE B 1 132 ? -11.161 -10.077 157.460 1.00 0.00 ?  132 PHE B CE1  1  
ATOM 6720   C CE2  . PHE B 1 132 ? -11.593 -7.804  156.928 1.00 0.00 ?  132 PHE B CE2  1  
ATOM 6721   C CZ   . PHE B 1 132 ? -11.625 -8.840  157.827 1.00 0.00 ?  132 PHE B CZ   1  
ATOM 6722   H H    . PHE B 1 132 ? -8.756  -9.688  151.774 1.00 0.00 ?  132 PHE B H    1  
ATOM 6723   H HA   . PHE B 1 132 ? -8.580  -7.913  153.906 1.00 0.00 ?  132 PHE B HA   1  
ATOM 6724   H HB2  . PHE B 1 132 ? -10.761 -8.904  153.214 1.00 0.00 ?  132 PHE B HB2  1  
ATOM 6725   H HB3  . PHE B 1 132 ? -10.163 -10.539 153.693 1.00 0.00 ?  132 PHE B HB3  1  
ATOM 6726   H HD1  . PHE B 1 132 ? -10.299 -11.252 155.908 1.00 0.00 ?  132 PHE B HD1  1  
ATOM 6727   H HD2  . PHE B 1 132 ? -11.076 -7.183  154.962 1.00 0.00 ?  132 PHE B HD2  1  
ATOM 6728   H HE1  . PHE B 1 132 ? -11.187 -10.895 158.165 1.00 0.00 ?  132 PHE B HE1  1  
ATOM 6729   H HE2  . PHE B 1 132 ? -11.956 -6.830  157.214 1.00 0.00 ?  132 PHE B HE2  1  
ATOM 6730   H HZ   . PHE B 1 132 ? -12.016 -8.682  158.822 1.00 0.00 ?  132 PHE B HZ   1  
ATOM 6731   N N    . VAL B 1 133 ? -7.547  -10.987 154.512 1.00 0.00 ?  133 VAL B N    1  
ATOM 6732   C CA   . VAL B 1 133 ? -6.803  -11.781 155.452 1.00 0.00 ?  133 VAL B CA   1  
ATOM 6733   C C    . VAL B 1 133 ? -5.409  -11.246 155.608 1.00 0.00 ?  133 VAL B C    1  
ATOM 6734   O O    . VAL B 1 133 ? -4.910  -11.152 156.716 1.00 0.00 ?  133 VAL B O    1  
ATOM 6735   C CB   . VAL B 1 133 ? -6.697  -13.220 155.031 1.00 0.00 ?  133 VAL B CB   1  
ATOM 6736   C CG1  . VAL B 1 133 ? -5.707  -13.934 155.967 1.00 0.00 ?  133 VAL B CG1  1  
ATOM 6737   C CG2  . VAL B 1 133 ? -8.104  -13.838 155.073 1.00 0.00 ?  133 VAL B CG2  1  
ATOM 6738   H H    . VAL B 1 133 ? -7.828  -11.442 153.671 1.00 0.00 ?  133 VAL B H    1  
ATOM 6739   H HA   . VAL B 1 133 ? -7.311  -11.712 156.401 1.00 0.00 ?  133 VAL B HA   1  
ATOM 6740   H HB   . VAL B 1 133 ? -6.314  -13.280 153.990 1.00 0.00 ?  133 VAL B HB   1  
ATOM 6741   H HG11 . VAL B 1 133 ? -4.670  -13.835 155.580 1.00 0.00 ?  133 VAL B HG11 1  
ATOM 6742   H HG12 . VAL B 1 133 ? -5.956  -15.014 156.040 1.00 0.00 ?  133 VAL B HG12 1  
ATOM 6743   H HG13 . VAL B 1 133 ? -5.749  -13.491 156.985 1.00 0.00 ?  133 VAL B HG13 1  
ATOM 6744   H HG21 . VAL B 1 133 ? -8.191  -14.542 155.928 1.00 0.00 ?  133 VAL B HG21 1  
ATOM 6745   H HG22 . VAL B 1 133 ? -8.311  -14.392 154.133 1.00 0.00 ?  133 VAL B HG22 1  
ATOM 6746   H HG23 . VAL B 1 133 ? -8.871  -13.043 155.191 1.00 0.00 ?  133 VAL B HG23 1  
ATOM 6747   N N    . GLY B 1 134 ? -4.753  -10.896 154.491 1.00 0.00 ?  134 GLY B N    1  
ATOM 6748   C CA   . GLY B 1 134 ? -3.390  -10.440 154.535 1.00 0.00 ?  134 GLY B CA   1  
ATOM 6749   C C    . GLY B 1 134 ? -3.255  -9.177  155.331 1.00 0.00 ?  134 GLY B C    1  
ATOM 6750   O O    . GLY B 1 134 ? -2.319  -9.051  156.115 1.00 0.00 ?  134 GLY B O    1  
ATOM 6751   H H    . GLY B 1 134 ? -5.175  -10.931 153.597 1.00 0.00 ?  134 GLY B H    1  
ATOM 6752   H HA2  . GLY B 1 134 ? -2.812  -11.210 155.020 1.00 0.00 ?  134 GLY B HA2  1  
ATOM 6753   H HA3  . GLY B 1 134 ? -3.089  -10.243 153.515 1.00 0.00 ?  134 GLY B HA3  1  
ATOM 6754   N N    . MET B 1 135 ? -4.176  -8.206  155.171 1.00 0.00 ?  135 MET B N    1  
ATOM 6755   C CA   . MET B 1 135 ? -4.013  -6.977  155.905 1.00 0.00 ?  135 MET B CA   1  
ATOM 6756   C C    . MET B 1 135 ? -4.274  -7.247  157.354 1.00 0.00 ?  135 MET B C    1  
ATOM 6757   O O    . MET B 1 135 ? -3.667  -6.621  158.225 1.00 0.00 ?  135 MET B O    1  
ATOM 6758   C CB   . MET B 1 135 ? -4.914  -5.817  155.425 1.00 0.00 ?  135 MET B CB   1  
ATOM 6759   C CG   . MET B 1 135 ? -6.412  -6.087  155.573 1.00 0.00 ?  135 MET B CG   1  
ATOM 6760   S SD   . MET B 1 135 ? -7.430  -4.693  155.004 1.00 0.00 ?  135 MET B SD   1  
ATOM 6761   C CE   . MET B 1 135 ? -9.016  -5.461  155.437 1.00 0.00 ?  135 MET B CE   1  
ATOM 6762   H H    . MET B 1 135 ? -4.968  -8.287  154.567 1.00 0.00 ?  135 MET B H    1  
ATOM 6763   H HA   . MET B 1 135 ? -2.976  -6.695  155.800 1.00 0.00 ?  135 MET B HA   1  
ATOM 6764   H HB2  . MET B 1 135 ? -4.657  -4.904  156.004 1.00 0.00 ?  135 MET B HB2  1  
ATOM 6765   H HB3  . MET B 1 135 ? -4.693  -5.613  154.356 1.00 0.00 ?  135 MET B HB3  1  
ATOM 6766   H HG2  . MET B 1 135 ? -6.663  -6.994  154.986 1.00 0.00 ?  135 MET B HG2  1  
ATOM 6767   H HG3  . MET B 1 135 ? -6.635  -6.301  156.639 1.00 0.00 ?  135 MET B HG3  1  
ATOM 6768   H HE1  . MET B 1 135 ? -8.858  -6.429  155.958 1.00 0.00 ?  135 MET B HE1  1  
ATOM 6769   H HE2  . MET B 1 135 ? -9.625  -5.655  154.528 1.00 0.00 ?  135 MET B HE2  1  
ATOM 6770   H HE3  . MET B 1 135 ? -9.605  -4.801  156.110 1.00 0.00 ?  135 MET B HE3  1  
ATOM 6771   N N    . SER B 1 136 ? -5.193  -8.188  157.647 1.00 0.00 ?  136 SER B N    1  
ATOM 6772   C CA   . SER B 1 136 ? -5.486  -8.521  159.014 1.00 0.00 ?  136 SER B CA   1  
ATOM 6773   C C    . SER B 1 136 ? -4.250  -9.106  159.631 1.00 0.00 ?  136 SER B C    1  
ATOM 6774   O O    . SER B 1 136 ? -3.918  -8.815  160.775 1.00 0.00 ?  136 SER B O    1  
ATOM 6775   C CB   . SER B 1 136 ? -6.616  -9.550  159.164 1.00 0.00 ?  136 SER B CB   1  
ATOM 6776   O OG   . SER B 1 136 ? -6.841  -9.823  160.538 1.00 0.00 ?  136 SER B OG   1  
ATOM 6777   H H    . SER B 1 136 ? -5.706  -8.680  156.945 1.00 0.00 ?  136 SER B H    1  
ATOM 6778   H HA   . SER B 1 136 ? -5.739  -7.607  159.526 1.00 0.00 ?  136 SER B HA   1  
ATOM 6779   H HB2  . SER B 1 136 ? -7.554  -9.153  158.718 1.00 0.00 ?  136 SER B HB2  1  
ATOM 6780   H HB3  . SER B 1 136 ? -6.343  -10.496 158.649 1.00 0.00 ?  136 SER B HB3  1  
ATOM 6781   H HG   . SER B 1 136 ? -7.672  -9.399  160.760 1.00 0.00 ?  136 SER B HG   1  
ATOM 6782   N N    . GLY B 1 137 ? -3.563  -9.975  158.865 1.00 0.00 ?  137 GLY B N    1  
ATOM 6783   C CA   . GLY B 1 137 ? -2.380  -10.638 159.340 1.00 0.00 ?  137 GLY B CA   1  
ATOM 6784   C C    . GLY B 1 137 ? -1.330  -9.630  159.668 1.00 0.00 ?  137 GLY B C    1  
ATOM 6785   O O    . GLY B 1 137 ? -0.596  -9.804  160.635 1.00 0.00 ?  137 GLY B O    1  
ATOM 6786   H H    . GLY B 1 137 ? -3.853  -10.209 157.948 1.00 0.00 ?  137 GLY B H    1  
ATOM 6787   H HA2  . GLY B 1 137 ? -2.647  -11.169 160.242 1.00 0.00 ?  137 GLY B HA2  1  
ATOM 6788   H HA3  . GLY B 1 137 ? -2.023  -11.273 158.541 1.00 0.00 ?  137 GLY B HA3  1  
ATOM 6789   N N    . ILE B 1 138 ? -1.203  -8.573  158.839 1.00 0.00 ?  138 ILE B N    1  
ATOM 6790   C CA   . ILE B 1 138 ? -0.204  -7.564  159.092 1.00 0.00 ?  138 ILE B CA   1  
ATOM 6791   C C    . ILE B 1 138 ? -0.495  -6.927  160.416 1.00 0.00 ?  138 ILE B C    1  
ATOM 6792   O O    . ILE B 1 138 ? 0.416   -6.703  161.212 1.00 0.00 ?  138 ILE B O    1  
ATOM 6793   C CB   . ILE B 1 138 ? -0.165  -6.475  158.050 1.00 0.00 ?  138 ILE B CB   1  
ATOM 6794   C CG1  . ILE B 1 138 ? 0.350   -7.014  156.694 1.00 0.00 ?  138 ILE B CG1  1  
ATOM 6795   C CG2  . ILE B 1 138 ? 0.704   -5.323  158.586 1.00 0.00 ?  138 ILE B CG2  1  
ATOM 6796   C CD1  . ILE B 1 138 ? 1.786   -7.549  156.746 1.00 0.00 ?  138 ILE B CD1  1  
ATOM 6797   H H    . ILE B 1 138 ? -1.763  -8.457  158.023 1.00 0.00 ?  138 ILE B H    1  
ATOM 6798   H HA   . ILE B 1 138 ? 0.750   -8.064  159.152 1.00 0.00 ?  138 ILE B HA   1  
ATOM 6799   H HB   . ILE B 1 138 ? -1.196  -6.085  157.899 1.00 0.00 ?  138 ILE B HB   1  
ATOM 6800   H HG12 . ILE B 1 138 ? -0.319  -7.828  156.355 1.00 0.00 ?  138 ILE B HG12 1  
ATOM 6801   H HG13 . ILE B 1 138 ? 0.300   -6.198  155.943 1.00 0.00 ?  138 ILE B HG13 1  
ATOM 6802   H HG21 . ILE B 1 138 ? 0.095   -4.639  159.216 1.00 0.00 ?  138 ILE B HG21 1  
ATOM 6803   H HG22 . ILE B 1 138 ? 1.133   -4.740  157.744 1.00 0.00 ?  138 ILE B HG22 1  
ATOM 6804   H HG23 . ILE B 1 138 ? 1.537   -5.724  159.201 1.00 0.00 ?  138 ILE B HG23 1  
ATOM 6805   H HD11 . ILE B 1 138 ? 2.160   -7.737  155.717 1.00 0.00 ?  138 ILE B HD11 1  
ATOM 6806   H HD12 . ILE B 1 138 ? 1.826   -8.503  157.313 1.00 0.00 ?  138 ILE B HD12 1  
ATOM 6807   H HD13 . ILE B 1 138 ? 2.460   -6.816  157.236 1.00 0.00 ?  138 ILE B HD13 1  
ATOM 6808   N N    . ALA B 1 139 ? -1.778  -6.605  160.674 1.00 0.00 ?  139 ALA B N    1  
ATOM 6809   C CA   . ALA B 1 139 ? -2.138  -5.972  161.917 1.00 0.00 ?  139 ALA B CA   1  
ATOM 6810   C C    . ALA B 1 139 ? -1.810  -6.890  163.061 1.00 0.00 ?  139 ALA B C    1  
ATOM 6811   O O    . ALA B 1 139 ? -1.327  -6.446  164.096 1.00 0.00 ?  139 ALA B O    1  
ATOM 6812   C CB   . ALA B 1 139 ? -3.635  -5.635  162.009 1.00 0.00 ?  139 ALA B CB   1  
ATOM 6813   H H    . ALA B 1 139 ? -2.521  -6.788  160.032 1.00 0.00 ?  139 ALA B H    1  
ATOM 6814   H HA   . ALA B 1 139 ? -1.550  -5.072  162.006 1.00 0.00 ?  139 ALA B HA   1  
ATOM 6815   H HB1  . ALA B 1 139 ? -3.820  -4.923  162.840 1.00 0.00 ?  139 ALA B HB1  1  
ATOM 6816   H HB2  . ALA B 1 139 ? -4.226  -6.557  162.194 1.00 0.00 ?  139 ALA B HB2  1  
ATOM 6817   H HB3  . ALA B 1 139 ? -3.985  -5.173  161.061 1.00 0.00 ?  139 ALA B HB3  1  
ATOM 6818   N N    . LEU B 1 140 ? -2.080  -8.195  162.894 1.00 0.00 ?  140 LEU B N    1  
ATOM 6819   C CA   . LEU B 1 140 ? -1.828  -9.146  163.947 1.00 0.00 ?  140 LEU B CA   1  
ATOM 6820   C C    . LEU B 1 140 ? -0.358  -9.197  164.250 1.00 0.00 ?  140 LEU B C    1  
ATOM 6821   O O    . LEU B 1 140 ? 0.040   -9.203  165.413 1.00 0.00 ?  140 LEU B O    1  
ATOM 6822   C CB   . LEU B 1 140 ? -2.288  -10.571 163.569 1.00 0.00 ?  140 LEU B CB   1  
ATOM 6823   C CG   . LEU B 1 140 ? -2.030  -11.621 164.668 1.00 0.00 ?  140 LEU B CG   1  
ATOM 6824   C CD1  . LEU B 1 140 ? -2.771  -11.267 165.965 1.00 0.00 ?  140 LEU B CD1  1  
ATOM 6825   C CD2  . LEU B 1 140 ? -2.410  -13.031 164.184 1.00 0.00 ?  140 LEU B CD2  1  
ATOM 6826   H H    . LEU B 1 140 ? -2.474  -8.555  162.056 1.00 0.00 ?  140 LEU B H    1  
ATOM 6827   H HA   . LEU B 1 140 ? -2.358  -8.809  164.824 1.00 0.00 ?  140 LEU B HA   1  
ATOM 6828   H HB2  . LEU B 1 140 ? -3.376  -10.547 163.341 1.00 0.00 ?  140 LEU B HB2  1  
ATOM 6829   H HB3  . LEU B 1 140 ? -1.755  -10.886 162.647 1.00 0.00 ?  140 LEU B HB3  1  
ATOM 6830   H HG   . LEU B 1 140 ? -0.942  -11.630 164.893 1.00 0.00 ?  140 LEU B HG   1  
ATOM 6831   H HD11 . LEU B 1 140 ? -2.990  -12.190 166.544 1.00 0.00 ?  140 LEU B HD11 1  
ATOM 6832   H HD12 . LEU B 1 140 ? -3.731  -10.756 165.735 1.00 0.00 ?  140 LEU B HD12 1  
ATOM 6833   H HD13 . LEU B 1 140 ? -2.152  -10.593 166.594 1.00 0.00 ?  140 LEU B HD13 1  
ATOM 6834   H HD21 . LEU B 1 140 ? -3.488  -13.068 163.918 1.00 0.00 ?  140 LEU B HD21 1  
ATOM 6835   H HD22 . LEU B 1 140 ? -2.216  -13.778 164.983 1.00 0.00 ?  140 LEU B HD22 1  
ATOM 6836   H HD23 . LEU B 1 140 ? -1.813  -13.304 163.289 1.00 0.00 ?  140 LEU B HD23 1  
ATOM 6837   N N    . SER B 1 141 ? 0.486   -9.251  163.205 1.00 0.00 ?  141 SER B N    1  
ATOM 6838   C CA   . SER B 1 141 ? 1.904   -9.358  163.421 1.00 0.00 ?  141 SER B CA   1  
ATOM 6839   C C    . SER B 1 141 ? 2.426   -8.116  164.072 1.00 0.00 ?  141 SER B C    1  
ATOM 6840   O O    . SER B 1 141 ? 3.296   -8.189  164.935 1.00 0.00 ?  141 SER B O    1  
ATOM 6841   C CB   . SER B 1 141 ? 2.702   -9.574  162.125 1.00 0.00 ?  141 SER B CB   1  
ATOM 6842   O OG   . SER B 1 141 ? 2.556   -8.453  161.267 1.00 0.00 ?  141 SER B OG   1  
ATOM 6843   H H    . SER B 1 141 ? 0.178   -9.223  162.262 1.00 0.00 ?  141 SER B H    1  
ATOM 6844   H HA   . SER B 1 141 ? 2.062   -10.190 164.088 1.00 0.00 ?  141 SER B HA   1  
ATOM 6845   H HB2  . SER B 1 141 ? 3.780   -9.708  162.359 1.00 0.00 ?  141 SER B HB2  1  
ATOM 6846   H HB3  . SER B 1 141 ? 2.332   -10.478 161.597 1.00 0.00 ?  141 SER B HB3  1  
ATOM 6847   H HG   . SER B 1 141 ? 3.328   -7.902  161.418 1.00 0.00 ?  141 SER B HG   1  
ATOM 6848   N N    . THR B 1 142 ? 1.909   -6.936  163.688 1.00 0.00 ?  142 THR B N    1  
ATOM 6849   C CA   . THR B 1 142 ? 2.420   -5.724  164.267 1.00 0.00 ?  142 THR B CA   1  
ATOM 6850   C C    . THR B 1 142 ? 2.007   -5.661  165.702 1.00 0.00 ?  142 THR B C    1  
ATOM 6851   O O    . THR B 1 142 ? 2.756   -5.165  166.545 1.00 0.00 ?  142 THR B O    1  
ATOM 6852   C CB   . THR B 1 142 ? 1.919   -4.481  163.590 1.00 0.00 ?  142 THR B CB   1  
ATOM 6853   O OG1  . THR B 1 142 ? 0.503   -4.422  163.663 1.00 0.00 ?  142 THR B OG1  1  
ATOM 6854   C CG2  . THR B 1 142 ? 2.377   -4.500  162.124 1.00 0.00 ?  142 THR B CG2  1  
ATOM 6855   H H    . THR B 1 142 ? 1.189   -6.850  163.007 1.00 0.00 ?  142 THR B H    1  
ATOM 6856   H HA   . THR B 1 142 ? 3.497   -5.770  164.213 1.00 0.00 ?  142 THR B HA   1  
ATOM 6857   H HB   . THR B 1 142 ? 2.343   -3.580  164.081 1.00 0.00 ?  142 THR B HB   1  
ATOM 6858   H HG1  . THR B 1 142 ? 0.295   -3.605  164.123 1.00 0.00 ?  142 THR B HG1  1  
ATOM 6859   H HG21 . THR B 1 142 ? 2.944   -3.575  161.884 1.00 0.00 ?  142 THR B HG21 1  
ATOM 6860   H HG22 . THR B 1 142 ? 1.499   -4.562  161.447 1.00 0.00 ?  142 THR B HG22 1  
ATOM 6861   H HG23 . THR B 1 142 ? 3.033   -5.376  161.936 1.00 0.00 ?  142 THR B HG23 1  
ATOM 6862   N N    . GLY B 1 143 ? 0.789   -6.146  166.010 1.00 0.00 ?  143 GLY B N    1  
ATOM 6863   C CA   . GLY B 1 143 ? 0.312   -6.114  167.364 1.00 0.00 ?  143 GLY B CA   1  
ATOM 6864   C C    . GLY B 1 143 ? 1.187   -6.979  168.218 1.00 0.00 ?  143 GLY B C    1  
ATOM 6865   O O    . GLY B 1 143 ? 1.541   -6.604  169.333 1.00 0.00 ?  143 GLY B O    1  
ATOM 6866   H H    . GLY B 1 143 ? 0.175   -6.528  165.330 1.00 0.00 ?  143 GLY B H    1  
ATOM 6867   H HA2  . GLY B 1 143 ? 0.384   -5.093  167.709 1.00 0.00 ?  143 GLY B HA2  1  
ATOM 6868   H HA3  . GLY B 1 143 ? -0.690  -6.516  167.364 1.00 0.00 ?  143 GLY B HA3  1  
ATOM 6869   N N    . LEU B 1 144 ? 1.556   -8.167  167.704 1.00 0.00 ?  144 LEU B N    1  
ATOM 6870   C CA   . LEU B 1 144 ? 2.373   -9.073  168.466 1.00 0.00 ?  144 LEU B CA   1  
ATOM 6871   C C    . LEU B 1 144 ? 3.718   -8.458  168.698 1.00 0.00 ?  144 LEU B C    1  
ATOM 6872   O O    . LEU B 1 144 ? 4.300   -8.618  169.770 1.00 0.00 ?  144 LEU B O    1  
ATOM 6873   C CB   . LEU B 1 144 ? 2.594   -10.428 167.770 1.00 0.00 ?  144 LEU B CB   1  
ATOM 6874   C CG   . LEU B 1 144 ? 1.316   -11.283 167.711 1.00 0.00 ?  144 LEU B CG   1  
ATOM 6875   C CD1  . LEU B 1 144 ? 1.511   -12.518 166.816 1.00 0.00 ?  144 LEU B CD1  1  
ATOM 6876   C CD2  . LEU B 1 144 ? 0.844   -11.686 169.119 1.00 0.00 ?  144 LEU B CD2  1  
ATOM 6877   H H    . LEU B 1 144 ? 1.280   -8.468  166.795 1.00 0.00 ?  144 LEU B H    1  
ATOM 6878   H HA   . LEU B 1 144 ? 1.888   -9.221  169.418 1.00 0.00 ?  144 LEU B HA   1  
ATOM 6879   H HB2  . LEU B 1 144 ? 2.961   -10.246 166.735 1.00 0.00 ?  144 LEU B HB2  1  
ATOM 6880   H HB3  . LEU B 1 144 ? 3.376   -10.994 168.318 1.00 0.00 ?  144 LEU B HB3  1  
ATOM 6881   H HG   . LEU B 1 144 ? 0.518   -10.661 167.256 1.00 0.00 ?  144 LEU B HG   1  
ATOM 6882   H HD11 . LEU B 1 144 ? 0.534   -13.003 166.610 1.00 0.00 ?  144 LEU B HD11 1  
ATOM 6883   H HD12 . LEU B 1 144 ? 2.175   -13.255 167.315 1.00 0.00 ?  144 LEU B HD12 1  
ATOM 6884   H HD13 . LEU B 1 144 ? 1.972   -12.224 165.848 1.00 0.00 ?  144 LEU B HD13 1  
ATOM 6885   H HD21 . LEU B 1 144 ? 1.703   -12.048 169.724 1.00 0.00 ?  144 LEU B HD21 1  
ATOM 6886   H HD22 . LEU B 1 144 ? 0.088   -12.497 169.054 1.00 0.00 ?  144 LEU B HD22 1  
ATOM 6887   H HD23 . LEU B 1 144 ? 0.388   -10.815 169.637 1.00 0.00 ?  144 LEU B HD23 1  
ATOM 6888   N N    . VAL B 1 145 ? 4.250   -7.761  167.677 1.00 0.00 ?  145 VAL B N    1  
ATOM 6889   C CA   . VAL B 1 145 ? 5.556   -7.168  167.791 1.00 0.00 ?  145 VAL B CA   1  
ATOM 6890   C C    . VAL B 1 145 ? 5.570   -6.151  168.891 1.00 0.00 ?  145 VAL B C    1  
ATOM 6891   O O    . VAL B 1 145 ? 6.494   -6.134  169.707 1.00 0.00 ?  145 VAL B O    1  
ATOM 6892   C CB   . VAL B 1 145 ? 5.993   -6.479  166.533 1.00 0.00 ?  145 VAL B CB   1  
ATOM 6893   C CG1  . VAL B 1 145 ? 7.279   -5.694  166.837 1.00 0.00 ?  145 VAL B CG1  1  
ATOM 6894   C CG2  . VAL B 1 145 ? 6.188   -7.543  165.441 1.00 0.00 ?  145 VAL B CG2  1  
ATOM 6895   H H    . VAL B 1 145 ? 3.779   -7.635  166.809 1.00 0.00 ?  145 VAL B H    1  
ATOM 6896   H HA   . VAL B 1 145 ? 6.247   -7.959  168.037 1.00 0.00 ?  145 VAL B HA   1  
ATOM 6897   H HB   . VAL B 1 145 ? 5.208   -5.766  166.201 1.00 0.00 ?  145 VAL B HB   1  
ATOM 6898   H HG11 . VAL B 1 145 ? 7.887   -5.578  165.914 1.00 0.00 ?  145 VAL B HG11 1  
ATOM 6899   H HG12 . VAL B 1 145 ? 7.887   -6.231  167.597 1.00 0.00 ?  145 VAL B HG12 1  
ATOM 6900   H HG13 . VAL B 1 145 ? 7.032   -4.686  167.228 1.00 0.00 ?  145 VAL B HG13 1  
ATOM 6901   H HG21 . VAL B 1 145 ? 7.248   -7.563  165.107 1.00 0.00 ?  145 VAL B HG21 1  
ATOM 6902   H HG22 . VAL B 1 145 ? 5.544   -7.318  164.564 1.00 0.00 ?  145 VAL B HG22 1  
ATOM 6903   H HG23 . VAL B 1 145 ? 5.920   -8.549  165.829 1.00 0.00 ?  145 VAL B HG23 1  
ATOM 6904   N N    . PHE B 1 146 ? 4.551   -5.271  168.940 1.00 0.00 ?  146 PHE B N    1  
ATOM 6905   C CA   . PHE B 1 146 ? 4.534   -4.253  169.956 1.00 0.00 ?  146 PHE B CA   1  
ATOM 6906   C C    . PHE B 1 146 ? 4.394   -4.893  171.299 1.00 0.00 ?  146 PHE B C    1  
ATOM 6907   O O    . PHE B 1 146 ? 4.975   -4.420  172.271 1.00 0.00 ?  146 PHE B O    1  
ATOM 6908   C CB   . PHE B 1 146 ? 3.414   -3.214  169.832 1.00 0.00 ?  146 PHE B CB   1  
ATOM 6909   C CG   . PHE B 1 146 ? 3.587   -2.105  170.815 1.00 0.00 ?  146 PHE B CG   1  
ATOM 6910   C CD1  . PHE B 1 146 ? 2.982   -2.164  172.049 1.00 0.00 ?  146 PHE B CD1  1  
ATOM 6911   C CD2  . PHE B 1 146 ? 4.377   -1.019  170.509 1.00 0.00 ?  146 PHE B CD2  1  
ATOM 6912   C CE1  . PHE B 1 146 ? 3.162   -1.158  172.964 1.00 0.00 ?  146 PHE B CE1  1  
ATOM 6913   C CE2  . PHE B 1 146 ? 4.555   -0.010  171.424 1.00 0.00 ?  146 PHE B CE2  1  
ATOM 6914   C CZ   . PHE B 1 146 ? 3.949   -0.081  172.652 1.00 0.00 ?  146 PHE B CZ   1  
ATOM 6915   H H    . PHE B 1 146 ? 3.788   -5.283  168.295 1.00 0.00 ?  146 PHE B H    1  
ATOM 6916   H HA   . PHE B 1 146 ? 5.492   -3.758  169.914 1.00 0.00 ?  146 PHE B HA   1  
ATOM 6917   H HB2  . PHE B 1 146 ? 3.413   -2.766  168.815 1.00 0.00 ?  146 PHE B HB2  1  
ATOM 6918   H HB3  . PHE B 1 146 ? 2.427   -3.685  170.026 1.00 0.00 ?  146 PHE B HB3  1  
ATOM 6919   H HD1  . PHE B 1 146 ? 2.369   -3.009  172.300 1.00 0.00 ?  146 PHE B HD1  1  
ATOM 6920   H HD2  . PHE B 1 146 ? 4.856   -0.959  169.543 1.00 0.00 ?  146 PHE B HD2  1  
ATOM 6921   H HE1  . PHE B 1 146 ? 2.682   -1.213  173.930 1.00 0.00 ?  146 PHE B HE1  1  
ATOM 6922   H HE2  . PHE B 1 146 ? 5.175   0.838   171.178 1.00 0.00 ?  146 PHE B HE2  1  
ATOM 6923   H HZ   . PHE B 1 146 ? 4.091   0.710   173.373 1.00 0.00 ?  146 PHE B HZ   1  
ATOM 6924   N N    . ALA B 1 147 ? 3.573   -5.957  171.385 1.00 0.00 ?  147 ALA B N    1  
ATOM 6925   C CA   . ALA B 1 147 ? 3.342   -6.614  172.646 1.00 0.00 ?  147 ALA B CA   1  
ATOM 6926   C C    . ALA B 1 147 ? 4.642   -7.135  173.180 1.00 0.00 ?  147 ALA B C    1  
ATOM 6927   O O    . ALA B 1 147 ? 4.870   -7.104  174.390 1.00 0.00 ?  147 ALA B O    1  
ATOM 6928   C CB   . ALA B 1 147 ? 2.374   -7.804  172.539 1.00 0.00 ?  147 ALA B CB   1  
ATOM 6929   H H    . ALA B 1 147 ? 3.094   -6.331  170.595 1.00 0.00 ?  147 ALA B H    1  
ATOM 6930   H HA   . ALA B 1 147 ? 2.949   -5.878  173.329 1.00 0.00 ?  147 ALA B HA   1  
ATOM 6931   H HB1  . ALA B 1 147 ? 1.554   -7.571  171.826 1.00 0.00 ?  147 ALA B HB1  1  
ATOM 6932   H HB2  . ALA B 1 147 ? 1.928   -8.029  173.531 1.00 0.00 ?  147 ALA B HB2  1  
ATOM 6933   H HB3  . ALA B 1 147 ? 2.912   -8.707  172.178 1.00 0.00 ?  147 ALA B HB3  1  
ATOM 6934   N N    . ARG B 1 148 ? 5.507   -7.665  172.294 1.00 0.00 ?  148 ARG B N    1  
ATOM 6935   C CA   . ARG B 1 148 ? 6.768   -8.196  172.742 1.00 0.00 ?  148 ARG B CA   1  
ATOM 6936   C C    . ARG B 1 148 ? 7.585   -7.093  173.353 1.00 0.00 ?  148 ARG B C    1  
ATOM 6937   O O    . ARG B 1 148 ? 8.231   -7.294  174.381 1.00 0.00 ?  148 ARG B O    1  
ATOM 6938   C CB   . ARG B 1 148 ? 7.625   -8.805  171.625 1.00 0.00 ?  148 ARG B CB   1  
ATOM 6939   C CG   . ARG B 1 148 ? 8.823   -9.569  172.191 1.00 0.00 ?  148 ARG B CG   1  
ATOM 6940   C CD   . ARG B 1 148 ? 9.762   -10.093 171.109 1.00 0.00 ?  148 ARG B CD   1  
ATOM 6941   N NE   . ARG B 1 148 ? 10.781  -10.959 171.768 1.00 0.00 ?  148 ARG B NE   1  
ATOM 6942   C CZ   . ARG B 1 148 ? 11.844  -10.406 172.417 1.00 0.00 ?  148 ARG B CZ   1  
ATOM 6943   N NH1  . ARG B 1 148 ? 11.954  -9.048  172.523 1.00 0.00 1  148 ARG B NH1  1  
ATOM 6944   N NH2  . ARG B 1 148 ? 12.788  -11.216 172.982 1.00 0.00 ?  148 ARG B NH2  1  
ATOM 6945   H H    . ARG B 1 148 ? 5.307   -7.733  171.319 1.00 0.00 ?  148 ARG B H    1  
ATOM 6946   H HA   . ARG B 1 148 ? 6.559   -8.935  173.494 1.00 0.00 ?  148 ARG B HA   1  
ATOM 6947   H HB2  . ARG B 1 148 ? 6.999   -9.495  171.018 1.00 0.00 ?  148 ARG B HB2  1  
ATOM 6948   H HB3  . ARG B 1 148 ? 7.994   -7.995  170.962 1.00 0.00 ?  148 ARG B HB3  1  
ATOM 6949   H HG2  . ARG B 1 148 ? 9.398   -8.903  172.866 1.00 0.00 ?  148 ARG B HG2  1  
ATOM 6950   H HG3  . ARG B 1 148 ? 8.451   -10.426 172.792 1.00 0.00 ?  148 ARG B HG3  1  
ATOM 6951   H HD2  . ARG B 1 148 ? 9.205   -10.699 170.365 1.00 0.00 ?  148 ARG B HD2  1  
ATOM 6952   H HD3  . ARG B 1 148 ? 10.291  -9.260  170.602 1.00 0.00 ?  148 ARG B HD3  1  
ATOM 6953   H HE   . ARG B 1 148 ? 10.695  -11.957 171.719 1.00 0.00 ?  148 ARG B HE   1  
ATOM 6954   H HH11 . ARG B 1 148 ? 11.254  -8.457  172.124 1.00 0.00 ?  148 ARG B HH11 1  
ATOM 6955   H HH12 . ARG B 1 148 ? 12.735  -8.645  173.001 1.00 0.00 ?  148 ARG B HH12 1  
ATOM 6956   H HH21 . ARG B 1 148 ? 12.696  -12.212 172.917 1.00 0.00 ?  148 ARG B HH21 1  
ATOM 6957   H HH22 . ARG B 1 148 ? 13.570  -10.815 173.460 1.00 0.00 ?  148 ARG B HH22 1  
ATOM 6958   N N    . PHE B 1 149 ? 7.594   -5.904  172.719 1.00 0.00 ?  149 PHE B N    1  
ATOM 6959   C CA   . PHE B 1 149 ? 8.386   -4.814  173.235 1.00 0.00 ?  149 PHE B CA   1  
ATOM 6960   C C    . PHE B 1 149 ? 7.836   -4.391  174.556 1.00 0.00 ?  149 PHE B C    1  
ATOM 6961   O O    . PHE B 1 149 ? 8.588   -3.985  175.442 1.00 0.00 ?  149 PHE B O    1  
ATOM 6962   C CB   . PHE B 1 149 ? 8.433   -3.584  172.316 1.00 0.00 ?  149 PHE B CB   1  
ATOM 6963   C CG   . PHE B 1 149 ? 9.374   -3.748  171.174 1.00 0.00 ?  149 PHE B CG   1  
ATOM 6964   C CD1  . PHE B 1 149 ? 10.732  -3.639  171.381 1.00 0.00 ?  149 PHE B CD1  1  
ATOM 6965   C CD2  . PHE B 1 149 ? 8.908   -4.014  169.906 1.00 0.00 ?  149 PHE B CD2  1  
ATOM 6966   C CE1  . PHE B 1 149 ? 11.611  -3.794  170.337 1.00 0.00 ?  149 PHE B CE1  1  
ATOM 6967   C CE2  . PHE B 1 149 ? 9.789   -4.167  168.861 1.00 0.00 ?  149 PHE B CE2  1  
ATOM 6968   C CZ   . PHE B 1 149 ? 11.140  -4.059  169.078 1.00 0.00 ?  149 PHE B CZ   1  
ATOM 6969   H H    . PHE B 1 149 ? 7.075   -5.732  171.882 1.00 0.00 ?  149 PHE B H    1  
ATOM 6970   H HA   . PHE B 1 149 ? 9.385   -5.195  173.385 1.00 0.00 ?  149 PHE B HA   1  
ATOM 6971   H HB2  . PHE B 1 149 ? 7.427   -3.390  171.889 1.00 0.00 ?  149 PHE B HB2  1  
ATOM 6972   H HB3  . PHE B 1 149 ? 8.757   -2.691  172.893 1.00 0.00 ?  149 PHE B HB3  1  
ATOM 6973   H HD1  . PHE B 1 149 ? 11.109  -3.430  172.371 1.00 0.00 ?  149 PHE B HD1  1  
ATOM 6974   H HD2  . PHE B 1 149 ? 7.846   -4.099  169.731 1.00 0.00 ?  149 PHE B HD2  1  
ATOM 6975   H HE1  . PHE B 1 149 ? 12.673  -3.708  170.508 1.00 0.00 ?  149 PHE B HE1  1  
ATOM 6976   H HE2  . PHE B 1 149 ? 9.419   -4.373  167.869 1.00 0.00 ?  149 PHE B HE2  1  
ATOM 6977   H HZ   . PHE B 1 149 ? 11.830  -4.184  168.259 1.00 0.00 ?  149 PHE B HZ   1  
ATOM 6978   N N    . ALA B 1 150 ? 6.503   -4.463  174.701 1.00 0.00 ?  150 ALA B N    1  
ATOM 6979   C CA   . ALA B 1 150 ? 5.858   -4.066  175.923 1.00 0.00 ?  150 ALA B CA   1  
ATOM 6980   C C    . ALA B 1 150 ? 6.367   -4.917  177.053 1.00 0.00 ?  150 ALA B C    1  
ATOM 6981   O O    . ALA B 1 150 ? 6.525   -4.428  178.171 1.00 0.00 ?  150 ALA B O    1  
ATOM 6982   C CB   . ALA B 1 150 ? 4.329   -4.212  175.872 1.00 0.00 ?  150 ALA B CB   1  
ATOM 6983   H H    . ALA B 1 150 ? 5.907   -4.768  173.967 1.00 0.00 ?  150 ALA B H    1  
ATOM 6984   H HA   . ALA B 1 150 ? 6.125   -3.038  176.110 1.00 0.00 ?  150 ALA B HA   1  
ATOM 6985   H HB1  . ALA B 1 150 ? 3.842   -3.226  176.029 1.00 0.00 ?  150 ALA B HB1  1  
ATOM 6986   H HB2  . ALA B 1 150 ? 3.980   -4.910  176.661 1.00 0.00 ?  150 ALA B HB2  1  
ATOM 6987   H HB3  . ALA B 1 150 ? 4.014   -4.608  174.883 1.00 0.00 ?  150 ALA B HB3  1  
ATOM 6988   N N    . ARG B 1 151 ? 6.611   -6.221  176.792 1.00 0.00 ?  151 ARG B N    1  
ATOM 6989   C CA   . ARG B 1 151 ? 7.078   -7.099  177.840 1.00 0.00 ?  151 ARG B CA   1  
ATOM 6990   C C    . ARG B 1 151 ? 8.451   -6.631  178.302 1.00 0.00 ?  151 ARG B C    1  
ATOM 6991   O O    . ARG B 1 151 ? 9.384   -6.593  177.504 1.00 0.00 ?  151 ARG B O    1  
ATOM 6992   C CB   . ARG B 1 151 ? 7.261   -8.551  177.330 1.00 0.00 ?  151 ARG B CB   1  
ATOM 6993   C CG   . ARG B 1 151 ? 7.739   -9.538  178.411 1.00 0.00 ?  151 ARG B CG   1  
ATOM 6994   C CD   . ARG B 1 151 ? 6.684   -9.798  179.484 1.00 0.00 ?  151 ARG B CD   1  
ATOM 6995   N NE   . ARG B 1 151 ? 7.249   -10.725 180.506 1.00 0.00 ?  151 ARG B NE   1  
ATOM 6996   C CZ   . ARG B 1 151 ? 7.268   -12.068 180.276 1.00 0.00 ?  151 ARG B CZ   1  
ATOM 6997   N NH1  . ARG B 1 151 ? 6.844   -12.562 179.077 1.00 0.00 1  151 ARG B NH1  1  
ATOM 6998   N NH2  . ARG B 1 151 ? 7.719   -12.918 181.245 1.00 0.00 ?  151 ARG B NH2  1  
ATOM 6999   H H    . ARG B 1 151 ? 6.465   -6.628  175.892 1.00 0.00 ?  151 ARG B H    1  
ATOM 7000   H HA   . ARG B 1 151 ? 6.351   -7.077  178.626 1.00 0.00 ?  151 ARG B HA   1  
ATOM 7001   H HB2  . ARG B 1 151 ? 6.292   -8.910  176.921 1.00 0.00 ?  151 ARG B HB2  1  
ATOM 7002   H HB3  . ARG B 1 151 ? 7.999   -8.548  176.500 1.00 0.00 ?  151 ARG B HB3  1  
ATOM 7003   H HG2  . ARG B 1 151 ? 7.994   -10.503 177.924 1.00 0.00 ?  151 ARG B HG2  1  
ATOM 7004   H HG3  . ARG B 1 151 ? 8.661   -9.150  178.892 1.00 0.00 ?  151 ARG B HG3  1  
ATOM 7005   H HD2  . ARG B 1 151 ? 6.399   -8.858  179.993 1.00 0.00 ?  151 ARG B HD2  1  
ATOM 7006   H HD3  . ARG B 1 151 ? 5.782   -10.275 179.048 1.00 0.00 ?  151 ARG B HD3  1  
ATOM 7007   H HE   . ARG B 1 151 ? 7.583   -10.362 181.376 1.00 0.00 ?  151 ARG B HE   1  
ATOM 7008   H HH11 . ARG B 1 151 ? 6.518   -11.937 178.367 1.00 0.00 ?  151 ARG B HH11 1  
ATOM 7009   H HH12 . ARG B 1 151 ? 6.857   -13.548 178.909 1.00 0.00 ?  151 ARG B HH12 1  
ATOM 7010   H HH21 . ARG B 1 151 ? 8.034   -12.555 182.122 1.00 0.00 ?  151 ARG B HH21 1  
ATOM 7011   H HH22 . ARG B 1 151 ? 7.731   -13.905 181.079 1.00 0.00 ?  151 ARG B HH22 1  
ATOM 7012   N N    . PRO B 1 152 ? 8.611   -6.271  179.580 1.00 0.00 ?  152 PRO B N    1  
ATOM 7013   C CA   . PRO B 1 152 ? 9.911   -5.889  180.095 1.00 0.00 ?  152 PRO B CA   1  
ATOM 7014   C C    . PRO B 1 152 ? 10.731  -7.090  180.444 1.00 0.00 ?  152 PRO B C    1  
ATOM 7015   O O    . PRO B 1 152 ? 10.195  -8.192  180.552 1.00 0.00 ?  152 PRO B O    1  
ATOM 7016   C CB   . PRO B 1 152 ? 9.601   -5.067  181.337 1.00 0.00 ?  152 PRO B CB   1  
ATOM 7017   C CG   . PRO B 1 152 ? 8.336   -5.714  181.874 1.00 0.00 ?  152 PRO B CG   1  
ATOM 7018   C CD   . PRO B 1 152 ? 7.569   -6.152  180.624 1.00 0.00 ?  152 PRO B CD   1  
ATOM 7019   H HA   . PRO B 1 152 ? 10.452  -5.282  179.383 1.00 0.00 ?  152 PRO B HA   1  
ATOM 7020   H HB2  . PRO B 1 152 ? 10.430  -5.139  182.076 1.00 0.00 ?  152 PRO B HB2  1  
ATOM 7021   H HB3  . PRO B 1 152 ? 9.418   -4.004  181.075 1.00 0.00 ?  152 PRO B HB3  1  
ATOM 7022   H HG2  . PRO B 1 152 ? 8.586   -6.589  182.513 1.00 0.00 ?  152 PRO B HG2  1  
ATOM 7023   H HG3  . PRO B 1 152 ? 7.742   -4.983  182.460 1.00 0.00 ?  152 PRO B HG3  1  
ATOM 7024   H HD2  . PRO B 1 152 ? 7.066   -7.121  180.803 1.00 0.00 ?  152 PRO B HD2  1  
ATOM 7025   H HD3  . PRO B 1 152 ? 6.810   -5.390  180.350 1.00 0.00 ?  152 PRO B HD3  1  
ATOM 7026   N N    . ARG B 1 153 ? 12.058  -6.895  180.628 1.00 0.00 ?  153 ARG B N    1  
ATOM 7027   C CA   . ARG B 1 153 ? 12.930  -7.993  180.969 1.00 0.00 ?  153 ARG B CA   1  
ATOM 7028   C C    . ARG B 1 153 ? 13.407  -7.746  182.364 1.00 0.00 ?  153 ARG B C    1  
ATOM 7029   O O    . ARG B 1 153 ? 13.860  -6.645  182.680 1.00 0.00 ?  153 ARG B O    1  
ATOM 7030   C CB   . ARG B 1 153 ? 14.159  -8.100  180.045 1.00 0.00 ?  153 ARG B CB   1  
ATOM 7031   C CG   . ARG B 1 153 ? 13.766  -8.261  178.572 1.00 0.00 ?  153 ARG B CG   1  
ATOM 7032   C CD   . ARG B 1 153 ? 13.622  -6.919  177.844 1.00 0.00 ?  153 ARG B CD   1  
ATOM 7033   N NE   . ARG B 1 153 ? 12.632  -7.086  176.743 1.00 0.00 ?  153 ARG B NE   1  
ATOM 7034   C CZ   . ARG B 1 153 ? 12.099  -5.986  176.132 1.00 0.00 ?  153 ARG B CZ   1  
ATOM 7035   N NH1  . ARG B 1 153 ? 12.507  -4.737  176.502 1.00 0.00 1  153 ARG B NH1  1  
ATOM 7036   N NH2  . ARG B 1 153 ? 11.159  -6.136  175.152 1.00 0.00 ?  153 ARG B NH2  1  
ATOM 7037   H H    . ARG B 1 153 ? 12.486  -5.998  180.538 1.00 0.00 ?  153 ARG B H    1  
ATOM 7038   H HA   . ARG B 1 153 ? 12.360  -8.907  180.946 1.00 0.00 ?  153 ARG B HA   1  
ATOM 7039   H HB2  . ARG B 1 153 ? 14.780  -7.185  180.160 1.00 0.00 ?  153 ARG B HB2  1  
ATOM 7040   H HB3  . ARG B 1 153 ? 14.770  -8.974  180.352 1.00 0.00 ?  153 ARG B HB3  1  
ATOM 7041   H HG2  . ARG B 1 153 ? 14.539  -8.870  178.057 1.00 0.00 ?  153 ARG B HG2  1  
ATOM 7042   H HG3  . ARG B 1 153 ? 12.802  -8.810  178.514 1.00 0.00 ?  153 ARG B HG3  1  
ATOM 7043   H HD2  . ARG B 1 153 ? 13.251  -6.130  178.534 1.00 0.00 ?  153 ARG B HD2  1  
ATOM 7044   H HD3  . ARG B 1 153 ? 14.588  -6.604  177.396 1.00 0.00 ?  153 ARG B HD3  1  
ATOM 7045   H HE   . ARG B 1 153 ? 12.346  -8.002  176.463 1.00 0.00 ?  153 ARG B HE   1  
ATOM 7046   H HH11 . ARG B 1 153 ? 13.194  -4.628  177.220 1.00 0.00 ?  153 ARG B HH11 1  
ATOM 7047   H HH12 . ARG B 1 153 ? 12.117  -3.932  176.056 1.00 0.00 ?  153 ARG B HH12 1  
ATOM 7048   H HH21 . ARG B 1 153 ? 10.860  -7.051  174.880 1.00 0.00 ?  153 ARG B HH21 1  
ATOM 7049   H HH22 . ARG B 1 153 ? 10.766  -5.329  174.709 1.00 0.00 ?  153 ARG B HH22 1  
ATOM 7050   N N    . ALA B 1 154 ? 13.332  -8.798  183.227 1.00 0.00 ?  154 ALA B N    1  
ATOM 7051   C CA   . ALA B 1 154 ? 13.738  -8.661  184.606 1.00 0.00 ?  154 ALA B CA   1  
ATOM 7052   C C    . ALA B 1 154 ? 14.914  -9.554  184.849 1.00 0.00 ?  154 ALA B C    1  
ATOM 7053   O O    . ALA B 1 154 ? 14.767  -10.724 185.200 1.00 0.00 ?  154 ALA B O    1  
ATOM 7054   C CB   . ALA B 1 154 ? 12.637  -9.068  185.598 1.00 0.00 ?  154 ALA B CB   1  
ATOM 7055   H H    . ALA B 1 154 ? 12.997  -9.694  182.949 1.00 0.00 ?  154 ALA B H    1  
ATOM 7056   H HA   . ALA B 1 154 ? 14.030  -7.638  184.775 1.00 0.00 ?  154 ALA B HA   1  
ATOM 7057   H HB1  . ALA B 1 154 ? 12.453  -10.163 185.545 1.00 0.00 ?  154 ALA B HB1  1  
ATOM 7058   H HB2  . ALA B 1 154 ? 11.690  -8.540  185.361 1.00 0.00 ?  154 ALA B HB2  1  
ATOM 7059   H HB3  . ALA B 1 154 ? 12.936  -8.810  186.636 1.00 0.00 ?  154 ALA B HB3  1  
ATOM 7060   N N    . LYS B 1 155 ? 16.121  -8.999  184.660 1.00 0.00 ?  155 LYS B N    1  
ATOM 7061   C CA   . LYS B 1 155 ? 17.331  -9.736  184.894 1.00 0.00 ?  155 LYS B CA   1  
ATOM 7062   C C    . LYS B 1 155 ? 17.678  -9.539  186.338 1.00 0.00 ?  155 LYS B C    1  
ATOM 7063   O O    . LYS B 1 155 ? 18.587  -10.169 186.877 1.00 0.00 ?  155 LYS B O    1  
ATOM 7064   C CB   . LYS B 1 155 ? 18.508  -9.251  184.033 1.00 0.00 ?  155 LYS B CB   1  
ATOM 7065   C CG   . LYS B 1 155 ? 18.230  -9.356  182.527 1.00 0.00 ?  155 LYS B CG   1  
ATOM 7066   C CD   . LYS B 1 155 ? 18.095  -10.802 182.028 1.00 0.00 ?  155 LYS B CD   1  
ATOM 7067   C CE   . LYS B 1 155 ? 17.859  -10.874 180.518 1.00 0.00 ?  155 LYS B CE   1  
ATOM 7068   N NZ   . LYS B 1 155 ? 19.004  -10.284 179.788 1.00 0.00 1  155 LYS B NZ   1  
ATOM 7069   H H    . LYS B 1 155 ? 16.231  -8.056  184.350 1.00 0.00 ?  155 LYS B H    1  
ATOM 7070   H HA   . LYS B 1 155 ? 17.127  -10.780 184.712 1.00 0.00 ?  155 LYS B HA   1  
ATOM 7071   H HB2  . LYS B 1 155 ? 18.721  -8.193  184.286 1.00 0.00 ?  155 LYS B HB2  1  
ATOM 7072   H HB3  . LYS B 1 155 ? 19.409  -9.853  184.276 1.00 0.00 ?  155 LYS B HB3  1  
ATOM 7073   H HG2  . LYS B 1 155 ? 17.290  -8.810  182.297 1.00 0.00 ?  155 LYS B HG2  1  
ATOM 7074   H HG3  . LYS B 1 155 ? 19.055  -8.859  181.974 1.00 0.00 ?  155 LYS B HG3  1  
ATOM 7075   H HD2  . LYS B 1 155 ? 19.022  -11.361 182.277 1.00 0.00 ?  155 LYS B HD2  1  
ATOM 7076   H HD3  . LYS B 1 155 ? 17.247  -11.298 182.546 1.00 0.00 ?  155 LYS B HD3  1  
ATOM 7077   H HE2  . LYS B 1 155 ? 17.752  -11.929 180.190 1.00 0.00 ?  155 LYS B HE2  1  
ATOM 7078   H HE3  . LYS B 1 155 ? 16.945  -10.306 180.240 1.00 0.00 ?  155 LYS B HE3  1  
ATOM 7079   H HZ1  . LYS B 1 155 ? 19.230  -9.353  180.190 1.00 0.00 ?  155 LYS B HZ1  1  
ATOM 7080   H HZ2  . LYS B 1 155 ? 18.755  -10.177 178.784 1.00 0.00 ?  155 LYS B HZ2  1  
ATOM 7081   H HZ3  . LYS B 1 155 ? 19.830  -10.910 179.875 1.00 0.00 ?  155 LYS B HZ3  1  
ATOM 7082   N N    . ILE B 1 156 ? 16.927  -8.623  186.977 1.00 0.00 ?  156 ILE B N    1  
ATOM 7083   C CA   . ILE B 1 156 ? 17.130  -8.238  188.355 1.00 0.00 ?  156 ILE B CA   1  
ATOM 7084   C C    . ILE B 1 156 ? 17.083  -9.432  189.298 1.00 0.00 ?  156 ILE B C    1  
ATOM 7085   O O    . ILE B 1 156 ? 17.580  -9.339  190.425 1.00 0.00 ?  156 ILE B O    1  
ATOM 7086   C CB   . ILE B 1 156 ? 16.073  -7.250  188.784 1.00 0.00 ?  156 ILE B CB   1  
ATOM 7087   C CG1  . ILE B 1 156 ? 16.455  -6.540  190.091 1.00 0.00 ?  156 ILE B CG1  1  
ATOM 7088   C CG2  . ILE B 1 156 ? 14.742  -8.004  188.912 1.00 0.00 ?  156 ILE B CG2  1  
ATOM 7089   C CD1  . ILE B 1 156 ? 15.588  -5.311  190.364 1.00 0.00 ?  156 ILE B CD1  1  
ATOM 7090   H H    . ILE B 1 156 ? 16.177  -8.158  186.513 1.00 0.00 ?  156 ILE B H    1  
ATOM 7091   H HA   . ILE B 1 156 ? 18.104  -7.782  188.420 1.00 0.00 ?  156 ILE B HA   1  
ATOM 7092   H HB   . ILE B 1 156 ? 15.956  -6.479  187.990 1.00 0.00 ?  156 ILE B HB   1  
ATOM 7093   H HG12 . ILE B 1 156 ? 16.348  -7.255  190.932 1.00 0.00 ?  156 ILE B HG12 1  
ATOM 7094   H HG13 . ILE B 1 156 ? 17.512  -6.229  190.038 1.00 0.00 ?  156 ILE B HG13 1  
ATOM 7095   H HG21 . ILE B 1 156 ? 13.888  -7.312  188.756 1.00 0.00 ?  156 ILE B HG21 1  
ATOM 7096   H HG22 . ILE B 1 156 ? 14.654  -8.456  189.923 1.00 0.00 ?  156 ILE B HG22 1  
ATOM 7097   H HG23 . ILE B 1 156 ? 14.684  -8.815  188.155 1.00 0.00 ?  156 ILE B HG23 1  
ATOM 7098   H HD11 . ILE B 1 156 ? 15.782  -4.922  191.387 1.00 0.00 ?  156 ILE B HD11 1  
ATOM 7099   H HD12 . ILE B 1 156 ? 14.512  -5.572  190.281 1.00 0.00 ?  156 ILE B HD12 1  
ATOM 7100   H HD13 . ILE B 1 156 ? 15.816  -4.508  189.631 1.00 0.00 ?  156 ILE B HD13 1  
ATOM 7101   N N    . MET B 1 157 ? 16.490  -10.580 188.889 1.00 0.00 ?  157 MET B N    1  
ATOM 7102   C CA   . MET B 1 157 ? 16.408  -11.704 189.794 1.00 0.00 ?  157 MET B CA   1  
ATOM 7103   C C    . MET B 1 157 ? 17.790  -12.221 190.128 1.00 0.00 ?  157 MET B C    1  
ATOM 7104   O O    . MET B 1 157 ? 18.043  -12.559 191.285 1.00 0.00 ?  157 MET B O    1  
ATOM 7105   C CB   . MET B 1 157 ? 15.539  -12.868 189.257 1.00 0.00 ?  157 MET B CB   1  
ATOM 7106   C CG   . MET B 1 157 ? 16.044  -13.466 187.939 1.00 0.00 ?  157 MET B CG   1  
ATOM 7107   S SD   . MET B 1 157 ? 14.967  -14.788 187.308 1.00 0.00 ?  157 MET B SD   1  
ATOM 7108   C CE   . MET B 1 157 ? 15.996  -15.154 185.855 1.00 0.00 ?  157 MET B CE   1  
ATOM 7109   H H    . MET B 1 157 ? 16.097  -10.697 187.980 1.00 0.00 ?  157 MET B H    1  
ATOM 7110   H HA   . MET B 1 157 ? 15.968  -11.326 190.705 1.00 0.00 ?  157 MET B HA   1  
ATOM 7111   H HB2  . MET B 1 157 ? 15.505  -13.671 190.024 1.00 0.00 ?  157 MET B HB2  1  
ATOM 7112   H HB3  . MET B 1 157 ? 14.502  -12.499 189.106 1.00 0.00 ?  157 MET B HB3  1  
ATOM 7113   H HG2  . MET B 1 157 ? 16.118  -12.651 187.187 1.00 0.00 ?  157 MET B HG2  1  
ATOM 7114   H HG3  . MET B 1 157 ? 17.067  -13.866 188.100 1.00 0.00 ?  157 MET B HG3  1  
ATOM 7115   H HE1  . MET B 1 157 ? 15.622  -16.055 185.323 1.00 0.00 ?  157 MET B HE1  1  
ATOM 7116   H HE2  . MET B 1 157 ? 17.049  -15.343 186.153 1.00 0.00 ?  157 MET B HE2  1  
ATOM 7117   H HE3  . MET B 1 157 ? 15.988  -14.303 185.141 1.00 0.00 ?  157 MET B HE3  1  
ATOM 7118   N N    . PHE B 1 158 ? 18.718  -12.269 189.131 1.00 0.00 ?  158 PHE B N    1  
ATOM 7119   C CA   . PHE B 1 158 ? 20.079  -12.742 189.363 1.00 0.00 ?  158 PHE B CA   1  
ATOM 7120   C C    . PHE B 1 158 ? 20.053  -14.129 189.949 1.00 0.00 ?  158 PHE B C    1  
ATOM 7121   O O    . PHE B 1 158 ? 19.043  -14.831 189.916 1.00 0.00 ?  158 PHE B O    1  
ATOM 7122   C CB   . PHE B 1 158 ? 20.883  -11.852 190.329 1.00 0.00 ?  158 PHE B CB   1  
ATOM 7123   C CG   . PHE B 1 158 ? 22.344  -11.787 190.020 1.00 0.00 ?  158 PHE B CG   1  
ATOM 7124   C CD1  . PHE B 1 158 ? 23.267  -12.276 190.918 1.00 0.00 ?  158 PHE B CD1  1  
ATOM 7125   C CD2  . PHE B 1 158 ? 22.787  -11.244 188.833 1.00 0.00 ?  158 PHE B CD2  1  
ATOM 7126   C CE1  . PHE B 1 158 ? 24.612  -12.222 190.635 1.00 0.00 ?  158 PHE B CE1  1  
ATOM 7127   C CE2  . PHE B 1 158 ? 24.133  -11.190 188.551 1.00 0.00 ?  158 PHE B CE2  1  
ATOM 7128   C CZ   . PHE B 1 158 ? 25.044  -11.679 189.452 1.00 0.00 ?  158 PHE B CZ   1  
ATOM 7129   H H    . PHE B 1 158 ? 18.508  -11.983 188.199 1.00 0.00 ?  158 PHE B H    1  
ATOM 7130   H HA   . PHE B 1 158 ? 20.571  -12.780 188.404 1.00 0.00 ?  158 PHE B HA   1  
ATOM 7131   H HB2  . PHE B 1 158 ? 20.492  -10.823 190.303 1.00 0.00 ?  158 PHE B HB2  1  
ATOM 7132   H HB3  . PHE B 1 158 ? 20.781  -12.240 191.366 1.00 0.00 ?  158 PHE B HB3  1  
ATOM 7133   H HD1  . PHE B 1 158 ? 22.932  -12.704 191.851 1.00 0.00 ?  158 PHE B HD1  1  
ATOM 7134   H HD2  . PHE B 1 158 ? 22.075  -10.858 188.120 1.00 0.00 ?  158 PHE B HD2  1  
ATOM 7135   H HE1  . PHE B 1 158 ? 25.328  -12.609 191.345 1.00 0.00 ?  158 PHE B HE1  1  
ATOM 7136   H HE2  . PHE B 1 158 ? 24.472  -10.762 187.619 1.00 0.00 ?  158 PHE B HE2  1  
ATOM 7137   H HZ   . PHE B 1 158 ? 26.100  -11.638 189.230 1.00 0.00 ?  158 PHE B HZ   1  
ATOM 7138   N N    . ALA B 1 159 ? 21.218  -14.564 190.471 1.00 0.00 ?  159 ALA B N    1  
ATOM 7139   C CA   . ALA B 1 159 ? 21.309  -15.851 191.086 1.00 0.00 ?  159 ALA B CA   1  
ATOM 7140   C C    . ALA B 1 159 ? 22.541  -15.826 191.930 1.00 0.00 ?  159 ALA B C    1  
ATOM 7141   O O    . ALA B 1 159 ? 23.641  -15.591 191.433 1.00 0.00 ?  159 ALA B O    1  
ATOM 7142   C CB   . ALA B 1 159 ? 21.442  -17.006 190.079 1.00 0.00 ?  159 ALA B CB   1  
ATOM 7143   H H    . ALA B 1 159 ? 22.052  -14.017 190.453 1.00 0.00 ?  159 ALA B H    1  
ATOM 7144   H HA   . ALA B 1 159 ? 20.442  -15.986 191.713 1.00 0.00 ?  159 ALA B HA   1  
ATOM 7145   H HB1  . ALA B 1 159 ? 20.563  -17.028 189.400 1.00 0.00 ?  159 ALA B HB1  1  
ATOM 7146   H HB2  . ALA B 1 159 ? 21.503  -17.978 190.613 1.00 0.00 ?  159 ALA B HB2  1  
ATOM 7147   H HB3  . ALA B 1 159 ? 22.361  -16.879 189.467 1.00 0.00 ?  159 ALA B HB3  1  
ATOM 7148   N N    . ARG B 1 160 ? 22.382  -16.070 193.243 1.00 0.00 ?  160 ARG B N    1  
ATOM 7149   C CA   . ARG B 1 160 ? 23.522  -16.069 194.112 1.00 0.00 ?  160 ARG B CA   1  
ATOM 7150   C C    . ARG B 1 160 ? 23.112  -16.837 195.322 1.00 0.00 ?  160 ARG B C    1  
ATOM 7151   O O    . ARG B 1 160 ? 21.936  -16.895 195.651 1.00 0.00 ?  160 ARG B O    1  
ATOM 7152   C CB   . ARG B 1 160 ? 23.975  -14.661 194.542 1.00 0.00 ?  160 ARG B CB   1  
ATOM 7153   C CG   . ARG B 1 160 ? 25.502  -14.534 194.615 1.00 0.00 ?  160 ARG B CG   1  
ATOM 7154   C CD   . ARG B 1 160 ? 26.052  -14.645 196.039 1.00 0.00 ?  160 ARG B CD   1  
ATOM 7155   N NE   . ARG B 1 160 ? 27.530  -14.824 195.952 1.00 0.00 ?  160 ARG B NE   1  
ATOM 7156   C CZ   . ARG B 1 160 ? 28.352  -13.744 195.793 1.00 0.00 ?  160 ARG B CZ   1  
ATOM 7157   N NH1  . ARG B 1 160 ? 27.830  -12.485 195.730 1.00 0.00 1  160 ARG B NH1  1  
ATOM 7158   N NH2  . ARG B 1 160 ? 29.700  -13.926 195.696 1.00 0.00 ?  160 ARG B NH2  1  
ATOM 7159   H H    . ARG B 1 160 ? 21.496  -16.255 193.658 1.00 0.00 ?  160 ARG B H    1  
ATOM 7160   H HA   . ARG B 1 160 ? 24.321  -16.593 193.609 1.00 0.00 ?  160 ARG B HA   1  
ATOM 7161   H HB2  . ARG B 1 160 ? 23.581  -13.915 193.817 1.00 0.00 ?  160 ARG B HB2  1  
ATOM 7162   H HB3  . ARG B 1 160 ? 23.547  -14.430 195.540 1.00 0.00 ?  160 ARG B HB3  1  
ATOM 7163   H HG2  . ARG B 1 160 ? 25.960  -15.330 193.991 1.00 0.00 ?  160 ARG B HG2  1  
ATOM 7164   H HG3  . ARG B 1 160 ? 25.801  -13.553 194.187 1.00 0.00 ?  160 ARG B HG3  1  
ATOM 7165   H HD2  . ARG B 1 160 ? 25.838  -13.724 196.623 1.00 0.00 ?  160 ARG B HD2  1  
ATOM 7166   H HD3  . ARG B 1 160 ? 25.631  -15.525 196.560 1.00 0.00 ?  160 ARG B HD3  1  
ATOM 7167   H HE   . ARG B 1 160 ? 27.923  -15.742 196.004 1.00 0.00 ?  160 ARG B HE   1  
ATOM 7168   H HH11 . ARG B 1 160 ? 26.841  -12.350 195.802 1.00 0.00 ?  160 ARG B HH11 1  
ATOM 7169   H HH12 . ARG B 1 160 ? 28.435  -11.699 195.613 1.00 0.00 ?  160 ARG B HH12 1  
ATOM 7170   H HH21 . ARG B 1 160 ? 30.085  -14.849 195.741 1.00 0.00 ?  160 ARG B HH21 1  
ATOM 7171   H HH22 . ARG B 1 160 ? 30.304  -13.138 195.577 1.00 0.00 ?  160 ARG B HH22 1  
ATOM 7172   N N    . HIS B 1 161 ? 24.085  -17.416 196.043 1.00 0.00 ?  161 HIS B N    1  
ATOM 7173   C CA   . HIS B 1 161 ? 23.754  -18.196 197.200 1.00 0.00 ?  161 HIS B CA   1  
ATOM 7174   C C    . HIS B 1 161 ? 23.732  -17.287 198.387 1.00 0.00 ?  161 HIS B C    1  
ATOM 7175   O O    . HIS B 1 161 ? 24.536  -16.366 198.510 1.00 0.00 ?  161 HIS B O    1  
ATOM 7176   C CB   . HIS B 1 161 ? 24.763  -19.323 197.456 1.00 0.00 ?  161 HIS B CB   1  
ATOM 7177   C CG   . HIS B 1 161 ? 24.424  -20.585 196.718 1.00 0.00 ?  161 HIS B CG   1  
ATOM 7178   N ND1  . HIS B 1 161 ? 24.044  -20.527 195.386 1.00 0.00 ?  161 HIS B ND1  1  
ATOM 7179   C CD2  . HIS B 1 161 ? 24.425  -21.876 197.155 1.00 0.00 ?  161 HIS B CD2  1  
ATOM 7180   C CE1  . HIS B 1 161 ? 23.819  -21.783 195.049 1.00 0.00 ?  161 HIS B CE1  1  
ATOM 7181   N NE2  . HIS B 1 161 ? 24.032  -22.637 196.079 1.00 0.00 ?  161 HIS B NE2  1  
ATOM 7182   H H    . HIS B 1 161 ? 25.050  -17.342 195.809 1.00 0.00 ?  161 HIS B H    1  
ATOM 7183   H HA   . HIS B 1 161 ? 22.769  -18.609 197.052 1.00 0.00 ?  161 HIS B HA   1  
ATOM 7184   H HB2  . HIS B 1 161 ? 25.776  -19.002 197.133 1.00 0.00 ?  161 HIS B HB2  1  
ATOM 7185   H HB3  . HIS B 1 161 ? 24.794  -19.560 198.540 1.00 0.00 ?  161 HIS B HB3  1  
ATOM 7186   H HD2  . HIS B 1 161 ? 24.692  -22.285 198.121 1.00 0.00 ?  161 HIS B HD2  1  
ATOM 7187   H HE1  . HIS B 1 161 ? 23.497  -22.120 194.064 1.00 0.00 ?  161 HIS B HE1  1  
ATOM 7188   H HE2  . HIS B 1 161 ? 23.923  -23.633 196.074 1.00 0.00 ?  161 HIS B HE2  1  
ATOM 7189   N N    . ALA B 1 162 ? 22.769  -17.547 199.297 1.00 0.00 ?  162 ALA B N    1  
ATOM 7190   C CA   . ALA B 1 162 ? 22.620  -16.741 200.478 1.00 0.00 ?  162 ALA B CA   1  
ATOM 7191   C C    . ALA B 1 162 ? 23.802  -16.997 201.351 1.00 0.00 ?  162 ALA B C    1  
ATOM 7192   O O    . ALA B 1 162 ? 24.419  -18.050 201.272 1.00 0.00 ?  162 ALA B O    1  
ATOM 7193   C CB   . ALA B 1 162 ? 21.351  -17.068 201.282 1.00 0.00 ?  162 ALA B CB   1  
ATOM 7194   H H    . ALA B 1 162 ? 22.130  -18.307 199.195 1.00 0.00 ?  162 ALA B H    1  
ATOM 7195   H HA   . ALA B 1 162 ? 22.617  -15.708 200.173 1.00 0.00 ?  162 ALA B HA   1  
ATOM 7196   H HB1  . ALA B 1 162 ? 21.504  -17.986 201.887 1.00 0.00 ?  162 ALA B HB1  1  
ATOM 7197   H HB2  . ALA B 1 162 ? 20.492  -17.234 200.597 1.00 0.00 ?  162 ALA B HB2  1  
ATOM 7198   H HB3  . ALA B 1 162 ? 21.102  -16.229 201.966 1.00 0.00 ?  162 ALA B HB3  1  
ATOM 7199   N N    . ILE B 1 163 ? 24.155  -15.997 202.190 1.00 0.00 ?  163 ILE B N    1  
ATOM 7200   C CA   . ILE B 1 163 ? 25.285  -16.128 203.078 1.00 0.00 ?  163 ILE B CA   1  
ATOM 7201   C C    . ILE B 1 163 ? 24.827  -15.785 204.462 1.00 0.00 ?  163 ILE B C    1  
ATOM 7202   O O    . ILE B 1 163 ? 24.254  -14.727 204.654 1.00 0.00 ?  163 ILE B O    1  
ATOM 7203   C CB   . ILE B 1 163 ? 26.379  -15.164 202.735 1.00 0.00 ?  163 ILE B CB   1  
ATOM 7204   C CG1  . ILE B 1 163 ? 26.717  -15.251 201.235 1.00 0.00 ?  163 ILE B CG1  1  
ATOM 7205   C CG2  . ILE B 1 163 ? 27.584  -15.469 203.636 1.00 0.00 ?  163 ILE B CG2  1  
ATOM 7206   C CD1  . ILE B 1 163 ? 25.971  -14.207 200.405 1.00 0.00 ?  163 ILE B CD1  1  
ATOM 7207   H H    . ILE B 1 163 ? 23.658  -15.131 202.228 1.00 0.00 ?  163 ILE B H    1  
ATOM 7208   H HA   . ILE B 1 163 ? 25.642  -17.144 203.051 1.00 0.00 ?  163 ILE B HA   1  
ATOM 7209   H HB   . ILE B 1 163 ? 26.033  -14.130 202.955 1.00 0.00 ?  163 ILE B HB   1  
ATOM 7210   H HG12 . ILE B 1 163 ? 27.807  -15.105 201.102 1.00 0.00 ?  163 ILE B HG12 1  
ATOM 7211   H HG13 . ILE B 1 163 ? 26.456  -16.263 200.861 1.00 0.00 ?  163 ILE B HG13 1  
ATOM 7212   H HG21 . ILE B 1 163 ? 27.786  -16.562 203.652 1.00 0.00 ?  163 ILE B HG21 1  
ATOM 7213   H HG22 . ILE B 1 163 ? 27.385  -15.130 204.675 1.00 0.00 ?  163 ILE B HG22 1  
ATOM 7214   H HG23 . ILE B 1 163 ? 28.488  -14.947 203.260 1.00 0.00 ?  163 ILE B HG23 1  
ATOM 7215   H HD11 . ILE B 1 163 ? 24.915  -14.519 200.252 1.00 0.00 ?  163 ILE B HD11 1  
ATOM 7216   H HD12 . ILE B 1 163 ? 26.452  -14.088 199.410 1.00 0.00 ?  163 ILE B HD12 1  
ATOM 7217   H HD13 . ILE B 1 163 ? 25.979  -13.224 200.922 1.00 0.00 ?  163 ILE B HD13 1  
ATOM 7218   N N    . VAL B 1 164 ? 25.087  -16.669 205.466 1.00 0.00 ?  164 VAL B N    1  
ATOM 7219   C CA   . VAL B 1 164 ? 24.696  -16.364 206.831 1.00 0.00 ?  164 VAL B CA   1  
ATOM 7220   C C    . VAL B 1 164 ? 25.961  -16.021 207.564 1.00 0.00 ?  164 VAL B C    1  
ATOM 7221   O O    . VAL B 1 164 ? 26.747  -16.892 207.939 1.00 0.00 ?  164 VAL B O    1  
ATOM 7222   C CB   . VAL B 1 164 ? 23.978  -17.491 207.544 1.00 0.00 ?  164 VAL B CB   1  
ATOM 7223   C CG1  . VAL B 1 164 ? 24.642  -18.840 207.202 1.00 0.00 ?  164 VAL B CG1  1  
ATOM 7224   C CG2  . VAL B 1 164 ? 23.988  -17.193 209.054 1.00 0.00 ?  164 VAL B CG2  1  
ATOM 7225   H H    . VAL B 1 164 ? 25.544  -17.545 205.312 1.00 0.00 ?  164 VAL B H    1  
ATOM 7226   H HA   . VAL B 1 164 ? 24.070  -15.485 206.808 1.00 0.00 ?  164 VAL B HA   1  
ATOM 7227   H HB   . VAL B 1 164 ? 22.922  -17.527 207.206 1.00 0.00 ?  164 VAL B HB   1  
ATOM 7228   H HG11 . VAL B 1 164 ? 24.655  -19.499 208.096 1.00 0.00 ?  164 VAL B HG11 1  
ATOM 7229   H HG12 . VAL B 1 164 ? 25.685  -18.689 206.862 1.00 0.00 ?  164 VAL B HG12 1  
ATOM 7230   H HG13 . VAL B 1 164 ? 24.078  -19.352 206.396 1.00 0.00 ?  164 VAL B HG13 1  
ATOM 7231   H HG21 . VAL B 1 164 ? 23.162  -17.737 209.560 1.00 0.00 ?  164 VAL B HG21 1  
ATOM 7232   H HG22 . VAL B 1 164 ? 23.859  -16.105 209.234 1.00 0.00 ?  164 VAL B HG22 1  
ATOM 7233   H HG23 . VAL B 1 164 ? 24.951  -17.515 209.506 1.00 0.00 ?  164 VAL B HG23 1  
ATOM 7234   N N    . ARG B 1 165 ? 26.172  -14.700 207.778 1.00 0.00 ?  165 ARG B N    1  
ATOM 7235   C CA   . ARG B 1 165 ? 27.369  -14.228 208.426 1.00 0.00 ?  165 ARG B CA   1  
ATOM 7236   C C    . ARG B 1 165 ? 26.970  -13.315 209.563 1.00 0.00 ?  165 ARG B C    1  
ATOM 7237   O O    . ARG B 1 165 ? 25.869  -12.773 209.567 1.00 0.00 ?  165 ARG B O    1  
ATOM 7238   C CB   . ARG B 1 165 ? 28.252  -13.447 207.428 1.00 0.00 ?  165 ARG B CB   1  
ATOM 7239   C CG   . ARG B 1 165 ? 27.496  -12.287 206.772 1.00 0.00 ?  165 ARG B CG   1  
ATOM 7240   C CD   . ARG B 1 165 ? 28.351  -11.504 205.773 1.00 0.00 ?  165 ARG B CD   1  
ATOM 7241   N NE   . ARG B 1 165 ? 29.400  -10.753 206.516 1.00 0.00 ?  165 ARG B NE   1  
ATOM 7242   C CZ   . ARG B 1 165 ? 30.333  -10.033 205.827 1.00 0.00 ?  165 ARG B CZ   1  
ATOM 7243   N NH1  . ARG B 1 165 ? 30.310  -10.019 204.461 1.00 0.00 1  165 ARG B NH1  1  
ATOM 7244   N NH2  . ARG B 1 165 ? 31.290  -9.334  206.501 1.00 0.00 ?  165 ARG B NH2  1  
ATOM 7245   H H    . ARG B 1 165 ? 25.510  -14.005 207.510 1.00 0.00 ?  165 ARG B H    1  
ATOM 7246   H HA   . ARG B 1 165 ? 27.887  -15.082 208.803 1.00 0.00 ?  165 ARG B HA   1  
ATOM 7247   H HB2  . ARG B 1 165 ? 29.142  -13.049 207.961 1.00 0.00 ?  165 ARG B HB2  1  
ATOM 7248   H HB3  . ARG B 1 165 ? 28.605  -14.140 206.635 1.00 0.00 ?  165 ARG B HB3  1  
ATOM 7249   H HG2  . ARG B 1 165 ? 26.604  -12.689 206.246 1.00 0.00 ?  165 ARG B HG2  1  
ATOM 7250   H HG3  . ARG B 1 165 ? 27.140  -11.594 207.564 1.00 0.00 ?  165 ARG B HG3  1  
ATOM 7251   H HD2  . ARG B 1 165 ? 28.856  -12.194 205.061 1.00 0.00 ?  165 ARG B HD2  1  
ATOM 7252   H HD3  . ARG B 1 165 ? 27.734  -10.772 205.211 1.00 0.00 ?  165 ARG B HD3  1  
ATOM 7253   H HE   . ARG B 1 165 ? 29.418  -10.773 207.515 1.00 0.00 ?  165 ARG B HE   1  
ATOM 7254   H HH11 . ARG B 1 165 ? 29.610  -10.535 203.967 1.00 0.00 ?  165 ARG B HH11 1  
ATOM 7255   H HH12 . ARG B 1 165 ? 30.996  -9.494  203.956 1.00 0.00 ?  165 ARG B HH12 1  
ATOM 7256   H HH21 . ARG B 1 165 ? 31.309  -9.347  207.500 1.00 0.00 ?  165 ARG B HH21 1  
ATOM 7257   H HH22 . ARG B 1 165 ? 31.974  -8.807  205.995 1.00 0.00 ?  165 ARG B HH22 1  
ATOM 7258   N N    . PRO B 1 166 ? 27.828  -13.156 210.567 1.00 0.00 ?  166 PRO B N    1  
ATOM 7259   C CA   . PRO B 1 166 ? 27.527  -12.267 211.667 1.00 0.00 ?  166 PRO B CA   1  
ATOM 7260   C C    . PRO B 1 166 ? 27.767  -10.836 211.311 1.00 0.00 ?  166 PRO B C    1  
ATOM 7261   O O    . PRO B 1 166 ? 28.700  -10.519 210.574 1.00 0.00 ?  166 PRO B O    1  
ATOM 7262   C CB   . PRO B 1 166 ? 28.474  -12.712 212.775 1.00 0.00 ?  166 PRO B CB   1  
ATOM 7263   C CG   . PRO B 1 166 ? 29.703  -13.193 212.016 1.00 0.00 ?  166 PRO B CG   1  
ATOM 7264   C CD   . PRO B 1 166 ? 29.148  -13.800 210.726 1.00 0.00 ?  166 PRO B CD   1  
ATOM 7265   H HA   . PRO B 1 166 ? 26.506  -12.386 211.998 1.00 0.00 ?  166 PRO B HA   1  
ATOM 7266   H HB2  . PRO B 1 166 ? 28.727  -11.861 213.443 1.00 0.00 ?  166 PRO B HB2  1  
ATOM 7267   H HB3  . PRO B 1 166 ? 28.031  -13.539 213.367 1.00 0.00 ?  166 PRO B HB3  1  
ATOM 7268   H HG2  . PRO B 1 166 ? 30.381  -12.340 211.793 1.00 0.00 ?  166 PRO B HG2  1  
ATOM 7269   H HG3  . PRO B 1 166 ? 30.251  -13.958 212.605 1.00 0.00 ?  166 PRO B HG3  1  
ATOM 7270   H HD2  . PRO B 1 166 ? 29.816  -13.567 209.870 1.00 0.00 ?  166 PRO B HD2  1  
ATOM 7271   H HD3  . PRO B 1 166 ? 29.049  -14.902 210.826 1.00 0.00 ?  166 PRO B HD3  1  
ATOM 7272   N N    . PHE B 1 167 ? 26.923  -9.935  211.838 1.00 0.00 ?  167 PHE B N    1  
ATOM 7273   C CA   . PHE B 1 167 ? 27.082  -8.539  211.573 1.00 0.00 ?  167 PHE B CA   1  
