data_7UUT
# 
_entry.id   7UUT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.359 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7UUT         pdb_00007uut 10.2210/pdb7uut/pdb 
WWPDB D_1000264965 ?            ?                   
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2022-05-11 
_pdbx_database_PDB_obs_spr.pdb_id           7UUT 
_pdbx_database_PDB_obs_spr.replace_pdb_id   7JNU 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7UUT 
_pdbx_database_status.recvd_initial_deposition_date   2022-04-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Dinh, T.'     1 0000-0002-5141-3281 
'Phillips, R.' 2 0000-0001-8710-562X 
'Rahn, K.'     3 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proteins 
_citation.journal_id_ASTM           PSFGEY 
_citation.journal_id_CSD            0867 
_citation.journal_id_ISSN           1097-0134 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            90 
_citation.language                  ? 
_citation.page_first                1570 
_citation.page_last                 1583 
_citation.title                     
;Crystallographic snapshots of ternary complexes of thermophilic secondary alcohol dehydrogenase from Thermoanaerobacter pseudoethanolicus reveal the dynamics of ligand exchange and the proton relay network.
;
_citation.year                      2022 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/prot.26339 
_citation.pdbx_database_id_PubMed   35357038 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Dinh, T.'       1 ? 
primary 'Rahn, K.T.'     2 ? 
primary 'Phillips, R.S.' 3 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7UUT 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     79.870 
_cell.length_a_esd                 ? 
_cell.length_b                     124.560 
_cell.length_b_esd                 ? 
_cell.length_c                     166.470 
_cell.length_c_esd                 ? 
_cell.volume                       1656144.641 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
_cell.pdbx_esd_method              ? 
# 
_symmetry.entry_id                         7UUT 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            'P 2ac 2ab' 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Secondary-alcohol dehydrogenase'                  37652.793 1   1.1.1.80 I86A ? ? 
2 polymer     man 'Secondary-alcohol dehydrogenase'                  37680.801 3   1.1.1.80 I86A ? ? 
3 non-polymer syn 'ZINC ION'                                         65.409    4   ?        ?    ? ? 
4 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 743.405   4   ?        ?    ? ? 
5 non-polymer syn '(2R)-pentan-2-ol'                                 88.148    4   ?        ?    ? ? 
6 non-polymer syn 'POTASSIUM ION'                                    39.098    4   ?        ?    ? ? 
7 water       nat water                                              18.015    358 ?        ?    ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDR
VVVPAATPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAE
LADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAI
IAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLV
THVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
;
;MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDR
VVVPAATPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAE
LADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAI
IAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLV
THVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
;
A     ? 
2 'polypeptide(L)' no yes 
;(FME)KGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFK
PGDRVVVPAATPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGF
HGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGV
DAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDP
SKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
;
;MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDR
VVVPAATPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAE
LADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAI
IAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLV
THVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
;
B,C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLY n 
1 4   PHE n 
1 5   ALA n 
1 6   MET n 
1 7   LEU n 
1 8   SER n 
1 9   ILE n 
1 10  GLY n 
1 11  LYS n 
1 12  VAL n 
1 13  GLY n 
1 14  TRP n 
1 15  ILE n 
1 16  GLU n 
1 17  LYS n 
1 18  GLU n 
1 19  LYS n 
1 20  PRO n 
1 21  ALA n 
1 22  PRO n 
1 23  GLY n 
1 24  PRO n 
1 25  PHE n 
1 26  ASP n 
1 27  ALA n 
1 28  ILE n 
1 29  VAL n 
1 30  ARG n 
1 31  PRO n 
1 32  LEU n 
1 33  ALA n 
1 34  VAL n 
1 35  ALA n 
1 36  PRO n 
1 37  CYS n 
1 38  THR n 
1 39  SER n 
1 40  ASP n 
1 41  ILE n 
1 42  HIS n 
1 43  THR n 
1 44  VAL n 
1 45  PHE n 
1 46  GLU n 
1 47  GLY n 
1 48  ALA n 
1 49  ILE n 
1 50  GLY n 
1 51  GLU n 
1 52  ARG n 
1 53  HIS n 
1 54  ASN n 
1 55  MET n 
1 56  ILE n 
1 57  LEU n 
1 58  GLY n 
1 59  HIS n 
1 60  GLU n 
1 61  ALA n 
1 62  VAL n 
1 63  GLY n 
1 64  GLU n 
1 65  VAL n 
1 66  VAL n 
1 67  GLU n 
1 68  VAL n 
1 69  GLY n 
1 70  SER n 
1 71  GLU n 
1 72  VAL n 
1 73  LYS n 
1 74  ASP n 
1 75  PHE n 
1 76  LYS n 
1 77  PRO n 
1 78  GLY n 
1 79  ASP n 
1 80  ARG n 
1 81  VAL n 
1 82  VAL n 
1 83  VAL n 
1 84  PRO n 
1 85  ALA n 
1 86  ALA n 
1 87  THR n 
1 88  PRO n 
1 89  ASP n 
1 90  TRP n 
1 91  ARG n 
1 92  THR n 
1 93  SER n 
1 94  GLU n 
1 95  VAL n 
1 96  GLN n 
1 97  ARG n 
1 98  GLY n 
1 99  TYR n 
1 100 HIS n 
1 101 GLN n 
1 102 HIS n 
1 103 SER n 
1 104 GLY n 
1 105 GLY n 
1 106 MET n 
1 107 LEU n 
1 108 ALA n 
1 109 GLY n 
1 110 TRP n 
1 111 LYS n 
1 112 PHE n 
1 113 SER n 
1 114 ASN n 
1 115 VAL n 
1 116 LYS n 
1 117 ASP n 
1 118 GLY n 
1 119 VAL n 
1 120 PHE n 
1 121 GLY n 
1 122 GLU n 
1 123 PHE n 
1 124 PHE n 
1 125 HIS n 
1 126 VAL n 
1 127 ASN n 
1 128 ASP n 
1 129 ALA n 
1 130 ASP n 
1 131 MET n 
1 132 ASN n 
1 133 LEU n 
1 134 ALA n 
1 135 HIS n 
1 136 LEU n 
1 137 PRO n 
1 138 LYS n 
1 139 GLU n 
1 140 ILE n 
1 141 PRO n 
1 142 LEU n 
1 143 GLU n 
1 144 ALA n 
1 145 ALA n 
1 146 VAL n 
1 147 MET n 
1 148 ILE n 
1 149 PRO n 
1 150 ASP n 
1 151 MET n 
1 152 MET n 
1 153 THR n 
1 154 THR n 
1 155 GLY n 
1 156 PHE n 
1 157 HIS n 
1 158 GLY n 
1 159 ALA n 
1 160 GLU n 
1 161 LEU n 
1 162 ALA n 
1 163 ASP n 
1 164 ILE n 
1 165 GLU n 
1 166 LEU n 
1 167 GLY n 
1 168 ALA n 
1 169 THR n 
1 170 VAL n 
1 171 ALA n 
1 172 VAL n 
1 173 LEU n 
1 174 GLY n 
1 175 ILE n 
1 176 GLY n 
1 177 PRO n 
1 178 VAL n 
1 179 GLY n 
1 180 LEU n 
1 181 MET n 
1 182 ALA n 
1 183 VAL n 
1 184 ALA n 
1 185 GLY n 
1 186 ALA n 
1 187 LYS n 
1 188 LEU n 
1 189 ARG n 
1 190 GLY n 
1 191 ALA n 
1 192 GLY n 
1 193 ARG n 
1 194 ILE n 
1 195 ILE n 
1 196 ALA n 
1 197 VAL n 
1 198 GLY n 
1 199 SER n 
1 200 ARG n 
1 201 PRO n 
1 202 VAL n 
1 203 CYS n 
1 204 VAL n 
1 205 ASP n 
1 206 ALA n 
1 207 ALA n 
1 208 LYS n 
1 209 TYR n 
1 210 TYR n 
1 211 GLY n 
1 212 ALA n 
1 213 THR n 
1 214 ASP n 
1 215 ILE n 
1 216 VAL n 
1 217 ASN n 
1 218 TYR n 
1 219 LYS n 
1 220 ASP n 
1 221 GLY n 
1 222 PRO n 
1 223 ILE n 
1 224 GLU n 
1 225 SER n 
1 226 GLN n 
1 227 ILE n 
1 228 MET n 
1 229 ASN n 
1 230 LEU n 
1 231 THR n 
1 232 GLU n 
1 233 GLY n 
1 234 LYS n 
1 235 GLY n 
1 236 VAL n 
1 237 ASP n 
1 238 ALA n 
1 239 ALA n 
1 240 ILE n 
1 241 ILE n 
1 242 ALA n 
1 243 GLY n 