ATOM 7274   C C    . PHE B 1 167 ? 26.600  -7.807  212.780 1.00 0.00 ?  167 PHE B C    1  
ATOM 7275   O O    . PHE B 1 167 ? 25.518  -8.090  213.293 1.00 0.00 ?  167 PHE B O    1  
ATOM 7276   C CB   . PHE B 1 167 ? 26.272  -8.023  210.371 1.00 0.00 ?  167 PHE B CB   1  
ATOM 7277   C CG   . PHE B 1 167 ? 27.070  -7.873  209.121 1.00 0.00 ?  167 PHE B CG   1  
ATOM 7278   C CD1  . PHE B 1 167 ? 26.686  -8.517  207.965 1.00 0.00 ?  167 PHE B CD1  1  
ATOM 7279   C CD2  . PHE B 1 167 ? 28.202  -7.085  209.103 1.00 0.00 ?  167 PHE B CD2  1  
ATOM 7280   C CE1  . PHE B 1 167 ? 27.419  -8.374  206.813 1.00 0.00 ?  167 PHE B CE1  1  
ATOM 7281   C CE2  . PHE B 1 167 ? 28.935  -6.947  207.948 1.00 0.00 ?  167 PHE B CE2  1  
ATOM 7282   C CZ   . PHE B 1 167 ? 28.543  -7.591  206.804 1.00 0.00 ?  167 PHE B CZ   1  
ATOM 7283   H H    . PHE B 1 167 ? 26.162  -10.193 212.428 1.00 0.00 ?  167 PHE B H    1  
ATOM 7284   H HA   . PHE B 1 167 ? 28.134  -8.344  211.434 1.00 0.00 ?  167 PHE B HA   1  
ATOM 7285   H HB2  . PHE B 1 167 ? 25.443  -8.726  210.147 1.00 0.00 ?  167 PHE B HB2  1  
ATOM 7286   H HB3  . PHE B 1 167 ? 25.838  -7.028  210.611 1.00 0.00 ?  167 PHE B HB3  1  
ATOM 7287   H HD1  . PHE B 1 167 ? 25.802  -9.135  207.965 1.00 0.00 ?  167 PHE B HD1  1  
ATOM 7288   H HD2  . PHE B 1 167 ? 28.516  -6.574  210.001 1.00 0.00 ?  167 PHE B HD2  1  
ATOM 7289   H HE1  . PHE B 1 167 ? 27.109  -8.881  205.913 1.00 0.00 ?  167 PHE B HE1  1  
ATOM 7290   H HE2  . PHE B 1 167 ? 29.820  -6.333  207.942 1.00 0.00 ?  167 PHE B HE2  1  
ATOM 7291   H HZ   . PHE B 1 167 ? 29.118  -7.480  205.897 1.00 0.00 ?  167 PHE B HZ   1  
ATOM 7292   N N    . ASN B 1 168 ? 27.419  -6.837  213.246 1.00 0.00 ?  168 ASN B N    1  
ATOM 7293   C CA   . ASN B 1 168 ? 27.082  -6.025  214.391 1.00 0.00 ?  168 ASN B CA   1  
ATOM 7294   C C    . ASN B 1 168 ? 26.884  -6.911  215.592 1.00 0.00 ?  168 ASN B C    1  
ATOM 7295   O O    . ASN B 1 168 ? 26.102  -6.587  216.483 1.00 0.00 ?  168 ASN B O    1  
ATOM 7296   C CB   . ASN B 1 168 ? 25.799  -5.193  214.193 1.00 0.00 ?  168 ASN B CB   1  
ATOM 7297   C CG   . ASN B 1 168 ? 25.731  -3.997  215.135 1.00 0.00 ?  168 ASN B CG   1  
ATOM 7298   O OD1  . ASN B 1 168 ? 26.738  -3.348  215.411 1.00 0.00 ?  168 ASN B OD1  1  
ATOM 7299   N ND2  . ASN B 1 168 ? 24.506  -3.698  215.646 1.00 0.00 ?  168 ASN B ND2  1  
ATOM 7300   H H    . ASN B 1 168 ? 28.297  -6.639  212.816 1.00 0.00 ?  168 ASN B H    1  
ATOM 7301   H HA   . ASN B 1 168 ? 27.920  -5.370  214.577 1.00 0.00 ?  168 ASN B HA   1  
ATOM 7302   H HB2  . ASN B 1 168 ? 25.755  -4.826  213.146 1.00 0.00 ?  168 ASN B HB2  1  
ATOM 7303   H HB3  . ASN B 1 168 ? 24.912  -5.837  214.372 1.00 0.00 ?  168 ASN B HB3  1  
ATOM 7304   H HD21 . ASN B 1 168 ? 23.711  -4.253  215.397 1.00 0.00 ?  168 ASN B HD21 1  
ATOM 7305   H HD22 . ASN B 1 168 ? 24.400  -2.924  216.269 1.00 0.00 ?  168 ASN B HD22 1  
ATOM 7306   N N    . GLY B 1 169 ? 27.600  -8.054  215.645 1.00 0.00 ?  169 GLY B N    1  
ATOM 7307   C CA   . GLY B 1 169 ? 27.501  -8.928  216.788 1.00 0.00 ?  169 GLY B CA   1  
ATOM 7308   C C    . GLY B 1 169 ? 26.175  -9.629  216.783 1.00 0.00 ?  169 GLY B C    1  
ATOM 7309   O O    . GLY B 1 169 ? 25.742  -10.125 217.818 1.00 0.00 ?  169 GLY B O    1  
ATOM 7310   H H    . GLY B 1 169 ? 28.216  -8.340  214.915 1.00 0.00 ?  169 GLY B H    1  
ATOM 7311   H HA2  . GLY B 1 169 ? 28.283  -9.665  216.699 1.00 0.00 ?  169 GLY B HA2  1  
ATOM 7312   H HA3  . GLY B 1 169 ? 27.569  -8.310  217.672 1.00 0.00 ?  169 GLY B HA3  1  
ATOM 7313   N N    . ARG B 1 170 ? 25.506  -9.696  215.615 1.00 0.00 ?  170 ARG B N    1  
ATOM 7314   C CA   . ARG B 1 170 ? 24.212  -10.336 215.533 1.00 0.00 ?  170 ARG B CA   1  
ATOM 7315   C C    . ARG B 1 170 ? 24.257  -11.212 214.314 1.00 0.00 ?  170 ARG B C    1  
ATOM 7316   O O    . ARG B 1 170 ? 24.780  -10.806 213.293 1.00 0.00 ?  170 ARG B O    1  
ATOM 7317   C CB   . ARG B 1 170 ? 23.100  -9.283  215.365 1.00 0.00 ?  170 ARG B CB   1  
ATOM 7318   C CG   . ARG B 1 170 ? 22.974  -8.385  216.606 1.00 0.00 ?  170 ARG B CG   1  
ATOM 7319   C CD   . ARG B 1 170 ? 22.257  -7.059  216.322 1.00 0.00 ?  170 ARG B CD   1  
ATOM 7320   N NE   . ARG B 1 170 ? 20.867  -7.321  215.858 1.00 0.00 ?  170 ARG B NE   1  
ATOM 7321   C CZ   . ARG B 1 170 ? 19.860  -7.515  216.757 1.00 0.00 ?  170 ARG B CZ   1  
ATOM 7322   N NH1  . ARG B 1 170 ? 20.129  -7.569  218.095 1.00 0.00 1  170 ARG B NH1  1  
ATOM 7323   N NH2  . ARG B 1 170 ? 18.580  -7.663  216.310 1.00 0.00 ?  170 ARG B NH2  1  
ATOM 7324   H H    . ARG B 1 170 ? 25.869  -9.316  214.768 1.00 0.00 ?  170 ARG B H    1  
ATOM 7325   H HA   . ARG B 1 170 ? 24.054  -10.938 216.413 1.00 0.00 ?  170 ARG B HA   1  
ATOM 7326   H HB2  . ARG B 1 170 ? 23.326  -8.653  214.477 1.00 0.00 ?  170 ARG B HB2  1  
ATOM 7327   H HB3  . ARG B 1 170 ? 22.132  -9.797  215.190 1.00 0.00 ?  170 ARG B HB3  1  
ATOM 7328   H HG2  . ARG B 1 170 ? 22.414  -8.934  217.392 1.00 0.00 ?  170 ARG B HG2  1  
ATOM 7329   H HG3  . ARG B 1 170 ? 23.988  -8.169  217.000 1.00 0.00 ?  170 ARG B HG3  1  
ATOM 7330   H HD2  . ARG B 1 170 ? 22.205  -6.437  217.241 1.00 0.00 ?  170 ARG B HD2  1  
ATOM 7331   H HD3  . ARG B 1 170 ? 22.783  -6.496  215.523 1.00 0.00 ?  170 ARG B HD3  1  
ATOM 7332   H HE   . ARG B 1 170 ? 20.664  -7.319  214.879 1.00 0.00 ?  170 ARG B HE   1  
ATOM 7333   H HH11 . ARG B 1 170 ? 21.069  -7.467  218.420 1.00 0.00 ?  170 ARG B HH11 1  
ATOM 7334   H HH12 . ARG B 1 170 ? 19.386  -7.711  218.749 1.00 0.00 ?  170 ARG B HH12 1  
ATOM 7335   H HH21 . ARG B 1 170 ? 18.389  -7.631  215.329 1.00 0.00 ?  170 ARG B HH21 1  
ATOM 7336   H HH22 . ARG B 1 170 ? 17.830  -7.793  216.960 1.00 0.00 ?  170 ARG B HH22 1  
ATOM 7337   N N    . MET B 1 171 ? 23.682  -12.437 214.367 1.00 0.00 ?  171 MET B N    1  
ATOM 7338   C CA   . MET B 1 171 ? 23.756  -13.290 213.200 1.00 0.00 ?  171 MET B CA   1  
ATOM 7339   C C    . MET B 1 171 ? 22.810  -12.745 212.172 1.00 0.00 ?  171 MET B C    1  
ATOM 7340   O O    . MET B 1 171 ? 21.679  -12.377 212.490 1.00 0.00 ?  171 MET B O    1  
ATOM 7341   C CB   . MET B 1 171 ? 23.387  -14.756 213.480 1.00 0.00 ?  171 MET B CB   1  
ATOM 7342   C CG   . MET B 1 171 ? 24.324  -15.410 214.497 1.00 0.00 ?  171 MET B CG   1  
ATOM 7343   S SD   . MET B 1 171 ? 26.052  -15.462 213.935 1.00 0.00 ?  171 MET B SD   1  
ATOM 7344   C CE   . MET B 1 171 ? 26.695  -16.207 215.461 1.00 0.00 ?  171 MET B CE   1  
ATOM 7345   H H    . MET B 1 171 ? 23.209  -12.793 215.173 1.00 0.00 ?  171 MET B H    1  
ATOM 7346   H HA   . MET B 1 171 ? 24.763  -13.224 212.817 1.00 0.00 ?  171 MET B HA   1  
ATOM 7347   H HB2  . MET B 1 171 ? 22.350  -14.800 213.865 1.00 0.00 ?  171 MET B HB2  1  
ATOM 7348   H HB3  . MET B 1 171 ? 23.429  -15.330 212.531 1.00 0.00 ?  171 MET B HB3  1  
ATOM 7349   H HG2  . MET B 1 171 ? 24.257  -14.846 215.452 1.00 0.00 ?  171 MET B HG2  1  
ATOM 7350   H HG3  . MET B 1 171 ? 23.966  -16.443 214.693 1.00 0.00 ?  171 MET B HG3  1  
ATOM 7351   H HE1  . MET B 1 171 ? 26.993  -15.423 216.190 1.00 0.00 ?  171 MET B HE1  1  
ATOM 7352   H HE2  . MET B 1 171 ? 27.585  -16.836 215.250 1.00 0.00 ?  171 MET B HE2  1  
ATOM 7353   H HE3  . MET B 1 171 ? 25.927  -16.850 215.942 1.00 0.00 ?  171 MET B HE3  1  
ATOM 7354   N N    . THR B 1 172 ? 23.275  -12.684 210.888 1.00 0.00 ?  172 THR B N    1  
ATOM 7355   C CA   . THR B 1 172 ? 22.458  -12.144 209.825 1.00 0.00 ?  172 THR B CA   1  
ATOM 7356   C C    . THR B 1 172 ? 22.630  -12.976 208.573 1.00 0.00 ?  172 THR B C    1  
ATOM 7357   O O    . THR B 1 172 ? 23.509  -13.829 208.488 1.00 0.00 ?  172 THR B O    1  
ATOM 7358   C CB   . THR B 1 172 ? 22.827  -10.736 209.473 1.00 0.00 ?  172 THR B CB   1  
ATOM 7359   O OG1  . THR B 1 172 ? 24.145  -10.697 208.949 1.00 0.00 ?  172 THR B OG1  1  
ATOM 7360   C CG2  . THR B 1 172 ? 22.724  -9.857  210.730 1.00 0.00 ?  172 THR B CG2  1  
ATOM 7361   H H    . THR B 1 172 ? 24.186  -12.994 210.632 1.00 0.00 ?  172 THR B H    1  
ATOM 7362   H HA   . THR B 1 172 ? 21.427  -12.193 210.139 1.00 0.00 ?  172 THR B HA   1  
ATOM 7363   H HB   . THR B 1 172 ? 22.127  -10.349 208.714 1.00 0.00 ?  172 THR B HB   1  
ATOM 7364   H HG1  . THR B 1 172 ? 24.052  -10.746 207.995 1.00 0.00 ?  172 THR B HG1  1  
ATOM 7365   H HG21 . THR B 1 172 ? 21.911  -10.224 211.392 1.00 0.00 ?  172 THR B HG21 1  
ATOM 7366   H HG22 . THR B 1 172 ? 22.503  -8.805  210.448 1.00 0.00 ?  172 THR B HG22 1  
ATOM 7367   H HG23 . THR B 1 172 ? 23.680  -9.879  211.295 1.00 0.00 ?  172 THR B HG23 1  
ATOM 7368   N N    . LEU B 1 173 ? 21.758  -12.700 207.559 1.00 0.00 ?  173 LEU B N    1  
ATOM 7369   C CA   . LEU B 1 173 ? 21.785  -13.402 206.281 1.00 0.00 ?  173 LEU B CA   1  
ATOM 7370   C C    . LEU B 1 173 ? 21.862  -12.326 205.227 1.00 0.00 ?  173 LEU B C    1  
ATOM 7371   O O    . LEU B 1 173 ? 21.265  -11.290 205.412 1.00 0.00 ?  173 LEU B O    1  
ATOM 7372   C CB   . LEU B 1 173 ? 20.505  -14.213 206.026 1.00 0.00 ?  173 LEU B CB   1  
ATOM 7373   C CG   . LEU B 1 173 ? 20.479  -14.984 204.691 1.00 0.00 ?  173 LEU B CG   1  
ATOM 7374   C CD1  . LEU B 1 173 ? 21.566  -16.067 204.624 1.00 0.00 ?  173 LEU B CD1  1  
ATOM 7375   C CD2  . LEU B 1 173 ? 19.088  -15.582 204.428 1.00 0.00 ?  173 LEU B CD2  1  
ATOM 7376   H H    . LEU B 1 173 ? 21.056  -11.997 207.652 1.00 0.00 ?  173 LEU B H    1  
ATOM 7377   H HA   . LEU B 1 173 ? 22.661  -14.024 206.248 1.00 0.00 ?  173 LEU B HA   1  
ATOM 7378   H HB2  . LEU B 1 173 ? 20.370  -14.936 206.860 1.00 0.00 ?  173 LEU B HB2  1  
ATOM 7379   H HB3  . LEU B 1 173 ? 19.643  -13.515 206.041 1.00 0.00 ?  173 LEU B HB3  1  
ATOM 7380   H HG   . LEU B 1 173 ? 20.684  -14.256 203.878 1.00 0.00 ?  173 LEU B HG   1  
ATOM 7381   H HD11 . LEU B 1 173 ? 21.109  -17.057 204.413 1.00 0.00 ?  173 LEU B HD11 1  
ATOM 7382   H HD12 . LEU B 1 173 ? 22.119  -16.133 205.584 1.00 0.00 ?  173 LEU B HD12 1  
ATOM 7383   H HD13 . LEU B 1 173 ? 22.282  -15.834 203.815 1.00 0.00 ?  173 LEU B HD13 1  
ATOM 7384   H HD21 . LEU B 1 173 ? 18.793  -16.254 205.262 1.00 0.00 ?  173 LEU B HD21 1  
ATOM 7385   H HD22 . LEU B 1 173 ? 19.092  -16.167 203.485 1.00 0.00 ?  173 LEU B HD22 1  
ATOM 7386   H HD23 . LEU B 1 173 ? 18.331  -14.774 204.341 1.00 0.00 ?  173 LEU B HD23 1  
ATOM 7387   N N    . MET B 1 174 ? 22.598  -12.547 204.091 1.00 0.00 ?  174 MET B N    1  
ATOM 7388   C CA   . MET B 1 174 ? 22.739  -11.505 203.071 1.00 0.00 ?  174 MET B CA   1  
ATOM 7389   C C    . MET B 1 174 ? 22.447  -12.072 201.687 1.00 0.00 ?  174 MET B C    1  
ATOM 7390   O O    . MET B 1 174 ? 22.768  -13.224 201.394 1.00 0.00 ?  174 MET B O    1  
ATOM 7391   C CB   . MET B 1 174 ? 24.162  -10.904 203.053 1.00 0.00 ?  174 MET B CB   1  
ATOM 7392   C CG   . MET B 1 174 ? 24.341  -9.773  202.031 1.00 0.00 ?  174 MET B CG   1  
ATOM 7393   S SD   . MET B 1 174 ? 26.009  -9.048  202.056 1.00 0.00 ?  174 MET B SD   1  
ATOM 7394   C CE   . MET B 1 174 ? 25.766  -8.135  203.606 1.00 0.00 ?  174 MET B CE   1  
ATOM 7395   H H    . MET B 1 174 ? 23.071  -13.404 203.921 1.00 0.00 ?  174 MET B H    1  
ATOM 7396   H HA   . MET B 1 174 ? 22.021  -10.737 203.285 1.00 0.00 ?  174 MET B HA   1  
ATOM 7397   H HB2  . MET B 1 174 ? 24.397  -10.514 204.067 1.00 0.00 ?  174 MET B HB2  1  
ATOM 7398   H HB3  . MET B 1 174 ? 24.890  -11.711 202.824 1.00 0.00 ?  174 MET B HB3  1  
ATOM 7399   H HG2  . MET B 1 174 ? 24.125  -10.172 201.017 1.00 0.00 ?  174 MET B HG2  1  
ATOM 7400   H HG3  . MET B 1 174 ? 23.591  -8.983  202.245 1.00 0.00 ?  174 MET B HG3  1  
ATOM 7401   H HE1  . MET B 1 174 ? 25.566  -8.829  204.449 1.00 0.00 ?  174 MET B HE1  1  
ATOM 7402   H HE2  . MET B 1 174 ? 24.907  -7.437  203.525 1.00 0.00 ?  174 MET B HE2  1  
ATOM 7403   H HE3  . MET B 1 174 ? 26.669  -7.538  203.859 1.00 0.00 ?  174 MET B HE3  1  
ATOM 7404   N N    . VAL B 1 175 ? 21.792  -11.227 200.810 1.00 0.00 ?  175 VAL B N    1  
ATOM 7405   C CA   . VAL B 1 175 ? 21.449  -11.626 199.443 1.00 0.00 ?  175 VAL B CA   1  
ATOM 7406   C C    . VAL B 1 175 ? 21.930  -10.551 198.460 1.00 0.00 ?  175 VAL B C    1  
ATOM 7407   O O    . VAL B 1 175 ? 21.755  -9.358  198.709 1.00 0.00 ?  175 VAL B O    1  
ATOM 7408   C CB   . VAL B 1 175 ? 19.969  -11.795 199.247 1.00 0.00 ?  175 VAL B CB   1  
ATOM 7409   C CG1  . VAL B 1 175 ? 19.711  -12.180 197.780 1.00 0.00 ?  175 VAL B CG1  1  
ATOM 7410   C CG2  . VAL B 1 175 ? 19.473  -12.861 200.237 1.00 0.00 ?  175 VAL B CG2  1  
ATOM 7411   H H    . VAL B 1 175 ? 21.513  -10.308 201.079 1.00 0.00 ?  175 VAL B H    1  
ATOM 7412   H HA   . VAL B 1 175 ? 21.965  -12.551 199.233 1.00 0.00 ?  175 VAL B HA   1  
ATOM 7413   H HB   . VAL B 1 175 ? 19.449  -10.839 199.464 1.00 0.00 ?  175 VAL B HB   1  
ATOM 7414   H HG11 . VAL B 1 175 ? 19.705  -11.272 197.139 1.00 0.00 ?  175 VAL B HG11 1  
ATOM 7415   H HG12 . VAL B 1 175 ? 18.727  -12.688 197.682 1.00 0.00 ?  175 VAL B HG12 1  
ATOM 7416   H HG13 . VAL B 1 175 ? 20.503  -12.867 197.416 1.00 0.00 ?  175 VAL B HG13 1  
ATOM 7417   H HG21 . VAL B 1 175 ? 20.245  -13.647 200.377 1.00 0.00 ?  175 VAL B HG21 1  
ATOM 7418   H HG22 . VAL B 1 175 ? 18.545  -13.339 199.856 1.00 0.00 ?  175 VAL B HG22 1  
ATOM 7419   H HG23 . VAL B 1 175 ? 19.255  -12.399 201.224 1.00 0.00 ?  175 VAL B HG23 1  
ATOM 7420   N N    . ARG B 1 176 ? 22.544  -10.987 197.298 1.00 0.00 ?  176 ARG B N    1  
ATOM 7421   C CA   . ARG B 1 176 ? 23.071  -10.067 196.263 1.00 0.00 ?  176 ARG B CA   1  
ATOM 7422   C C    . ARG B 1 176 ? 21.967  -9.667  195.309 1.00 0.00 ?  176 ARG B C    1  
ATOM 7423   O O    . ARG B 1 176 ? 21.338  -10.519 194.688 1.00 0.00 ?  176 ARG B O    1  
ATOM 7424   C CB   . ARG B 1 176 ? 24.191  -10.745 195.397 1.00 0.00 ?  176 ARG B CB   1  
ATOM 7425   C CG   . ARG B 1 176 ? 24.778  -9.885  194.232 1.00 0.00 ?  176 ARG B CG   1  
ATOM 7426   C CD   . ARG B 1 176 ? 25.984  -10.567 193.573 1.00 0.00 ?  176 ARG B CD   1  
ATOM 7427   N NE   . ARG B 1 176 ? 26.457  -9.740  192.425 1.00 0.00 ?  176 ARG B NE   1  
ATOM 7428   C CZ   . ARG B 1 176 ? 27.618  -10.076 191.782 1.00 0.00 ?  176 ARG B CZ   1  
ATOM 7429   N NH1  . ARG B 1 176 ? 28.328  -11.168 192.192 1.00 0.00 1  176 ARG B NH1  1  
ATOM 7430   N NH2  . ARG B 1 176 ? 28.071  -9.326  190.733 1.00 0.00 ?  176 ARG B NH2  1  
ATOM 7431   H H    . ARG B 1 176 ? 22.659  -11.958 197.105 1.00 0.00 ?  176 ARG B H    1  
ATOM 7432   H HA   . ARG B 1 176 ? 23.456  -9.191  196.759 1.00 0.00 ?  176 ARG B HA   1  
ATOM 7433   H HB2  . ARG B 1 176 ? 25.025  -11.033 196.071 1.00 0.00 ?  176 ARG B HB2  1  
ATOM 7434   H HB3  . ARG B 1 176 ? 23.776  -11.681 194.966 1.00 0.00 ?  176 ARG B HB3  1  
ATOM 7435   H HG2  . ARG B 1 176 ? 23.990  -9.717  193.467 1.00 0.00 ?  176 ARG B HG2  1  
ATOM 7436   H HG3  . ARG B 1 176 ? 25.090  -8.895  194.630 1.00 0.00 ?  176 ARG B HG3  1  
ATOM 7437   H HD2  . ARG B 1 176 ? 26.823  -10.666 194.296 1.00 0.00 ?  176 ARG B HD2  1  
ATOM 7438   H HD3  . ARG B 1 176 ? 25.707  -11.570 193.184 1.00 0.00 ?  176 ARG B HD3  1  
ATOM 7439   H HE   . ARG B 1 176 ? 25.930  -8.943  192.129 1.00 0.00 ?  176 ARG B HE   1  
ATOM 7440   H HH11 . ARG B 1 176 ? 28.000  -11.719 192.959 1.00 0.00 ?  176 ARG B HH11 1  
ATOM 7441   H HH12 . ARG B 1 176 ? 29.177  -11.416 191.725 1.00 0.00 ?  176 ARG B HH12 1  
ATOM 7442   H HH21 . ARG B 1 176 ? 27.555  -8.524  190.430 1.00 0.00 ?  176 ARG B HH21 1  
ATOM 7443   H HH22 . ARG B 1 176 ? 28.920  -9.581  190.263 1.00 0.00 ?  176 ARG B HH22 1  
ATOM 7444   N N    . ALA B 1 177 ? 21.724  -8.330  195.172 1.00 0.00 ?  177 ALA B N    1  
ATOM 7445   C CA   . ALA B 1 177 ? 20.715  -7.829  194.249 1.00 0.00 ?  177 ALA B CA   1  
ATOM 7446   C C    . ALA B 1 177 ? 21.385  -7.610  192.914 1.00 0.00 ?  177 ALA B C    1  
ATOM 7447   O O    . ALA B 1 177 ? 22.610  -7.537  192.854 1.00 0.00 ?  177 ALA B O    1  
ATOM 7448   C CB   . ALA B 1 177 ? 20.089  -6.495  194.687 1.00 0.00 ?  177 ALA B CB   1  
ATOM 7449   H H    . ALA B 1 177 ? 22.218  -7.642  195.701 1.00 0.00 ?  177 ALA B H    1  
ATOM 7450   H HA   . ALA B 1 177 ? 19.956  -8.589  194.147 1.00 0.00 ?  177 ALA B HA   1  
ATOM 7451   H HB1  . ALA B 1 177 ? 19.943  -6.481  195.789 1.00 0.00 ?  177 ALA B HB1  1  
ATOM 7452   H HB2  . ALA B 1 177 ? 19.102  -6.354  194.197 1.00 0.00 ?  177 ALA B HB2  1  
ATOM 7453   H HB3  . ALA B 1 177 ? 20.750  -5.648  194.406 1.00 0.00 ?  177 ALA B HB3  1  
ATOM 7454   N N    . ALA B 1 178 ? 20.580  -7.470  191.804 1.00 0.00 ?  178 ALA B N    1  
ATOM 7455   C CA   . ALA B 1 178 ? 21.159  -7.287  190.475 1.00 0.00 ?  178 ALA B CA   1  
ATOM 7456   C C    . ALA B 1 178 ? 20.810  -5.939  189.909 1.00 0.00 ?  178 ALA B C    1  
ATOM 7457   O O    . ALA B 1 178 ? 19.710  -5.432  190.066 1.00 0.00 ?  178 ALA B O    1  
ATOM 7458   C CB   . ALA B 1 178 ? 20.665  -8.313  189.453 1.00 0.00 ?  178 ALA B CB   1  
ATOM 7459   H H    . ALA B 1 178 ? 19.582  -7.500  191.855 1.00 0.00 ?  178 ALA B H    1  
ATOM 7460   H HA   . ALA B 1 178 ? 22.229  -7.357  190.566 1.00 0.00 ?  178 ALA B HA   1  
ATOM 7461   H HB1  . ALA B 1 178 ? 20.296  -7.800  188.539 1.00 0.00 ?  178 ALA B HB1  1  
ATOM 7462   H HB2  . ALA B 1 178 ? 19.839  -8.911  189.879 1.00 0.00 ?  178 ALA B HB2  1  
ATOM 7463   H HB3  . ALA B 1 178 ? 21.488  -8.996  189.166 1.00 0.00 ?  178 ALA B HB3  1  
ATOM 7464   N N    . ASN B 1 179 ? 21.813  -5.349  189.230 1.00 0.00 ?  179 ASN B N    1  
ATOM 7465   C CA   . ASN B 1 179 ? 21.703  -4.059  188.590 1.00 0.00 ?  179 ASN B CA   1  
ATOM 7466   C C    . ASN B 1 179 ? 21.752  -4.234  187.090 1.00 0.00 ?  179 ASN B C    1  
ATOM 7467   O O    . ASN B 1 179 ? 22.099  -3.300  186.382 1.00 0.00 ?  179 ASN B O    1  
ATOM 7468   C CB   . ASN B 1 179 ? 22.836  -3.104  188.977 1.00 0.00 ?  179 ASN B CB   1  
ATOM 7469   C CG   . ASN B 1 179 ? 22.832  -2.785  190.463 1.00 0.00 ?  179 ASN B CG   1  
ATOM 7470   O OD1  . ASN B 1 179 ? 21.805  -2.403  191.023 1.00 0.00 ?  179 ASN B OD1  1  
ATOM 7471   N ND2  . ASN B 1 179 ? 24.009  -2.953  191.124 1.00 0.00 ?  179 ASN B ND2  1  
ATOM 7472   H H    . ASN B 1 179 ? 22.701  -5.791  189.137 1.00 0.00 ?  179 ASN B H    1  
ATOM 7473   H HA   . ASN B 1 179 ? 20.750  -3.636  188.863 1.00 0.00 ?  179 ASN B HA   1  
ATOM 7474   H HB2  . ASN B 1 179 ? 23.812  -3.560  188.710 1.00 0.00 ?  179 ASN B HB2  1  
ATOM 7475   H HB3  . ASN B 1 179 ? 22.727  -2.154  188.409 1.00 0.00 ?  179 ASN B HB3  1  
ATOM 7476   H HD21 . ASN B 1 179 ? 24.818  -3.272  190.631 1.00 0.00 ?  179 ASN B HD21 1  
ATOM 7477   H HD22 . ASN B 1 179 ? 24.065  -2.756  192.102 1.00 0.00 ?  179 ASN B HD22 1  
ATOM 7478   N N    . ALA B 1 180 ? 21.421  -5.432  186.578 1.00 0.00 ?  180 ALA B N    1  
ATOM 7479   C CA   . ALA B 1 180 ? 21.610  -5.744  185.168 1.00 0.00 ?  180 ALA B CA   1  
ATOM 7480   C C    . ALA B 1 180 ? 20.925  -4.803  184.185 1.00 0.00 ?  180 ALA B C    1  
ATOM 7481   O O    . ALA B 1 180 ? 21.515  -4.551  183.137 1.00 0.00 ?  180 ALA B O    1  
ATOM 7482   C CB   . ALA B 1 180 ? 21.125  -7.156  184.836 1.00 0.00 ?  180 ALA B CB   1  
ATOM 7483   H H    . ALA B 1 180 ? 21.031  -6.158  187.139 1.00 0.00 ?  180 ALA B H    1  
ATOM 7484   H HA   . ALA B 1 180 ? 22.670  -5.697  184.988 1.00 0.00 ?  180 ALA B HA   1  
ATOM 7485   H HB1  . ALA B 1 180 ? 21.986  -7.855  184.775 1.00 0.00 ?  180 ALA B HB1  1  
ATOM 7486   H HB2  . ALA B 1 180 ? 20.593  -7.160  183.861 1.00 0.00 ?  180 ALA B HB2  1  
ATOM 7487   H HB3  . ALA B 1 180 ? 20.428  -7.519  185.621 1.00 0.00 ?  180 ALA B HB3  1  
ATOM 7488   N N    . ARG B 1 181 ? 19.694  -4.284  184.442 1.00 0.00 ?  181 ARG B N    1  
ATOM 7489   C CA   . ARG B 1 181 ? 19.048  -3.402  183.459 1.00 0.00 ?  181 ARG B CA   1  
ATOM 7490   C C    . ARG B 1 181 ? 18.909  -2.023  184.067 1.00 0.00 ?  181 ARG B C    1  
ATOM 7491   O O    . ARG B 1 181 ? 19.888  -1.474  184.566 1.00 0.00 ?  181 ARG B O    1  
ATOM 7492   C CB   . ARG B 1 181 ? 17.664  -3.941  183.010 1.00 0.00 ?  181 ARG B CB   1  
ATOM 7493   C CG   . ARG B 1 181 ? 17.337  -3.577  181.556 1.00 0.00 ?  181 ARG B CG   1  
ATOM 7494   C CD   . ARG B 1 181 ? 16.087  -2.700  181.423 1.00 0.00 ?  181 ARG B CD   1  
ATOM 7495   N NE   . ARG B 1 181 ? 14.937  -3.428  182.023 1.00 0.00 ?  181 ARG B NE   1  
ATOM 7496   C CZ   . ARG B 1 181 ? 13.766  -2.772  182.278 1.00 0.00 ?  181 ARG B CZ   1  
ATOM 7497   N NH1  . ARG B 1 181 ? 13.641  -1.443  181.973 1.00 0.00 1  181 ARG B NH1  1  
ATOM 7498   N NH2  . ARG B 1 181 ? 12.721  -3.446  182.837 1.00 0.00 ?  181 ARG B NH2  1  
ATOM 7499   H H    . ARG B 1 181 ? 19.188  -4.473  185.280 1.00 0.00 ?  181 ARG B H    1  
ATOM 7500   H HA   . ARG B 1 181 ? 19.699  -3.324  182.605 1.00 0.00 ?  181 ARG B HA   1  
ATOM 7501   H HB2  . ARG B 1 181 ? 17.677  -5.049  183.101 1.00 0.00 ?  181 ARG B HB2  1  
ATOM 7502   H HB3  . ARG B 1 181 ? 16.861  -3.565  183.674 1.00 0.00 ?  181 ARG B HB3  1  
ATOM 7503   H HG2  . ARG B 1 181 ? 18.201  -3.039  181.115 1.00 0.00 ?  181 ARG B HG2  1  
ATOM 7504   H HG3  . ARG B 1 181 ? 17.186  -4.514  180.976 1.00 0.00 ?  181 ARG B HG3  1  
ATOM 7505   H HD2  . ARG B 1 181 ? 16.213  -1.738  181.961 1.00 0.00 ?  181 ARG B HD2  1  
ATOM 7506   H HD3  . ARG B 1 181 ? 15.851  -2.506  180.355 1.00 0.00 ?  181 ARG B HD3  1  
ATOM 7507   H HE   . ARG B 1 181 ? 15.021  -4.399  182.244 1.00 0.00 ?  181 ARG B HE   1  
ATOM 7508   H HH11 . ARG B 1 181 ? 14.407  -0.951  181.560 1.00 0.00 ?  181 ARG B HH11 1  
ATOM 7509   H HH12 . ARG B 1 181 ? 12.780  -0.963  182.162 1.00 0.00 ?  181 ARG B HH12 1  
ATOM 7510   H HH21 . ARG B 1 181 ? 12.812  -4.419  183.057 1.00 0.00 ?  181 ARG B HH21 1  
ATOM 7511   H HH22 . ARG B 1 181 ? 11.868  -2.968  183.035 1.00 0.00 ?  181 ARG B HH22 1  
ATOM 7512   N N    . GLN B 1 182 ? 17.704  -1.389  183.951 1.00 0.00 ?  182 GLN B N    1  
ATOM 7513   C CA   . GLN B 1 182 ? 17.474  -0.096  184.562 1.00 0.00 ?  182 GLN B CA   1  
ATOM 7514   C C    . GLN B 1 182 ? 16.778  -0.420  185.855 1.00 0.00 ?  182 GLN B C    1  
ATOM 7515   O O    . GLN B 1 182 ? 15.553  -0.473  185.927 1.00 0.00 ?  182 GLN B O    1  
ATOM 7516   C CB   . GLN B 1 182 ? 16.544  0.800   183.719 1.00 0.00 ?  182 GLN B CB   1  
ATOM 7517   C CG   . GLN B 1 182 ? 16.402  2.217   184.277 1.00 0.00 ?  182 GLN B CG   1  
ATOM 7518   C CD   . GLN B 1 182 ? 17.759  2.894   184.232 1.00 0.00 ?  182 GLN B CD   1  
ATOM 7519   O OE1  . GLN B 1 182 ? 18.376  3.009   183.181 1.00 0.00 ?  182 GLN B OE1  1  
ATOM 7520   N NE2  . GLN B 1 182 ? 18.238  3.359   185.407 1.00 0.00 ?  182 GLN B NE2  1  
ATOM 7521   H H    . GLN B 1 182 ? 16.939  -1.784  183.446 1.00 0.00 ?  182 GLN B H    1  
ATOM 7522   H HA   . GLN B 1 182 ? 18.422  0.380   184.755 1.00 0.00 ?  182 GLN B HA   1  
ATOM 7523   H HB2  . GLN B 1 182 ? 16.945  0.862   182.685 1.00 0.00 ?  182 GLN B HB2  1  
ATOM 7524   H HB3  . GLN B 1 182 ? 15.538  0.333   183.667 1.00 0.00 ?  182 GLN B HB3  1  
ATOM 7525   H HG2  . GLN B 1 182 ? 15.674  2.796   183.666 1.00 0.00 ?  182 GLN B HG2  1  
ATOM 7526   H HG3  . GLN B 1 182 ? 16.045  2.180   185.328 1.00 0.00 ?  182 GLN B HG3  1  
ATOM 7527   H HE21 . GLN B 1 182 ? 17.704  3.244   186.244 1.00 0.00 ?  182 GLN B HE21 1  
ATOM 7528   H HE22 . GLN B 1 182 ? 19.121  3.824   185.438 1.00 0.00 ?  182 GLN B HE22 1  
ATOM 7529   N N    . ASN B 1 183 ? 17.591  -0.655  186.903 1.00 0.00 ?  183 ASN B N    1  
ATOM 7530   C CA   . ASN B 1 183 ? 17.106  -1.071  188.215 1.00 0.00 ?  183 ASN B CA   1  
ATOM 7531   C C    . ASN B 1 183 ? 16.863  0.063   189.190 1.00 0.00 ?  183 ASN B C    1  
ATOM 7532   O O    . ASN B 1 183 ? 16.474  -0.207  190.310 1.00 0.00 ?  183 ASN B O    1  
ATOM 7533   C CB   . ASN B 1 183 ? 18.116  -1.993  188.905 1.00 0.00 ?  183 ASN B CB   1  
ATOM 7534   C CG   . ASN B 1 183 ? 19.345  -1.218  189.373 1.00 0.00 ?  183 ASN B CG   1  
ATOM 7535   O OD1  . ASN B 1 183 ? 19.381  -0.700  190.487 1.00 0.00 ?  183 ASN B OD1  1  
ATOM 7536   N ND2  . ASN B 1 183 ? 20.371  -1.103  188.491 1.00 0.00 ?  183 ASN B ND2  1  
ATOM 7537   H H    . ASN B 1 183 ? 18.579  -0.552  186.827 1.00 0.00 ?  183 ASN B H    1  
ATOM 7538   H HA   . ASN B 1 183 ? 16.183  -1.604  188.062 1.00 0.00 ?  183 ASN B HA   1  
ATOM 7539   H HB2  . ASN B 1 183 ? 17.639  -2.479  189.783 1.00 0.00 ?  183 ASN B HB2  1  
ATOM 7540   H HB3  . ASN B 1 183 ? 18.442  -2.786  188.198 1.00 0.00 ?  183 ASN B HB3  1  
ATOM 7541   H HD21 . ASN B 1 183 ? 20.301  -1.515  187.581 1.00 0.00 ?  183 ASN B HD21 1  
ATOM 7542   H HD22 . ASN B 1 183 ? 21.204  -0.619  188.758 1.00 0.00 ?  183 ASN B HD22 1  
ATOM 7543   N N    . VAL B 1 184 ? 17.049  1.321   188.801 1.00 0.00 ?  184 VAL B N    1  
ATOM 7544   C CA   . VAL B 1 184 ? 17.073  2.446   189.748 1.00 0.00 ?  184 VAL B CA   1  
ATOM 7545   C C    . VAL B 1 184 ? 16.041  2.567   190.887 1.00 0.00 ?  184 VAL B C    1  
ATOM 7546   O O    . VAL B 1 184 ? 16.411  3.222   191.856 1.00 0.00 ?  184 VAL B O    1  
ATOM 7547   C CB   . VAL B 1 184 ? 17.043  3.770   189.047 1.00 0.00 ?  184 VAL B CB   1  
ATOM 7548   C CG1  . VAL B 1 184 ? 18.428  4.009   188.422 1.00 0.00 ?  184 VAL B CG1  1  
ATOM 7549   C CG2  . VAL B 1 184 ? 15.912  3.746   188.004 1.00 0.00 ?  184 VAL B CG2  1  
ATOM 7550   H H    . VAL B 1 184 ? 17.180  1.558   187.842 1.00 0.00 ?  184 VAL B H    1  
ATOM 7551   H HA   . VAL B 1 184 ? 18.034  2.369   190.226 1.00 0.00 ?  184 VAL B HA   1  
ATOM 7552   H HB   . VAL B 1 184 ? 16.836  4.579   189.778 1.00 0.00 ?  184 VAL B HB   1  
ATOM 7553   H HG11 . VAL B 1 184 ? 19.119  4.447   189.174 1.00 0.00 ?  184 VAL B HG11 1  
ATOM 7554   H HG12 . VAL B 1 184 ? 18.347  4.710   187.564 1.00 0.00 ?  184 VAL B HG12 1  
ATOM 7555   H HG13 . VAL B 1 184 ? 18.858  3.051   188.060 1.00 0.00 ?  184 VAL B HG13 1  
ATOM 7556   H HG21 . VAL B 1 184 ? 15.188  2.939   188.237 1.00 0.00 ?  184 VAL B HG21 1  
ATOM 7557   H HG22 . VAL B 1 184 ? 16.325  3.569   186.992 1.00 0.00 ?  184 VAL B HG22 1  
ATOM 7558   H HG23 . VAL B 1 184 ? 15.373  4.716   188.001 1.00 0.00 ?  184 VAL B HG23 1  
ATOM 7559   N N    . ILE B 1 185 ? 14.779  2.020   190.885 1.00 0.00 ?  185 ILE B N    1  
ATOM 7560   C CA   . ILE B 1 185 ? 13.872  2.332   192.033 1.00 0.00 ?  185 ILE B CA   1  
ATOM 7561   C C    . ILE B 1 185 ? 13.250  1.116   192.717 1.00 0.00 ?  185 ILE B C    1  
ATOM 7562   O O    . ILE B 1 185 ? 12.212  1.250   193.364 1.00 0.00 ?  185 ILE B O    1  
ATOM 7563   C CB   . ILE B 1 185 ? 12.755  3.280   191.657 1.00 0.00 ?  185 ILE B CB   1  
ATOM 7564   C CG1  . ILE B 1 185 ? 13.163  4.153   190.458 1.00 0.00 ?  185 ILE B CG1  1  
ATOM 7565   C CG2  . ILE B 1 185 ? 12.427  4.152   192.884 1.00 0.00 ?  185 ILE B CG2  1  
ATOM 7566   C CD1  . ILE B 1 185 ? 12.298  5.404   190.331 1.00 0.00 ?  185 ILE B CD1  1  
ATOM 7567   H H    . ILE B 1 185 ? 14.426  1.433   190.157 1.00 0.00 ?  185 ILE B H    1  
ATOM 7568   H HA   . ILE B 1 185 ? 14.475  2.814   192.779 1.00 0.00 ?  185 ILE B HA   1  
ATOM 7569   H HB   . ILE B 1 185 ? 11.850  2.698   191.381 1.00 0.00 ?  185 ILE B HB   1  
ATOM 7570   H HG12 . ILE B 1 185 ? 14.224  4.461   190.576 1.00 0.00 ?  185 ILE B HG12 1  
ATOM 7571   H HG13 . ILE B 1 185 ? 13.076  3.558   189.524 1.00 0.00 ?  185 ILE B HG13 1  
ATOM 7572   H HG21 . ILE B 1 185 ? 12.597  3.583   193.822 1.00 0.00 ?  185 ILE B HG21 1  
ATOM 7573   H HG22 . ILE B 1 185 ? 11.364  4.477   192.854 1.00 0.00 ?  185 ILE B HG22 1  
ATOM 7574   H HG23 . ILE B 1 185 ? 13.072  5.057   192.897 1.00 0.00 ?  185 ILE B HG23 1  
ATOM 7575   H HD11 . ILE B 1 185 ? 12.277  5.746   189.279 1.00 0.00 ?  185 ILE B HD11 1  
ATOM 7576   H HD12 . ILE B 1 185 ? 12.710  6.223   190.960 1.00 0.00 ?  185 ILE B HD12 1  
ATOM 7577   H HD13 . ILE B 1 185 ? 11.259  5.194   190.660 1.00 0.00 ?  185 ILE B HD13 1  
ATOM 7578   N N    . ALA B 1 186 ? 13.824  -0.089  192.615 1.00 0.00 ?  186 ALA B N    1  
ATOM 7579   C CA   . ALA B 1 186 ? 13.173  -1.254  193.208 1.00 0.00 ?  186 ALA B CA   1  
ATOM 7580   C C    . ALA B 1 186 ? 13.147  -1.245  194.737 1.00 0.00 ?  186 ALA B C    1  
ATOM 7581   O O    . ALA B 1 186 ? 13.896  -0.539  195.412 1.00 0.00 ?  186 ALA B O    1  
ATOM 7582   C CB   . ALA B 1 186 ? 13.793  -2.578  192.741 1.00 0.00 ?  186 ALA B CB   1  
ATOM 7583   H H    . ALA B 1 186 ? 14.691  -0.243  192.146 1.00 0.00 ?  186 ALA B H    1  
ATOM 7584   H HA   . ALA B 1 186 ? 12.159  -1.224  192.877 1.00 0.00 ?  186 ALA B HA   1  
ATOM 7585   H HB1  . ALA B 1 186 ? 14.483  -2.404  191.891 1.00 0.00 ?  186 ALA B HB1  1  
ATOM 7586   H HB2  . ALA B 1 186 ? 12.995  -3.275  192.405 1.00 0.00 ?  186 ALA B HB2  1  
ATOM 7587   H HB3  . ALA B 1 186 ? 14.356  -3.060  193.566 1.00 0.00 ?  186 ALA B HB3  1  
ATOM 7588   N N    . GLU B 1 187 ? 12.164  -2.032  195.275 1.00 0.00 ?  187 GLU B N    1  
ATOM 7589   C CA   . GLU B 1 187 ? 11.961  -2.244  196.699 1.00 0.00 ?  187 GLU B CA   1  
ATOM 7590   C C    . GLU B 1 187 ? 11.789  -3.739  196.815 1.00 0.00 ?  187 GLU B C    1  
ATOM 7591   O O    . GLU B 1 187 ? 11.481  -4.370  195.814 1.00 0.00 ?  187 GLU B O    1  
ATOM 7592   C CB   . GLU B 1 187 ? 10.713  -1.553  197.273 1.00 0.00 ?  187 GLU B CB   1  
ATOM 7593   C CG   . GLU B 1 187 ? 10.828  -0.026  197.244 1.00 0.00 ?  187 GLU B CG   1  
ATOM 7594   C CD   . GLU B 1 187 ? 9.531   0.559   197.778 1.00 0.00 ?  187 GLU B CD   1  
ATOM 7595   O OE1  . GLU B 1 187 ? 9.491   1.798   198.007 1.00 0.00 ?  187 GLU B OE1  1  
ATOM 7596   O OE2  . GLU B 1 187 ? 8.560   -0.223  197.962 1.00 0.00 -1 187 GLU B OE2  1  
ATOM 7597   H H    . GLU B 1 187 ? 11.511  -2.500  194.691 1.00 0.00 ?  187 GLU B H    1  
ATOM 7598   H HA   . GLU B 1 187 ? 12.857  -1.939  197.218 1.00 0.00 ?  187 GLU B HA   1  
ATOM 7599   H HB2  . GLU B 1 187 ? 9.822   -1.863  196.684 1.00 0.00 ?  187 GLU B HB2  1  
ATOM 7600   H HB3  . GLU B 1 187 ? 10.564  -1.881  198.323 1.00 0.00 ?  187 GLU B HB3  1  
ATOM 7601   H HG2  . GLU B 1 187 ? 11.680  0.305   197.878 1.00 0.00 ?  187 GLU B HG2  1  
ATOM 7602   H HG3  . GLU B 1 187 ? 10.988  0.327   196.204 1.00 0.00 ?  187 GLU B HG3  1  
ATOM 7603   N N    . ALA B 1 188 ? 11.983  -4.365  198.018 1.00 0.00 ?  188 ALA B N    1  
ATOM 7604   C CA   . ALA B 1 188 ? 11.892  -5.823  198.082 1.00 0.00 ?  188 ALA B CA   1  
ATOM 7605   C C    . ALA B 1 188 ? 11.127  -6.286  199.294 1.00 0.00 ?  188 ALA B C    1  
ATOM 7606   O O    . ALA B 1 188 ? 10.959  -5.563  200.274 1.00 0.00 ?  188 ALA B O    1  
ATOM 7607   C CB   . ALA B 1 188 ? 13.269  -6.500  198.114 1.00 0.00 ?  188 ALA B CB   1  
ATOM 7608   H H    . ALA B 1 188 ? 12.182  -3.879  198.866 1.00 0.00 ?  188 ALA B H    1  
ATOM 7609   H HA   . ALA B 1 188 ? 11.355  -6.156  197.211 1.00 0.00 ?  188 ALA B HA   1  
ATOM 7610   H HB1  . ALA B 1 188 ? 13.178  -7.541  198.492 1.00 0.00 ?  188 ALA B HB1  1  
ATOM 7611   H HB2  . ALA B 1 188 ? 13.959  -5.940  198.779 1.00 0.00 ?  188 ALA B HB2  1  
ATOM 7612   H HB3  . ALA B 1 188 ? 13.705  -6.529  197.097 1.00 0.00 ?  188 ALA B HB3  1  
ATOM 7613   N N    . ARG B 1 189 ? 10.603  -7.543  199.187 1.00 0.00 ?  189 ARG B N    1  
ATOM 7614   C CA   . ARG B 1 189 ? 9.840   -8.160  200.251 1.00 0.00 ?  189 ARG B CA   1  
ATOM 7615   C C    . ARG B 1 189 ? 10.349  -9.587  200.365 1.00 0.00 ?  189 ARG B C    1  
ATOM 7616   O O    . ARG B 1 189 ? 10.598  -10.226 199.342 1.00 0.00 ?  189 ARG B O    1  
ATOM 7617   C CB   . ARG B 1 189 ? 8.338   -8.192  199.911 1.00 0.00 ?  189 ARG B CB   1  
ATOM 7618   C CG   . ARG B 1 189 ? 7.767   -6.779  199.721 1.00 0.00 ?  189 ARG B CG   1  
ATOM 7619   C CD   . ARG B 1 189 ? 6.349   -6.768  199.141 1.00 0.00 ?  189 ARG B CD   1  
ATOM 7620   N NE   . ARG B 1 189 ? 6.402   -7.245  197.729 1.00 0.00 ?  189 ARG B NE   1  
ATOM 7621   C CZ   . ARG B 1 189 ? 5.247   -7.361  197.008 1.00 0.00 ?  189 ARG B CZ   1  
ATOM 7622   N NH1  . ARG B 1 189 ? 4.043   -7.138  197.611 1.00 0.00 1  189 ARG B NH1  1  
ATOM 7623   N NH2  . ARG B 1 189 ? 5.292   -7.702  195.686 1.00 0.00 ?  189 ARG B NH2  1  
ATOM 7624   H H    . ARG B 1 189 ? 10.726  -8.094  198.364 1.00 0.00 ?  189 ARG B H    1  
ATOM 7625   H HA   . ARG B 1 189 ? 10.027  -7.622  201.168 1.00 0.00 ?  189 ARG B HA   1  
ATOM 7626   H HB2  . ARG B 1 189 ? 8.188   -8.777  198.977 1.00 0.00 ?  189 ARG B HB2  1  
ATOM 7627   H HB3  . ARG B 1 189 ? 7.786   -8.697  200.730 1.00 0.00 ?  189 ARG B HB3  1  
ATOM 7628   H HG2  . ARG B 1 189 ? 7.757   -6.260  200.703 1.00 0.00 ?  189 ARG B HG2  1  
ATOM 7629   H HG3  . ARG B 1 189 ? 8.439   -6.210  199.043 1.00 0.00 ?  189 ARG B HG3  1  
ATOM 7630   H HD2  . ARG B 1 189 ? 5.681   -7.446  199.715 1.00 0.00 ?  189 ARG B HD2  1  
ATOM 7631   H HD3  . ARG B 1 189 ? 5.931   -5.739  199.141 1.00 0.00 ?  189 ARG B HD3  1  
ATOM 7632   H HE   . ARG B 1 189 ? 7.284   -7.444  197.300 1.00 0.00 ?  189 ARG B HE   1  
ATOM 7633   H HH11 . ARG B 1 189 ? 4.007   -6.891  198.580 1.00 0.00 ?  189 ARG B HH11 1  
ATOM 7634   H HH12 . ARG B 1 189 ? 3.197   -7.223  197.085 1.00 0.00 ?  189 ARG B HH12 1  
ATOM 7635   H HH21 . ARG B 1 189 ? 6.171   -7.868  195.239 1.00 0.00 ?  189 ARG B HH21 1  
ATOM 7636   H HH22 . ARG B 1 189 ? 4.444   -7.774  195.160 1.00 0.00 ?  189 ARG B HH22 1  
ATOM 7637   N N    . ALA B 1 190 ? 10.527  -10.125 201.620 1.00 0.00 ?  190 ALA B N    1  
ATOM 7638   C CA   . ALA B 1 190 ? 11.044  -11.484 201.781 1.00 0.00 ?  190 ALA B CA   1  
ATOM 7639   C C    . ALA B 1 190 ? 9.975   -12.420 202.282 1.00 0.00 ?  190 ALA B C    1  
ATOM 7640   O O    . ALA B 1 190 ? 9.235   -12.111 203.217 1.00 0.00 ?  190 ALA B O    1  
ATOM 7641   C CB   . ALA B 1 190 ? 12.212  -11.577 202.764 1.00 0.00 ?  190 ALA B CB   1  
ATOM 7642   H H    . ALA B 1 190 ? 10.311  -9.628  202.459 1.00 0.00 ?  190 ALA B H    1  
ATOM 7643   H HA   . ALA B 1 190 ? 11.367  -11.827 200.813 1.00 0.00 ?  190 ALA B HA   1  
ATOM 7644   H HB1  . ALA B 1 190 ? 13.176  -11.631 202.215 1.00 0.00 ?  190 ALA B HB1  1  
ATOM 7645   H HB2  . ALA B 1 190 ? 12.111  -12.488 203.393 1.00 0.00 ?  190 ALA B HB2  1  
ATOM 7646   H HB3  . ALA B 1 190 ? 12.230  -10.687 203.428 1.00 0.00 ?  190 ALA B HB3  1  
ATOM 7647   N N    . LYS B 1 191 ? 9.926   -13.628 201.659 1.00 0.00 ?  191 LYS B N    1  
ATOM 7648   C CA   . LYS B 1 191 ? 8.985   -14.665 202.033 1.00 0.00 ?  191 LYS B CA   1  
ATOM 7649   C C    . LYS B 1 191 ? 9.827   -15.893 202.299 1.00 0.00 ?  191 LYS B C    1  
ATOM 7650   O O    . LYS B 1 191 ? 10.870  -16.061 201.683 1.00 0.00 ?  191 LYS B O    1  
ATOM 7651   C CB   . LYS B 1 191 ? 7.989   -15.017 200.909 1.00 0.00 ?  191 LYS B CB   1  
ATOM 7652   C CG   . LYS B 1 191 ? 6.814   -15.887 201.369 1.00 0.00 ?  191 LYS B CG   1  
ATOM 7653   C CD   . LYS B 1 191 ? 5.782   -15.110 202.191 1.00 0.00 ?  191 LYS B CD   1  
ATOM 7654   C CE   . LYS B 1 191 ? 4.562   -15.961 202.547 1.00 0.00 ?  191 LYS B CE   1  
ATOM 7655   N NZ   . LYS B 1 191 ? 3.564   -15.152 203.293 1.00 0.00 1  191 LYS B NZ   1  
ATOM 7656   H H    . LYS B 1 191 ? 10.541  -13.854 200.910 1.00 0.00 ?  191 LYS B H    1  
ATOM 7657   H HA   . LYS B 1 191 ? 8.475   -14.364 202.935 1.00 0.00 ?  191 LYS B HA   1  
ATOM 7658   H HB2  . LYS B 1 191 ? 7.588   -14.076 200.477 1.00 0.00 ?  191 LYS B HB2  1  
ATOM 7659   H HB3  . LYS B 1 191 ? 8.531   -15.552 200.106 1.00 0.00 ?  191 LYS B HB3  1  
ATOM 7660   H HG2  . LYS B 1 191 ? 6.313   -16.319 200.477 1.00 0.00 ?  191 LYS B HG2  1  
ATOM 7661   H HG3  . LYS B 1 191 ? 7.205   -16.727 201.981 1.00 0.00 ?  191 LYS B HG3  1  
ATOM 7662   H HD2  . LYS B 1 191 ? 6.258   -14.749 203.126 1.00 0.00 ?  191 LYS B HD2  1  
ATOM 7663   H HD3  . LYS B 1 191 ? 5.448   -14.224 201.610 1.00 0.00 ?  191 LYS B HD3  1  
ATOM 7664   H HE2  . LYS B 1 191 ? 4.073   -16.342 201.623 1.00 0.00 ?  191 LYS B HE2  1  
ATOM 7665   H HE3  . LYS B 1 191 ? 4.859   -16.819 203.186 1.00 0.00 ?  191 LYS B HE3  1  
ATOM 7666   H HZ1  . LYS B 1 191 ? 2.626   -15.260 202.847 1.00 0.00 ?  191 LYS B HZ1  1  
ATOM 7667   H HZ2  . LYS B 1 191 ? 3.846   -14.150 203.267 1.00 0.00 ?  191 LYS B HZ2  1  
ATOM 7668   H HZ3  . LYS B 1 191 ? 3.516   -15.470 204.285 1.00 0.00 ?  191 LYS B HZ3  1  
ATOM 7669   N N    . MET B 1 192 ? 9.417   -16.758 203.259 1.00 0.00 ?  192 MET B N    1  
ATOM 7670   C CA   . MET B 1 192 ? 10.178  -17.962 203.561 1.00 0.00 ?  192 MET B CA   1  
ATOM 7671   C C    . MET B 1 192 ? 9.209   -19.112 203.576 1.00 0.00 ?  192 MET B C    1  
ATOM 7672   O O    . MET B 1 192 ? 8.010   -18.897 203.654 1.00 0.00 ?  192 MET B O    1  
ATOM 7673   C CB   . MET B 1 192 ? 10.906  -17.920 204.915 1.00 0.00 ?  192 MET B CB   1  
ATOM 7674   C CG   . MET B 1 192 ? 12.388  -17.580 204.766 1.00 0.00 ?  192 MET B CG   1  
ATOM 7675   S SD   . MET B 1 192 ? 12.680  -15.818 204.429 1.00 0.00 ?  192 MET B SD   1  
ATOM 7676   C CE   . MET B 1 192 ? 14.010  -15.645 205.653 1.00 0.00 ?  192 MET B CE   1  
ATOM 7677   H H    . MET B 1 192 ? 8.579   -16.618 203.783 1.00 0.00 ?  192 MET B H    1  
ATOM 7678   H HA   . MET B 1 192 ? 10.884  -18.120 202.762 1.00 0.00 ?  192 MET B HA   1  
ATOM 7679   H HB2  . MET B 1 192 ? 10.420  -17.162 205.566 1.00 0.00 ?  192 MET B HB2  1  
ATOM 7680   H HB3  . MET B 1 192 ? 10.811  -18.911 205.409 1.00 0.00 ?  192 MET B HB3  1  
ATOM 7681   H HG2  . MET B 1 192 ? 12.914  -17.878 205.699 1.00 0.00 ?  192 MET B HG2  1  
ATOM 7682   H HG3  . MET B 1 192 ? 12.805  -18.191 203.938 1.00 0.00 ?  192 MET B HG3  1  
ATOM 7683   H HE1  . MET B 1 192 ? 14.572  -14.699 205.495 1.00 0.00 ?  192 MET B HE1  1  
ATOM 7684   H HE2  . MET B 1 192 ? 14.728  -16.487 205.581 1.00 0.00 ?  192 MET B HE2  1  
ATOM 7685   H HE3  . MET B 1 192 ? 13.598  -15.631 206.685 1.00 0.00 ?  192 MET B HE3  1  
ATOM 7686   N N    . ARG B 1 193 ? 9.691   -20.361 203.347 1.00 0.00 ?  193 ARG B N    1  
ATOM 7687   C CA   . ARG B 1 193 ? 8.788   -21.494 203.406 1.00 0.00 ?  193 ARG B CA   1  
ATOM 7688   C C    . ARG B 1 193 ? 9.420   -22.531 204.284 1.00 0.00 ?  193 ARG B C    1  
ATOM 7689   O O    . ARG B 1 193 ? 10.419  -23.133 203.910 1.00 0.00 ?  193 ARG B O    1  
ATOM 7690   C CB   . ARG B 1 193 ? 8.551   -22.137 202.032 1.00 0.00 ?  193 ARG B CB   1  
ATOM 7691   C CG   . ARG B 1 193 ? 7.520   -23.265 202.068 1.00 0.00 ?  193 ARG B CG   1  
ATOM 7692   C CD   . ARG B 1 193 ? 7.333   -23.912 200.696 1.00 0.00 ?  193 ARG B CD   1  
ATOM 7693   N NE   . ARG B 1 193 ? 8.606   -24.588 200.324 1.00 0.00 ?  193 ARG B NE   1  
ATOM 7694   C CZ   . ARG B 1 193 ? 8.757   -25.121 199.078 1.00 0.00 ?  193 ARG B CZ   1  
ATOM 7695   N NH1  . ARG B 1 193 ? 7.730   -25.060 198.181 1.00 0.00 1  193 ARG B NH1  1  
ATOM 7696   N NH2  . ARG B 1 193 ? 9.934   -25.720 198.729 1.00 0.00 ?  193 ARG B NH2  1  
ATOM 7697   H H    . ARG B 1 193 ? 10.645  -20.546 203.124 1.00 0.00 ?  193 ARG B H    1  
ATOM 7698   H HA   . ARG B 1 193 ? 7.857   -21.179 203.846 1.00 0.00 ?  193 ARG B HA   1  
ATOM 7699   H HB2  . ARG B 1 193 ? 8.210   -21.356 201.319 1.00 0.00 ?  193 ARG B HB2  1  
ATOM 7700   H HB3  . ARG B 1 193 ? 9.510   -22.548 201.661 1.00 0.00 ?  193 ARG B HB3  1  
ATOM 7701   H HG2  . ARG B 1 193 ? 7.849   -24.040 202.792 1.00 0.00 ?  193 ARG B HG2  1  
ATOM 7702   H HG3  . ARG B 1 193 ? 6.547   -22.858 202.415 1.00 0.00 ?  193 ARG B HG3  1  
ATOM 7703   H HD2  . ARG B 1 193 ? 6.525   -24.673 200.722 1.00 0.00 ?  193 ARG B HD2  1  
ATOM 7704   H HD3  . ARG B 1 193 ? 7.109   -23.147 199.922 1.00 0.00 ?  193 ARG B HD3  1  
ATOM 7705   H HE   . ARG B 1 193 ? 9.355   -24.642 200.987 1.00 0.00 ?  193 ARG B HE   1  
ATOM 7706   H HH11 . ARG B 1 193 ? 6.868   -24.625 198.438 1.00 0.00 ?  193 ARG B HH11 1  
ATOM 7707   H HH12 . ARG B 1 193 ? 7.841   -25.451 197.267 1.00 0.00 ?  193 ARG B HH12 1  
ATOM 7708   H HH21 . ARG B 1 193 ? 10.685  -25.768 199.388 1.00 0.00 ?  193 ARG B HH21 1  
ATOM 7709   H HH22 . ARG B 1 193 ? 10.044  -26.111 197.815 1.00 0.00 ?  193 ARG B HH22 1  
ATOM 7710   N N    . LEU B 1 194 ? 8.831   -22.739 205.492 1.00 0.00 ?  194 LEU B N    1  
ATOM 7711   C CA   . LEU B 1 194 ? 9.322   -23.729 206.427 1.00 0.00 ?  194 LEU B CA   1  
ATOM 7712   C C    . LEU B 1 194 ? 8.237   -24.741 206.662 1.00 0.00 ?  194 LEU B C    1  
ATOM 7713   O O    . LEU B 1 194 ? 7.053   -24.430 206.530 1.00 0.00 ?  194 LEU B O    1  
ATOM 7714   C CB   . LEU B 1 194 ? 9.735   -23.146 207.792 1.00 0.00 ?  194 LEU B CB   1  
ATOM 7715   C CG   . LEU B 1 194 ? 10.861  -22.102 207.678 1.00 0.00 ?  194 LEU B CG   1  
ATOM 7716   C CD1  . LEU B 1 194 ? 11.193  -21.484 209.047 1.00 0.00 ?  194 LEU B CD1  1  
ATOM 7717   C CD2  . LEU B 1 194 ? 12.119  -22.703 207.025 1.00 0.00 ?  194 LEU B CD2  1  
ATOM 7718   H H    . LEU B 1 194 ? 8.033   -22.216 205.788 1.00 0.00 ?  194 LEU B H    1  
ATOM 7719   H HA   . LEU B 1 194 ? 10.161  -24.227 205.970 1.00 0.00 ?  194 LEU B HA   1  
ATOM 7720   H HB2  . LEU B 1 194 ? 8.847   -22.673 208.266 1.00 0.00 ?  194 LEU B HB2  1  
ATOM 7721   H HB3  . LEU B 1 194 ? 10.079  -23.970 208.450 1.00 0.00 ?  194 LEU B HB3  1  
ATOM 7722   H HG   . LEU B 1 194 ? 10.499  -21.285 207.020 1.00 0.00 ?  194 LEU B HG   1  
ATOM 7723   H HD11 . LEU B 1 194 ? 10.272  -21.092 209.528 1.00 0.00 ?  194 LEU B HD11 1  
ATOM 7724   H HD12 . LEU B 1 194 ? 11.916  -20.649 208.929 1.00 0.00 ?  194 LEU B HD12 1  
ATOM 7725   H HD13 . LEU B 1 194 ? 11.643  -22.250 209.716 1.00 0.00 ?  194 LEU B HD13 1  
ATOM 7726   H HD21 . LEU B 1 194 ? 12.109  -23.811 207.113 1.00 0.00 ?  194 LEU B HD21 1  
ATOM 7727   H HD22 . LEU B 1 194 ? 13.033  -22.316 207.522 1.00 0.00 ?  194 LEU B HD22 1  
ATOM 7728   H HD23 . LEU B 1 194 ? 12.160  -22.434 205.948 1.00 0.00 ?  194 LEU B HD23 1  
ATOM 7729   N N    . MET B 1 195 ? 8.636   -25.994 206.992 1.00 0.00 ?  195 MET B N    1  
ATOM 7730   C CA   . MET B 1 195 ? 7.677   -27.027 207.307 1.00 0.00 ?  195 MET B CA   1  
ATOM 7731   C C    . MET B 1 195 ? 7.783   -27.233 208.787 1.00 0.00 ?  195 MET B C    1  
ATOM 7732   O O    . MET B 1 195 ? 8.875   -27.184 209.348 1.00 0.00 ?  195 MET B O    1  
ATOM 7733   C CB   . MET B 1 195 ? 7.957   -28.375 206.621 1.00 0.00 ?  195 MET B CB   1  
ATOM 7734   C CG   . MET B 1 195 ? 7.730   -28.328 205.109 1.00 0.00 ?  195 MET B CG   1  
ATOM 7735   S SD   . MET B 1 195 ? 8.091   -29.914 204.298 1.00 0.00 ?  195 MET B SD   1  
ATOM 7736   C CE   . MET B 1 195 ? 7.429   -29.422 202.681 1.00 0.00 ?  195 MET B CE   1  
ATOM 7737   H H    . MET B 1 195 ? 9.598   -26.254 207.034 1.00 0.00 ?  195 MET B H    1  
ATOM 7738   H HA   . MET B 1 195 ? 6.689   -26.670 207.064 1.00 0.00 ?  195 MET B HA   1  
ATOM 7739   H HB2  . MET B 1 195 ? 9.010   -28.670 206.821 1.00 0.00 ?  195 MET B HB2  1  
ATOM 7740   H HB3  . MET B 1 195 ? 7.294   -29.149 207.060 1.00 0.00 ?  195 MET B HB3  1  
ATOM 7741   H HG2  . MET B 1 195 ? 6.672   -28.040 204.920 1.00 0.00 ?  195 MET B HG2  1  
ATOM 7742   H HG3  . MET B 1 195 ? 8.375   -27.534 204.679 1.00 0.00 ?  195 MET B HG3  1  
ATOM 7743   H HE1  . MET B 1 195 ? 6.327   -29.562 202.647 1.00 0.00 ?  195 MET B HE1  1  
ATOM 7744   H HE2  . MET B 1 195 ? 7.874   -30.031 201.867 1.00 0.00 ?  195 MET B HE2  1  
ATOM 7745   H HE3  . MET B 1 195 ? 7.647   -28.353 202.471 1.00 0.00 ?  195 MET B HE3  1  
ATOM 7746   N N    . ARG B 1 196 ? 6.644   -27.469 209.469 1.00 0.00 ?  196 ARG B N    1  
ATOM 7747   C CA   . ARG B 1 196 ? 6.697   -27.644 210.897 1.00 0.00 ?  196 ARG B CA   1  
ATOM 7748   C C    . ARG B 1 196 ? 7.231   -29.011 211.186 1.00 0.00 ?  196 ARG B C    1  
ATOM 7749   O O    . ARG B 1 196 ? 7.271   -29.882 210.325 1.00 0.00 ?  196 ARG B O    1  
ATOM 7750   C CB   . ARG B 1 196 ? 5.341   -27.509 211.609 1.00 0.00 ?  196 ARG B CB   1  
ATOM 7751   C CG   . ARG B 1 196 ? 5.487   -26.971 213.040 1.00 0.00 ?  196 ARG B CG   1  
ATOM 7752   C CD   . ARG B 1 196 ? 5.519   -25.442 213.098 1.00 0.00 ?  196 ARG B CD   1  
ATOM 7753   N NE   . ARG B 1 196 ? 4.115   -24.943 213.064 1.00 0.00 ?  196 ARG B NE   1  
ATOM 7754   C CZ   . ARG B 1 196 ? 3.370   -24.924 214.215 1.00 0.00 ?  196 ARG B CZ   1  
ATOM 7755   N NH1  . ARG B 1 196 ? 3.911   -25.361 215.389 1.00 0.00 1  196 ARG B NH1  1  
ATOM 7756   N NH2  . ARG B 1 196 ? 2.083   -24.473 214.191 1.00 0.00 ?  196 ARG B NH2  1  
ATOM 7757   H H    . ARG B 1 196 ? 5.749   -27.533 209.034 1.00 0.00 ?  196 ARG B H    1  
ATOM 7758   H HA   . ARG B 1 196 ? 7.390   -26.912 211.282 1.00 0.00 ?  196 ARG B HA   1  
ATOM 7759   H HB2  . ARG B 1 196 ? 4.689   -26.824 211.024 1.00 0.00 ?  196 ARG B HB2  1  
ATOM 7760   H HB3  . ARG B 1 196 ? 4.850   -28.505 211.648 1.00 0.00 ?  196 ARG B HB3  1  
ATOM 7761   H HG2  . ARG B 1 196 ? 4.635   -27.336 213.651 1.00 0.00 ?  196 ARG B HG2  1  
ATOM 7762   H HG3  . ARG B 1 196 ? 6.421   -27.368 213.488 1.00 0.00 ?  196 ARG B HG3  1  
ATOM 7763   H HD2  . ARG B 1 196 ? 6.001   -25.089 214.036 1.00 0.00 ?  196 ARG B HD2  1  
ATOM 7764   H HD3  . ARG B 1 196 ? 6.054   -25.024 212.220 1.00 0.00 ?  196 ARG B HD3  1  
ATOM 7765   H HE   . ARG B 1 196 ? 3.717   -24.624 212.204 1.00 0.00 ?  196 ARG B HE   1  
ATOM 7766   H HH11 . ARG B 1 196 ? 4.854   -25.697 215.411 1.00 0.00 ?  196 ARG B HH11 1  
ATOM 7767   H HH12 . ARG B 1 196 ? 3.367   -25.347 216.228 1.00 0.00 ?  196 ARG B HH12 1  
ATOM 7768   H HH21 . ARG B 1 196 ? 1.678   -24.156 213.336 1.00 0.00 ?  196 ARG B HH21 1  
ATOM 7769   H HH22 . ARG B 1 196 ? 1.543   -24.461 215.034 1.00 0.00 ?  196 ARG B HH22 1  
ATOM 7770   N N    . ARG B 1 197 ? 7.717   -29.201 212.426 1.00 0.00 ?  197 ARG B N    1  
ATOM 7771   C CA   . ARG B 1 197 ? 8.239   -30.476 212.825 1.00 0.00 ?  197 ARG B CA   1  
ATOM 7772   C C    . ARG B 1 197 ? 7.133   -31.479 212.773 1.00 0.00 ?  197 ARG B C    1  
ATOM 7773   O O    . ARG B 1 197 ? 7.333   -32.622 212.375 1.00 0.00 ?  197 ARG B O    1  
ATOM 7774   C CB   . ARG B 1 197 ? 8.769   -30.483 214.267 1.00 0.00 ?  197 ARG B CB   1  
ATOM 7775   C CG   . ARG B 1 197 ? 10.044  -29.664 214.449 1.00 0.00 ?  197 ARG B CG   1  
ATOM 7776   C CD   . ARG B 1 197 ? 11.261  -30.348 213.830 1.00 0.00 ?  197 ARG B CD   1  
ATOM 7777   N NE   . ARG B 1 197 ? 12.471  -29.557 214.180 1.00 0.00 ?  197 ARG B NE   1  
ATOM 7778   C CZ   . ARG B 1 197 ? 13.706  -30.012 213.827 1.00 0.00 ?  197 ARG B CZ   1  
ATOM 7779   N NH1  . ARG B 1 197 ? 13.831  -31.177 213.126 1.00 0.00 1  197 ARG B NH1  1  
ATOM 7780   N NH2  . ARG B 1 197 ? 14.815  -29.303 214.177 1.00 0.00 ?  197 ARG B NH2  1  
ATOM 7781   H H    . ARG B 1 197 ? 7.736   -28.477 213.111 1.00 0.00 ?  197 ARG B H    1  
ATOM 7782   H HA   . ARG B 1 197 ? 9.017   -30.754 212.132 1.00 0.00 ?  197 ARG B HA   1  
ATOM 7783   H HB2  . ARG B 1 197 ? 7.983   -30.081 214.941 1.00 0.00 ?  197 ARG B HB2  1  
ATOM 7784   H HB3  . ARG B 1 197 ? 8.973   -31.532 214.570 1.00 0.00 ?  197 ARG B HB3  1  
ATOM 7785   H HG2  . ARG B 1 197 ? 9.907   -28.667 213.976 1.00 0.00 ?  197 ARG B HG2  1  
ATOM 7786   H HG3  . ARG B 1 197 ? 10.225  -29.507 215.535 1.00 0.00 ?  197 ARG B HG3  1  
ATOM 7787   H HD2  . ARG B 1 197 ? 11.387  -31.377 214.236 1.00 0.00 ?  197 ARG B HD2  1  
ATOM 7788   H HD3  . ARG B 1 197 ? 11.179  -30.385 212.724 1.00 0.00 ?  197 ARG B HD3  1  
ATOM 7789   H HE   . ARG B 1 197 ? 12.378  -28.699 214.684 1.00 0.00 ?  197 ARG B HE   1  
ATOM 7790   H HH11 . ARG B 1 197 ? 13.016  -31.696 212.870 1.00 0.00 ?  197 ARG B HH11 1  
ATOM 7791   H HH12 . ARG B 1 197 ? 14.738  -31.508 212.867 1.00 0.00 ?  197 ARG B HH12 1  
ATOM 7792   H HH21 . ARG B 1 197 ? 14.722  -28.450 214.691 1.00 0.00 ?  197 ARG B HH21 1  
ATOM 7793   H HH22 . ARG B 1 197 ? 15.722  -29.633 213.920 1.00 0.00 ?  197 ARG B HH22 1  
ATOM 7794   N N    . GLU B 1 198 ? 5.934   -31.056 213.200 1.00 0.00 ?  198 GLU B N    1  
ATOM 7795   C CA   . GLU B 1 198 ? 4.795   -31.934 213.244 1.00 0.00 ?  198 GLU B CA   1  
ATOM 7796   C C    . GLU B 1 198 ? 4.082   -31.942 211.923 1.00 0.00 ?  198 GLU B C    1  
ATOM 7797   O O    . GLU B 1 198 ? 3.081   -32.634 211.794 1.00 0.00 ?  198 GLU B O    1  
ATOM 7798   C CB   . GLU B 1 198 ? 3.770   -31.541 214.320 1.00 0.00 ?  198 GLU B CB   1  
ATOM 7799   C CG   . GLU B 1 198 ? 4.306   -31.744 215.739 1.00 0.00 ?  198 GLU B CG   1  
ATOM 7800   C CD   . GLU B 1 198 ? 3.252   -31.251 216.720 1.00 0.00 ?  198 GLU B CD   1  
ATOM 7801   O OE1  . GLU B 1 198 ? 2.261   -30.624 216.257 1.00 0.00 ?  198 GLU B OE1  1  
ATOM 7802   O OE2  . GLU B 1 198 ? 3.417   -31.501 217.945 1.00 0.00 -1 198 GLU B OE2  1  
ATOM 7803   H H    . GLU B 1 198 ? 5.780   -30.120 213.505 1.00 0.00 ?  198 GLU B H    1  
ATOM 7804   H HA   . GLU B 1 198 ? 5.167   -32.926 213.442 1.00 0.00 ?  198 GLU B HA   1  
ATOM 7805   H HB2  . GLU B 1 198 ? 3.495   -30.472 214.183 1.00 0.00 ?  198 GLU B HB2  1  
ATOM 7806   H HB3  . GLU B 1 198 ? 2.854   -32.153 214.189 1.00 0.00 ?  198 GLU B HB3  1  
ATOM 7807   H HG2  . GLU B 1 198 ? 4.513   -32.822 215.919 1.00 0.00 ?  198 GLU B HG2  1  
ATOM 7808   H HG3  . GLU B 1 198 ? 5.241   -31.164 215.884 1.00 0.00 ?  198 GLU B HG3  1  
ATOM 7809   N N    . HIS B 1 199 ? 4.552   -31.127 210.947 1.00 0.00 ?  199 HIS B N    1  
ATOM 7810   C CA   . HIS B 1 199 ? 3.895   -30.996 209.647 1.00 0.00 ?  199 HIS B CA   1  
ATOM 7811   C C    . HIS B 1 199 ? 3.902   -32.260 208.826 1.00 0.00 ?  199 HIS B C    1  
ATOM 7812   O O    . HIS B 1 199 ? 4.713   -32.428 207.915 1.00 0.00 ?  199 HIS B O    1  
ATOM 7813   C CB   . HIS B 1 199 ? 4.409   -29.850 208.746 1.00 0.00 ?  199 HIS B CB   1  
ATOM 7814   C CG   . HIS B 1 199 ? 3.712   -28.532 208.967 1.00 0.00 ?  199 HIS B CG   1  
ATOM 7815   N ND1  . HIS B 1 199 ? 3.975   -27.472 208.112 1.00 0.00 ?  199 HIS B ND1  1  
ATOM 7816   C CD2  . HIS B 1 199 ? 2.777   -28.169 209.898 1.00 0.00 ?  199 HIS B CD2  1  
ATOM 7817   C CE1  . HIS B 1 199 ? 3.198   -26.495 208.543 1.00 0.00 ?  199 HIS B CE1  1  
ATOM 7818   N NE2  . HIS B 1 199 ? 2.455   -26.861 209.615 1.00 0.00 ?  199 HIS B NE2  1  
ATOM 7819   H H    . HIS B 1 199 ? 5.373   -30.576 211.073 1.00 0.00 ?  199 HIS B H    1  
ATOM 7820   H HA   . HIS B 1 199 ? 2.862   -30.791 209.882 1.00 0.00 ?  199 HIS B HA   1  
ATOM 7821   H HB2  . HIS B 1 199 ? 5.485   -29.689 208.911 1.00 0.00 ?  199 HIS B HB2  1  
ATOM 7822   H HB3  . HIS B 1 199 ? 4.259   -30.123 207.679 1.00 0.00 ?  199 HIS B HB3  1  
ATOM 7823   H HD2  . HIS B 1 199 ? 2.339   -28.731 210.714 1.00 0.00 ?  199 HIS B HD2  1  
ATOM 7824   H HE1  . HIS B 1 199 ? 3.141   -25.499 208.102 1.00 0.00 ?  199 HIS B HE1  1  
ATOM 7825   N N    . SER B 1 200 ? 3.003   -33.209 209.176 1.00 0.00 ?  200 SER B N    1  
ATOM 7826   C CA   . SER B 1 200 ? 2.839   -34.417 208.410 1.00 0.00 ?  200 SER B CA   1  
ATOM 7827   C C    . SER B 1 200 ? 2.149   -34.017 207.122 1.00 0.00 ?  200 SER B C    1  
ATOM 7828   O O    . SER B 1 200 ? 2.014   -34.834 206.210 1.00 0.00 ?  200 SER B O    1  
ATOM 7829   C CB   . SER B 1 200 ? 1.957   -35.462 209.116 1.00 0.00 ?  200 SER B CB   1  
ATOM 7830   O OG   . SER B 1 200 ? 0.637   -34.958 209.259 1.00 0.00 ?  200 SER B OG   1  
ATOM 7831   H H    . SER B 1 200 ? 2.420   -33.115 209.979 1.00 0.00 ?  200 SER B H    1  
ATOM 7832   H HA   . SER B 1 200 ? 3.818   -34.817 208.193 1.00 0.00 ?  200 SER B HA   1  
ATOM 7833   H HB2  . SER B 1 200 ? 1.920   -36.396 208.516 1.00 0.00 ?  200 SER B HB2  1  
ATOM 7834   H HB3  . SER B 1 200 ? 2.364   -35.692 210.122 1.00 0.00 ?  200 SER B HB3  1  
ATOM 7835   H HG   . SER B 1 200 ? 0.689   -34.268 209.924 1.00 0.00 ?  200 SER B HG   1  
ATOM 7836   N N    . SER B 1 201 ? 1.654   -32.739 207.096 1.00 0.00 ?  201 SER B N    1  
ATOM 7837   C CA   . SER B 1 201 ? 0.999   -32.126 205.960 1.00 0.00 ?  201 SER B CA   1  
ATOM 7838   C C    . SER B 1 201 ? -0.411  -32.604 205.861 1.00 0.00 ?  201 SER B C    1  
ATOM 7839   O O    . SER B 1 201 ? -1.022  -32.517 204.795 1.00 0.00 ?  201 SER B O    1  
ATOM 7840   C CB   . SER B 1 201 ? 1.692   -32.353 204.597 1.00 0.00 ?  201 SER B CB   1  
ATOM 7841   O OG   . SER B 1 201 ? 3.043   -31.913 204.657 1.00 0.00 ?  201 SER B OG   1  
ATOM 7842   H H    . SER B 1 201 ? 1.723   -32.151 207.900 1.00 0.00 ?  201 SER B H    1  
ATOM 7843   H HA   . SER B 1 201 ? 0.973   -31.067 206.169 1.00 0.00 ?  201 SER B HA   1  
ATOM 7844   H HB2  . SER B 1 201 ? 1.676   -33.430 204.329 1.00 0.00 ?  201 SER B HB2  1  
ATOM 7845   H HB3  . SER B 1 201 ? 1.167   -31.781 203.804 1.00 0.00 ?  201 SER B HB3  1  
ATOM 7846   H HG   . SER B 1 201 ? 3.068   -31.081 204.177 1.00 0.00 ?  201 SER B HG   1  
ATOM 7847   N N    . GLU B 1 202 ? -0.971  -33.109 206.979 1.00 0.00 ?  202 GLU B N    1  
ATOM 7848   C CA   . GLU B 1 202 ? -2.343  -33.547 206.971 1.00 0.00 ?  202 GLU B CA   1  
ATOM 7849   C C    . GLU B 1 202 ? -3.190  -32.374 207.363 1.00 0.00 ?  202 GLU B C    1  
ATOM 7850   O O    . GLU B 1 202 ? -4.392  -32.354 207.094 1.00 0.00 ?  202 GLU B O    1  
ATOM 7851   C CB   . GLU B 1 202 ? -2.631  -34.685 207.971 1.00 0.00 ?  202 GLU B CB   1  
ATOM 7852   C CG   . GLU B 1 202 ? -1.953  -36.008 207.594 1.00 0.00 ?  202 GLU B CG   1  
ATOM 7853   C CD   . GLU B 1 202 ? -2.478  -36.456 206.238 1.00 0.00 ?  202 GLU B CD   1  
ATOM 7854   O OE1  . GLU B 1 202 ? -3.726  -36.453 206.057 1.00 0.00 ?  202 GLU B OE1  1  
ATOM 7855   O OE2  . GLU B 1 202 ? -1.641  -36.807 205.365 1.00 0.00 -1 202 GLU B OE2  1  
ATOM 7856   H H    . GLU B 1 202 ? -0.475  -33.200 207.839 1.00 0.00 ?  202 GLU B H    1  
ATOM 7857   H HA   . GLU B 1 202 ? -2.594  -33.849 205.968 1.00 0.00 ?  202 GLU B HA   1  
ATOM 7858   H HB2  . GLU B 1 202 ? -2.284  -34.375 208.980 1.00 0.00 ?  202 GLU B HB2  1  
ATOM 7859   H HB3  . GLU B 1 202 ? -3.729  -34.849 208.023 1.00 0.00 ?  202 GLU B HB3  1  
ATOM 7860   H HG2  . GLU B 1 202 ? -0.852  -35.868 207.537 1.00 0.00 ?  202 GLU B HG2  1  
ATOM 7861   H HG3  . GLU B 1 202 ? -2.183  -36.786 208.351 1.00 0.00 ?  202 GLU B HG3  1  
ATOM 7862   N N    . GLY B 1 203 ? -2.558  -31.356 208.000 1.00 0.00 ?  203 GLY B N    1  
ATOM 7863   C CA   . GLY B 1 203 ? -3.282  -30.194 208.457 1.00 0.00 ?  203 GLY B CA   1  
ATOM 7864   C C    . GLY B 1 203 ? -2.899  -29.039 207.596 1.00 0.00 ?  203 GLY B C    1  
ATOM 7865   O O    . GLY B 1 203 ? -3.047  -29.082 206.376 1.00 0.00 ?  203 GLY B O    1  
ATOM 7866   H H    . GLY B 1 203 ? -1.577  -31.367 208.182 1.00 0.00 ?  203 GLY B H    1  
ATOM 7867   H HA2  . GLY B 1 203 ? -4.334  -30.385 208.345 1.00 0.00 ?  203 GLY B HA2  1  
ATOM 7868   H HA3  . GLY B 1 203 ? -2.969  -29.995 209.471 1.00 0.00 ?  203 GLY B HA3  1  
ATOM 7869   N N    . TYR B 1 204 ? -2.419  -27.947 208.232 1.00 0.00 ?  204 TYR B N    1  
ATOM 7870   C CA   . TYR B 1 204 ? -2.031  -26.791 207.482 1.00 0.00 ?  204 TYR B CA   1  
ATOM 7871   C C    . TYR B 1 204 ? -0.647  -27.041 206.981 1.00 0.00 ?  204 TYR B C    1  
ATOM 7872   O O    . TYR B 1 204 ? 0.334   -26.552 207.527 1.00 0.00 ?  204 TYR B O    1  
ATOM 7873   C CB   . TYR B 1 204 ? -2.059  -25.483 208.299 1.00 0.00 ?  204 TYR B CB   1  
ATOM 7874   C CG   . TYR B 1 204 ? -1.636  -25.639 209.721 1.00 0.00 ?  204 TYR B CG   1  
ATOM 7875   C CD1  . TYR B 1 204 ? -2.544  -26.056 210.670 1.00 0.00 ?  204 TYR B CD1  1  
ATOM 7876   C CD2  . TYR B 1 204 ? -0.347  -25.348 210.113 1.00 0.00 ?  204 TYR B CD2  1  
ATOM 7877   C CE1  . TYR B 1 204 ? -2.169  -26.186 211.985 1.00 0.00 ?  204 TYR B CE1  1  
ATOM 7878   C CE2  . TYR B 1 204 ? 0.028   -25.481 211.428 1.00 0.00 ?  204 TYR B CE2  1  
ATOM 7879   C CZ   . TYR B 1 204 ? -0.883  -25.899 212.363 1.00 0.00 ?  204 TYR B CZ   1  
ATOM 7880   O OH   . TYR B 1 204 ? -0.496  -26.028 213.711 1.00 0.00 ?  204 TYR B OH   1  
ATOM 7881   H H    . TYR B 1 204 ? -2.313  -27.901 209.223 1.00 0.00 ?  204 TYR B H    1  
ATOM 7882   H HA   . TYR B 1 204 ? -2.700  -26.715 206.637 1.00 0.00 ?  204 TYR B HA   1  
ATOM 7883   H HB2  . TYR B 1 204 ? -1.378  -24.737 207.838 1.00 0.00 ?  204 TYR B HB2  1  
ATOM 7884   H HB3  . TYR B 1 204 ? -3.090  -25.067 208.303 1.00 0.00 ?  204 TYR B HB3  1  
ATOM 7885   H HD1  . TYR B 1 204 ? -3.558  -26.287 210.376 1.00 0.00 ?  204 TYR B HD1  1  
ATOM 7886   H HD2  . TYR B 1 204 ? 0.375   -25.013 209.383 1.00 0.00 ?  204 TYR B HD2  1  
ATOM 7887   H HE1  . TYR B 1 204 ? -2.887  -26.514 212.722 1.00 0.00 ?  204 TYR B HE1  1  
ATOM 7888   H HE2  . TYR B 1 204 ? 1.040   -25.254 211.726 1.00 0.00 ?  204 TYR B HE2  1  
ATOM 7889   H HH   . TYR B 1 204 ? -1.043  -26.709 214.113 1.00 0.00 ?  204 TYR B HH   1  
ATOM 7890   N N    . SER B 1 205 ? -0.568  -27.816 205.888 1.00 0.00 ?  205 SER B N    1  
ATOM 7891   C CA   . SER B 1 205 ? 0.691   -28.171 205.296 1.00 0.00 ?  205 SER B CA   1  
ATOM 7892   C C    . SER B 1 205 ? 1.360   -26.930 204.805 1.00 0.00 ?  205 SER B C    1  
ATOM 7893   O O    . SER B 1 205 ? 0.688   -25.993 204.395 1.00 0.00 ?  205 SER B O    1  
ATOM 7894   C CB   . SER B 1 205 ? 0.526   -29.086 204.075 1.00 0.00 ?  205 SER B CB   1  
ATOM 7895   O OG   . SER B 1 205 ? 1.795   -29.400 203.523 1.00 0.00 ?  205 SER B OG   1  
ATOM 7896   H H    . SER B 1 205 ? -1.380  -28.180 205.439 1.00 0.00 ?  205 SER B H    1  
ATOM 7897   H HA   . SER B 1 205 ? 1.301   -28.644 206.049 1.00 0.00 ?  205 SER B HA   1  
ATOM 7898   H HB2  . SER B 1 205 ? 0.011   -30.022 204.360 1.00 0.00 ?  205 SER B HB2  1  
ATOM 7899   H HB3  . SER B 1 205 ? -0.079  -28.573 203.299 1.00 0.00 ?  205 SER B HB3  1  
ATOM 7900   H HG   . SER B 1 205 ? 2.433   -29.245 204.222 1.00 0.00 ?  205 SER B HG   1  
ATOM 7901   N N    . LEU B 1 206 ? 2.720   -26.905 204.887 1.00 0.00 ?  206 LEU B N    1  
ATOM 7902   C CA   . LEU B 1 206 ? 3.501   -25.788 204.387 1.00 0.00 ?  206 LEU B CA   1  
ATOM 7903   C C    . LEU B 1 206 ? 3.131   -24.539 205.158 1.00 0.00 ?  206 LEU B C    1  
ATOM 7904   O O    . LEU B 1 206 ? 2.184   -23.839 204.800 1.00 0.00 ?  206 LEU B O    1  
ATOM 7905   C CB   . LEU B 1 206 ? 3.287   -25.493 202.885 1.00 0.00 ?  206 LEU B CB   1  
ATOM 7906   C CG   . LEU B 1 206 ? 4.373   -26.113 201.989 1.00 0.00 ?  206 LEU B CG   1  
ATOM 7907   C CD1  . LEU B 1 206 ? 4.508   -27.623 202.231 1.00 0.00 ?  206 LEU B CD1  1  
ATOM 7908   C CD2  . LEU B 1 206 ? 4.104   -25.811 200.504 1.00 0.00 ?  206 LEU B CD2  1  
ATOM 7909   H H    . LEU B 1 206 ? 3.238   -27.648 205.308 1.00 0.00 ?  206 LEU B H    1  
ATOM 7910   H HA   . LEU B 1 206 ? 4.540   -26.016 204.576 1.00 0.00 ?  206 LEU B HA   1  
ATOM 7911   H HB2  . LEU B 1 206 ? 2.294   -25.883 202.574 1.00 0.00 ?  206 LEU B HB2  1  
ATOM 7912   H HB3  . LEU B 1 206 ? 3.288   -24.395 202.729 1.00 0.00 ?  206 LEU B HB3  1  
ATOM 7913   H HG   . LEU B 1 206 ? 5.341   -25.643 202.258 1.00 0.00 ?  206 LEU B HG   1  
ATOM 7914   H HD11 . LEU B 1 206 ? 5.020   -28.107 201.372 1.00 0.00 ?  206 LEU B HD11 1  
ATOM 7915   H HD12 . LEU B 1 206 ? 3.507   -28.086 202.352 1.00 0.00 ?  206 LEU B HD12 1  
ATOM 7916   H HD13 . LEU B 1 206 ? 5.103   -27.816 203.150 1.00 0.00 ?  206 LEU B HD13 1  
ATOM 7917   H HD21 . LEU B 1 206 ? 4.172   -24.718 200.314 1.00 0.00 ?  206 LEU B HD21 1  
ATOM 7918   H HD22 . LEU B 1 206 ? 3.088   -26.158 200.217 1.00 0.00 ?  206 LEU B HD22 1  
ATOM 7919   H HD23 . LEU B 1 206 ? 4.850   -26.328 199.864 1.00 0.00 ?  206 LEU B HD23 1  
ATOM 7920   N N    . MET B 1 207 ? 3.906   -24.195 206.227 1.00 0.00 ?  207 MET B N    1  
ATOM 7921   C CA   . MET B 1 207 ? 3.585   -23.011 207.000 1.00 0.00 ?  207 MET B CA   1  
ATOM 7922   C C    . MET B 1 207 ? 4.196   -21.843 206.292 1.00 0.00 ?  207 MET B C    1  
ATOM 7923   O O    . MET B 1 207 ? 5.414   -21.769 206.105 1.00 0.00 ?  207 MET B O    1  
ATOM 7924   C CB   . MET B 1 207 ? 4.133   -23.032 208.461 1.00 0.00 ?  207 MET B CB   1  
ATOM 7925   C CG   . MET B 1 207 ? 3.741   -21.789 209.308 1.00 0.00 ?  207 MET B CG   1  
ATOM 7926   S SD   . MET B 1 207 ? 4.296   -21.907 211.035 1.00 0.00 ?  207 MET B SD   1  
ATOM 7927   C CE   . MET B 1 207 ? 3.608   -20.302 211.537 1.00 0.00 ?  207 MET B CE   1  
ATOM 7928   H H    . MET B 1 207 ? 4.709   -24.717 206.509 1.00 0.00 ?  207 MET B H    1  
ATOM 7929   H HA   . MET B 1 207 ? 2.511   -22.902 207.002 1.00 0.00 ?  207 MET B HA   1  
ATOM 7930   H HB2  . MET B 1 207 ? 3.754   -23.944 208.969 1.00 0.00 ?  207 MET B HB2  1  
ATOM 7931   H HB3  . MET B 1 207 ? 5.242   -23.101 208.425 1.00 0.00 ?  207 MET B HB3  1  
ATOM 7932   H HG2  . MET B 1 207 ? 4.181   -20.888 208.835 1.00 0.00 ?  207 MET B HG2  1  
ATOM 7933   H HG3  . MET B 1 207 ? 2.636   -21.677 209.278 1.00 0.00 ?  207 MET B HG3  1  
ATOM 7934   H HE1  . MET B 1 207 ? 3.292   -20.323 212.602 1.00 0.00 ?  207 MET B HE1  1  
ATOM 7935   H HE2  . MET B 1 207 ? 2.720   -20.041 210.921 1.00 0.00 ?  207 MET B HE2  1  
ATOM 7936   H HE3  . MET B 1 207 ? 4.359   -19.493 211.417 1.00 0.00 ?  207 MET B HE3  1  
ATOM 7937   N N    . LYS B 1 208 ? 3.327   -20.893 205.882 1.00 0.00 ?  208 LYS B N    1  
ATOM 7938   C CA   . LYS B 1 208 ? 3.776   -19.708 205.211 1.00 0.00 ?  208 LYS B CA   1  
ATOM 7939   C C    . LYS B 1 208 ? 4.559   -18.959 206.220 1.00 0.00 ?  208 LYS B C    1  
ATOM 7940   O O    . LYS B 1 208 ? 4.225   -18.979 207.399 1.00 0.00 ?  208 LYS B O    1  
ATOM 7941   C CB   . LYS B 1 208 ? 2.626   -18.811 204.732 1.00 0.00 ?  208 LYS B CB   1  
ATOM 7942   C CG   . LYS B 1 208 ? 1.427   -18.844 205.683 1.00 0.00 ?  208 LYS B CG   1  
ATOM 7943   C CD   . LYS B 1 208 ? 0.371   -19.869 205.259 1.00 0.00 ?  208 LYS B CD   1  
ATOM 7944   C CE   . LYS B 1 208 ? -0.229  -20.620 206.450 1.00 0.00 ?  208 LYS B CE   1  
ATOM 7945   N NZ   . LYS B 1 208 ? -1.201  -21.634 205.983 1.00 0.00 1  208 LYS B NZ   1  
ATOM 7946   H H    . LYS B 1 208 ? 2.343   -20.976 206.021 1.00 0.00 ?  208 LYS B H    1  
ATOM 7947   H HA   . LYS B 1 208 ? 4.415   -19.999 204.391 1.00 0.00 ?  208 LYS B HA   1  
ATOM 7948   H HB2  . LYS B 1 208 ? 2.993   -17.766 204.642 1.00 0.00 ?  208 LYS B HB2  1  
ATOM 7949   H HB3  . LYS B 1 208 ? 2.297   -19.149 203.726 1.00 0.00 ?  208 LYS B HB3  1  
ATOM 7950   H HG2  . LYS B 1 208 ? 1.779   -19.088 206.707 1.00 0.00 ?  208 LYS B HG2  1  
ATOM 7951   H HG3  . LYS B 1 208 ? 0.961   -17.836 205.713 1.00 0.00 ?  208 LYS B HG3  1  
ATOM 7952   H HD2  . LYS B 1 208 ? -0.443  -19.345 204.714 1.00 0.00 ?  208 LYS B HD2  1  
ATOM 7953   H HD3  . LYS B 1 208 ? 0.834   -20.601 204.563 1.00 0.00 ?  208 LYS B HD3  1  
ATOM 7954   H HE2  . LYS B 1 208 ? 0.566   -21.147 207.019 1.00 0.00 ?  208 LYS B HE2  1  
ATOM 7955   H HE3  . LYS B 1 208 ? -0.762  -19.919 207.126 1.00 0.00 ?  208 LYS B HE3  1  
ATOM 7956   H HZ1  . LYS B 1 208 ? -1.359  -22.334 206.735 1.00 0.00 ?  208 LYS B HZ1  1  
ATOM 7957   H HZ2  . LYS B 1 208 ? -0.824  -22.110 205.139 1.00 0.00 ?  208 LYS B HZ2  1  
ATOM 7958   H HZ3  . LYS B 1 208 ? -2.100  -21.169 205.747 1.00 0.00 ?  208 LYS B HZ3  1  
ATOM 7959   N N    . ILE B 1 209 ? 5.602   -18.244 205.771 1.00 0.00 ?  209 ILE B N    1  
ATOM 7960   C CA   . ILE B 1 209 ? 6.453   -17.567 206.696 1.00 0.00 ?  209 ILE B CA   1  
ATOM 7961   C C    . ILE B 1 209 ? 6.563   -16.131 206.342 1.00 0.00 ?  209 ILE B C    1  
ATOM 7962   O O    . ILE B 1 209 ? 6.890   -15.791 205.207 1.00 0.00 ?  209 ILE B O    1  
ATOM 7963   C CB   . ILE B 1 209 ? 7.817   -18.103 206.633 1.00 0.00 ?  209 ILE B CB   1  
ATOM 7964   C CG1  . ILE B 1 209 ? 7.816   -19.632 206.842 1.00 0.00 ?  209 ILE B CG1  1  
ATOM 7965   C CG2  . ILE B 1 209 ? 8.653   -17.368 207.696 1.00 0.00 ?  209 ILE B CG2  1  
ATOM 7966   C CD1  . ILE B 1 209 ? 7.186   -20.064 208.173 1.00 0.00 ?  209 ILE B CD1  1  
ATOM 7967   H H    . ILE B 1 209 ? 5.829   -18.162 204.804 1.00 0.00 ?  209 ILE B H    1  
ATOM 7968   H HA   . ILE B 1 209 ? 6.055   -17.663 207.690 1.00 0.00 ?  209 ILE B HA   1  
ATOM 7969   H HB   . ILE B 1 209 ? 8.245   -17.873 205.655 1.00 0.00 ?  209 ILE B HB   1  
ATOM 7970   H HG12 . ILE B 1 209 ? 7.263   -20.114 206.007 1.00 0.00 ?  209 ILE B HG12 1  
ATOM 7971   H HG13 . ILE B 1 209 ? 8.864   -19.997 206.810 1.00 0.00 ?  209 ILE B HG13 1  
ATOM 7972   H HG21 . ILE B 1 209 ? 8.000   -17.013 208.522 1.00 0.00 ?  209 ILE B HG21 1  
ATOM 7973   H HG22 . ILE B 1 209 ? 9.164   -16.491 207.246 1.00 0.00 ?  209 ILE B HG22 1  
ATOM 7974   H HG23 . ILE B 1 209 ? 9.422   -18.049 208.119 1.00 0.00 ?  209 ILE B HG23 1  
ATOM 7975   H HD11 . ILE B 1 209 ? 7.187   -19.227 208.903 1.00 0.00 ?  209 ILE B HD11 1  
ATOM 7976   H HD12 . ILE B 1 209 ? 7.755   -20.912 208.610 1.00 0.00 ?  209 ILE B HD12 1  
ATOM 7977   H HD13 . ILE B 1 209 ? 6.136   -20.391 208.012 1.00 0.00 ?  209 ILE B HD13 1  
ATOM 7978   N N    . HIS B 1 210 ? 6.348   -15.255 207.344 1.00 0.00 ?  210 HIS B N    1  
ATOM 7979   C CA   . HIS B 1 210 ? 6.467   -13.850 207.111 1.00 0.00 ?  210 HIS B CA   1  
ATOM 7980   C C    . HIS B 1 210 ? 7.809   -13.451 207.639 1.00 0.00 ?  210 HIS B C    1  
ATOM 7981   O O    . HIS B 1 210 ? 8.038   -13.459 208.849 1.00 0.00 ?  210 HIS B O    1  
ATOM 7982   C CB   . HIS B 1 210 ? 5.402   -13.022 207.853 1.00 0.00 ?  210 HIS B CB   1  
ATOM 7983   C CG   . HIS B 1 210 ? 3.989   -13.374 207.470 1.00 0.00 ?  210 HIS B CG   1  
ATOM 7984   N ND1  . HIS B 1 210 ? 3.516   -13.067 206.202 1.00 0.00 ?  210 HIS B ND1  1  
ATOM 7985   C CD2  . HIS B 1 210 ? 3.002   -13.948 208.218 1.00 0.00 ?  210 HIS B CD2  1  
ATOM 7986   C CE1  . HIS B 1 210 ? 2.252   -13.455 206.215 1.00 0.00 ?  210 HIS B CE1  1  
ATOM 7987   N NE2  . HIS B 1 210 ? 1.891   -13.993 207.406 1.00 0.00 ?  210 HIS B NE2  1  
ATOM 7988   H H    . HIS B 1 210 ? 6.107   -15.539 208.270 1.00 0.00 ?  210 HIS B H    1  
ATOM 7989   H HA   . HIS B 1 210 ? 6.421   -13.666 206.050 1.00 0.00 ?  210 HIS B HA   1  
ATOM 7990   H HB2  . HIS B 1 210 ? 5.503   -13.183 208.948 1.00 0.00 ?  210 HIS B HB2  1  
ATOM 7991   H HB3  . HIS B 1 210 ? 5.553   -11.942 207.640 1.00 0.00 ?  210 HIS B HB3  1  
ATOM 7992   H HD2  . HIS B 1 210 ? 3.024   -14.318 209.238 1.00 0.00 ?  210 HIS B HD2  1  
ATOM 7993   H HE1  . HIS B 1 210 ? 1.558   -13.353 205.383 1.00 0.00 ?  210 HIS B HE1  1  
ATOM 7994   H HE2  . HIS B 1 210 ? 0.990   -14.356 207.661 1.00 0.00 ?  210 HIS B HE2  1  
ATOM 7995   N N    . ASP B 1 211 ? 8.725   -13.076 206.715 1.00 0.00 ?  211 ASP B N    1  
ATOM 7996   C CA   . ASP B 1 211 ? 10.044  -12.653 207.102 1.00 0.00 ?  211 ASP B CA   1  
ATOM 7997   C C    . ASP B 1 211 ? 10.233  -11.340 206.437 1.00 0.00 ?  211 ASP B C    1  
ATOM 7998   O O    . ASP B 1 211 ? 10.730  -11.256 205.319 1.00 0.00 ?  211 ASP B O    1  
ATOM 7999   C CB   . ASP B 1 211 ? 11.162  -13.596 206.625 1.00 0.00 ?  211 ASP B CB   1  
ATOM 8000   C CG   . ASP B 1 211 ? 12.540  -13.111 207.055 1.00 0.00 ?  211 ASP B CG   1  
ATOM 8001   O OD1  . ASP B 1 211 ? 12.821  -13.136 208.283 1.00 0.00 ?  211 ASP B OD1  1  
ATOM 8002   O OD2  . ASP B 1 211 ? 13.330  -12.710 206.159 1.00 0.00 -1 211 ASP B OD2  1  
ATOM 8003   H H    . ASP B 1 211 ? 8.530   -13.076 205.735 1.00 0.00 ?  211 ASP B H    1  
ATOM 8004   H HA   . ASP B 1 211 ? 10.072  -12.525 208.172 1.00 0.00 ?  211 ASP B HA   1  
ATOM 8005   H HB2  . ASP B 1 211 ? 10.992  -14.612 207.045 1.00 0.00 ?  211 ASP B HB2  1  
ATOM 8006   H HB3  . ASP B 1 211 ? 11.138  -13.668 205.517 1.00 0.00 ?  211 ASP B HB3  1  
ATOM 8007   N N    . LEU B 1 212 ? 9.828   -10.274 207.129 1.00 0.00 ?  212 LEU B N    1  
ATOM 8008   C CA   . LEU B 1 212 ? 9.933   -8.958  206.580 1.00 0.00 ?  212 LEU B CA   1  
ATOM 8009   C C    . LEU B 1 212 ? 11.261  -8.424  206.952 1.00 0.00 ?  212 LEU B C    1  
ATOM 8010   O O    . LEU B 1 212 ? 11.671  -7.375  206.490 1.00 0.00 ?  212 LEU B O    1  
ATOM 8011   C CB   . LEU B 1 212 ? 8.865   -7.994  207.122 1.00 0.00 ?  212 LEU B CB   1  
ATOM 8012   C CG   . LEU B 1 212 ? 7.434   -8.469  206.818 1.00 0.00 ?  212 LEU B CG   1  
ATOM 8013   C CD1  . LEU B 1 212 ? 6.388   -7.525  207.433 1.00 0.00 ?  212 LEU B CD1  1  
ATOM 8014   C CD2  . LEU B 1 212 ? 7.208   -8.642  205.306 1.00 0.00 ?  212 LEU B CD2  1  
ATOM 8015   H H    . LEU B 1 212 ? 9.441   -10.345 208.045 1.00 0.00 ?  212 LEU B H    1  
ATOM 8016   H HA   . LEU B 1 212 ? 9.864   -9.034  205.507 1.00 0.00 ?  212 LEU B HA   1  
ATOM 8017   H HB2  . LEU B 1 212 ? 8.992   -7.893  208.223 1.00 0.00 ?  212 LEU B HB2  1  
ATOM 8018   H HB3  . LEU B 1 212 ? 9.012   -6.993  206.665 1.00 0.00 ?  212 LEU B HB3  1  
ATOM 8019   H HG   . LEU B 1 212 ? 7.305   -9.466  207.293 1.00 0.00 ?  212 LEU B HG   1  
ATOM 8020   H HD11 . LEU B 1 212 ? 6.428   -7.575  208.542 1.00 0.00 ?  212 LEU B HD11 1  
ATOM 8021   H HD12 . LEU B 1 212 ? 5.366   -7.814  207.103 1.00 0.00 ?  212 LEU B HD12 1  
ATOM 8022   H HD13 . LEU B 1 212 ? 6.579   -6.477  207.118 1.00 0.00 ?  212 LEU B HD13 1  
ATOM 8023   H HD21 . LEU B 1 212 ? 7.723   -7.835  204.744 1.00 0.00 ?  212 LEU B HD21 1  
ATOM 8024   H HD22 . LEU B 1 212 ? 6.123   -8.602  205.071 1.00 0.00 ?  212 LEU B HD22 1  
ATOM 8025   H HD23 . LEU B 1 212 ? 7.608   -9.621  204.966 1.00 0.00 ?  212 LEU B HD23 1  
ATOM 8026   N N    . LYS B 1 213 ? 11.956  -9.152  207.814 1.00 0.00 ?  213 LYS B N    1  
ATOM 8027   C CA   . LYS B 1 213 ? 13.207  -8.694  208.325 1.00 0.00 ?  213 LYS B CA   1  
ATOM 8028   C C    . LYS B 1 213 ? 14.266  -8.561  207.265 1.00 0.00 ?  213 LYS B C    1  
ATOM 8029   O O    . LYS B 1 213 ? 15.179  -7.753  207.438 1.00 0.00 ?  213 LYS B O    1  
ATOM 8030   C CB   . LYS B 1 213 ? 13.752  -9.611  209.424 1.00 0.00 ?  213 LYS B CB   1  
ATOM 8031   C CG   . LYS B 1 213 ? 12.896  -9.548  210.690 1.00 0.00 ?  213 LYS B CG   1  
ATOM 8032   C CD   . LYS B 1 213 ? 13.426  -10.442 211.809 1.00 0.00 ?  213 LYS B CD   1  
ATOM 8033   C CE   . LYS B 1 213 ? 12.580  -10.342 213.081 1.00 0.00 ?  213 LYS B CE   1  
ATOM 8034   N NZ   . LYS B 1 213 ? 11.208  -10.837 212.830 1.00 0.00 1  213 LYS B NZ   1  
ATOM 8035   H H    . LYS B 1 213 ? 11.642  -10.040 208.140 1.00 0.00 ?  213 LYS B H    1  
ATOM 8036   H HA   . LYS B 1 213 ? 13.029  -7.729  208.745 1.00 0.00 ?  213 LYS B HA   1  
ATOM 8037   H HB2  . LYS B 1 213 ? 13.777  -10.657 209.048 1.00 0.00 ?  213 LYS B HB2  1  
ATOM 8038   H HB3  . LYS B 1 213 ? 14.789  -9.307  209.675 1.00 0.00 ?  213 LYS B HB3  1  
ATOM 8039   H HG2  . LYS B 1 213 ? 12.862  -8.499  211.051 1.00 0.00 ?  213 LYS B HG2  1  
ATOM 8040   H HG3  . LYS B 1 213 ? 11.857  -9.856  210.439 1.00 0.00 ?  213 LYS B HG3  1  
ATOM 8041   H HD2  . LYS B 1 213 ? 13.433  -11.496 211.460 1.00 0.00 ?  213 LYS B HD2  1  
ATOM 8042   H HD3  . LYS B 1 213 ? 14.471  -10.149 212.044 1.00 0.00 ?  213 LYS B HD3  1  
ATOM 8043   H HE2  . LYS B 1 213 ? 13.020  -10.959 213.892 1.00 0.00 ?  213 LYS B HE2  1  
ATOM 8044   H HE3  . LYS B 1 213 ? 12.506  -9.286  213.416 1.00 0.00 ?  213 LYS B HE3  1  
ATOM 8045   H HZ1  . LYS B 1 213 ? 10.521  -10.100 213.088 1.00 0.00 ?  213 LYS B HZ1  1  
ATOM 8046   H HZ2  . LYS B 1 213 ? 11.035  -11.688 213.404 1.00 0.00 ?  213 LYS B HZ2  1  
ATOM 8047   H HZ3  . LYS B 1 213 ? 11.102  -11.070 211.822 1.00 0.00 ?  213 LYS B HZ3  1  
ATOM 8048   N N    . LEU B 1 214 ? 14.194  -9.331  206.158 1.00 0.00 ?  214 LEU B N    1  
ATOM 8049   C CA   . LEU B 1 214 ? 15.250  -9.269  205.169 1.00 0.00 ?  214 LEU B CA   1  
ATOM 8050   C C    . LEU B 1 214 ? 15.310  -7.878  204.613 1.00 0.00 ?  214 LEU B C    1  
ATOM 8051   O O    . LEU B 1 214 ? 16.384  -7.353  204.341 1.00 0.00 ?  214 LEU B O    1  
ATOM 8052   C CB   . LEU B 1 214 ? 15.029  -10.237 204.000 1.00 0.00 ?  214 LEU B CB   1  
ATOM 8053   C CG   . LEU B 1 214 ? 16.263  -10.379 203.100 1.00 0.00 ?  214 LEU B CG   1  
ATOM 8054   C CD1  . LEU B 1 214 ? 17.378  -11.200 203.775 1.00 0.00 ?  214 LEU B CD1  1  
ATOM 8055   C CD2  . LEU B 1 214 ? 15.893  -10.950 201.726 1.00 0.00 ?  214 LEU B CD2  1  
ATOM 8056   H H    . LEU B 1 214 ? 13.440  -9.958  205.979 1.00 0.00 ?  214 LEU B H    1  
ATOM 8057   H HA   . LEU B 1 214 ? 16.179  -9.491  205.666 1.00 0.00 ?  214 LEU B HA   1  
ATOM 8058   H HB2  . LEU B 1 214 ? 14.755  -11.237 204.404 1.00 0.00 ?  214 LEU B HB2  1  
ATOM 8059   H HB3  . LEU B 1 214 ? 14.184  -9.869  203.385 1.00 0.00 ?  214 LEU B HB3  1  
ATOM 8060   H HG   . LEU B 1 214 ? 16.664  -9.369  202.946 1.00 0.00 ?  214 LEU B HG   1  
ATOM 8061   H HD11 . LEU B 1 214 ? 17.048  -12.252 203.916 1.00 0.00 ?  214 LEU B HD11 1  
ATOM 8062   H HD12 . LEU B 1 214 ? 17.636  -10.774 204.766 1.00 0.00 ?  214 LEU B HD12 1  
ATOM 8063   H HD13 . LEU B 1 214 ? 18.291  -11.200 203.141 1.00 0.00 ?  214 LEU B HD13 1  
ATOM 8064   H HD21 . LEU B 1 214 ? 15.276  -10.219 201.159 1.00 0.00 ?  214 LEU B HD21 1  
ATOM 8065   H HD22 . LEU B 1 214 ? 15.313  -11.888 201.846 1.00 0.00 ?  214 LEU B HD22 1  
ATOM 8066   H HD23 . LEU B 1 214 ? 16.810  -11.171 201.139 1.00 0.00 ?  214 LEU B HD23 1  
ATOM 8067   N N    . VAL B 1 215 ? 14.137  -7.293  204.376 1.00 0.00 ?  215 VAL B N    1  
ATOM 8068   C CA   . VAL B 1 215 ? 14.051  -5.963  203.838 1.00 0.00 ?  215 VAL B CA   1  
ATOM 8069   C C    . VAL B 1 215 ? 13.837  -4.931  204.916 1.00 0.00 ?  215 VAL B C    1  
ATOM 8070   O O    . VAL B 1 215 ? 13.940  -3.745  204.636 1.00 0.00 ?  215 VAL B O    1  
ATOM 8071   C CB   . VAL B 1 215 ? 12.940  -5.828  202.848 1.00 0.00 ?  215 VAL B CB   1  
ATOM 8072   C CG1  . VAL B 1 215 ? 13.241  -6.795  201.695 1.00 0.00 ?  215 VAL B CG1  1  
ATOM 8073   C CG2  . VAL B 1 215 ? 11.595  -6.130  203.541 1.00 0.00 ?  215 VAL B CG2  1  
ATOM 8074   H H    . VAL B 1 215 ? 13.270  -7.748  204.562 1.00 0.00 ?  215 VAL B H    1  
ATOM 8075   H HA   . VAL B 1 215 ? 14.988  -5.754  203.349 1.00 0.00 ?  215 VAL B HA   1  
ATOM 8076   H HB   . VAL B 1 215 ? 12.914  -4.791  202.450 1.00 0.00 ?  215 VAL B HB   1  
ATOM 8077   H HG11 . VAL B 1 215 ? 14.186  -7.347  201.881 1.00 0.00 ?  215 VAL B HG11 1  
ATOM 8078   H HG12 . VAL B 1 215 ? 13.344  -6.230  200.752 1.00 0.00 ?  215 VAL B HG12 1  
ATOM 8079   H HG13 . VAL B 1 215 ? 12.415  -7.530  201.583 1.00 0.00 ?  215 VAL B HG13 1  
ATOM 8080   H HG21 . VAL B 1 215 ? 11.328  -5.314  204.247 1.00 0.00 ?  215 VAL B HG21 1  
ATOM 8081   H HG22 . VAL B 1 215 ? 11.652  -7.083  204.106 1.00 0.00 ?  215 VAL B HG22 1  
ATOM 8082   H HG23 . VAL B 1 215 ? 10.786  -6.217  202.784 1.00 0.00 ?  215 VAL B HG23 1  
ATOM 8083   N N    . ARG B 1 216 ? 13.501  -5.347  206.160 1.00 0.00 ?  216 ARG B N    1  
ATOM 8084   C CA   . ARG B 1 216 ? 13.116  -4.387  207.188 1.00 0.00 ?  216 ARG B CA   1  
ATOM 8085   C C    . ARG B 1 216 ? 14.167  -3.360  207.470 1.00 0.00 ?  216 ARG B C    1  
ATOM 8086   O O    . ARG B 1 216 ? 13.846  -2.174  207.492 1.00 0.00 ?  216 ARG B O    1  
ATOM 8087   C CB   . ARG B 1 216 ? 12.762  -5.052  208.533 1.00 0.00 ?  216 ARG B CB   1  
ATOM 8088   C CG   . ARG B 1 216 ? 12.396  -4.067  209.662 1.00 0.00 ?  216 ARG B CG   1  
ATOM 8089   C CD   . ARG B 1 216 ? 11.167  -3.201  209.347 1.00 0.00 ?  216 ARG B CD   1  
ATOM 8090   N NE   . ARG B 1 216 ? 9.998   -4.105  209.153 1.00 0.00 ?  216 ARG B NE   1  
ATOM 8091   C CZ   . ARG B 1 216 ? 8.806   -3.595  208.727 1.00 0.00 ?  216 ARG B CZ   1  
ATOM 8092   N NH1  . ARG B 1 216 ? 8.684   -2.257  208.484 1.00 0.00 1  216 ARG B NH1  1  
ATOM 8093   N NH2  . ARG B 1 216 ? 7.736   -4.423  208.547 1.00 0.00 ?  216 ARG B NH2  1  
ATOM 8094   H H    . ARG B 1 216 ? 13.496  -6.307  206.422 1.00 0.00 ?  216 ARG B H    1  
ATOM 8095   H HA   . ARG B 1 216 ? 12.244  -3.876  206.814 1.00 0.00 ?  216 ARG B HA   1  
ATOM 8096   H HB2  . ARG B 1 216 ? 11.905  -5.741  208.373 1.00 0.00 ?  216 ARG B HB2  1  
ATOM 8097   H HB3  . ARG B 1 216 ? 13.628  -5.663  208.865 1.00 0.00 ?  216 ARG B HB3  1  
ATOM 8098   H HG2  . ARG B 1 216 ? 12.186  -4.650  210.583 1.00 0.00 ?  216 ARG B HG2  1  
ATOM 8099   H HG3  . ARG B 1 216 ? 13.261  -3.405  209.878 1.00 0.00 ?  216 ARG B HG3  1  
ATOM 8100   H HD2  . ARG B 1 216 ? 10.940  -2.520  210.196 1.00 0.00 ?  216 ARG B HD2  1  
ATOM 8101   H HD3  . ARG B 1 216 ? 11.307  -2.609  208.420 1.00 0.00 ?  216 ARG B HD3  1  
ATOM 8102   H HE   . ARG B 1 216 ? 10.088  -5.084  209.334 1.00 0.00 ?  216 ARG B HE   1  
ATOM 8103   H HH11 . ARG B 1 216 ? 9.468   -1.652  208.618 1.00 0.00 ?  216 ARG B HH11 1  
ATOM 8104   H HH12 . ARG B 1 216 ? 7.811   -1.884  208.172 1.00 0.00 ?  216 ARG B HH12 1  
ATOM 8105   H HH21 . ARG B 1 216 ? 7.827   -5.402  208.727 1.00 0.00 ?  216 ARG B HH21 1  
ATOM 8106   H HH22 . ARG B 1 216 ? 6.863   -4.050  208.235 1.00 0.00 ?  216 ARG B HH22 1  
ATOM 8107   N N    . ASN B 1 217 ? 15.426  -3.744  207.698 1.00 0.00 ?  217 ASN B N    1  
ATOM 8108   C CA   . ASN B 1 217 ? 16.408  -2.729  207.984 1.00 0.00 ?  217 ASN B CA   1  
ATOM 8109   C C    . ASN B 1 217 ? 17.005  -2.316  206.689 1.00 0.00 ?  217 ASN B C    1  
ATOM 8110   O O    . ASN B 1 217 ? 17.648  -1.281  206.589 1.00 0.00 ?  217 ASN B O    1  
ATOM 8111   C CB   . ASN B 1 217 ? 17.555  -3.239  208.872 1.00 0.00 ?  217 ASN B CB   1  
ATOM 8112   C CG   . ASN B 1 217 ? 17.097  -3.515  210.297 1.00 0.00 ?  217 ASN B CG   1  
ATOM 8113   O OD1  . ASN B 1 217 ? 16.072  -3.004  210.744 1.00 0.00 ?  217 ASN B OD1  1  
ATOM 8114   N ND2  . ASN B 1 217 ? 17.880  -4.349  211.033 1.00 0.00 ?  217 ASN B ND2  1  
ATOM 8115   H H    . ASN B 1 217 ? 15.728  -4.697  207.682 1.00 0.00 ?  217 ASN B H    1  
ATOM 8116   H HA   . ASN B 1 217 ? 15.919  -1.888  208.447 1.00 0.00 ?  217 ASN B HA   1  
ATOM 8117   H HB2  . ASN B 1 217 ? 17.967  -4.177  208.440 1.00 0.00 ?  217 ASN B HB2  1  
ATOM 8118   H HB3  . ASN B 1 217 ? 18.367  -2.481  208.898 1.00 0.00 ?  217 ASN B HB3  1  
ATOM 8119   H HD21 . ASN B 1 217 ? 18.707  -4.743  210.631 1.00 0.00 ?  217 ASN B HD21 1  
ATOM 8120   H HD22 . ASN B 1 217 ? 17.629  -4.567  211.976 1.00 0.00 ?  217 ASN B HD22 1  
ATOM 8121   N N    . GLU B 1 218 ? 16.727  -3.120  205.660 1.00 0.00 ?  218 GLU B N    1  
ATOM 8122   C CA   . GLU B 1 218 ? 17.327  -2.954  204.369 1.00 0.00 ?  218 GLU B CA   1  
ATOM 8123   C C    . GLU B 1 218 ? 16.573  -2.135  203.354 1.00 0.00 ?  218 GLU B C    1  
ATOM 8124   O O    . GLU B 1 218 ? 17.109  -2.073  202.257 1.00 0.00 ?  218 GLU B O    1  
ATOM 8125   C CB   . GLU B 1 218 ? 17.758  -4.292  203.754 1.00 0.00 ?  218 GLU B CB   1  
ATOM 8126   C CG   . GLU B 1 218 ? 19.256  -4.531  203.975 1.00 0.00 ?  218 GLU B CG   1  
ATOM 8127   C CD   . GLU B 1 218 ? 19.540  -4.501  205.471 1.00 0.00 ?  218 GLU B CD   1  
ATOM 8128   O OE1  . GLU B 1 218 ? 18.734  -5.080  206.242 1.00 0.00 ?  218 GLU B OE1  1  
ATOM 8129   O OE2  . GLU B 1 218 ? 20.576  -3.901  205.862 1.00 0.00 -1 218 GLU B OE2  1  
ATOM 8130   H H    . GLU B 1 218 ? 16.085  -3.878  205.745 1.00 0.00 ?  218 GLU B H    1  
ATOM 8131   H HA   . GLU B 1 218 ? 18.230  -2.401  204.567 1.00 0.00 ?  218 GLU B HA   1  
ATOM 8132   H HB2  . GLU B 1 218 ? 17.182  -5.110  204.233 1.00 0.00 ?  218 GLU B HB2  1  
ATOM 8133   H HB3  . GLU B 1 218 ? 17.544  -4.307  202.667 1.00 0.00 ?  218 GLU B HB3  1  
ATOM 8134   H HG2  . GLU B 1 218 ? 19.556  -5.510  203.557 1.00 0.00 ?  218 GLU B HG2  1  
ATOM 8135   H HG3  . GLU B 1 218 ? 19.846  -3.734  203.479 1.00 0.00 ?  218 GLU B HG3  1  
ATOM 8136   N N    . HIS B 1 219 ? 15.339  -1.556  203.646 1.00 0.00 ?  219 HIS B N    1  
ATOM 8137   C CA   . HIS B 1 219 ? 14.552  -0.791  202.635 1.00 0.00 ?  219 HIS B CA   1  
ATOM 8138   C C    . HIS B 1 219 ? 15.557  -0.153  201.659 1.00 0.00 ?  219 HIS B C    1  
ATOM 8139   O O    . HIS B 1 219 ? 16.198  0.832   201.983 1.00 0.00 ?  219 HIS B O    1  
ATOM 8140   C CB   . HIS B 1 219 ? 13.733  0.339   203.293 1.00 0.00 ?  219 HIS B CB   1  
ATOM 8141   C CG   . HIS B 1 219 ? 12.702  0.973   202.401 1.00 0.00 ?  219 HIS B CG   1  
ATOM 8142   N ND1  . HIS B 1 219 ? 12.910  2.248   201.910 1.00 0.00 ?  219 HIS B ND1  1  
ATOM 8143   C CD2  . HIS B 1 219 ? 11.505  0.485   201.965 1.00 0.00 ?  219 HIS B CD2  1  
ATOM 8144   C CE1  . HIS B 1 219 ? 11.835  2.509   201.187 1.00 0.00 ?  219 HIS B CE1  1  
ATOM 8145   N NE2  . HIS B 1 219 ? 10.955  1.480   201.186 1.00 0.00 ?  219 HIS B NE2  1  
ATOM 8146   H H    . HIS B 1 219 ? 14.925  -1.633  204.549 1.00 0.00 ?  219 HIS B H    1  
ATOM 8147   H HA   . HIS B 1 219 ? 13.895  -1.487  202.152 1.00 0.00 ?  219 HIS B HA   1  
ATOM 8148   H HB2  . HIS B 1 219 ? 13.202  -0.058  204.182 1.00 0.00 ?  219 HIS B HB2  1  
ATOM 8149   H HB3  . HIS B 1 219 ? 14.422  1.143   203.629 1.00 0.00 ?  219 HIS B HB3  1  
ATOM 8150   H HD2  . HIS B 1 219 ? 11.028  -0.469  202.155 1.00 0.00 ?  219 HIS B HD2  1  
ATOM 8151   H HE1  . HIS B 1 219 ? 11.652  3.438   200.646 1.00 0.00 ?  219 HIS B HE1  1  
ATOM 8152   H HE2  . HIS B 1 219 ? 10.071  1.436   200.714 1.00 0.00 ?  219 HIS B HE2  1  
ATOM 8153   N N    . PRO B 1 220 ? 15.659  -0.710  200.438 1.00 0.00 ?  220 PRO B N    1  
ATOM 8154   C CA   . PRO B 1 220 ? 16.710  -0.418  199.436 1.00 0.00 ?  220 PRO B CA   1  
ATOM 8155   C C    . PRO B 1 220 ? 16.704  0.800   198.517 1.00 0.00 ?  220 PRO B C    1  
ATOM 8156   O O    . PRO B 1 220 ? 17.515  0.791   197.606 1.00 0.00 ?  220 PRO B O    1  
ATOM 8157   C CB   . PRO B 1 220 ? 16.775  -1.703  198.640 1.00 0.00 ?  220 PRO B CB   1  
ATOM 8158   C CG   . PRO B 1 220 ? 15.319  -2.079  198.507 1.00 0.00 ?  220 PRO B CG   1  
ATOM 8159   C CD   . PRO B 1 220 ? 14.713  -1.702  199.859 1.00 0.00 ?  220 PRO B CD   1  
ATOM 8160   H HA   . PRO B 1 220 ? 17.647  -0.359  199.966 1.00 0.00 ?  220 PRO B HA   1  
ATOM 8161   H HB2  . PRO B 1 220 ? 17.253  -1.543  197.662 1.00 0.00 ?  220 PRO B HB2  1  
ATOM 8162   H HB3  . PRO B 1 220 ? 17.328  -2.484  199.202 1.00 0.00 ?  220 PRO B HB3  1  
ATOM 8163   H HG2  . PRO B 1 220 ? 14.844  -1.509  197.681 1.00 0.00 ?  220 PRO B HG2  1  
ATOM 8164   H HG3  . PRO B 1 220 ? 15.210  -3.164  198.322 1.00 0.00 ?  220 PRO B HG3  1  
ATOM 8165   H HD2  . PRO B 1 220 ? 13.702  -1.262  199.722 1.00 0.00 ?  220 PRO B HD2  1  
ATOM 8166   H HD3  . PRO B 1 220 ? 14.637  -2.609  200.496 1.00 0.00 ?  220 PRO B HD3  1  
ATOM 8167   N N    . ILE B 1 221 ? 15.827  1.823   198.686 1.00 0.00 ?  221 ILE B N    1  
ATOM 8168   C CA   . ILE B 1 221 ? 15.673  2.960   197.719 1.00 0.00 ?  221 ILE B CA   1  
ATOM 8169   C C    . ILE B 1 221 ? 16.938  3.417   196.944 1.00 0.00 ?  221 ILE B C    1  
ATOM 8170   O O    . ILE B 1 221 ? 16.814  3.680   195.749 1.00 0.00 ?  221 ILE B O    1  
ATOM 8171   C CB   . ILE B 1 221 ? 15.160  4.194   198.427 1.00 0.00 ?  221 ILE B CB   1  
ATOM 8172   C CG1  . ILE B 1 221 ? 13.820  3.904   199.130 1.00 0.00 ?  221 ILE B CG1  1  
ATOM 8173   C CG2  . ILE B 1 221 ? 15.041  5.353   197.420 1.00 0.00 ?  221 ILE B CG2  1  
ATOM 8174   C CD1  . ILE B 1 221 ? 12.698  3.478   198.175 1.00 0.00 ?  221 ILE B CD1  1  
ATOM 8175   H H    . ILE B 1 221 ? 15.230  1.864   199.484 1.00 0.00 ?  221 ILE B H    1  
ATOM 8176   H HA   . ILE B 1 221 ? 14.942  2.644   196.995 1.00 0.00 ?  221 ILE B HA   1  
ATOM 8177   H HB   . ILE B 1 221 ? 15.896  4.494   199.204 1.00 0.00 ?  221 ILE B HB   1  
ATOM 8178   H HG12 . ILE B 1 221 ? 13.983  3.098   199.869 1.00 0.00 ?  221 ILE B HG12 1  
ATOM 8179   H HG13 . ILE B 1 221 ? 13.497  4.813   199.680 1.00 0.00 ?  221 ILE B HG13 1  
ATOM 8180   H HG21 . ILE B 1 221 ? 16.026  5.851   197.280 1.00 0.00 ?  221 ILE B HG21 1  
ATOM 8181   H HG22 . ILE B 1 221 ? 14.319  6.107   197.791 1.00 0.00 ?  221 ILE B HG22 1  
ATOM 8182   H HG23 . ILE B 1 221 ? 14.690  4.976   196.436 1.00 0.00 ?  221 ILE B HG23 1  
ATOM 8183   H HD11 . ILE B 1 221 ? 12.662  4.147   197.290 1.00 0.00 ?  221 ILE B HD11 1  
ATOM 8184   H HD12 . ILE B 1 221 ? 11.716  3.526   198.694 1.00 0.00 ?  221 ILE B HD12 1  
ATOM 8185   H HD13 . ILE B 1 221 ? 12.861  2.436   197.827 1.00 0.00 ?  221 ILE B HD13 1  
ATOM 8186   N N    . PHE B 1 222 ? 18.164  3.516   197.535 1.00 0.00 ?  222 PHE B N    1  
ATOM 8187   C CA   . PHE B 1 222 ? 19.375  3.952   196.767 1.00 0.00 ?  222 PHE B CA   1  
ATOM 8188   C C    . PHE B 1 222 ? 19.887  2.698   195.988 1.00 0.00 ?  222 PHE B C    1  
ATOM 8189   O O    . PHE B 1 222 ? 21.085  2.448   195.945 1.00 0.00 ?  222 PHE B O    1  
ATOM 8190   C CB   . PHE B 1 222 ? 20.522  4.425   197.689 1.00 0.00 ?  222 PHE B CB   1  
ATOM 8191   C CG   . PHE B 1 222 ? 20.056  4.860   199.026 1.00 0.00 ?  222 PHE B CG   1  
ATOM 8192   C CD1  . PHE B 1 222 ? 19.523  6.111   199.219 1.00 0.00 ?  222 PHE B CD1  1  
ATOM 8193   C CD2  . PHE B 1 222 ? 20.143  3.992   200.091 1.00 0.00 ?  222 PHE B CD2  1  
ATOM 8194   C CE1  . PHE B 1 222 ? 19.084  6.489   200.464 1.00 0.00 ?  222 PHE B CE1  1  
ATOM 8195   C CE2  . PHE B 1 222 ? 19.707  4.369   201.333 1.00 0.00 ?  222 PHE B CE2  1  
ATOM 8196   C CZ   . PHE B 1 222 ? 19.177  5.615   201.520 1.00 0.00 ?  222 PHE B CZ   1  
ATOM 8197   H H    . PHE B 1 222 ? 18.307  3.303   198.498 1.00 0.00 ?  222 PHE B H    1  
ATOM 8198   H HA   . PHE B 1 222 ? 19.079  4.723   196.071 1.00 0.00 ?  222 PHE B HA   1  
ATOM 8199   H HB2  . PHE B 1 222 ? 21.250  3.608   197.864 1.00 0.00 ?  222 PHE B HB2  1  
ATOM 8200   H HB3  . PHE B 1 222 ? 21.051  5.285   197.225 1.00 0.00 ?  222 PHE B HB3  1  
ATOM 8201   H HD1  . PHE B 1 222 ? 19.452  6.800   198.390 1.00 0.00 ?  222 PHE B HD1  1  
ATOM 8202   H HD2  . PHE B 1 222 ? 20.562  3.005   199.947 1.00 0.00 ?  222 PHE B HD2  1  
ATOM 8203   H HE1  . PHE B 1 222 ? 18.666  7.474   200.613 1.00 0.00 ?  222 PHE B HE1  1  
ATOM 8204   H HE2  . PHE B 1 222 ? 19.779  3.683   202.163 1.00 0.00 ?  222 PHE B HE2  1  
ATOM 8205   H HZ   . PHE B 1 222 ? 18.829  5.904   202.495 1.00 0.00 ?  222 PHE B HZ   1  
ATOM 8206   N N    . LEU B 1 223 ? 18.927  1.879   195.418 1.00 0.00 ?  223 LEU B N    1  
ATOM 8207   C CA   . LEU B 1 223 ? 19.118  0.578   194.706 1.00 0.00 ?  223 LEU B CA   1  
ATOM 8208   C C    . LEU B 1 223 ? 20.296  0.440   193.730 1.00 0.00 ?  223 LEU B C    1  
ATOM 8209   O O    . LEU B 1 223 ? 20.351  -0.548  193.003 1.00 0.00 ?  223 LEU B O    1  
ATOM 8210   C CB   . LEU B 1 223 ? 17.863  0.152   193.916 1.00 0.00 ?  223 LEU B CB   1  
ATOM 8211   C CG   . LEU B 1 223 ? 17.582  -1.365  194.021 1.00 0.00 ?  223 LEU B CG   1  
ATOM 8212   C CD1  . LEU B 1 223 ? 16.639  -1.693  195.172 1.00 0.00 ?  223 LEU B CD1  1  
ATOM 8213   C CD2  . LEU B 1 223 ? 17.055  -1.930  192.699 1.00 0.00 ?  223 LEU B CD2  1  
ATOM 8214   H H    . LEU B 1 223 ? 17.969  2.156   195.465 1.00 0.00 ?  223 LEU B H    1  
ATOM 8215   H HA   . LEU B 1 223 ? 19.273  -0.149  195.485 1.00 0.00 ?  223 LEU B HA   1  
ATOM 8216   H HB2  . LEU B 1 223 ? 16.984  0.715   194.301 1.00 0.00 ?  223 LEU B HB2  1  
ATOM 8217   H HB3  . LEU B 1 223 ? 18.000  0.413   192.847 1.00 0.00 ?  223 LEU B HB3  1  
ATOM 8218   H HG   . LEU B 1 223 ? 18.550  -1.867  194.235 1.00 0.00 ?  223 LEU B HG   1  
ATOM 8219   H HD11 . LEU B 1 223 ? 16.502  -0.804  195.826 1.00 0.00 ?  223 LEU B HD11 1  
ATOM 8220   H HD12 . LEU B 1 223 ? 17.049  -2.525  195.783 1.00 0.00 ?  223 LEU B HD12 1  
ATOM 8221   H HD13 . LEU B 1 223 ? 15.656  -1.997  194.779 1.00 0.00 ?  223 LEU B HD13 1  
ATOM 8222   H HD21 . LEU B 1 223 ? 17.839  -1.870  191.914 1.00 0.00 ?  223 LEU B HD21 1  
ATOM 8223   H HD22 . LEU B 1 223 ? 16.174  -1.351  192.365 1.00 0.00 ?  223 LEU B HD22 1  
ATOM 8224   H HD23 . LEU B 1 223 ? 16.758  -2.993  192.824 1.00 0.00 ?  223 LEU B HD23 1  
ATOM 8225   N N    . LEU B 1 224 ? 21.206  1.402   193.588 1.00 0.00 ?  224 LEU B N    1  
ATOM 8226   C CA   . LEU B 1 224 ? 22.328  1.252   192.670 1.00 0.00 ?  224 LEU B CA   1  
ATOM 8227   C C    . LEU B 1 224 ? 23.219  0.032   192.984 1.00 0.00 ?  224 LEU B C    1  
ATOM 8228   O O    . LEU B 1 224 ? 24.243  -0.137  192.325 1.00 0.00 ?  224 LEU B O    1  
ATOM 8229   C CB   . LEU B 1 224 ? 23.243  2.487   192.684 1.00 0.00 ?  224 LEU B CB   1  
ATOM 8230   C CG   . LEU B 1 224 ? 23.872  2.736   194.064 1.00 0.00 ?  224 LEU B CG   1  
ATOM 8231   C CD1  . LEU B 1 224 ? 25.335  2.264   194.106 1.00 0.00 ?  224 LEU B CD1  1  
ATOM 8232   C CD2  . LEU B 1 224 ? 23.749  4.212   194.478 1.00 0.00 ?  224 LEU B CD2  1  
ATOM 8233   H H    . LEU B 1 224 ? 21.164  2.257   194.100 1.00 0.00 ?  224 LEU B H    1  
ATOM 8234   H HA   . LEU B 1 224 ? 21.912  1.128   191.684 1.00 0.00 ?  224 LEU B HA   1  
ATOM 8235   H HB2  . LEU B 1 224 ? 24.052  2.347   191.934 1.00 0.00 ?  224 LEU B HB2  1  
ATOM 8236   H HB3  . LEU B 1 224 ? 22.653  3.381   192.395 1.00 0.00 ?  224 LEU B HB3  1  
ATOM 8237   H HG   . LEU B 1 224 ? 23.304  2.132   194.805 1.00 0.00 ?  224 LEU B HG   1  
ATOM 8238   H HD11 . LEU B 1 224 ? 25.884  2.782   194.921 1.00 0.00 ?  224 LEU B HD11 1  
ATOM 8239   H HD12 . LEU B 1 224 ? 25.839  2.487   193.142 1.00 0.00 ?  224 LEU B HD12 1  
ATOM 8240   H HD13 . LEU B 1 224 ? 25.382  1.168   194.287 1.00 0.00 ?  224 LEU B HD13 1  
ATOM 8241   H HD21 . LEU B 1 224 ? 24.315  4.399   195.415 1.00 0.00 ?  224 LEU B HD21 1  
ATOM 8242   H HD22 . LEU B 1 224 ? 22.683  4.478   194.648 1.00 0.00 ?  224 LEU B HD22 1  
ATOM 8243   H HD23 . LEU B 1 224 ? 24.155  4.871   193.681 1.00 0.00 ?  224 LEU B HD23 1  
ATOM 8244   N N    . GLY B 1 225 ? 22.892  -0.844  193.984 1.00 0.00 ?  225 GLY B N    1  
ATOM 8245   C CA   . GLY B 1 225 ? 23.741  -1.986  194.253 1.00 0.00 ?  225 GLY B CA   1  
ATOM 8246   C C    . GLY B 1 225 ? 23.559  -2.368  195.692 1.00 0.00 ?  225 GLY B C    1  
ATOM 8247   O O    . GLY B 1 225 ? 24.535  -2.512  196.422 1.00 0.00 ?  225 GLY B O    1  
ATOM 8248   H H    . GLY B 1 225 ? 22.079  -0.740  194.553 1.00 0.00 ?  225 GLY B H    1  
ATOM 8249   H HA2  . GLY B 1 225 ? 23.408  -2.798  193.625 1.00 0.00 ?  225 GLY B HA2  1  
ATOM 8250   H HA3  . GLY B 1 225 ? 24.764  -1.680  194.094 1.00 0.00 ?  225 GLY B HA3  1  
ATOM 8251   N N    . TRP B 1 226 ? 22.292  -2.540  196.133 1.00 0.00 ?  226 TRP B N    1  
ATOM 8252   C CA   . TRP B 1 226 ? 22.034  -2.841  197.523 1.00 0.00 ?  226 TRP B CA   1  
ATOM 8253   C C    . TRP B 1 226 ? 21.926  -4.327  197.751 1.00 0.00 ?  226 TRP B C    1  
ATOM 8254   O O    . TRP B 1 226 ? 21.639  -5.106  196.840 1.00 0.00 ?  226 TRP B O    1  
ATOM 8255   C CB   . TRP B 1 226 ? 20.740  -2.192  198.032 1.00 0.00 ?  226 TRP B CB   1  
ATOM 8256   C CG   . TRP B 1 226 ? 20.768  -1.950  199.517 1.00 0.00 ?  226 TRP B CG   1  
ATOM 8257   C CD1  . TRP B 1 226 ? 19.957  -2.470  200.482 1.00 0.00 ?  226 TRP B CD1  1  
ATOM 8258   C CD2  . TRP B 1 226 ? 21.722  -1.114  200.200 1.00 0.00 ?  226 TRP B CD2  1  
ATOM 8259   N NE1  . TRP B 1 226 ? 20.328  -1.998  201.711 1.00 0.00 ?  226 TRP B NE1  1  
ATOM 8260   C CE2  . TRP B 1 226 ? 21.415  -1.170  201.556 1.00 0.00 ?  226 TRP B CE2  1  
ATOM 8261   C CE3  . TRP B 1 226 ? 22.769  -0.355  199.759 1.00 0.00 ?  226 TRP B CE3  1  
ATOM 8262   C CZ2  . TRP B 1 226 ? 22.140  -0.475  202.477 1.00 0.00 ?  226 TRP B CZ2  1  
ATOM 8263   C CZ3  . TRP B 1 226 ? 23.506  0.349   200.687 1.00 0.00 ?  226 TRP B CZ3  1  
ATOM 8264   C CH2  . TRP B 1 226 ? 23.196  0.288   202.031 1.00 0.00 ?  226 TRP B CH2  1  
ATOM 8265   H H    . TRP B 1 226 ? 21.498  -2.469  195.535 1.00 0.00 ?  226 TRP B H    1  
ATOM 8266   H HA   . TRP B 1 226 ? 22.868  -2.466  198.094 1.00 0.00 ?  226 TRP B HA   1  
ATOM 8267   H HB2  . TRP B 1 226 ? 20.588  -1.221  197.513 1.00 0.00 ?  226 TRP B HB2  1  
ATOM 8268   H HB3  . TRP B 1 226 ? 19.880  -2.851  197.796 1.00 0.00 ?  226 TRP B HB3  1  
ATOM 8269   H HD1  . TRP B 1 226 ? 19.132  -3.142  200.301 1.00 0.00 ?  226 TRP B HD1  1  
ATOM 8270   H HE1  . TRP B 1 226 ? 19.896  -2.218  202.559 1.00 0.00 ?  226 TRP B HE1  1  
ATOM 8271   H HE3  . TRP B 1 226 ? 23.027  -0.294  198.712 1.00 0.00 ?  226 TRP B HE3  1  
ATOM 8272   H HZ2  . TRP B 1 226 ? 21.914  -0.515  203.528 1.00 0.00 ?  226 TRP B HZ2  1  
ATOM 8273   H HZ3  . TRP B 1 226 ? 24.339  0.953   200.359 1.00 0.00 ?  226 TRP B HZ3  1  
ATOM 8274   H HH2  . TRP B 1 226 ? 23.788  0.847   202.741 1.00 0.00 ?  226 TRP B HH2  1  
ATOM 8275   N N    . ASN B 1 227 ? 22.197  -4.729  199.027 1.00 0.00 ?  227 ASN B N    1  
ATOM 8276   C CA   . ASN B 1 227 ? 22.111  -6.112  199.435 1.00 0.00 ?  227 ASN B CA   1  
ATOM 8277   C C    . ASN B 1 227 ? 21.036  -6.171  200.483 1.00 0.00 ?  227 ASN B C    1  
ATOM 8278   O O    . ASN B 1 227 ? 20.896  -5.248  201.284 1.00 0.00 ?  227 ASN B O    1  
ATOM 8279   C CB   . ASN B 1 227 ? 23.409  -6.655  200.059 1.00 0.00 ?  227 ASN B CB   1  
ATOM 8280   C CG   . ASN B 1 227 ? 24.594  -6.532  199.111 1.00 0.00 ?  227 ASN B CG   1  
ATOM 8281   O OD1  . ASN B 1 227 ? 25.588  -5.876  199.422 1.00 0.00 ?  227 ASN B OD1  1  
ATOM 8282   N ND2  . ASN B 1 227 ? 24.489  -7.181  197.921 1.00 0.00 ?  227 ASN B ND2  1  
ATOM 8283   H H    . ASN B 1 227 ? 22.465  -4.083  199.736 1.00 0.00 ?  227 ASN B H    1  
ATOM 8284   H HA   . ASN B 1 227 ? 21.817  -6.704  198.582 1.00 0.00 ?  227 ASN B HA   1  
ATOM 8285   H HB2  . ASN B 1 227 ? 23.635  -6.091  200.990 1.00 0.00 ?  227 ASN B HB2  1  
ATOM 8286   H HB3  . ASN B 1 227 ? 23.273  -7.725  200.323 1.00 0.00 ?  227 ASN B HB3  1  
ATOM 8287   H HD21 . ASN B 1 227 ? 23.664  -7.703  197.707 1.00 0.00 ?  227 ASN B HD21 1  
ATOM 8288   H HD22 . ASN B 1 227 ? 25.239  -7.137  197.260 1.00 0.00 ?  227 ASN B HD22 1  
ATOM 8289   N N    . MET B 1 228 ? 20.269  -7.287  200.517 1.00 0.00 ?  228 MET B N    1  
ATOM 8290   C CA   . MET B 1 228 ? 19.179  -7.413  201.465 1.00 0.00 ?  228 MET B CA   1  
ATOM 8291   C C    . MET B 1 228 ? 19.693  -8.185  202.656 1.00 0.00 ?  228 MET B C    1  
ATOM 8292   O O    . MET B 1 228 ? 20.580  -9.020  202.506 1.00 0.00 ?  228 MET B O    1  
ATOM 8293   C CB   . MET B 1 228 ? 17.977  -8.150  200.863 1.00 0.00 ?  228 MET B CB   1  
ATOM 8294   C CG   . MET B 1 228 ? 17.553  -7.562  199.517 1.00 0.00 ?  228 MET B CG   1  
ATOM 8295   S SD   . MET B 1 228 ? 17.068  -5.815  199.629 1.00 0.00 ?  228 MET B SD   1  
ATOM 8296   C CE   . MET B 1 228 ? 16.891  -5.601  197.836 1.00 0.00 ?  228 MET B CE   1  
ATOM 8297   H H    . MET B 1 228 ? 20.423  -8.062  199.905 1.00 0.00 ?  228 MET B H    1  
ATOM 8298   H HA   . MET B 1 228 ? 18.894  -6.421  201.779 1.00 0.00 ?  228 MET B HA   1  
ATOM 8299   H HB2  . MET B 1 228 ? 18.227  -9.225  200.737 1.00 0.00 ?  228 MET B HB2  1  
ATOM 8300   H HB3  . MET B 1 228 ? 17.124  -8.069  201.561 1.00 0.00 ?  228 MET B HB3  1  
ATOM 8301   H HG2  . MET B 1 228 ? 18.397  -7.672  198.803 1.00 0.00 ?  228 MET B HG2  1  
ATOM 8302   H HG3  . MET B 1 228 ? 16.703  -8.159  199.124 1.00 0.00 ?  228 MET B HG3  1  
ATOM 8303   H HE1  . MET B 1 228 ? 16.474  -6.517  197.367 1.00 0.00 ?  228 MET B HE1  1  
ATOM 8304   H HE2  . MET B 1 228 ? 17.873  -5.389  197.364 1.00 0.00 ?  228 MET B HE2  1  
ATOM 8305   H HE3  . MET B 1 228 ? 16.211  -4.758  197.602 1.00 0.00 ?  228 MET B HE3  1  
ATOM 8306   N N    . MET B 1 229 ? 19.132  -7.932  203.886 1.00 0.00 ?  229 MET B N    1  
ATOM 8307   C CA   . MET B 1 229 ? 19.652  -8.606  205.063 1.00 0.00 ?  229 MET B CA   1  
ATOM 8308   C C    . MET B 1 229 ? 18.644  -8.628  206.205 1.00 0.00 ?  229 MET B C    1  
ATOM 8309   O O    . MET B 1 229 ? 17.979  -7.633  206.473 1.00 0.00 ?  229 MET B O    1  
ATOM 8310   C CB   . MET B 1 229 ? 20.940  -7.909  205.559 1.00 0.00 ?  229 MET B CB   1  
ATOM 8311   C CG   . MET B 1 229 ? 21.465  -8.414  206.904 1.00 0.00 ?  229 MET B CG   1  
ATOM 8312   S SD   . MET B 1 229 ? 23.083  -7.705  207.335 1.00 0.00 ?  229 MET B SD   1  
ATOM 8313   C CE   . MET B 1 229 ? 22.457  -6.024  207.616 1.00 0.00 ?  229 MET B CE   1  
ATOM 8314   H H    . MET B 1 229 ? 18.360  -7.319  204.018 1.00 0.00 ?  229 MET B H    1  
ATOM 8315   H HA   . MET B 1 229 ? 19.867  -9.611  204.772 1.00 0.00 ?  229 MET B HA   1  
ATOM 8316   H HB2  . MET B 1 229 ? 21.735  -8.048  204.795 1.00 0.00 ?  229 MET B HB2  1  
ATOM 8317   H HB3  . MET B 1 229 ? 20.745  -6.821  205.643 1.00 0.00 ?  229 MET B HB3  1  
ATOM 8318   H HG2  . MET B 1 229 ? 20.729  -8.154  207.695 1.00 0.00 ?  229 MET B HG2  1  
ATOM 8319   H HG3  . MET B 1 229 ? 21.541  -9.515  206.872 1.00 0.00 ?  229 MET B HG3  1  
ATOM 8320   H HE1  . MET B 1 229 ? 23.081  -5.489  208.364 1.00 0.00 ?  229 MET B HE1  1  
ATOM 8321   H HE2  . MET B 1 229 ? 21.413  -6.048  207.995 1.00 0.00 ?  229 MET B HE2  1  
ATOM 8322   H HE3  . MET B 1 229 ? 22.468  -5.435  206.674 1.00 0.00 ?  229 MET B HE3  1  
ATOM 8323   N N    . HIS B 1 230 ? 18.534  -9.806  206.920 1.00 0.00 ?  230 HIS B N    1  
ATOM 8324   C CA   . HIS B 1 230 ? 17.642  -9.922  208.079 1.00 0.00 ?  230 HIS B CA   1  
ATOM 8325   C C    . HIS B 1 230 ? 18.504  -10.196 209.270 1.00 0.00 ?  230 HIS B C    1  
ATOM 8326   O O    . HIS B 1 230 ? 19.701  -10.424 209.127 1.00 0.00 ?  230 HIS B O    1  
ATOM 8327   C CB   . HIS B 1 230 ? 16.603  -11.077 208.057 1.00 0.00 ?  230 HIS B CB   1  
ATOM 8328   C CG   . HIS B 1 230 ? 17.174  -12.447 207.873 1.00 0.00 ?  230 HIS B CG   1  
ATOM 8329   N ND1  . HIS B 1 230 ? 16.917  -13.151 206.708 1.00 0.00 ?  230 HIS B ND1  1  
ATOM 8330   C CD2  . HIS B 1 230 ? 17.906  -13.200 208.737 1.00 0.00 ?  230 HIS B CD2  1  
ATOM 8331   C CE1  . HIS B 1 230 ? 17.491  -14.324 206.900 1.00 0.00 ?  230 HIS B CE1  1  
ATOM 8332   N NE2  . HIS B 1 230 ? 18.103  -14.406 208.108 1.00 0.00 ?  230 HIS B NE2  1  
ATOM 8333   H H    . HIS B 1 230 ? 19.058  -10.621 206.681 1.00 0.00 ?  230 HIS B H    1  
ATOM 8334   H HA   . HIS B 1 230 ? 17.146  -8.975  208.216 1.00 0.00 ?  230 HIS B HA   1  
ATOM 8335   H HB2  . HIS B 1 230 ? 16.053  -11.091 209.017 1.00 0.00 ?  230 HIS B HB2  1  
ATOM 8336   H HB3  . HIS B 1 230 ? 15.873  -10.917 207.253 1.00 0.00 ?  230 HIS B HB3  1  
ATOM 8337   H HD2  . HIS B 1 230 ? 18.295  -12.952 209.717 1.00 0.00 ?  230 HIS B HD2  1  
ATOM 8338   H HE1  . HIS B 1 230 ? 17.488  -15.147 206.186 1.00 0.00 ?  230 HIS B HE1  1  
ATOM 8339   H HE2  . HIS B 1 230 ? 18.601  -15.190 208.484 1.00 0.00 ?  230 HIS B HE2  1  
ATOM 8340   N N    . VAL B 1 231 ? 17.881  -10.209 210.486 1.00 0.00 ?  231 VAL B N    1  
ATOM 8341   C CA   . VAL B 1 231 ? 18.614  -10.498 211.694 1.00 0.00 ?  231 VAL B CA   1  
ATOM 8342   C C    . VAL B 1 231 ? 17.971  -11.725 212.292 1.00 0.00 ?  231 VAL B C    1  
ATOM 8343   O O    . VAL B 1 231 ? 16.751  -11.891 212.283 1.00 0.00 ?  231 VAL B O    1  
ATOM 8344   C CB   . VAL B 1 231 ? 18.596  -9.372  212.697 1.00 0.00 ?  231 VAL B CB   1  
ATOM 8345   C CG1  . VAL B 1 231 ? 17.149  -9.104  213.147 1.00 0.00 ?  231 VAL B CG1  1  
ATOM 8346   C CG2  . VAL B 1 231 ? 19.528  -9.747  213.861 1.00 0.00 ?  231 VAL B CG2  1  
ATOM 8347   H H    . VAL B 1 231 ? 16.907  -10.021 210.590 1.00 0.00 ?  231 VAL B H    1  
ATOM 8348   H HA   . VAL B 1 231 ? 19.629  -10.742 211.419 1.00 0.00 ?  231 VAL B HA   1  
ATOM 8349   H HB   . VAL B 1 231 ? 18.991  -8.449  212.220 1.00 0.00 ?  231 VAL B HB   1  
ATOM 8350   H HG11 . VAL B 1 231 ? 16.813  -9.892  213.854 1.00 0.00 ?  231 VAL B HG11 1  
ATOM 8351   H HG12 . VAL B 1 231 ? 16.466  -9.099  212.271 1.00 0.00 ?  231 VAL B HG12 1  
ATOM 8352   H HG13 . VAL B 1 231 ? 17.080  -8.119  213.655 1.00 0.00 ?  231 VAL B HG13 1  
ATOM 8353   H HG21 . VAL B 1 231 ? 18.939  -9.927  214.786 1.00 0.00 ?  231 VAL B HG21 1  
ATOM 8354   H HG22 . VAL B 1 231 ? 20.248  -8.927  214.051 1.00 0.00 ?  231 VAL B HG22 1  
ATOM 8355   H HG23 . VAL B 1 231 ? 20.102  -10.665 213.619 1.00 0.00 ?  231 VAL B HG23 1  
ATOM 8356   N N    . ILE B 1 232 ? 18.828  -12.643 212.782 1.00 0.00 ?  232 ILE B N    1  
ATOM 8357   C CA   . ILE B 1 232 ? 18.385  -13.902 213.338 1.00 0.00 ?  232 ILE B CA   1  
ATOM 8358   C C    . ILE B 1 232 ? 18.009  -13.787 214.794 1.00 0.00 ?  232 ILE B C    1  
ATOM 8359   O O    . ILE B 1 232 ? 17.050  -14.411 215.248 1.00 0.00 ?  232 ILE B O    1  
ATOM 8360   C CB   . ILE B 1 232 ? 19.469  -14.939 213.262 1.00 0.00 ?  232 ILE B CB   1  
ATOM 8361   C CG1  . ILE B 1 232 ? 19.964  -15.130 211.811 1.00 0.00 ?  232 ILE B CG1  1  
ATOM 8362   C CG2  . ILE B 1 232 ? 18.932  -16.248 213.864 1.00 0.00 ?  232 ILE B CG2  1  
ATOM 8363   C CD1  . ILE B 1 232 ? 18.883  -15.646 210.858 1.00 0.00 ?  232 ILE B CD1  1  
ATOM 8364   H H    . ILE B 1 232 ? 19.813  -12.489 212.790 1.00 0.00 ?  232 ILE B H    1  
ATOM 8365   H HA   . ILE B 1 232 ? 17.525  -14.226 212.774 1.00 0.00 ?  232 ILE B HA   1  
ATOM 8366   H HB   . ILE B 1 232 ? 20.324  -14.605 213.881 1.00 0.00 ?  232 ILE B HB   1  
ATOM 8367   H HG12 . ILE B 1 232 ? 20.343  -14.156 211.430 1.00 0.00 ?  232 ILE B HG12 1  
ATOM 8368   H HG13 . ILE B 1 232 ? 20.811  -15.847 211.812 1.00 0.00 ?  232 ILE B HG13 1  
ATOM 8369   H HG21 . ILE B 1 232 ? 19.350  -17.122 213.322 1.00 0.00 ?  232 ILE B HG21 1  
ATOM 8370   H HG22 . ILE B 1 232 ? 17.823  -16.280 213.789 1.00 0.00 ?  232 ILE B HG22 1  
ATOM 8371   H HG23 . ILE B 1 232 ? 19.217  -16.325 214.935 1.00 0.00 ?  232 ILE B HG23 1  
ATOM 8372   H HD11 . ILE B 1 232 ? 18.428  -16.571 211.262 1.00 0.00 ?  232 ILE B HD11 1  
ATOM 8373   H HD12 . ILE B 1 232 ? 19.327  -15.879 209.867 1.00 0.00 ?  232 ILE B HD12 1  
ATOM 8374   H HD13 . ILE B 1 232 ? 18.084  -14.892 210.714 1.00 0.00 ?  232 ILE B HD13 1  
ATOM 8375   N N    . ASP B 1 233 ? 18.762  -12.963 215.547 1.00 0.00 ?  233 ASP B N    1  
ATOM 8376   C CA   . ASP B 1 233 ? 18.618  -12.896 216.990 1.00 0.00 ?  233 ASP B CA   1  
ATOM 8377   C C    . ASP B 1 233 ? 17.244  -12.485 217.431 1.00 0.00 ?  233 ASP B C    1  
ATOM 8378   O O    . ASP B 1 233 ? 16.793  -12.905 218.491 1.00 0.00 ?  233 ASP B O    1  
ATOM 8379   C CB   . ASP B 1 233 ? 19.600  -11.892 217.613 1.00 0.00 ?  233 ASP B CB   1  
ATOM 8380   C CG   . ASP B 1 233 ? 21.041  -12.383 217.552 1.00 0.00 ?  233 ASP B CG   1  
ATOM 8381   O OD1  . ASP B 1 233 ? 21.957  -11.560 217.812 1.00 0.00 ?  233 ASP B OD1  1  
ATOM 8382   O OD2  . ASP B 1 233 ? 21.246  -13.583 217.223 1.00 0.00 -1 233 ASP B OD2  1  
ATOM 8383   H H    . ASP B 1 233 ? 19.451  -12.362 215.148 1.00 0.00 ?  233 ASP B H    1  
ATOM 8384   H HA   . ASP B 1 233 ? 18.825  -13.881 217.374 1.00 0.00 ?  233 ASP B HA   1  