1 244 GLY n 
1 245 ASN n 
1 246 ALA n 
1 247 ASP n 
1 248 ILE n 
1 249 MET n 
1 250 ALA n 
1 251 THR n 
1 252 ALA n 
1 253 VAL n 
1 254 LYS n 
1 255 ILE n 
1 256 VAL n 
1 257 LYS n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 ILE n 
1 263 ALA n 
1 264 ASN n 
1 265 VAL n 
1 266 ASN n 
1 267 TYR n 
1 268 PHE n 
1 269 GLY n 
1 270 GLU n 
1 271 GLY n 
1 272 GLU n 
1 273 VAL n 
1 274 LEU n 
1 275 PRO n 
1 276 VAL n 
1 277 PRO n 
1 278 ARG n 
1 279 LEU n 
1 280 GLU n 
1 281 TRP n 
1 282 GLY n 
1 283 CYS n 
1 284 GLY n 
1 285 MET n 
1 286 ALA n 
1 287 HIS n 
1 288 LYS n 
1 289 THR n 
1 290 ILE n 
1 291 LYS n 
1 292 GLY n 
1 293 GLY n 
1 294 LEU n 
1 295 CYS n 
1 296 PRO n 
1 297 GLY n 
1 298 GLY n 
1 299 ARG n 
1 300 LEU n 
1 301 ARG n 
1 302 MET n 
1 303 GLU n 
1 304 ARG n 
1 305 LEU n 
1 306 ILE n 
1 307 ASP n 
1 308 LEU n 
1 309 VAL n 
1 310 PHE n 
1 311 TYR n 
1 312 LYS n 
1 313 ARG n 
1 314 VAL n 
1 315 ASP n 
1 316 PRO n 
1 317 SER n 
1 318 LYS n 
1 319 LEU n 
1 320 VAL n 
1 321 THR n 
1 322 HIS n 
1 323 VAL n 
1 324 PHE n 
1 325 ARG n 
1 326 GLY n 
1 327 PHE n 
1 328 ASP n 
1 329 ASN n 
1 330 ILE n 
1 331 GLU n 
1 332 LYS n 
1 333 ALA n 
1 334 PHE n 
1 335 MET n 
1 336 LEU n 
1 337 MET n 
1 338 LYS n 
1 339 ASP n 
1 340 LYS n 
1 341 PRO n 
1 342 LYS n 
1 343 ASP n 
1 344 LEU n 
1 345 ILE n 
1 346 LYS n 
1 347 PRO n 
1 348 VAL n 
1 349 VAL n 
1 350 ILE n 
1 351 LEU n 
1 352 ALA n 
2 1   FME n 
2 2   LYS n 
2 3   GLY n 
2 4   PHE n 
2 5   ALA n 
2 6   MET n 
2 7   LEU n 
2 8   SER n 
2 9   ILE n 
2 10  GLY n 
2 11  LYS n 
2 12  VAL n 
2 13  GLY n 
2 14  TRP n 
2 15  ILE n 
2 16  GLU n 
2 17  LYS n 
2 18  GLU n 
2 19  LYS n 
2 20  PRO n 
2 21  ALA n 
2 22  PRO n 
2 23  GLY n 
2 24  PRO n 
2 25  PHE n 
2 26  ASP n 
2 27  ALA n 
2 28  ILE n 
2 29  VAL n 
2 30  ARG n 
2 31  PRO n 
2 32  LEU n 
2 33  ALA n 
2 34  VAL n 
2 35  ALA n 
2 36  PRO n 
2 37  CYS n 
2 38  THR n 
2 39  SER n 
2 40  ASP n 
2 41  ILE n 
2 42  HIS n 
2 43  THR n 
2 44  VAL n 
2 45  PHE n 
2 46  GLU n 
2 47  GLY n 
2 48  ALA n 
2 49  ILE n 
2 50  GLY n 
2 51  GLU n 
2 52  ARG n 
2 53  HIS n 
2 54  ASN n 
2 55  MET n 
2 56  ILE n 
2 57  LEU n 
2 58  GLY n 
2 59  HIS n 
2 60  GLU n 
2 61  ALA n 
2 62  VAL n 
2 63  GLY n 
2 64  GLU n 
2 65  VAL n 
2 66  VAL n 
2 67  GLU n 
2 68  VAL n 
2 69  GLY n 
2 70  SER n 
2 71  GLU n 
2 72  VAL n 
2 73  LYS n 
2 74  ASP n 
2 75  PHE n 
2 76  LYS n 
2 77  PRO n 
2 78  GLY n 
2 79  ASP n 
2 80  ARG n 
2 81  VAL n 
2 82  VAL n 
2 83  VAL n 
2 84  PRO n 
2 85  ALA n 
2 86  ALA n 
2 87  THR n 
2 88  PRO n 
2 89  ASP n 
2 90  TRP n 
2 91  ARG n 
2 92  THR n 
2 93  SER n 
2 94  GLU n 
2 95  VAL n 
2 96  GLN n 
2 97  ARG n 
2 98  GLY n 
2 99  TYR n 
2 100 HIS n 
2 101 GLN n 
2 102 HIS n 
2 103 SER n 
2 104 GLY n 
2 105 GLY n 
2 106 MET n 
2 107 LEU n 
2 108 ALA n 
2 109 GLY n 
2 110 TRP n 
2 111 LYS n 
2 112 PHE n 
2 113 SER n 
2 114 ASN n 
2 115 VAL n 
2 116 LYS n 
2 117 ASP n 
2 118 GLY n 
2 119 VAL n 
2 120 PHE n 
2 121 GLY n 
2 122 GLU n 
2 123 PHE n 
2 124 PHE n 
2 125 HIS n 
2 126 VAL n 
2 127 ASN n 
2 128 ASP n 
2 129 ALA n 
2 130 ASP n 
2 131 MET n 
2 132 ASN n 
2 133 LEU n 
2 134 ALA n 
2 135 HIS n 
2 136 LEU n 
2 137 PRO n 
2 138 LYS n 
2 139 GLU n 
2 140 ILE n 
2 141 PRO n 
2 142 LEU n 
2 143 GLU n 
2 144 ALA n 
2 145 ALA n 
2 146 VAL n 
2 147 MET n 
2 148 ILE n 
2 149 PRO n 
2 150 ASP n 
2 151 MET n 
2 152 MET n 
2 153 THR n 
2 154 THR n 
2 155 GLY n 
2 156 PHE n 
2 157 HIS n 
2 158 GLY n 
2 159 ALA n 
2 160 GLU n 
2 161 LEU n 
2 162 ALA n 
2 163 ASP n 
2 164 ILE n 
2 165 GLU n 
2 166 LEU n 
2 167 GLY n 
2 168 ALA n 
2 169 THR n 
2 170 VAL n 
2 171 ALA n 
2 172 VAL n 
2 173 LEU n 