ATOM 8385   H HB2  . ASP B 1 233 ? 19.529  -10.923 217.072 1.00 0.00 ?  233 ASP B HB2  1  
ATOM 8386   H HB3  . ASP B 1 233 ? 19.327  -11.718 218.675 1.00 0.00 ?  233 ASP B HB3  1  
ATOM 8387   N N    . GLU B 1 234 ? 16.520  -11.698 216.641 1.00 0.00 ?  234 GLU B N    1  
ATOM 8388   C CA   . GLU B 1 234 ? 15.224  -11.254 217.084 1.00 0.00 ?  234 GLU B CA   1  
ATOM 8389   C C    . GLU B 1 234 ? 14.272  -12.402 217.037 1.00 0.00 ?  234 GLU B C    1  
ATOM 8390   O O    . GLU B 1 234 ? 14.641  -13.533 216.711 1.00 0.00 ?  234 GLU B O    1  
ATOM 8391   C CB   . GLU B 1 234 ? 14.669  -10.102 216.234 1.00 0.00 ?  234 GLU B CB   1  
ATOM 8392   C CG   . GLU B 1 234 ? 15.568  -8.870  216.328 1.00 0.00 ?  234 GLU B CG   1  
ATOM 8393   C CD   . GLU B 1 234 ? 14.973  -7.752  215.490 1.00 0.00 ?  234 GLU B CD   1  
ATOM 8394   O OE1  . GLU B 1 234 ? 13.919  -7.989  214.846 1.00 0.00 ?  234 GLU B OE1  1  
ATOM 8395   O OE2  . GLU B 1 234 ? 15.569  -6.643  215.487 1.00 0.00 -1 234 GLU B OE2  1  
ATOM 8396   H H    . GLU B 1 234 ? 16.826  -11.392 215.743 1.00 0.00 ?  234 GLU B H    1  
ATOM 8397   H HA   . GLU B 1 234 ? 15.331  -10.936 218.109 1.00 0.00 ?  234 GLU B HA   1  
ATOM 8398   H HB2  . GLU B 1 234 ? 14.598  -10.429 215.173 1.00 0.00 ?  234 GLU B HB2  1  
ATOM 8399   H HB3  . GLU B 1 234 ? 13.651  -9.834  216.587 1.00 0.00 ?  234 GLU B HB3  1  
ATOM 8400   H HG2  . GLU B 1 234 ? 15.653  -8.540  217.387 1.00 0.00 ?  234 GLU B HG2  1  
ATOM 8401   H HG3  . GLU B 1 234 ? 16.578  -9.114  215.943 1.00 0.00 ?  234 GLU B HG3  1  
ATOM 8402   N N    . SER B 1 235 ? 12.990  -12.137 217.342 1.00 0.00 ?  235 SER B N    1  
ATOM 8403   C CA   . SER B 1 235 ? 12.067  -13.211 217.332 1.00 0.00 ?  235 SER B CA   1  
ATOM 8404   C C    . SER B 1 235 ? 11.704  -13.381 215.909 1.00 0.00 ?  235 SER B C    1  
ATOM 8405   O O    . SER B 1 235 ? 11.074  -12.527 215.286 1.00 0.00 ?  235 SER B O    1  
ATOM 8406   C CB   . SER B 1 235 ? 10.782  -12.931 218.131 1.00 0.00 ?  235 SER B CB   1  
ATOM 8407   O OG   . SER B 1 235 ? 11.089  -12.769 219.509 1.00 0.00 ?  235 SER B OG   1  
ATOM 8408   H H    . SER B 1 235 ? 12.650  -11.230 217.575 1.00 0.00 ?  235 SER B H    1  
ATOM 8409   H HA   . SER B 1 235 ? 12.563  -14.098 217.695 1.00 0.00 ?  235 SER B HA   1  
ATOM 8410   H HB2  . SER B 1 235 ? 10.297  -12.002 217.760 1.00 0.00 ?  235 SER B HB2  1  
ATOM 8411   H HB3  . SER B 1 235 ? 10.071  -13.777 218.019 1.00 0.00 ?  235 SER B HB3  1  
ATOM 8412   H HG   . SER B 1 235 ? 10.254  -12.848 219.977 1.00 0.00 ?  235 SER B HG   1  
ATOM 8413   N N    . SER B 1 236 ? 12.107  -14.537 215.375 1.00 0.00 ?  236 SER B N    1  
ATOM 8414   C CA   . SER B 1 236 ? 11.848  -14.842 214.015 1.00 0.00 ?  236 SER B CA   1  
ATOM 8415   C C    . SER B 1 236 ? 11.972  -16.337 213.923 1.00 0.00 ?  236 SER B C    1  
ATOM 8416   O O    . SER B 1 236 ? 12.639  -16.945 214.759 1.00 0.00 ?  236 SER B O    1  
ATOM 8417   C CB   . SER B 1 236 ? 12.877  -14.201 213.062 1.00 0.00 ?  236 SER B CB   1  
ATOM 8418   O OG   . SER B 1 236 ? 14.175  -14.715 213.328 1.00 0.00 ?  236 SER B OG   1  
ATOM 8419   H H    . SER B 1 236 ? 12.600  -15.227 215.899 1.00 0.00 ?  236 SER B H    1  
ATOM 8420   H HA   . SER B 1 236 ? 10.843  -14.520 213.791 1.00 0.00 ?  236 SER B HA   1  
ATOM 8421   H HB2  . SER B 1 236 ? 12.610  -14.425 212.007 1.00 0.00 ?  236 SER B HB2  1  
ATOM 8422   H HB3  . SER B 1 236 ? 12.892  -13.101 213.204 1.00 0.00 ?  236 SER B HB3  1  
ATOM 8423   H HG   . SER B 1 236 ? 14.534  -14.179 214.041 1.00 0.00 ?  236 SER B HG   1  
ATOM 8424   N N    . PRO B 1 237 ? 11.359  -16.972 212.928 1.00 0.00 ?  237 PRO B N    1  
ATOM 8425   C CA   . PRO B 1 237 ? 11.468  -18.424 212.774 1.00 0.00 ?  237 PRO B CA   1  
ATOM 8426   C C    . PRO B 1 237 ? 12.871  -18.873 212.507 1.00 0.00 ?  237 PRO B C    1  
ATOM 8427   O O    . PRO B 1 237 ? 13.219  -20.038 212.686 1.00 0.00 ?  237 PRO B O    1  
ATOM 8428   C CB   . PRO B 1 237 ? 10.606  -18.763 211.555 1.00 0.00 ?  237 PRO B CB   1  
ATOM 8429   C CG   . PRO B 1 237 ? 9.698   -17.554 211.370 1.00 0.00 ?  237 PRO B CG   1  
ATOM 8430   C CD   . PRO B 1 237 ? 10.518  -16.375 211.867 1.00 0.00 ?  237 PRO B CD   1  
ATOM 8431   H HA   . PRO B 1 237 ? 11.085  -18.941 213.641 1.00 0.00 ?  237 PRO B HA   1  
ATOM 8432   H HB2  . PRO B 1 237 ? 11.241  -18.916 210.657 1.00 0.00 ?  237 PRO B HB2  1  
ATOM 8433   H HB3  . PRO B 1 237 ? 10.003  -19.676 211.744 1.00 0.00 ?  237 PRO B HB3  1  
ATOM 8434   H HG2  . PRO B 1 237 ? 9.433   -17.429 210.298 1.00 0.00 ?  237 PRO B HG2  1  
ATOM 8435   H HG3  . PRO B 1 237 ? 8.770   -17.668 211.970 1.00 0.00 ?  237 PRO B HG3  1  
ATOM 8436   H HD2  . PRO B 1 237 ? 11.136  -15.955 211.043 1.00 0.00 ?  237 PRO B HD2  1  
ATOM 8437   H HD3  . PRO B 1 237 ? 9.840   -15.590 212.263 1.00 0.00 ?  237 PRO B HD3  1  
ATOM 8438   N N    . LEU B 1 238 ? 13.692  -17.924 212.056 1.00 0.00 ?  238 LEU B N    1  
ATOM 8439   C CA   . LEU B 1 238 ? 15.042  -18.177 211.666 1.00 0.00 ?  238 LEU B CA   1  
ATOM 8440   C C    . LEU B 1 238 ? 15.923  -18.411 212.868 1.00 0.00 ?  238 LEU B C    1  
ATOM 8441   O O    . LEU B 1 238 ? 17.094  -18.681 212.708 1.00 0.00 ?  238 LEU B O    1  
ATOM 8442   C CB   . LEU B 1 238 ? 15.612  -17.020 210.838 1.00 0.00 ?  238 LEU B CB   1  
ATOM 8443   C CG   . LEU B 1 238 ? 14.776  -16.763 209.567 1.00 0.00 ?  238 LEU B CG   1  
ATOM 8444   C CD1  . LEU B 1 238 ? 15.304  -15.560 208.778 1.00 0.00 ?  238 LEU B CD1  1  
ATOM 8445   C CD2  . LEU B 1 238 ? 14.689  -18.015 208.674 1.00 0.00 ?  238 LEU B CD2  1  
ATOM 8446   H H    . LEU B 1 238 ? 13.392  -16.976 211.970 1.00 0.00 ?  238 LEU B H    1  
ATOM 8447   H HA   . LEU B 1 238 ? 15.035  -19.078 211.078 1.00 0.00 ?  238 LEU B HA   1  
ATOM 8448   H HB2  . LEU B 1 238 ? 15.638  -16.098 211.461 1.00 0.00 ?  238 LEU B HB2  1  
ATOM 8449   H HB3  . LEU B 1 238 ? 16.648  -17.267 210.534 1.00 0.00 ?  238 LEU B HB3  1  
ATOM 8450   H HG   . LEU B 1 238 ? 13.743  -16.517 209.896 1.00 0.00 ?  238 LEU B HG   1  
ATOM 8451   H HD11 . LEU B 1 238 ? 16.006  -14.968 209.403 1.00 0.00 ?  238 LEU B HD11 1  
ATOM 8452   H HD12 . LEU B 1 238 ? 14.464  -14.902 208.469 1.00 0.00 ?  238 LEU B HD12 1  
ATOM 8453   H HD13 . LEU B 1 238 ? 15.839  -15.902 207.868 1.00 0.00 ?  238 LEU B HD13 1  
ATOM 8454   H HD21 . LEU B 1 238 ? 15.553  -18.685 208.865 1.00 0.00 ?  238 LEU B HD21 1  
ATOM 8455   H HD22 . LEU B 1 238 ? 14.693  -17.725 207.602 1.00 0.00 ?  238 LEU B HD22 1  
ATOM 8456   H HD23 . LEU B 1 238 ? 13.752  -18.575 208.887 1.00 0.00 ?  238 LEU B HD23 1  
ATOM 8457   N N    . PHE B 1 239 ? 15.433  -18.194 214.097 1.00 0.00 ?  239 PHE B N    1  
ATOM 8458   C CA   . PHE B 1 239 ? 16.275  -18.406 215.265 1.00 0.00 ?  239 PHE B CA   1  
ATOM 8459   C C    . PHE B 1 239 ? 16.770  -19.845 215.311 1.00 0.00 ?  239 PHE B C    1  
ATOM 8460   O O    . PHE B 1 239 ? 17.951  -20.102 215.517 1.00 0.00 ?  239 PHE B O    1  
ATOM 8461   C CB   . PHE B 1 239 ? 15.545  -18.133 216.589 1.00 0.00 ?  239 PHE B CB   1  
ATOM 8462   C CG   . PHE B 1 239 ? 16.378  -18.405 217.795 1.00 0.00 ?  239 PHE B CG   1  
ATOM 8463   C CD1  . PHE B 1 239 ? 16.204  -19.565 218.519 1.00 0.00 ?  239 PHE B CD1  1  
ATOM 8464   C CD2  . PHE B 1 239 ? 17.335  -17.501 218.199 1.00 0.00 ?  239 PHE B CD2  1  
ATOM 8465   C CE1  . PHE B 1 239 ? 16.975  -19.816 219.630 1.00 0.00 ?  239 PHE B CE1  1  
ATOM 8466   C CE2  . PHE B 1 239 ? 18.106  -17.752 219.310 1.00 0.00 ?  239 PHE B CE2  1  
ATOM 8467   C CZ   . PHE B 1 239 ? 17.925  -18.909 220.025 1.00 0.00 ?  239 PHE B CZ   1  
ATOM 8468   H H    . PHE B 1 239 ? 14.499  -17.889 214.262 1.00 0.00 ?  239 PHE B H    1  
ATOM 8469   H HA   . PHE B 1 239 ? 17.124  -17.750 215.172 1.00 0.00 ?  239 PHE B HA   1  
ATOM 8470   H HB2  . PHE B 1 239 ? 15.235  -17.068 216.638 1.00 0.00 ?  239 PHE B HB2  1  
ATOM 8471   H HB3  . PHE B 1 239 ? 14.638  -18.772 216.660 1.00 0.00 ?  239 PHE B HB3  1  
ATOM 8472   H HD1  . PHE B 1 239 ? 15.456  -20.281 218.212 1.00 0.00 ?  239 PHE B HD1  1  
ATOM 8473   H HD2  . PHE B 1 239 ? 17.482  -16.588 217.640 1.00 0.00 ?  239 PHE B HD2  1  
ATOM 8474   H HE1  . PHE B 1 239 ? 16.832  -20.727 220.192 1.00 0.00 ?  239 PHE B HE1  1  
ATOM 8475   H HE2  . PHE B 1 239 ? 18.854  -17.038 219.620 1.00 0.00 ?  239 PHE B HE2  1  
ATOM 8476   H HZ   . PHE B 1 239 ? 18.531  -19.106 220.897 1.00 0.00 ?  239 PHE B HZ   1  
ATOM 8477   N N    . GLY B 1 240 ? 15.859  -20.800 215.098 1.00 0.00 ?  240 GLY B N    1  
ATOM 8478   C CA   . GLY B 1 240 ? 16.157  -22.222 215.171 1.00 0.00 ?  240 GLY B CA   1  
ATOM 8479   C C    . GLY B 1 240 ? 16.751  -22.728 213.873 1.00 0.00 ?  240 GLY B C    1  
ATOM 8480   O O    . GLY B 1 240 ? 16.830  -23.935 213.678 1.00 0.00 ?  240 GLY B O    1  
ATOM 8481   H H    . GLY B 1 240 ? 14.913  -20.574 214.876 1.00 0.00 ?  240 GLY B H    1  
ATOM 8482   H HA2  . GLY B 1 240 ? 16.886  -22.355 215.955 1.00 0.00 ?  240 GLY B HA2  1  
ATOM 8483   H HA3  . GLY B 1 240 ? 15.222  -22.734 215.349 1.00 0.00 ?  240 GLY B HA3  1  
ATOM 8484   N N    . GLU B 1 241 ? 17.116  -21.803 212.954 1.00 0.00 ?  241 GLU B N    1  
ATOM 8485   C CA   . GLU B 1 241 ? 17.588  -22.117 211.592 1.00 0.00 ?  241 GLU B CA   1  
ATOM 8486   C C    . GLU B 1 241 ? 18.818  -23.011 211.470 1.00 0.00 ?  241 GLU B C    1  
ATOM 8487   O O    . GLU B 1 241 ? 19.407  -22.999 210.390 1.00 0.00 ?  241 GLU B O    1  
ATOM 8488   C CB   . GLU B 1 241 ? 17.917  -20.858 210.748 1.00 0.00 ?  241 GLU B CB   1  
ATOM 8489   C CG   . GLU B 1 241 ? 19.208  -20.127 211.183 1.00 0.00 ?  241 GLU B CG   1  
ATOM 8490   C CD   . GLU B 1 241 ? 19.358  -18.870 210.336 1.00 0.00 ?  241 GLU B CD   1  
ATOM 8491   O OE1  . GLU B 1 241 ? 18.424  -18.568 209.544 1.00 0.00 ?  241 GLU B OE1  1  
ATOM 8492   O OE2  . GLU B 1 241 ? 20.415  -18.196 210.466 1.00 0.00 -1 241 GLU B OE2  1  
ATOM 8493   H H    . GLU B 1 241 ? 17.078  -20.830 213.167 1.00 0.00 ?  241 GLU B H    1  
ATOM 8494   H HA   . GLU B 1 241 ? 16.770  -22.631 211.115 1.00 0.00 ?  241 GLU B HA   1  
ATOM 8495   H HB2  . GLU B 1 241 ? 18.018  -21.158 209.684 1.00 0.00 ?  241 GLU B HB2  1  
ATOM 8496   H HB3  . GLU B 1 241 ? 17.066  -20.149 210.817 1.00 0.00 ?  241 GLU B HB3  1  
ATOM 8497   H HG2  . GLU B 1 241 ? 19.149  -19.850 212.257 1.00 0.00 ?  241 GLU B HG2  1  
ATOM 8498   H HG3  . GLU B 1 241 ? 20.094  -20.776 211.025 1.00 0.00 ?  241 GLU B HG3  1  
ATOM 8499   N N    . THR B 1 242 ? 19.279  -23.769 212.502 1.00 0.00 ?  242 THR B N    1  
ATOM 8500   C CA   . THR B 1 242 ? 20.487  -24.578 212.325 1.00 0.00 ?  242 THR B CA   1  
ATOM 8501   C C    . THR B 1 242 ? 20.312  -25.436 211.060 1.00 0.00 ?  242 THR B C    1  
ATOM 8502   O O    . THR B 1 242 ? 19.194  -25.828 210.736 1.00 0.00 ?  242 THR B O    1  
ATOM 8503   C CB   . THR B 1 242 ? 20.724  -25.507 213.486 1.00 0.00 ?  242 THR B CB   1  
ATOM 8504   O OG1  . THR B 1 242 ? 19.692  -26.481 213.549 1.00 0.00 ?  242 THR B OG1  1  
ATOM 8505   C CG2  . THR B 1 242 ? 20.755  -24.679 214.781 1.00 0.00 ?  242 THR B CG2  1  
ATOM 8506   H H    . THR B 1 242 ? 18.834  -23.806 213.393 1.00 0.00 ?  242 THR B H    1  
ATOM 8507   H HA   . THR B 1 242 ? 21.303  -23.888 212.210 1.00 0.00 ?  242 THR B HA   1  
ATOM 8508   H HB   . THR B 1 242 ? 21.700  -26.023 213.371 1.00 0.00 ?  242 THR B HB   1  
ATOM 8509   H HG1  . THR B 1 242 ? 19.086  -26.181 214.230 1.00 0.00 ?  242 THR B HG1  1  
ATOM 8510   H HG21 . THR B 1 242 ? 19.774  -24.736 215.299 1.00 0.00 ?  242 THR B HG21 1  
ATOM 8511   H HG22 . THR B 1 242 ? 20.973  -23.614 214.552 1.00 0.00 ?  242 THR B HG22 1  
ATOM 8512   H HG23 . THR B 1 242 ? 21.540  -25.062 215.466 1.00 0.00 ?  242 THR B HG23 1  
ATOM 8513   N N    . PRO B 1 243 ? 21.403  -25.728 210.328 1.00 0.00 ?  243 PRO B N    1  
ATOM 8514   C CA   . PRO B 1 243 ? 21.317  -26.450 209.047 1.00 0.00 ?  243 PRO B CA   1  
ATOM 8515   C C    . PRO B 1 243 ? 20.568  -27.740 209.060 1.00 0.00 ?  243 PRO B C    1  
ATOM 8516   O O    . PRO B 1 243 ? 19.869  -28.049 208.100 1.00 0.00 ?  243 PRO B O    1  
ATOM 8517   C CB   . PRO B 1 243 ? 22.770  -26.739 208.679 1.00 0.00 ?  243 PRO B CB   1  
ATOM 8518   C CG   . PRO B 1 243 ? 23.538  -25.609 209.332 1.00 0.00 ?  243 PRO B CG   1  
ATOM 8519   C CD   . PRO B 1 243 ? 22.811  -25.390 210.653 1.00 0.00 ?  243 PRO B CD   1  
ATOM 8520   H HA   . PRO B 1 243 ? 20.893  -25.817 208.284 1.00 0.00 ?  243 PRO B HA   1  
ATOM 8521   H HB2  . PRO B 1 243 ? 23.090  -27.723 209.084 1.00 0.00 ?  243 PRO B HB2  1  
ATOM 8522   H HB3  . PRO B 1 243 ? 22.909  -26.722 207.577 1.00 0.00 ?  243 PRO B HB3  1  
ATOM 8523   H HG2  . PRO B 1 243 ? 24.598  -25.902 209.502 1.00 0.00 ?  243 PRO B HG2  1  
ATOM 8524   H HG3  . PRO B 1 243 ? 23.498  -24.693 208.706 1.00 0.00 ?  243 PRO B HG3  1  
ATOM 8525   H HD2  . PRO B 1 243 ? 23.222  -26.061 211.439 1.00 0.00 ?  243 PRO B HD2  1  
ATOM 8526   H HD3  . PRO B 1 243 ? 22.922  -24.332 210.970 1.00 0.00 ?  243 PRO B HD3  1  
ATOM 8527   N N    . GLU B 1 244 ? 20.713  -28.540 210.126 1.00 0.00 ?  244 GLU B N    1  
ATOM 8528   C CA   . GLU B 1 244 ? 20.027  -29.803 210.164 1.00 0.00 ?  244 GLU B CA   1  
ATOM 8529   C C    . GLU B 1 244 ? 18.543  -29.573 210.207 1.00 0.00 ?  244 GLU B C    1  
ATOM 8530   O O    . GLU B 1 244 ? 17.785  -30.291 209.553 1.00 0.00 ?  244 GLU B O    1  
ATOM 8531   C CB   . GLU B 1 244 ? 20.403  -30.664 211.387 1.00 0.00 ?  244 GLU B CB   1  
ATOM 8532   C CG   . GLU B 1 244 ? 21.840  -31.207 211.329 1.00 0.00 ?  244 GLU B CG   1  
ATOM 8533   C CD   . GLU B 1 244 ? 21.985  -32.084 210.092 1.00 0.00 ?  244 GLU B CD   1  
ATOM 8534   O OE1  . GLU B 1 244 ? 21.107  -32.963 209.883 1.00 0.00 ?  244 GLU B OE1  1  
ATOM 8535   O OE2  . GLU B 1 244 ? 22.976  -31.886 209.338 1.00 0.00 -1 244 GLU B OE2  1  
ATOM 8536   H H    . GLU B 1 244 ? 21.279  -28.305 210.912 1.00 0.00 ?  244 GLU B H    1  
ATOM 8537   H HA   . GLU B 1 244 ? 20.267  -30.323 209.253 1.00 0.00 ?  244 GLU B HA   1  
ATOM 8538   H HB2  . GLU B 1 244 ? 20.286  -30.054 212.308 1.00 0.00 ?  244 GLU B HB2  1  
ATOM 8539   H HB3  . GLU B 1 244 ? 19.701  -31.521 211.454 1.00 0.00 ?  244 GLU B HB3  1  
ATOM 8540   H HG2  . GLU B 1 244 ? 22.564  -30.364 211.276 1.00 0.00 ?  244 GLU B HG2  1  
ATOM 8541   H HG3  . GLU B 1 244 ? 22.056  -31.814 212.234 1.00 0.00 ?  244 GLU B HG3  1  
ATOM 8542   N N    . SER B 1 245 ? 18.083  -28.567 210.981 1.00 0.00 ?  245 SER B N    1  
ATOM 8543   C CA   . SER B 1 245 ? 16.662  -28.344 211.081 1.00 0.00 ?  245 SER B CA   1  
ATOM 8544   C C    . SER B 1 245 ? 16.143  -27.855 209.767 1.00 0.00 ?  245 SER B C    1  
ATOM 8545   O O    . SER B 1 245 ? 15.035  -28.216 209.360 1.00 0.00 ?  245 SER B O    1  
ATOM 8546   C CB   . SER B 1 245 ? 16.259  -27.306 212.146 1.00 0.00 ?  245 SER B CB   1  
ATOM 8547   O OG   . SER B 1 245 ? 16.710  -26.013 211.783 1.00 0.00 ?  245 SER B OG   1  
ATOM 8548   H H    . SER B 1 245 ? 18.678  -27.959 211.498 1.00 0.00 ?  245 SER B H    1  
ATOM 8549   H HA   . SER B 1 245 ? 16.204  -29.295 211.304 1.00 0.00 ?  245 SER B HA   1  
ATOM 8550   H HB2  . SER B 1 245 ? 15.154  -27.279 212.250 1.00 0.00 ?  245 SER B HB2  1  
ATOM 8551   H HB3  . SER B 1 245 ? 16.706  -27.577 213.126 1.00 0.00 ?  245 SER B HB3  1  
ATOM 8552   H HG   . SER B 1 245 ? 16.419  -25.425 212.482 1.00 0.00 ?  245 SER B HG   1  
ATOM 8553   N N    . LEU B 1 246 ? 16.930  -27.002 209.080 1.00 0.00 ?  246 LEU B N    1  
ATOM 8554   C CA   . LEU B 1 246 ? 16.489  -26.458 207.824 1.00 0.00 ?  246 LEU B CA   1  
ATOM 8555   C C    . LEU B 1 246 ? 16.348  -27.569 206.834 1.00 0.00 ?  246 LEU B C    1  
ATOM 8556   O O    . LEU B 1 246 ? 15.415  -27.583 206.042 1.00 0.00 ?  246 LEU B O    1  
ATOM 8557   C CB   . LEU B 1 246 ? 17.471  -25.439 207.223 1.00 0.00 ?  246 LEU B CB   1  
ATOM 8558   C CG   . LEU B 1 246 ? 17.562  -24.136 208.032 1.00 0.00 ?  246 LEU B CG   1  
ATOM 8559   C CD1  . LEU B 1 246 ? 18.688  -23.236 207.497 1.00 0.00 ?  246 LEU B CD1  1  
ATOM 8560   C CD2  . LEU B 1 246 ? 16.217  -23.393 208.066 1.00 0.00 ?  246 LEU B CD2  1  
ATOM 8561   H H    . LEU B 1 246 ? 17.824  -26.705 209.413 1.00 0.00 ?  246 LEU B H    1  
ATOM 8562   H HA   . LEU B 1 246 ? 15.527  -26.000 207.985 1.00 0.00 ?  246 LEU B HA   1  
ATOM 8563   H HB2  . LEU B 1 246 ? 18.481  -25.904 207.166 1.00 0.00 ?  246 LEU B HB2  1  
ATOM 8564   H HB3  . LEU B 1 246 ? 17.147  -25.194 206.191 1.00 0.00 ?  246 LEU B HB3  1  
ATOM 8565   H HG   . LEU B 1 246 ? 17.821  -24.410 209.078 1.00 0.00 ?  246 LEU B HG   1  
ATOM 8566   H HD11 . LEU B 1 246 ? 18.738  -22.293 208.079 1.00 0.00 ?  246 LEU B HD11 1  
ATOM 8567   H HD12 . LEU B 1 246 ? 18.508  -22.986 206.431 1.00 0.00 ?  246 LEU B HD12 1  
ATOM 8568   H HD13 . LEU B 1 246 ? 19.667  -23.755 207.579 1.00 0.00 ?  246 LEU B HD13 1  
ATOM 8569   H HD21 . LEU B 1 246 ? 16.368  -22.312 207.859 1.00 0.00 ?  246 LEU B HD21 1  
ATOM 8570   H HD22 . LEU B 1 246 ? 15.742  -23.499 209.065 1.00 0.00 ?  246 LEU B HD22 1  
ATOM 8571   H HD23 . LEU B 1 246 ? 15.526  -23.805 207.302 1.00 0.00 ?  246 LEU B HD23 1  
ATOM 8572   N N    . ALA B 1 247 ? 17.296  -28.520 206.865 1.00 0.00 ?  247 ALA B N    1  
ATOM 8573   C CA   . ALA B 1 247 ? 17.291  -29.621 205.938 1.00 0.00 ?  247 ALA B CA   1  
ATOM 8574   C C    . ALA B 1 247 ? 16.056  -30.451 206.118 1.00 0.00 ?  247 ALA B C    1  
ATOM 8575   O O    . ALA B 1 247 ? 15.501  -30.942 205.133 1.00 0.00 ?  247 ALA B O    1  
ATOM 8576   C CB   . ALA B 1 247 ? 18.501  -30.553 206.108 1.00 0.00 ?  247 ALA B CB   1  
ATOM 8577   H H    . ALA B 1 247 ? 18.042  -28.502 207.520 1.00 0.00 ?  247 ALA B H    1  
ATOM 8578   H HA   . ALA B 1 247 ? 17.289  -29.203 204.945 1.00 0.00 ?  247 ALA B HA   1  
ATOM 8579   H HB1  . ALA B 1 247 ? 18.996  -30.724 205.128 1.00 0.00 ?  247 ALA B HB1  1  
ATOM 8580   H HB2  . ALA B 1 247 ? 18.178  -31.534 206.518 1.00 0.00 ?  247 ALA B HB2  1  
ATOM 8581   H HB3  . ALA B 1 247 ? 19.240  -30.103 206.804 1.00 0.00 ?  247 ALA B HB3  1  
ATOM 8582   N N    . GLU B 1 248 ? 15.617  -30.650 207.387 1.00 0.00 ?  248 GLU B N    1  
ATOM 8583   C CA   . GLU B 1 248 ? 14.460  -31.483 207.649 1.00 0.00 ?  248 GLU B CA   1  
ATOM 8584   C C    . GLU B 1 248 ? 13.275  -30.909 206.945 1.00 0.00 ?  248 GLU B C    1  
ATOM 8585   O O    . GLU B 1 248 ? 12.526  -31.638 206.294 1.00 0.00 ?  248 GLU B O    1  
ATOM 8586   C CB   . GLU B 1 248 ? 14.105  -31.574 209.152 1.00 0.00 ?  248 GLU B CB   1  
ATOM 8587   C CG   . GLU B 1 248 ? 12.893  -32.477 209.449 1.00 0.00 ?  248 GLU B CG   1  
ATOM 8588   C CD   . GLU B 1 248 ? 13.231  -33.921 209.080 1.00 0.00 ?  248 GLU B CD   1  
ATOM 8589   O OE1  . GLU B 1 248 ? 14.444  -34.271 209.059 1.00 0.00 ?  248 GLU B OE1  1  
ATOM 8590   O OE2  . GLU B 1 248 ? 12.275  -34.697 208.814 1.00 0.00 -1 248 GLU B OE2  1  
ATOM 8591   H H    . GLU B 1 248 ? 16.075  -30.256 208.182 1.00 0.00 ?  248 GLU B H    1  
ATOM 8592   H HA   . GLU B 1 248 ? 14.667  -32.465 207.254 1.00 0.00 ?  248 GLU B HA   1  
ATOM 8593   H HB2  . GLU B 1 248 ? 14.987  -31.963 209.705 1.00 0.00 ?  248 GLU B HB2  1  
ATOM 8594   H HB3  . GLU B 1 248 ? 13.889  -30.553 209.531 1.00 0.00 ?  248 GLU B HB3  1  
ATOM 8595   H HG2  . GLU B 1 248 ? 12.642  -32.423 210.531 1.00 0.00 ?  248 GLU B HG2  1  
ATOM 8596   H HG3  . GLU B 1 248 ? 12.010  -32.148 208.863 1.00 0.00 ?  248 GLU B HG3  1  
ATOM 8597   N N    . GLY B 1 249 ? 13.071  -29.587 207.052 1.00 0.00 ?  249 GLY B N    1  
ATOM 8598   C CA   . GLY B 1 249 ? 11.956  -28.991 206.379 1.00 0.00 ?  249 GLY B CA   1  
ATOM 8599   C C    . GLY B 1 249 ? 12.428  -28.689 205.001 1.00 0.00 ?  249 GLY B C    1  
ATOM 8600   O O    . GLY B 1 249 ? 13.585  -28.906 204.684 1.00 0.00 ?  249 GLY B O    1  
ATOM 8601   H H    . GLY B 1 249 ? 13.666  -28.981 207.580 1.00 0.00 ?  249 GLY B H    1  
ATOM 8602   H HA2  . GLY B 1 249 ? 11.152  -29.712 206.341 1.00 0.00 ?  249 GLY B HA2  1  
ATOM 8603   H HA3  . GLY B 1 249 ? 11.718  -28.068 206.884 1.00 0.00 ?  249 GLY B HA3  1  
ATOM 8604   N N    . ARG B 1 250 ? 11.525  -28.212 204.135 1.00 0.00 ?  250 ARG B N    1  
ATOM 8605   C CA   . ARG B 1 250 ? 11.922  -27.836 202.809 1.00 0.00 ?  250 ARG B CA   1  
ATOM 8606   C C    . ARG B 1 250 ? 12.124  -26.369 202.888 1.00 0.00 ?  250 ARG B C    1  
ATOM 8607   O O    . ARG B 1 250 ? 11.388  -25.600 202.266 1.00 0.00 ?  250 ARG B O    1  
ATOM 8608   C CB   . ARG B 1 250 ? 10.875  -28.128 201.721 1.00 0.00 ?  250 ARG B CB   1  
ATOM 8609   C CG   . ARG B 1 250 ? 10.609  -29.623 201.544 1.00 0.00 ?  250 ARG B CG   1  
ATOM 8610   C CD   . ARG B 1 250 ? 11.825  -30.365 200.978 1.00 0.00 ?  250 ARG B CD   1  
ATOM 8611   N NE   . ARG B 1 250 ? 11.424  -31.765 200.662 1.00 0.00 ?  250 ARG B NE   1  
ATOM 8612   C CZ   . ARG B 1 250 ? 12.344  -32.642 200.158 1.00 0.00 ?  250 ARG B CZ   1  
ATOM 8613   N NH1  . ARG B 1 250 ? 13.646  -32.258 200.005 1.00 0.00 1  250 ARG B NH1  1  
ATOM 8614   N NH2  . ARG B 1 250 ? 11.963  -33.907 199.816 1.00 0.00 ?  250 ARG B NH2  1  
ATOM 8615   H H    . ARG B 1 250 ? 10.562  -28.100 204.365 1.00 0.00 ?  250 ARG B H    1  
ATOM 8616   H HA   . ARG B 1 250 ? 12.859  -28.316 202.576 1.00 0.00 ?  250 ARG B HA   1  
ATOM 8617   H HB2  . ARG B 1 250 ? 9.924   -27.618 201.989 1.00 0.00 ?  250 ARG B HB2  1  
ATOM 8618   H HB3  . ARG B 1 250 ? 11.229  -27.709 200.755 1.00 0.00 ?  250 ARG B HB3  1  
ATOM 8619   H HG2  . ARG B 1 250 ? 10.339  -30.064 202.528 1.00 0.00 ?  250 ARG B HG2  1  
ATOM 8620   H HG3  . ARG B 1 250 ? 9.746   -29.760 200.857 1.00 0.00 ?  250 ARG B HG3  1  
ATOM 8621   H HD2  . ARG B 1 250 ? 12.181  -29.883 200.042 1.00 0.00 ?  250 ARG B HD2  1  
ATOM 8622   H HD3  . ARG B 1 250 ? 12.649  -30.400 201.721 1.00 0.00 ?  250 ARG B HD3  1  
ATOM 8623   H HE   . ARG B 1 250 ? 10.478  -32.057 200.797 1.00 0.00 ?  250 ARG B HE   1  
ATOM 8624   H HH11 . ARG B 1 250 ? 13.928  -31.334 200.261 1.00 0.00 ?  250 ARG B HH11 1  
ATOM 8625   H HH12 . ARG B 1 250 ? 14.318  -32.903 199.636 1.00 0.00 ?  250 ARG B HH12 1  
ATOM 8626   H HH21 . ARG B 1 250 ? 11.012  -34.193 199.936 1.00 0.00 ?  250 ARG B HH21 1  
ATOM 8627   H HH22 . ARG B 1 250 ? 12.633  -34.545 199.435 1.00 0.00 ?  250 ARG B HH22 1  
ATOM 8628   N N    . ALA B 1 251 ? 13.140  -25.951 203.689 1.00 0.00 ?  251 ALA B N    1  
ATOM 8629   C CA   . ALA B 1 251 ? 13.395  -24.551 203.883 1.00 0.00 ?  251 ALA B CA   1  
ATOM 8630   C C    . ALA B 1 251 ? 13.706  -23.934 202.562 1.00 0.00 ?  251 ALA B C    1  
ATOM 8631   O O    . ALA B 1 251 ? 14.620  -24.355 201.855 1.00 0.00 ?  251 ALA B O    1  
ATOM 8632   C CB   . ALA B 1 251 ? 14.577  -24.271 204.822 1.00 0.00 ?  251 ALA B CB   1  
ATOM 8633   H H    . ALA B 1 251 ? 13.746  -26.588 204.166 1.00 0.00 ?  251 ALA B H    1  
ATOM 8634   H HA   . ALA B 1 251 ? 12.500  -24.111 204.279 1.00 0.00 ?  251 ALA B HA   1  
ATOM 8635   H HB1  . ALA B 1 251 ? 14.262  -23.595 205.645 1.00 0.00 ?  251 ALA B HB1  1  
ATOM 8636   H HB2  . ALA B 1 251 ? 15.407  -23.787 204.263 1.00 0.00 ?  251 ALA B HB2  1  
ATOM 8637   H HB3  . ALA B 1 251 ? 14.952  -25.218 205.264 1.00 0.00 ?  251 ALA B HB3  1  
ATOM 8638   N N    . MET B 1 252 ? 12.897  -22.915 202.202 1.00 0.00 ?  252 MET B N    1  
ATOM 8639   C CA   . MET B 1 252 ? 13.082  -22.211 200.965 1.00 0.00 ?  252 MET B CA   1  
ATOM 8640   C C    . MET B 1 252 ? 13.128  -20.757 201.312 1.00 0.00 ?  252 MET B C    1  
ATOM 8641   O O    . MET B 1 252 ? 12.300  -20.284 202.090 1.00 0.00 ?  252 MET B O    1  
ATOM 8642   C CB   . MET B 1 252 ? 11.920  -22.418 199.975 1.00 0.00 ?  252 MET B CB   1  
ATOM 8643   C CG   . MET B 1 252 ? 12.177  -21.798 198.600 1.00 0.00 ?  252 MET B CG   1  
ATOM 8644   S SD   . MET B 1 252 ? 13.537  -22.601 197.701 1.00 0.00 ?  252 MET B SD   1  
ATOM 8645   C CE   . MET B 1 252 ? 12.585  -24.085 197.265 1.00 0.00 ?  252 MET B CE   1  
ATOM 8646   H H    . MET B 1 252 ? 12.132  -22.620 202.770 1.00 0.00 ?  252 MET B H    1  
ATOM 8647   H HA   . MET B 1 252 ? 14.020  -22.510 200.528 1.00 0.00 ?  252 MET B HA   1  
ATOM 8648   H HB2  . MET B 1 252 ? 11.738  -23.507 199.853 1.00 0.00 ?  252 MET B HB2  1  
ATOM 8649   H HB3  . MET B 1 252 ? 11.004  -21.963 200.400 1.00 0.00 ?  252 MET B HB3  1  
ATOM 8650   H HG2  . MET B 1 252 ? 11.242  -21.866 198.003 1.00 0.00 ?  252 MET B HG2  1  
ATOM 8651   H HG3  . MET B 1 252 ? 12.407  -20.720 198.737 1.00 0.00 ?  252 MET B HG3  1  
ATOM 8652   H HE1  . MET B 1 252 ? 12.728  -24.346 196.194 1.00 0.00 ?  252 MET B HE1  1  
ATOM 8653   H HE2  . MET B 1 252 ? 11.500  -23.925 197.438 1.00 0.00 ?  252 MET B HE2  1  
ATOM 8654   H HE3  . MET B 1 252 ? 12.906  -24.955 197.876 1.00 0.00 ?  252 MET B HE3  1  
ATOM 8655   N N    . LEU B 1 253 ? 14.109  -20.017 200.747 1.00 0.00 ?  253 LEU B N    1  
ATOM 8656   C CA   . LEU B 1 253 ? 14.195  -18.601 201.001 1.00 0.00 ?  253 LEU B CA   1  
ATOM 8657   C C    . LEU B 1 253 ? 13.748  -17.958 199.729 1.00 0.00 ?  253 LEU B C    1  
ATOM 8658   O O    . LEU B 1 253 ? 14.322  -18.224 198.681 1.00 0.00 ?  253 LEU B O    1  
ATOM 8659   C CB   . LEU B 1 253 ? 15.629  -18.114 201.287 1.00 0.00 ?  253 LEU B CB   1  
ATOM 8660   C CG   . LEU B 1 253 ? 16.278  -18.826 202.486 1.00 0.00 ?  253 LEU B CG   1  
ATOM 8661   C CD1  . LEU B 1 253 ? 17.727  -18.356 202.692 1.00 0.00 ?  253 LEU B CD1  1  
ATOM 8662   C CD2  . LEU B 1 253 ? 15.449  -18.640 203.768 1.00 0.00 ?  253 LEU B CD2  1  
ATOM 8663   H H    . LEU B 1 253 ? 14.803  -20.405 200.143 1.00 0.00 ?  253 LEU B H    1  
ATOM 8664   H HA   . LEU B 1 253 ? 13.525  -18.338 201.803 1.00 0.00 ?  253 LEU B HA   1  
ATOM 8665   H HB2  . LEU B 1 253 ? 16.254  -18.281 200.382 1.00 0.00 ?  253 LEU B HB2  1  
ATOM 8666   H HB3  . LEU B 1 253 ? 15.605  -17.023 201.492 1.00 0.00 ?  253 LEU B HB3  1  
ATOM 8667   H HG   . LEU B 1 253 ? 16.307  -19.913 202.259 1.00 0.00 ?  253 LEU B HG   1  
ATOM 8668   H HD11 . LEU B 1 253 ? 18.437  -19.171 202.440 1.00 0.00 ?  253 LEU B HD11 1  
ATOM 8669   H HD12 . LEU B 1 253 ? 17.890  -18.057 203.749 1.00 0.00 ?  253 LEU B HD12 1  
ATOM 8670   H HD13 . LEU B 1 253 ? 17.945  -17.482 202.040 1.00 0.00 ?  253 LEU B HD13 1  
ATOM 8671   H HD21 . LEU B 1 253 ? 14.588  -19.341 203.776 1.00 0.00 ?  253 LEU B HD21 1  
ATOM 8672   H HD22 . LEU B 1 253 ? 15.062  -17.601 203.827 1.00 0.00 ?  253 LEU B HD22 1  
ATOM 8673   H HD23 . LEU B 1 253 ? 16.077  -18.837 204.664 1.00 0.00 ?  253 LEU B HD23 1  
ATOM 8674   N N    . LEU B 1 254 ? 12.705  -17.097 199.794 1.00 0.00 ?  254 LEU B N    1  
ATOM 8675   C CA   . LEU B 1 254 ? 12.207  -16.454 198.600 1.00 0.00 ?  254 LEU B CA   1  
ATOM 8676   C C    . LEU B 1 254 ? 12.308  -14.973 198.796 1.00 0.00 ?  254 LEU B C    1  
ATOM 8677   O O    . LEU B 1 254 ? 11.969  -14.451 199.853 1.00 0.00 ?  254 LEU B O    1  
ATOM 8678   C CB   . LEU B 1 254 ? 10.734  -16.785 198.297 1.00 0.00 ?  254 LEU B CB   1  
ATOM 8679   C CG   . LEU B 1 254 ? 10.429  -18.295 198.353 1.00 0.00 ?  254 LEU B CG   1  
ATOM 8680   C CD1  . LEU B 1 254 ? 10.085  -18.753 199.781 1.00 0.00 ?  254 LEU B CD1  1  
ATOM 8681   C CD2  . LEU B 1 254 ? 9.313   -18.677 197.365 1.00 0.00 ?  254 LEU B CD2  1  
ATOM 8682   H H    . LEU B 1 254 ? 12.240  -16.876 200.645 1.00 0.00 ?  254 LEU B H    1  
ATOM 8683   H HA   . LEU B 1 254 ? 12.831  -16.739 197.770 1.00 0.00 ?  254 LEU B HA   1  
ATOM 8684   H HB2  . LEU B 1 254 ? 10.092  -16.258 199.030 1.00 0.00 ?  254 LEU B HB2  1  
ATOM 8685   H HB3  . LEU B 1 254 ? 10.480  -16.409 197.285 1.00 0.00 ?  254 LEU B HB3  1  
ATOM 8686   H HG   . LEU B 1 254 ? 11.351  -18.832 198.043 1.00 0.00 ?  254 LEU B HG   1  
ATOM 8687   H HD11 . LEU B 1 254 ? 9.494   -17.972 200.306 1.00 0.00 ?  254 LEU B HD11 1  
ATOM 8688   H HD12 . LEU B 1 254 ? 11.014  -18.943 200.360 1.00 0.00 ?  254 LEU B HD12 1  
ATOM 8689   H HD13 . LEU B 1 254 ? 9.488   -19.690 199.753 1.00 0.00 ?  254 LEU B HD13 1  
ATOM 8690   H HD21 . LEU B 1 254 ? 8.380   -18.125 197.605 1.00 0.00 ?  254 LEU B HD21 1  
ATOM 8691   H HD22 . LEU B 1 254 ? 9.104   -19.767 197.422 1.00 0.00 ?  254 LEU B HD22 1  
ATOM 8692   H HD23 . LEU B 1 254 ? 9.616   -18.428 196.325 1.00 0.00 ?  254 LEU B HD23 1  
ATOM 8693   N N    . VAL B 1 255 ? 12.792  -14.266 197.752 1.00 0.00 ?  255 VAL B N    1  
ATOM 8694   C CA   . VAL B 1 255 ? 12.922  -12.833 197.818 1.00 0.00 ?  255 VAL B CA   1  
ATOM 8695   C C    . VAL B 1 255 ? 12.372  -12.288 196.542 1.00 0.00 ?  255 VAL B C    1  
ATOM 8696   O O    . VAL B 1 255 ? 12.645  -12.831 195.470 1.00 0.00 ?  255 VAL B O    1  
ATOM 8697   C CB   . VAL B 1 255 ? 14.342  -12.365 197.971 1.00 0.00 ?  255 VAL B CB   1  
ATOM 8698   C CG1  . VAL B 1 255 ? 14.362  -10.827 197.939 1.00 0.00 ?  255 VAL B CG1  1  
ATOM 8699   C CG2  . VAL B 1 255 ? 14.878  -12.919 199.299 1.00 0.00 ?  255 VAL B CG2  1  
ATOM 8700   H H    . VAL B 1 255 ? 13.069  -14.698 196.891 1.00 0.00 ?  255 VAL B H    1  
ATOM 8701   H HA   . VAL B 1 255 ? 12.316  -12.478 198.637 1.00 0.00 ?  255 VAL B HA   1  
ATOM 8702   H HB   . VAL B 1 255 ? 14.967  -12.755 197.141 1.00 0.00 ?  255 VAL B HB   1  
ATOM 8703   H HG11 . VAL B 1 255 ? 14.590  -10.464 196.914 1.00 0.00 ?  255 VAL B HG11 1  
ATOM 8704   H HG12 . VAL B 1 255 ? 15.138  -10.437 198.633 1.00 0.00 ?  255 VAL B HG12 1  
ATOM 8705   H HG13 . VAL B 1 255 ? 13.375  -10.421 198.247 1.00 0.00 ?  255 VAL B HG13 1  
ATOM 8706   H HG21 . VAL B 1 255 ? 14.303  -12.496 200.148 1.00 0.00 ?  255 VAL B HG21 1  
ATOM 8707   H HG22 . VAL B 1 255 ? 15.949  -12.651 199.426 1.00 0.00 ?  255 VAL B HG22 1  
ATOM 8708   H HG23 . VAL B 1 255 ? 14.783  -14.024 199.323 1.00 0.00 ?  255 VAL B HG23 1  
ATOM 8709   N N    . MET B 1 256 ? 11.565  -11.198 196.636 1.00 0.00 ?  256 MET B N    1  
ATOM 8710   C CA   . MET B 1 256 ? 11.005  -10.602 195.450 1.00 0.00 ?  256 MET B CA   1  
ATOM 8711   C C    . MET B 1 256 ? 11.414  -9.168  195.463 1.00 0.00 ?  256 MET B C    1  
ATOM 8712   O O    . MET B 1 256 ? 11.472  -8.530  196.512 1.00 0.00 ?  256 MET B O    1  
ATOM 8713   C CB   . MET B 1 256 ? 9.467   -10.685 195.367 1.00 0.00 ?  256 MET B CB   1  
ATOM 8714   C CG   . MET B 1 256 ? 8.754   -9.975  196.520 1.00 0.00 ?  256 MET B CG   1  
ATOM 8715   S SD   . MET B 1 256 ? 6.950   -10.162 196.448 1.00 0.00 ?  256 MET B SD   1  
ATOM 8716   C CE   . MET B 1 256 ? 6.960   -11.911 196.924 1.00 0.00 ?  256 MET B CE   1  
ATOM 8717   H H    . MET B 1 256 ? 11.341  -10.762 197.509 1.00 0.00 ?  256 MET B H    1  
ATOM 8718   H HA   . MET B 1 256 ? 11.450  -11.076 194.591 1.00 0.00 ?  256 MET B HA   1  
ATOM 8719   H HB2  . MET B 1 256 ? 9.136   -10.235 194.407 1.00 0.00 ?  256 MET B HB2  1  
ATOM 8720   H HB3  . MET B 1 256 ? 9.165   -11.754 195.364 1.00 0.00 ?  256 MET B HB3  1  
ATOM 8721   H HG2  . MET B 1 256 ? 9.133   -10.390 197.475 1.00 0.00 ?  256 MET B HG2  1  
ATOM 8722   H HG3  . MET B 1 256 ? 9.016   -8.897  196.494 1.00 0.00 ?  256 MET B HG3  1  
ATOM 8723   H HE1  . MET B 1 256 ? 6.298   -12.088 197.798 1.00 0.00 ?  256 MET B HE1  1  
ATOM 8724   H HE2  . MET B 1 256 ? 7.985   -12.241 197.197 1.00 0.00 ?  256 MET B HE2  1  
ATOM 8725   H HE3  . MET B 1 256 ? 6.605   -12.551 196.088 1.00 0.00 ?  256 MET B HE3  1  
ATOM 8726   N N    . ILE B 1 257 ? 11.715  -8.650  194.257 1.00 0.00 ?  257 ILE B N    1  
ATOM 8727   C CA   . ILE B 1 257 ? 12.165  -7.294  194.104 1.00 0.00 ?  257 ILE B CA   1  
ATOM 8728   C C    . ILE B 1 257 ? 11.284  -6.661  193.070 1.00 0.00 ?  257 ILE B C    1  
ATOM 8729   O O    . ILE B 1 257 ? 11.078  -7.246  192.012 1.00 0.00 ?  257 ILE B O    1  
ATOM 8730   C CB   . ILE B 1 257 ? 13.573  -7.233  193.584 1.00 0.00 ?  257 ILE B CB   1  
ATOM 8731   C CG1  . ILE B 1 257 ? 14.550  -7.952  194.537 1.00 0.00 ?  257 ILE B CG1  1  
ATOM 8732   C CG2  . ILE B 1 257 ? 13.938  -5.759  193.399 1.00 0.00 ?  257 ILE B CG2  1  
ATOM 8733   C CD1  . ILE B 1 257 ? 15.931  -8.144  193.915 1.00 0.00 ?  257 ILE B CD1  1  
ATOM 8734   H H    . ILE B 1 257 ? 11.635  -9.184  193.418 1.00 0.00 ?  257 ILE B H    1  
ATOM 8735   H HA   . ILE B 1 257 ? 12.068  -6.777  195.043 1.00 0.00 ?  257 ILE B HA   1  
ATOM 8736   H HB   . ILE B 1 257 ? 13.621  -7.731  192.591 1.00 0.00 ?  257 ILE B HB   1  
ATOM 8737   H HG12 . ILE B 1 257 ? 14.654  -7.356  195.466 1.00 0.00 ?  257 ILE B HG12 1  
ATOM 8738   H HG13 . ILE B 1 257 ? 14.139  -8.946  194.809 1.00 0.00 ?  257 ILE B HG13 1  
ATOM 8739   H HG21 . ILE B 1 257 ? 13.757  -5.445  192.349 1.00 0.00 ?  257 ILE B HG21 1  
ATOM 8740   H HG22 . ILE B 1 257 ? 15.010  -5.593  193.640 1.00 0.00 ?  257 ILE B HG22 1  
ATOM 8741   H HG23 . ILE B 1 257 ? 13.321  -5.123  194.071 1.00 0.00 ?  257 ILE B HG23 1  
ATOM 8742   H HD11 . ILE B 1 257 ? 15.969  -7.674  192.912 1.00 0.00 ?  257 ILE B HD11 1  
ATOM 8743   H HD12 . ILE B 1 257 ? 16.160  -9.226  193.809 1.00 0.00 ?  257 ILE B HD12 1  
ATOM 8744   H HD13 . ILE B 1 257 ? 16.711  -7.678  194.553 1.00 0.00 ?  257 ILE B HD13 1  
ATOM 8745   N N    . GLU B 1 258 ? 10.720  -5.456  193.339 1.00 0.00 ?  258 GLU B N    1  
ATOM 8746   C CA   . GLU B 1 258 ? 9.889   -4.844  192.335 1.00 0.00 ?  258 GLU B CA   1  
ATOM 8747   C C    . GLU B 1 258 ? 9.868   -3.356  192.537 1.00 0.00 ?  258 GLU B C    1  
ATOM 8748   O O    . GLU B 1 258 ? 10.028  -2.867  193.648 1.00 0.00 ?  258 GLU B O    1  
ATOM 8749   C CB   . GLU B 1 258 ? 8.437   -5.353  192.353 1.00 0.00 ?  258 GLU B CB   1  
ATOM 8750   C CG   . GLU B 1 258 ? 7.679   -4.961  193.626 1.00 0.00 ?  258 GLU B CG   1  
ATOM 8751   C CD   . GLU B 1 258 ? 6.304   -5.612  193.587 1.00 0.00 ?  258 GLU B CD   1  
ATOM 8752   O OE1  . GLU B 1 258 ? 6.096   -6.509  192.727 1.00 0.00 ?  258 GLU B OE1  1  
ATOM 8753   O OE2  . GLU B 1 258 ? 5.435   -5.212  194.407 1.00 0.00 -1 258 GLU B OE2  1  
ATOM 8754   H H    . GLU B 1 258 ? 10.851  -4.965  194.193 1.00 0.00 ?  258 GLU B H    1  
ATOM 8755   H HA   . GLU B 1 258 ? 10.343  -5.055  191.387 1.00 0.00 ?  258 GLU B HA   1  
ATOM 8756   H HB2  . GLU B 1 258 ? 7.899   -4.944  191.470 1.00 0.00 ?  258 GLU B HB2  1  
ATOM 8757   H HB3  . GLU B 1 258 ? 8.445   -6.460  192.268 1.00 0.00 ?  258 GLU B HB3  1  
ATOM 8758   H HG2  . GLU B 1 258 ? 8.234   -5.311  194.524 1.00 0.00 ?  258 GLU B HG2  1  
ATOM 8759   H HG3  . GLU B 1 258 ? 7.556   -3.859  193.680 1.00 0.00 ?  258 GLU B HG3  1  
ATOM 8760   N N    . GLY B 1 259 ? 9.654   -2.598  191.427 1.00 0.00 ?  259 GLY B N    1  
ATOM 8761   C CA   . GLY B 1 259 ? 9.595   -1.158  191.520 1.00 0.00 ?  259 GLY B CA   1  
ATOM 8762   C C    . GLY B 1 259 ? 9.497   -0.603  190.129 1.00 0.00 ?  259 GLY B C    1  
ATOM 8763   O O    . GLY B 1 259 ? 9.498   -1.348  189.148 1.00 0.00 ?  259 GLY B O    1  
ATOM 8764   H H    . GLY B 1 259 ? 9.531   -2.994  190.521 1.00 0.00 ?  259 GLY B H    1  
ATOM 8765   H HA2  . GLY B 1 259 ? 8.698   -0.902  192.064 1.00 0.00 ?  259 GLY B HA2  1  
ATOM 8766   H HA3  . GLY B 1 259 ? 10.503  -0.812  191.971 1.00 0.00 ?  259 GLY B HA3  1  
ATOM 8767   N N    . SER B 1 260 ? 9.410   0.749   190.020 1.00 0.00 ?  260 SER B N    1  
ATOM 8768   C CA   . SER B 1 260 ? 9.302   1.375   188.725 1.00 0.00 ?  260 SER B CA   1  
ATOM 8769   C C    . SER B 1 260 ? 10.640  1.300   188.064 1.00 0.00 ?  260 SER B C    1  
ATOM 8770   O O    . SER B 1 260 ? 11.670  1.187   188.731 1.00 0.00 ?  260 SER B O    1  
ATOM 8771   C CB   . SER B 1 260 ? 8.890   2.849   188.787 1.00 0.00 ?  260 SER B CB   1  
ATOM 8772   O OG   . SER B 1 260 ? 9.942   3.620   189.337 1.00 0.00 ?  260 SER B OG   1  
ATOM 8773   H H    . SER B 1 260 ? 9.421   1.356   190.813 1.00 0.00 ?  260 SER B H    1  
ATOM 8774   H HA   . SER B 1 260 ? 8.589   0.808   188.147 1.00 0.00 ?  260 SER B HA   1  
ATOM 8775   H HB2  . SER B 1 260 ? 8.666   3.225   187.765 1.00 0.00 ?  260 SER B HB2  1  
ATOM 8776   H HB3  . SER B 1 260 ? 7.987   2.968   189.422 1.00 0.00 ?  260 SER B HB3  1  
ATOM 8777   H HG   . SER B 1 260 ? 10.136  4.299   188.684 1.00 0.00 ?  260 SER B HG   1  
ATOM 8778   N N    . ASP B 1 261 ? 10.640  1.396   186.712 1.00 0.00 ?  261 ASP B N    1  
ATOM 8779   C CA   . ASP B 1 261 ? 11.867  1.293   185.964 1.00 0.00 ?  261 ASP B CA   1  
ATOM 8780   C C    . ASP B 1 261 ? 12.384  2.637   185.494 1.00 0.00 ?  261 ASP B C    1  
ATOM 8781   O O    . ASP B 1 261 ? 13.400  2.641   184.814 1.00 0.00 ?  261 ASP B O    1  
ATOM 8782   C CB   . ASP B 1 261 ? 11.697  0.413   184.718 1.00 0.00 ?  261 ASP B CB   1  
ATOM 8783   C CG   . ASP B 1 261 ? 11.457  -1.045  185.083 1.00 0.00 ?  261 ASP B CG   1  
ATOM 8784   O OD1  . ASP B 1 261 ? 11.808  -1.434  186.229 1.00 0.00 ?  261 ASP B OD1  1  
ATOM 8785   O OD2  . ASP B 1 261 ? 10.902  -1.783  184.227 1.00 0.00 -1 261 ASP B OD2  1  
ATOM 8786   H H    . ASP B 1 261 ? 9.802   1.524   186.182 1.00 0.00 ?  261 ASP B H    1  
ATOM 8787   H HA   . ASP B 1 261 ? 12.605  0.850   186.610 1.00 0.00 ?  261 ASP B HA   1  
ATOM 8788   H HB2  . ASP B 1 261 ? 10.833  0.779   184.125 1.00 0.00 ?  261 ASP B HB2  1  
ATOM 8789   H HB3  . ASP B 1 261 ? 12.610  0.479   184.089 1.00 0.00 ?  261 ASP B HB3  1  
ATOM 8790   N N    . GLU B 1 262 ? 11.682  3.796   185.781 1.00 0.00 ?  262 GLU B N    1  
ATOM 8791   C CA   . GLU B 1 262 ? 12.119  5.156   185.327 1.00 0.00 ?  262 GLU B CA   1  
ATOM 8792   C C    . GLU B 1 262 ? 11.792  5.311   183.847 1.00 0.00 ?  262 GLU B C    1  
ATOM 8793   O O    . GLU B 1 262 ? 11.546  6.409   183.346 1.00 0.00 ?  262 GLU B O    1  
ATOM 8794   C CB   . GLU B 1 262 ? 13.617  5.489   185.538 1.00 0.00 ?  262 GLU B CB   1  
ATOM 8795   C CG   . GLU B 1 262 ? 13.934  6.975   185.336 1.00 0.00 ?  262 GLU B CG   1  
ATOM 8796   C CD   . GLU B 1 262 ? 13.263  7.783   186.441 1.00 0.00 ?  262 GLU B CD   1  
ATOM 8797   O OE1  . GLU B 1 262 ? 13.010  8.995   186.211 1.00 0.00 ?  262 GLU B OE1  1  
ATOM 8798   O OE2  . GLU B 1 262 ? 13.018  7.212   187.536 1.00 0.00 -1 262 GLU B OE2  1  
ATOM 8799   H H    . GLU B 1 262 ? 10.838  3.775   186.313 1.00 0.00 ?  262 GLU B H    1  
ATOM 8800   H HA   . GLU B 1 262 ? 11.511  5.863   185.874 1.00 0.00 ?  262 GLU B HA   1  
ATOM 8801   H HB2  . GLU B 1 262 ? 13.910  5.192   186.568 1.00 0.00 ?  262 GLU B HB2  1  
ATOM 8802   H HB3  . GLU B 1 262 ? 14.224  4.894   184.825 1.00 0.00 ?  262 GLU B HB3  1  
ATOM 8803   H HG2  . GLU B 1 262 ? 15.034  7.137   185.371 1.00 0.00 ?  262 GLU B HG2  1  
ATOM 8804   H HG3  . GLU B 1 262 ? 13.550  7.315   184.351 1.00 0.00 ?  262 GLU B HG3  1  
ATOM 8805   N N    . THR B 1 263 ? 11.773  4.160   183.159 1.00 0.00 ?  263 THR B N    1  
ATOM 8806   C CA   . THR B 1 263 ? 11.414  3.974   181.777 1.00 0.00 ?  263 THR B CA   1  
ATOM 8807   C C    . THR B 1 263 ? 9.929   4.027   181.809 1.00 0.00 ?  263 THR B C    1  
ATOM 8808   O O    . THR B 1 263 ? 9.389   4.441   182.830 1.00 0.00 ?  263 THR B O    1  
ATOM 8809   C CB   . THR B 1 263 ? 11.855  2.664   181.184 1.00 0.00 ?  263 THR B CB   1  
ATOM 8810   O OG1  . THR B 1 263 ? 11.214  1.577   181.838 1.00 0.00 ?  263 THR B OG1  1  
ATOM 8811   C CG2  . THR B 1 263 ? 13.379  2.552   181.335 1.00 0.00 ?  263 THR B CG2  1  
ATOM 8812   H H    . THR B 1 263 ? 12.029  3.313   183.619 1.00 0.00 ?  263 THR B H    1  
ATOM 8813   H HA   . THR B 1 263 ? 11.795  4.814   181.215 1.00 0.00 ?  263 THR B HA   1  
ATOM 8814   H HB   . THR B 1 263 ? 11.603  2.631   180.104 1.00 0.00 ?  263 THR B HB   1  
ATOM 8815   H HG1  . THR B 1 263 ? 11.821  1.285   182.522 1.00 0.00 ?  263 THR B HG1  1  
ATOM 8816   H HG21 . THR B 1 263 ? 13.832  3.562   181.423 1.00 0.00 ?  263 THR B HG21 1  
ATOM 8817   H HG22 . THR B 1 263 ? 13.818  2.042   180.450 1.00 0.00 ?  263 THR B HG22 1  
ATOM 8818   H HG23 . THR B 1 263 ? 13.635  1.968   182.244 1.00 0.00 ?  263 THR B HG23 1  
ATOM 8819   N N    . THR B 1 264 ? 9.217   3.777   180.674 1.00 0.00 ?  264 THR B N    1  
ATOM 8820   C CA   . THR B 1 264 ? 7.777   3.861   180.741 1.00 0.00 ?  264 THR B CA   1  
ATOM 8821   C C    . THR B 1 264 ? 7.471   2.993   181.905 1.00 0.00 ?  264 THR B C    1  
ATOM 8822   O O    . THR B 1 264 ? 7.860   1.833   181.974 1.00 0.00 ?  264 THR B O    1  
ATOM 8823   C CB   . THR B 1 264 ? 7.081   3.284   179.540 1.00 0.00 ?  264 THR B CB   1  
ATOM 8824   O OG1  . THR B 1 264 ? 7.531   3.928   178.358 1.00 0.00 ?  264 THR B OG1  1  
ATOM 8825   C CG2  . THR B 1 264 ? 5.568   3.477   179.710 1.00 0.00 ?  264 THR B CG2  1  
ATOM 8826   H H    . THR B 1 264 ? 9.632   3.539   179.799 1.00 0.00 ?  264 THR B H    1  
ATOM 8827   H HA   . THR B 1 264 ? 7.486   4.884   180.938 1.00 0.00 ?  264 THR B HA   1  
ATOM 8828   H HB   . THR B 1 264 ? 7.294   2.198   179.462 1.00 0.00 ?  264 THR B HB   1  
ATOM 8829   H HG1  . THR B 1 264 ? 8.442   3.651   178.235 1.00 0.00 ?  264 THR B HG1  1  
ATOM 8830   H HG21 . THR B 1 264 ? 5.092   2.527   180.036 1.00 0.00 ?  264 THR B HG21 1  
ATOM 8831   H HG22 . THR B 1 264 ? 5.109   3.793   178.750 1.00 0.00 ?  264 THR B HG22 1  
ATOM 8832   H HG23 . THR B 1 264 ? 5.365   4.255   180.474 1.00 0.00 ?  264 THR B HG23 1  
ATOM 8833   N N    . ALA B 1 265 ? 6.717   3.583   182.854 1.00 0.00 ?  265 ALA B N    1  
ATOM 8834   C CA   . ALA B 1 265 ? 6.574   2.975   184.134 1.00 0.00 ?  265 ALA B CA   1  
ATOM 8835   C C    . ALA B 1 265 ? 5.657   1.827   184.133 1.00 0.00 ?  265 ALA B C    1  
ATOM 8836   O O    . ALA B 1 265 ? 4.454   1.929   183.918 1.00 0.00 ?  265 ALA B O    1  
ATOM 8837   C CB   . ALA B 1 265 ? 6.071   3.956   185.202 1.00 0.00 ?  265 ALA B CB   1  
ATOM 8838   H H    . ALA B 1 265 ? 6.231   4.444   182.704 1.00 0.00 ?  265 ALA B H    1  
ATOM 8839   H HA   . ALA B 1 265 ? 7.551   2.624   184.419 1.00 0.00 ?  265 ALA B HA   1  
ATOM 8840   H HB1  . ALA B 1 265 ? 4.970   4.081   185.124 1.00 0.00 ?  265 ALA B HB1  1  
ATOM 8841   H HB2  . ALA B 1 265 ? 6.552   4.949   185.070 1.00 0.00 ?  265 ALA B HB2  1  
ATOM 8842   H HB3  . ALA B 1 265 ? 6.314   3.577   186.218 1.00 0.00 ?  265 ALA B HB3  1  
ATOM 8843   N N    . GLN B 1 266 ? 6.287   0.685   184.429 1.00 0.00 ?  266 GLN B N    1  
ATOM 8844   C CA   . GLN B 1 266 ? 5.609   -0.544  184.590 1.00 0.00 ?  266 GLN B CA   1  
ATOM 8845   C C    . GLN B 1 266 ? 6.220   -1.070  185.840 1.00 0.00 ?  266 GLN B C    1  
ATOM 8846   O O    . GLN B 1 266 ? 7.396   -0.799  186.104 1.00 0.00 ?  266 GLN B O    1  
ATOM 8847   C CB   . GLN B 1 266 ? 5.850   -1.586  183.480 1.00 0.00 ?  266 GLN B CB   1  
ATOM 8848   C CG   . GLN B 1 266 ? 5.331   -1.154  182.108 1.00 0.00 ?  266 GLN B CG   1  
ATOM 8849   C CD   . GLN B 1 266 ? 5.593   -2.299  181.136 1.00 0.00 ?  266 GLN B CD   1  
ATOM 8850   O OE1  . GLN B 1 266 ? 5.366   -3.466  181.459 1.00 0.00 ?  266 GLN B OE1  1  
ATOM 8851   N NE2  . GLN B 1 266 ? 6.088   -1.962  179.913 1.00 0.00 ?  266 GLN B NE2  1  
ATOM 8852   H H    . GLN B 1 266 ? 7.276   0.651   184.550 1.00 0.00 ?  266 GLN B H    1  
ATOM 8853   H HA   . GLN B 1 266 ? 4.557   -0.347  184.740 1.00 0.00 ?  266 GLN B HA   1  
ATOM 8854   H HB2  . GLN B 1 266 ? 6.940   -1.785  183.406 1.00 0.00 ?  266 GLN B HB2  1  
ATOM 8855   H HB3  . GLN B 1 266 ? 5.350   -2.535  183.767 1.00 0.00 ?  266 GLN B HB3  1  
ATOM 8856   H HG2  . GLN B 1 266 ? 4.240   -0.943  182.158 1.00 0.00 ?  266 GLN B HG2  1  
ATOM 8857   H HG3  . GLN B 1 266 ? 5.867   -0.246  181.760 1.00 0.00 ?  266 GLN B HG3  1  
ATOM 8858   H HE21 . GLN B 1 266 ? 6.262   -1.003  179.691 1.00 0.00 ?  266 GLN B HE21 1  
ATOM 8859   H HE22 . GLN B 1 266 ? 6.279   -2.676  179.233 1.00 0.00 ?  266 GLN B HE22 1  
ATOM 8860   N N    . VAL B 1 267 ? 5.457   -1.832  186.643 1.00 0.00 ?  267 VAL B N    1  
ATOM 8861   C CA   . VAL B 1 267 ? 6.017   -2.368  187.851 1.00 0.00 ?  267 VAL B CA   1  
ATOM 8862   C C    . VAL B 1 267 ? 6.580   -3.696  187.472 1.00 0.00 ?  267 VAL B C    1  
ATOM 8863   O O    . VAL B 1 267 ? 5.849   -4.642  187.188 1.00 0.00 ?  267 VAL B O    1  
ATOM 8864   C CB   . VAL B 1 267 ? 5.019   -2.545  188.976 1.00 0.00 ?  267 VAL B CB   1  
ATOM 8865   C CG1  . VAL B 1 267 ? 3.660   -3.002  188.401 1.00 0.00 ?  267 VAL B CG1  1  
ATOM 8866   C CG2  . VAL B 1 267 ? 5.600   -3.544  190.000 1.00 0.00 ?  267 VAL B CG2  1  
ATOM 8867   H H    . VAL B 1 267 ? 4.504   -2.051  186.446 1.00 0.00 ?  267 VAL B H    1  
ATOM 8868   H HA   . VAL B 1 267 ? 6.823   -1.721  188.162 1.00 0.00 ?  267 VAL B HA   1  
ATOM 8869   H HB   . VAL B 1 267 ? 4.869   -1.572  189.489 1.00 0.00 ?  267 VAL B HB   1  
ATOM 8870   H HG11 . VAL B 1 267 ? 3.160   -3.699  189.107 1.00 0.00 ?  267 VAL B HG11 1  
ATOM 8871   H HG12 . VAL B 1 267 ? 3.793   -3.520  187.430 1.00 0.00 ?  267 VAL B HG12 1  
ATOM 8872   H HG13 . VAL B 1 267 ? 2.996   -2.125  188.244 1.00 0.00 ?  267 VAL B HG13 1  
ATOM 8873   H HG21 . VAL B 1 267 ? 5.408   -4.589  189.673 1.00 0.00 ?  267 VAL B HG21 1  
ATOM 8874   H HG22 . VAL B 1 267 ? 5.129   -3.394  190.994 1.00 0.00 ?  267 VAL B HG22 1  
ATOM 8875   H HG23 . VAL B 1 267 ? 6.697   -3.400  190.102 1.00 0.00 ?  267 VAL B HG23 1  
ATOM 8876   N N    . MET B 1 268 ? 7.925   -3.782  187.463 1.00 0.00 ?  268 MET B N    1  
ATOM 8877   C CA   . MET B 1 268 ? 8.582   -5.000  187.082 1.00 0.00 ?  268 MET B CA   1  
ATOM 8878   C C    . MET B 1 268 ? 8.965   -5.693  188.341 1.00 0.00 ?  268 MET B C    1  
ATOM 8879   O O    . MET B 1 268 ? 9.614   -5.104  189.192 1.00 0.00 ?  268 MET B O    1  
ATOM 8880   C CB   . MET B 1 268 ? 9.855   -4.753  186.260 1.00 0.00 ?  268 MET B CB   1  
ATOM 8881   C CG   . MET B 1 268 ? 10.546  -6.046  185.836 1.00 0.00 ?  268 MET B CG   1  
ATOM 8882   S SD   . MET B 1 268 ? 11.963  -5.750  184.739 1.00 0.00 ?  268 MET B SD   1  
ATOM 8883   C CE   . MET B 1 268 ? 13.022  -5.035  186.029 1.00 0.00 ?  268 MET B CE   1  
ATOM 8884   H H    . MET B 1 268 ? 8.516   -3.015  187.713 1.00 0.00 ?  268 MET B H    1  
ATOM 8885   H HA   . MET B 1 268 ? 7.885   -5.610  186.532 1.00 0.00 ?  268 MET B HA   1  
ATOM 8886   H HB2  . MET B 1 268 ? 9.591   -4.168  185.353 1.00 0.00 ?  268 MET B HB2  1  
ATOM 8887   H HB3  . MET B 1 268 ? 10.565  -4.149  186.864 1.00 0.00 ?  268 MET B HB3  1  
ATOM 8888   H HG2  . MET B 1 268 ? 10.884  -6.584  186.749 1.00 0.00 ?  268 MET B HG2  1  
ATOM 8889   H HG3  . MET B 1 268 ? 9.805   -6.692  185.321 1.00 0.00 ?  268 MET B HG3  1  
ATOM 8890   H HE1  . MET B 1 268 ? 12.912  -3.929  186.065 1.00 0.00 ?  268 MET B HE1  1  
ATOM 8891   H HE2  . MET B 1 268 ? 14.091  -5.268  185.838 1.00 0.00 ?  268 MET B HE2  1  
ATOM 8892   H HE3  . MET B 1 268 ? 12.755  -5.440  187.029 1.00 0.00 ?  268 MET B HE3  1  
ATOM 8893   N N    . GLN B 1 269 ? 8.575   -6.984  188.457 1.00 0.00 ?  269 GLN B N    1  
ATOM 8894   C CA   . GLN B 1 269 ? 8.851   -7.759  189.645 1.00 0.00 ?  269 GLN B CA   1  
ATOM 8895   C C    . GLN B 1 269 ? 9.746   -8.891  189.252 1.00 0.00 ?  269 GLN B C    1  
ATOM 8896   O O    . GLN B 1 269 ? 9.936   -9.162  188.068 1.00 0.00 ?  269 GLN B O    1  
ATOM 8897   C CB   . GLN B 1 269 ? 7.598   -8.408  190.272 1.00 0.00 ?  269 GLN B CB   1  
ATOM 8898   C CG   . GLN B 1 269 ? 6.276   -7.983  189.605 1.00 0.00 ?  269 GLN B CG   1  
ATOM 8899   C CD   . GLN B 1 269 ? 6.134   -8.695  188.257 1.00 0.00 ?  269 GLN B CD   1  
ATOM 8900   O OE1  . GLN B 1 269 ? 5.886   -8.064  187.235 1.00 0.00 ?  269 GLN B OE1  1  
ATOM 8901   N NE2  . GLN B 1 269 ? 6.283   -10.044 188.253 1.00 0.00 ?  269 GLN B NE2  1  
ATOM 8902   H H    . GLN B 1 269 ? 8.082   -7.456  187.731 1.00 0.00 ?  269 GLN B H    1  
ATOM 8903   H HA   . GLN B 1 269 ? 9.351   -7.129  190.360 1.00 0.00 ?  269 GLN B HA   1  
ATOM 8904   H HB2  . GLN B 1 269 ? 7.701   -9.511  190.217 1.00 0.00 ?  269 GLN B HB2  1  
ATOM 8905   H HB3  . GLN B 1 269 ? 7.556   -8.129  191.347 1.00 0.00 ?  269 GLN B HB3  1  
ATOM 8906   H HG2  . GLN B 1 269 ? 5.419   -8.259  190.259 1.00 0.00 ?  269 GLN B HG2  1  
ATOM 8907   H HG3  . GLN B 1 269 ? 6.263   -6.886  189.442 1.00 0.00 ?  269 GLN B HG3  1  
ATOM 8908   H HE21 . GLN B 1 269 ? 6.472   -10.528 189.106 1.00 0.00 ?  269 GLN B HE21 1  
ATOM 8909   H HE22 . GLN B 1 269 ? 6.205   -10.553 187.395 1.00 0.00 ?  269 GLN B HE22 1  
ATOM 8910   N N    . ALA B 1 270 ? 10.314  -9.592  190.264 1.00 0.00 ?  270 ALA B N    1  
ATOM 8911   C CA   . ALA B 1 270 ? 11.176  -10.712 189.985 1.00 0.00 ?  270 ALA B CA   1  
ATOM 8912   C C    . ALA B 1 270 ? 10.978  -11.712 191.088 1.00 0.00 ?  270 ALA B C    1  
ATOM 8913   O O    . ALA B 1 270 ? 10.782  -11.331 192.243 1.00 0.00 ?  270 ALA B O    1  
ATOM 8914   C CB   . ALA B 1 270 ? 12.665  -10.339 189.949 1.00 0.00 ?  270 ALA B CB   1  
ATOM 8915   H H    . ALA B 1 270 ? 10.171  -9.364  191.223 1.00 0.00 ?  270 ALA B H    1  
ATOM 8916   H HA   . ALA B 1 270 ? 10.869  -11.147 189.047 1.00 0.00 ?  270 ALA B HA   1  
ATOM 8917   H HB1  . ALA B 1 270 ? 12.820  -9.340  190.409 1.00 0.00 ?  270 ALA B HB1  1  
ATOM 8918   H HB2  . ALA B 1 270 ? 13.031  -10.309 188.900 1.00 0.00 ?  270 ALA B HB2  1  
ATOM 8919   H HB3  . ALA B 1 270 ? 13.264  -11.086 190.513 1.00 0.00 ?  270 ALA B HB3  1  
ATOM 8920   N N    . ARG B 1 271 ? 11.058  -13.029 190.737 1.00 0.00 ?  271 ARG B N    1  
ATOM 8921   C CA   . ARG B 1 271 ? 10.874  -14.093 191.708 1.00 0.00 ?  271 ARG B CA   1  
ATOM 8922   C C    . ARG B 1 271 ? 12.093  -14.948 191.686 1.00 0.00 ?  271 ARG B C    1  
ATOM 8923   O O    . ARG B 1 271 ? 12.535  -15.385 190.625 1.00 0.00 ?  271 ARG B O    1  
ATOM 8924   C CB   . ARG B 1 271 ? 9.650   -14.982 191.410 1.00 0.00 ?  271 ARG B CB   1  
ATOM 8925   C CG   . ARG B 1 271 ? 9.465   -16.123 192.422 1.00 0.00 ?  271 ARG B CG   1  
ATOM 8926   C CD   . ARG B 1 271 ? 8.285   -17.033 192.072 1.00 0.00 ?  271 ARG B CD   1  
ATOM 8927   N NE   . ARG B 1 271 ? 7.019   -16.263 192.241 1.00 0.00 ?  271 ARG B NE   1  
ATOM 8928   C CZ   . ARG B 1 271 ? 6.425   -16.171 193.470 1.00 0.00 ?  271 ARG B CZ   1  
ATOM 8929   N NH1  . ARG B 1 271 ? 7.003   -16.755 194.561 1.00 0.00 1  271 ARG B NH1  1  
ATOM 8930   N NH2  . ARG B 1 271 ? 5.253   -15.488 193.610 1.00 0.00 ?  271 ARG B NH2  1  
ATOM 8931   H H    . ARG B 1 271 ? 11.245  -13.318 189.801 1.00 0.00 ?  271 ARG B H    1  
ATOM 8932   H HA   . ARG B 1 271 ? 10.780  -13.643 192.684 1.00 0.00 ?  271 ARG B HA   1  
ATOM 8933   H HB2  . ARG B 1 271 ? 8.737   -14.347 191.414 1.00 0.00 ?  271 ARG B HB2  1  
ATOM 8934   H HB3  . ARG B 1 271 ? 9.757   -15.412 190.398 1.00 0.00 ?  271 ARG B HB3  1  
ATOM 8935   H HG2  . ARG B 1 271 ? 10.387  -16.739 192.460 1.00 0.00 ?  271 ARG B HG2  1  
ATOM 8936   H HG3  . ARG B 1 271 ? 9.300   -15.689 193.432 1.00 0.00 ?  271 ARG B HG3  1  
ATOM 8937   H HD2  . ARG B 1 271 ? 8.349   -17.368 191.014 1.00 0.00 ?  271 ARG B HD2  1  
ATOM 8938   H HD3  . ARG B 1 271 ? 8.249   -17.918 192.742 1.00 0.00 ?  271 ARG B HD3  1  
ATOM 8939   H HE   . ARG B 1 271 ? 6.596   -15.821 191.449 1.00 0.00 ?  271 ARG B HE   1  
ATOM 8940   H HH11 . ARG B 1 271 ? 7.865   -17.252 194.463 1.00 0.00 ?  271 ARG B HH11 1  
ATOM 8941   H HH12 . ARG B 1 271 ? 6.565   -16.683 195.457 1.00 0.00 ?  271 ARG B HH12 1  
ATOM 8942   H HH21 . ARG B 1 271 ? 4.830   -15.052 192.816 1.00 0.00 ?  271 ARG B HH21 1  
ATOM 8943   H HH22 . ARG B 1 271 ? 4.810   -15.434 194.505 1.00 0.00 ?  271 ARG B HH22 1  
ATOM 8944   N N    . HIS B 1 272 ? 12.685  -15.199 192.878 1.00 0.00 ?  272 HIS B N    1  
ATOM 8945   C CA   . HIS B 1 272 ? 13.840  -16.045 192.924 1.00 0.00 ?  272 HIS B CA   1  
ATOM 8946   C C    . HIS B 1 272 ? 13.838  -16.712 194.268 1.00 0.00 ?  272 HIS B C    1  
ATOM 8947   O O    . HIS B 1 272 ? 13.744  -16.047 195.307 1.00 0.00 ?  272 HIS B O    1  
ATOM 8948   C CB   . HIS B 1 272 ? 15.161  -15.288 192.751 1.00 0.00 ?  272 HIS B CB   1  
ATOM 8949   C CG   . HIS B 1 272 ? 16.282  -16.170 192.288 1.00 0.00 ?  272 HIS B CG   1  
ATOM 8950   N ND1  . HIS B 1 272 ? 16.842  -17.099 193.146 1.00 0.00 ?  272 HIS B ND1  1  
ATOM 8951   C CD2  . HIS B 1 272 ? 16.888  -16.216 191.071 1.00 0.00 ?  272 HIS B CD2  1  
ATOM 8952   C CE1  . HIS B 1 272 ? 17.782  -17.688 192.427 1.00 0.00 ?  272 HIS B CE1  1  
ATOM 8953   N NE2  . HIS B 1 272 ? 17.852  -17.192 191.168 1.00 0.00 ?  272 HIS B NE2  1  
ATOM 8954   H H    . HIS B 1 272 ? 12.361  -14.818 193.743 1.00 0.00 ?  272 HIS B H    1  
ATOM 8955   H HA   . HIS B 1 272 ? 13.729  -16.796 192.157 1.00 0.00 ?  272 HIS B HA   1  
ATOM 8956   H HB2  . HIS B 1 272 ? 15.035  -14.479 192.000 1.00 0.00 ?  272 HIS B HB2  1  
ATOM 8957   H HB3  . HIS B 1 272 ? 15.464  -14.834 193.718 1.00 0.00 ?  272 HIS B HB3  1  
ATOM 8958   H HD2  . HIS B 1 272 ? 16.687  -15.648 190.171 1.00 0.00 ?  272 HIS B HD2  1  
ATOM 8959   H HE1  . HIS B 1 272 ? 18.438  -18.483 192.782 1.00 0.00 ?  272 HIS B HE1  1  
ATOM 8960   H HE2  . HIS B 1 272 ? 18.479  -17.468 190.440 1.00 0.00 ?  272 HIS B HE2  1  
ATOM 8961   N N    . ALA B 1 273 ? 13.959  -18.064 194.261 1.00 0.00 ?  273 ALA B N    1  
ATOM 8962   C CA   . ALA B 1 273 ? 13.952  -18.828 195.487 1.00 0.00 ?  273 ALA B CA   1  
ATOM 8963   C C    . ALA B 1 273 ? 15.246  -19.572 195.572 1.00 0.00 ?  273 ALA B C    1  
ATOM 8964   O O    . ALA B 1 273 ? 15.838  -19.918 194.550 1.00 0.00 ?  273 ALA B O    1  
ATOM 8965   C CB   . ALA B 1 273 ? 12.817  -19.864 195.543 1.00 0.00 ?  273 ALA B CB   1  
ATOM 8966   H H    . ALA B 1 273 ? 14.057  -18.585 193.418 1.00 0.00 ?  273 ALA B H    1  
ATOM 8967   H HA   . ALA B 1 273 ? 13.878  -18.145 196.316 1.00 0.00 ?  273 ALA B HA   1  
ATOM 8968   H HB1  . ALA B 1 273 ? 13.202  -20.872 195.280 1.00 0.00 ?  273 ALA B HB1  1  
ATOM 8969   H HB2  . ALA B 1 273 ? 12.013  -19.594 194.827 1.00 0.00 ?  273 ALA B HB2  1  
ATOM 8970   H HB3  . ALA B 1 273 ? 12.384  -19.904 196.564 1.00 0.00 ?  273 ALA B HB3  1  
ATOM 8971   N N    . TRP B 1 274 ? 15.715  -19.821 196.820 1.00 0.00 ?  274 TRP B N    1  
ATOM 8972   C CA   . TRP B 1 274 ? 16.944  -20.540 197.019 1.00 0.00 ?  274 TRP B CA   1  
ATOM 8973   C C    . TRP B 1 274 ? 16.675  -21.642 197.996 1.00 0.00 ?  274 TRP B C    1  
ATOM 8974   O O    . TRP B 1 274 ? 15.931  -21.479 198.965 1.00 0.00 ?  274 TRP B O    1  
ATOM 8975   C CB   . TRP B 1 274 ? 18.079  -19.658 197.549 1.00 0.00 ?  274 TRP B CB   1  
ATOM 8976   C CG   . TRP B 1 274 ? 18.428  -18.559 196.576 1.00 0.00 ?  274 TRP B CG   1  
ATOM 8977   C CD1  . TRP B 1 274 ? 19.321  -18.592 195.546 1.00 0.00 ?  274 TRP B CD1  1  
ATOM 8978   C CD2  . TRP B 1 274 ? 17.853  -17.237 196.561 1.00 0.00 ?  274 TRP B CD2  1  
ATOM 8979   N NE1  . TRP B 1 274 ? 19.328  -17.394 194.889 1.00 0.00 ?  274 TRP B NE1  1  
ATOM 8980   C CE2  . TRP B 1 274 ? 18.445  -16.548 195.505 1.00 0.00 ?  274 TRP B CE2  1  
ATOM 8981   C CE3  . TRP B 1 274 ? 16.919  -16.628 197.343 1.00 0.00 ?  274 TRP B CE3  1  
ATOM 8982   C CZ2  . TRP B 1 274 ? 18.114  -15.257 195.221 1.00 0.00 ?  274 TRP B CZ2  1  
ATOM 8983   C CZ3  . TRP B 1 274 ? 16.581  -15.323 197.060 1.00 0.00 ?  274 TRP B CZ3  1  
ATOM 8984   C CH2  . TRP B 1 274 ? 17.170  -14.644 196.012 1.00 0.00 ?  274 TRP B CH2  1  
ATOM 8985   H H    . TRP B 1 274 ? 15.242  -19.511 197.638 1.00 0.00 ?  274 TRP B H    1  
ATOM 8986   H HA   . TRP B 1 274 ? 17.227  -20.981 196.078 1.00 0.00 ?  274 TRP B HA   1  
ATOM 8987   H HB2  . TRP B 1 274 ? 17.774  -19.203 198.515 1.00 0.00 ?  274 TRP B HB2  1  
ATOM 8988   H HB3  . TRP B 1 274 ? 18.981  -20.279 197.722 1.00 0.00 ?  274 TRP B HB3  1  
ATOM 8989   H HD1  . TRP B 1 274 ? 19.923  -19.448 195.278 1.00 0.00 ?  274 TRP B HD1  1  
ATOM 8990   H HE1  . TRP B 1 274 ? 19.882  -17.173 194.117 1.00 0.00 ?  274 TRP B HE1  1  
ATOM 8991   H HE3  . TRP B 1 274 ? 16.447  -17.139 198.168 1.00 0.00 ?  274 TRP B HE3  1  
ATOM 8992   H HZ2  . TRP B 1 274 ? 18.567  -14.715 194.404 1.00 0.00 ?  274 TRP B HZ2  1  
ATOM 8993   H HZ3  . TRP B 1 274 ? 15.844  -14.828 197.664 1.00 0.00 ?  274 TRP B HZ3  1  
ATOM 8994   H HH2  . TRP B 1 274 ? 16.887  -13.622 195.811 1.00 0.00 ?  274 TRP B HH2  1  
ATOM 8995   N N    . GLU B 1 275 ? 17.324  -22.798 197.752 1.00 0.00 ?  275 GLU B N    1  
ATOM 8996   C CA   . GLU B 1 275 ? 17.136  -23.960 198.575 1.00 0.00 ?  275 GLU B CA   1  
ATOM 8997   C C    . GLU B 1 275 ? 17.850  -23.771 199.876 1.00 0.00 ?  275 GLU B C    1  
ATOM 8998   O O    . GLU B 1 275 ? 18.709  -22.906 200.024 1.00 0.00 ?  275 GLU B O    1  
ATOM 8999   C CB   . GLU B 1 275 ? 17.670  -25.243 197.919 1.00 0.00 ?  275 GLU B CB   1  
ATOM 9000   C CG   . GLU B 1 275 ? 16.979  -25.565 196.589 1.00 0.00 ?  275 GLU B CG   1  
ATOM 9001   C CD   . GLU B 1 275 ? 15.523  -25.938 196.858 1.00 0.00 ?  275 GLU B CD   1  
ATOM 9002   O OE1  . GLU B 1 275 ? 14.701  -25.813 195.911 1.00 0.00 ?  275 GLU B OE1  1  
ATOM 9003   O OE2  . GLU B 1 275 ? 15.218  -26.382 197.998 1.00 0.00 -1 275 GLU B OE2  1  
ATOM 9004   H H    . GLU B 1 275 ? 17.962  -22.897 196.992 1.00 0.00 ?  275 GLU B H    1  
ATOM 9005   H HA   . GLU B 1 275 ? 16.079  -24.055 198.765 1.00 0.00 ?  275 GLU B HA   1  
ATOM 9006   H HB2  . GLU B 1 275 ? 18.758  -25.119 197.736 1.00 0.00 ?  275 GLU B HB2  1  
ATOM 9007   H HB3  . GLU B 1 275 ? 17.531  -26.097 198.616 1.00 0.00 ?  275 GLU B HB3  1  
ATOM 9008   H HG2  . GLU B 1 275 ? 17.018  -24.679 195.917 1.00 0.00 ?  275 GLU B HG2  1  
ATOM 9009   H HG3  . GLU B 1 275 ? 17.488  -26.417 196.092 1.00 0.00 ?  275 GLU B HG3  1  
ATOM 9010   N N    . HIS B 1 276 ? 17.469  -24.594 200.872 1.00 0.00 ?  276 HIS B N    1  
ATOM 9011   C CA   . HIS B 1 276 ? 18.065  -24.505 202.173 1.00 0.00 ?  276 HIS B CA   1  
ATOM 9012   C C    . HIS B 1 276 ? 19.520  -24.846 202.085 1.00 0.00 ?  276 HIS B C    1  
ATOM 9013   O O    . HIS B 1 276 ? 20.304  -24.377 202.902 1.00 0.00 ?  276 HIS B O    1  
ATOM 9014   C CB   . HIS B 1 276 ? 17.443  -25.485 203.176 1.00 0.00 ?  276 HIS B CB   1  
ATOM 9015   C CG   . HIS B 1 276 ? 17.787  -26.916 202.884 1.00 0.00 ?  276 HIS B CG   1  
ATOM 9016   N ND1  . HIS B 1 276 ? 17.113  -27.596 201.883 1.00 0.00 ?  276 HIS B ND1  1  
ATOM 9017   C CD2  . HIS B 1 276 ? 18.718  -27.723 203.466 1.00 0.00 ?  276 HIS B CD2  1  
ATOM 9018   C CE1  . HIS B 1 276 ? 17.653  -28.802 201.880 1.00 0.00 ?  276 HIS B CE1  1  
ATOM 9019   N NE2  . HIS B 1 276 ? 18.625  -28.931 202.815 1.00 0.00 ?  276 HIS B NE2  1  
ATOM 9020   H H    . HIS B 1 276 ? 16.762  -25.286 200.754 1.00 0.00 ?  276 HIS B H    1  
ATOM 9021   H HA   . HIS B 1 276 ? 17.953  -23.492 202.522 1.00 0.00 ?  276 HIS B HA   1  
ATOM 9022   H HB2  . HIS B 1 276 ? 17.801  -25.253 204.201 1.00 0.00 ?  276 HIS B HB2  1  
ATOM 9023   H HB3  . HIS B 1 276 ? 16.340  -25.393 203.155 1.00 0.00 ?  276 HIS B HB3  1  
ATOM 9024   H HD2  . HIS B 1 276 ? 19.412  -27.518 204.272 1.00 0.00 ?  276 HIS B HD2  1  
ATOM 9025   H HE1  . HIS B 1 276 ? 17.368  -29.616 201.213 1.00 0.00 ?  276 HIS B HE1  1  
ATOM 9026   H HE2  . HIS B 1 276 ? 19.178  -29.742 203.006 1.00 0.00 ?  276 HIS B HE2  1  
ATOM 9027   N N    . ASP B 1 277 ? 19.927  -25.670 201.091 1.00 0.00 ?  277 ASP B N    1  
ATOM 9028   C CA   . ASP B 1 277 ? 21.317  -26.036 200.999 1.00 0.00 ?  277 ASP B CA   1  
ATOM 9029   C C    . ASP B 1 277 ? 22.024  -25.018 200.163 1.00 0.00 ?  277 ASP B C    1  
ATOM 9030   O O    . ASP B 1 277 ? 23.226  -25.134 199.928 1.00 0.00 ?  277 ASP B O    1  
ATOM 9031   C CB   . ASP B 1 277 ? 21.563  -27.439 200.397 1.00 0.00 ?  277 ASP B CB   1  
ATOM 9032   C CG   . ASP B 1 277 ? 21.081  -27.586 198.955 1.00 0.00 ?  277 ASP B CG   1  
ATOM 9033   O OD1  . ASP B 1 277 ? 20.369  -26.676 198.461 1.00 0.00 ?  277 ASP B OD1  1  
ATOM 9034   O OD2  . ASP B 1 277 ? 21.428  -28.621 198.325 1.00 0.00 -1 277 ASP B OD2  1  
ATOM 9035   H H    . ASP B 1 277 ? 19.308  -26.046 200.405 1.00 0.00 ?  277 ASP B H    1  
ATOM 9036   H HA   . ASP B 1 277 ? 21.725  -25.999 201.997 1.00 0.00 ?  277 ASP B HA   1  
ATOM 9037   H HB2  . ASP B 1 277 ? 22.651  -27.660 200.426 1.00 0.00 ?  277 ASP B HB2  1  
ATOM 9038   H HB3  . ASP B 1 277 ? 21.043  -28.197 201.021 1.00 0.00 ?  277 ASP B HB3  1  
ATOM 9039   N N    . ASP B 1 278 ? 21.288  -23.982 199.702 1.00 0.00 ?  278 ASP B N    1  
ATOM 9040   C CA   . ASP B 1 278 ? 21.906  -22.962 198.903 1.00 0.00 ?  278 ASP B CA   1  
ATOM 9041   C C    . ASP B 1 278 ? 22.401  -21.916 199.841 1.00 0.00 ?  278 ASP B C    1  
ATOM 9042   O O    . ASP B 1 278 ? 23.016  -20.937 199.423 1.00 0.00 ?  278 ASP B O    1  
ATOM 9043   C CB   . ASP B 1 278 ? 20.975  -22.292 197.878 1.00 0.00 ?  278 ASP B CB   1  
ATOM 9044   C CG   . ASP B 1 278 ? 20.606  -23.242 196.747 1.00 0.00 ?  278 ASP B CG   1  
ATOM 9045   O OD1  . ASP B 1 278 ? 21.293  -24.289 196.607 1.00 0.00 ?  278 ASP B OD1  1  
ATOM 9046   O OD2  . ASP B 1 278 ? 19.631  -22.933 196.010 1.00 0.00 -1 278 ASP B OD2  1  
ATOM 9047   H H    . ASP B 1 278 ? 20.315  -23.882 199.890 1.00 0.00 ?  278 ASP B H    1  
ATOM 9048   H HA   . ASP B 1 278 ? 22.750  -23.407 198.399 1.00 0.00 ?  278 ASP B HA   1  
ATOM 9049   H HB2  . ASP B 1 278 ? 20.052  -21.948 198.378 1.00 0.00 ?  278 ASP B HB2  1  
ATOM 9050   H HB3  . ASP B 1 278 ? 21.485  -21.406 197.444 1.00 0.00 ?  278 ASP B HB3  1  
ATOM 9051   N N    . ILE B 1 279 ? 22.124  -22.090 201.148 1.00 0.00 ?  279 ILE B N    1  
ATOM 9052   C CA   . ILE B 1 279 ? 22.611  -21.137 202.096 1.00 0.00 ?  279 ILE B CA   1  
ATOM 9053   C C    . ILE B 1 279 ? 24.040  -21.521 202.326 1.00 0.00 ?  279 ILE B C    1  
ATOM 9054   O O    . ILE B 1 279 ? 24.387  -22.702 202.281 1.00 0.00 ?  279 ILE B O    1  
ATOM 9055   C CB   . ILE B 1 279 ? 21.868  -21.129 203.414 1.00 0.00 ?  279 ILE B CB   1  
ATOM 9056   C CG1  . ILE B 1 279 ? 22.262  -19.891 204.233 1.00 0.00 ?  279 ILE B CG1  1  
ATOM 9057   C CG2  . ILE B 1 279 ? 22.160  -22.434 204.174 1.00 0.00 ?  279 ILE B CG2  1  
ATOM 9058   C CD1  . ILE B 1 279 ? 21.347  -19.671 205.436 1.00 0.00 ?  279 ILE B CD1  1  
ATOM 9059   H H    . ILE B 1 279 ? 21.574  -22.848 201.495 1.00 0.00 ?  279 ILE B H    1  
ATOM 9060   H HA   . ILE B 1 279 ? 22.577  -20.162 201.632 1.00 0.00 ?  279 ILE B HA   1  
ATOM 9061   H HB   . ILE B 1 279 ? 20.775  -21.080 203.216 1.00 0.00 ?  279 ILE B HB   1  
ATOM 9062   H HG12 . ILE B 1 279 ? 23.308  -20.013 204.585 1.00 0.00 ?  279 ILE B HG12 1  
ATOM 9063   H HG13 . ILE B 1 279 ? 22.221  -18.995 203.581 1.00 0.00 ?  279 ILE B HG13 1  
ATOM 9064   H HG21 . ILE B 1 279 ? 23.045  -22.306 204.834 1.00 0.00 ?  279 ILE B HG21 1  
ATOM 9065   H HG22 . ILE B 1 279 ? 22.366  -23.260 203.461 1.00 0.00 ?  279 ILE B HG22 1  
ATOM 9066   H HG23 . ILE B 1 279 ? 21.288  -22.717 204.802 1.00 0.00 ?  279 ILE B HG23 1  
ATOM 9067   H HD11 . ILE B 1 279 ? 21.442  -20.514 206.153 1.00 0.00 ?  279 ILE B HD11 1  
ATOM 9068   H HD12 . ILE B 1 279 ? 20.287  -19.601 205.108 1.00 0.00 ?  279 ILE B HD12 1  
ATOM 9069   H HD13 . ILE B 1 279 ? 21.619  -18.729 205.959 1.00 0.00 ?  279 ILE B HD13 1  
ATOM 9070   N N    . ARG B 1 280 ? 24.910  -20.511 202.532 1.00 0.00 ?  280 ARG B N    1  
ATOM 9071   C CA   . ARG B 1 280 ? 26.311  -20.766 202.733 1.00 0.00 ?  280 ARG B CA   1  
ATOM 9072   C C    . ARG B 1 280 ? 26.694  -20.234 204.064 1.00 0.00 ?  280 ARG B C    1  
ATOM 9073   O O    . ARG B 1 280 ? 26.068  -19.321 204.601 1.00 0.00 ?  280 ARG B O    1  
ATOM 9074   C CB   . ARG B 1 280 ? 27.222  -20.098 201.689 1.00 0.00 ?  280 ARG B CB   1  
ATOM 9075   C CG   . ARG B 1 280 ? 26.970  -20.609 200.271 1.00 0.00 ?  280 ARG B CG   1  
ATOM 9076   C CD   . ARG B 1 280 ? 27.401  -22.068 200.094 1.00 0.00 ?  280 ARG B CD   1  
ATOM 9077   N NE   . ARG B 1 280 ? 27.272  -22.430 198.656 1.00 0.00 ?  280 ARG B NE   1  
ATOM 9078   C CZ   . ARG B 1 280 ? 27.579  -23.693 198.241 1.00 0.00 ?  280 ARG B CZ   1  
ATOM 9079   N NH1  . ARG B 1 280 ? 28.015  -24.621 199.142 1.00 0.00 1  280 ARG B NH1  1  
ATOM 9080   N NH2  . ARG B 1 280 ? 27.451  -24.029 196.924 1.00 0.00 ?  280 ARG B NH2  1  
ATOM 9081   H H    . ARG B 1 280 ? 24.628  -19.559 202.541 1.00 0.00 ?  280 ARG B H    1  
ATOM 9082   H HA   . ARG B 1 280 ? 26.467  -21.831 202.730 1.00 0.00 ?  280 ARG B HA   1  
ATOM 9083   H HB2  . ARG B 1 280 ? 27.058  -19.000 201.715 1.00 0.00 ?  280 ARG B HB2  1  
ATOM 9084   H HB3  . ARG B 1 280 ? 28.281  -20.295 201.957 1.00 0.00 ?  280 ARG B HB3  1  
ATOM 9085   H HG2  . ARG B 1 280 ? 25.887  -20.521 200.042 1.00 0.00 ?  280 ARG B HG2  1  
ATOM 9086   H HG3  . ARG B 1 280 ? 27.527  -19.974 199.550 1.00 0.00 ?  280 ARG B HG3  1  
ATOM 9087   H HD2  . ARG B 1 280 ? 28.462  -22.207 200.396 1.00 0.00 ?  280 ARG B HD2  1  
ATOM 9088   H HD3  . ARG B 1 280 ? 26.749  -22.748 200.682 1.00 0.00 ?  280 ARG B HD3  1  
ATOM 9089   H HE   . ARG B 1 280 ? 26.957  -21.748 197.995 1.00 0.00 ?  280 ARG B HE   1  
ATOM 9090   H HH11 . ARG B 1 280 ? 28.110  -24.374 200.107 1.00 0.00 ?  280 ARG B HH11 1  
ATOM 9091   H HH12 . ARG B 1 280 ? 28.240  -25.546 198.838 1.00 0.00 ?  280 ARG B HH12 1  
ATOM 9092   H HH21 . ARG B 1 280 ? 27.134  -23.350 196.263 1.00 0.00 ?  280 ARG B HH21 1  
ATOM 9093   H HH22 . ARG B 1 280 ? 27.677  -24.955 196.620 1.00 0.00 ?  280 ARG B HH22 1  
ATOM 9094   N N    . TRP B 1 281 ? 27.775  -20.816 204.607 1.00 0.00 ?  281 TRP B N    1  
ATOM 9095   C CA   . TRP B 1 281 ? 28.273  -20.447 205.896 1.00 0.00 ?  281 TRP B CA   1  
ATOM 9096   C C    . TRP B 1 281 ? 28.833  -19.055 205.819 1.00 0.00 ?  281 TRP B C    1  
ATOM 9097   O O    . TRP B 1 281 ? 28.920  -18.448 204.756 1.00 0.00 ?  281 TRP B O    1  
ATOM 9098   C CB   . TRP B 1 281 ? 29.393  -21.381 206.389 1.00 0.00 ?  281 TRP B CB   1  
ATOM 9099   C CG   . TRP B 1 281 ? 28.909  -22.781 206.683 1.00 0.00 ?  281 TRP B CG   1  
ATOM 9100   C CD1  . TRP B 1 281 ? 28.907  -23.867 205.856 1.00 0.00 ?  281 TRP B CD1  1  
ATOM 9101   C CD2  . TRP B 1 281 ? 28.351  -23.235 207.936 1.00 0.00 ?  281 TRP B CD2  1  
ATOM 9102   N NE1  . TRP B 1 281 ? 28.389  -24.954 206.502 1.00 0.00 ?  281 TRP B NE1  1  
ATOM 9103   C CE2  . TRP B 1 281 ? 28.043  -24.586 207.778 1.00 0.00 ?  281 TRP B CE2  1  
ATOM 9104   C CE3  . TRP B 1 281 ? 28.105  -22.607 209.123 1.00 0.00 ?  281 TRP B CE3  1  
ATOM 9105   C CZ2  . TRP B 1 281 ? 27.495  -25.314 208.790 1.00 0.00 ?  281 TRP B CZ2  1  
ATOM 9106   C CZ3  . TRP B 1 281 ? 27.550  -23.341 210.152 1.00 0.00 ?  281 TRP B CZ3  1  
ATOM 9107   C CH2  . TRP B 1 281 ? 27.249  -24.679 209.987 1.00 0.00 ?  281 TRP B CH2  1  
ATOM 9108   H H    . TRP B 1 281 ? 28.280  -21.534 204.134 1.00 0.00 ?  281 TRP B H    1  
ATOM 9109   H HA   . TRP B 1 281 ? 27.445  -20.459 206.585 1.00 0.00 ?  281 TRP B HA   1  
ATOM 9110   H HB2  . TRP B 1 281 ? 30.187  -21.438 205.615 1.00 0.00 ?  281 TRP B HB2  1  
ATOM 9111   H HB3  . TRP B 1 281 ? 29.842  -20.964 207.315 1.00 0.00 ?  281 TRP B HB3  1  
ATOM 9112   H HD1  . TRP B 1 281 ? 29.262  -23.866 204.836 1.00 0.00 ?  281 TRP B HD1  1  
ATOM 9113   H HE1  . TRP B 1 281 ? 28.283  -25.846 206.120 1.00 0.00 ?  281 TRP B HE1  1  
ATOM 9114   H HE3  . TRP B 1 281 ? 28.333  -21.561 209.272 1.00 0.00 ?  281 TRP B HE3  1  
ATOM 9115   H HZ2  . TRP B 1 281 ? 27.253  -26.361 208.676 1.00 0.00 ?  281 TRP B HZ2  1  
ATOM 9116   H HZ3  . TRP B 1 281 ? 27.349  -22.862 211.099 1.00 0.00 ?  281 TRP B HZ3  1  
ATOM 9117   H HH2  . TRP B 1 281 ? 26.814  -25.234 210.806 1.00 0.00 ?  281 TRP B HH2  1  
ATOM 9118   N N    . HIS B 1 282 ? 29.255  -18.552 206.992 1.00 0.00 ?  282 HIS B N    1  
ATOM 9119   C CA   . HIS B 1 282 ? 29.785  -17.217 207.143 1.00 0.00 ?  282 HIS B CA   1  
ATOM 9120   C C    . HIS B 1 282 ? 31.106  -17.049 206.432 1.00 0.00 ?  282 HIS B C    1  
ATOM 9121   O O    . HIS B 1 282 ? 31.589  -15.927 206.312 1.00 0.00 ?  282 HIS B O    1  
ATOM 9122   C CB   . HIS B 1 282 ? 29.979  -16.849 208.621 1.00 0.00 ?  282 HIS B CB   1  
ATOM 9123   C CG   . HIS B 1 282 ? 30.942  -17.744 209.339 1.00 0.00 ?  282 HIS B CG   1  
ATOM 9124   N ND1  . HIS B 1 282 ? 30.573  -19.046 209.642 1.00 0.00 ?  282 HIS B ND1  1  
ATOM 9125   C CD2  . HIS B 1 282 ? 32.191  -17.481 209.803 1.00 0.00 ?  282 HIS B CD2  1  
ATOM 9126   C CE1  . HIS B 1 282 ? 31.613  -19.542 210.285 1.00 0.00 ?  282 HIS B CE1  1  
ATOM 9127   N NE2  . HIS B 1 282 ? 32.615  -18.641 210.409 1.00 0.00 ?  282 HIS B NE2  1  
ATOM 9128   H H    . HIS B 1 282 ? 29.208  -19.086 207.831 1.00 0.00 ?  282 HIS B H    1  
ATOM 9129   H HA   . HIS B 1 282 ? 29.070  -16.544 206.698 1.00 0.00 ?  282 HIS B HA   1  
ATOM 9130   H HB2  . HIS B 1 282 ? 30.363  -15.810 208.700 1.00 0.00 ?  282 HIS B HB2  1  
ATOM 9131   H HB3  . HIS B 1 282 ? 29.004  -16.907 209.150 1.00 0.00 ?  282 HIS B HB3  1  
ATOM 9132   H HD2  . HIS B 1 282 ? 32.776  -16.572 209.753 1.00 0.00 ?  282 HIS B HD2  1  
ATOM 9133   H HE1  . HIS B 1 282 ? 31.682  -20.557 210.678 1.00 0.00 ?  282 HIS B HE1  1  
ATOM 9134   H HE2  . HIS B 1 282 ? 33.501  -18.777 210.854 1.00 0.00 ?  282 HIS B HE2  1  
ATOM 9135   N N    . HIS B 1 283 ? 31.733  -18.147 205.954 1.00 0.00 ?  283 HIS B N    1  
ATOM 9136   C CA   . HIS B 1 283 ? 33.031  -18.050 205.296 1.00 0.00 ?  283 HIS B CA   1  
ATOM 9137   C C    . HIS B 1 283 ? 32.955  -17.187 204.049 1.00 0.00 ?  283 HIS B C    1  
ATOM 9138   O O    . HIS B 1 283 ? 33.981  -16.714 203.563 1.00 0.00 ?  283 HIS B O    1  
ATOM 9139   C CB   . HIS B 1 283 ? 33.583  -19.418 204.857 1.00 0.00 ?  283 HIS B CB   1  
ATOM 9140   C CG   . HIS B 1 283 ? 34.037  -20.300 205.988 1.00 0.00 ?  283 HIS B CG   1  
ATOM 9141   N ND1  . HIS B 1 283 ? 34.323  -21.634 205.737 1.00 0.00 ?  283 HIS B ND1  1  
ATOM 9142   C CD2  . HIS B 1 283 ? 34.268  -20.005 207.302 1.00 0.00 ?  283 HIS B CD2  1  
ATOM 9143   C CE1  . HIS B 1 283 ? 34.721  -22.114 206.901 1.00 0.00 ?  283 HIS B CE1  1  
ATOM 9144   N NE2  . HIS B 1 283 ? 34.707  -21.176 207.876 1.00 0.00 ?  283 HIS B NE2  1  
ATOM 9145   H H    . HIS B 1 283 ? 31.343  -19.061 206.033 1.00 0.00 ?  283 HIS B H    1  
ATOM 9146   H HA   . HIS B 1 283 ? 33.709  -17.590 205.995 1.00 0.00 ?  283 HIS B HA   1  
ATOM 9147   H HB2  . HIS B 1 283 ? 32.799  -19.971 204.299 1.00 0.00 ?  283 HIS B HB2  1  
ATOM 9148   H HB3  . HIS B 1 283 ? 34.451  -19.264 204.180 1.00 0.00 ?  283 HIS B HB3  1  
ATOM 9149   H HD2  . HIS B 1 283 ? 34.152  -19.074 207.842 1.00 0.00 ?  283 HIS B HD2  1  
ATOM 9150   H HE1  . HIS B 1 283 ? 35.029  -23.145 207.081 1.00 0.00 ?  283 HIS B HE1  1  
ATOM 9151   H HE2  . HIS B 1 283 ? 34.970  -21.296 208.834 1.00 0.00 ?  283 HIS B HE2  1  
ATOM 9152   N N    . ARG B 1 284 ? 31.748  -16.971 203.495 1.00 0.00 ?  284 ARG B N    1  
ATOM 9153   C CA   . ARG B 1 284 ? 31.593  -16.171 202.294 1.00 0.00 ?  284 ARG B CA   1  
ATOM 9154   C C    . ARG B 1 284 ? 31.751  -14.698 202.596 1.00 0.00 ?  284 ARG B C    1  
ATOM 9155   O O    . ARG B 1 284 ? 31.671  -13.875 201.682 1.00 0.00 ?  284 ARG B O    1  
ATOM 9156   C CB   . ARG B 1 284 ? 30.235  -16.362 201.609 1.00 0.00 ?  284 ARG B CB   1  
ATOM 9157   C CG   . ARG B 1 284 ? 30.308  -17.295 200.403 1.00 0.00 ?  284 ARG B CG   1  
ATOM 9158   C CD   . ARG B 1 284 ? 30.658  -18.733 200.781 1.00 0.00 ?  284 ARG B CD   1  
ATOM 9159   N NE   . ARG B 1 284 ? 30.476  -19.586 199.571 1.00 0.00 ?  284 ARG B NE   1  
ATOM 9160   C CZ   . ARG B 1 284 ? 30.847  -20.900 199.597 1.00 0.00 ?  284 ARG B CZ   1  
ATOM 9161   N NH1  . ARG B 1 284 ? 31.484  -21.401 200.695 1.00 0.00 1  284 ARG B NH1  1  
ATOM 9162   N NH2  . ARG B 1 284 ? 30.623  -21.698 198.511 1.00 0.00 ?  284 ARG B NH2  1  
ATOM 9163   H H    . ARG B 1 284 ? 30.911  -17.346 203.885 1.00 0.00 ?  284 ARG B H    1  
ATOM 9164   H HA   . ARG B 1 284 ? 32.382  -16.465 201.619 1.00 0.00 ?  284 ARG B HA   1  
ATOM 9165   H HB2  . ARG B 1 284 ? 29.520  -16.784 202.345 1.00 0.00 ?  284 ARG B HB2  1  
ATOM 9166   H HB3  . ARG B 1 284 ? 29.853  -15.377 201.278 1.00 0.00 ?  284 ARG B HB3  1  
ATOM 9167   H HG2  . ARG B 1 284 ? 29.325  -17.290 199.886 1.00 0.00 ?  284 ARG B HG2  1  
ATOM 9168   H HG3  . ARG B 1 284 ? 31.070  -16.907 199.694 1.00 0.00 ?  284 ARG B HG3  1  
ATOM 9169   H HD2  . ARG B 1 284 ? 31.713  -18.809 201.118 1.00 0.00 ?  284 ARG B HD2  1  
ATOM 9170   H HD3  . ARG B 1 284 ? 29.982  -19.110 201.574 1.00 0.00 ?  284 ARG B HD3  1  
ATOM 9171   H HE   . ARG B 1 284 ? 30.068  -19.198 198.744 1.00 0.00 ?  284 ARG B HE   1  
ATOM 9172   H HH11 . ARG B 1 284 ? 31.681  -20.805 201.476 1.00 0.00 ?  284 ARG B HH11 1  
ATOM 9173   H HH12 . ARG B 1 284 ? 31.754  -22.364 200.720 1.00 0.00 ?  284 ARG B HH12 1  
ATOM 9174   H HH21 . ARG B 1 284 ? 30.188  -21.318 197.692 1.00 0.00 ?  284 ARG B HH21 1  
ATOM 9175   H HH22 . ARG B 1 284 ? 30.895  -22.659 198.533 1.00 0.00 ?  284 ARG B HH22 1  
ATOM 9176   N N    . TYR B 1 285 ? 31.969  -14.337 203.886 1.00 0.00 ?  285 TYR B N    1  
ATOM 9177   C CA   . TYR B 1 285 ? 32.072  -12.942 204.315 1.00 0.00 ?  285 TYR B CA   1  
ATOM 9178   C C    . TYR B 1 285 ? 33.095  -12.156 203.519 1.00 0.00 ?  285 TYR B C    1  
ATOM 9179   O O    . TYR B 1 285 ? 33.053  -10.927 203.547 1.00 0.00 ?  285 TYR B O    1  
ATOM 9180   C CB   . TYR B 1 285 ? 32.490  -12.802 205.798 1.00 0.00 ?  285 TYR B CB   1  
ATOM 9181   C CG   . TYR B 1 285 ? 33.955  -12.999 206.044 1.00 0.00 ?  285 TYR B CG   1  
ATOM 9182   C CD1  . TYR B 1 285 ? 34.799  -11.907 206.159 1.00 0.00 ?  285 TYR B CD1  1  
ATOM 9183   C CD2  . TYR B 1 285 ? 34.489  -14.266 206.160 1.00 0.00 ?  285 TYR B CD2  1  
ATOM 9184   C CE1  . TYR B 1 285 ? 36.144  -12.086 206.381 1.00 0.00 ?  285 TYR B CE1  1  
ATOM 9185   C CE2  . TYR B 1 285 ? 35.835  -14.435 206.386 1.00 0.00 ?  285 TYR B CE2  1  
ATOM 9186   C CZ   . TYR B 1 285 ? 36.659  -13.347 206.496 1.00 0.00 ?  285 TYR B CZ   1  
ATOM 9187   O OH   . TYR B 1 285 ? 38.035  -13.527 206.711 1.00 0.00 ?  285 TYR B OH   1  
ATOM 9188   H H    . TYR B 1 285 ? 32.078  -15.015 204.605 1.00 0.00 ?  285 TYR B H    1  
ATOM 9189   H HA   . TYR B 1 285 ? 31.099  -12.494 204.170 1.00 0.00 ?  285 TYR B HA   1  
ATOM 9190   H HB2  . TYR B 1 285 ? 32.236  -11.788 206.165 1.00 0.00 ?  285 TYR B HB2  1  
ATOM 9191   H HB3  . TYR B 1 285 ? 31.944  -13.548 206.417 1.00 0.00 ?  285 TYR B HB3  1  
ATOM 9192   H HD1  . TYR B 1 285 ? 34.401  -10.907 206.069 1.00 0.00 ?  285 TYR B HD1  1  
ATOM 9193   H HD2  . TYR B 1 285 ? 33.852  -15.129 206.072 1.00 0.00 ?  285 TYR B HD2  1  
ATOM 9194   H HE1  . TYR B 1 285 ? 36.795  -11.230 206.471 1.00 0.00 ?  285 TYR B HE1  1  
ATOM 9195   H HE2  . TYR B 1 285 ? 36.243  -15.429 206.482 1.00 0.00 ?  285 TYR B HE2  1  
ATOM 9196   H HH   . TYR B 1 285 ? 38.234  -13.295 207.621 1.00 0.00 ?  285 TYR B HH   1  
ATOM 9197   N N    . VAL B 1 286 ? 34.058  -12.830 202.835 1.00 0.00 ?  286 VAL B N    1  
ATOM 9198   C CA   . VAL B 1 286 ? 35.087  -12.131 202.080 1.00 0.00 ?  286 VAL B CA   1  
ATOM 9199   C C    . VAL B 1 286 ? 34.458  -11.189 201.062 1.00 0.00 ?  286 VAL B C    1  
ATOM 9200   O O    . VAL B 1 286 ? 35.076  -10.190 200.696 1.00 0.00 ?  286 VAL B O    1  
ATOM 9201   C CB   . VAL B 1 286 ? 36.039  -13.081 201.395 1.00 0.00 ?  286 VAL B CB   1  
ATOM 9202   C CG1  . VAL B 1 286 ? 35.274  -13.843 200.297 1.00 0.00 ?  286 VAL B CG1  1  
ATOM 9203   C CG2  . VAL B 1 286 ? 37.226  -12.279 200.844 1.00 0.00 ?  286 VAL B CG2  1  
ATOM 9204   H H    . VAL B 1 286 ? 34.108  -13.827 202.829 1.00 0.00 ?  286 VAL B H    1  
ATOM 9205   H HA   . VAL B 1 286 ? 35.634  -11.533 202.798 1.00 0.00 ?  286 VAL B HA   1  
ATOM 9206   H HB   . VAL B 1 286 ? 36.421  -13.817 202.135 1.00 0.00 ?  286 VAL B HB   1  
ATOM 9207   H HG11 . VAL B 1 286 ? 35.243  -13.245 199.362 1.00 0.00 ?  286 VAL B HG11 1  
ATOM 9208   H HG12 . VAL B 1 286 ? 34.231  -14.042 200.624 1.00 0.00 ?  286 VAL B HG12 1  
ATOM 9209   H HG13 . VAL B 1 286 ? 35.769  -14.812 200.080 1.00 0.00 ?  286 VAL B HG13 1  
ATOM 9210   H HG21 . VAL B 1 286 ? 37.199  -12.264 199.733 1.00 0.00 ?  286 VAL B HG21 1  
ATOM 9211   H HG22 . VAL B 1 286 ? 38.185  -12.737 201.168 1.00 0.00 ?  286 VAL B HG22 1  
ATOM 9212   H HG23 . VAL B 1 286 ? 37.191  -11.231 201.215 1.00 0.00 ?  286 VAL B HG23 1  
ATOM 9213   N N    . ASP B 1 287 ? 33.230  -11.512 200.566 1.00 0.00 ?  287 ASP B N    1  
ATOM 9214   C CA   . ASP B 1 287 ? 32.505  -10.638 199.651 1.00 0.00 ?  287 ASP B CA   1  
ATOM 9215   C C    . ASP B 1 287 ? 33.272  -10.460 198.363 1.00 0.00 ?  287 ASP B C    1  
ATOM 9216   O O    . ASP B 1 287 ? 34.286  -11.121 198.128 1.00 0.00 ?  287 ASP B O    1  
ATOM 9217   C CB   . ASP B 1 287 ? 32.231  -9.236  200.240 1.00 0.00 ?  287 ASP B CB   1  
ATOM 9218   C CG   . ASP B 1 287 ? 30.901  -8.636  199.787 1.00 0.00 ?  287 ASP B CG   1  
ATOM 9219   O OD1  . ASP B 1 287 ? 30.216  -9.259  198.929 1.00 0.00 ?  287 ASP B OD1  1  
ATOM 9220   O OD2  . ASP B 1 287 ? 30.550  -7.538  200.297 1.00 0.00 -1 287 ASP B OD2  1  
ATOM 9221   H H    . ASP B 1 287 ? 32.779  -12.367 200.798 1.00 0.00 ?  287 ASP B H    1  
ATOM 9222   H HA   . ASP B 1 287 ? 31.571  -11.134 199.432 1.00 0.00 ?  287 ASP B HA   1  
ATOM 9223   H HB2  . ASP B 1 287 ? 32.231  -9.302  201.350 1.00 0.00 ?  287 ASP B HB2  1  
ATOM 9224   H HB3  . ASP B 1 287 ? 33.050  -8.550  199.936 1.00 0.00 ?  287 ASP B HB3  1  
ATOM 9225   N N    . LEU B 1 288 ? 32.751  -9.554  197.472 1.00 0.00 ?  288 LEU B N    1  
ATOM 9226   C CA   . LEU B 1 288 ? 33.392  -9.305  196.198 1.00 0.00 ?  288 LEU B CA   1  
ATOM 9227   C C    . LEU B 1 288 ? 34.728  -8.705  196.499 1.00 0.00 ?  288 LEU B C    1  
ATOM 9228   O O    . LEU B 1 288 ? 35.736  -9.127  195.940 1.00 0.00 ?  288 LEU B O    1  
ATOM 9229   C CB   . LEU B 1 288 ? 32.630  -8.303  195.297 1.00 0.00 ?  288 LEU B CB   1  
ATOM 9230   C CG   . LEU B 1 288 ? 33.267  -8.125  193.896 1.00 0.00 ?  288 LEU B CG   1  
ATOM 9231   C CD1  . LEU B 1 288 ? 33.083  -9.392  193.033 1.00 0.00 ?  288 LEU B CD1  1  
ATOM 9232   C CD2  . LEU B 1 288 ? 32.737  -6.865  193.187 1.00 0.00 ?  288 LEU B CD2  1  
ATOM 9233   H H    . LEU B 1 288 ? 31.923  -9.036  197.659 1.00 0.00 ?  288 LEU B H    1  
ATOM 9234   H HA   . LEU B 1 288 ? 33.528  -10.253 195.701 1.00 0.00 ?  288 LEU B HA   1  
ATOM 9235   H HB2  . LEU B 1 288 ? 31.576  -8.649  195.178 1.00 0.00 ?  288 LEU B HB2  1  
ATOM 9236   H HB3  . LEU B 1 288 ? 32.610  -7.314  195.801 1.00 0.00 ?  288 LEU B HB3  1  
ATOM 9237   H HG   . LEU B 1 288 ? 34.361  -7.985  194.038 1.00 0.00 ?  288 LEU B HG   1  
ATOM 9238   H HD11 . LEU B 1 288 ? 33.716  -10.211 193.420 1.00 0.00 ?  288 LEU B HD11 1  
ATOM 9239   H HD12 . LEU B 1 288 ? 33.370  -9.192  191.979 1.00 0.00 ?  288 LEU B HD12 1  
ATOM 9240   H HD13 . LEU B 1 288 ? 32.021  -9.729  193.054 1.00 0.00 ?  288 LEU B HD13 1  
ATOM 9241   H HD21 . LEU B 1 288 ? 33.426  -6.011  193.368 1.00 0.00 ?  288 LEU B HD21 1  
ATOM 9242   H HD22 . LEU B 1 288 ? 31.731  -6.598  193.570 1.00 0.00 ?  288 LEU B HD22 1  
ATOM 9243   H HD23 . LEU B 1 288 ? 32.668  -7.035  192.091 1.00 0.00 ?  288 LEU B HD23 1  
ATOM 9244   N N    . MET B 1 289 ? 34.741  -7.725  197.444 1.00 0.00 ?  289 MET B N    1  
ATOM 9245   C CA   . MET B 1 289 ? 35.954  -7.024  197.811 1.00 0.00 ?  289 MET B CA   1  
ATOM 9246   C C    . MET B 1 289 ? 36.512  -6.329  196.592 1.00 0.00 ?  289 MET B C    1  
ATOM 9247   O O    . MET B 1 289 ? 37.114  -6.954  195.717 1.00 0.00 ?  289 MET B O    1  
ATOM 9248   C CB   . MET B 1 289 ? 37.038  -7.934  198.427 1.00 0.00 ?  289 MET B CB   1  
ATOM 9249   C CG   . MET B 1 289 ? 37.018  -7.891  199.961 1.00 0.00 ?  289 MET B CG   1  
ATOM 9250   S SD   . MET B 1 289 ? 37.613  -6.313  200.635 1.00 0.00 ?  289 MET B SD   1  
ATOM 9251   C CE   . MET B 1 289 ? 37.401  -6.781  202.378 1.00 0.00 ?  289 MET B CE   1  
ATOM 9252   H H    . MET B 1 289 ? 33.919  -7.465  197.942 1.00 0.00 ?  289 MET B H    1  
ATOM 9253   H HA   . MET B 1 289 ? 35.667  -6.266  198.526 1.00 0.00 ?  289 MET B HA   1  
ATOM 9254   H HB2  . MET B 1 289 ? 36.868  -8.986  198.095 1.00 0.00 ?  289 MET B HB2  1  
ATOM 9255   H HB3  . MET B 1 289 ? 38.038  -7.612  198.069 1.00 0.00 ?  289 MET B HB3  1  
ATOM 9256   H HG2  . MET B 1 289 ? 35.976  -8.064  200.302 1.00 0.00 ?  289 MET B HG2  1  
ATOM 9257   H HG3  . MET B 1 289 ? 37.644  -8.724  200.350 1.00 0.00 ?  289 MET B HG3  1  
ATOM 9258   H HE1  . MET B 1 289 ? 36.428  -6.416  202.771 1.00 0.00 ?  289 MET B HE1  1  
ATOM 9259   H HE2  . MET B 1 289 ? 38.207  -6.347  203.004 1.00 0.00 ?  289 MET B HE2  1  
ATOM 9260   H HE3  . MET B 1 289 ? 37.431  -7.887  202.496 1.00 0.00 ?  289 MET B HE3  1  
ATOM 9261   N N    . SER B 1 290 ? 36.340  -4.979  196.542 1.00 0.00 ?  290 SER B N    1  
ATOM 9262   C CA   . SER B 1 290 ? 36.822  -4.201  195.418 1.00 0.00 ?  290 SER B CA   1  
ATOM 9263   C C    . SER B 1 290 ? 38.309  -4.364  195.321 1.00 0.00 ?  290 SER B C    1  
ATOM 9264   O O    . SER B 1 290 ? 39.017  -4.309  196.324 1.00 0.00 ?  290 SER B O    1  
ATOM 9265   C CB   . SER B 1 290 ? 36.553  -2.689  195.547 1.00 0.00 ?  290 SER B CB   1  
ATOM 9266   O OG   . SER B 1 290 ? 35.165  -2.417  195.486 1.00 0.00 ?  290 SER B OG   1  
ATOM 9267   H H    . SER B 1 290 ? 35.879  -4.476  197.265 1.00 0.00 ?  290 SER B H    1  
ATOM 9268   H HA   . SER B 1 290 ? 36.358  -4.592  194.536 1.00 0.00 ?  290 SER B HA   1  
ATOM 9269   H HB2  . SER B 1 290 ? 36.939  -2.317  196.521 1.00 0.00 ?  290 SER B HB2  1  
ATOM 9270   H HB3  . SER B 1 290 ? 37.061  -2.139  194.726 1.00 0.00 ?  290 SER B HB3  1  
ATOM 9271   H HG   . SER B 1 290 ? 35.075  -1.482  195.691 1.00 0.00 ?  290 SER B HG   1  
ATOM 9272   N N    . ASP B 1 291 ? 38.813  -4.532  194.070 1.00 0.00 ?  291 ASP B N    1  
ATOM 9273   C CA   . ASP B 1 291 ? 40.224  -4.717  193.860 1.00 0.00 ?  291 ASP B CA   1  
ATOM 9274   C C    . ASP B 1 291 ? 40.833  -3.370  193.629 1.00 0.00 ?  291 ASP B C    1  
ATOM 9275   O O    . ASP B 1 291 ? 42.013  -3.156  193.904 1.00 0.00 ?  291 ASP B O    1  
ATOM 9276   C CB   . ASP B 1 291 ? 40.560  -5.593  192.628 1.00 0.00 ?  291 ASP B CB   1  
ATOM 9277   C CG   . ASP B 1 291 ? 40.120  -7.041  192.801 1.00 0.00 ?  291 ASP B CG   1  
ATOM 9278   O OD1  . ASP B 1 291 ? 40.037  -7.759  191.769 1.00 0.00 ?  291 ASP B OD1  1  
ATOM 9279   O OD2  . ASP B 1 291 ? 39.864  -7.451  193.965 1.00 0.00 -1 291 ASP B OD2  1  
ATOM 9280   H H    . ASP B 1 291 ? 38.242  -4.517  193.253 1.00 0.00 ?  291 ASP B H    1  
ATOM 9281   H HA   . ASP B 1 291 ? 40.639  -5.149  194.758 1.00 0.00 ?  291 ASP B HA   1  
ATOM 9282   H HB2  . ASP B 1 291 ? 40.058  -5.170  191.733 1.00 0.00 ?  291 ASP B HB2  1  
ATOM 9283   H HB3  . ASP B 1 291 ? 41.659  -5.572  192.449 1.00 0.00 ?  291 ASP B HB3  1  
ATOM 9284   N N    . VAL B 1 292 ? 40.031  -2.421  193.100 1.00 0.00 ?  292 VAL B N    1  
ATOM 9285   C CA   . VAL B 1 292 ? 40.551  -1.113  192.830 1.00 0.00 ?  292 VAL B CA   1  
ATOM 9286   C C    . VAL B 1 292 ? 40.546  -0.353  194.112 1.00 0.00 ?  292 VAL B C    1  
ATOM 9287   O O    . VAL B 1 292 ? 39.535  -0.288  194.810 1.00 0.00 ?  292 VAL B O    1  
ATOM 9288   C CB   . VAL B 1 292 ? 39.748  -0.344  191.823 1.00 0.00 ?  292 VAL B CB   1  
ATOM 9289   C CG1  . VAL B 1 292 ? 40.338  1.069   191.706 1.00 0.00 ?  292 VAL B CG1  1  
ATOM 9290   C CG2  . VAL B 1 292 ? 39.775  -1.114  190.493 1.00 0.00 ?  292 VAL B CG2  1  
ATOM 9291   H H    . VAL B 1 292 ? 39.071  -2.578  192.883 1.00 0.00 ?  292 VAL B H    1  
ATOM 9292   H HA   . VAL B 1 292 ? 41.570  -1.232  192.492 1.00 0.00 ?  292 VAL B HA   1  
ATOM 9293   H HB   . VAL B 1 292 ? 38.697  -0.261  192.161 1.00 0.00 ?  292 VAL B HB   1  
ATOM 9294   H HG11 . VAL B 1 292 ? 40.184  1.468   190.680 1.00 0.00 ?  292 VAL B HG11 1  
ATOM 9295   H HG12 . VAL B 1 292 ? 41.429  1.055   191.921 1.00 0.00 ?  292 VAL B HG12 1  
ATOM 9296   H HG13 . VAL B 1 292 ? 39.843  1.751   192.429 1.00 0.00 ?  292 VAL B HG13 1  
ATOM 9297   H HG21 . VAL B 1 292 ? 40.815  -1.179  190.103 1.00 0.00 ?  292 VAL B HG21 1  
ATOM 9298   H HG22 . VAL B 1 292 ? 39.144  -0.600  189.738 1.00 0.00 ?  292 VAL B HG22 1  
ATOM 9299   H HG23 . VAL B 1 292 ? 39.388  -2.143  190.639 1.00 0.00 ?  292 VAL B HG23 1  
ATOM 9300   N N    . ASP B 1 293 ? 41.713  0.235   194.445 1.00 0.00 ?  293 ASP B N    1  
ATOM 9301   C CA   . ASP B 1 293 ? 41.844  0.993   195.656 1.00 0.00 ?  293 ASP B CA   1  
ATOM 9302   C C    . ASP B 1 293 ? 40.933  2.175   195.566 1.00 0.00 ?  293 ASP B C    1  
ATOM 9303   O O    . ASP B 1 293 ? 40.720  2.732   194.492 1.00 0.00 ?  293 ASP B O    1  
ATOM 9304   C CB   . ASP B 1 293 ? 43.270  1.513   195.905 1.00 0.00 ?  293 ASP B CB   1  
ATOM 9305   C CG   . ASP B 1 293 ? 43.445  2.033   197.326 1.00 0.00 ?  293 ASP B CG   1  
ATOM 9306   O OD1  . ASP B 1 293 ? 42.606  1.676   198.195 1.00 0.00 ?  293 ASP B OD1  1  
ATOM 9307   O OD2  . ASP B 1 293 ? 44.420  2.796   197.561 1.00 0.00 -1 293 ASP B OD2  1  
ATOM 9308   H H    . ASP B 1 293 ? 42.528  0.166   193.876 1.00 0.00 ?  293 ASP B H    1  
ATOM 9309   H HA   . ASP B 1 293 ? 41.529  0.361   196.474 1.00 0.00 ?  293 ASP B HA   1  
ATOM 9310   H HB2  . ASP B 1 293 ? 44.000  0.691   195.736 1.00 0.00 ?  293 ASP B HB2  1  
ATOM 9311   H HB3  . ASP B 1 293 ? 43.496  2.334   195.194 1.00 0.00 ?  293 ASP B HB3  1  
ATOM 9312   N N    . GLY B 1 294 ? 40.359  2.570   196.726 1.00 0.00 ?  294 GLY B N    1  
ATOM 9313   C CA   . GLY B 1 294 ? 39.463  3.692   196.764 1.00 0.00 ?  294 GLY B CA   1  
ATOM 9314   C C    . GLY B 1 294 ? 38.084  3.145   196.649 1.00 0.00 ?  294 GLY B C    1  
ATOM 9315   O O    . GLY B 1 294 ? 37.898  1.955   196.403 1.00 0.00 ?  294 GLY B O    1  
ATOM 9316   H H    . GLY B 1 294 ? 40.527  2.107   197.593 1.00 0.00 ?  294 GLY B H    1  
ATOM 9317   H HA2  . GLY B 1 294 ? 39.577  4.173   197.725 1.00 0.00 ?  294 GLY B HA2  1  
ATOM 9318   H HA3  . GLY B 1 294 ? 39.672  4.323   195.913 1.00 0.00 ?  294 GLY B HA3  1  
ATOM 9319   N N    . MET B 1 295 ? 37.072  4.015   196.823 1.00 0.00 ?  295 MET B N    1  
ATOM 9320   C CA   . MET B 1 295 ? 35.722  3.552   196.732 1.00 0.00 ?  295 MET B CA   1  
ATOM 9321   C C    . MET B 1 295 ? 35.380  3.534   195.285 1.00 0.00 ?  295 MET B C    1  
ATOM 9322   O O    . MET B 1 295 ? 35.273  4.583   194.649 1.00 0.00 ?  295 MET B O    1  
ATOM 9323   C CB   . MET B 1 295 ? 34.716  4.466   197.455 1.00 0.00 ?  295 MET B CB   1  
ATOM 9324   C CG   . MET B 1 295 ? 33.277  3.950   197.371 1.00 0.00 ?  295 MET B CG   1  
ATOM 9325   S SD   . MET B 1 295 ? 32.106  4.972   198.313 1.00 0.00 ?  295 MET B SD   1  
ATOM 9326   C CE   . MET B 1 295 ? 32.182  6.385   197.175 1.00 0.00 ?  295 MET B CE   1  
ATOM 9327   H H    . MET B 1 295 ? 37.210  4.984   197.016 1.00 0.00 ?  295 MET B H    1  
ATOM 9328   H HA   . MET B 1 295 ? 35.683  2.549   197.128 1.00 0.00 ?  295 MET B HA   1  
ATOM 9329   H HB2  . MET B 1 295 ? 35.009  4.553   198.524 1.00 0.00 ?  295 MET B HB2  1  
ATOM 9330   H HB3  . MET B 1 295 ? 34.760  5.480   197.004 1.00 0.00 ?  295 MET B HB3  1  
ATOM 9331   H HG2  . MET B 1 295 ? 32.972  3.922   196.302 1.00 0.00 ?  295 MET B HG2  1  
ATOM 9332   H HG3  . MET B 1 295 ? 33.253  2.907   197.752 1.00 0.00 ?  295 MET B HG3  1  
ATOM 9333   H HE1  . MET B 1 295 ? 32.205  6.042   196.118 1.00 0.00 ?  295 MET B HE1  1  
ATOM 9334   H HE2  . MET B 1 295 ? 33.094  6.992   197.357 1.00 0.00 ?  295 MET B HE2  1  
ATOM 9335   H HE3  . MET B 1 295 ? 31.298  7.045   197.304 1.00 0.00 ?  295 MET B HE3  1  
ATOM 9336   N N    . THR B 1 296 ? 35.211  2.315   194.733 1.00 0.00 ?  296 THR B N    1  
ATOM 9337   C CA   . THR B 1 296 ? 34.874  2.177   193.349 1.00 0.00 ?  296 THR B CA   1  
ATOM 9338   C C    . THR B 1 296 ? 33.815  1.134   193.267 1.00 0.00 ?  296 THR B C    1  
ATOM 9339   O O    . THR B 1 296 ? 33.728  0.259   194.130 1.00 0.00 ?  296 THR B O    1  
ATOM 9340   C CB   . THR B 1 296 ? 36.033  1.733   192.503 1.00 0.00 ?  296 THR B CB   1  
ATOM 9341   O OG1  . THR B 1 296 ? 36.484  0.456   192.936 1.00 0.00 ?  296 THR B OG1  1  
ATOM 9342   C CG2  . THR B 1 296 ? 37.161  2.770   192.630 1.00 0.00 ?  296 THR B CG2  1  
ATOM 9343   H H    . THR B 1 296 ? 35.312  1.472   195.254 1.00 0.00 ?  296 THR B H    1  
ATOM 9344   H HA   . THR B 1 296 ? 34.477  3.116   192.996 1.00 0.00 ?  296 THR B HA   1  
ATOM 9345   H HB   . THR B 1 296 ? 35.727  1.667   191.439 1.00 0.00 ?  296 THR B HB   1  
ATOM 9346   H HG1  . THR B 1 296 ? 37.342  0.602   193.346 1.00 0.00 ?  296 THR B HG1  1  
ATOM 9347   H HG21 . THR B 1 296 ? 37.639  2.701   193.630 1.00 0.00 ?  296 THR B HG21 1  
ATOM 9348   H HG22 . THR B 1 296 ? 36.759  3.797   192.498 1.00 0.00 ?  296 THR B HG22 1  
ATOM 9349   H HG23 . THR B 1 296 ? 37.937  2.591   191.854 1.00 0.00 ?  296 THR B HG23 1  
ATOM 9350   N N    . HIS B 1 297 ? 32.983  1.214   192.205 1.00 0.00 ?  297 HIS B N    1  
ATOM 9351   C CA   . HIS B 1 297 ? 31.937  0.252   192.011 1.00 0.00 ?  297 HIS B CA   1  
ATOM 9352   C C    . HIS B 1 297 ? 32.330  -0.546  190.819 1.00 0.00 ?  297 HIS B C    1  
ATOM 9353   O O    . HIS B 1 297 ? 32.499  0.003   189.730 1.00 0.00 ?  297 HIS B O    1  
ATOM 9354   C CB   . HIS B 1 297 ? 30.563  0.875   191.723 1.00 0.00 ?  297 HIS B CB   1  
ATOM 9355   C CG   . HIS B 1 297 ? 29.491  -0.150  191.510 1.00 0.00 ?  297 HIS B CG   1  
ATOM 9356   N ND1  . HIS B 1 297 ? 28.999  -0.867  192.587 1.00 0.00 ?  297 HIS B ND1  1  
ATOM 9357   C CD2  . HIS B 1 297 ? 28.879  -0.540  190.357 1.00 0.00 ?  297 HIS B CD2  1  
ATOM 9358   C CE1  . HIS B 1 297 ? 28.098  -1.678  192.062 1.00 0.00 ?  297 HIS B CE1  1  
ATOM 9359   N NE2  . HIS B 1 297 ? 27.985  -1.522  190.720 1.00 0.00 ?  297 HIS B NE2  1  
ATOM 9360   H H    . HIS B 1 297 ? 33.058  1.933   191.519 1.00 0.00 ?  297 HIS B H    1  
ATOM 9361   H HA   . HIS B 1 297 ? 31.890  -0.393  192.875 1.00 0.00 ?  297 HIS B HA   1  
ATOM 9362   H HB2  . HIS B 1 297 ? 30.256  1.516   192.577 1.00 0.00 ?  297 HIS B HB2  1  
ATOM 9363   H HB3  . HIS B 1 297 ? 30.621  1.504   190.809 1.00 0.00 ?  297 HIS B HB3  1  
ATOM 9364   H HD2  . HIS B 1 297 ? 29.019  -0.193  189.341 1.00 0.00 ?  297 HIS B HD2  1  
ATOM 9365   H HE1  . HIS B 1 297 ? 27.503  -2.400  192.622 1.00 0.00 ?  297 HIS B HE1  1  
ATOM 9366   N N    . ILE B 1 298 ? 32.493  -1.872  191.011 1.00 0.00 ?  298 ILE B N    1  
ATOM 9367   C CA   . ILE B 1 298 ? 32.880  -2.729  189.925 1.00 0.00 ?  298 ILE B CA   1  
ATOM 9368   C C    . ILE B 1 298 ? 31.938  -3.883  189.896 1.00 0.00 ?  298 ILE B C    1  
ATOM 9369   O O    . ILE B 1 298 ? 31.435  -4.311  190.935 1.00 0.00 ?  298 ILE B O    1  
ATOM 9370   C CB   . ILE B 1 298 ? 34.289  -3.232  190.071 1.00 0.00 ?  298 ILE B CB   1  
ATOM 9371   C CG1  . ILE B 1 298 ? 34.489  -3.974  191.415 1.00 0.00 ?  298 ILE B CG1  1  
ATOM 9372   C CG2  . ILE B 1 298 ? 35.230  -2.024  189.932 1.00 0.00 ?  298 ILE B CG2  1  
ATOM 9373   C CD1  . ILE B 1 298 ? 35.870  -4.622  191.529 1.00 0.00 ?  298 ILE B CD1  1  
ATOM 9374   H H    . ILE B 1 298 ? 32.353  -2.309  191.896 1.00 0.00 ?  298 ILE B H    1  
ATOM 9375   H HA   . ILE B 1 298 ? 32.775  -2.175  189.007 1.00 0.00 ?  298 ILE B HA   1  
ATOM 9376   H HB   . ILE B 1 298 ? 34.507  -3.940  189.244 1.00 0.00 ?  298 ILE B HB   1  
ATOM 9377   H HG12 . ILE B 1 298 ? 34.360  -3.250  192.249 1.00 0.00 ?  298 ILE B HG12 1  
ATOM 9378   H HG13 . ILE B 1 298 ? 33.720  -4.764  191.528 1.00 0.00 ?  298 ILE B HG13 1  
ATOM 9379   H HG21 . ILE B 1 298 ? 34.769  -1.248  189.284 1.00 0.00 ?  298 ILE B HG21 1  
ATOM 9380   H HG22 . ILE B 1 298 ? 36.195  -2.337  189.479 1.00 0.00 ?  298 ILE B HG22 1  
ATOM 9381   H HG23 . ILE B 1 298 ? 35.435  -1.577  190.929 1.00 0.00 ?  298 ILE B HG23 1  
ATOM 9382   H HD11 . ILE B 1 298 ? 36.293  -4.445  192.534 1.00 0.00 ?  298 ILE B HD11 1  
ATOM 9383   H HD12 . ILE B 1 298 ? 36.564  -4.193  190.779 1.00 0.00 ?  298 ILE B HD12 1  
ATOM 9384   H HD13 . ILE B 1 298 ? 35.799  -5.717  191.365 1.00 0.00 ?  298 ILE B HD13 1  
ATOM 9385   N N    . ASP B 1 299 ? 31.674  -4.404  188.671 1.00 0.00 ?  299 ASP B N    1  
ATOM 9386   C CA   . ASP B 1 299 ? 30.778  -5.516  188.520 1.00 0.00 ?  299 ASP B CA   1  
ATOM 9387   C C    . ASP B 1 299 ? 31.550  -6.651  187.927 1.00 0.00 ?  299 ASP B C    1  
ATOM 9388   O O    . ASP B 1 299 ? 31.933  -6.607  186.758 1.00 0.00 ?  299 ASP B O    1  
ATOM 9389   C CB   . ASP B 1 299 ? 29.597  -5.210  187.580 1.00 0.00 ?  299 ASP B CB   1  
ATOM 9390   C CG   . ASP B 1 299 ? 28.583  -6.350  187.522 1.00 0.00 ?  299 ASP B CG   1  
ATOM 9391   O OD1  . ASP B 1 299 ? 27.631  -6.247  186.704 1.00 0.00 ?  299 ASP B OD1  1  
ATOM 9392   O OD2  . ASP B 1 299 ? 28.729  -7.322  188.312 1.00 0.00 -1 299 ASP B OD2  1  
ATOM 9393   H H    . ASP B 1 299 ? 32.087  -4.047  187.837 1.00 0.00 ?  299 ASP B H    1  
ATOM 9394   H HA   . ASP B 1 299 ? 30.416  -5.804  189.493 1.00 0.00 ?  299 ASP B HA   1  
ATOM 9395   H HB2  . ASP B 1 299 ? 29.079  -4.290  187.928 1.00 0.00 ?  299 ASP B HB2  1  
ATOM 9396   H HB3  . ASP B 1 299 ? 29.983  -5.025  186.555 1.00 0.00 ?  299 ASP B HB3  1  
ATOM 9397   N N    . TYR B 1 300 ? 31.801  -7.697  188.740 1.00 0.00 ?  300 TYR B N    1  
ATOM 9398   C CA   . TYR B 1 300 ? 32.484  -8.869  188.260 1.00 0.00 ?  300 TYR B CA   1  
ATOM 9399   C C    . TYR B 1 300 ? 31.736  -10.039 188.779 1.00 0.00 ?  300 TYR B C    1  
ATOM 9400   O O    . TYR B 1 300 ? 31.085  -9.957  189.823 1.00 0.00 ?  300 TYR B O    1  
ATOM 9401   C CB   . TYR B 1 300 ? 33.952  -9.018  188.698 1.00 0.00 ?  300 TYR B CB   1  
ATOM 9402   C CG   . TYR B 1 300 ? 34.872  -7.985  188.144 1.00 0.00 ?  300 TYR B CG   1  
ATOM 9403   C CD1  . TYR B 1 300 ? 35.452  -8.175  186.907 1.00 0.00 ?  300 TYR B CD1  1  
ATOM 9404   C CD2  . TYR B 1 300 ? 35.169  -6.844  188.852 1.00 0.00 ?  300 TYR B CD2  1  
ATOM 9405   C CE1  . TYR B 1 300 ? 36.314  -7.242  186.388 1.00 0.00 ?  300 TYR B CE1  1  
ATOM 9406   C CE2  . TYR B 1 300 ? 36.033  -5.908  188.327 1.00 0.00 ?  300 TYR B CE2  1  
ATOM 9407   C CZ   . TYR B 1 300 ? 36.604  -6.109  187.099 1.00 0.00 ?  300 TYR B CZ   1  
ATOM 9408   O OH   . TYR B 1 300 ? 37.489  -5.146  186.568 1.00 0.00 ?  300 TYR B OH   1  
ATOM 9409   H H    . TYR B 1 300 ? 31.528  -7.704  189.699 1.00 0.00 ?  300 TYR B H    1  
ATOM 9410   H HA   . TYR B 1 300 ? 32.416  -8.869  187.183 1.00 0.00 ?  300 TYR B HA   1  
ATOM 9411   H HB2  . TYR B 1 300 ? 34.022  -8.955  189.804 1.00 0.00 ?  300 TYR B HB2  1  
ATOM 9412   H HB3  . TYR B 1 300 ? 34.337  -10.011 188.376 1.00 0.00 ?  300 TYR B HB3  1  
ATOM 9413   H HD1  . TYR B 1 300 ? 35.226  -9.068  186.342 1.00 0.00 ?  300 TYR B HD1  1  
ATOM 9414   H HD2  . TYR B 1 300 ? 34.720  -6.682  189.820 1.00 0.00 ?  300 TYR B HD2  1  
ATOM 9415   H HE1  . TYR B 1 300 ? 36.764  -7.400  185.420 1.00 0.00 ?  300 TYR B HE1  1  
ATOM 9416   H HE2  . TYR B 1 300 ? 36.266  -5.018  188.881 1.00 0.00 ?  300 TYR B HE2  1  
ATOM 9417   H HH   . TYR B 1 300 ? 36.999  -4.330  186.444 1.00 0.00 ?  300 TYR B HH   1  
ATOM 9418   N N    . THR B 1 301 ? 31.807  -11.165 188.037 1.00 0.00 ?  301 THR B N    1  
ATOM 9419   C CA   . THR B 1 301 ? 31.124  -12.352 188.453 1.00 0.00 ?  301 THR B CA   1  
ATOM 9420   C C    . THR B 1 301 ? 32.156  -13.273 189.016 1.00 0.00 ?  301 THR B C    1  
ATOM 9421   C CB   . THR B 1 301 ? 30.466  -13.058 187.301 1.00 0.00 ?  301 THR B CB   1  
ATOM 9422   O OG1  . THR B 1 301 ? 29.512  -12.200 186.685 1.00 0.00 ?  301 THR B OG1  1  
ATOM 9423   C CG2  . THR B 1 301 ? 29.781  -14.333 187.817 1.00 0.00 ?  301 THR B CG2  1  
ATOM 9424   H H    . THR B 1 301 ? 32.318  -11.217 187.178 1.00 0.00 ?  301 THR B H    1  
ATOM 9425   H HA   . THR B 1 301 ? 30.404  -12.099 189.213 1.00 0.00 ?  301 THR B HA   1  
ATOM 9426   H HB   . THR B 1 301 ? 31.227  -13.345 186.547 1.00 0.00 ?  301 THR B HB   1  
ATOM 9427   H HG1  . THR B 1 301 ? 29.348  -12.570 185.812 1.00 0.00 ?  301 THR B HG1  1  
ATOM 9428   H HG21 . THR B 1 301 ? 29.042  -14.699 187.072 1.00 0.00 ?  301 THR B HG21 1  
ATOM 9429   H HG22 . THR B 1 301 ? 29.251  -14.129 188.771 1.00 0.00 ?  301 THR B HG22 1  
ATOM 9430   H HG23 . THR B 1 301 ? 30.534  -15.131 187.990 1.00 0.00 ?  301 THR B HG23 1  
ATOM 9431   N N    . MET C 1 1   ? 14.962  -32.549 183.082 1.00 0.00 ?  1   MET C N    1  
ATOM 9432   C CA   . MET C 1 1   ? 14.315  -33.454 184.059 1.00 0.00 ?  1   MET C CA   1  
ATOM 9433   C C    . MET C 1 1   ? 14.170  -32.758 185.375 1.00 0.00 ?  1   MET C C    1  
ATOM 9434   O O    . MET C 1 1   ? 14.708  -33.199 186.390 1.00 0.00 ?  1   MET C O    1  
ATOM 9435   C CB   . MET C 1 1   ? 15.167  -34.717 184.256 1.00 0.00 ?  1   MET C CB   1  
ATOM 9436   C CG   . MET C 1 1   ? 15.220  -35.582 182.994 1.00 0.00 ?  1   MET C CG   1  
ATOM 9437   S SD   . MET C 1 1   ? 14.714  -37.301 183.291 1.00 0.00 ?  1   MET C SD   1  
ATOM 9438   C CE   . MET C 1 1   ? 13.942  -37.521 181.662 1.00 0.00 ?  1   MET C CE   1  
ATOM 9439   H H1   . MET C 1 1   ? 14.255  -32.216 182.396 1.00 0.00 ?  1   MET C H1   1  
ATOM 9440   H HA   . MET C 1 1   ? 13.340  -33.708 183.674 1.00 0.00 ?  1   MET C HA   1  
ATOM 9441   H HB2  . MET C 1 1   ? 16.200  -34.418 184.538 1.00 0.00 ?  1   MET C HB2  1  
ATOM 9442   H HB3  . MET C 1 1   ? 14.742  -35.319 185.087 1.00 0.00 ?  1   MET C HB3  1  
ATOM 9443   H HG2  . MET C 1 1   ? 14.560  -35.125 182.226 1.00 0.00 ?  1   MET C HG2  1  
ATOM 9444   H HG3  . MET C 1 1   ? 16.258  -35.562 182.595 1.00 0.00 ?  1   MET C HG3  1  
ATOM 9445   H HE1  . MET C 1 1   ? 12.842  -37.374 181.722 1.00 0.00 ?  1   MET C HE1  1  
ATOM 9446   H HE2  . MET C 1 1   ? 14.130  -38.542 181.267 1.00 0.00 ?  1   MET C HE2  1  
ATOM 9447   H HE3  . MET C 1 1   ? 14.347  -36.789 180.929 1.00 0.00 ?  1   MET C HE3  1  
ATOM 9448   N N    . ASN C 1 2   ? 13.429  -31.632 185.375 1.00 0.00 ?  2   ASN C N    1  
ATOM 9449   C CA   . ASN C 1 2   ? 13.230  -30.888 186.585 1.00 0.00 ?  2   ASN C CA   1  
ATOM 9450   C C    . ASN C 1 2   ? 12.078  -31.526 187.313 1.00 0.00 ?  2   ASN C C    1  
ATOM 9451   O O    . ASN C 1 2   ? 11.342  -32.315 186.731 1.00 0.00 ?  2   ASN C O    1  
ATOM 9452   C CB   . ASN C 1 2   ? 12.930  -29.404 186.347 1.00 0.00 ?  2   ASN C CB   1  
ATOM 9453   C CG   . ASN C 1 2   ? 14.144  -28.639 185.837 1.00 0.00 ?  2   ASN C CG   1  
ATOM 9454   O OD1  . ASN C 1 2   ? 15.282  -29.079 185.988 1.00 0.00 ?  2   ASN C OD1  1  
ATOM 9455   N ND2  . ASN C 1 2   ? 13.893  -27.451 185.218 1.00 0.00 ?  2   ASN C ND2  1  
ATOM 9456   H H    . ASN C 1 2   ? 12.996  -31.271 184.552 1.00 0.00 ?  2   ASN C H    1  
ATOM 9457   H HA   . ASN C 1 2   ? 14.123  -30.998 187.182 1.00 0.00 ?  2   ASN C HA   1  
ATOM 9458   H HB2  . ASN C 1 2   ? 12.111  -29.310 185.602 1.00 0.00 ?  2   ASN C HB2  1  
ATOM 9459   H HB3  . ASN C 1 2   ? 12.590  -28.941 187.298 1.00 0.00 ?  2   ASN C HB3  1  
ATOM 9460   H HD21 . ASN C 1 2   ? 12.953  -27.127 185.121 1.00 0.00 ?  2   ASN C HD21 1  
ATOM 9461   H HD22 . ASN C 1 2   ? 14.651  -26.900 184.866 1.00 0.00 ?  2   ASN C HD22 1  
ATOM 9462   N N    . VAL C 1 3   ? 11.882  -31.180 188.615 1.00 0.00 ?  3   VAL C N    1  
ATOM 9463   C CA   . VAL C 1 3   ? 10.851  -31.837 189.392 1.00 0.00 ?  3   VAL C CA   1  
ATOM 9464   C C    . VAL C 1 3   ? 9.454   -31.555 188.879 1.00 0.00 ?  3   VAL C C    1  
ATOM 9465   O O    . VAL C 1 3   ? 8.697   -32.496 188.663 1.00 0.00 ?  3   VAL C O    1  
ATOM 9466   C CB   . VAL C 1 3   ? 10.912  -31.501 190.883 1.00 0.00 ?  3   VAL C CB   1  
ATOM 9467   C CG1  . VAL C 1 3   ? 10.773  -29.968 191.131 1.00 0.00 ?  3   VAL C CG1  1  
ATOM 9468   C CG2  . VAL C 1 3   ? 9.809   -32.305 191.590 1.00 0.00 ?  3   VAL C CG2  1  
ATOM 9469   H H    . VAL C 1 3   ? 12.423  -30.482 189.079 1.00 0.00 ?  3   VAL C H    1  
ATOM 9470   H HA   . VAL C 1 3   ? 11.027  -32.895 189.272 1.00 0.00 ?  3   VAL C HA   1  
ATOM 9471   H HB   . VAL C 1 3   ? 11.890  -31.829 191.291 1.00 0.00 ?  3   VAL C HB   1  
ATOM 9472   H HG11 . VAL C 1 3   ? 11.178  -29.702 192.131 1.00 0.00 ?  3   VAL C HG11 1  
ATOM 9473   H HG12 . VAL C 1 3   ? 9.704   -29.666 191.092 1.00 0.00 ?  3   VAL C HG12 1  
ATOM 9474   H HG13 . VAL C 1 3   ? 11.331  -29.399 190.358 1.00 0.00 ?  3   VAL C HG13 1  
ATOM 9475   H HG21 . VAL C 1 3   ? 8.823   -31.813 191.447 1.00 0.00 ?  3   VAL C HG21 1  
ATOM 9476   H HG22 . VAL C 1 3   ? 10.018  -32.370 192.679 1.00 0.00 ?  3   VAL C HG22 1  
ATOM 9477   H HG23 . VAL C 1 3   ? 9.756   -33.334 191.176 1.00 0.00 ?  3   VAL C HG23 1  
ATOM 9478   N N    . ASP C 1 4   ? 9.047   -30.275 188.727 1.00 0.00 ?  4   ASP C N    1  
ATOM 9479   C CA   . ASP C 1 4   ? 7.716   -29.974 188.236 1.00 0.00 ?  4   ASP C CA   1  
ATOM 9480   C C    . ASP C 1 4   ? 7.674   -29.880 186.712 1.00 0.00 ?  4   ASP C C    1  
ATOM 9481   O O    . ASP C 1 4   ? 6.800   -30.488 186.103 1.00 0.00 ?  4   ASP C O    1  
ATOM 9482   C CB   . ASP C 1 4   ? 7.063   -28.716 188.866 1.00 0.00 ?  4   ASP C CB   1  
ATOM 9483   C CG   . ASP C 1 4   ? 5.550   -28.853 188.975 1.00 0.00 ?  4   ASP C CG   1  
ATOM 9484   O OD1  . ASP C 1 4   ? 4.984   -29.755 188.300 1.00 0.00 ?  4   ASP C OD1  1  
ATOM 9485   O OD2  . ASP C 1 4   ? 4.940   -28.063 189.743 1.00 0.00 -1 4   ASP C OD2  1  
ATOM 9486   H H    . ASP C 1 4   ? 9.631   -29.496 188.941 1.00 0.00 ?  4   ASP C H    1  
ATOM 9487   H HA   . ASP C 1 4   ? 7.112   -30.826 188.506 1.00 0.00 ?  4   ASP C HA   1  
ATOM 9488   H HB2  . ASP C 1 4   ? 7.484   -28.549 189.881 1.00 0.00 ?  4   ASP C HB2  1  
ATOM 9489   H HB3  . ASP C 1 4   ? 7.291   -27.827 188.244 1.00 0.00 ?  4   ASP C HB3  1  
ATOM 9490   N N    . PRO C 1 5   ? 8.572   -29.109 186.063 1.00 0.00 ?  5   PRO C N    1  
ATOM 9491   C CA   . PRO C 1 5   ? 8.553   -28.967 184.599 1.00 0.00 ?  5   PRO C CA   1  
ATOM 9492   C C    . PRO C 1 5   ? 8.534   -30.229 183.754 1.00 0.00 ?  5   PRO C C    1  
ATOM 9493   O O    . PRO C 1 5   ? 8.377   -30.110 182.545 1.00 0.00 ?  5   PRO C O    1  
ATOM 9494   C CB   . PRO C 1 5   ? 9.805   -28.135 184.283 1.00 0.00 ?  5   PRO C CB   1  