2 174 GLY n 
2 175 ILE n 
2 176 GLY n 
2 177 PRO n 
2 178 VAL n 
2 179 GLY n 
2 180 LEU n 
2 181 MET n 
2 182 ALA n 
2 183 VAL n 
2 184 ALA n 
2 185 GLY n 
2 186 ALA n 
2 187 LYS n 
2 188 LEU n 
2 189 ARG n 
2 190 GLY n 
2 191 ALA n 
2 192 GLY n 
2 193 ARG n 
2 194 ILE n 
2 195 ILE n 
2 196 ALA n 
2 197 VAL n 
2 198 GLY n 
2 199 SER n 
2 200 ARG n 
2 201 PRO n 
2 202 VAL n 
2 203 CYS n 
2 204 VAL n 
2 205 ASP n 
2 206 ALA n 
2 207 ALA n 
2 208 LYS n 
2 209 TYR n 
2 210 TYR n 
2 211 GLY n 
2 212 ALA n 
2 213 THR n 
2 214 ASP n 
2 215 ILE n 
2 216 VAL n 
2 217 ASN n 
2 218 TYR n 
2 219 LYS n 
2 220 ASP n 
2 221 GLY n 
2 222 PRO n 
2 223 ILE n 
2 224 GLU n 
2 225 SER n 
2 226 GLN n 
2 227 ILE n 
2 228 MET n 
2 229 ASN n 
2 230 LEU n 
2 231 THR n 
2 232 GLU n 
2 233 GLY n 
2 234 LYS n 
2 235 GLY n 
2 236 VAL n 
2 237 ASP n 
2 238 ALA n 
2 239 ALA n 
2 240 ILE n 
2 241 ILE n 
2 242 ALA n 
2 243 GLY n 
2 244 GLY n 
2 245 ASN n 
2 246 ALA n 
2 247 ASP n 
2 248 ILE n 
2 249 MET n 
2 250 ALA n 
2 251 THR n 
2 252 ALA n 
2 253 VAL n 
2 254 LYS n 
2 255 ILE n 
2 256 VAL n 
2 257 LYS n 
2 258 PRO n 
2 259 GLY n 
2 260 GLY n 
2 261 THR n 
2 262 ILE n 
2 263 ALA n 
2 264 ASN n 
2 265 VAL n 
2 266 ASN n 
2 267 TYR n 
2 268 PHE n 
2 269 GLY n 
2 270 GLU n 
2 271 GLY n 
2 272 GLU n 
2 273 VAL n 
2 274 LEU n 
2 275 PRO n 
2 276 VAL n 
2 277 PRO n 
2 278 ARG n 
2 279 LEU n 
2 280 GLU n 
2 281 TRP n 
2 282 GLY n 
2 283 CYS n 
2 284 GLY n 
2 285 MET n 
2 286 ALA n 
2 287 HIS n 
2 288 LYS n 
2 289 THR n 
2 290 ILE n 
2 291 LYS n 
2 292 GLY n 
2 293 GLY n 
2 294 LEU n 
2 295 CYS n 
2 296 PRO n 
2 297 GLY n 
2 298 GLY n 
2 299 ARG n 
2 300 LEU n 
2 301 ARG n 
2 302 MET n 
2 303 GLU n 
2 304 ARG n 
2 305 LEU n 
2 306 ILE n 
2 307 ASP n 
2 308 LEU n 
2 309 VAL n 
2 310 PHE n 
2 311 TYR n 
2 312 LYS n 
2 313 ARG n 
2 314 VAL n 
2 315 ASP n 
2 316 PRO n 
2 317 SER n 
2 318 LYS n 
2 319 LEU n 
2 320 VAL n 
2 321 THR n 
2 322 HIS n 
2 323 VAL n 
2 324 PHE n 
2 325 ARG n 
2 326 GLY n 
2 327 PHE n 
2 328 ASP n 
2 329 ASN n 
2 330 ILE n 
2 331 GLU n 
2 332 LYS n 
2 333 ALA n 
2 334 PHE n 
2 335 MET n 
2 336 LEU n 
2 337 MET n 
2 338 LYS n 
2 339 ASP n 
2 340 LYS n 
2 341 PRO n 
2 342 LYS n 
2 343 ASP n 
2 344 LEU n 
2 345 ILE n 
2 346 LYS n 
2 347 PRO n 
2 348 VAL n 
2 349 VAL n 
2 350 ILE n 
2 351 LEU n 
2 352 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 352 ? ? ? ? ? ? ? ? ? 'Thermoanaerobacter pseudethanolicus' 496866 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 352 ? ? ? ? ? ? ? ? ? 'Thermoanaerobacter pseudethanolicus' 496866 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ADH_THEBR P14941 ? 1 
;MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDR
VVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAE
LADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAI
IAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLV
THVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
;
1 
2 UNP ADH_THEBR P14941 ? 2 
;MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDR
VVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAE
LADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAI
IAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLV
THVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 7UUT A 1 ? 352 ? P14941 1 ? 352 ? 1 352 
2 2 7UUT B 1 ? 352 ? P14941 1 ? 352 ? 1 352 
3 2 7UUT C 1 ? 352 ? P14941 1 ? 352 ? 1 352 
4 2 7UUT D 1 ? 352 ? P14941 1 ? 352 ? 1 352 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7UUT ALA A 86 ? UNP P14941 ILE 86 'engineered mutation' 86 1 
2 7UUT ALA B 86 ? UNP P14941 ILE 86 'engineered mutation' 86 2 
3 7UUT ALA C 86 ? UNP P14941 ILE 86 'engineered mutation' 86 3 
4 7UUT ALA D 86 ? UNP P14941 ILE 86 'engineered mutation' 86 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2RP non-polymer         . '(2R)-pentan-2-ol'                                 ?                                            
'C5 H12 O'          88.148  
ALA 'L-peptide linking' y ALANINE                                            ?                                            
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                                            
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                                            
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                                            
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                           ?                                            
'C3 H7 N O2 S'      121.158 
FME 'L-peptide linking' n N-FORMYLMETHIONINE                                 ?                                            
'C6 H11 N O3 S'     177.221 
GLN 'L-peptide linking' y GLUTAMINE                                          ?                                            
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                                            
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                                            
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                          ?                                            
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                              ?                                            'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                                            
'C6 H13 N O2'       131.173 
K   non-polymer         . 'POTASSIUM ION'                                    ?                                            'K 1' 
39.098  
LEU 'L-peptide linking' y LEUCINE                                            ?                                            
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                                            
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                                            
'C5 H11 N O2 S'     149.211 
NAP non-polymer         . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 
;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE
;
'C21 H28 N7 O17 P3' 743.405 
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                                            
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                                            
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                             ?                                            
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                          ?                                            
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ?                                            
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                           ?                                            
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                             ?                                            
'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                         ?                                            'Zn 2' 
65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7UUT 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                       ? 
_exptl_crystal.density_diffrn               ? 
_exptl_crystal.density_Matthews             2.75 
_exptl_crystal.density_method               ? 
_exptl_crystal.density_percent_sol          55.23 
_exptl_crystal.description                  ? 