ATOM 9495   C CG   . PRO C 1 5   ? 9.993   -27.261 185.525 1.00 0.00 ?  5   PRO C CG   1  
ATOM 9496   C CD   . PRO C 1 5   ? 9.589   -28.192 186.665 1.00 0.00 ?  5   PRO C CD   1  
ATOM 9497   H HA   . PRO C 1 5   ? 7.695   -28.383 184.310 1.00 0.00 ?  5   PRO C HA   1  
ATOM 9498   H HB2  . PRO C 1 5   ? 10.686  -28.795 184.126 1.00 0.00 ?  5   PRO C HB2  1  
ATOM 9499   H HB3  . PRO C 1 5   ? 9.643   -27.506 183.382 1.00 0.00 ?  5   PRO C HB3  1  
ATOM 9500   H HG2  . PRO C 1 5   ? 11.053  -26.937 185.622 1.00 0.00 ?  5   PRO C HG2  1  
ATOM 9501   H HG3  . PRO C 1 5   ? 9.329   -26.373 185.485 1.00 0.00 ?  5   PRO C HG3  1  
ATOM 9502   H HD2  . PRO C 1 5   ? 10.454  -28.755 187.045 1.00 0.00 ?  5   PRO C HD2  1  
ATOM 9503   H HD3  . PRO C 1 5   ? 9.158   -27.600 187.490 1.00 0.00 ?  5   PRO C HD3  1  
ATOM 9504   N N    . PHE C 1 6   ? 8.771   -31.450 184.310 1.00 0.00 ?  6   PHE C N    1  
ATOM 9505   C CA   . PHE C 1 6   ? 8.716   -32.645 183.464 1.00 0.00 ?  6   PHE C CA   1  
ATOM 9506   C C    . PHE C 1 6   ? 7.271   -33.056 183.320 1.00 0.00 ?  6   PHE C C    1  
ATOM 9507   O O    . PHE C 1 6   ? 6.927   -33.863 182.457 1.00 0.00 ?  6   PHE C O    1  
ATOM 9508   C CB   . PHE C 1 6   ? 9.499   -33.866 183.995 1.00 0.00 ?  6   PHE C CB   1  
ATOM 9509   C CG   . PHE C 1 6   ? 8.762   -34.701 184.987 1.00 0.00 ?  6   PHE C CG   1  
ATOM 9510   C CD1  . PHE C 1 6   ? 8.103   -35.847 184.590 1.00 0.00 ?  6   PHE C CD1  1  
ATOM 9511   C CD2  . PHE C 1 6   ? 8.743   -34.346 186.307 1.00 0.00 ?  6   PHE C CD2  1  
ATOM 9512   C CE1  . PHE C 1 6   ? 7.435   -36.620 185.511 1.00 0.00 ?  6   PHE C CE1  1  
ATOM 9513   C CE2  . PHE C 1 6   ? 8.076   -35.115 187.231 1.00 0.00 ?  6   PHE C CE2  1  
ATOM 9514   C CZ   . PHE C 1 6   ? 7.422   -36.254 186.833 1.00 0.00 ?  6   PHE C CZ   1  
ATOM 9515   H H    . PHE C 1 6   ? 8.988   -31.582 185.276 1.00 0.00 ?  6   PHE C H    1  
ATOM 9516   H HA   . PHE C 1 6   ? 9.092   -32.366 182.491 1.00 0.00 ?  6   PHE C HA   1  
ATOM 9517   H HB2  . PHE C 1 6   ? 9.767   -34.532 183.149 1.00 0.00 ?  6   PHE C HB2  1  
ATOM 9518   H HB3  . PHE C 1 6   ? 10.437  -33.522 184.483 1.00 0.00 ?  6   PHE C HB3  1  
ATOM 9519   H HD1  . PHE C 1 6   ? 8.111   -36.138 183.550 1.00 0.00 ?  6   PHE C HD1  1  
ATOM 9520   H HD2  . PHE C 1 6   ? 9.254   -33.459 186.617 1.00 0.00 ?  6   PHE C HD2  1  
ATOM 9521   H HE1  . PHE C 1 6   ? 6.922   -37.515 185.195 1.00 0.00 ?  6   PHE C HE1  1  
ATOM 9522   H HE2  . PHE C 1 6   ? 8.067   -34.824 188.271 1.00 0.00 ?  6   PHE C HE2  1  
ATOM 9523   H HZ   . PHE C 1 6   ? 6.898   -36.859 187.559 1.00 0.00 ?  6   PHE C HZ   1  
ATOM 9524   N N    . SER C 1 7   ? 6.409   -32.502 184.194 1.00 0.00 ?  7   SER C N    1  
ATOM 9525   C CA   . SER C 1 7   ? 4.987   -32.830 184.235 1.00 0.00 ?  7   SER C CA   1  
ATOM 9526   C C    . SER C 1 7   ? 4.250   -32.772 182.886 1.00 0.00 ?  7   SER C C    1  
ATOM 9527   O O    . SER C 1 7   ? 3.448   -33.660 182.635 1.00 0.00 ?  7   SER C O    1  
ATOM 9528   C CB   . SER C 1 7   ? 4.205   -31.934 185.211 1.00 0.00 ?  7   SER C CB   1  
ATOM 9529   O OG   . SER C 1 7   ? 2.836   -32.310 185.223 1.00 0.00 ?  7   SER C OG   1  
ATOM 9530   H H    . SER C 1 7   ? 6.711   -31.830 184.866 1.00 0.00 ?  7   SER C H    1  
ATOM 9531   H HA   . SER C 1 7   ? 4.931   -33.846 184.589 1.00 0.00 ?  7   SER C HA   1  
ATOM 9532   H HB2  . SER C 1 7   ? 4.616   -32.043 186.238 1.00 0.00 ?  7   SER C HB2  1  
ATOM 9533   H HB3  . SER C 1 7   ? 4.281   -30.871 184.905 1.00 0.00 ?  7   SER C HB3  1  
ATOM 9534   H HG   . SER C 1 7   ? 2.458   -31.906 186.007 1.00 0.00 ?  7   SER C HG   1  
ATOM 9535   N N    . PRO C 1 8   ? 4.433   -31.768 182.022 1.00 0.00 ?  8   PRO C N    1  
ATOM 9536   C CA   . PRO C 1 8   ? 3.699   -31.700 180.743 1.00 0.00 ?  8   PRO C CA   1  
ATOM 9537   C C    . PRO C 1 8   ? 3.816   -32.904 179.844 1.00 0.00 ?  8   PRO C C    1  
ATOM 9538   O O    . PRO C 1 8   ? 3.008   -33.064 178.929 1.00 0.00 ?  8   PRO C O    1  
ATOM 9539   C CB   . PRO C 1 8   ? 4.282   -30.481 180.031 1.00 0.00 ?  8   PRO C CB   1  
ATOM 9540   C CG   . PRO C 1 8   ? 4.754   -29.599 181.168 1.00 0.00 ?  8   PRO C CG   1  
ATOM 9541   C CD   . PRO C 1 8   ? 5.291   -30.589 182.190 1.00 0.00 ?  8   PRO C CD   1  
ATOM 9542   H HA   . PRO C 1 8   ? 2.651   -31.518 180.925 1.00 0.00 ?  8   PRO C HA   1  
ATOM 9543   H HB2  . PRO C 1 8   ? 5.132   -30.776 179.378 1.00 0.00 ?  8   PRO C HB2  1  
ATOM 9544   H HB3  . PRO C 1 8   ? 3.510   -29.965 179.428 1.00 0.00 ?  8   PRO C HB3  1  
ATOM 9545   H HG2  . PRO C 1 8   ? 5.554   -28.909 180.822 1.00 0.00 ?  8   PRO C HG2  1  
ATOM 9546   H HG3  . PRO C 1 8   ? 3.911   -29.015 181.591 1.00 0.00 ?  8   PRO C HG3  1  
ATOM 9547   H HD2  . PRO C 1 8   ? 6.338   -30.843 181.961 1.00 0.00 ?  8   PRO C HD2  1  
ATOM 9548   H HD3  . PRO C 1 8   ? 5.220   -30.170 183.213 1.00 0.00 ?  8   PRO C HD3  1  
ATOM 9549   N N    . HIS C 1 9   ? 4.812   -33.786 180.070 1.00 0.00 ?  9   HIS C N    1  
ATOM 9550   C CA   . HIS C 1 9   ? 4.966   -34.939 179.211 1.00 0.00 ?  9   HIS C CA   1  
ATOM 9551   C C    . HIS C 1 9   ? 4.069   -36.033 179.723 1.00 0.00 ?  9   HIS C C    1  
ATOM 9552   O O    . HIS C 1 9   ? 4.062   -37.143 179.192 1.00 0.00 ?  9   HIS C O    1  
ATOM 9553   C CB   . HIS C 1 9   ? 6.401   -35.494 179.177 1.00 0.00 ?  9   HIS C CB   1  
ATOM 9554   C CG   . HIS C 1 9   ? 7.410   -34.514 178.658 1.00 0.00 ?  9   HIS C CG   1  
ATOM 9555   N ND1  . HIS C 1 9   ? 7.405   -34.162 177.318 1.00 0.00 ?  9   HIS C ND1  1  
ATOM 9556   C CD2  . HIS C 1 9   ? 8.411   -33.867 179.317 1.00 0.00 ?  9   HIS C CD2  1  
ATOM 9557   C CE1  . HIS C 1 9   ? 8.406   -33.308 177.196 1.00 0.00 ?  9   HIS C CE1  1  
ATOM 9558   N NE2  . HIS C 1 9   ? 9.046   -33.095 178.372 1.00 0.00 ?  9   HIS C NE2  1  
ATOM 9559   H H    . HIS C 1 9   ? 5.468   -33.686 180.815 1.00 0.00 ?  9   HIS C H    1  
ATOM 9560   H HA   . HIS C 1 9   ? 4.651   -34.655 178.219 1.00 0.00 ?  9   HIS C HA   1  
ATOM 9561   H HB2  . HIS C 1 9   ? 6.712   -35.787 180.202 1.00 0.00 ?  9   HIS C HB2  1  
ATOM 9562   H HB3  . HIS C 1 9   ? 6.437   -36.394 178.526 1.00 0.00 ?  9   HIS C HB3  1  
ATOM 9563   H HD2  . HIS C 1 9   ? 8.701   -33.911 180.360 1.00 0.00 ?  9   HIS C HD2  1  
ATOM 9564   H HE1  . HIS C 1 9   ? 8.703   -32.819 176.269 1.00 0.00 ?  9   HIS C HE1  1  
ATOM 9565   N N    . SER C 1 10  ? 3.287   -35.733 180.774 1.00 0.00 ?  10  SER C N    1  
ATOM 9566   C CA   . SER C 1 10  ? 2.399   -36.705 181.348 1.00 0.00 ?  10  SER C CA   1  
ATOM 9567   C C    . SER C 1 10  ? 1.185   -36.829 180.462 1.00 0.00 ?  10  SER C C    1  
ATOM 9568   O O    . SER C 1 10  ? 1.179   -36.394 179.312 1.00 0.00 ?  10  SER C O    1  
ATOM 9569   C CB   . SER C 1 10  ? 1.931   -36.336 182.771 1.00 0.00 ?  10  SER C CB   1  
ATOM 9570   O OG   . SER C 1 10  ? 3.053   -36.209 183.631 1.00 0.00 ?  10  SER C OG   1  
ATOM 9571   H H    . SER C 1 10  ? 3.290   -34.832 181.199 1.00 0.00 ?  10  SER C H    1  
ATOM 9572   H HA   . SER C 1 10  ? 2.919   -37.650 181.362 1.00 0.00 ?  10  SER C HA   1  
ATOM 9573   H HB2  . SER C 1 10  ? 1.380   -35.371 182.755 1.00 0.00 ?  10  SER C HB2  1  
ATOM 9574   H HB3  . SER C 1 10  ? 1.264   -37.125 183.179 1.00 0.00 ?  10  SER C HB3  1  
ATOM 9575   H HG   . SER C 1 10  ? 2.914   -36.840 184.342 1.00 0.00 ?  10  SER C HG   1  
ATOM 9576   N N    . SER C 1 11  ? 0.118   -37.441 181.019 1.00 0.00 ?  11  SER C N    1  
ATOM 9577   C CA   . SER C 1 11  ? -1.101  -37.678 180.290 1.00 0.00 ?  11  SER C CA   1  
ATOM 9578   C C    . SER C 1 11  ? -1.775  -36.368 180.009 1.00 0.00 ?  11  SER C C    1  
ATOM 9579   O O    . SER C 1 11  ? -1.354  -35.313 180.483 1.00 0.00 ?  11  SER C O    1  
ATOM 9580   C CB   . SER C 1 11  ? -2.097  -38.564 181.053 1.00 0.00 ?  11  SER C CB   1  
ATOM 9581   O OG   . SER C 1 11  ? -2.613  -37.864 182.176 1.00 0.00 ?  11  SER C OG   1  
ATOM 9582   H H    . SER C 1 11  ? 0.129   -37.759 181.964 1.00 0.00 ?  11  SER C H    1  
ATOM 9583   H HA   . SER C 1 11  ? -0.833  -38.141 179.355 1.00 0.00 ?  11  SER C HA   1  
ATOM 9584   H HB2  . SER C 1 11  ? -2.940  -38.848 180.388 1.00 0.00 ?  11  SER C HB2  1  
ATOM 9585   H HB3  . SER C 1 11  ? -1.590  -39.487 181.408 1.00 0.00 ?  11  SER C HB3  1  
ATOM 9586   H HG   . SER C 1 11  ? -3.345  -37.340 181.846 1.00 0.00 ?  11  SER C HG   1  
ATOM 9587   N N    . ASP C 1 12  ? -2.857  -36.447 179.192 1.00 0.00 ?  12  ASP C N    1  
ATOM 9588   C CA   . ASP C 1 12  ? -3.590  -35.283 178.758 1.00 0.00 ?  12  ASP C CA   1  
ATOM 9589   C C    . ASP C 1 12  ? -4.103  -34.494 179.930 1.00 0.00 ?  12  ASP C C    1  
ATOM 9590   O O    . ASP C 1 12  ? -4.505  -35.025 180.964 1.00 0.00 ?  12  ASP C O    1  
ATOM 9591   C CB   . ASP C 1 12  ? -4.799  -35.630 177.880 1.00 0.00 ?  12  ASP C CB   1  
ATOM 9592   C CG   . ASP C 1 12  ? -4.377  -36.104 176.499 1.00 0.00 ?  12  ASP C CG   1  
ATOM 9593   O OD1  . ASP C 1 12  ? -3.178  -35.929 176.154 1.00 0.00 ?  12  ASP C OD1  1  
ATOM 9594   O OD2  . ASP C 1 12  ? -5.248  -36.647 175.769 1.00 0.00 -1 12  ASP C OD2  1  
ATOM 9595   H H    . ASP C 1 12  ? -3.195  -37.322 178.853 1.00 0.00 ?  12  ASP C H    1  
ATOM 9596   H HA   . ASP C 1 12  ? -2.904  -34.666 178.200 1.00 0.00 ?  12  ASP C HA   1  
ATOM 9597   H HB2  . ASP C 1 12  ? -5.393  -36.431 178.370 1.00 0.00 ?  12  ASP C HB2  1  
ATOM 9598   H HB3  . ASP C 1 12  ? -5.442  -34.733 177.771 1.00 0.00 ?  12  ASP C HB3  1  
ATOM 9599   N N    . SER C 1 13  ? -4.072  -33.163 179.724 1.00 0.00 ?  13  SER C N    1  
ATOM 9600   C CA   . SER C 1 13  ? -4.476  -32.181 180.696 1.00 0.00 ?  13  SER C CA   1  
ATOM 9601   C C    . SER C 1 13  ? -5.965  -31.922 180.610 1.00 0.00 ?  13  SER C C    1  
ATOM 9602   O O    . SER C 1 13  ? -6.492  -31.106 181.366 1.00 0.00 ?  13  SER C O    1  
ATOM 9603   C CB   . SER C 1 13  ? -3.763  -30.844 180.499 1.00 0.00 ?  13  SER C CB   1  
ATOM 9604   O OG   . SER C 1 13  ? -4.234  -30.206 179.321 1.00 0.00 ?  13  SER C OG   1  
ATOM 9605   H H    . SER C 1 13  ? -3.757  -32.786 178.855 1.00 0.00 ?  13  SER C H    1  
ATOM 9606   H HA   . SER C 1 13  ? -4.245  -32.579 181.671 1.00 0.00 ?  13  SER C HA   1  
ATOM 9607   H HB2  . SER C 1 13  ? -3.942  -30.185 181.368 1.00 0.00 ?  13  SER C HB2  1  
ATOM 9608   H HB3  . SER C 1 13  ? -2.670  -31.011 180.398 1.00 0.00 ?  13  SER C HB3  1  
ATOM 9609   H HG   . SER C 1 13  ? -4.776  -29.470 179.617 1.00 0.00 ?  13  SER C HG   1  
ATOM 9610   N N    . PHE C 1 14  ? -6.656  -32.571 179.645 1.00 0.00 ?  14  PHE C N    1  
ATOM 9611   C CA   . PHE C 1 14  ? -8.087  -32.355 179.389 1.00 0.00 ?  14  PHE C CA   1  
ATOM 9612   C C    . PHE C 1 14  ? -8.989  -32.498 180.613 1.00 0.00 ?  14  PHE C C    1  
ATOM 9613   O O    . PHE C 1 14  ? -10.178 -32.182 180.519 1.00 0.00 ?  14  PHE C O    1  
ATOM 9614   C CB   . PHE C 1 14  ? -8.656  -33.298 178.315 1.00 0.00 ?  14  PHE C CB   1  
ATOM 9615   C CG   . PHE C 1 14  ? -8.291  -32.908 176.923 1.00 0.00 ?  14  PHE C CG   1  
ATOM 9616   C CD1  . PHE C 1 14  ? -8.743  -31.718 176.392 1.00 0.00 ?  14  PHE C CD1  1  
ATOM 9617   C CD2  . PHE C 1 14  ? -7.510  -33.732 176.144 1.00 0.00 ?  14  PHE C CD2  1  
ATOM 9618   C CE1  . PHE C 1 14  ? -8.415  -31.359 175.106 1.00 0.00 ?  14  PHE C CE1  1  
ATOM 9619   C CE2  . PHE C 1 14  ? -7.182  -33.372 174.858 1.00 0.00 ?  14  PHE C CE2  1  
ATOM 9620   C CZ   . PHE C 1 14  ? -7.634  -32.186 174.340 1.00 0.00 ?  14  PHE C CZ   1  
ATOM 9621   H H    . PHE C 1 14  ? -6.215  -33.239 179.051 1.00 0.00 ?  14  PHE C H    1  
ATOM 9622   H HA   . PHE C 1 14  ? -8.175  -31.350 179.036 1.00 0.00 ?  14  PHE C HA   1  
ATOM 9623   H HB2  . PHE C 1 14  ? -8.277  -34.329 178.477 1.00 0.00 ?  14  PHE C HB2  1  
ATOM 9624   H HB3  . PHE C 1 14  ? -9.766  -33.312 178.377 1.00 0.00 ?  14  PHE C HB3  1  
ATOM 9625   H HD1  . PHE C 1 14  ? -9.357  -31.062 176.992 1.00 0.00 ?  14  PHE C HD1  1  
ATOM 9626   H HD2  . PHE C 1 14  ? -7.155  -34.670 176.545 1.00 0.00 ?  14  PHE C HD2  1  
ATOM 9627   H HE1  . PHE C 1 14  ? -8.774  -30.425 174.698 1.00 0.00 ?  14  PHE C HE1  1  
ATOM 9628   H HE2  . PHE C 1 14  ? -6.567  -34.024 174.256 1.00 0.00 ?  14  PHE C HE2  1  
ATOM 9629   H HZ   . PHE C 1 14  ? -7.376  -31.903 173.330 1.00 0.00 ?  14  PHE C HZ   1  
ATOM 9630   N N    . ALA C 1 15  ? -8.481  -32.981 181.763 1.00 0.00 ?  15  ALA C N    1  
ATOM 9631   C CA   . ALA C 1 15  ? -9.306  -33.203 182.936 1.00 0.00 ?  15  ALA C CA   1  
ATOM 9632   C C    . ALA C 1 15  ? -10.037 -31.947 183.410 1.00 0.00 ?  15  ALA C C    1  
ATOM 9633   O O    . ALA C 1 15  ? -11.006 -32.081 184.162 1.00 0.00 ?  15  ALA C O    1  
ATOM 9634   C CB   . ALA C 1 15  ? -8.488  -33.715 184.132 1.00 0.00 ?  15  ALA C CB   1  
ATOM 9635   H H    . ALA C 1 15  ? -7.515  -33.208 181.859 1.00 0.00 ?  15  ALA C H    1  
ATOM 9636   H HA   . ALA C 1 15  ? -10.040 -33.943 182.667 1.00 0.00 ?  15  ALA C HA   1  
ATOM 9637   H HB1  . ALA C 1 15  ? -8.346  -34.814 184.061 1.00 0.00 ?  15  ALA C HB1  1  
ATOM 9638   H HB2  . ALA C 1 15  ? -9.012  -33.485 185.085 1.00 0.00 ?  15  ALA C HB2  1  
ATOM 9639   H HB3  . ALA C 1 15  ? -7.489  -33.229 184.152 1.00 0.00 ?  15  ALA C HB3  1  
ATOM 9640   N N    . GLN C 1 16  ? -9.589  -30.708 183.053 1.00 0.00 ?  16  GLN C N    1  
ATOM 9641   C CA   . GLN C 1 16  ? -10.301 -29.511 183.521 1.00 0.00 ?  16  GLN C CA   1  
ATOM 9642   C C    . GLN C 1 16  ? -11.695 -29.547 182.953 1.00 0.00 ?  16  GLN C C    1  
ATOM 9643   O O    . GLN C 1 16  ? -12.654 -29.299 183.685 1.00 0.00 ?  16  GLN C O    1  
ATOM 9644   C CB   . GLN C 1 16  ? -9.633  -28.202 183.059 1.00 0.00 ?  16  GLN C CB   1  
ATOM 9645   C CG   . GLN C 1 16  ? -10.277 -26.950 183.667 1.00 0.00 ?  16  GLN C CG   1  
ATOM 9646   C CD   . GLN C 1 16  ? -10.115 -27.007 185.180 1.00 0.00 ?  16  GLN C CD   1  
ATOM 9647   O OE1  . GLN C 1 16  ? -9.007  -27.142 185.695 1.00 0.00 ?  16  GLN C OE1  1  
ATOM 9648   N NE2  . GLN C 1 16  ? -11.254 -26.892 185.914 1.00 0.00 ?  16  GLN C NE2  1  
ATOM 9649   H H    . GLN C 1 16  ? -8.787  -30.564 182.476 1.00 0.00 ?  16  GLN C H    1  
ATOM 9650   H HA   . GLN C 1 16  ? -10.351 -29.558 184.597 1.00 0.00 ?  16  GLN C HA   1  
ATOM 9651   H HB2  . GLN C 1 16  ? -8.556  -28.228 183.336 1.00 0.00 ?  16  GLN C HB2  1  
ATOM 9652   H HB3  . GLN C 1 16  ? -9.700  -28.136 181.952 1.00 0.00 ?  16  GLN C HB3  1  
ATOM 9653   H HG2  . GLN C 1 16  ? -9.780  -26.037 183.273 1.00 0.00 ?  16  GLN C HG2  1  
ATOM 9654   H HG3  . GLN C 1 16  ? -11.357 -26.915 183.415 1.00 0.00 ?  16  GLN C HG3  1  
ATOM 9655   H HE21 . GLN C 1 16  ? -12.135 -26.773 185.456 1.00 0.00 ?  16  GLN C HE21 1  
ATOM 9656   H HE22 . GLN C 1 16  ? -11.212 -26.937 186.912 1.00 0.00 ?  16  GLN C HE22 1  
ATOM 9657   N N    . ALA C 1 17  ? -11.837 -29.904 181.637 1.00 0.00 ?  17  ALA C N    1  
ATOM 9658   C CA   . ALA C 1 17  ? -13.154 -29.969 181.028 1.00 0.00 ?  17  ALA C CA   1  
ATOM 9659   C C    . ALA C 1 17  ? -12.995 -30.242 179.561 1.00 0.00 ?  17  ALA C C    1  
ATOM 9660   O O    . ALA C 1 17  ? -12.809 -29.317 178.769 1.00 0.00 ?  17  ALA C O    1  
ATOM 9661   C CB   . ALA C 1 17  ? -13.964 -28.662 181.146 1.00 0.00 ?  17  ALA C CB   1  
ATOM 9662   H H    . ALA C 1 17  ? -11.061 -30.131 181.053 1.00 0.00 ?  17  ALA C H    1  
ATOM 9663   H HA   . ALA C 1 17  ? -13.689 -30.784 181.487 1.00 0.00 ?  17  ALA C HA   1  
ATOM 9664   H HB1  . ALA C 1 17  ? -13.282 -27.800 181.303 1.00 0.00 ?  17  ALA C HB1  1  
ATOM 9665   H HB2  . ALA C 1 17  ? -14.666 -28.721 182.005 1.00 0.00 ?  17  ALA C HB2  1  
ATOM 9666   H HB3  . ALA C 1 17  ? -14.551 -28.487 180.219 1.00 0.00 ?  17  ALA C HB3  1  
ATOM 9667   N N    . ALA C 1 18  ? -13.085 -31.530 179.153 1.00 0.00 ?  18  ALA C N    1  
ATOM 9668   C CA   . ALA C 1 18  ? -12.963 -31.853 177.752 1.00 0.00 ?  18  ALA C CA   1  
ATOM 9669   C C    . ALA C 1 18  ? -14.323 -31.735 177.116 1.00 0.00 ?  18  ALA C C    1  
ATOM 9670   O O    . ALA C 1 18  ? -14.507 -31.000 176.146 1.00 0.00 ?  18  ALA C O    1  
ATOM 9671   C CB   . ALA C 1 18  ? -12.453 -33.282 177.502 1.00 0.00 ?  18  ALA C CB   1  
ATOM 9672   H H    . ALA C 1 18  ? -13.219 -32.291 179.784 1.00 0.00 ?  18  ALA C H    1  
ATOM 9673   H HA   . ALA C 1 18  ? -12.296 -31.134 177.304 1.00 0.00 ?  18  ALA C HA   1  
ATOM 9674   H HB1  . ALA C 1 18  ? -13.232 -33.886 176.991 1.00 0.00 ?  18  ALA C HB1  1  
ATOM 9675   H HB2  . ALA C 1 18  ? -12.197 -33.775 178.464 1.00 0.00 ?  18  ALA C HB2  1  
ATOM 9676   H HB3  . ALA C 1 18  ? -11.545 -33.261 176.862 1.00 0.00 ?  18  ALA C HB3  1  
ATOM 9677   N N    . SER C 1 19  ? -15.311 -32.470 177.666 1.00 0.00 ?  19  SER C N    1  
ATOM 9678   C CA   . SER C 1 19  ? -16.655 -32.452 177.121 1.00 0.00 ?  19  SER C CA   1  
ATOM 9679   C C    . SER C 1 19  ? -17.304 -31.065 177.172 1.00 0.00 ?  19  SER C C    1  
ATOM 9680   O O    . SER C 1 19  ? -17.890 -30.649 176.169 1.00 0.00 ?  19  SER C O    1  
ATOM 9681   C CB   . SER C 1 19  ? -17.610 -33.468 177.783 1.00 0.00 ?  19  SER C CB   1  
ATOM 9682   O OG   . SER C 1 19  ? -17.238 -34.788 177.417 1.00 0.00 ?  19  SER C OG   1  
ATOM 9683   H H    . SER C 1 19  ? -15.164 -33.051 178.462 1.00 0.00 ?  19  SER C H    1  
ATOM 9684   H HA   . SER C 1 19  ? -16.548 -32.715 176.079 1.00 0.00 ?  19  SER C HA   1  
ATOM 9685   H HB2  . SER C 1 19  ? -17.564 -33.381 178.887 1.00 0.00 ?  19  SER C HB2  1  
ATOM 9686   H HB3  . SER C 1 19  ? -18.653 -33.286 177.450 1.00 0.00 ?  19  SER C HB3  1  
ATOM 9687   H HG   . SER C 1 19  ? -16.653 -34.699 176.662 1.00 0.00 ?  19  SER C HG   1  
ATOM 9688   N N    . PRO C 1 20  ? -17.254 -30.320 178.291 1.00 0.00 ?  20  PRO C N    1  
ATOM 9689   C CA   . PRO C 1 20  ? -17.886 -28.995 178.353 1.00 0.00 ?  20  PRO C CA   1  
ATOM 9690   C C    . PRO C 1 20  ? -17.442 -28.008 177.315 1.00 0.00 ?  20  PRO C C    1  
ATOM 9691   O O    . PRO C 1 20  ? -18.096 -26.978 177.139 1.00 0.00 ?  20  PRO C O    1  
ATOM 9692   C CB   . PRO C 1 20  ? -17.536 -28.458 179.739 1.00 0.00 ?  20  PRO C CB   1  
ATOM 9693   C CG   . PRO C 1 20  ? -17.343 -29.709 180.573 1.00 0.00 ?  20  PRO C CG   1  
ATOM 9694   C CD   . PRO C 1 20  ? -16.696 -30.695 179.610 1.00 0.00 ?  20  PRO C CD   1  
ATOM 9695   H HA   . PRO C 1 20  ? -18.954 -29.090 178.284 1.00 0.00 ?  20  PRO C HA   1  
ATOM 9696   H HB2  . PRO C 1 20  ? -16.602 -27.857 179.703 1.00 0.00 ?  20  PRO C HB2  1  
ATOM 9697   H HB3  . PRO C 1 20  ? -18.366 -27.841 180.145 1.00 0.00 ?  20  PRO C HB3  1  
ATOM 9698   H HG2  . PRO C 1 20  ? -16.679 -29.503 181.440 1.00 0.00 ?  20  PRO C HG2  1  
ATOM 9699   H HG3  . PRO C 1 20  ? -18.320 -30.096 180.934 1.00 0.00 ?  20  PRO C HG3  1  
ATOM 9700   H HD2  . PRO C 1 20  ? -15.595 -30.585 179.626 1.00 0.00 ?  20  PRO C HD2  1  
ATOM 9701   H HD3  . PRO C 1 20  ? -16.966 -31.732 179.885 1.00 0.00 ?  20  PRO C HD3  1  
ATOM 9702   N N    . ALA C 1 21  ? -16.304 -28.268 176.641 1.00 0.00 ?  21  ALA C N    1  
ATOM 9703   C CA   . ALA C 1 21  ? -15.822 -27.355 175.641 1.00 0.00 ?  21  ALA C CA   1  
ATOM 9704   C C    . ALA C 1 21  ? -16.853 -27.224 174.558 1.00 0.00 ?  21  ALA C C    1  
ATOM 9705   O O    . ALA C 1 21  ? -17.078 -26.129 174.045 1.00 0.00 ?  21  ALA C O    1  
ATOM 9706   C CB   . ALA C 1 21  ? -14.510 -27.812 174.986 1.00 0.00 ?  21  ALA C CB   1  
ATOM 9707   H H    . ALA C 1 21  ? -15.754 -29.084 176.809 1.00 0.00 ?  21  ALA C H    1  
ATOM 9708   H HA   . ALA C 1 21  ? -15.686 -26.397 176.116 1.00 0.00 ?  21  ALA C HA   1  
ATOM 9709   H HB1  . ALA C 1 21  ? -14.719 -28.342 174.032 1.00 0.00 ?  21  ALA C HB1  1  
ATOM 9710   H HB2  . ALA C 1 21  ? -13.960 -28.502 175.662 1.00 0.00 ?  21  ALA C HB2  1  
ATOM 9711   H HB3  . ALA C 1 21  ? -13.861 -26.937 174.770 1.00 0.00 ?  21  ALA C HB3  1  
ATOM 9712   N N    . ARG C 1 22  ? -17.513 -28.334 174.176 1.00 0.00 ?  22  ARG C N    1  
ATOM 9713   C CA   . ARG C 1 22  ? -18.497 -28.241 173.132 1.00 0.00 ?  22  ARG C CA   1  
ATOM 9714   C C    . ARG C 1 22  ? -19.715 -27.565 173.690 1.00 0.00 ?  22  ARG C C    1  
ATOM 9715   O O    . ARG C 1 22  ? -20.521 -27.017 172.940 1.00 0.00 ?  22  ARG C O    1  
ATOM 9716   C CB   . ARG C 1 22  ? -18.931 -29.602 172.563 1.00 0.00 ?  22  ARG C CB   1  
ATOM 9717   C CG   . ARG C 1 22  ? -17.804 -30.305 171.804 1.00 0.00 ?  22  ARG C CG   1  
ATOM 9718   C CD   . ARG C 1 22  ? -18.178 -31.731 171.390 1.00 0.00 ?  22  ARG C CD   1  
ATOM 9719   N NE   . ARG C 1 22  ? -18.335 -32.555 172.619 1.00 0.00 ?  22  ARG C NE   1  
ATOM 9720   C CZ   . ARG C 1 22  ? -18.760 -33.848 172.521 1.00 0.00 ?  22  ARG C CZ   1  
ATOM 9721   N NH1  . ARG C 1 22  ? -19.040 -34.383 171.297 1.00 0.00 1  22  ARG C NH1  1  
ATOM 9722   N NH2  . ARG C 1 22  ? -18.907 -34.606 173.647 1.00 0.00 ?  22  ARG C NH2  1  
ATOM 9723   H H    . ARG C 1 22  ? -17.354 -29.234 174.579 1.00 0.00 ?  22  ARG C H    1  
ATOM 9724   H HA   . ARG C 1 22  ? -18.082 -27.626 172.349 1.00 0.00 ?  22  ARG C HA   1  
ATOM 9725   H HB2  . ARG C 1 22  ? -19.270 -30.253 173.399 1.00 0.00 ?  22  ARG C HB2  1  
ATOM 9726   H HB3  . ARG C 1 22  ? -19.789 -29.452 171.875 1.00 0.00 ?  22  ARG C HB3  1  
ATOM 9727   H HG2  . ARG C 1 22  ? -17.557 -29.717 170.895 1.00 0.00 ?  22  ARG C HG2  1  
ATOM 9728   H HG3  . ARG C 1 22  ? -16.899 -30.339 172.447 1.00 0.00 ?  22  ARG C HG3  1  
ATOM 9729   H HD2  . ARG C 1 22  ? -19.141 -31.742 170.834 1.00 0.00 ?  22  ARG C HD2  1  
ATOM 9730   H HD3  . ARG C 1 22  ? -17.378 -32.186 170.769 1.00 0.00 ?  22  ARG C HD3  1  
ATOM 9731   H HE   . ARG C 1 22  ? -18.131 -32.161 173.516 1.00 0.00 ?  22  ARG C HE   1  
ATOM 9732   H HH11 . ARG C 1 22  ? -18.932 -33.827 170.472 1.00 0.00 ?  22  ARG C HH11 1  
ATOM 9733   H HH12 . ARG C 1 22  ? -19.351 -35.330 171.224 1.00 0.00 ?  22  ARG C HH12 1  
ATOM 9734   H HH21 . ARG C 1 22  ? -18.704 -34.213 174.544 1.00 0.00 ?  22  ARG C HH21 1  
ATOM 9735   H HH22 . ARG C 1 22  ? -19.218 -35.554 173.574 1.00 0.00 ?  22  ARG C HH22 1  
ATOM 9736   N N    . LYS C 1 23  ? -19.885 -27.583 175.029 1.00 0.00 ?  23  LYS C N    1  
ATOM 9737   C CA   . LYS C 1 23  ? -21.039 -26.945 175.610 1.00 0.00 ?  23  LYS C CA   1  
ATOM 9738   C C    . LYS C 1 23  ? -20.779 -25.446 175.623 1.00 0.00 ?  23  LYS C C    1  
ATOM 9739   O O    . LYS C 1 23  ? -19.623 -25.025 175.583 1.00 0.00 ?  23  LYS C O    1  
ATOM 9740   C CB   . LYS C 1 23  ? -21.359 -27.417 177.051 1.00 0.00 ?  23  LYS C CB   1  
ATOM 9741   C CG   . LYS C 1 23  ? -21.826 -28.873 177.102 1.00 0.00 ?  23  LYS C CG   1  
ATOM 9742   C CD   . LYS C 1 23  ? -22.408 -29.264 178.467 1.00 0.00 ?  23  LYS C CD   1  
ATOM 9743   C CE   . LYS C 1 23  ? -21.363 -29.295 179.583 1.00 0.00 ?  23  LYS C CE   1  
ATOM 9744   N NZ   . LYS C 1 23  ? -21.980 -29.734 180.854 1.00 0.00 1  23  LYS C NZ   1  
ATOM 9745   H H    . LYS C 1 23  ? -19.245 -28.029 175.655 1.00 0.00 ?  23  LYS C H    1  
ATOM 9746   H HA   . LYS C 1 23  ? -21.867 -27.163 174.953 1.00 0.00 ?  23  LYS C HA   1  
ATOM 9747   H HB2  . LYS C 1 23  ? -20.448 -27.305 177.679 1.00 0.00 ?  23  LYS C HB2  1  
ATOM 9748   H HB3  . LYS C 1 23  ? -22.152 -26.769 177.480 1.00 0.00 ?  23  LYS C HB3  1  
ATOM 9749   H HG2  . LYS C 1 23  ? -22.600 -29.032 176.321 1.00 0.00 ?  23  LYS C HG2  1  
ATOM 9750   H HG3  . LYS C 1 23  ? -20.966 -29.538 176.870 1.00 0.00 ?  23  LYS C HG3  1  
ATOM 9751   H HD2  . LYS C 1 23  ? -23.202 -28.538 178.740 1.00 0.00 ?  23  LYS C HD2  1  
ATOM 9752   H HD3  . LYS C 1 23  ? -22.877 -30.268 178.384 1.00 0.00 ?  23  LYS C HD3  1  
ATOM 9753   H HE2  . LYS C 1 23  ? -20.548 -30.006 179.335 1.00 0.00 ?  23  LYS C HE2  1  
ATOM 9754   H HE3  . LYS C 1 23  ? -20.932 -28.282 179.741 1.00 0.00 ?  23  LYS C HE3  1  
ATOM 9755   H HZ1  . LYS C 1 23  ? -21.314 -29.571 181.637 1.00 0.00 ?  23  LYS C HZ1  1  
ATOM 9756   H HZ2  . LYS C 1 23  ? -22.208 -30.746 180.797 1.00 0.00 ?  23  LYS C HZ2  1  
ATOM 9757   H HZ3  . LYS C 1 23  ? -22.850 -29.190 181.023 1.00 0.00 ?  23  LYS C HZ3  1  
ATOM 9758   N N    . PRO C 1 24  ? -21.834 -24.614 175.669 1.00 0.00 ?  24  PRO C N    1  
ATOM 9759   C CA   . PRO C 1 24  ? -21.664 -23.158 175.688 1.00 0.00 ?  24  PRO C CA   1  
ATOM 9760   C C    . PRO C 1 24  ? -20.824 -22.664 176.855 1.00 0.00 ?  24  PRO C C    1  
ATOM 9761   O O    . PRO C 1 24  ? -20.721 -23.358 177.865 1.00 0.00 ?  24  PRO C O    1  
ATOM 9762   C CB   . PRO C 1 24  ? -23.087 -22.599 175.811 1.00 0.00 ?  24  PRO C CB   1  
ATOM 9763   C CG   . PRO C 1 24  ? -23.967 -23.695 175.239 1.00 0.00 ?  24  PRO C CG   1  
ATOM 9764   C CD   . PRO C 1 24  ? -23.269 -24.987 175.645 1.00 0.00 ?  24  PRO C CD   1  
ATOM 9765   H HA   . PRO C 1 24  ? -21.233 -22.833 174.756 1.00 0.00 ?  24  PRO C HA   1  
ATOM 9766   H HB2  . PRO C 1 24  ? -23.341 -22.402 176.874 1.00 0.00 ?  24  PRO C HB2  1  
ATOM 9767   H HB3  . PRO C 1 24  ? -23.194 -21.665 175.221 1.00 0.00 ?  24  PRO C HB3  1  
ATOM 9768   H HG2  . PRO C 1 24  ? -24.990 -23.641 175.675 1.00 0.00 ?  24  PRO C HG2  1  
ATOM 9769   H HG3  . PRO C 1 24  ? -24.029 -23.613 174.134 1.00 0.00 ?  24  PRO C HG3  1  
ATOM 9770   H HD2  . PRO C 1 24  ? -23.619 -25.321 176.646 1.00 0.00 ?  24  PRO C HD2  1  
ATOM 9771   H HD3  . PRO C 1 24  ? -23.477 -25.777 174.894 1.00 0.00 ?  24  PRO C HD3  1  
ATOM 9772   N N    . PRO C 1 25  ? -20.212 -21.483 176.761 1.00 0.00 ?  25  PRO C N    1  
ATOM 9773   C CA   . PRO C 1 25  ? -19.349 -20.958 177.819 1.00 0.00 ?  25  PRO C CA   1  
ATOM 9774   C C    . PRO C 1 25  ? -20.072 -20.522 179.064 1.00 0.00 ?  25  PRO C C    1  
ATOM 9775   O O    . PRO C 1 25  ? -21.289 -20.345 179.070 1.00 0.00 ?  25  PRO C O    1  
ATOM 9776   C CB   . PRO C 1 25  ? -18.645 -19.767 177.179 1.00 0.00 ?  25  PRO C CB   1  
ATOM 9777   C CG   . PRO C 1 25  ? -19.648 -19.266 176.155 1.00 0.00 ?  25  PRO C CG   1  
ATOM 9778   C CD   . PRO C 1 25  ? -20.329 -20.531 175.638 1.00 0.00 ?  25  PRO C CD   1  
ATOM 9779   H HA   . PRO C 1 25  ? -18.605 -21.691 178.096 1.00 0.00 ?  25  PRO C HA   1  
ATOM 9780   H HB2  . PRO C 1 25  ? -18.426 -18.984 177.937 1.00 0.00 ?  25  PRO C HB2  1  
ATOM 9781   H HB3  . PRO C 1 25  ? -17.704 -20.084 176.682 1.00 0.00 ?  25  PRO C HB3  1  
ATOM 9782   H HG2  . PRO C 1 25  ? -20.386 -18.585 176.634 1.00 0.00 ?  25  PRO C HG2  1  
ATOM 9783   H HG3  . PRO C 1 25  ? -19.132 -18.733 175.329 1.00 0.00 ?  25  PRO C HG3  1  
ATOM 9784   H HD2  . PRO C 1 25  ? -21.392 -20.325 175.393 1.00 0.00 ?  25  PRO C HD2  1  
ATOM 9785   H HD3  . PRO C 1 25  ? -19.808 -20.910 174.733 1.00 0.00 ?  25  PRO C HD3  1  
ATOM 9786   N N    . ARG C 1 26  ? -19.290 -20.342 180.163 1.00 0.00 ?  26  ARG C N    1  
ATOM 9787   C CA   . ARG C 1 26  ? -19.846 -19.951 181.439 1.00 0.00 ?  26  ARG C CA   1  
ATOM 9788   C C    . ARG C 1 26  ? -20.224 -18.477 181.351 1.00 0.00 ?  26  ARG C C    1  
ATOM 9789   O O    . ARG C 1 26  ? -19.416 -17.584 181.603 1.00 0.00 ?  26  ARG C O    1  
ATOM 9790   C CB   . ARG C 1 26  ? -18.823 -20.149 182.591 1.00 0.00 ?  26  ARG C CB   1  
ATOM 9791   C CG   . ARG C 1 26  ? -18.146 -21.551 182.590 1.00 0.00 ?  26  ARG C CG   1  
ATOM 9792   C CD   . ARG C 1 26  ? -19.154 -22.700 182.721 1.00 0.00 ?  26  ARG C CD   1  
ATOM 9793   N NE   . ARG C 1 26  ? -18.395 -23.975 182.852 1.00 0.00 ?  26  ARG C NE   1  
ATOM 9794   C CZ   . ARG C 1 26  ? -19.060 -25.168 182.850 1.00 0.00 ?  26  ARG C CZ   1  
ATOM 9795   N NH1  . ARG C 1 26  ? -20.419 -25.192 182.725 1.00 0.00 1  26  ARG C NH1  1  
ATOM 9796   N NH2  . ARG C 1 26  ? -18.365 -26.337 182.971 1.00 0.00 ?  26  ARG C NH2  1  
ATOM 9797   H H    . ARG C 1 26  ? -18.302 -20.469 180.136 1.00 0.00 ?  26  ARG C H    1  
ATOM 9798   H HA   . ARG C 1 26  ? -20.733 -20.540 181.611 1.00 0.00 ?  26  ARG C HA   1  
ATOM 9799   H HB2  . ARG C 1 26  ? -18.035 -19.368 182.508 1.00 0.00 ?  26  ARG C HB2  1  
ATOM 9800   H HB3  . ARG C 1 26  ? -19.344 -20.004 183.561 1.00 0.00 ?  26  ARG C HB3  1  
ATOM 9801   H HG2  . ARG C 1 26  ? -17.577 -21.678 181.645 1.00 0.00 ?  26  ARG C HG2  1  
ATOM 9802   H HG3  . ARG C 1 26  ? -17.424 -21.603 183.433 1.00 0.00 ?  26  ARG C HG3  1  
ATOM 9803   H HD2  . ARG C 1 26  ? -19.786 -22.573 183.627 1.00 0.00 ?  26  ARG C HD2  1  
ATOM 9804   H HD3  . ARG C 1 26  ? -19.796 -22.775 181.819 1.00 0.00 ?  26  ARG C HD3  1  
ATOM 9805   H HE   . ARG C 1 26  ? -17.399 -23.958 182.942 1.00 0.00 ?  26  ARG C HE   1  
ATOM 9806   H HH11 . ARG C 1 26  ? -20.928 -24.336 182.635 1.00 0.00 ?  26  ARG C HH11 1  
ATOM 9807   H HH12 . ARG C 1 26  ? -20.905 -26.066 182.723 1.00 0.00 ?  26  ARG C HH12 1  
ATOM 9808   H HH21 . ARG C 1 26  ? -17.370 -26.319 183.061 1.00 0.00 ?  26  ARG C HH21 1  
ATOM 9809   H HH22 . ARG C 1 26  ? -18.852 -27.210 182.969 1.00 0.00 ?  26  ARG C HH22 1  
ATOM 9810   N N    . GLY C 1 27  ? -21.504 -18.241 180.980 1.00 0.00 ?  27  GLY C N    1  
ATOM 9811   C CA   . GLY C 1 27  ? -22.080 -16.918 180.765 1.00 0.00 ?  27  GLY C CA   1  
ATOM 9812   C C    . GLY C 1 27  ? -22.620 -16.225 182.019 1.00 0.00 ?  27  GLY C C    1  
ATOM 9813   O O    . GLY C 1 27  ? -23.061 -15.087 181.906 1.00 0.00 ?  27  GLY C O    1  
ATOM 9814   H H    . GLY C 1 27  ? -22.136 -18.997 180.831 1.00 0.00 ?  27  GLY C H    1  
ATOM 9815   H HA2  . GLY C 1 27  ? -21.290 -16.302 180.370 1.00 0.00 ?  27  GLY C HA2  1  
ATOM 9816   H HA3  . GLY C 1 27  ? -22.900 -17.054 180.071 1.00 0.00 ?  27  GLY C HA3  1  
ATOM 9817   N N    . GLY C 1 28  ? -22.645 -16.880 183.211 1.00 0.00 ?  28  GLY C N    1  
ATOM 9818   C CA   . GLY C 1 28  ? -23.352 -16.330 184.387 1.00 0.00 ?  28  GLY C CA   1  
ATOM 9819   C C    . GLY C 1 28  ? -23.162 -14.833 184.701 1.00 0.00 ?  28  GLY C C    1  
ATOM 9820   O O    . GLY C 1 28  ? -24.186 -14.153 184.799 1.00 0.00 ?  28  GLY C O    1  
ATOM 9821   H H    . GLY C 1 28  ? -22.188 -17.756 183.344 1.00 0.00 ?  28  GLY C H    1  
ATOM 9822   H HA2  . GLY C 1 28  ? -24.400 -16.480 184.199 1.00 0.00 ?  28  GLY C HA2  1  
ATOM 9823   H HA3  . GLY C 1 28  ? -22.993 -16.899 185.237 1.00 0.00 ?  28  GLY C HA3  1  
ATOM 9824   N N    . ARG C 1 29  ? -21.925 -14.256 184.868 1.00 0.00 ?  29  ARG C N    1  
ATOM 9825   C CA   . ARG C 1 29  ? -21.831 -12.798 185.126 1.00 0.00 ?  29  ARG C CA   1  
ATOM 9826   C C    . ARG C 1 29  ? -21.325 -12.193 183.853 1.00 0.00 ?  29  ARG C C    1  
ATOM 9827   O O    . ARG C 1 29  ? -21.116 -10.982 183.775 1.00 0.00 ?  29  ARG C O    1  
ATOM 9828   C CB   . ARG C 1 29  ? -20.894 -12.310 186.325 1.00 0.00 ?  29  ARG C CB   1  
ATOM 9829   C CG   . ARG C 1 29  ? -21.663 -11.834 187.627 1.00 0.00 ?  29  ARG C CG   1  
ATOM 9830   C CD   . ARG C 1 29  ? -21.031 -10.597 188.410 1.00 0.00 ?  29  ARG C CD   1  
ATOM 9831   N NE   . ARG C 1 29  ? -19.578 -10.855 188.594 1.00 0.00 ?  29  ARG C NE   1  
ATOM 9832   C CZ   . ARG C 1 29  ? -18.707 -9.816  188.763 1.00 0.00 ?  29  ARG C CZ   1  
ATOM 9833   N NH1  . ARG C 1 29  ? -19.156 -8.522  188.768 1.00 0.00 1  29  ARG C NH1  1  
ATOM 9834   N NH2  . ARG C 1 29  ? -17.379 -10.075 188.922 1.00 0.00 ?  29  ARG C NH2  1  
ATOM 9835   H H    . ARG C 1 29  ? -21.072 -14.769 184.825 1.00 0.00 ?  29  ARG C H    1  
ATOM 9836   H HA   . ARG C 1 29  ? -22.833 -12.432 185.286 1.00 0.00 ?  29  ARG C HA   1  
ATOM 9837   H HB2  . ARG C 1 29  ? -20.215 -13.145 186.602 1.00 0.00 ?  29  ARG C HB2  1  
ATOM 9838   H HB3  . ARG C 1 29  ? -20.261 -11.472 185.963 1.00 0.00 ?  29  ARG C HB3  1  
ATOM 9839   H HG2  . ARG C 1 29  ? -22.700 -11.565 187.339 1.00 0.00 ?  29  ARG C HG2  1  
ATOM 9840   H HG3  . ARG C 1 29  ? -21.729 -12.697 188.325 1.00 0.00 ?  29  ARG C HG3  1  
ATOM 9841   H HD2  . ARG C 1 29  ? -21.155 -9.660  187.827 1.00 0.00 ?  29  ARG C HD2  1  
ATOM 9842   H HD3  . ARG C 1 29  ? -21.495 -10.481 189.413 1.00 0.00 ?  29  ARG C HD3  1  
ATOM 9843   H HE   . ARG C 1 29  ? -19.236 -11.794 188.590 1.00 0.00 ?  29  ARG C HE   1  
ATOM 9844   H HH11 . ARG C 1 29  ? -20.132 -8.327  188.644 1.00 0.00 ?  29  ARG C HH11 1  
ATOM 9845   H HH12 . ARG C 1 29  ? -18.509 -7.770  188.896 1.00 0.00 ?  29  ARG C HH12 1  
ATOM 9846   H HH21 . ARG C 1 29  ? -17.047 -11.020 188.914 1.00 0.00 ?  29  ARG C HH21 1  
ATOM 9847   H HH22 . ARG C 1 29  ? -16.734 -9.320  189.046 1.00 0.00 ?  29  ARG C HH22 1  
ATOM 9848   N N    . ARG C 1 30  ? -21.122 -13.047 182.809 1.00 0.00 ?  30  ARG C N    1  
ATOM 9849   C CA   . ARG C 1 30  ? -20.616 -12.564 181.543 1.00 0.00 ?  30  ARG C CA   1  
ATOM 9850   C C    . ARG C 1 30  ? -21.428 -13.160 180.435 1.00 0.00 ?  30  ARG C C    1  
ATOM 9851   O O    . ARG C 1 30  ? -20.920 -13.964 179.654 1.00 0.00 ?  30  ARG C O    1  
ATOM 9852   C CB   . ARG C 1 30  ? -19.153 -12.965 181.291 1.00 0.00 ?  30  ARG C CB   1  
ATOM 9853   C CG   . ARG C 1 30  ? -18.196 -12.452 182.369 1.00 0.00 ?  30  ARG C CG   1  
ATOM 9854   C CD   . ARG C 1 30  ? -18.075 -10.927 182.382 1.00 0.00 ?  30  ARG C CD   1  
ATOM 9855   N NE   . ARG C 1 30  ? -17.039 -10.555 183.388 1.00 0.00 ?  30  ARG C NE   1  
ATOM 9856   C CZ   . ARG C 1 30  ? -15.713 -10.602 183.057 1.00 0.00 ?  30  ARG C CZ   1  
ATOM 9857   N NH1  . ARG C 1 30  ? -15.331 -10.998 181.807 1.00 0.00 1  30  ARG C NH1  1  
ATOM 9858   N NH2  . ARG C 1 30  ? -14.766 -10.258 183.979 1.00 0.00 ?  30  ARG C NH2  1  
ATOM 9859   H H    . ARG C 1 30  ? -21.309 -14.024 182.870 1.00 0.00 ?  30  ARG C H    1  
ATOM 9860   H HA   . ARG C 1 30  ? -20.720 -11.492 181.520 1.00 0.00 ?  30  ARG C HA   1  
ATOM 9861   H HB2  . ARG C 1 30  ? -19.086 -14.074 181.245 1.00 0.00 ?  30  ARG C HB2  1  
ATOM 9862   H HB3  . ARG C 1 30  ? -18.833 -12.562 180.307 1.00 0.00 ?  30  ARG C HB3  1  
ATOM 9863   H HG2  . ARG C 1 30  ? -18.557 -12.793 183.363 1.00 0.00 ?  30  ARG C HG2  1  
ATOM 9864   H HG3  . ARG C 1 30  ? -17.191 -12.895 182.200 1.00 0.00 ?  30  ARG C HG3  1  
ATOM 9865   H HD2  . ARG C 1 30  ? -17.762 -10.542 181.387 1.00 0.00 ?  30  ARG C HD2  1  
ATOM 9866   H HD3  . ARG C 1 30  ? -19.033 -10.455 182.684 1.00 0.00 ?  30  ARG C HD3  1  
ATOM 9867   H HE   . ARG C 1 30  ? -17.315 -10.271 184.306 1.00 0.00 ?  30  ARG C HE   1  
ATOM 9868   H HH11 . ARG C 1 30  ? -16.022 -11.255 181.132 1.00 0.00 ?  30  ARG C HH11 1  
ATOM 9869   H HH12 . ARG C 1 30  ? -14.361 -11.032 181.568 1.00 0.00 ?  30  ARG C HH12 1  
ATOM 9870   H HH21 . ARG C 1 30  ? -15.042 -9.972  184.897 1.00 0.00 ?  30  ARG C HH21 1  
ATOM 9871   H HH22 . ARG C 1 30  ? -13.797 -10.294 183.737 1.00 0.00 ?  30  ARG C HH22 1  
ATOM 9872   N N    . ILE C 1 31  ? -22.716 -12.770 180.342 1.00 0.00 ?  31  ILE C N    1  
ATOM 9873   C CA   . ILE C 1 31  ? -23.564 -13.270 179.290 1.00 0.00 ?  31  ILE C CA   1  
ATOM 9874   C C    . ILE C 1 31  ? -23.477 -12.268 178.195 1.00 0.00 ?  31  ILE C C    1  
ATOM 9875   O O    . ILE C 1 31  ? -22.959 -11.170 178.403 1.00 0.00 ?  31  ILE C O    1  
ATOM 9876   C CB   . ILE C 1 31  ? -25.024 -13.421 179.668 1.00 0.00 ?  31  ILE C CB   1  
ATOM 9877   C CG1  . ILE C 1 31  ? -25.400 -12.531 180.875 1.00 0.00 ?  31  ILE C CG1  1  
ATOM 9878   C CG2  . ILE C 1 31  ? -25.311 -14.909 179.946 1.00 0.00 ?  31  ILE C CG2  1  
ATOM 9879   C CD1  . ILE C 1 31  ? -25.295 -11.037 180.568 1.00 0.00 ?  31  ILE C CD1  1  
ATOM 9880   H H    . ILE C 1 31  ? -23.133 -12.137 180.989 1.00 0.00 ?  31  ILE C H    1  
ATOM 9881   H HA   . ILE C 1 31  ? -23.155 -14.206 178.943 1.00 0.00 ?  31  ILE C HA   1  
ATOM 9882   H HB   . ILE C 1 31  ? -25.650 -13.109 178.803 1.00 0.00 ?  31  ILE C HB   1  
ATOM 9883   H HG12 . ILE C 1 31  ? -26.446 -12.761 181.173 1.00 0.00 ?  31  ILE C HG12 1  
ATOM 9884   H HG13 . ILE C 1 31  ? -24.744 -12.773 181.737 1.00 0.00 ?  31  ILE C HG13 1  
ATOM 9885   H HG21 . ILE C 1 31  ? -24.373 -15.502 179.928 1.00 0.00 ?  31  ILE C HG21 1  
ATOM 9886   H HG22 . ILE C 1 31  ? -26.001 -15.317 179.179 1.00 0.00 ?  31  ILE C HG22 1  
ATOM 9887   H HG23 . ILE C 1 31  ? -25.784 -15.028 180.945 1.00 0.00 ?  31  ILE C HG23 1  
ATOM 9888   H HD11 . ILE C 1 31  ? -24.232 -10.716 180.569 1.00 0.00 ?  31  ILE C HD11 1  
ATOM 9889   H HD12 . ILE C 1 31  ? -25.846 -10.447 181.332 1.00 0.00 ?  31  ILE C HD12 1  
ATOM 9890   H HD13 . ILE C 1 31  ? -25.730 -10.821 179.570 1.00 0.00 ?  31  ILE C HD13 1  
ATOM 9891   N N    . TRP C 1 32  ? -23.951 -12.635 176.982 1.00 0.00 ?  32  TRP C N    1  
ATOM 9892   C CA   . TRP C 1 32  ? -23.905 -11.705 175.893 1.00 0.00 ?  32  TRP C CA   1  
ATOM 9893   C C    . TRP C 1 32  ? -24.824 -10.597 176.274 1.00 0.00 ?  32  TRP C C    1  
ATOM 9894   O O    . TRP C 1 32  ? -25.997 -10.819 176.574 1.00 0.00 ?  32  TRP C O    1  
ATOM 9895   C CB   . TRP C 1 32  ? -24.382 -12.298 174.554 1.00 0.00 ?  32  TRP C CB   1  
ATOM 9896   C CG   . TRP C 1 32  ? -24.285 -11.324 173.402 1.00 0.00 ?  32  TRP C CG   1  
ATOM 9897   C CD1  . TRP C 1 32  ? -23.219 -11.089 172.581 1.00 0.00 ?  32  TRP C CD1  1  
ATOM 9898   C CD2  . TRP C 1 32  ? -25.340 -10.451 172.944 1.00 0.00 ?  32  TRP C CD2  1  
ATOM 9899   N NE1  . TRP C 1 32  ? -23.536 -10.132 171.657 1.00 0.00 ?  32  TRP C NE1  1  
ATOM 9900   C CE2  . TRP C 1 32  ? -24.832 -9.731  171.864 1.00 0.00 ?  32  TRP C CE2  1  
ATOM 9901   C CE3  . TRP C 1 32  ? -26.623 -10.246 173.366 1.00 0.00 ?  32  TRP C CE3  1  
ATOM 9902   C CZ2  . TRP C 1 32  ? -25.587 -8.810  171.201 1.00 0.00 ?  32  TRP C CZ2  1  
ATOM 9903   C CZ3  . TRP C 1 32  ? -27.392 -9.316  172.697 1.00 0.00 ?  32  TRP C CZ3  1  
ATOM 9904   C CH2  . TRP C 1 32  ? -26.881 -8.606  171.628 1.00 0.00 ?  32  TRP C CH2  1  
ATOM 9905   H H    . TRP C 1 32  ? -24.339 -13.535 176.797 1.00 0.00 ?  32  TRP C H    1  
ATOM 9906   H HA   . TRP C 1 32  ? -22.897 -11.330 175.813 1.00 0.00 ?  32  TRP C HA   1  
ATOM 9907   H HB2  . TRP C 1 32  ? -23.768 -13.192 174.313 1.00 0.00 ?  32  TRP C HB2  1  
ATOM 9908   H HB3  . TRP C 1 32  ? -25.439 -12.621 174.654 1.00 0.00 ?  32  TRP C HB3  1  
ATOM 9909   H HD1  . TRP C 1 32  ? -22.262 -11.584 172.655 1.00 0.00 ?  32  TRP C HD1  1  
ATOM 9910   H HE1  . TRP C 1 32  ? -22.939 -9.792  170.964 1.00 0.00 ?  32  TRP C HE1  1  
ATOM 9911   H HE3  . TRP C 1 32  ? -27.043 -10.790 174.199 1.00 0.00 ?  32  TRP C HE3  1  
ATOM 9912   H HZ2  . TRP C 1 32  ? -25.201 -8.249  170.364 1.00 0.00 ?  32  TRP C HZ2  1  
ATOM 9913   H HZ3  . TRP C 1 32  ? -28.410 -9.139  173.015 1.00 0.00 ?  32  TRP C HZ3  1  
ATOM 9914   H HH2  . TRP C 1 32  ? -27.502 -7.883  171.120 1.00 0.00 ?  32  TRP C HH2  1  
ATOM 9915   N N    . SER C 1 33  ? -24.299 -9.362  176.267 1.00 0.00 ?  33  SER C N    1  
ATOM 9916   C CA   . SER C 1 33  ? -25.104 -8.249  176.652 1.00 0.00 ?  33  SER C CA   1  
ATOM 9917   C C    . SER C 1 33  ? -24.511 -7.044  176.023 1.00 0.00 ?  33  SER C C    1  
ATOM 9918   O O    . SER C 1 33  ? -23.370 -7.071  175.569 1.00 0.00 ?  33  SER C O    1  
ATOM 9919   C CB   . SER C 1 33  ? -25.117 -8.010  178.172 1.00 0.00 ?  33  SER C CB   1  
ATOM 9920   O OG   . SER C 1 33  ? -23.826 -7.596  178.619 1.00 0.00 ?  33  SER C OG   1  
ATOM 9921   H H    . SER C 1 33  ? -23.357 -9.172  176.004 1.00 0.00 ?  33  SER C H    1  
ATOM 9922   H HA   . SER C 1 33  ? -26.103 -8.405  176.278 1.00 0.00 ?  33  SER C HA   1  
ATOM 9923   H HB2  . SER C 1 33  ? -25.855 -7.220  178.427 1.00 0.00 ?  33  SER C HB2  1  
ATOM 9924   H HB3  . SER C 1 33  ? -25.394 -8.946  178.700 1.00 0.00 ?  33  SER C HB3  1  
ATOM 9925   H HG   . SER C 1 33  ? -23.185 -8.060  178.071 1.00 0.00 ?  33  SER C HG   1  
ATOM 9926   N N    . GLY C 1 34  ? -25.308 -5.960  175.955 1.00 0.00 ?  34  GLY C N    1  
ATOM 9927   C CA   . GLY C 1 34  ? -24.827 -4.732  175.401 1.00 0.00 ?  34  GLY C CA   1  
ATOM 9928   C C    . GLY C 1 34  ? -24.474 -3.856  176.555 1.00 0.00 ?  34  GLY C C    1  
ATOM 9929   O O    . GLY C 1 34  ? -24.015 -2.729  176.373 1.00 0.00 ?  34  GLY C O    1  
ATOM 9930   H H    . GLY C 1 34  ? -26.251 -5.964  176.282 1.00 0.00 ?  34  GLY C H    1  
ATOM 9931   H HA2  . GLY C 1 34  ? -23.943 -4.938  174.819 1.00 0.00 ?  34  GLY C HA2  1  
ATOM 9932   H HA3  . GLY C 1 34  ? -25.638 -4.279  174.849 1.00 0.00 ?  34  GLY C HA3  1  
ATOM 9933   N N    . THR C 1 35  ? -24.680 -4.372  177.788 1.00 0.00 ?  35  THR C N    1  
ATOM 9934   C CA   . THR C 1 35  ? -24.390 -3.594  178.961 1.00 0.00 ?  35  THR C CA   1  
ATOM 9935   C C    . THR C 1 35  ? -22.998 -3.909  179.390 1.00 0.00 ?  35  THR C C    1  
ATOM 9936   O O    . THR C 1 35  ? -22.465 -4.971  179.078 1.00 0.00 ?  35  THR C O    1  
ATOM 9937   C CB   . THR C 1 35  ? -25.296 -3.918  180.112 1.00 0.00 ?  35  THR C CB   1  
ATOM 9938   O OG1  . THR C 1 35  ? -25.089 -5.262  180.527 1.00 0.00 ?  35  THR C OG1  1  
ATOM 9939   C CG2  . THR C 1 35  ? -26.749 -3.722  179.660 1.00 0.00 ?  35  THR C CG2  1  
ATOM 9940   H H    . THR C 1 35  ? -25.032 -5.293  177.936 1.00 0.00 ?  35  THR C H    1  
ATOM 9941   H HA   . THR C 1 35  ? -24.462 -2.549  178.702 1.00 0.00 ?  35  THR C HA   1  
ATOM 9942   H HB   . THR C 1 35  ? -25.093 -3.239  180.965 1.00 0.00 ?  35  THR C HB   1  
ATOM 9943   H HG1  . THR C 1 35  ? -24.196 -5.295  180.882 1.00 0.00 ?  35  THR C HG1  1  
ATOM 9944   H HG21 . THR C 1 35  ? -27.212 -4.703  179.417 1.00 0.00 ?  35  THR C HG21 1  
ATOM 9945   H HG22 . THR C 1 35  ? -26.789 -3.078  178.756 1.00 0.00 ?  35  THR C HG22 1  
ATOM 9946   H HG23 . THR C 1 35  ? -27.343 -3.242  180.466 1.00 0.00 ?  35  THR C HG23 1  
ATOM 9947   N N    . ARG C 1 36  ? -22.384 -2.975  180.148 1.00 0.00 ?  36  ARG C N    1  
ATOM 9948   C CA   . ARG C 1 36  ? -21.050 -3.190  180.629 1.00 0.00 ?  36  ARG C CA   1  
ATOM 9949   C C    . ARG C 1 36  ? -21.215 -3.790  181.980 1.00 0.00 ?  36  ARG C C    1  
ATOM 9950   O O    . ARG C 1 36  ? -20.472 -4.679  182.393 1.00 0.00 ?  36  ARG C O    1  
ATOM 9951   C CB   . ARG C 1 36  ? -20.260 -1.886  180.802 1.00 0.00 ?  36  ARG C CB   1  
ATOM 9952   C CG   . ARG C 1 36  ? -20.177 -1.086  179.511 1.00 0.00 ?  36  ARG C CG   1  
ATOM 9953   C CD   . ARG C 1 36  ? -19.484 0.265   179.702 1.00 0.00 ?  36  ARG C CD   1  
ATOM 9954   N NE   . ARG C 1 36  ? -20.247 1.053   180.719 1.00 0.00 ?  36  ARG C NE   1  
ATOM 9955   C CZ   . ARG C 1 36  ? -21.400 1.700   180.370 1.00 0.00 ?  36  ARG C CZ   1  
ATOM 9956   N NH1  . ARG C 1 36  ? -21.941 1.522   179.132 1.00 0.00 1  36  ARG C NH1  1  
ATOM 9957   N NH2  . ARG C 1 36  ? -22.030 2.504   181.271 1.00 0.00 ?  36  ARG C NH2  1  
ATOM 9958   H H    . ARG C 1 36  ? -22.819 -2.114  180.401 1.00 0.00 ?  36  ARG C H    1  
ATOM 9959   H HA   . ARG C 1 36  ? -20.541 -3.877  179.972 1.00 0.00 ?  36  ARG C HA   1  
ATOM 9960   H HB2  . ARG C 1 36  ? -20.744 -1.268  181.588 1.00 0.00 ?  36  ARG C HB2  1  
ATOM 9961   H HB3  . ARG C 1 36  ? -19.232 -2.126  181.136 1.00 0.00 ?  36  ARG C HB3  1  
ATOM 9962   H HG2  . ARG C 1 36  ? -19.619 -1.676  178.753 1.00 0.00 ?  36  ARG C HG2  1  
ATOM 9963   H HG3  . ARG C 1 36  ? -21.205 -0.916  179.124 1.00 0.00 ?  36  ARG C HG3  1  
ATOM 9964   H HD2  . ARG C 1 36  ? -18.445 0.130   180.072 1.00 0.00 ?  36  ARG C HD2  1  
ATOM 9965   H HD3  . ARG C 1 36  ? -19.475 0.845   178.755 1.00 0.00 ?  36  ARG C HD3  1  
ATOM 9966   H HE   . ARG C 1 36  ? -19.886 1.143   181.652 1.00 0.00 ?  36  ARG C HE   1  
ATOM 9967   H HH11 . ARG C 1 36  ? -21.494 0.916   178.473 1.00 0.00 ?  36  ARG C HH11 1  
ATOM 9968   H HH12 . ARG C 1 36  ? -22.789 1.990   178.886 1.00 0.00 ?  36  ARG C HH12 1  
ATOM 9969   H HH21 . ARG C 1 36  ? -21.649 2.622   182.189 1.00 0.00 ?  36  ARG C HH21 1  
ATOM 9970   H HH22 . ARG C 1 36  ? -22.873 2.977   181.016 1.00 0.00 ?  36  ARG C HH22 1  
ATOM 9971   N N    . GLU C 1 37  ? -22.231 -3.285  182.698 1.00 0.00 ?  37  GLU C N    1  
ATOM 9972   C CA   . GLU C 1 37  ? -22.533 -3.764  184.006 1.00 0.00 ?  37  GLU C CA   1  
ATOM 9973   C C    . GLU C 1 37  ? -23.994 -3.505  184.149 1.00 0.00 ?  37  GLU C C    1  
ATOM 9974   O O    . GLU C 1 37  ? -24.546 -2.641  183.466 1.00 0.00 ?  37  GLU C O    1  
ATOM 9975   C CB   . GLU C 1 37  ? -21.759 -3.058  185.147 1.00 0.00 ?  37  GLU C CB   1  
ATOM 9976   C CG   . GLU C 1 37  ? -21.859 -3.781  186.505 1.00 0.00 ?  37  GLU C CG   1  
ATOM 9977   C CD   . GLU C 1 37  ? -21.174 -5.147  186.407 1.00 0.00 ?  37  GLU C CD   1  
ATOM 9978   O OE1  . GLU C 1 37  ? -21.529 -6.048  187.219 1.00 0.00 ?  37  GLU C OE1  1  
ATOM 9979   O OE2  . GLU C 1 37  ? -20.274 -5.305  185.541 1.00 0.00 -1 37  GLU C OE2  1  
ATOM 9980   H H    . GLU C 1 37  ? -22.818 -2.557  182.350 1.00 0.00 ?  37  GLU C H    1  
ATOM 9981   H HA   . GLU C 1 37  ? -22.356 -4.830  184.018 1.00 0.00 ?  37  GLU C HA   1  
ATOM 9982   H HB2  . GLU C 1 37  ? -20.688 -2.979  184.859 1.00 0.00 ?  37  GLU C HB2  1  
ATOM 9983   H HB3  . GLU C 1 37  ? -22.154 -2.029  185.268 1.00 0.00 ?  37  GLU C HB3  1  
ATOM 9984   H HG2  . GLU C 1 37  ? -21.358 -3.175  187.292 1.00 0.00 ?  37  GLU C HG2  1  
ATOM 9985   H HG3  . GLU C 1 37  ? -22.921 -3.926  186.788 1.00 0.00 ?  37  GLU C HG3  1  
ATOM 9986   N N    . VAL C 1 38  ? -24.655 -4.266  185.027 1.00 0.00 ?  38  VAL C N    1  
ATOM 9987   C CA   . VAL C 1 38  ? -26.070 -4.134  185.203 1.00 0.00 ?  38  VAL C CA   1  
ATOM 9988   C C    . VAL C 1 38  ? -26.396 -2.762  185.725 1.00 0.00 ?  38  VAL C C    1  
ATOM 9989   O O    . VAL C 1 38  ? -27.493 -2.254  185.495 1.00 0.00 ?  38  VAL C O    1  
ATOM 9990   C CB   . VAL C 1 38  ? -26.606 -5.163  186.151 1.00 0.00 ?  38  VAL C CB   1  
ATOM 9991   C CG1  . VAL C 1 38  ? -26.230 -6.537  185.581 1.00 0.00 ?  38  VAL C CG1  1  
ATOM 9992   C CG2  . VAL C 1 38  ? -26.008 -4.937  187.552 1.00 0.00 ?  38  VAL C CG2  1  
ATOM 9993   H H    . VAL C 1 38  ? -24.200 -4.950  185.594 1.00 0.00 ?  38  VAL C H    1  
ATOM 9994   H HA   . VAL C 1 38  ? -26.525 -4.254  184.232 1.00 0.00 ?  38  VAL C HA   1  
ATOM 9995   H HB   . VAL C 1 38  ? -27.712 -5.087  186.212 1.00 0.00 ?  38  VAL C HB   1  
ATOM 9996   H HG11 . VAL C 1 38  ? -26.681 -7.333  186.192 1.00 0.00 ?  38  VAL C HG11 1  
ATOM 9997   H HG12 . VAL C 1 38  ? -25.126 -6.670  185.590 1.00 0.00 ?  38  VAL C HG12 1  
ATOM 9998   H HG13 . VAL C 1 38  ? -26.590 -6.636  184.537 1.00 0.00 ?  38  VAL C HG13 1  
ATOM 9999   H HG21 . VAL C 1 38  ? -26.490 -4.063  188.039 1.00 0.00 ?  38  VAL C HG21 1  
ATOM 10000  H HG22 . VAL C 1 38  ? -24.917 -4.749  187.484 1.00 0.00 ?  38  VAL C HG22 1  
ATOM 10001  H HG23 . VAL C 1 38  ? -26.174 -5.831  188.190 1.00 0.00 ?  38  VAL C HG23 1  
ATOM 10002  N N    . ILE C 1 39  ? -25.453 -2.128  186.441 1.00 0.00 ?  39  ILE C N    1  
ATOM 10003  C CA   . ILE C 1 39  ? -25.699 -0.819  186.969 1.00 0.00 ?  39  ILE C CA   1  
ATOM 10004  C C    . ILE C 1 39  ? -25.367 0.179   185.894 1.00 0.00 ?  39  ILE C C    1  
ATOM 10005  O O    . ILE C 1 39  ? -25.959 1.257   185.821 1.00 0.00 ?  39  ILE C O    1  
ATOM 10006  C CB   . ILE C 1 39  ? -24.860 -0.503  188.172 1.00 0.00 ?  39  ILE C CB   1  
ATOM 10007  C CG1  . ILE C 1 39  ? -24.975 -1.621  189.234 1.00 0.00 ?  39  ILE C CG1  1  
ATOM 10008  C CG2  . ILE C 1 39  ? -25.320 0.858   188.720 1.00 0.00 ?  39  ILE C CG2  1  
ATOM 10009  C CD1  . ILE C 1 39  ? -26.402 -1.828  189.762 1.00 0.00 ?  39  ILE C CD1  1  
ATOM 10010  H H    . ILE C 1 39  ? -24.560 -2.529  186.634 1.00 0.00 ?  39  ILE C H    1  
ATOM 10011  H HA   . ILE C 1 39  ? -26.749 -0.751  187.210 1.00 0.00 ?  39  ILE C HA   1  
ATOM 10012  H HB   . ILE C 1 39  ? -23.794 -0.417  187.866 1.00 0.00 ?  39  ILE C HB   1  
ATOM 10013  H HG12 . ILE C 1 39  ? -24.615 -2.574  188.791 1.00 0.00 ?  39  ILE C HG12 1  
ATOM 10014  H HG13 . ILE C 1 39  ? -24.313 -1.371  190.087 1.00 0.00 ?  39  ILE C HG13 1  
ATOM 10015  H HG21 . ILE C 1 39  ? -25.021 1.675   188.030 1.00 0.00 ?  39  ILE C HG21 1  
ATOM 10016  H HG22 . ILE C 1 39  ? -24.860 1.048   189.712 1.00 0.00 ?  39  ILE C HG22 1  
ATOM 10017  H HG23 . ILE C 1 39  ? -26.426 0.875   188.832 1.00 0.00 ?  39  ILE C HG23 1  
ATOM 10018  H HD11 . ILE C 1 39  ? -27.049 -2.285  188.984 1.00 0.00 ?  39  ILE C HD11 1  
ATOM 10019  H HD12 . ILE C 1 39  ? -26.848 -0.860  190.069 1.00 0.00 ?  39  ILE C HD12 1  
ATOM 10020  H HD13 . ILE C 1 39  ? -26.387 -2.502  190.645 1.00 0.00 ?  39  ILE C HD13 1  
ATOM 10021  N N    . ALA C 1 40  ? -24.403 -0.181  185.019 1.00 0.00 ?  40  ALA C N    1  
ATOM 10022  C CA   . ALA C 1 40  ? -23.945 0.708   183.970 1.00 0.00 ?  40  ALA C CA   1  
ATOM 10023  C C    . ALA C 1 40  ? -25.026 0.959   182.956 1.00 0.00 ?  40  ALA C C    1  
ATOM 10024  O O    . ALA C 1 40  ? -24.891 1.859   182.126 1.00 0.00 ?  40  ALA C O    1  
ATOM 10025  C CB   . ALA C 1 40  ? -22.729 0.164   183.205 1.00 0.00 ?  40  ALA C CB   1  
ATOM 10026  H H    . ALA C 1 40  ? -23.963 -1.076  185.057 1.00 0.00 ?  40  ALA C H    1  
ATOM 10027  H HA   . ALA C 1 40  ? -23.688 1.644   184.438 1.00 0.00 ?  40  ALA C HA   1  
ATOM 10028  H HB1  . ALA C 1 40  ? -22.405 -0.805  183.632 1.00 0.00 ?  40  ALA C HB1  1  
ATOM 10029  H HB2  . ALA C 1 40  ? -21.882 0.880   183.268 1.00 0.00 ?  40  ALA C HB2  1  
ATOM 10030  H HB3  . ALA C 1 40  ? -22.985 0.010   182.135 1.00 0.00 ?  40  ALA C HB3  1  
ATOM 10031  N N    . TYR C 1 41  ? -26.105 0.153   182.979 1.00 0.00 ?  41  TYR C N    1  
ATOM 10032  C CA   . TYR C 1 41  ? -27.182 0.297   182.026 1.00 0.00 ?  41  TYR C CA   1  
ATOM 10033  C C    . TYR C 1 41  ? -27.776 1.680   182.094 1.00 0.00 ?  41  TYR C C    1  
ATOM 10034  O O    . TYR C 1 41  ? -28.291 2.171   181.095 1.00 0.00 ?  41  TYR C O    1  
ATOM 10035  C CB   . TYR C 1 41  ? -28.327 -0.701  182.247 1.00 0.00 ?  41  TYR C CB   1  
ATOM 10036  C CG   . TYR C 1 41  ? -29.417 -0.576  181.238 1.00 0.00 ?  41  TYR C CG   1  
ATOM 10037  C CD1  . TYR C 1 41  ? -30.622 -0.001  181.578 1.00 0.00 ?  41  TYR C CD1  1  
ATOM 10038  C CD2  . TYR C 1 41  ? -29.230 -1.025  179.950 1.00 0.00 ?  41  TYR C CD2  1  
ATOM 10039  C CE1  . TYR C 1 41  ? -31.626 0.117   180.644 1.00 0.00 ?  41  TYR C CE1  1  
ATOM 10040  C CE2  . TYR C 1 41  ? -30.233 -0.905  179.017 1.00 0.00 ?  41  TYR C CE2  1  
ATOM 10041  C CZ   . TYR C 1 41  ? -31.430 -0.335  179.364 1.00 0.00 ?  41  TYR C CZ   1  
ATOM 10042  O OH   . TYR C 1 41  ? -32.460 -0.216  178.408 1.00 0.00 ?  41  TYR C OH   1  
ATOM 10043  H H    . TYR C 1 41  ? -26.206 -0.577  183.651 1.00 0.00 ?  41  TYR C H    1  
ATOM 10044  H HA   . TYR C 1 41  ? -26.759 0.152   181.045 1.00 0.00 ?  41  TYR C HA   1  
ATOM 10045  H HB2  . TYR C 1 41  ? -27.941 -1.741  182.188 1.00 0.00 ?  41  TYR C HB2  1  
ATOM 10046  H HB3  . TYR C 1 41  ? -28.780 -0.543  183.250 1.00 0.00 ?  41  TYR C HB3  1  
ATOM 10047  H HD1  . TYR C 1 41  ? -30.782 0.355   182.585 1.00 0.00 ?  41  TYR C HD1  1  
ATOM 10048  H HD2  . TYR C 1 41  ? -28.289 -1.473  179.670 1.00 0.00 ?  41  TYR C HD2  1  
ATOM 10049  H HE1  . TYR C 1 41  ? -32.567 0.569   180.919 1.00 0.00 ?  41  TYR C HE1  1  