_exptl_crystal.F_000                        ? 
_exptl_crystal.id                           1 
_exptl_crystal.preparation                  ? 
_exptl_crystal.size_max                     ? 
_exptl_crystal.size_mid                     ? 
_exptl_crystal.size_min                     ? 
_exptl_crystal.size_rad                     ? 
_exptl_crystal.colour_lustre                ? 
_exptl_crystal.colour_modifier              ? 
_exptl_crystal.colour_primary               ? 
_exptl_crystal.density_meas                 ? 
_exptl_crystal.density_meas_esd             ? 
_exptl_crystal.density_meas_gt              ? 
_exptl_crystal.density_meas_lt              ? 
_exptl_crystal.density_meas_temp            ? 
_exptl_crystal.density_meas_temp_esd        ? 
_exptl_crystal.density_meas_temp_gt         ? 
_exptl_crystal.density_meas_temp_lt         ? 
_exptl_crystal.pdbx_crystal_image_url       ? 
_exptl_crystal.pdbx_crystal_image_format    ? 
_exptl_crystal.pdbx_mosaicity               ? 
_exptl_crystal.pdbx_mosaicity_esd           ? 
_exptl_crystal.pdbx_mosaic_method           ? 
_exptl_crystal.pdbx_mosaic_block_size       ? 
_exptl_crystal.pdbx_mosaic_block_size_esd   ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.6 M KCl, 12% PEG 3350, 50 mM HEPES buffer pH 7.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-02-14 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate                          36.41 
_reflns.entry_id                                       7UUT 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              1.89 
_reflns.d_resolution_low                               83.24 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     89509 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           94 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                21.3 
_reflns.pdbx_Rmerge_I_obs                              ? 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          15.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                ? 
_reflns.pdbx_Rpim_I_all                                ? 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   0.999 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
_reflns.pdbx_CC_split_method                           ? 
# 
_reflns_shell.d_res_high                                    1.89 
_reflns_shell.d_res_low                                     1.96 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           ? 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             4475 
_reflns_shell.percent_possible_all                          ? 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               ? 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               ? 
_reflns_shell.pdbx_Rpim_I_all                               ? 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  0.365 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               56.97 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7UUT 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.89 
_refine.ls_d_res_low                             39.47 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     89179 
_refine.ls_number_reflns_R_free                  1995 
_refine.ls_number_reflns_R_work                  87184 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    67.05 
_refine.ls_percent_reflns_R_free                 2.24 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2005 
_refine.ls_R_factor_R_free                       0.2312 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1997 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1YKF 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 32.8720 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3087 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.89 
_refine_hist.d_res_low                        39.47 
_refine_hist.number_atoms_solvent             358 
_refine_hist.number_atoms_total               11148 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        10566 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         224 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0029  ? 11171 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.5999  ? 15177 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0472  ? 1688  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0043  ? 1949  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 11.2293 ? 4082  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' d_2 ? ? 0.542424315594 ? ? 1 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_3 ? ? 0.730135329445 ? ? 2 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_4 ? ? 0.622971572143 ? ? 3 'Torsion NCS' ? A ? ? ? ens_1 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.89 1.94  . . 15  577  6.34   . . . 0.7232 . 0.5748 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.94 1.99  . . 24  1083 11.81  . . . 0.3413 . 0.4174 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.99 2.05  . . 41  1762 19.15  . . . 0.3945 . 0.3612 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.05 2.12  . . 68  2972 32.28  . . . 0.4599 . 0.3536 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.12 2.19  . . 100 4405 48.00  . . . 0.3377 . 0.3214 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.19 2.28  . . 129 5651 61.05  . . . 0.3863 . 0.3793 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.28 2.38  . . 152 6622 72.03  . . . 0.3225 . 0.2900 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.38 2.51  . . 181 7871 85.04  . . . 0.3084 . 0.2814 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.51 2.66  . . 208 9141 98.77  . . . 0.3407 . 0.2663 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.66 2.87  . . 212 9270 99.92  . . . 0.2612 . 0.2423 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.87 3.16  . . 213 9313 100.00 . . . 0.2748 . 0.2245 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.16 3.62  . . 213 9357 100.00 . . . 0.2292 . 0.1898 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.62 4.55  . . 216 9413 100.00 . . . 0.1766 . 0.1517 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.56 39.47 . . 223 9747 99.96  . . . 0.1718 . 0.1470 . . . . . . . . . . . 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
_struct_ncs_oper.details 
1 given -0.999986107419 0.00526897464284 -0.000151246680783 0.00411500157507 0.762401468556  -0.647091235844 -0.00329419662173 
-0.647082868457 -0.76241255867  37.1152935417  -9.21878621551 -24.3100317512 ? 