ATOM 10050  H HE2  . TYR C 1 41  ? -30.078 -1.262  178.009 1.00 0.00 ?  41  TYR C HE2  1  
ATOM 10051  H HH   . TYR C 1 41  ? -33.015 -0.997  178.471 1.00 0.00 ?  41  TYR C HH   1  
ATOM 10052  N N    . GLY C 1 42  ? -27.709 2.334   183.271 1.00 0.00 ?  42  GLY C N    1  
ATOM 10053  C CA   . GLY C 1 42  ? -28.316 3.633   183.456 1.00 0.00 ?  42  GLY C CA   1  
ATOM 10054  C C    . GLY C 1 42  ? -27.766 4.671   182.499 1.00 0.00 ?  42  GLY C C    1  
ATOM 10055  O O    . GLY C 1 42  ? -28.522 5.519   182.027 1.00 0.00 ?  42  GLY C O    1  
ATOM 10056  H H    . GLY C 1 42  ? -27.241 1.952   184.064 1.00 0.00 ?  42  GLY C H    1  
ATOM 10057  H HA2  . GLY C 1 42  ? -29.371 3.519   183.263 1.00 0.00 ?  42  GLY C HA2  1  
ATOM 10058  H HA3  . GLY C 1 42  ? -28.089 3.941   184.468 1.00 0.00 ?  42  GLY C HA3  1  
ATOM 10059  N N    . MET C 1 43  ? -26.453 4.678   182.187 1.00 0.00 ?  43  MET C N    1  
ATOM 10060  C CA   . MET C 1 43  ? -25.962 5.720   181.308 1.00 0.00 ?  43  MET C CA   1  
ATOM 10061  C C    . MET C 1 43  ? -26.476 5.467   179.891 1.00 0.00 ?  43  MET C C    1  
ATOM 10062  O O    . MET C 1 43  ? -26.199 4.416   179.314 1.00 0.00 ?  43  MET C O    1  
ATOM 10063  C CB   . MET C 1 43  ? -24.428 5.801   181.240 1.00 0.00 ?  43  MET C CB   1  
ATOM 10064  C CG   . MET C 1 43  ? -23.950 6.920   180.307 1.00 0.00 ?  43  MET C CG   1  
ATOM 10065  S SD   . MET C 1 43  ? -22.160 7.197   180.385 1.00 0.00 ?  43  MET C SD   1  
ATOM 10066  C CE   . MET C 1 43  ? -22.236 8.164   181.918 1.00 0.00 ?  43  MET C CE   1  
ATOM 10067  H H    . MET C 1 43  ? -25.799 4.006   182.524 1.00 0.00 ?  43  MET C H    1  
ATOM 10068  H HA   . MET C 1 43  ? -26.347 6.637   181.704 1.00 0.00 ?  43  MET C HA   1  
ATOM 10069  H HB2  . MET C 1 43  ? -24.026 5.976   182.260 1.00 0.00 ?  43  MET C HB2  1  
ATOM 10070  H HB3  . MET C 1 43  ? -24.027 4.833   180.873 1.00 0.00 ?  43  MET C HB3  1  
ATOM 10071  H HG2  . MET C 1 43  ? -24.238 6.664   179.264 1.00 0.00 ?  43  MET C HG2  1  
ATOM 10072  H HG3  . MET C 1 43  ? -24.483 7.854   180.579 1.00 0.00 ?  43  MET C HG3  1  
ATOM 10073  H HE1  . MET C 1 43  ? -22.787 9.114   181.761 1.00 0.00 ?  43  MET C HE1  1  
ATOM 10074  H HE2  . MET C 1 43  ? -21.217 8.416   182.279 1.00 0.00 ?  43  MET C HE2  1  
ATOM 10075  H HE3  . MET C 1 43  ? -22.755 7.595   182.719 1.00 0.00 ?  43  MET C HE3  1  
ATOM 10076  N N    . PRO C 1 44  ? -27.229 6.412   179.306 1.00 0.00 ?  44  PRO C N    1  
ATOM 10077  C CA   . PRO C 1 44  ? -27.766 6.259   177.955 1.00 0.00 ?  44  PRO C CA   1  
ATOM 10078  C C    . PRO C 1 44  ? -26.859 6.711   176.835 1.00 0.00 ?  44  PRO C C    1  
ATOM 10079  O O    . PRO C 1 44  ? -26.987 6.253   175.701 1.00 0.00 ?  44  PRO C O    1  
ATOM 10080  C CB   . PRO C 1 44  ? -28.999 7.145   177.987 1.00 0.00 ?  44  PRO C CB   1  
ATOM 10081  C CG   . PRO C 1 44  ? -28.546 8.330   178.834 1.00 0.00 ?  44  PRO C CG   1  
ATOM 10082  C CD   . PRO C 1 44  ? -27.601 7.722   179.872 1.00 0.00 ?  44  PRO C CD   1  
ATOM 10083  H HA   . PRO C 1 44  ? -28.072 5.241   177.771 1.00 0.00 ?  44  PRO C HA   1  
ATOM 10084  H HB2  . PRO C 1 44  ? -29.280 7.471   176.962 1.00 0.00 ?  44  PRO C HB2  1  
ATOM 10085  H HB3  . PRO C 1 44  ? -29.852 6.622   178.468 1.00 0.00 ?  44  PRO C HB3  1  
ATOM 10086  H HG2  . PRO C 1 44  ? -28.013 9.074   178.204 1.00 0.00 ?  44  PRO C HG2  1  
ATOM 10087  H HG3  . PRO C 1 44  ? -29.407 8.816   179.330 1.00 0.00 ?  44  PRO C HG3  1  
ATOM 10088  H HD2  . PRO C 1 44  ? -26.706 8.367   180.007 1.00 0.00 ?  44  PRO C HD2  1  
ATOM 10089  H HD3  . PRO C 1 44  ? -28.120 7.605   180.847 1.00 0.00 ?  44  PRO C HD3  1  
ATOM 10090  N N    . ALA C 1 45  ? -25.919 7.631   177.139 1.00 0.00 ?  45  ALA C N    1  
ATOM 10091  C CA   . ALA C 1 45  ? -25.030 8.182   176.132 1.00 0.00 ?  45  ALA C CA   1  
ATOM 10092  C C    . ALA C 1 45  ? -23.999 7.166   175.768 1.00 0.00 ?  45  ALA C C    1  
ATOM 10093  O O    . ALA C 1 45  ? -23.276 7.310   174.783 1.00 0.00 ?  45  ALA C O    1  
ATOM 10094  C CB   . ALA C 1 45  ? -24.290 9.442   176.606 1.00 0.00 ?  45  ALA C CB   1  
ATOM 10095  H H    . ALA C 1 45  ? -25.793 7.973   178.067 1.00 0.00 ?  45  ALA C H    1  
ATOM 10096  H HA   . ALA C 1 45  ? -25.625 8.407   175.262 1.00 0.00 ?  45  ALA C HA   1  
ATOM 10097  H HB1  . ALA C 1 45  ? -25.009 10.275  176.766 1.00 0.00 ?  45  ALA C HB1  1  
ATOM 10098  H HB2  . ALA C 1 45  ? -23.544 9.760   175.847 1.00 0.00 ?  45  ALA C HB2  1  
ATOM 10099  H HB3  . ALA C 1 45  ? -23.761 9.242   177.562 1.00 0.00 ?  45  ALA C HB3  1  
ATOM 10100  N N    . SER C 1 46  ? -23.909 6.123   176.581 1.00 0.00 ?  46  SER C N    1  
ATOM 10101  C CA   . SER C 1 46  ? -22.923 5.108   176.410 1.00 0.00 ?  46  SER C CA   1  
ATOM 10102  C C    . SER C 1 46  ? -23.141 4.300   175.164 1.00 0.00 ?  46  SER C C    1  
ATOM 10103  O O    . SER C 1 46  ? -22.270 3.517   174.845 1.00 0.00 ?  46  SER C O    1  
ATOM 10104  C CB   . SER C 1 46  ? -22.878 4.128   177.582 1.00 0.00 ?  46  SER C CB   1  
ATOM 10105  O OG   . SER C 1 46  ? -24.086 3.387   177.649 1.00 0.00 ?  46  SER C OG   1  
ATOM 10106  H H    . SER C 1 46  ? -24.528 6.002   177.352 1.00 0.00 ?  46  SER C H    1  
ATOM 10107  H HA   . SER C 1 46  ? -21.972 5.607   176.329 1.00 0.00 ?  46  SER C HA   1  
ATOM 10108  H HB2  . SER C 1 46  ? -22.030 3.420   177.452 1.00 0.00 ?  46  SER C HB2  1  
ATOM 10109  H HB3  . SER C 1 46  ? -22.743 4.680   178.536 1.00 0.00 ?  46  SER C HB3  1  
ATOM 10110  H HG   . SER C 1 46  ? -23.958 2.619   177.083 1.00 0.00 ?  46  SER C HG   1  
ATOM 10111  N N    . VAL C 1 47  ? -24.312 4.415   174.483 1.00 0.00 ?  47  VAL C N    1  
ATOM 10112  C CA   . VAL C 1 47  ? -24.603 3.586   173.316 1.00 0.00 ?  47  VAL C CA   1  
ATOM 10113  C C    . VAL C 1 47  ? -23.424 3.485   172.347 1.00 0.00 ?  47  VAL C C    1  
ATOM 10114  O O    . VAL C 1 47  ? -23.169 2.404   171.811 1.00 0.00 ?  47  VAL C O    1  
ATOM 10115  C CB   . VAL C 1 47  ? -25.808 4.057   172.539 1.00 0.00 ?  47  VAL C CB   1  
ATOM 10116  C CG1  . VAL C 1 47  ? -27.047 3.875   173.432 1.00 0.00 ?  47  VAL C CG1  1  
ATOM 10117  C CG2  . VAL C 1 47  ? -25.612 5.526   172.110 1.00 0.00 ?  47  VAL C CG2  1  
ATOM 10118  H H    . VAL C 1 47  ? -25.020 5.065   174.748 1.00 0.00 ?  47  VAL C H    1  
ATOM 10119  H HA   . VAL C 1 47  ? -24.798 2.596   173.695 1.00 0.00 ?  47  VAL C HA   1  
ATOM 10120  H HB   . VAL C 1 47  ? -25.932 3.435   171.628 1.00 0.00 ?  47  VAL C HB   1  
ATOM 10121  H HG11 . VAL C 1 47  ? -27.660 4.802   173.434 1.00 0.00 ?  47  VAL C HG11 1  
ATOM 10122  H HG12 . VAL C 1 47  ? -26.741 3.650   174.476 1.00 0.00 ?  47  VAL C HG12 1  
ATOM 10123  H HG13 . VAL C 1 47  ? -27.673 3.038   173.057 1.00 0.00 ?  47  VAL C HG13 1  
ATOM 10124  H HG21 . VAL C 1 47  ? -25.294 6.148   172.973 1.00 0.00 ?  47  VAL C HG21 1  
ATOM 10125  H HG22 . VAL C 1 47  ? -26.561 5.939   171.710 1.00 0.00 ?  47  VAL C HG22 1  
ATOM 10126  H HG23 . VAL C 1 47  ? -24.837 5.596   171.318 1.00 0.00 ?  47  VAL C HG23 1  
ATOM 10127  N N    . TRP C 1 48  ? -22.672 4.576   172.096 1.00 0.00 ?  48  TRP C N    1  
ATOM 10128  C CA   . TRP C 1 48  ? -21.546 4.489   171.184 1.00 0.00 ?  48  TRP C CA   1  
ATOM 10129  C C    . TRP C 1 48  ? -20.481 3.588   171.761 1.00 0.00 ?  48  TRP C C    1  
ATOM 10130  O O    . TRP C 1 48  ? -19.949 2.701   171.090 1.00 0.00 ?  48  TRP C O    1  
ATOM 10131  C CB   . TRP C 1 48  ? -20.890 5.851   170.905 1.00 0.00 ?  48  TRP C CB   1  
ATOM 10132  C CG   . TRP C 1 48  ? -19.718 5.760   169.957 1.00 0.00 ?  48  TRP C CG   1  
ATOM 10133  C CD1  . TRP C 1 48  ? -18.386 5.855   170.245 1.00 0.00 ?  48  TRP C CD1  1  
ATOM 10134  C CD2  . TRP C 1 48  ? -19.803 5.545   168.532 1.00 0.00 ?  48  TRP C CD2  1  
ATOM 10135  N NE1  . TRP C 1 48  ? -17.645 5.718   169.104 1.00 0.00 ?  48  TRP C NE1  1  
ATOM 10136  C CE2  . TRP C 1 48  ? -18.496 5.526   168.045 1.00 0.00 ?  48  TRP C CE2  1  
ATOM 10137  C CE3  . TRP C 1 48  ? -20.858 5.374   167.682 1.00 0.00 ?  48  TRP C CE3  1  
ATOM 10138  C CZ2  . TRP C 1 48  ? -18.232 5.341   166.721 1.00 0.00 ?  48  TRP C CZ2  1  
ATOM 10139  C CZ3  . TRP C 1 48  ? -20.595 5.186   166.341 1.00 0.00 ?  48  TRP C CZ3  1  
ATOM 10140  C CH2  . TRP C 1 48  ? -19.298 5.168   165.866 1.00 0.00 ?  48  TRP C CH2  1  
ATOM 10141  H H    . TRP C 1 48  ? -22.850 5.465   172.511 1.00 0.00 ?  48  TRP C H    1  
ATOM 10142  H HA   . TRP C 1 48  ? -21.908 4.059   170.264 1.00 0.00 ?  48  TRP C HA   1  
ATOM 10143  H HB2  . TRP C 1 48  ? -21.646 6.539   170.469 1.00 0.00 ?  48  TRP C HB2  1  
ATOM 10144  H HB3  . TRP C 1 48  ? -20.535 6.287   171.863 1.00 0.00 ?  48  TRP C HB3  1  
ATOM 10145  H HD1  . TRP C 1 48  ? -17.978 6.019   171.231 1.00 0.00 ?  48  TRP C HD1  1  
ATOM 10146  H HE1  . TRP C 1 48  ? -16.670 5.750   169.051 1.00 0.00 ?  48  TRP C HE1  1  
ATOM 10147  H HE3  . TRP C 1 48  ? -21.879 5.385   168.034 1.00 0.00 ?  48  TRP C HE3  1  
ATOM 10148  H HZ2  . TRP C 1 48  ? -17.223 5.325   166.336 1.00 0.00 ?  48  TRP C HZ2  1  
ATOM 10149  H HZ3  . TRP C 1 48  ? -21.416 5.050   165.653 1.00 0.00 ?  48  TRP C HZ3  1  
ATOM 10150  H HH2  . TRP C 1 48  ? -19.118 5.019   164.812 1.00 0.00 ?  48  TRP C HH2  1  
ATOM 10151  N N    . ARG C 1 49  ? -20.167 3.806   173.046 1.00 0.00 ?  49  ARG C N    1  
ATOM 10152  C CA   . ARG C 1 49  ? -19.124 3.071   173.716 1.00 0.00 ?  49  ARG C CA   1  
ATOM 10153  C C    . ARG C 1 49  ? -19.538 1.649   173.951 1.00 0.00 ?  49  ARG C C    1  
ATOM 10154  O O    . ARG C 1 49  ? -18.695 0.807   174.266 1.00 0.00 ?  49  ARG C O    1  
ATOM 10155  C CB   . ARG C 1 49  ? -18.773 3.721   175.059 1.00 0.00 ?  49  ARG C CB   1  
ATOM 10156  C CG   . ARG C 1 49  ? -18.059 5.059   174.855 1.00 0.00 ?  49  ARG C CG   1  
ATOM 10157  C CD   . ARG C 1 49  ? -18.028 5.917   176.118 1.00 0.00 ?  49  ARG C CD   1  
ATOM 10158  N NE   . ARG C 1 49  ? -19.417 6.394   176.360 1.00 0.00 ?  49  ARG C NE   1  
ATOM 10159  C CZ   . ARG C 1 49  ? -19.698 7.193   177.425 1.00 0.00 ?  49  ARG C CZ   1  
ATOM 10160  N NH1  . ARG C 1 49  ? -18.716 7.526   178.312 1.00 0.00 1  49  ARG C NH1  1  
ATOM 10161  N NH2  . ARG C 1 49  ? -20.970 7.656   177.605 1.00 0.00 ?  49  ARG C NH2  1  
ATOM 10162  H H    . ARG C 1 49  ? -20.643 4.488   173.596 1.00 0.00 ?  49  ARG C H    1  
ATOM 10163  H HA   . ARG C 1 49  ? -18.261 3.080   173.071 1.00 0.00 ?  49  ARG C HA   1  
ATOM 10164  H HB2  . ARG C 1 49  ? -19.705 3.882   175.644 1.00 0.00 ?  49  ARG C HB2  1  
ATOM 10165  H HB3  . ARG C 1 49  ? -18.111 3.042   175.636 1.00 0.00 ?  49  ARG C HB3  1  
ATOM 10166  H HG2  . ARG C 1 49  ? -17.017 4.866   174.525 1.00 0.00 ?  49  ARG C HG2  1  
ATOM 10167  H HG3  . ARG C 1 49  ? -18.574 5.623   174.047 1.00 0.00 ?  49  ARG C HG3  1  
ATOM 10168  H HD2  . ARG C 1 49  ? -17.696 5.323   176.998 1.00 0.00 ?  49  ARG C HD2  1  
ATOM 10169  H HD3  . ARG C 1 49  ? -17.374 6.804   175.985 1.00 0.00 ?  49  ARG C HD3  1  
ATOM 10170  H HE   . ARG C 1 49  ? -20.148 6.139   175.725 1.00 0.00 ?  49  ARG C HE   1  
ATOM 10171  H HH11 . ARG C 1 49  ? -17.785 7.182   178.180 1.00 0.00 ?  49  ARG C HH11 1  
ATOM 10172  H HH12 . ARG C 1 49  ? -18.925 8.113   179.093 1.00 0.00 ?  49  ARG C HH12 1  
ATOM 10173  H HH21 . ARG C 1 49  ? -21.690 7.405   176.957 1.00 0.00 ?  49  ARG C HH21 1  
ATOM 10174  H HH22 . ARG C 1 49  ? -21.180 8.248   178.384 1.00 0.00 ?  49  ARG C HH22 1  
ATOM 10175  N N    . ASP C 1 50  ? -20.850 1.356   173.842 1.00 0.00 ?  50  ASP C N    1  
ATOM 10176  C CA   . ASP C 1 50  ? -21.321 0.015   174.047 1.00 0.00 ?  50  ASP C CA   1  
ATOM 10177  C C    . ASP C 1 50  ? -20.690 -0.847  173.001 1.00 0.00 ?  50  ASP C C    1  
ATOM 10178  O O    . ASP C 1 50  ? -20.355 -1.997  173.259 1.00 0.00 ?  50  ASP C O    1  
ATOM 10179  C CB   . ASP C 1 50  ? -22.848 -0.144  173.935 1.00 0.00 ?  50  ASP C CB   1  
ATOM 10180  C CG   . ASP C 1 50  ? -23.579 0.482   175.117 1.00 0.00 ?  50  ASP C CG   1  
ATOM 10181  O OD1  . ASP C 1 50  ? -22.900 0.830   176.120 1.00 0.00 ?  50  ASP C OD1  1  
ATOM 10182  O OD2  . ASP C 1 50  ? -24.830 0.611   175.037 1.00 0.00 -1 50  ASP C OD2  1  
ATOM 10183  H H    . ASP C 1 50  ? -21.537 2.043   173.625 1.00 0.00 ?  50  ASP C H    1  
ATOM 10184  H HA   . ASP C 1 50  ? -20.980 -0.304  175.021 1.00 0.00 ?  50  ASP C HA   1  
ATOM 10185  H HB2  . ASP C 1 50  ? -23.203 0.333   172.999 1.00 0.00 ?  50  ASP C HB2  1  
ATOM 10186  H HB3  . ASP C 1 50  ? -23.102 -1.224  173.893 1.00 0.00 ?  50  ASP C HB3  1  
ATOM 10187  N N    . LEU C 1 51  ? -20.540 -0.299  171.777 1.00 0.00 ?  51  LEU C N    1  
ATOM 10188  C CA   . LEU C 1 51  ? -19.949 -1.045  170.690 1.00 0.00 ?  51  LEU C CA   1  
ATOM 10189  C C    . LEU C 1 51  ? -18.537 -1.388  171.045 1.00 0.00 ?  51  LEU C C    1  
ATOM 10190  O O    . LEU C 1 51  ? -18.069 -2.467  170.703 1.00 0.00 ?  51  LEU C O    1  
ATOM 10191  C CB   . LEU C 1 51  ? -19.918 -0.265  169.365 1.00 0.00 ?  51  LEU C CB   1  
ATOM 10192  C CG   . LEU C 1 51  ? -21.319 -0.054  168.766 1.00 0.00 ?  51  LEU C CG   1  
ATOM 10193  C CD1  . LEU C 1 51  ? -21.275 0.911   167.569 1.00 0.00 ?  51  LEU C CD1  1  
ATOM 10194  C CD2  . LEU C 1 51  ? -21.972 -1.392  168.379 1.00 0.00 ?  51  LEU C CD2  1  
ATOM 10195  H H    . LEU C 1 51  ? -20.835 0.635   171.569 1.00 0.00 ?  51  LEU C H    1  
ATOM 10196  H HA   . LEU C 1 51  ? -20.515 -1.956  170.574 1.00 0.00 ?  51  LEU C HA   1  
ATOM 10197  H HB2  . LEU C 1 51  ? -19.444 0.726   169.542 1.00 0.00 ?  51  LEU C HB2  1  
ATOM 10198  H HB3  . LEU C 1 51  ? -19.297 -0.818  168.632 1.00 0.00 ?  51  LEU C HB3  1  
ATOM 10199  H HG   . LEU C 1 51  ? -21.952 0.414   169.550 1.00 0.00 ?  51  LEU C HG   1  
ATOM 10200  H HD11 . LEU C 1 51  ? -22.218 1.495   167.509 1.00 0.00 ?  51  LEU C HD11 1  
ATOM 10201  H HD12 . LEU C 1 51  ? -21.146 0.344   166.622 1.00 0.00 ?  51  LEU C HD12 1  
ATOM 10202  H HD13 . LEU C 1 51  ? -20.425 1.619   167.676 1.00 0.00 ?  51  LEU C HD13 1  
ATOM 10203  H HD21 . LEU C 1 51  ? -21.195 -2.140  168.115 1.00 0.00 ?  51  LEU C HD21 1  
ATOM 10204  H HD22 . LEU C 1 51  ? -22.644 -1.254  167.505 1.00 0.00 ?  51  LEU C HD22 1  
ATOM 10205  H HD23 . LEU C 1 51  ? -22.571 -1.788  169.227 1.00 0.00 ?  51  LEU C HD23 1  
ATOM 10206  N N    . TYR C 1 52  ? -17.813 -0.453  171.702 1.00 0.00 ?  52  TYR C N    1  
ATOM 10207  C CA   . TYR C 1 52  ? -16.436 -0.705  172.071 1.00 0.00 ?  52  TYR C CA   1  
ATOM 10208  C C    . TYR C 1 52  ? -16.395 -1.902  172.975 1.00 0.00 ?  52  TYR C C    1  
ATOM 10209  O O    . TYR C 1 52  ? -15.583 -2.807  172.792 1.00 0.00 ?  52  TYR C O    1  
ATOM 10210  C CB   . TYR C 1 52  ? -15.776 0.468   172.812 1.00 0.00 ?  52  TYR C CB   1  
ATOM 10211  C CG   . TYR C 1 52  ? -14.375 0.188   173.233 1.00 0.00 ?  52  TYR C CG   1  
ATOM 10212  C CD1  . TYR C 1 52  ? -14.089 -0.141  174.540 1.00 0.00 ?  52  TYR C CD1  1  
ATOM 10213  C CD2  . TYR C 1 52  ? -13.347 0.251   172.318 1.00 0.00 ?  52  TYR C CD2  1  
ATOM 10214  C CE1  . TYR C 1 52  ? -12.795 -0.401  174.925 1.00 0.00 ?  52  TYR C CE1  1  
ATOM 10215  C CE2  . TYR C 1 52  ? -12.053 -0.010  172.703 1.00 0.00 ?  52  TYR C CE2  1  
ATOM 10216  C CZ   . TYR C 1 52  ? -11.777 -0.335  174.007 1.00 0.00 ?  52  TYR C CZ   1  
ATOM 10217  O OH   . TYR C 1 52  ? -10.449 -0.603  174.402 1.00 0.00 ?  52  TYR C OH   1  
ATOM 10218  H H    . TYR C 1 52  ? -18.191 0.439   171.956 1.00 0.00 ?  52  TYR C H    1  
ATOM 10219  H HA   . TYR C 1 52  ? -15.893 -0.928  171.165 1.00 0.00 ?  52  TYR C HA   1  
ATOM 10220  H HB2  . TYR C 1 52  ? -15.749 1.364   172.157 1.00 0.00 ?  52  TYR C HB2  1  
ATOM 10221  H HB3  . TYR C 1 52  ? -16.356 0.712   173.727 1.00 0.00 ?  52  TYR C HB3  1  
ATOM 10222  H HD1  . TYR C 1 52  ? -14.886 -0.193  175.266 1.00 0.00 ?  52  TYR C HD1  1  
ATOM 10223  H HD2  . TYR C 1 52  ? -13.559 0.507   171.290 1.00 0.00 ?  52  TYR C HD2  1  
ATOM 10224  H HE1  . TYR C 1 52  ? -12.579 -0.657  175.952 1.00 0.00 ?  52  TYR C HE1  1  
ATOM 10225  H HE2  . TYR C 1 52  ? -11.254 0.042   171.979 1.00 0.00 ?  52  TYR C HE2  1  
ATOM 10226  H HH   . TYR C 1 52  ? -9.864  -0.279  173.714 1.00 0.00 ?  52  TYR C HH   1  
ATOM 10227  N N    . TYR C 1 53  ? -17.285 -1.909  173.984 1.00 0.00 ?  53  TYR C N    1  
ATOM 10228  C CA   . TYR C 1 53  ? -17.363 -2.998  174.931 1.00 0.00 ?  53  TYR C CA   1  
ATOM 10229  C C    . TYR C 1 53  ? -17.648 -4.288  174.218 1.00 0.00 ?  53  TYR C C    1  
ATOM 10230  O O    . TYR C 1 53  ? -17.009 -5.308  174.482 1.00 0.00 ?  53  TYR C O    1  
ATOM 10231  C CB   . TYR C 1 53  ? -18.485 -2.768  175.956 1.00 0.00 ?  53  TYR C CB   1  
ATOM 10232  C CG   . TYR C 1 53  ? -18.919 -3.991  176.685 1.00 0.00 ?  53  TYR C CG   1  
ATOM 10233  C CD1  . TYR C 1 53  ? -20.106 -4.590  176.334 1.00 0.00 ?  53  TYR C CD1  1  
ATOM 10234  C CD2  . TYR C 1 53  ? -18.169 -4.536  177.706 1.00 0.00 ?  53  TYR C CD2  1  
ATOM 10235  C CE1  . TYR C 1 53  ? -20.543 -5.711  176.986 1.00 0.00 ?  53  TYR C CE1  1  
ATOM 10236  C CE2  . TYR C 1 53  ? -18.612 -5.668  178.362 1.00 0.00 ?  53  TYR C CE2  1  
ATOM 10237  C CZ   . TYR C 1 53  ? -19.803 -6.253  177.998 1.00 0.00 ?  53  TYR C CZ   1  
ATOM 10238  O OH   . TYR C 1 53  ? -20.274 -7.408  178.664 1.00 0.00 ?  53  TYR C OH   1  
ATOM 10239  H H    . TYR C 1 53  ? -17.933 -1.160  174.122 1.00 0.00 ?  53  TYR C H    1  
ATOM 10240  H HA   . TYR C 1 53  ? -16.411 -3.069  175.430 1.00 0.00 ?  53  TYR C HA   1  
ATOM 10241  H HB2  . TYR C 1 53  ? -18.146 -2.039  176.722 1.00 0.00 ?  53  TYR C HB2  1  
ATOM 10242  H HB3  . TYR C 1 53  ? -19.380 -2.351  175.444 1.00 0.00 ?  53  TYR C HB3  1  
ATOM 10243  H HD1  . TYR C 1 53  ? -20.700 -4.171  175.536 1.00 0.00 ?  53  TYR C HD1  1  
ATOM 10244  H HD2  . TYR C 1 53  ? -17.234 -4.078  177.992 1.00 0.00 ?  53  TYR C HD2  1  
ATOM 10245  H HE1  . TYR C 1 53  ? -21.474 -6.167  176.703 1.00 0.00 ?  53  TYR C HE1  1  
ATOM 10246  H HE2  . TYR C 1 53  ? -18.023 -6.094  179.161 1.00 0.00 ?  53  TYR C HE2  1  
ATOM 10247  H HH   . TYR C 1 53  ? -21.077 -7.699  178.221 1.00 0.00 ?  53  TYR C HH   1  
ATOM 10248  N N    . TRP C 1 54  ? -18.628 -4.250  173.308 1.00 0.00 ?  54  TRP C N    1  
ATOM 10249  C CA   . TRP C 1 54  ? -19.053 -5.415  172.582 1.00 0.00 ?  54  TRP C CA   1  
ATOM 10250  C C    . TRP C 1 54  ? -17.903 -5.983  171.786 1.00 0.00 ?  54  TRP C C    1  
ATOM 10251  O O    . TRP C 1 54  ? -17.683 -7.196  171.766 1.00 0.00 ?  54  TRP C O    1  
ATOM 10252  C CB   . TRP C 1 54  ? -20.201 -5.068  171.613 1.00 0.00 ?  54  TRP C CB   1  
ATOM 10253  C CG   . TRP C 1 54  ? -20.697 -6.248  170.816 1.00 0.00 ?  54  TRP C CG   1  
ATOM 10254  C CD1  . TRP C 1 54  ? -21.640 -7.172  171.170 1.00 0.00 ?  54  TRP C CD1  1  
ATOM 10255  C CD2  . TRP C 1 54  ? -20.269 -6.605  169.486 1.00 0.00 ?  54  TRP C CD2  1  
ATOM 10256  N NE1  . TRP C 1 54  ? -21.814 -8.078  170.162 1.00 0.00 ?  54  TRP C NE1  1  
ATOM 10257  C CE2  . TRP C 1 54  ? -20.984 -7.745  169.121 1.00 0.00 ?  54  TRP C CE2  1  
ATOM 10258  C CE3  . TRP C 1 54  ? -19.365 -6.053  168.625 1.00 0.00 ?  54  TRP C CE3  1  
ATOM 10259  C CZ2  . TRP C 1 54  ? -20.805 -8.340  167.908 1.00 0.00 ?  54  TRP C CZ2  1  
ATOM 10260  C CZ3  . TRP C 1 54  ? -19.181 -6.651  167.396 1.00 0.00 ?  54  TRP C CZ3  1  
ATOM 10261  C CH2  . TRP C 1 54  ? -19.892 -7.781  167.042 1.00 0.00 ?  54  TRP C CH2  1  
ATOM 10262  H H    . TRP C 1 54  ? -19.108 -3.410  173.093 1.00 0.00 ?  54  TRP C H    1  
ATOM 10263  H HA   . TRP C 1 54  ? -19.383 -6.148  173.301 1.00 0.00 ?  54  TRP C HA   1  
ATOM 10264  H HB2  . TRP C 1 54  ? -21.053 -4.653  172.195 1.00 0.00 ?  54  TRP C HB2  1  
ATOM 10265  H HB3  . TRP C 1 54  ? -19.855 -4.285  170.905 1.00 0.00 ?  54  TRP C HB3  1  
ATOM 10266  H HD1  . TRP C 1 54  ? -22.164 -7.189  172.114 1.00 0.00 ?  54  TRP C HD1  1  
ATOM 10267  H HE1  . TRP C 1 54  ? -22.429 -8.836  170.179 1.00 0.00 ?  54  TRP C HE1  1  
ATOM 10268  H HE3  . TRP C 1 54  ? -18.798 -5.171  168.883 1.00 0.00 ?  54  TRP C HE3  1  
ATOM 10269  H HZ2  . TRP C 1 54  ? -21.355 -9.222  167.618 1.00 0.00 ?  54  TRP C HZ2  1  
ATOM 10270  H HZ3  . TRP C 1 54  ? -18.470 -6.230  166.700 1.00 0.00 ?  54  TRP C HZ3  1  
ATOM 10271  H HH2  . TRP C 1 54  ? -19.732 -8.231  166.073 1.00 0.00 ?  54  TRP C HH2  1  
ATOM 10272  N N    . ALA C 1 55  ? -17.143 -5.109  171.117 1.00 0.00 ?  55  ALA C N    1  
ATOM 10273  C CA   . ALA C 1 55  ? -16.050 -5.547  170.291 1.00 0.00 ?  55  ALA C CA   1  
ATOM 10274  C C    . ALA C 1 55  ? -14.931 -6.094  171.133 1.00 0.00 ?  55  ALA C C    1  
ATOM 10275  O O    . ALA C 1 55  ? -14.018 -6.704  170.601 1.00 0.00 ?  55  ALA C O    1  
ATOM 10276  C CB   . ALA C 1 55  ? -15.465 -4.419  169.427 1.00 0.00 ?  55  ALA C CB   1  
ATOM 10277  H H    . ALA C 1 55  ? -17.300 -4.131  171.157 1.00 0.00 ?  55  ALA C H    1  
ATOM 10278  H HA   . ALA C 1 55  ? -16.424 -6.333  169.656 1.00 0.00 ?  55  ALA C HA   1  
ATOM 10279  H HB1  . ALA C 1 55  ? -15.903 -4.448  168.406 1.00 0.00 ?  55  ALA C HB1  1  
ATOM 10280  H HB2  . ALA C 1 55  ? -14.362 -4.530  169.342 1.00 0.00 ?  55  ALA C HB2  1  
ATOM 10281  H HB3  . ALA C 1 55  ? -15.688 -3.429  169.880 1.00 0.00 ?  55  ALA C HB3  1  
ATOM 10282  N N    . LEU C 1 56  ? -14.935 -5.844  172.453 1.00 0.00 ?  56  LEU C N    1  
ATOM 10283  C CA   . LEU C 1 56  ? -13.842 -6.297  173.281 1.00 0.00 ?  56  LEU C CA   1  
ATOM 10284  C C    . LEU C 1 56  ? -14.019 -7.709  173.816 1.00 0.00 ?  56  LEU C C    1  
ATOM 10285  O O    . LEU C 1 56  ? -13.015 -8.389  174.025 1.00 0.00 ?  56  LEU C O    1  
ATOM 10286  C CB   . LEU C 1 56  ? -13.638 -5.389  174.507 1.00 0.00 ?  56  LEU C CB   1  
ATOM 10287  C CG   . LEU C 1 56  ? -12.340 -4.564  174.445 1.00 0.00 ?  56  LEU C CG   1  
ATOM 10288  C CD1  . LEU C 1 56  ? -11.106 -5.459  174.638 1.00 0.00 ?  56  LEU C CD1  1  
ATOM 10289  C CD2  . LEU C 1 56  ? -12.241 -3.746  173.145 1.00 0.00 ?  56  LEU C CD2  1  
ATOM 10290  H H    . LEU C 1 56  ? -15.669 -5.347  172.907 1.00 0.00 ?  56  LEU C H    1  
ATOM 10291  H HA   . LEU C 1 56  ? -12.953 -6.276  172.675 1.00 0.00 ?  56  LEU C HA   1  
ATOM 10292  H HB2  . LEU C 1 56  ? -14.504 -4.696  174.588 1.00 0.00 ?  56  LEU C HB2  1  
ATOM 10293  H HB3  . LEU C 1 56  ? -13.615 -6.017  175.422 1.00 0.00 ?  56  LEU C HB3  1  
ATOM 10294  H HG   . LEU C 1 56  ? -12.363 -3.845  175.292 1.00 0.00 ?  56  LEU C HG   1  
ATOM 10295  H HD11 . LEU C 1 56  ? -10.190 -4.840  174.733 1.00 0.00 ?  56  LEU C HD11 1  
ATOM 10296  H HD12 . LEU C 1 56  ? -10.986 -6.142  173.769 1.00 0.00 ?  56  LEU C HD12 1  
ATOM 10297  H HD13 . LEU C 1 56  ? -11.216 -6.074  175.558 1.00 0.00 ?  56  LEU C HD13 1  
ATOM 10298  H HD21 . LEU C 1 56  ? -13.244 -3.373  172.847 1.00 0.00 ?  56  LEU C HD21 1  
ATOM 10299  H HD22 . LEU C 1 56  ? -11.839 -4.376  172.322 1.00 0.00 ?  56  LEU C HD22 1  
ATOM 10300  H HD23 . LEU C 1 56  ? -11.566 -2.875  173.287 1.00 0.00 ?  56  LEU C HD23 1  
ATOM 10301  N N    . LYS C 1 57  ? -15.263 -8.203  174.063 1.00 0.00 ?  57  LYS C N    1  
ATOM 10302  C CA   . LYS C 1 57  ? -15.390 -9.512  174.715 1.00 0.00 ?  57  LYS C CA   1  
ATOM 10303  C C    . LYS C 1 57  ? -15.510 -10.719 173.789 1.00 0.00 ?  57  LYS C C    1  
ATOM 10304  O O    . LYS C 1 57  ? -14.664 -11.611 173.817 1.00 0.00 ?  57  LYS C O    1  
ATOM 10305  C CB   . LYS C 1 57  ? -16.632 -9.567  175.622 1.00 0.00 ?  57  LYS C CB   1  
ATOM 10306  C CG   . LYS C 1 57  ? -16.650 -8.477  176.701 1.00 0.00 ?  57  LYS C CG   1  
ATOM 10307  C CD   . LYS C 1 57  ? -15.516 -8.618  177.719 1.00 0.00 ?  57  LYS C CD   1  
ATOM 10308  C CE   . LYS C 1 57  ? -15.665 -7.641  178.885 1.00 0.00 ?  57  LYS C CE   1  
ATOM 10309  N NZ   . LYS C 1 57  ? -15.560 -6.245  178.405 1.00 0.00 1  57  LYS C NZ   1  
ATOM 10310  H H    . LYS C 1 57  ? -16.105 -7.722  173.824 1.00 0.00 ?  57  LYS C H    1  
ATOM 10311  H HA   . LYS C 1 57  ? -14.516 -9.644  175.327 1.00 0.00 ?  57  LYS C HA   1  
ATOM 10312  H HB2  . LYS C 1 57  ? -17.542 -9.466  174.992 1.00 0.00 ?  57  LYS C HB2  1  
ATOM 10313  H HB3  . LYS C 1 57  ? -16.670 -10.560 176.118 1.00 0.00 ?  57  LYS C HB3  1  
ATOM 10314  H HG2  . LYS C 1 57  ? -16.571 -7.483  176.211 1.00 0.00 ?  57  LYS C HG2  1  
ATOM 10315  H HG3  . LYS C 1 57  ? -17.624 -8.516  177.236 1.00 0.00 ?  57  LYS C HG3  1  
ATOM 10316  H HD2  . LYS C 1 57  ? -15.506 -9.656  178.113 1.00 0.00 ?  57  LYS C HD2  1  
ATOM 10317  H HD3  . LYS C 1 57  ? -14.543 -8.432  177.215 1.00 0.00 ?  57  LYS C HD3  1  
ATOM 10318  H HE2  . LYS C 1 57  ? -16.656 -7.761  179.371 1.00 0.00 ?  57  LYS C HE2  1  
ATOM 10319  H HE3  . LYS C 1 57  ? -14.864 -7.808  179.636 1.00 0.00 ?  57  LYS C HE3  1  
ATOM 10320  H HZ1  . LYS C 1 57  ? -14.876 -5.727  178.992 1.00 0.00 ?  57  LYS C HZ1  1  
ATOM 10321  H HZ2  . LYS C 1 57  ? -16.490 -5.786  178.470 1.00 0.00 ?  57  LYS C HZ2  1  
ATOM 10322  H HZ3  . LYS C 1 57  ? -15.240 -6.242  177.415 1.00 0.00 ?  57  LYS C HZ3  1  
ATOM 10323  N N    . VAL C 1 58  ? -16.570 -10.767 172.964 1.00 0.00 ?  58  VAL C N    1  
ATOM 10324  C CA   . VAL C 1 58  ? -16.865 -11.934 172.123 1.00 0.00 ?  58  VAL C CA   1  
ATOM 10325  C C    . VAL C 1 58  ? -15.963 -12.001 170.912 1.00 0.00 ?  58  VAL C C    1  
ATOM 10326  O O    . VAL C 1 58  ? -15.931 -12.993 170.198 1.00 0.00 ?  58  VAL C O    1  
ATOM 10327  C CB   . VAL C 1 58  ? -18.317 -11.976 171.709 1.00 0.00 ?  58  VAL C CB   1  
ATOM 10328  C CG1  . VAL C 1 58  ? -18.584 -10.828 170.720 1.00 0.00 ?  58  VAL C CG1  1  
ATOM 10329  C CG2  . VAL C 1 58  ? -18.667 -13.370 171.146 1.00 0.00 ?  58  VAL C CG2  1  
ATOM 10330  H H    . VAL C 1 58  ? -17.208 -10.001 172.882 1.00 0.00 ?  58  VAL C H    1  
ATOM 10331  H HA   . VAL C 1 58  ? -16.650 -12.799 172.733 1.00 0.00 ?  58  VAL C HA   1  
ATOM 10332  H HB   . VAL C 1 58  ? -18.949 -11.802 172.607 1.00 0.00 ?  58  VAL C HB   1  
ATOM 10333  H HG11 . VAL C 1 58  ? -19.675 -10.711 170.552 1.00 0.00 ?  58  VAL C HG11 1  
ATOM 10334  H HG12 . VAL C 1 58  ? -18.098 -11.029 169.750 1.00 0.00 ?  58  VAL C HG12 1  
ATOM 10335  H HG13 . VAL C 1 58  ? -18.186 -9.873  171.124 1.00 0.00 ?  58  VAL C HG13 1  
ATOM 10336  H HG21 . VAL C 1 58  ? -18.229 -14.165 171.785 1.00 0.00 ?  58  VAL C HG21 1  
ATOM 10337  H HG22 . VAL C 1 58  ? -18.268 -13.483 170.118 1.00 0.00 ?  58  VAL C HG22 1  
ATOM 10338  H HG23 . VAL C 1 58  ? -19.768 -13.507 171.115 1.00 0.00 ?  58  VAL C HG23 1  
ATOM 10339  N N    . SER C 1 59  ? -15.259 -10.909 170.671 1.00 0.00 ?  59  SER C N    1  
ATOM 10340  C CA   . SER C 1 59  ? -14.414 -10.687 169.510 1.00 0.00 ?  59  SER C CA   1  
ATOM 10341  C C    . SER C 1 59  ? -13.575 -11.829 168.938 1.00 0.00 ?  59  SER C C    1  
ATOM 10342  O O    . SER C 1 59  ? -13.071 -11.608 167.850 1.00 0.00 ?  59  SER C O    1  
ATOM 10343  C CB   . SER C 1 59  ? -13.407 -9.579  169.789 1.00 0.00 ?  59  SER C CB   1  
ATOM 10344  O OG   . SER C 1 59  ? -13.337 -9.320  171.182 1.00 0.00 ?  59  SER C OG   1  
ATOM 10345  H H    . SER C 1 59  ? -15.281 -10.147 171.314 1.00 0.00 ?  59  SER C H    1  
ATOM 10346  H HA   . SER C 1 59  ? -15.069 -10.343 168.731 1.00 0.00 ?  59  SER C HA   1  
ATOM 10347  H HB2  . SER C 1 59  ? -12.403 -9.884  169.427 1.00 0.00 ?  59  SER C HB2  1  
ATOM 10348  H HB3  . SER C 1 59  ? -13.711 -8.650  169.264 1.00 0.00 ?  59  SER C HB3  1  
ATOM 10349  H HG   . SER C 1 59  ? -13.317 -8.367  171.271 1.00 0.00 ?  59  SER C HG   1  
ATOM 10350  N N    . TRP C 1 60  ? -13.324 -13.011 169.565 1.00 0.00 ?  60  TRP C N    1  
ATOM 10351  C CA   . TRP C 1 60  ? -12.442 -13.959 168.879 1.00 0.00 ?  60  TRP C CA   1  
ATOM 10352  C C    . TRP C 1 60  ? -12.970 -14.281 167.460 1.00 0.00 ?  60  TRP C C    1  
ATOM 10353  O O    . TRP C 1 60  ? -12.319 -13.861 166.501 1.00 0.00 ?  60  TRP C O    1  
ATOM 10354  C CB   . TRP C 1 60  ? -12.119 -15.257 169.675 1.00 0.00 ?  60  TRP C CB   1  
ATOM 10355  C CG   . TRP C 1 60  ? -10.902 -15.170 170.568 1.00 0.00 ?  60  TRP C CG   1  
ATOM 10356  C CD1  . TRP C 1 60  ? -9.770  -14.424 170.402 1.00 0.00 ?  60  TRP C CD1  1  
ATOM 10357  C CD2  . TRP C 1 60  ? -10.721 -15.895 171.805 1.00 0.00 ?  60  TRP C CD2  1  
ATOM 10358  N NE1  . TRP C 1 60  ? -8.900  -14.650 171.433 1.00 0.00 ?  60  TRP C NE1  1  
ATOM 10359  C CE2  . TRP C 1 60  ? -9.470  -15.541 172.306 1.00 0.00 ?  60  TRP C CE2  1  
ATOM 10360  C CE3  . TRP C 1 60  ? -11.509 -16.781 172.483 1.00 0.00 ?  60  TRP C CE3  1  
ATOM 10361  C CZ2  . TRP C 1 60  ? -8.996  -16.061 173.473 1.00 0.00 ?  60  TRP C CZ2  1  
ATOM 10362  C CZ3  . TRP C 1 60  ? -11.035 -17.309 173.667 1.00 0.00 ?  60  TRP C CZ3  1  
ATOM 10363  C CH2  . TRP C 1 60  ? -9.793  -16.952 174.156 1.00 0.00 ?  60  TRP C CH2  1  
ATOM 10364  H H    . TRP C 1 60  ? -13.697 -13.267 170.453 1.00 0.00 ?  60  TRP C H    1  
ATOM 10365  H HA   . TRP C 1 60  ? -11.521 -13.413 168.736 1.00 0.00 ?  60  TRP C HA   1  
ATOM 10366  H HB2  . TRP C 1 60  ? -12.994 -15.516 170.308 1.00 0.00 ?  60  TRP C HB2  1  
ATOM 10367  H HB3  . TRP C 1 60  ? -11.965 -16.089 168.955 1.00 0.00 ?  60  TRP C HB3  1  
ATOM 10368  H HD1  . TRP C 1 60  ? -9.582  -13.765 169.568 1.00 0.00 ?  60  TRP C HD1  1  
ATOM 10369  H HE1  . TRP C 1 60  ? -8.022  -14.237 171.536 1.00 0.00 ?  60  TRP C HE1  1  
ATOM 10370  H HE3  . TRP C 1 60  ? -12.483 -17.072 172.118 1.00 0.00 ?  60  TRP C HE3  1  
ATOM 10371  H HZ2  . TRP C 1 60  ? -8.028  -15.791 173.868 1.00 0.00 ?  60  TRP C HZ2  1  
ATOM 10372  H HZ3  . TRP C 1 60  ? -11.643 -18.010 174.219 1.00 0.00 ?  60  TRP C HZ3  1  
ATOM 10373  H HH2  . TRP C 1 60  ? -9.443  -17.378 175.085 1.00 0.00 ?  60  TRP C HH2  1  
ATOM 10374  N N    . PRO C 1 61  ? -14.098 -14.975 167.232 1.00 0.00 ?  61  PRO C N    1  
ATOM 10375  C CA   . PRO C 1 61  ? -14.544 -15.176 165.857 1.00 0.00 ?  61  PRO C CA   1  
ATOM 10376  C C    . PRO C 1 61  ? -15.439 -14.074 165.335 1.00 0.00 ?  61  PRO C C    1  
ATOM 10377  O O    . PRO C 1 61  ? -15.441 -13.752 164.143 1.00 0.00 ?  61  PRO C O    1  
ATOM 10378  C CB   . PRO C 1 61  ? -15.310 -16.491 165.931 1.00 0.00 ?  61  PRO C CB   1  
ATOM 10379  C CG   . PRO C 1 61  ? -15.967 -16.458 167.312 1.00 0.00 ?  61  PRO C CG   1  
ATOM 10380  C CD   . PRO C 1 61  ? -15.026 -15.626 168.197 1.00 0.00 ?  61  PRO C CD   1  
ATOM 10381  H HA   . PRO C 1 61  ? -13.707 -15.296 165.188 1.00 0.00 ?  61  PRO C HA   1  
ATOM 10382  H HB2  . PRO C 1 61  ? -16.077 -16.545 165.128 1.00 0.00 ?  61  PRO C HB2  1  
ATOM 10383  H HB3  . PRO C 1 61  ? -14.618 -17.356 165.849 1.00 0.00 ?  61  PRO C HB3  1  
ATOM 10384  H HG2  . PRO C 1 61  ? -16.971 -15.985 167.250 1.00 0.00 ?  61  PRO C HG2  1  
ATOM 10385  H HG3  . PRO C 1 61  ? -16.071 -17.489 167.714 1.00 0.00 ?  61  PRO C HG3  1  
ATOM 10386  H HD2  . PRO C 1 61  ? -15.603 -14.873 168.772 1.00 0.00 ?  61  PRO C HD2  1  
ATOM 10387  H HD3  . PRO C 1 61  ? -14.488 -16.292 168.897 1.00 0.00 ?  61  PRO C HD3  1  
ATOM 10388  N N    . VAL C 1 62  ? -16.203 -13.465 166.262 1.00 0.00 ?  62  VAL C N    1  
ATOM 10389  C CA   . VAL C 1 62  ? -17.167 -12.459 165.934 1.00 0.00 ?  62  VAL C CA   1  
ATOM 10390  C C    . VAL C 1 62  ? -16.521 -11.235 165.367 1.00 0.00 ?  62  VAL C C    1  
ATOM 10391  O O    . VAL C 1 62  ? -17.069 -10.654 164.449 1.00 0.00 ?  62  VAL C O    1  
ATOM 10392  C CB   . VAL C 1 62  ? -17.994 -12.065 167.123 1.00 0.00 ?  62  VAL C CB   1  
ATOM 10393  C CG1  . VAL C 1 62  ? -18.847 -10.833 166.774 1.00 0.00 ?  62  VAL C CG1  1  
ATOM 10394  C CG2  . VAL C 1 62  ? -18.855 -13.276 167.517 1.00 0.00 ?  62  VAL C CG2  1  
ATOM 10395  H H    . VAL C 1 62  ? -16.130 -13.693 167.233 1.00 0.00 ?  62  VAL C H    1  
ATOM 10396  H HA   . VAL C 1 62  ? -17.809 -12.881 165.178 1.00 0.00 ?  62  VAL C HA   1  
ATOM 10397  H HB   . VAL C 1 62  ? -17.330 -11.813 167.975 1.00 0.00 ?  62  VAL C HB   1  
ATOM 10398  H HG11 . VAL C 1 62  ? -19.153 -10.865 165.706 1.00 0.00 ?  62  VAL C HG11 1  
ATOM 10399  H HG12 . VAL C 1 62  ? -18.269 -9.901  166.950 1.00 0.00 ?  62  VAL C HG12 1  
ATOM 10400  H HG13 . VAL C 1 62  ? -19.762 -10.806 167.404 1.00 0.00 ?  62  VAL C HG13 1  
ATOM 10401  H HG21 . VAL C 1 62  ? -19.570 -12.995 168.320 1.00 0.00 ?  62  VAL C HG21 1  
ATOM 10402  H HG22 . VAL C 1 62  ? -18.212 -14.102 167.887 1.00 0.00 ?  62  VAL C HG22 1  
ATOM 10403  H HG23 . VAL C 1 62  ? -19.431 -13.640 166.640 1.00 0.00 ?  62  VAL C HG23 1  
ATOM 10404  N N    . PHE C 1 63  ? -15.366 -10.790 165.911 1.00 0.00 ?  63  PHE C N    1  
ATOM 10405  C CA   . PHE C 1 63  ? -14.752 -9.565  165.425 1.00 0.00 ?  63  PHE C CA   1  
ATOM 10406  C C    . PHE C 1 63  ? -14.430 -9.657  163.973 1.00 0.00 ?  63  PHE C C    1  
ATOM 10407  O O    . PHE C 1 63  ? -14.700 -8.714  163.243 1.00 0.00 ?  63  PHE C O    1  
ATOM 10408  C CB   . PHE C 1 63  ? -13.452 -9.160  166.123 1.00 0.00 ?  63  PHE C CB   1  
ATOM 10409  C CG   . PHE C 1 63  ? -12.786 -7.980  165.501 1.00 0.00 ?  63  PHE C CG   1  
ATOM 10410  C CD1  . PHE C 1 63  ? -11.704 -8.150  164.666 1.00 0.00 ?  63  PHE C CD1  1  
ATOM 10411  C CD2  . PHE C 1 63  ? -13.246 -6.706  165.753 1.00 0.00 ?  63  PHE C CD2  1  
ATOM 10412  C CE1  . PHE C 1 63  ? -11.089 -7.063  164.092 1.00 0.00 ?  63  PHE C CE1  1  
ATOM 10413  C CE2  . PHE C 1 63  ? -12.630 -5.618  165.178 1.00 0.00 ?  63  PHE C CE2  1  
ATOM 10414  C CZ   . PHE C 1 63  ? -11.553 -5.797  164.348 1.00 0.00 ?  63  PHE C CZ   1  
ATOM 10415  H H    . PHE C 1 63  ? -14.894 -11.270 166.648 1.00 0.00 ?  63  PHE C H    1  
ATOM 10416  H HA   . PHE C 1 63  ? -15.483 -8.784  165.558 1.00 0.00 ?  63  PHE C HA   1  
ATOM 10417  H HB2  . PHE C 1 63  ? -13.661 -8.894  167.172 1.00 0.00 ?  63  PHE C HB2  1  
ATOM 10418  H HB3  . PHE C 1 63  ? -12.727 -10.003 166.101 1.00 0.00 ?  63  PHE C HB3  1  
ATOM 10419  H HD1  . PHE C 1 63  ? -11.335 -9.144  164.461 1.00 0.00 ?  63  PHE C HD1  1  
ATOM 10420  H HD2  . PHE C 1 63  ? -14.093 -6.559  166.405 1.00 0.00 ?  63  PHE C HD2  1  
ATOM 10421  H HE1  . PHE C 1 63  ? -10.241 -7.205  163.439 1.00 0.00 ?  63  PHE C HE1  1  
ATOM 10422  H HE2  . PHE C 1 63  ? -12.997 -4.622  165.380 1.00 0.00 ?  63  PHE C HE2  1  
ATOM 10423  H HZ   . PHE C 1 63  ? -11.070 -4.943  163.897 1.00 0.00 ?  63  PHE C HZ   1  
ATOM 10424  N N    . PHE C 1 64  ? -13.805 -10.761 163.526 1.00 0.00 ?  64  PHE C N    1  
ATOM 10425  C CA   . PHE C 1 64  ? -13.433 -10.862 162.137 1.00 0.00 ?  64  PHE C CA   1  
ATOM 10426  C C    . PHE C 1 64  ? -14.667 -10.807 161.284 1.00 0.00 ?  64  PHE C C    1  
ATOM 10427  O O    . PHE C 1 64  ? -14.681 -10.131 160.255 1.00 0.00 ?  64  PHE C O    1  
ATOM 10428  C CB   . PHE C 1 64  ? -12.719 -12.181 161.800 1.00 0.00 ?  64  PHE C CB   1  
ATOM 10429  C CG   . PHE C 1 64  ? -11.342 -12.286 162.357 1.00 0.00 ?  64  PHE C CG   1  
ATOM 10430  C CD1  . PHE C 1 64  ? -11.141 -12.778 163.627 1.00 0.00 ?  64  PHE C CD1  1  
ATOM 10431  C CD2  . PHE C 1 64  ? -10.251 -11.906 161.606 1.00 0.00 ?  64  PHE C CD2  1  
ATOM 10432  C CE1  . PHE C 1 64  ? -9.871  -12.887 164.141 1.00 0.00 ?  64  PHE C CE1  1  
ATOM 10433  C CE2  . PHE C 1 64  ? -8.981  -12.014 162.121 1.00 0.00 ?  64  PHE C CE2  1  
ATOM 10434  C CZ   . PHE C 1 64  ? -8.791  -12.505 163.388 1.00 0.00 ?  64  PHE C CZ   1  
ATOM 10435  H H    . PHE C 1 64  ? -13.577 -11.534 164.115 1.00 0.00 ?  64  PHE C H    1  
ATOM 10436  H HA   . PHE C 1 64  ? -12.798 -10.023 161.903 1.00 0.00 ?  64  PHE C HA   1  
ATOM 10437  H HB2  . PHE C 1 64  ? -13.300 -13.038 162.202 1.00 0.00 ?  64  PHE C HB2  1  
ATOM 10438  H HB3  . PHE C 1 64  ? -12.640 -12.293 160.696 1.00 0.00 ?  64  PHE C HB3  1  
ATOM 10439  H HD1  . PHE C 1 64  ? -11.989 -13.080 164.223 1.00 0.00 ?  64  PHE C HD1  1  
ATOM 10440  H HD2  . PHE C 1 64  ? -10.395 -11.519 160.609 1.00 0.00 ?  64  PHE C HD2  1  
ATOM 10441  H HE1  . PHE C 1 64  ? -9.723  -13.275 165.138 1.00 0.00 ?  64  PHE C HE1  1  
ATOM 10442  H HE2  . PHE C 1 64  ? -8.132  -11.715 161.527 1.00 0.00 ?  64  PHE C HE2  1  
ATOM 10443  H HZ   . PHE C 1 64  ? -7.793  -12.591 163.791 1.00 0.00 ?  64  PHE C HZ   1  
ATOM 10444  N N    . ALA C 1 65  ? -15.737 -11.513 161.698 1.00 0.00 ?  65  ALA C N    1  
ATOM 10445  C CA   . ALA C 1 65  ? -16.946 -11.525 160.913 1.00 0.00 ?  65  ALA C CA   1  
ATOM 10446  C C    . ALA C 1 65  ? -17.540 -10.145 160.868 1.00 0.00 ?  65  ALA C C    1  
ATOM 10447  O O    . ALA C 1 65  ? -18.012 -9.698  159.829 1.00 0.00 ?  65  ALA C O    1  
ATOM 10448  C CB   . ALA C 1 65  ? -18.019 -12.471 161.476 1.00 0.00 ?  65  ALA C CB   1  
ATOM 10449  H H    . ALA C 1 65  ? -15.748 -12.032 162.554 1.00 0.00 ?  65  ALA C H    1  
ATOM 10450  H HA   . ALA C 1 65  ? -16.680 -11.825 159.912 1.00 0.00 ?  65  ALA C HA   1  
ATOM 10451  H HB1  . ALA C 1 65  ? -17.640 -12.985 162.385 1.00 0.00 ?  65  ALA C HB1  1  
ATOM 10452  H HB2  . ALA C 1 65  ? -18.290 -13.239 160.721 1.00 0.00 ?  65  ALA C HB2  1  
ATOM 10453  H HB3  . ALA C 1 65  ? -18.933 -11.901 161.747 1.00 0.00 ?  65  ALA C HB3  1  
ATOM 10454  N N    . SER C 1 66  ? -17.529 -9.451  162.018 1.00 0.00 ?  66  SER C N    1  
ATOM 10455  C CA   . SER C 1 66  ? -18.105 -8.138  162.120 1.00 0.00 ?  66  SER C CA   1  
ATOM 10456  C C    . SER C 1 66  ? -17.378 -7.201  161.221 1.00 0.00 ?  66  SER C C    1  
ATOM 10457  O O    . SER C 1 66  ? -17.995 -6.377  160.558 1.00 0.00 ?  66  SER C O    1  
ATOM 10458  C CB   . SER C 1 66  ? -18.038 -7.559  163.542 1.00 0.00 ?  66  SER C CB   1  
ATOM 10459  O OG   . SER C 1 66  ? -18.619 -6.264  163.568 1.00 0.00 ?  66  SER C OG   1  
ATOM 10460  H H    . SER C 1 66  ? -17.131 -9.816  162.847 1.00 0.00 ?  66  SER C H    1  
ATOM 10461  H HA   . SER C 1 66  ? -19.132 -8.209  161.799 1.00 0.00 ?  66  SER C HA   1  
ATOM 10462  H HB2  . SER C 1 66  ? -18.592 -8.215  164.247 1.00 0.00 ?  66  SER C HB2  1  
ATOM 10463  H HB3  . SER C 1 66  ? -16.981 -7.483  163.873 1.00 0.00 ?  66  SER C HB3  1  
ATOM 10464  H HG   . SER C 1 66  ? -17.950 -5.681  163.933 1.00 0.00 ?  66  SER C HG   1  
ATOM 10465  N N    . LEU C 1 67  ? -16.039 -7.296  161.208 1.00 0.00 ?  67  LEU C N    1  
ATOM 10466  C CA   . LEU C 1 67  ? -15.243 -6.420  160.403 1.00 0.00 ?  67  LEU C CA   1  
ATOM 10467  C C    . LEU C 1 67  ? -15.597 -6.652  158.969 1.00 0.00 ?  67  LEU C C    1  
ATOM 10468  O O    . LEU C 1 67  ? -15.720 -5.705  158.207 1.00 0.00 ?  67  LEU C O    1  
ATOM 10469  C CB   . LEU C 1 67  ? -13.729 -6.651  160.577 1.00 0.00 ?  67  LEU C CB   1  
ATOM 10470  C CG   . LEU C 1 67  ? -12.864 -5.699  159.729 1.00 0.00 ?  67  LEU C CG   1  
ATOM 10471  C CD1  . LEU C 1 67  ? -13.118 -4.229  160.104 1.00 0.00 ?  67  LEU C CD1  1  
ATOM 10472  C CD2  . LEU C 1 67  ? -11.371 -6.051  159.850 1.00 0.00 ?  67  LEU C CD2  1  
ATOM 10473  H H    . LEU C 1 67  ? -15.549 -7.963  161.754 1.00 0.00 ?  67  LEU C H    1  
ATOM 10474  H HA   . LEU C 1 67  ? -15.500 -5.406  160.671 1.00 0.00 ?  67  LEU C HA   1  
ATOM 10475  H HB2  . LEU C 1 67  ? -13.467 -6.520  161.650 1.00 0.00 ?  67  LEU C HB2  1  
ATOM 10476  H HB3  . LEU C 1 67  ? -13.489 -7.696  160.291 1.00 0.00 ?  67  LEU C HB3  1  
ATOM 10477  H HG   . LEU C 1 67  ? -13.151 -5.828  158.665 1.00 0.00 ?  67  LEU C HG   1  
ATOM 10478  H HD11 . LEU C 1 67  ? -13.597 -4.164  161.104 1.00 0.00 ?  67  LEU C HD11 1  
ATOM 10479  H HD12 . LEU C 1 67  ? -13.789 -3.752  159.358 1.00 0.00 ?  67  LEU C HD12 1  
ATOM 10480  H HD13 . LEU C 1 67  ? -12.160 -3.667  160.132 1.00 0.00 ?  67  LEU C HD13 1  
ATOM 10481  H HD21 . LEU C 1 67  ? -11.249 -7.085  160.239 1.00 0.00 ?  67  LEU C HD21 1  
ATOM 10482  H HD22 . LEU C 1 67  ? -10.864 -5.349  160.546 1.00 0.00 ?  67  LEU C HD22 1  
ATOM 10483  H HD23 . LEU C 1 67  ? -10.877 -5.986  158.857 1.00 0.00 ?  67  LEU C HD23 1  
ATOM 10484  N N    . ALA C 1 68  ? -15.747 -7.929  158.569 1.00 0.00 ?  68  ALA C N    1  
ATOM 10485  C CA   . ALA C 1 68  ? -16.072 -8.233  157.199 1.00 0.00 ?  68  ALA C CA   1  
ATOM 10486  C C    . ALA C 1 68  ? -17.414 -7.645  156.859 1.00 0.00 ?  68  ALA C C    1  
ATOM 10487  O O    . ALA C 1 68  ? -17.608 -7.136  155.757 1.00 0.00 ?  68  ALA C O    1  
ATOM 10488  C CB   . ALA C 1 68  ? -16.140 -9.741  156.914 1.00 0.00 ?  68  ALA C CB   1  
ATOM 10489  H H    . ALA C 1 68  ? -15.643 -8.705  159.188 1.00 0.00 ?  68  ALA C H    1  
ATOM 10490  H HA   . ALA C 1 68  ? -15.319 -7.774  156.577 1.00 0.00 ?  68  ALA C HA   1  
ATOM 10491  H HB1  . ALA C 1 68  ? -16.924 -9.956  156.155 1.00 0.00 ?  68  ALA C HB1  1  
ATOM 10492  H HB2  . ALA C 1 68  ? -16.386 -10.299 157.843 1.00 0.00 ?  68  ALA C HB2  1  
ATOM 10493  H HB3  . ALA C 1 68  ? -15.165 -10.107 156.528 1.00 0.00 ?  68  ALA C HB3  1  
ATOM 10494  N N    . ALA C 1 69  ? -18.382 -7.740  157.792 1.00 0.00 ?  69  ALA C N    1  
ATOM 10495  C CA   . ALA C 1 69  ? -19.703 -7.219  157.538 1.00 0.00 ?  69  ALA C CA   1  
ATOM 10496  C C    . ALA C 1 69  ? -19.620 -5.735  157.340 1.00 0.00 ?  69  ALA C C    1  
ATOM 10497  O O    . ALA C 1 69  ? -20.278 -5.183  156.459 1.00 0.00 ?  69  ALA C O    1  
ATOM 10498  C CB   . ALA C 1 69  ? -20.687 -7.483  158.688 1.00 0.00 ?  69  ALA C CB   1  
ATOM 10499  H H    . ALA C 1 69  ? -18.237 -8.176  158.671 1.00 0.00 ?  69  ALA C H    1  
ATOM 10500  H HA   . ALA C 1 69  ? -20.063 -7.676  156.630 1.00 0.00 ?  69  ALA C HA   1  
ATOM 10501  H HB1  . ALA C 1 69  ? -20.771 -6.586  159.338 1.00 0.00 ?  69  ALA C HB1  1  
ATOM 10502  H HB2  . ALA C 1 69  ? -20.338 -8.338  159.306 1.00 0.00 ?  69  ALA C HB2  1  
ATOM 10503  H HB3  . ALA C 1 69  ? -21.694 -7.725  158.286 1.00 0.00 ?  69  ALA C HB3  1  
ATOM 10504  N N    . LEU C 1 70  ? -18.801 -5.057  158.168 1.00 0.00 ?  70  LEU C N    1  
ATOM 10505  C CA   . LEU C 1 70  ? -18.668 -3.627  158.069 1.00 0.00 ?  70  LEU C CA   1  
ATOM 10506  C C    . LEU C 1 70  ? -18.048 -3.294  156.754 1.00 0.00 ?  70  LEU C C    1  
ATOM 10507  O O    . LEU C 1 70  ? -18.403 -2.297  156.142 1.00 0.00 ?  70  LEU C O    1  
ATOM 10508  C CB   . LEU C 1 70  ? -17.797 -3.010  159.179 1.00 0.00 ?  70  LEU C CB   1  
ATOM 10509  C CG   . LEU C 1 70  ? -18.620 -2.470  160.369 1.00 0.00 ?  70  LEU C CG   1  
ATOM 10510  C CD1  . LEU C 1 70  ? -19.163 -1.062  160.074 1.00 0.00 ?  70  LEU C CD1  1  
ATOM 10511  C CD2  . LEU C 1 70  ? -19.757 -3.425  160.776 1.00 0.00 ?  70  LEU C CD2  1  
ATOM 10512  H H    . LEU C 1 70  ? -18.269 -5.504  158.877 1.00 0.00 ?  70  LEU C H    1  
ATOM 10513  H HA   . LEU C 1 70  ? -19.662 -3.209  158.100 1.00 0.00 ?  70  LEU C HA   1  
ATOM 10514  H HB2  . LEU C 1 70  ? -17.086 -3.781  159.549 1.00 0.00 ?  70  LEU C HB2  1  
ATOM 10515  H HB3  . LEU C 1 70  ? -17.205 -2.174  158.750 1.00 0.00 ?  70  LEU C HB3  1  
ATOM 10516  H HG   . LEU C 1 70  ? -17.929 -2.384  161.236 1.00 0.00 ?  70  LEU C HG   1  
ATOM 10517  H HD11 . LEU C 1 70  ? -20.012 -1.117  159.360 1.00 0.00 ?  70  LEU C HD11 1  
ATOM 10518  H HD12 . LEU C 1 70  ? -18.366 -0.427  159.628 1.00 0.00 ?  70  LEU C HD12 1  
ATOM 10519  H HD13 . LEU C 1 70  ? -19.517 -0.580  161.010 1.00 0.00 ?  70  LEU C HD13 1  
ATOM 10520  H HD21 . LEU C 1 70  ? -19.427 -4.480  160.694 1.00 0.00 ?  70  LEU C HD21 1  
ATOM 10521  H HD22 . LEU C 1 70  ? -20.641 -3.278  160.118 1.00 0.00 ?  70  LEU C HD22 1  
ATOM 10522  H HD23 . LEU C 1 70  ? -20.064 -3.231  161.826 1.00 0.00 ?  70  LEU C HD23 1  
ATOM 10523  N N    . PHE C 1 71  ? -17.080 -4.115  156.312 1.00 0.00 ?  71  PHE C N    1  
ATOM 10524  C CA   . PHE C 1 71  ? -16.427 -3.883  155.053 1.00 0.00 ?  71  PHE C CA   1  
ATOM 10525  C C    . PHE C 1 71  ? -17.421 -3.910  153.942 1.00 0.00 ?  71  PHE C C    1  
ATOM 10526  O O    . PHE C 1 71  ? -17.414 -3.030  153.088 1.00 0.00 ?  71  PHE C O    1  
ATOM 10527  C CB   . PHE C 1 71  ? -15.362 -4.929  154.704 1.00 0.00 ?  71  PHE C CB   1  
ATOM 10528  C CG   . PHE C 1 71  ? -15.149 -5.025  153.235 1.00 0.00 ?  71  PHE C CG   1  
ATOM 10529  C CD1  . PHE C 1 71  ? -15.601 -6.133  152.553 1.00 0.00 ?  71  PHE C CD1  1  
ATOM 10530  C CD2  . PHE C 1 71  ? -14.551 -4.003  152.534 1.00 0.00 ?  71  PHE C CD2  1  
ATOM 10531  C CE1  . PHE C 1 71  ? -15.458 -6.222  151.192 1.00 0.00 ?  71  PHE C CE1  1  
ATOM 10532  C CE2  . PHE C 1 71  ? -14.401 -4.095  151.169 1.00 0.00 ?  71  PHE C CE2  1  
ATOM 10533  C CZ   . PHE C 1 71  ? -14.859 -5.205  150.500 1.00 0.00 ?  71  PHE C CZ   1  
ATOM 10534  H H    . PHE C 1 71  ? -16.767 -4.898  156.833 1.00 0.00 ?  71  PHE C H    1  
ATOM 10535  H HA   . PHE C 1 71  ? -15.978 -2.904  155.099 1.00 0.00 ?  71  PHE C HA   1  
ATOM 10536  H HB2  . PHE C 1 71  ? -14.390 -4.657  155.167 1.00 0.00 ?  71  PHE C HB2  1  
ATOM 10537  H HB3  . PHE C 1 71  ? -15.668 -5.931  155.067 1.00 0.00 ?  71  PHE C HB3  1  
ATOM 10538  H HD1  . PHE C 1 71  ? -16.072 -6.940  153.095 1.00 0.00 ?  71  PHE C HD1  1  
ATOM 10539  H HD2  . PHE C 1 71  ? -14.189 -3.130  153.057 1.00 0.00 ?  71  PHE C HD2  1  
ATOM 10540  H HE1  . PHE C 1 71  ? -15.817 -7.095  150.667 1.00 0.00 ?  71  PHE C HE1  1  
ATOM 10541  H HE2  . PHE C 1 71  ? -13.928 -3.293  150.622 1.00 0.00 ?  71  PHE C HE2  1  
ATOM 10542  H HZ   . PHE C 1 71  ? -14.755 -5.274  149.429 1.00 0.00 ?  71  PHE C HZ   1  
ATOM 10543  N N    . VAL C 1 72  ? -18.280 -4.940  153.915 1.00 0.00 ?  72  VAL C N    1  
ATOM 10544  C CA   . VAL C 1 72  ? -19.237 -5.066  152.851 1.00 0.00 ?  72  VAL C CA   1  
ATOM 10545  C C    . VAL C 1 72  ? -20.172 -3.892  152.853 1.00 0.00 ?  72  VAL C C    1  
ATOM 10546  O O    . VAL C 1 72  ? -20.452 -3.319  151.802 1.00 0.00 ?  72  VAL C O    1  
ATOM 10547  C CB   . VAL C 1 72  ? -20.075 -6.306  152.965 1.00 0.00 ?  72  VAL C CB   1  
ATOM 10548  C CG1  . VAL C 1 72  ? -21.201 -6.225  151.920 1.00 0.00 ?  72  VAL C CG1  1  
ATOM 10549  C CG2  . VAL C 1 72  ? -19.161 -7.527  152.763 1.00 0.00 ?  72  VAL C CG2  1  
ATOM 10550  H H    . VAL C 1 72  ? -18.288 -5.652  154.613 1.00 0.00 ?  72  VAL C H    1  
ATOM 10551  H HA   . VAL C 1 72  ? -18.688 -5.075  151.922 1.00 0.00 ?  72  VAL C HA   1  
ATOM 10552  H HB   . VAL C 1 72  ? -20.528 -6.364  153.977 1.00 0.00 ?  72  VAL C HB   1  
ATOM 10553  H HG11 . VAL C 1 72  ? -22.072 -5.672  152.333 1.00 0.00 ?  72  VAL C HG11 1  
ATOM 10554  H HG12 . VAL C 1 72  ? -21.533 -7.245  151.631 1.00 0.00 ?  72  VAL C HG12 1  
ATOM 10555  H HG13 . VAL C 1 72  ? -20.845 -5.697  151.008 1.00 0.00 ?  72  VAL C HG13 1  
ATOM 10556  H HG21 . VAL C 1 72  ? -19.696 -8.321  152.200 1.00 0.00 ?  72  VAL C HG21 1  
ATOM 10557  H HG22 . VAL C 1 72  ? -18.846 -7.939  153.746 1.00 0.00 ?  72  VAL C HG22 1  
ATOM 10558  H HG23 . VAL C 1 72  ? -18.252 -7.238  152.193 1.00 0.00 ?  72  VAL C HG23 1  
ATOM 10559  N N    . VAL C 1 73  ? -20.683 -3.510  154.039 1.00 0.00 ?  73  VAL C N    1  
ATOM 10560  C CA   . VAL C 1 73  ? -21.629 -2.426  154.111 1.00 0.00 ?  73  VAL C CA   1  
ATOM 10561  C C    . VAL C 1 73  ? -20.998 -1.135  153.668 1.00 0.00 ?  73  VAL C C    1  
ATOM 10562  O O    . VAL C 1 73  ? -21.585 -0.388  152.893 1.00 0.00 ?  73  VAL C O    1  
ATOM 10563  C CB   . VAL C 1 73  ? -22.162 -2.209  155.497 1.00 0.00 ?  73  VAL C CB   1  
ATOM 10564  C CG1  . VAL C 1 73  ? -22.981 -0.907  155.503 1.00 0.00 ?  73  VAL C CG1  1  
ATOM 10565  C CG2  . VAL C 1 73  ? -22.995 -3.439  155.891 1.00 0.00 ?  73  VAL C CG2  1  
ATOM 10566  H H    . VAL C 1 73  ? -20.424 -3.938  154.902 1.00 0.00 ?  73  VAL C H    1  
ATOM 10567  H HA   . VAL C 1 73  ? -22.439 -2.663  153.440 1.00 0.00 ?  73  VAL C HA   1  
ATOM 10568  H HB   . VAL C 1 73  ? -21.318 -2.105  156.213 1.00 0.00 ?  73  VAL C HB   1  
ATOM 10569  H HG11 . VAL C 1 73  ? -22.319 -0.034  155.688 1.00 0.00 ?  73  VAL C HG11 1  
ATOM 10570  H HG12 . VAL C 1 73  ? -23.753 -0.941  156.301 1.00 0.00 ?  73  VAL C HG12 1  
ATOM 10571  H HG13 . VAL C 1 73  ? -23.489 -0.766  154.525 1.00 0.00 ?  73  VAL C HG13 1  
ATOM 10572  H HG21 . VAL C 1 73  ? -23.043 -4.160  155.047 1.00 0.00 ?  73  VAL C HG21 1  
ATOM 10573  H HG22 . VAL C 1 73  ? -24.031 -3.135  156.156 1.00 0.00 ?  73  VAL C HG22 1  
ATOM 10574  H HG23 . VAL C 1 73  ? -22.541 -3.949  156.768 1.00 0.00 ?  73  VAL C HG23 1  
ATOM 10575  N N    . ASN C 1 74  ? -19.786 -0.840  154.164 1.00 0.00 ?  74  ASN C N    1  
ATOM 10576  C CA   . ASN C 1 74  ? -19.142 0.406   153.835 1.00 0.00 ?  74  ASN C CA   1  
ATOM 10577  C C    . ASN C 1 74  ? -18.835 0.456   152.373 1.00 0.00 ?  74  ASN C C    1  
ATOM 10578  O O    . ASN C 1 74  ? -18.967 1.499   151.734 1.00 0.00 ?  74  ASN C O    1  
ATOM 10579  C CB   . ASN C 1 74  ? -17.821 0.615   154.593 1.00 0.00 ?  74  ASN C CB   1  
ATOM 10580  C CG   . ASN C 1 74  ? -18.053 0.900   156.069 1.00 0.00 ?  74  ASN C CG   1  
ATOM 10581  O OD1  . ASN C 1 74  ? -19.141 1.306   156.473 1.00 0.00 ?  74  ASN C OD1  1  
ATOM 10582  N ND2  . ASN C 1 74  ? -17.000 0.681   156.903 1.00 0.00 ?  74  ASN C ND2  1  
ATOM 10583  H H    . ASN C 1 74  ? -19.279 -1.464  154.743 1.00 0.00 ?  74  ASN C H    1  
ATOM 10584  H HA   . ASN C 1 74  ? -19.831 1.199   154.075 1.00 0.00 ?  74  ASN C HA   1  
ATOM 10585  H HB2  . ASN C 1 74  ? -17.191 -0.296  154.497 1.00 0.00 ?  74  ASN C HB2  1  
ATOM 10586  H HB3  . ASN C 1 74  ? -17.269 1.469   154.146 1.00 0.00 ?  74  ASN C HB3  1  
ATOM 10587  H HD21 . ASN C 1 74  ? -16.131 0.351   156.535 1.00 0.00 ?  74  ASN C HD21 1  
ATOM 10588  H HD22 . ASN C 1 74  ? -17.096 0.851   157.884 1.00 0.00 ?  74  ASN C HD22 1  
ATOM 10589  N N    . ASN C 1 75  ? -18.396 -0.677  151.814 1.00 0.00 ?  75  ASN C N    1  
ATOM 10590  C CA   . ASN C 1 75  ? -18.029 -0.703  150.433 1.00 0.00 ?  75  ASN C CA   1  
ATOM 10591  C C    . ASN C 1 75  ? -19.234 -0.468  149.572 1.00 0.00 ?  75  ASN C C    1  
ATOM 10592  O O    . ASN C 1 75  ? -19.145 0.221   148.556 1.00 0.00 ?  75  ASN C O    1  
ATOM 10593  C CB   . ASN C 1 75  ? -17.389 -2.021  149.999 1.00 0.00 ?  75  ASN C CB   1  
ATOM 10594  C CG   . ASN C 1 75  ? -16.799 -1.891  148.612 1.00 0.00 ?  75  ASN C CG   1  
ATOM 10595  O OD1  . ASN C 1 75  ? -17.494 -2.003  147.609 1.00 0.00 ?  75  ASN C OD1  1  
ATOM 10596  N ND2  . ASN C 1 75  ? -15.475 -1.608  148.558 1.00 0.00 ?  75  ASN C ND2  1  
ATOM 10597  H H    . ASN C 1 75  ? -18.308 -1.526  152.317 1.00 0.00 ?  75  ASN C H    1  
ATOM 10598  H HA   . ASN C 1 75  ? -17.334 0.105   150.278 1.00 0.00 ?  75  ASN C HA   1  
ATOM 10599  H HB2  . ASN C 1 75  ? -16.584 -2.298  150.714 1.00 0.00 ?  75  ASN C HB2  1  
ATOM 10600  H HB3  . ASN C 1 75  ? -18.153 -2.826  149.993 1.00 0.00 ?  75  ASN C HB3  1  
ATOM 10601  H HD21 . ASN C 1 75  ? -14.952 -1.500  149.404 1.00 0.00 ?  75  ASN C HD21 1  
ATOM 10602  H HD22 . ASN C 1 75  ? -15.018 -1.502  147.672 1.00 0.00 ?  75  ASN C HD22 1  
ATOM 10603  N N    . THR C 1 76  ? -20.395 -1.047  149.942 1.00 0.00 ?  76  THR C N    1  
ATOM 10604  C CA   . THR C 1 76  ? -21.565 -0.887  149.118 1.00 0.00 ?  76  THR C CA   1  
ATOM 10605  C C    . THR C 1 76  ? -22.006 0.543   149.160 1.00 0.00 ?  76  THR C C    1  
ATOM 10606  O O    . THR C 1 76  ? -22.565 1.039   148.182 1.00 0.00 ?  76  THR C O    1  
ATOM 10607  C CB   . THR C 1 76  ? -22.727 -1.742  149.539 1.00 0.00 ?  76  THR C CB   1  
ATOM 10608  O OG1  . THR C 1 76  ? -23.114 -1.427  150.868 1.00 0.00 ?  76  THR C OG1  1  
ATOM 10609  C CG2  . THR C 1 76  ? -22.311 -3.218  149.442 1.00 0.00 ?  76  THR C CG2  1  
ATOM 10610  H H    . THR C 1 76  ? -20.489 -1.604  150.763 1.00 0.00 ?  76  THR C H    1  
ATOM 10611  H HA   . THR C 1 76  ? -21.276 -1.130  148.107 1.00 0.00 ?  76  THR C HA   1  
ATOM 10612  H HB   . THR C 1 76  ? -23.590 -1.573  148.864 1.00 0.00 ?  76  THR C HB   1  
ATOM 10613  H HG1  . THR C 1 76  ? -24.005 -1.770  150.972 1.00 0.00 ?  76  THR C HG1  1  
ATOM 10614  H HG21 . THR C 1 76  ? -22.940 -3.748  148.694 1.00 0.00 ?  76  THR C HG21 1  
ATOM 10615  H HG22 . THR C 1 76  ? -22.435 -3.719  150.426 1.00 0.00 ?  76  THR C HG22 1  
ATOM 10616  H HG23 . THR C 1 76  ? -21.248 -3.301  149.132 1.00 0.00 ?  76  THR C HG23 1  
ATOM 10617  N N    . LEU C 1 77  ? -21.791 1.236   150.300 1.00 0.00 ?  77  LEU C N    1  
ATOM 10618  C CA   . LEU C 1 77  ? -22.186 2.621   150.386 1.00 0.00 ?  77  LEU C CA   1  
ATOM 10619  C C    . LEU C 1 77  ? -21.384 3.389   149.382 1.00 0.00 ?  77  LEU C C    1  
ATOM 10620  O O    . LEU C 1 77  ? -21.890 4.308   148.739 1.00 0.00 ?  77  LEU C O    1  
ATOM 10621  C CB   . LEU C 1 77  ? -21.956 3.256   151.770 1.00 0.00 ?  77  LEU C CB   1  
ATOM 10622  C CG   . LEU C 1 77  ? -22.920 2.715   152.840 1.00 0.00 ?  77  LEU C CG   1  
ATOM 10623  C CD1  . LEU C 1 77  ? -22.517 3.183   154.248 1.00 0.00 ?  77  LEU C CD1  1  
ATOM 10624  C CD2  . LEU C 1 77  ? -24.378 3.094   152.524 1.00 0.00 ?  77  LEU C CD2  1  
ATOM 10625  H H    . LEU C 1 77  ? -21.383 0.828   151.115 1.00 0.00 ?  77  LEU C H    1  
ATOM 10626  H HA   . LEU C 1 77  ? -23.229 2.676   150.117 1.00 0.00 ?  77  LEU C HA   1  
ATOM 10627  H HB2  . LEU C 1 77  ? -20.909 3.060   152.089 1.00 0.00 ?  77  LEU C HB2  1  
ATOM 10628  H HB3  . LEU C 1 77  ? -22.093 4.355   151.692 1.00 0.00 ?  77  LEU C HB3  1  
ATOM 10629  H HG   . LEU C 1 77  ? -22.853 1.609   152.823 1.00 0.00 ?  77  LEU C HG   1  
ATOM 10630  H HD11 . LEU C 1 77  ? -23.361 3.044   154.957 1.00 0.00 ?  77  LEU C HD11 1  
ATOM 10631  H HD12 . LEU C 1 77  ? -22.241 4.259   154.232 1.00 0.00 ?  77  LEU C HD12 1  
ATOM 10632  H HD13 . LEU C 1 77  ? -21.646 2.599   154.614 1.00 0.00 ?  77  LEU C HD13 1  
ATOM 10633  H HD21 . LEU C 1 77  ? -24.775 2.452   151.710 1.00 0.00 ?  77  LEU C HD21 1  
ATOM 10634  H HD22 . LEU C 1 77  ? -24.439 4.155   152.202 1.00 0.00 ?  77  LEU C HD22 1  
ATOM 10635  H HD23 . LEU C 1 77  ? -25.014 2.959   153.425 1.00 0.00 ?  77  LEU C HD23 1  
ATOM 10636  N N    . PHE C 1 78  ? -20.093 3.031   149.248 1.00 0.00 ?  78  PHE C N    1  
ATOM 10637  C CA   . PHE C 1 78  ? -19.239 3.694   148.299 1.00 0.00 ?  78  PHE C CA   1  
ATOM 10638  C C    . PHE C 1 78  ? -19.780 3.472   146.919 1.00 0.00 ?  78  PHE C C    1  
ATOM 10639  O O    . PHE C 1 78  ? -19.763 4.378   146.091 1.00 0.00 ?  78  PHE C O    1  
ATOM 10640  C CB   . PHE C 1 78  ? -17.791 3.201   148.287 1.00 0.00 ?  78  PHE C CB   1  
ATOM 10641  C CG   . PHE C 1 78  ? -16.955 3.949   147.306 1.00 0.00 ?  78  PHE C CG   1  
ATOM 10642  C CD1  . PHE C 1 78  ? -16.737 3.446   146.044 1.00 0.00 ?  78  PHE C CD1  1  
ATOM 10643  C CD2  . PHE C 1 78  ? -16.398 5.156   147.648 1.00 0.00 ?  78  PHE C CD2  1  
ATOM 10644  C CE1  . PHE C 1 78  ? -15.973 4.138   145.138 1.00 0.00 ?  78  PHE C CE1  1  
ATOM 10645  C CE2  . PHE C 1 78  ? -15.634 5.848   146.742 1.00 0.00 ?  78  PHE C CE2  1  
ATOM 10646  C CZ   . PHE C 1 78  ? -15.421 5.341   145.488 1.00 0.00 ?  78  PHE C CZ   1  
ATOM 10647  H H    . PHE C 1 78  ? -19.674 2.311   149.800 1.00 0.00 ?  78  PHE C H    1  
ATOM 10648  H HA   . PHE C 1 78  ? -19.270 4.750   148.521 1.00 0.00 ?  78  PHE C HA   1  
ATOM 10649  H HB2  . PHE C 1 78  ? -17.331 3.333   149.288 1.00 0.00 ?  78  PHE C HB2  1  
ATOM 10650  H HB3  . PHE C 1 78  ? -17.754 2.125   148.009 1.00 0.00 ?  78  PHE C HB3  1  
ATOM 10651  H HD1  . PHE C 1 78  ? -17.171 2.498   145.764 1.00 0.00 ?  78  PHE C HD1  1  
ATOM 10652  H HD2  . PHE C 1 78  ? -16.562 5.563   148.635 1.00 0.00 ?  78  PHE C HD2  1  
ATOM 10653  H HE1  . PHE C 1 78  ? -15.808 3.736   144.152 1.00 0.00 ?  78  PHE C HE1  1  
ATOM 10654  H HE2  . PHE C 1 78  ? -15.200 6.794   147.019 1.00 0.00 ?  78  PHE C HE2  1  
ATOM 10655  H HZ   . PHE C 1 78  ? -14.819 5.888   144.777 1.00 0.00 ?  78  PHE C HZ   1  
ATOM 10656  N N    . ALA C 1 79  ? -20.211 2.227   146.632 1.00 0.00 ?  79  ALA C N    1  
ATOM 10657  C CA   . ALA C 1 79  ? -20.713 1.891   145.320 1.00 0.00 ?  79  ALA C CA   1  
ATOM 10658  C C    . ALA C 1 79  ? -21.892 2.762   145.009 1.00 0.00 ?  79  ALA C C    1  
ATOM 10659  O O    . ALA C 1 79  ? -22.081 3.168   143.863 1.00 0.00 ?  79  ALA C O    1  
ATOM 10660  C CB   . ALA C 1 79  ? -21.169 0.428   145.204 1.00 0.00 ?  79  ALA C CB   1  
ATOM 10661  H H    . ALA C 1 79  ? -20.189 1.488   147.301 1.00 0.00 ?  79  ALA C H    1  
ATOM 10662  H HA   . ALA C 1 79  ? -19.926 2.092   144.610 1.00 0.00 ?  79  ALA C HA   1  
ATOM 10663  H HB1  . ALA C 1 79  ? -22.266 0.353   145.365 1.00 0.00 ?  79  ALA C HB1  1  
ATOM 10664  H HB2  . ALA C 1 79  ? -20.656 -0.198  145.964 1.00 0.00 ?  79  ALA C HB2  1  
ATOM 10665  H HB3  . ALA C 1 79  ? -20.931 0.028   144.195 1.00 0.00 ?  79  ALA C HB3  1  
ATOM 10666  N N    . LEU C 1 80  ? -22.738 3.034   146.015 1.00 0.00 ?  80  LEU C N    1  
ATOM 10667  C CA   . LEU C 1 80  ? -23.887 3.870   145.790 1.00 0.00 ?  80  LEU C CA   1  
ATOM 10668  C C    . LEU C 1 80  ? -23.405 5.239   145.388 1.00 0.00 ?  80  LEU C C    1  
ATOM 10669  O O    . LEU C 1 80  ? -24.002 5.888   144.528 1.00 0.00 ?  80  LEU C O    1  
ATOM 10670  C CB   . LEU C 1 80  ? -24.779 4.029   147.034 1.00 0.00 ?  80  LEU C CB   1  
ATOM 10671  C CG   . LEU C 1 80  ? -25.515 2.730   147.403 1.00 0.00 ?  80  LEU C CG   1  
ATOM 10672  C CD1  . LEU C 1 80  ? -26.217 2.852   148.766 1.00 0.00 ?  80  LEU C CD1  1  
ATOM 10673  C CD2  . LEU C 1 80  ? -26.507 2.315   146.302 1.00 0.00 ?  80  LEU C CD2  1  
ATOM 10674  H H    . LEU C 1 80  ? -22.622 2.661   146.931 1.00 0.00 ?  80  LEU C H    1  
ATOM 10675  H HA   . LEU C 1 80  ? -24.449 3.440   144.976 1.00 0.00 ?  80  LEU C HA   1  
ATOM 10676  H HB2  . LEU C 1 80  ? -24.149 4.349   147.893 1.00 0.00 ?  80  LEU C HB2  1  
ATOM 10677  H HB3  . LEU C 1 80  ? -25.531 4.822   146.844 1.00 0.00 ?  80  LEU C HB3  1  
ATOM 10678  H HG   . LEU C 1 80  ? -24.754 1.926   147.489 1.00 0.00 ?  80  LEU C HG   1  
ATOM 10679  H HD11 . LEU C 1 80  ? -26.970 3.668   148.741 1.00 0.00 ?  80  LEU C HD11 1  
ATOM 10680  H HD12 . LEU C 1 80  ? -25.476 3.077   149.562 1.00 0.00 ?  80  LEU C HD12 1  
ATOM 10681  H HD13 . LEU C 1 80  ? -26.733 1.901   149.021 1.00 0.00 ?  80  LEU C HD13 1  
ATOM 10682  H HD21 . LEU C 1 80  ? -26.817 3.200   145.708 1.00 0.00 ?  80  LEU C HD21 1  
ATOM 10683  H HD22 . LEU C 1 80  ? -27.412 1.854   146.752 1.00 0.00 ?  80  LEU C HD22 1  
ATOM 10684  H HD23 . LEU C 1 80  ? -26.036 1.576   145.618 1.00 0.00 ?  80  LEU C HD23 1  
ATOM 10685  N N    . LEU C 1 81  ? -22.311 5.714   146.020 1.00 0.00 ?  81  LEU C N    1  
ATOM 10686  C CA   . LEU C 1 81  ? -21.779 7.023   145.702 1.00 0.00 ?  81  LEU C CA   1  
ATOM 10687  C C    . LEU C 1 81  ? -21.305 7.022   144.272 1.00 0.00 ?  81  LEU C C    1  
ATOM 10688  O O    . LEU C 1 81  ? -21.349 8.041   143.601 1.00 0.00 ?  81  LEU C O    1  
ATOM 10689  C CB   . LEU C 1 81  ? -20.610 7.464   146.600 1.00 0.00 ?  81  LEU C CB   1  
ATOM 10690  C CG   . LEU C 1 81  ? -21.044 7.732   148.052 1.00 0.00 ?  81  LEU C CG   1  
ATOM 10691  C CD1  . LEU C 1 81  ? -19.829 7.961   148.965 1.00 0.00 ?  81  LEU C CD1  1  
ATOM 10692  C CD2  . LEU C 1 81  ? -22.032 8.909   148.136 1.00 0.00 ?  81  LEU C CD2  1  
ATOM 10693  H H    . LEU C 1 81  ? -21.839 5.202   146.735 1.00 0.00 ?  81  LEU C H    1  
ATOM 10694  H HA   . LEU C 1 81  ? -22.596 7.722   145.790 1.00 0.00 ?  81  LEU C HA   1  
ATOM 10695  H HB2  . LEU C 1 81  ? -19.822 6.683   146.591 1.00 0.00 ?  81  LEU C HB2  1  
ATOM 10696  H HB3  . LEU C 1 81  ? -20.176 8.396   146.187 1.00 0.00 ?  81  LEU C HB3  1  
ATOM 10697  H HG   . LEU C 1 81  ? -21.571 6.824   148.417 1.00 0.00 ?  81  LEU C HG   1  
ATOM 10698  H HD11 . LEU C 1 81  ? -19.060 7.180   148.787 1.00 0.00 ?  81  LEU C HD11 1  
ATOM 10699  H HD12 . LEU C 1 81  ? -20.136 7.921   150.033 1.00 0.00 ?  81  LEU C HD12 1  
ATOM 10700  H HD13 . LEU C 1 81  ? -19.377 8.956   148.764 1.00 0.00 ?  81  LEU C HD13 1  
ATOM 10701  H HD21 . LEU C 1 81  ? -21.801 9.545   149.017 1.00 0.00 ?  81  LEU C HD21 1  
ATOM 10702  H HD22 . LEU C 1 81  ? -23.073 8.533   148.234 1.00 0.00 ?  81  LEU C HD22 1  
ATOM 10703  H HD23 . LEU C 1 81  ? -21.967 9.535   147.220 1.00 0.00 ?  81  LEU C HD23 1  
ATOM 10704  N N    . TYR C 1 82  ? -20.746 5.895   143.808 1.00 0.00 ?  82  TYR C N    1  
ATOM 10705  C CA   . TYR C 1 82  ? -20.277 5.792   142.440 1.00 0.00 ?  82  TYR C CA   1  
ATOM 10706  C C    . TYR C 1 82  ? -21.422 6.049   141.486 1.00 0.00 ?  82  TYR C C    1  
ATOM 10707  O O    . TYR C 1 82  ? -21.234 6.615   140.410 1.00 0.00 ?  82  TYR C O    1  
ATOM 10708  C CB   . TYR C 1 82  ? -19.675 4.409   142.137 1.00 0.00 ?  82  TYR C CB   1  
ATOM 10709  C CG   . TYR C 1 82  ? -20.035 3.852   140.804 1.00 0.00 ?  82  TYR C CG   1  
ATOM 10710  C CD1  . TYR C 1 82  ? -20.976 2.847   140.709 1.00 0.00 ?  82  TYR C CD1  1  
ATOM 10711  C CD2  . TYR C 1 82  ? -19.433 4.311   139.656 1.00 0.00 ?  82  TYR C CD2  1  
ATOM 10712  C CE1  . TYR C 1 82  ? -21.303 2.310   139.488 1.00 0.00 ?  82  TYR C CE1  1  
ATOM 10713  C CE2  . TYR C 1 82  ? -19.769 3.773   138.437 1.00 0.00 ?  82  TYR C CE2  1  
ATOM 10714  C CZ   . TYR C 1 82  ? -20.698 2.777   138.353 1.00 0.00 ?  82  TYR C CZ   1  
ATOM 10715  O OH   . TYR C 1 82  ? -21.015 2.228   137.095 1.00 0.00 ?  82  TYR C OH   1  
ATOM 10716  H H    . TYR C 1 82  ? -20.607 5.097   144.385 1.00 0.00 ?  82  TYR C H    1  
ATOM 10717  H HA   . TYR C 1 82  ? -19.529 6.557   142.299 1.00 0.00 ?  82  TYR C HA   1  
ATOM 10718  H HB2  . TYR C 1 82  ? -18.567 4.473   142.167 1.00 0.00 ?  82  TYR C HB2  1  
ATOM 10719  H HB3  . TYR C 1 82  ? -20.001 3.678   142.904 1.00 0.00 ?  82  TYR C HB3  1  
ATOM 10720  H HD1  . TYR C 1 82  ? -21.456 2.477   141.603 1.00 0.00 ?  82  TYR C HD1  1  
ATOM 10721  H HD2  . TYR C 1 82  ? -18.696 5.099   139.713 1.00 0.00 ?  82  TYR C HD2  1  
ATOM 10722  H HE1  . TYR C 1 82  ? -22.042 1.525   139.422 1.00 0.00 ?  82  TYR C HE1  1  
ATOM 10723  H HE2  . TYR C 1 82  ? -19.303 4.133   137.542 1.00 0.00 ?  82  TYR C HE2  1  
ATOM 10724  H HH   . TYR C 1 82  ? -20.207 2.213   136.569 1.00 0.00 ?  82  TYR C HH   1  
ATOM 10725  N N    . GLN C 1 83  ? -22.631 5.631   141.881 1.00 0.00 ?  83  GLN C N    1  
ATOM 10726  C CA   . GLN C 1 83  ? -23.810 5.777   141.055 1.00 0.00 ?  83  GLN C CA   1  
ATOM 10727  C C    . GLN C 1 83  ? -24.423 7.147   141.237 1.00 0.00 ?  83  GLN C C    1  
ATOM 10728  O O    . GLN C 1 83  ? -25.471 7.415   140.651 1.00 0.00 ?  83  GLN C O    1  
ATOM 10729  C CB   . GLN C 1 83  ? -24.904 4.748   141.381 1.00 0.00 ?  83  GLN C CB   1  
ATOM 10730  C CG   . GLN C 1 83  ? -24.515 3.325   140.977 1.00 0.00 ?  83  GLN C CG   1  
ATOM 10731  C CD   . GLN C 1 83  ? -25.565 2.369   141.523 1.00 0.00 ?  83  GLN C CD   1  
ATOM 10732  O OE1  . GLN C 1 83  ? -26.177 2.624   142.559 1.00 0.00 ?  83  GLN C OE1  1  
ATOM 10733  N NE2  . GLN C 1 83  ? -25.787 1.238   140.804 1.00 0.00 ?  83  GLN C NE2  1  
ATOM 10734  H H    . GLN C 1 83  ? -22.770 5.189   142.764 1.00 0.00 ?  83  GLN C H    1  
ATOM 10735  H HA   . GLN C 1 83  ? -23.499 5.668   140.029 1.00 0.00 ?  83  GLN C HA   1  
ATOM 10736  H HB2  . GLN C 1 83  ? -25.110 4.774   142.473 1.00 0.00 ?  83  GLN C HB2  1  
ATOM 10737  H HB3  . GLN C 1 83  ? -25.837 5.030   140.849 1.00 0.00 ?  83  GLN C HB3  1  
ATOM 10738  H HG2  . GLN C 1 83  ? -24.469 3.241   139.869 1.00 0.00 ?  83  GLN C HG2  1  
ATOM 10739  H HG3  . GLN C 1 83  ? -23.523 3.062   141.403 1.00 0.00 ?  83  GLN C HG3  1  
ATOM 10740  H HE21 . GLN C 1 83  ? -25.269 1.069   139.965 1.00 0.00 ?  83  GLN C HE21 1  
ATOM 10741  H HE22 . GLN C 1 83  ? -26.466 0.573   141.115 1.00 0.00 ?  83  GLN C HE22 1  
ATOM 10742  N N    . LEU C 1 84  ? -23.793 8.028   142.067 1.00 0.00 ?  84  LEU C N    1  
ATOM 10743  C CA   . LEU C 1 84  ? -24.366 9.339   142.409 1.00 0.00 ?  84  LEU C CA   1  
ATOM 10744  C C    . LEU C 1 84  ? -24.831 10.138  141.212 1.00 0.00 ?  84  LEU C C    1  
ATOM 10745  O O    . LEU C 1 84  ? -25.877 10.762  141.317 1.00 0.00 ?  84  LEU C O    1  
ATOM 10746  C CB   . LEU C 1 84  ? -23.405 10.247  143.209 1.00 0.00 ?  84  LEU C CB   1  
ATOM 10747  C CG   . LEU C 1 84  ? -24.092 11.496  143.790 1.00 0.00 ?  84  LEU C CG   1  
ATOM 10748  C CD1  . LEU C 1 84  ? -23.639 11.764  145.235 1.00 0.00 ?  84  LEU C CD1  1  
ATOM 10749  C CD2  . LEU C 1 84  ? -23.862 12.729  142.898 1.00 0.00 ?  84  LEU C CD2  1  
ATOM 10750  H H    . LEU C 1 84  ? -22.920 7.811   142.497 1.00 0.00 ?  84  LEU C H    1  
ATOM 10751  H HA   . LEU C 1 84  ? -25.230 9.133   143.019 1.00 0.00 ?  84  LEU C HA   1  
ATOM 10752  H HB2  . LEU C 1 84  ? -22.974 9.662   144.046 1.00 0.00 ?  84  LEU C HB2  1  
ATOM 10753  H HB3  . LEU C 1 84  ? -22.575 10.571  142.548 1.00 0.00 ?  84  LEU C HB3  1  
ATOM 10754  H HG   . LEU C 1 84  ? -25.186 11.298  143.813 1.00 0.00 ?  84  LEU C HG   1  
ATOM 10755  H HD11 . LEU C 1 84  ? -24.343 12.461  145.738 1.00 0.00 ?  84  LEU C HD11 1  
ATOM 10756  H HD12 . LEU C 1 84  ? -22.625 12.218  145.243 1.00 0.00 ?  84  LEU C HD12 1  
ATOM 10757  H HD13 . LEU C 1 84  ? -23.607 10.815  145.811 1.00 0.00 ?  84  LEU C HD13 1  
ATOM 10758  H HD21 . LEU C 1 84  ? -24.819 13.267  142.729 1.00 0.00 ?  84  LEU C HD21 1  
ATOM 10759  H HD22 . LEU C 1 84  ? -23.450 12.421  141.914 1.00 0.00 ?  84  LEU C HD22 1  
ATOM 10760  H HD23 . LEU C 1 84  ? -23.144 13.426  143.381 1.00 0.00 ?  84  LEU C HD23 1  
ATOM 10761  N N    . GLY C 1 85  ? -24.148 10.137  140.049 1.00 0.00 ?  85  GLY C N    1  
ATOM 10762  C CA   . GLY C 1 85  ? -24.670 10.925  138.938 1.00 0.00 ?  85  GLY C CA   1  
ATOM 10763  C C    . GLY C 1 85  ? -23.605 11.783  138.351 1.00 0.00 ?  85  GLY C C    1  
ATOM 10764  O O    . GLY C 1 85  ? -23.869 12.574  137.453 1.00 0.00 ?  85  GLY C O    1  
ATOM 10765  H H    . GLY C 1 85  ? -23.304 9.627   139.901 1.00 0.00 ?  85  GLY C H    1  
ATOM 10766  H HA2  . GLY C 1 85  ? -24.997 10.230  138.183 1.00 0.00 ?  85  GLY C HA2  1  
ATOM 10767  H HA3  . GLY C 1 85  ? -25.455 11.564  139.309 1.00 0.00 ?  85  GLY C HA3  1  
ATOM 10768  N N    . ASP C 1 86  ? -22.378 11.653  138.849 1.00 0.00 ?  86  ASP C N    1  
ATOM 10769  C CA   . ASP C 1 86  ? -21.279 12.347  138.253 1.00 0.00 ?  86  ASP C CA   1  
ATOM 10770  C C    . ASP C 1 86  ? -20.914 11.440  137.124 1.00 0.00 ?  86  ASP C C    1  
ATOM 10771  O O    . ASP C 1 86  ? -21.566 10.409  136.955 1.00 0.00 ?  86  ASP C O    1  
ATOM 10772  C CB   . ASP C 1 86  ? -20.054 12.508  139.160 1.00 0.00 ?  86  ASP C CB   1  
ATOM 10773  C CG   . ASP C 1 86  ? -19.362 11.180  139.427 1.00 0.00 ?  86  ASP C CG   1  
ATOM 10774  O OD1  . ASP C 1 86  ? -18.104 11.163  139.426 1.00 0.00 ?  86  ASP C OD1  1  
ATOM 10775  O OD2  . ASP C 1 86  ? -20.080 10.168  139.647 1.00 0.00 -1 86  ASP C OD2  1  
ATOM 10776  H H    . ASP C 1 86  ? -22.174 11.084  139.641 1.00 0.00 ?  86  ASP C H    1  
ATOM 10777  H HA   . ASP C 1 86  ? -21.627 13.296  137.873 1.00 0.00 ?  86  ASP C HA   1  
ATOM 10778  H HB2  . ASP C 1 86  ? -19.333 13.196  138.675 1.00 0.00 ?  86  ASP C HB2  1  
ATOM 10779  H HB3  . ASP C 1 86  ? -20.366 12.951  140.130 1.00 0.00 ?  86  ASP C HB3  1  
ATOM 10780  N N    . ALA C 1 87  ? -19.955 11.812  136.252 1.00 0.00 ?  87  ALA C N    1  
ATOM 10781  C CA   . ALA C 1 87  ? -19.611 10.891  135.200 1.00 0.00 ?  87  ALA C CA   1  
ATOM 10782  C C    . ALA C 1 87  ? -19.165 9.631   135.932 1.00 0.00 ?  87  ALA C C    1  
ATOM 10783  O O    . ALA C 1 87  ? -18.301 9.700   136.801 1.00 0.00 ?  87  ALA C O    1  
ATOM 10784  C CB   . ALA C 1 87  ? -18.452 11.371  134.313 1.00 0.00 ?  87  ALA C CB   1  
ATOM 10785  H H    . ALA C 1 87  ? -19.469 12.682  136.292 1.00 0.00 ?  87  ALA C H    1  
ATOM 10786  H HA   . ALA C 1 87  ? -20.502 10.736  134.621 1.00 0.00 ?  87  ALA C HA   1  
ATOM 10787  H HB1  . ALA C 1 87  ? -17.612 10.645  134.351 1.00 0.00 ?  87  ALA C HB1  1  
ATOM 10788  H HB2  . ALA C 1 87  ? -18.082 12.358  134.662 1.00 0.00 ?  87  ALA C HB2  1  
ATOM 10789  H HB3  . ALA C 1 87  ? -18.789 11.469  133.259 1.00 0.00 ?  87  ALA C HB3  1  
ATOM 10790  N N    . PRO C 1 88  ? -19.743 8.477   135.618 1.00 0.00 ?  88  PRO C N    1  
ATOM 10791  C CA   . PRO C 1 88  ? -19.435 7.254   136.347 1.00 0.00 ?  88  PRO C CA   1  
ATOM 10792  C C    . PRO C 1 88  ? -18.098 6.673   136.059 1.00 0.00 ?  88  PRO C C    1  
ATOM 10793  O O    . PRO C 1 88  ? -17.494 6.962   135.030 1.00 0.00 ?  88  PRO C O    1  
ATOM 10794  C CB   . PRO C 1 88  ? -20.528 6.281   135.919 1.00 0.00 ?  88  PRO C CB   1  
ATOM 10795  C CG   . PRO C 1 88  ? -20.857 6.714   134.499 1.00 0.00 ?  88  PRO C CG   1  
ATOM 10796  C CD   . PRO C 1 88  ? -20.697 8.233   134.520 1.00 0.00 ?  88  PRO C CD   1  
ATOM 10797  H HA   . PRO C 1 88  ? -19.516 7.416   137.411 1.00 0.00 ?  88  PRO C HA   1  
ATOM 10798  H HB2  . PRO C 1 88  ? -20.156 5.235   135.937 1.00 0.00 ?  88  PRO C HB2  1  
ATOM 10799  H HB3  . PRO C 1 88  ? -21.420 6.376   136.573 1.00 0.00 ?  88  PRO C HB3  1  
ATOM 10800  H HG2  . PRO C 1 88  ? -20.151 6.249   133.777 1.00 0.00 ?  88  PRO C HG2  1  
ATOM 10801  H HG3  . PRO C 1 88  ? -21.897 6.434   134.236 1.00 0.00 ?  88  PRO C HG3  1  
ATOM 10802  H HD2  . PRO C 1 88  ? -20.294 8.594   133.550 1.00 0.00 ?  88  PRO C HD2  1  
ATOM 10803  H HD3  . PRO C 1 88  ? -21.674 8.723   134.719 1.00 0.00 ?  88  PRO C HD3  1  
ATOM 10804  N N    . ILE C 1 89  ? -17.604 5.835   137.006 1.00 0.00 ?  89  ILE C N    1  
ATOM 10805  C CA   . ILE C 1 89  ? -16.349 5.178   136.811 1.00 0.00 ?  89  ILE C CA   1  
ATOM 10806  C C    . ILE C 1 89  ? -16.696 3.833   136.274 1.00 0.00 ?  89  ILE C C    1  
ATOM 10807  O O    . ILE C 1 89  ? -17.258 2.981   136.959 1.00 0.00 ?  89  ILE C O    1  
ATOM 10808  C CB   . ILE C 1 89  ? -15.559 4.990   138.070 1.00 0.00 ?  89  ILE C CB   1  
ATOM 10809  C CG1  . ILE C 1 89  ? -15.244 6.353   138.707 1.00 0.00 ?  89  ILE C CG1  1  
ATOM 10810  C CG2  . ILE C 1 89  ? -14.284 4.206   137.715 1.00 0.00 ?  89  ILE C CG2  1  
ATOM 10811  C CD1  . ILE C 1 89  ? -14.651 6.222   140.108 1.00 0.00 ?  89  ILE C CD1  1  
ATOM 10812  H H    . ILE C 1 89  ? -18.081 5.645   137.860 1.00 0.00 ?  89  ILE C H    1  
ATOM 10813  H HA   . ILE C 1 89  ? -15.782 5.729   136.075 1.00 0.00 ?  89  ILE C HA   1  
ATOM 10814  H HB   . ILE C 1 89  ? -16.151 4.390   138.794 1.00 0.00 ?  89  ILE C HB   1  
ATOM 10815  H HG12 . ILE C 1 89  ? -14.525 6.898   138.057 1.00 0.00 ?  89  ILE C HG12 1  
ATOM 10816  H HG13 . ILE C 1 89  ? -16.176 6.951   138.767 1.00 0.00 ?  89  ILE C HG13 1  
ATOM 10817  H HG21 . ILE C 1 89  ? -13.417 4.600   138.286 1.00 0.00 ?  89  ILE C HG21 1  
ATOM 10818  H HG22 . ILE C 1 89  ? -14.065 4.296   136.630 1.00 0.00 ?  89  ILE C HG22 1  
ATOM 10819  H HG23 . ILE C 1 89  ? -14.412 3.130   137.963 1.00 0.00 ?  89  ILE C HG23 1  
ATOM 10820  H HD11 . ILE C 1 89  ? -14.006 5.320   140.172 1.00 0.00 ?  89  ILE C HD11 1  
ATOM 10821  H HD12 . ILE C 1 89  ? -15.461 6.133   140.863 1.00 0.00 ?  89  ILE C HD12 1  
ATOM 10822  H HD13 . ILE C 1 89  ? -14.036 7.115   140.352 1.00 0.00 ?  89  ILE C HD13 1  
ATOM 10823  N N    . ALA C 1 90  ? -16.331 3.644   135.008 1.00 0.00 ?  90  ALA C N    1  
ATOM 10824  C CA   . ALA C 1 90  ? -16.592 2.438   134.288 1.00 0.00 ?  90  ALA C CA   1  
ATOM 10825  C C    . ALA C 1 90  ? -15.272 1.921   133.850 1.00 0.00 ?  90  ALA C C    1  
ATOM 10826  O O    . ALA C 1 90  ? -14.243 2.310   134.389 1.00 0.00 ?  90  ALA C O    1  
ATOM 10827  C CB   . ALA C 1 90  ? -17.468 2.644   133.040 1.00 0.00 ?  90  ALA C CB   1  
ATOM 10828  H H    . ALA C 1 90  ? -15.849 4.352   134.497 1.00 0.00 ?  90  ALA C H    1  
ATOM 10829  H HA   . ALA C 1 90  ? -17.050 1.730   134.960 1.00 0.00 ?  90  ALA C HA   1  
ATOM 10830  H HB1  . ALA C 1 90  ? -18.414 3.159   133.313 1.00 0.00 ?  90  ALA C HB1  1  
ATOM 10831  H HB2  . ALA C 1 90  ? -17.719 1.665   132.578 1.00 0.00 ?  90  ALA C HB2  1  
ATOM 10832  H HB3  . ALA C 1 90  ? -16.931 3.263   132.288 1.00 0.00 ?  90  ALA C HB3  1  
ATOM 10833  N N    . ASN C 1 91  ? -15.319 0.935   132.930 1.00 0.00 ?  91  ASN C N    1  
ATOM 10834  C CA   . ASN C 1 91  ? -14.134 0.352   132.349 1.00 0.00 ?  91  ASN C CA   1  
ATOM 10835  C C    . ASN C 1 91  ? -13.478 -0.512  133.356 1.00 0.00 ?  91  ASN C C    1  
ATOM 10836  O O    . ASN C 1 91  ? -12.253 -0.544  133.475 1.00 0.00 ?  91  ASN C O    1  
ATOM 10837  C CB   . ASN C 1 91  ? -13.101 1.365   131.808 1.00 0.00 ?  91  ASN C CB   1  
ATOM 10838  C CG   . ASN C 1 91  ? -12.172 0.740   130.775 1.00 0.00 ?  91  ASN C CG   1  
ATOM 10839  O OD1  . ASN C 1 91  ? -12.579 -0.126  129.998 1.00 0.00 ?  91  ASN C OD1  1  
ATOM 10840  N ND2  . ASN C 1 91  ? -10.890 1.192   130.753 1.00 0.00 ?  91  ASN C ND2  1  
ATOM 10841  H H    . ASN C 1 91  ? -16.186 0.562   132.607 1.00 0.00 ?  91  ASN C H    1  
ATOM 10842  H HA   . ASN C 1 91  ? -14.472 -0.278  131.540 1.00 0.00 ?  91  ASN C HA   1  
ATOM 10843  H HB2  . ASN C 1 91  ? -13.634 2.221   131.338 1.00 0.00 ?  91  ASN C HB2  1  
ATOM 10844  H HB3  . ASN C 1 91  ? -12.489 1.755   132.648 1.00 0.00 ?  91  ASN C HB3  1  
ATOM 10845  H HD21 . ASN C 1 91  ? -10.597 1.905   131.398 1.00 0.00 ?  91  ASN C HD21 1  
ATOM 10846  H HD22 . ASN C 1 91  ? -10.238 0.817   130.094 1.00 0.00 ?  91  ASN C HD22 1  
ATOM 10847  N N    . GLN C 1 92  ? -14.325 -1.234  134.108 1.00 0.00 ?  92  GLN C N    1  
ATOM 10848  C CA   . GLN C 1 92  ? -13.862 -2.183  135.066 1.00 0.00 ?  92  GLN C CA   1  
ATOM 10849  C C    . GLN C 1 92  ? -14.300 -3.468  134.444 1.00 0.00 ?  92  GLN C C    1  
ATOM 10850  O O    . GLN C 1 92  ? -15.182 -3.433  133.584 1.00 0.00 ?  92  GLN C O    1  
ATOM 10851  C CB   . GLN C 1 92  ? -14.506 -2.041  136.459 1.00 0.00 ?  92  GLN C CB   1  
ATOM 10852  C CG   . GLN C 1 92  ? -13.800 -2.879  137.531 1.00 0.00 ?  92  GLN C CG   1  
ATOM 10853  C CD   . GLN C 1 92  ? -12.374 -2.385  137.674 1.00 0.00 ?  92  GLN C CD   1  
ATOM 10854  O OE1  . GLN C 1 92  ? -12.131 -1.206  137.929 1.00 0.00 ?  92  GLN C OE1  1  
ATOM 10855  N NE2  . GLN C 1 92  ? -11.401 -3.315  137.497 1.00 0.00 ?  92  GLN C NE2  1  
ATOM 10856  H H    . GLN C 1 92  ? -15.314 -1.138  134.030 1.00 0.00 ?  92  GLN C H    1  
ATOM 10857  H HA   . GLN C 1 92  ? -12.785 -2.143  135.109 1.00 0.00 ?  92  GLN C HA   1  
ATOM 10858  H HB2  . GLN C 1 92  ? -14.483 -0.971  136.760 1.00 0.00 ?  92  GLN C HB2  1  
ATOM 10859  H HB3  . GLN C 1 92  ? -15.569 -2.358  136.399 1.00 0.00 ?  92  GLN C HB3  1  
ATOM 10860  H HG2  . GLN C 1 92  ? -14.327 -2.785  138.500 1.00 0.00 ?  92  GLN C HG2  1  
ATOM 10861  H HG3  . GLN C 1 92  ? -13.778 -3.941  137.234 1.00 0.00 ?  92  GLN C HG3  1  
ATOM 10862  H HE21 . GLN C 1 92  ? -11.646 -4.261  137.284 1.00 0.00 ?  92  GLN C HE21 1  
ATOM 10863  H HE22 . GLN C 1 92  ? -10.443 -3.053  137.584 1.00 0.00 ?  92  GLN C HE22 1  
ATOM 10864  N N    . SER C 1 93  ? -13.682 -4.619  134.811 1.00 0.00 ?  93  SER C N    1  
ATOM 10865  C CA   . SER C 1 93  ? -14.058 -5.874  134.185 1.00 0.00 ?  93  SER C CA   1  
ATOM 10866  C C    . SER C 1 93  ? -15.558 -6.123  134.311 1.00 0.00 ?  93  SER C C    1  
ATOM 10867  O O    . SER C 1 93  ? -16.196 -6.365  133.288 1.00 0.00 ?  93  SER C O    1  
ATOM 10868  C CB   . SER C 1 93  ? -13.280 -7.112  134.698 1.00 0.00 ?  93  SER C CB   1  
ATOM 10869  O OG   . SER C 1 93  ? -13.737 -8.287  134.038 1.00 0.00 ?  93  SER C OG   1  
ATOM 10870  H H    . SER C 1 93  ? -12.967 -4.655  135.504 1.00 0.00 ?  93  SER C H    1  
ATOM 10871  H HA   . SER C 1 93  ? -13.845 -5.746  133.133 1.00 0.00 ?  93  SER C HA   1  
ATOM 10872  H HB2  . SER C 1 93  ? -12.196 -6.988  134.491 1.00 0.00 ?  93  SER C HB2  1  
ATOM 10873  H HB3  . SER C 1 93  ? -13.421 -7.239  135.788 1.00 0.00 ?  93  SER C HB3  1  
ATOM 10874  H HG   . SER C 1 93  ? -13.264 -9.019  134.446 1.00 0.00 ?  93  SER C HG   1  
ATOM 10875  N N    . PRO C 1 94  ? -16.187 -6.073  135.490 1.00 0.00 ?  94  PRO C N    1  
ATOM 10876  C CA   . PRO C 1 94  ? -17.614 -6.265  135.533 1.00 0.00 ?  94  PRO C CA   1  
ATOM 10877  C C    . PRO C 1 94  ? -18.339 -4.962  135.276 1.00 0.00 ?  94  PRO C C    1  
ATOM 10878  O O    . PRO C 1 94  ? -18.036 -3.975  135.946 1.00 0.00 ?  94  PRO C O    1  
ATOM 10879  C CB   . PRO C 1 94  ? -17.905 -6.754  136.960 1.00 0.00 ?  94  PRO C CB   1  
ATOM 10880  C CG   . PRO C 1 94  ? -16.549 -6.766  137.674 1.00 0.00 ?  94  PRO C CG   1  
ATOM 10881  C CD   . PRO C 1 94  ? -15.663 -5.856  136.839 1.00 0.00 ?  94  PRO C CD   1  
ATOM 10882  H HA   . PRO C 1 94  ? -17.910 -7.026  134.835 1.00 0.00 ?  94  PRO C HA   1  
ATOM 10883  H HB2  . PRO C 1 94  ? -18.608 -6.063  137.473 1.00 0.00 ?  94  PRO C HB2  1  
ATOM 10884  H HB3  . PRO C 1 94  ? -18.341 -7.776  136.941 1.00 0.00 ?  94  PRO C HB3  1  
ATOM 10885  H HG2  . PRO C 1 94  ? -16.650 -6.377  138.710 1.00 0.00 ?  94  PRO C HG2  1  
ATOM 10886  H HG3  . PRO C 1 94  ? -16.134 -7.796  137.705 1.00 0.00 ?  94  PRO C HG3  1  
ATOM 10887  H HD2  . PRO C 1 94  ? -15.787 -4.798  137.157 1.00 0.00 ?  94  PRO C HD2  1  
ATOM 10888  H HD3  . PRO C 1 94  ? -14.606 -6.149  136.938 1.00 0.00 ?  94  PRO C HD3  1  
ATOM 10889  N N    . PRO C 1 95  ? -19.278 -4.870  134.352 1.00 0.00 ?  95  PRO C N    1  
ATOM 10890  C CA   . PRO C 1 95  ? -19.973 -3.618  134.135 1.00 0.00 ?  95  PRO C CA   1  
ATOM 10891  C C    . PRO C 1 95  ? -20.956 -3.345  135.220 1.00 0.00 ?  95  PRO C C    1  
ATOM 10892  O O    . PRO C 1 95  ? -21.433 -4.268  135.863 1.00 0.00 ?  95  PRO C O    1  
ATOM 10893  C CB   . PRO C 1 95  ? -20.690 -3.811  132.802 1.00 0.00 ?  95  PRO C CB   1  
ATOM 10894  C CG   . PRO C 1 95  ? -20.969 -5.306  132.762 1.00 0.00 ?  95  PRO C CG   1  
ATOM 10895  C CD   . PRO C 1 95  ? -19.763 -5.936  133.458 1.00 0.00 ?  95  PRO C CD   1  
ATOM 10896  H HA   . PRO C 1 95  ? -19.282 -2.792  134.060 1.00 0.00 ?  95  PRO C HA   1  
ATOM 10897  H HB2  . PRO C 1 95  ? -21.637 -3.229  132.776 1.00 0.00 ?  95  PRO C HB2  1  
ATOM 10898  H HB3  . PRO C 1 95  ? -20.038 -3.510  131.954 1.00 0.00 ?  95  PRO C HB3  1  
ATOM 10899  H HG2  . PRO C 1 95  ? -21.910 -5.542  133.306 1.00 0.00 ?  95  PRO C HG2  1  
ATOM 10900  H HG3  . PRO C 1 95  ? -21.047 -5.662  131.714 1.00 0.00 ?  95  PRO C HG3  1  
ATOM 10901  H HD2  . PRO C 1 95  ? -20.070 -6.836  134.034 1.00 0.00 ?  95  PRO C HD2  1  
ATOM 10902  H HD3  . PRO C 1 95  ? -18.989 -6.221  132.714 1.00 0.00 ?  95  PRO C HD3  1  
ATOM 10903  N N    . GLY C 1 96  ? -21.283 -2.062  135.455 1.00 0.00 ?  96  GLY C N    1  
ATOM 10904  C CA   . GLY C 1 96  ? -22.257 -1.744  136.463 1.00 0.00 ?  96  GLY C CA   1  
ATOM 10905  C C    . GLY C 1 96  ? -21.586 -1.565  137.790 1.00 0.00 ?  96  GLY C C    1  
ATOM 10906  O O    . GLY C 1 96  ? -20.362 -1.507  137.904 1.00 0.00 ?  96  GLY C O    1  
ATOM 10907  H H    . GLY C 1 96  ? -20.880 -1.299  134.958 1.00 0.00 ?  96  GLY C H    1  
ATOM 10908  H HA2  . GLY C 1 96  ? -22.715 -0.809  136.181 1.00 0.00 ?  96  GLY C HA2  1  
ATOM 10909  H HA3  . GLY C 1 96  ? -22.948 -2.572  136.525 1.00 0.00 ?  96  GLY C HA3  1  
ATOM 10910  N N    . PHE C 1 97  ? -22.429 -1.500  138.846 1.00 0.00 ?  97  PHE C N    1  
ATOM 10911  C CA   . PHE C 1 97  ? -21.964 -1.270  140.191 1.00 0.00 ?  97  PHE C CA   1  
ATOM 10912  C C    . PHE C 1 97  ? -21.081 -2.383  140.659 1.00 0.00 ?  97  PHE C C    1  
ATOM 10913  O O    . PHE C 1 97  ? -20.356 -2.203  141.635 1.00 0.00 ?  97  PHE C O    1  
ATOM 10914  C CB   . PHE C 1 97  ? -23.116 -1.124  141.201 1.00 0.00 ?  97  PHE C CB   1  
ATOM 10915  C CG   . PHE C 1 97  ? -23.843 -2.396  141.487 1.00 0.00 ?  97  PHE C CG   1  
ATOM 10916  C CD1  . PHE C 1 97  ? -23.489 -3.181  142.564 1.00 0.00 ?  97  PHE C CD1  1  
ATOM 10917  C CD2  . PHE C 1 97  ? -24.881 -2.803  140.676 1.00 0.00 ?  97  PHE C CD2  1  
ATOM 10918  C CE1  . PHE C 1 97  ? -24.161 -4.352  142.825 1.00 0.00 ?  97  PHE C CE1  1  
ATOM 10919  C CE2  . PHE C 1 97  ? -25.553 -3.974  140.938 1.00 0.00 ?  97  PHE C CE2  1  
ATOM 10920  C CZ   . PHE C 1 97  ? -25.192 -4.748  142.013 1.00 0.00 ?  97  PHE C CZ   1  
ATOM 10921  H H    . PHE C 1 97  ? -23.415 -1.610  138.740 1.00 0.00 ?  97  PHE C H    1  
ATOM 10922  H HA   . PHE C 1 97  ? -21.386 -0.361  140.172 1.00 0.00 ?  97  PHE C HA   1  
ATOM 10923  H HB2  . PHE C 1 97  ? -22.723 -0.749  142.169 1.00 0.00 ?  97  PHE C HB2  1  
ATOM 10924  H HB3  . PHE C 1 97  ? -23.861 -0.397  140.815 1.00 0.00 ?  97  PHE C HB3  1  
ATOM 10925  H HD1  . PHE C 1 97  ? -22.677 -2.874  143.207 1.00 0.00 ?  97  PHE C HD1  1  
ATOM 10926  H HD2  . PHE C 1 97  ? -25.168 -2.198  139.829 1.00 0.00 ?  97  PHE C HD2  1  
ATOM 10927  H HE1  . PHE C 1 97  ? -23.877 -4.960  143.672 1.00 0.00 ?  97  PHE C HE1  1  
ATOM 10928  H HE2  . PHE C 1 97  ? -26.365 -4.285  140.299 1.00 0.00 ?  97  PHE C HE2  1  
ATOM 10929  H HZ   . PHE C 1 97  ? -25.721 -5.667  142.219 1.00 0.00 ?  97  PHE C HZ   1  
ATOM 10930  N N    . VAL C 1 98  ? -21.142 -3.570  140.020 1.00 0.00 ?  98  VAL C N    1  
ATOM 10931  C CA   . VAL C 1 98  ? -20.308 -4.660  140.450 1.00 0.00 ?  98  VAL C CA   1  
ATOM 10932  C C    . VAL C 1 98  ? -18.888 -4.223  140.243 1.00 0.00 ?  98  VAL C C    1  
ATOM 10933  O O    . VAL C 1 98  ? -18.022 -4.490  141.065 1.00 0.00 ?  98  VAL C O    1  
ATOM 10934  C CB   . VAL C 1 98  ? -20.527 -5.935  139.686 1.00 0.00 ?  98  VAL C CB   1  
ATOM 10935  C CG1  . VAL C 1 98  ? -19.465 -6.960  140.130 1.00 0.00 ?  98  VAL C CG1  1  
ATOM 10936  C CG2  . VAL C 1 98  ? -21.963 -6.417  139.950 1.00 0.00 ?  98  VAL C CG2  1  
ATOM 10937  H H    . VAL C 1 98  ? -21.748 -3.741  139.247 1.00 0.00 ?  98  VAL C H    1  
ATOM 10938  H HA   . VAL C 1 98  ? -20.482 -4.811  141.505 1.00 0.00 ?  98  VAL C HA   1  
ATOM 10939  H HB   . VAL C 1 98  ? -20.410 -5.746  138.597 1.00 0.00 ?  98  VAL C HB   1  
ATOM 10940  H HG11 . VAL C 1 98  ? -18.484 -6.735  139.667 1.00 0.00 ?  98  VAL C HG11 1  
ATOM 10941  H HG12 . VAL C 1 98  ? -19.769 -7.984  139.829 1.00 0.00 ?  98  VAL C HG12 1  
ATOM 10942  H HG13 . VAL C 1 98  ? -19.347 -6.936  141.235 1.00 0.00 ?  98  VAL C HG13 1  
ATOM 10943  H HG21 . VAL C 1 98  ? -22.013 -7.525  139.901 1.00 0.00 ?  98  VAL C HG21 1  
ATOM 10944  H HG22 . VAL C 1 98  ? -22.656 -5.996  139.190 1.00 0.00 ?  98  VAL C HG22 1  
ATOM 10945  H HG23 . VAL C 1 98  ? -22.301 -6.091  140.957 1.00 0.00 ?  98  VAL C HG23 1  
ATOM 10946  N N    . GLY C 1 99  ? -18.621 -3.561  139.102 1.00 0.00 ?  99  GLY C N    1  
ATOM 10947  C CA   . GLY C 1 99  ? -17.295 -3.089  138.816 1.00 0.00 ?  99  GLY C CA   1  
ATOM 10948  C C    . GLY C 1 99  ? -16.894 -2.087  139.860 1.00 0.00 ?  99  GLY C C    1  
ATOM 10949  O O    . GLY C 1 99  ? -15.729 -2.042  140.263 1.00 0.00 ?  99  GLY C O    1  
ATOM 10950  H H    . GLY C 1 99  ? -19.316 -3.378  138.411 1.00 0.00 ?  99  GLY C H    1  
ATOM 10951  H HA2  . GLY C 1 99  ? -16.630 -3.937  138.872 1.00 0.00 ?  99  GLY C HA2  1  
ATOM 10952  H HA3  . GLY C 1 99  ? -17.322 -2.603  137.851 1.00 0.00 ?  99  GLY C HA3  1  
ATOM 10953  N N    . ALA C 1 100 ? -17.851 -1.232  140.285 1.00 0.00 ?  100 ALA C N    1  
ATOM 10954  C CA   . ALA C 1 100 ? -17.549 -0.220  141.264 1.00 0.00 ?  100 ALA C CA   1  
ATOM 10955  C C    . ALA C 1 100 ? -17.106 -0.889  142.528 1.00 0.00 ?  100 ALA C C    1  
ATOM 10956  O O    . ALA C 1 100 ? -16.170 -0.441  143.175 1.00 0.00 ?  100 ALA C O    1  
ATOM 10957  C CB   . ALA C 1 100 ? -18.753 0.671   141.606 1.00 0.00 ?  100 ALA C CB   1  
ATOM 10958  H H    . ALA C 1 100 ? -18.789 -1.261  139.945 1.00 0.00 ?  100 ALA C H    1  
ATOM 10959  H HA   . ALA C 1 100 ? -16.747 0.375   140.876 1.00 0.00 ?  100 ALA C HA   1  
ATOM 10960  H HB1  . ALA C 1 100 ? -19.117 0.450   142.632 1.00 0.00 ?  100 ALA C HB1  1  
ATOM 10961  H HB2  . ALA C 1 100 ? -19.582 0.489   140.888 1.00 0.00 ?  100 ALA C HB2  1  
ATOM 10962  H HB3  . ALA C 1 100 ? -18.468 1.743   141.555 1.00 0.00 ?  100 ALA C HB3  1  
ATOM 10963  N N    . PHE C 1 101 ? -17.790 -1.985  142.888 1.00 0.00 ?  101 PHE C N    1  
ATOM 10964  C CA   . PHE C 1 101 ? -17.473 -2.730  144.080 1.00 0.00 ?  101 PHE C CA   1  
ATOM 10965  C C    . PHE C 1 101 ? -16.067 -3.245  143.964 1.00 0.00 ?  101 PHE C C    1  
ATOM 10966  O O    . PHE C 1 101 ? -15.284 -3.183  144.912 1.00 0.00 ?  101 PHE C O    1  
ATOM 10967  C CB   . PHE C 1 101 ? -18.396 -3.952  144.267 1.00 0.00 ?  101 PHE C CB   1  
ATOM 10968  C CG   . PHE C 1 101 ? -18.150 -4.733  145.512 1.00 0.00 ?  101 PHE C CG   1  
ATOM 10969  C CD1  . PHE C 1 101 ? -18.819 -4.424  146.675 1.00 0.00 ?  101 PHE C CD1  1  
ATOM 10970  C CD2  . PHE C 1 101 ? -17.250 -5.776  145.515 1.00 0.00 ?  101 PHE C CD2  1  
ATOM 10971  C CE1  . PHE C 1 101 ? -18.592 -5.146  147.822 1.00 0.00 ?  101 PHE C CE1  1  
ATOM 10972  C CE2  . PHE C 1 101 ? -17.022 -6.497  146.663 1.00 0.00 ?  101 PHE C CE2  1  
ATOM 10973  C CZ   . PHE C 1 101 ? -17.694 -6.182  147.817 1.00 0.00 ?  101 PHE C CZ   1  
ATOM 10974  H H    . PHE C 1 101 ? -18.555 -2.326  142.355 1.00 0.00 ?  101 PHE C H    1  
ATOM 10975  H HA   . PHE C 1 101 ? -17.548 -2.064  144.924 1.00 0.00 ?  101 PHE C HA   1  
ATOM 10976  H HB2  . PHE C 1 101 ? -19.454 -3.620  144.297 1.00 0.00 ?  101 PHE C HB2  1  
ATOM 10977  H HB3  . PHE C 1 101 ? -18.270 -4.650  143.413 1.00 0.00 ?  101 PHE C HB3  1  
ATOM 10978  H HD1  . PHE C 1 101 ? -19.529 -3.610  146.685 1.00 0.00 ?  101 PHE C HD1  1  
ATOM 10979  H HD2  . PHE C 1 101 ? -16.717 -6.028  144.609 1.00 0.00 ?  101 PHE C HD2  1  
ATOM 10980  H HE1  . PHE C 1 101 ? -19.122 -4.896  148.730 1.00 0.00 ?  101 PHE C HE1  1  
ATOM 10981  H HE2  . PHE C 1 101 ? -16.315 -7.313  146.658 1.00 0.00 ?  101 PHE C HE2  1  
ATOM 10982  H HZ   . PHE C 1 101 ? -17.516 -6.749  148.718 1.00 0.00 ?  101 PHE C HZ   1  
ATOM 10983  N N    . PHE C 1 102 ? -15.743 -3.789  142.778 1.00 0.00 ?  102 PHE C N    1  
ATOM 10984  C CA   . PHE C 1 102 ? -14.458 -4.395  142.544 1.00 0.00 ?  102 PHE C CA   1  
ATOM 10985  C C    . PHE C 1 102 ? -13.320 -3.432  142.726 1.00 0.00 ?  102 PHE C C    1  
ATOM 10986  O O    . PHE C 1 102 ? -12.310 -3.814  143.305 1.00 0.00 ?  102 PHE C O    1  
ATOM 10987  C CB   . PHE C 1 102 ? -14.339 -4.945  141.112 1.00 0.00 ?  102 PHE C CB   1  
ATOM 10988  C CG   . PHE C 1 102 ? -14.724 -6.379  140.953 1.00 0.00 ?  102 PHE C CG   1  
ATOM 10989  C CD1  . PHE C 1 102 ? -13.877 -7.245  140.298 1.00 0.00 ?  102 PHE C CD1  1  
ATOM 10990  C CD2  . PHE C 1 102 ? -15.923 -6.862  141.445 1.00 0.00 ?  102 PHE C CD2  1  
ATOM 10991  C CE1  . PHE C 1 102 ? -14.216 -8.564  140.136 1.00 0.00 ?  102 PHE C CE1  1  
ATOM 10992  C CE2  . PHE C 1 102 ? -16.258 -8.185  141.283 1.00 0.00 ?  102 PHE C CE2  1  
ATOM 10993  C CZ   . PHE C 1 102 ? -15.405 -9.035  140.627 1.00 0.00 ?  102 PHE C CZ   1  
ATOM 10994  H H    . PHE C 1 102 ? -16.382 -3.809  142.014 1.00 0.00 ?  102 PHE C H    1  
ATOM 10995  H HA   . PHE C 1 102 ? -14.350 -5.202  143.248 1.00 0.00 ?  102 PHE C HA   1  
ATOM 10996  H HB2  . PHE C 1 102 ? -14.991 -4.359  140.432 1.00 0.00 ?  102 PHE C HB2  1  
ATOM 10997  H HB3  . PHE C 1 102 ? -13.287 -4.845  140.763 1.00 0.00 ?  102 PHE C HB3  1  
ATOM 10998  H HD1  . PHE C 1 102 ? -12.937 -6.882  139.909 1.00 0.00 ?  102 PHE C HD1  1  
ATOM 10999  H HD2  . PHE C 1 102 ? -16.601 -6.205  141.963 1.00 0.00 ?  102 PHE C HD2  1  
ATOM 11000  H HE1  . PHE C 1 102 ? -13.543 -9.234  139.621 1.00 0.00 ?  102 PHE C HE1  1  
ATOM 11001  H HE2  . PHE C 1 102 ? -17.196 -8.555  141.670 1.00 0.00 ?  102 PHE C HE2  1  
ATOM 11002  H HZ   . PHE C 1 102 ? -15.671 -10.072 140.498 1.00 0.00 ?  102 PHE C HZ   1  
ATOM 11003  N N    . PHE C 1 103 ? -13.406 -2.178  142.226 1.00 0.00 ?  103 PHE C N    1  
ATOM 11004  C CA   . PHE C 1 103 ? -12.259 -1.301  142.376 1.00 0.00 ?  103 PHE C CA   1  
ATOM 11005  C C    . PHE C 1 103 ? -12.295 -0.650  143.722 1.00 0.00 ?  103 PHE C C    1  
ATOM 11006  O O    . PHE C 1 103 ? -11.256 -0.371  144.319 1.00 0.00 ?  103 PHE C O    1  
ATOM 11007  C CB   . PHE C 1 103 ? -12.140 -0.194  141.301 1.00 0.00 ?  103 PHE C CB   1  
ATOM 11008  C CG   . PHE C 1 103 ? -12.952 1.038   141.532 1.00 0.00 ?  103 PHE C CG   1  
ATOM 11009  C CD1  . PHE C 1 103 ? -12.406 2.117   142.198 1.00 0.00 ?  103 PHE C CD1  1  
ATOM 11010  C CD2  . PHE C 1 103 ? -14.237 1.132   141.052 1.00 0.00 ?  103 PHE C CD2  1  
ATOM 11011  C CE1  . PHE C 1 103 ? -13.138 3.264   142.385 1.00 0.00 ?  103 PHE C CE1  1  
ATOM 11012  C CE2  . PHE C 1 103 ? -14.969 2.281   141.243 1.00 0.00 ?  103 PHE C CE2  1  
ATOM 11013  C CZ   . PHE C 1 103 ? -14.419 3.346   141.908 1.00 0.00 ?  103 PHE C CZ   1  
ATOM 11014  H H    . PHE C 1 103 ? -14.211 -1.825  141.750 1.00 0.00 ?  103 PHE C H    1  
ATOM 11015  H HA   . PHE C 1 103 ? -11.380 -1.926  142.331 1.00 0.00 ?  103 PHE C HA   1  
ATOM 11016  H HB2  . PHE C 1 103 ? -11.085 0.135   141.225 1.00 0.00 ?  103 PHE C HB2  1  
ATOM 11017  H HB3  . PHE C 1 103 ? -12.446 -0.607  140.314 1.00 0.00 ?  103 PHE C HB3  1  
ATOM 11018  H HD1  . PHE C 1 103 ? -11.399 2.055   142.580 1.00 0.00 ?  103 PHE C HD1  1  
ATOM 11019  H HD2  . PHE C 1 103 ? -14.672 0.296   140.526 1.00 0.00 ?  103 PHE C HD2  1  
ATOM 11020  H HE1  . PHE C 1 103 ? -12.701 4.102   142.909 1.00 0.00 ?  103 PHE C HE1  1  
ATOM 11021  H HE2  . PHE C 1 103 ? -15.978 2.348   140.866 1.00 0.00 ?  103 PHE C HE2  1  
ATOM 11022  H HZ   . PHE C 1 103 ? -14.994 4.248   142.055 1.00 0.00 ?  103 PHE C HZ   1  
ATOM 11023  N N    . SER C 1 104 ? -13.500 -0.394  144.236 1.00 0.00 ?  104 SER C N    1  
ATOM 11024  C CA   . SER C 1 104 ? -13.626 0.279   145.495 1.00 0.00 ?  104 SER C CA   1  
ATOM 11025  C C    . SER C 1 104 ? -13.087 -0.549  146.629 1.00 0.00 ?  104 SER C C    1  
ATOM 11026  O O    . SER C 1 104 ? -12.728 0.015   147.666 1.00 0.00 ?  104 SER C O    1  
ATOM 11027  C CB   . SER C 1 104 ? -15.078 0.619   145.833 1.00 0.00 ?  104 SER C CB   1  
ATOM 11028  O OG   . SER C 1 104 ? -15.852 -0.566  145.923 1.00 0.00 ?  104 SER C OG   1  
ATOM 11029  H H    . SER C 1 104 ? -14.345 -0.649  143.780 1.00 0.00 ?  104 SER C H    1  
ATOM 11030  H HA   . SER C 1 104 ? -13.051 1.187   145.426 1.00 0.00 ?  104 SER C HA   1  
ATOM 11031  H HB2  . SER C 1 104 ? -15.127 1.154   146.805 1.00 0.00 ?  104 SER C HB2  1  
ATOM 11032  H HB3  . SER C 1 104 ? -15.510 1.268   145.042 1.00 0.00 ?  104 SER C HB3  1  
ATOM 11033  H HG   . SER C 1 104 ? -15.296 -1.213  146.364 1.00 0.00 ?  104 SER C HG   1  
ATOM 11034  N N    . VAL C 1 105 ? -13.058 -1.898  146.506 1.00 0.00 ?  105 VAL C N    1  
ATOM 11035  C CA   . VAL C 1 105 ? -12.554 -2.695  147.603 1.00 0.00 ?  105 VAL C CA   1  
ATOM 11036  C C    . VAL C 1 105 ? -11.106 -2.393  147.768 1.00 0.00 ?  105 VAL C C    1  
ATOM 11037  O O    . VAL C 1 105 ? -10.580 -2.368  148.878 1.00 0.00 ?  105 VAL C O    1  
ATOM 11038  C CB   . VAL C 1 105 ? -12.748 -4.193  147.445 1.00 0.00 ?  105 VAL C CB   1  
ATOM 11039  C CG1  . VAL C 1 105 ? -12.045 -4.692  146.170 1.00 0.00 ?  105 VAL C CG1  1  
ATOM 11040  C CG2  . VAL C 1 105 ? -12.190 -4.878  148.703 1.00 0.00 ?  105 VAL C CG2  1  
ATOM 11041  H H    . VAL C 1 105 ? -13.380 -2.382  145.696 1.00 0.00 ?  105 VAL C H    1  
ATOM 11042  H HA   . VAL C 1 105 ? -13.067 -2.354  148.491 1.00 0.00 ?  105 VAL C HA   1  
ATOM 11043  H HB   . VAL C 1 105 ? -13.830 -4.427  147.370 1.00 0.00 ?  105 VAL C HB   1  
ATOM 11044  H HG11 . VAL C 1 105 ? -11.123 -5.252  146.431 1.00 0.00 ?  105 VAL C HG11 1  
ATOM 11045  H HG12 . VAL C 1 105 ? -11.769 -3.839  145.529 1.00 0.00 ?  105 VAL C HG12 1  
ATOM 11046  H HG13 . VAL C 1 105 ? -12.717 -5.365  145.596 1.00 0.00 ?  105 VAL C HG13 1  
ATOM 11047  H HG21 . VAL C 1 105 ? -12.284 -4.205  149.582 1.00 0.00 ?  105 VAL C HG21 1  
ATOM 11048  H HG22 . VAL C 1 105 ? -11.117 -5.130  148.563 1.00 0.00 ?  105 VAL C HG22 1  
ATOM 11049  H HG23 . VAL C 1 105 ? -12.749 -5.815  148.912 1.00 0.00 ?  105 VAL C HG23 1  
ATOM 11050  N N    . GLU C 1 106 ? -10.423 -2.143  146.657 1.00 0.00 ?  106 GLU C N    1  
ATOM 11051  C CA   . GLU C 1 106 ? -9.039  -1.852  146.719 1.00 0.00 ?  106 GLU C CA   1  
ATOM 11052  C C    . GLU C 1 106 ? -8.843  -0.511  147.390 1.00 0.00 ?  106 GLU C C    1  
ATOM 11053  O O    . GLU C 1 106 ? -7.934  -0.350  148.196 1.00 0.00 ?  106 GLU C O    1  
ATOM 11054  C CB   . GLU C 1 106 ? -8.415  -1.901  145.315 1.00 0.00 ?  106 GLU C CB   1  
ATOM 11055  C CG   . GLU C 1 106 ? -8.371  -3.361  144.829 1.00 0.00 ?  106 GLU C CG   1  
ATOM 11056  C CD   . GLU C 1 106 ? -8.011  -3.431  143.354 1.00 0.00 ?  106 GLU C CD   1  
ATOM 11057  O OE1  . GLU C 1 106 ? -8.099  -2.390  142.663 1.00 0.00 ?  106 GLU C OE1  1  
ATOM 11058  O OE2  . GLU C 1 106 ? -7.663  -4.547  142.892 1.00 0.00 -1 106 GLU C OE2  1  
ATOM 11059  H H    . GLU C 1 106 ? -10.839 -2.164  145.747 1.00 0.00 ?  106 GLU C H    1  
ATOM 11060  H HA   . GLU C 1 106 ? -8.588  -2.610  147.341 1.00 0.00 ?  106 GLU C HA   1  
ATOM 11061  H HB2  . GLU C 1 106 ? -9.027  -1.289  144.615 1.00 0.00 ?  106 GLU C HB2  1  
ATOM 11062  H HB3  . GLU C 1 106 ? -7.384  -1.491  145.341 1.00 0.00 ?  106 GLU C HB3  1  
ATOM 11063  H HG2  . GLU C 1 106 ? -7.613  -3.924  145.414 1.00 0.00 ?  106 GLU C HG2  1  
ATOM 11064  H HG3  . GLU C 1 106 ? -9.362  -3.836  144.982 1.00 0.00 ?  106 GLU C HG3  1  
ATOM 11065  N N    . THR C 1 107 ? -9.715  0.477   147.093 1.00 0.00 ?  107 THR C N    1  
ATOM 11066  C CA   . THR C 1 107 ? -9.567  1.803   147.676 1.00 0.00 ?  107 THR C CA   1  
ATOM 11067  C C    . THR C 1 107 ? -9.830  1.835   149.180 1.00 0.00 ?  107 THR C C    1  
ATOM 11068  O O    . THR C 1 107 ? -9.062  2.448   149.922 1.00 0.00 ?  107 THR C O    1  
ATOM 11069  C CB   . THR C 1 107 ? -10.537 2.796   147.098 1.00 0.00 ?  107 THR C CB   1  
ATOM 11070  O OG1  . THR C 1 107 ? -10.373 2.914   145.693 1.00 0.00 ?  107 THR C OG1  1  
ATOM 11071  C CG2  . THR C 1 107 ? -10.293 4.161   147.765 1.00 0.00 ?  107 THR C CG2  1  
ATOM 11072  H H    . THR C 1 107 ? -10.454 0.359   146.433 1.00 0.00 ?  107 THR C H    1  
ATOM 11073  H HA   . THR C 1 107 ? -8.557  2.130   147.486 1.00 0.00 ?  107 THR C HA   1  
ATOM 11074  H HB   . THR C 1 107 ? -11.577 2.481   147.314 1.00 0.00 ?  107 THR C HB   1  
ATOM 11075  H HG1  . THR C 1 107 ? -11.242 3.158   145.354 1.00 0.00 ?  107 THR C HG1  1  
ATOM 11076  H HG21 . THR C 1 107 ? -9.208  4.309   147.958 1.00 0.00 ?  107 THR C HG21 1  
ATOM 11077  H HG22 . THR C 1 107 ? -10.835 4.223   148.730 1.00 0.00 ?  107 THR C HG22 1  
ATOM 11078  H HG23 . THR C 1 107 ? -10.648 4.981   147.106 1.00 0.00 ?  107 THR C HG23 1  
ATOM 11079  N N    . LEU C 1 108 ? -10.919 1.179   149.671 1.00 0.00 ?  108 LEU C N    1  
ATOM 11080  C CA   . LEU C 1 108 ? -11.292 1.284   151.094 1.00 0.00 ?  108 LEU C CA   1  
ATOM 11081  C C    . LEU C 1 108 ? -10.433 0.407   151.960 1.00 0.00 ?  108 LEU C C    1  
ATOM 11082  O O    . LEU C 1 108 ? -10.605 0.392   153.222 1.00 0.00 ?  108 LEU C O    1  
ATOM 11083  C CB   . LEU C 1 108 ? -12.766 0.896   151.365 1.00 0.00 ?  108 LEU C CB   1  
ATOM 11084  C CG   . LEU C 1 108 ? -13.412 1.706   152.521 1.00 0.00 ?  108 LEU C CG   1  
ATOM 11085  C CD1  . LEU C 1 108 ? -14.828 2.197   152.162 1.00 0.00 ?  108 LEU C CD1  1  
ATOM 11086  C CD2  . LEU C 1 108 ? -13.447 0.903   153.836 1.00 0.00 ?  108 LEU C CD2  1  
ATOM 11087  H H    . LEU C 1 108 ? -11.501 0.608   149.096 1.00 0.00 ?  108 LEU C H    1  
ATOM 11088  H HA   . LEU C 1 108 ? -11.132 2.311   151.383 1.00 0.00 ?  108 LEU C HA   1  
ATOM 11089  H HB2  . LEU C 1 108 ? -13.351 1.053   150.434 1.00 0.00 ?  108 LEU C HB2  1  
ATOM 11090  H HB3  . LEU C 1 108 ? -12.813 -0.183  151.620 1.00 0.00 ?  108 LEU C HB3  1  
ATOM 11091  H HG   . LEU C 1 108 ? -12.781 2.604   152.694 1.00 0.00 ?  108 LEU C HG   1  
ATOM 11092  H HD11 . LEU C 1 108 ? -15.082 1.933   151.114 1.00 0.00 ?  108 LEU C HD11 1  
ATOM 11093  H HD12 . LEU C 1 108 ? -14.893 3.300   152.275 1.00 0.00 ?  108 LEU C HD12 1  
ATOM 11094  H HD13 . LEU C 1 108 ? -15.578 1.728   152.836 1.00 0.00 ?  108 LEU C HD13 1  
ATOM 11095  H HD21 . LEU C 1 108 ? -13.457 -0.187  153.624 1.00 0.00 ?  108 LEU C HD21 1  
ATOM 11096  H HD22 . LEU C 1 108 ? -14.357 1.159   154.421 1.00 0.00 ?  108 LEU C HD22 1  
ATOM 11097  H HD23 . LEU C 1 108 ? -12.552 1.135   154.454 1.00 0.00 ?  108 LEU C HD23 1  
ATOM 11098  N N    . ALA C 1 109 ? -9.520  -0.361  151.307 1.00 0.00 ?  109 ALA C N    1  
ATOM 11099  C CA   . ALA C 1 109 ? -8.650  -1.249  152.023 1.00 0.00 ?  109 ALA C CA   1  
ATOM 11100  C C    . ALA C 1 109 ? -7.234  -0.785  151.844 1.00 0.00 ?  109 ALA C C    1  
ATOM 11101  O O    . ALA C 1 109 ? -6.700  -0.104  152.733 1.00 0.00 ?  109 ALA C O    1  
ATOM 11102  C CB   . ALA C 1 109 ? -8.727  -2.699  151.518 1.00 0.00 ?  109 ALA C CB   1  
ATOM 11103  H H    . ALA C 1 109 ? -9.422  -0.348  150.315 1.00 0.00 ?  109 ALA C H    1  
ATOM 11104  H HA   . ALA C 1 109 ? -8.905  -1.208  153.068 1.00 0.00 ?  109 ALA C HA   1  
ATOM 11105  H HB1  . ALA C 1 109 ? -8.583  -2.732  150.417 1.00 0.00 ?  109 ALA C HB1  1  
ATOM 11106  H HB2  . ALA C 1 109 ? -9.719  -3.138  151.759 1.00 0.00 ?  109 ALA C HB2  1  
ATOM 11107  H HB3  . ALA C 1 109 ? -7.940  -3.318  151.997 1.00 0.00 ?  109 ALA C HB3  1  
ATOM 11108  N N    . THR C 1 110 ? -6.621  -1.147  150.662 1.00 0.00 ?  110 THR C N    1  
ATOM 11109  C CA   . THR C 1 110 ? -5.233  -0.814  150.370 1.00 0.00 ?  110 THR C CA   1  
ATOM 11110  C C    . THR C 1 110 ? -5.212  0.243   149.277 1.00 0.00 ?  110 THR C C    1  
ATOM 11111  O O    . THR C 1 110 ? -5.313  1.406   149.655 1.00 0.00 ?  110 THR C O    1  
ATOM 11112  C CB   . THR C 1 110 ? -4.414  -2.040  149.995 1.00 0.00 ?  110 THR C CB   1  
ATOM 11113  O OG1  . THR C 1 110 ? -3.169  -1.684  149.404 1.00 0.00 ?  110 THR C OG1  1  
ATOM 11114  C CG2  . THR C 1 110 ? -5.230  -2.946  149.051 1.00 0.00 ?  110 THR C CG2  1  
ATOM 11115  H H    . THR C 1 110 ? -7.103  -1.653  149.954 1.00 0.00 ?  110 THR C H    1  
ATOM 11116  H HA   . THR C 1 110 ? -4.827  -0.369  151.267 1.00 0.00 ?  110 THR C HA   1  
ATOM 11117  H HB   . THR C 1 110 ? -4.196  -2.623  150.914 1.00 0.00 ?  110 THR C HB   1  
ATOM 11118  H HG1  . THR C 1 110 ? -2.717  -2.515  149.214 1.00 0.00 ?  110 THR C HG1  1  
ATOM 11119  H HG21 . THR C 1 110 ? -4.568  -3.399  148.283 1.00 0.00 ?  110 THR C HG21 1  
ATOM 11120  H HG22 . THR C 1 110 ? -6.019  -2.359  148.535 1.00 0.00 ?  110 THR C HG22 1  
ATOM 11121  H HG23 . THR C 1 110 ? -5.716  -3.764  149.625 1.00 0.00 ?  110 THR C HG23 1  
ATOM 11122  N N    . VAL C 1 111 ? -4.980  -0.128  147.931 1.00 0.00 ?  111 VAL C N    1  
ATOM 11123  C CA   . VAL C 1 111 ? -5.021  0.838   146.807 1.00 0.00 ?  111 VAL C CA   1  
ATOM 11124  C C    . VAL C 1 111 ? -4.992  0.065   145.465 1.00 0.00 ?  111 VAL C C    1  
ATOM 11125  O O    . VAL C 1 111 ? -4.145  -0.819  145.234 1.00 0.00 ?  111 VAL C O    1  
ATOM 11126  C CB   . VAL C 1 111 ? -3.950  1.906   146.808 1.00 0.00 ?  111 VAL C CB   1  
ATOM 11127  C CG1  . VAL C 1 111 ? -2.590  1.294   146.465 1.00 0.00 ?  111 VAL C CG1  1  
ATOM 11128  C CG2  . VAL C 1 111 ? -4.373  3.001   145.811 1.00 0.00 ?  111 VAL C CG2  1  
ATOM 11129  H H    . VAL C 1 111 ? -4.778  -1.072  147.680 1.00 0.00 ?  111 VAL C H    1  
ATOM 11130  H HA   . VAL C 1 111 ? -5.994  1.312   146.874 1.00 0.00 ?  111 VAL C HA   1  
ATOM 11131  H HB   . VAL C 1 111 ? -3.884  2.366   147.815 1.00 0.00 ?  111 VAL C HB   1  
ATOM 11132  H HG11 . VAL C 1 111 ? -2.518  0.265   146.872 1.00 0.00 ?  111 VAL C HG11 1  
ATOM 11133  H HG12 . VAL C 1 111 ? -1.771  1.908   146.897 1.00 0.00 ?  111 VAL C HG12 1  
ATOM 11134  H HG13 . VAL C 1 111 ? -2.455  1.248   145.366 1.00 0.00 ?  111 VAL C HG13 1  
ATOM 11135  H HG21 . VAL C 1 111 ? -5.409  2.818   145.453 1.00 0.00 ?  111 VAL C HG21 1  
ATOM 11136  H HG22 . VAL C 1 111 ? -3.692  3.010   144.933 1.00 0.00 ?  111 VAL C HG22 1  
ATOM 11137  H HG23 . VAL C 1 111 ? -4.339  4.000   146.297 1.00 0.00 ?  111 VAL C HG23 1  
ATOM 11138  N N    . GLY C 1 112 ? -5.872  0.517   144.499 1.00 0.00 ?  112 GLY C N    1  
ATOM 11139  C CA   . GLY C 1 112 ? -6.102  -0.180  143.218 1.00 0.00 ?  112 GLY C CA   1  
ATOM 11140  C C    . GLY C 1 112 ? -5.025  -0.047  142.150 1.00 0.00 ?  112 GLY C C    1  
ATOM 11141  O O    . GLY C 1 112 ? -4.641  1.031   141.690 1.00 0.00 ?  112 GLY C O    1  
ATOM 11142  H H    . GLY C 1 112 ? -6.400  1.351   144.630 1.00 0.00 ?  112 GLY C H    1  
ATOM 11143  H HA2  . GLY C 1 112 ? -6.173  -1.225  143.461 1.00 0.00 ?  112 GLY C HA2  1  
ATOM 11144  H HA3  . GLY C 1 112 ? -7.025  0.224   142.822 1.00 0.00 ?  112 GLY C HA3  1  
ATOM 11145  N N    . TYR C 1 113 ? -4.736  -1.202  141.516 1.00 0.00 ?  113 TYR C N    1  
ATOM 11146  C CA   . TYR C 1 113 ? -3.681  -1.237  140.541 1.00 0.00 ?  113 TYR C CA   1  
ATOM 11147  C C    . TYR C 1 113 ? -4.074  -0.714  139.170 1.00 0.00 ?  113 TYR C C    1  
ATOM 11148  O O    . TYR C 1 113 ? -3.793  0.435   138.872 1.00 0.00 ?  113 TYR C O    1  
ATOM 11149  C CB   . TYR C 1 113 ? -3.058  -2.624  140.358 1.00 0.00 ?  113 TYR C CB   1  
ATOM 11150  C CG   . TYR C 1 113 ? -3.932  -3.768  140.751 1.00 0.00 ?  113 TYR C CG   1  
ATOM 11151  C CD1  . TYR C 1 113 ? -3.925  -4.234  142.048 1.00 0.00 ?  113 TYR C CD1  1  
ATOM 11152  C CD2  . TYR C 1 113 ? -4.735  -4.395  139.821 1.00 0.00 ?  113 TYR C CD2  1  
ATOM 11153  C CE1  . TYR C 1 113 ? -4.705  -5.305  142.410 1.00 0.00 ?  113 TYR C CE1  1  
ATOM 11154  C CE2  . TYR C 1 113 ? -5.520  -5.464  140.185 1.00 0.00 ?  113 TYR C CE2  1  
ATOM 11155  C CZ   . TYR C 1 113 ? -5.502  -5.921  141.478 1.00 0.00 ?  113 TYR C CZ   1  
ATOM 11156  O OH   . TYR C 1 113 ? -6.302  -7.022  141.851 1.00 0.00 ?  113 TYR C OH   1  
ATOM 11157  H H    . TYR C 1 113 ? -5.231  -2.055  141.684 1.00 0.00 ?  113 TYR C H    1  
ATOM 11158  H HA   . TYR C 1 113 ? -2.919  -0.577  140.924 1.00 0.00 ?  113 TYR C HA   1  
ATOM 11159  H HB2  . TYR C 1 113 ? -2.781  -2.776  139.294 1.00 0.00 ?  113 TYR C HB2  1  
ATOM 11160  H HB3