2 given -0.526545052152 0.312872507371   0.790481563469     0.293635205141   -0.805664148533 0.514474145192  0.797827471547    
0.503007031661  0.332348088221  39.4741689807  -3.70874249878 -22.0589721664 ? 
3 given 0.515426938075  -0.302880510701  -0.801622397232    -0.305277033728  -0.938981391043 0.158492523335  -0.800712810054   
0.163025591586  -0.576438767176 -2.21158929118 2.70307135082  -5.21690695735 ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
ens_1 d_1 
;(chain "A" and (resid 2 through 55 or resid 57 through 61 or resid 63 through 79 or resid 81 through 88 or resid 90 or resid 92 through 93 or resid 95 through 164 or resid 166 through 188 or resid 190 through 223 or resid 225 through 313 or resid 315 through 317 or resid 319 through 325 or resid 328 through 331 or resid 333 through 338 or resid 340 through 350 or resid 352 or resid 401 through 512))
;
ens_1 d_2 
;(chain "B" and (resid 2 through 55 or resid 57 through 61 or resid 63 through 79 or resid 81 through 88 or resid 90 or resid 92 through 93 or resid 95 through 164 or resid 166 through 188 or resid 190 through 223 or resid 225 through 313 or resid 315 through 317 or resid 319 through 325 or resid 328 through 331 or resid 333 through 338 or resid 340 through 350 or resid 352 or resid 401 through 512))
;
ens_1 d_3 
;(chain "C" and (resid 2 through 55 or resid 57 through 61 or resid 63 through 79 or resid 81 through 88 or resid 90 or resid 92 through 93 or resid 95 through 164 or resid 166 through 188 or resid 190 through 223 or resid 225 through 313 or resid 315 through 317 or resid 319 through 325 or resid 328 through 331 or resid 333 through 338 or resid 340 through 350 or resid 352 or resid 401 through 512))
;
ens_1 d_4 
;(chain "D" and (resid 2 through 55 or resid 57 through 61 or resid 63 through 79 or resid 81 through 88 or resid 90 or resid 92 through 93 or resid 95 through 164 or resid 166 through 188 or resid 190 through 223 or resid 225 through 313 or resid 315 through 317 or resid 319 through 325 or resid 328 through 331 or resid 333 through 338 or resid 340 through 350 or resid 352 or resid 401 through 512))
;
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.selection_details 
ens_1 d_1 1  . A LYS 2   . A MET 55  ? ? ? ? ? ? 
ens_1 d_1 2  . A LEU 57  . A ALA 61  ? ? ? ? ? ? 
ens_1 d_1 3  . A GLY 63  . A ASP 79  ? ? ? ? ? ? 
ens_1 d_1 4  . A VAL 81  . A PRO 88  ? ? ? ? ? ? 
ens_1 d_1 5  . A TRP 90  . A TRP 90  ? ? ? ? ? ? 
ens_1 d_1 6  . A THR 92  . A SER 93  ? ? ? ? ? ? 
ens_1 d_1 7  . A VAL 95  . A ILE 164 ? ? ? ? ? ? 
ens_1 d_1 8  . A LEU 166 . A LEU 188 ? ? ? ? ? ? 
ens_1 d_1 9  . A GLY 190 . A ILE 223 ? ? ? ? ? ? 
ens_1 d_1 10 . A SER 225 . A ARG 313 ? ? ? ? ? ? 
ens_1 d_1 11 . A ASP 315 . A SER 317 ? ? ? ? ? ? 
ens_1 d_1 12 . A LEU 319 . A ARG 325 ? ? ? ? ? ? 
ens_1 d_1 13 . A ASP 328 . A GLU 331 ? ? ? ? ? ? 
ens_1 d_1 14 . A ALA 333 . A LYS 338 ? ? ? ? ? ? 
ens_1 d_1 15 . A LYS 340 . A ILE 350 ? ? ? ? ? ? 
ens_1 d_1 16 . A ALA 352 . A ALA 352 ? ? ? ? ? ? 
ens_1 d_1 17 . B ZN  .   . B ZN  .   ? ? ? ? ? ? 
ens_1 d_1 18 . C NAP .   . C NAP .   ? ? ? ? ? ? 
ens_1 d_1 19 . D R2P .   . D R2P .   ? ? ? ? ? ? 
ens_1 d_2 1  . E LYS 2   . E MET 55  ? ? ? ? ? ? 
ens_1 d_2 2  . E LEU 57  . E ALA 61  ? ? ? ? ? ? 
ens_1 d_2 3  . E GLY 63  . E ASP 79  ? ? ? ? ? ? 
ens_1 d_2 4  . E VAL 81  . E PRO 88  ? ? ? ? ? ? 
ens_1 d_2 5  . E TRP 90  . E TRP 90  ? ? ? ? ? ? 
ens_1 d_2 6  . E THR 92  . E SER 93  ? ? ? ? ? ? 
ens_1 d_2 7  . E VAL 95  . E ILE 164 ? ? ? ? ? ? 
ens_1 d_2 8  . E LEU 166 . E LEU 188 ? ? ? ? ? ? 
ens_1 d_2 9  . E GLY 190 . E ILE 223 ? ? ? ? ? ? 
ens_1 d_2 10 . E SER 225 . E ARG 313 ? ? ? ? ? ? 
ens_1 d_2 11 . E ASP 315 . E SER 317 ? ? ? ? ? ? 
ens_1 d_2 12 . E LEU 319 . E ARG 325 ? ? ? ? ? ? 
ens_1 d_2 13 . E ASP 328 . E GLU 331 ? ? ? ? ? ? 
ens_1 d_2 14 . E ALA 333 . E LYS 338 ? ? ? ? ? ? 
ens_1 d_2 15 . E LYS 340 . E ILE 350 ? ? ? ? ? ? 
ens_1 d_2 16 . E ALA 352 . E ALA 352 ? ? ? ? ? ? 
ens_1 d_2 17 . F ZN  .   . F ZN  .   ? ? ? ? ? ? 
ens_1 d_2 18 . G NAP .   . G NAP .   ? ? ? ? ? ? 
ens_1 d_2 19 . H R2P .   . H R2P .   ? ? ? ? ? ? 
ens_1 d_3 1  . I LYS 2   . I MET 55  ? ? ? ? ? ? 
ens_1 d_3 2  . I LEU 57  . I ALA 61  ? ? ? ? ? ? 
ens_1 d_3 3  . I GLY 63  . I ASP 79  ? ? ? ? ? ? 
ens_1 d_3 4  . I VAL 81  . I PRO 88  ? ? ? ? ? ? 
ens_1 d_3 5  . I TRP 90  . I TRP 90  ? ? ? ? ? ? 
ens_1 d_3 6  . I THR 92  . I SER 93  ? ? ? ? ? ? 
ens_1 d_3 7  . I VAL 95  . I ILE 164 ? ? ? ? ? ? 
ens_1 d_3 8  . I LEU 166 . I LEU 188 ? ? ? ? ? ? 
ens_1 d_3 9  . I GLY 190 . I ILE 223 ? ? ? ? ? ? 
ens_1 d_3 10 . I SER 225 . I ARG 313 ? ? ? ? ? ? 
ens_1 d_3 11 . I ASP 315 . I SER 317 ? ? ? ? ? ? 
ens_1 d_3 12 . I LEU 319 . I ARG 325 ? ? ? ? ? ? 
ens_1 d_3 13 . I ASP 328 . I GLU 331 ? ? ? ? ? ? 
ens_1 d_3 14 . I ALA 333 . I LYS 338 ? ? ? ? ? ? 
ens_1 d_3 15 . I LYS 340 . I ILE 350 ? ? ? ? ? ? 
ens_1 d_3 16 . I ALA 352 . I ALA 352 ? ? ? ? ? ? 
ens_1 d_3 17 . J ZN  .   . J ZN  .   ? ? ? ? ? ? 
ens_1 d_3 18 . K NAP .   . K NAP .   ? ? ? ? ? ? 
ens_1 d_3 19 . L R2P .   . L R2P .   ? ? ? ? ? ? 
ens_1 d_4 1  . M LYS 2   . M MET 55  ? ? ? ? ? ? 
ens_1 d_4 2  . M LEU 57  . M ALA 61  ? ? ? ? ? ? 
ens_1 d_4 3  . M GLY 63  . M ASP 79  ? ? ? ? ? ? 
ens_1 d_4 4  . M VAL 81  . M PRO 88  ? ? ? ? ? ? 
ens_1 d_4 5  . M TRP 90  . M TRP 90  ? ? ? ? ? ? 
ens_1 d_4 6  . M THR 92  . M SER 93  ? ? ? ? ? ? 
ens_1 d_4 7  . M VAL 95  . M ILE 164 ? ? ? ? ? ? 
ens_1 d_4 8  . M LEU 166 . M LEU 188 ? ? ? ? ? ? 
ens_1 d_4 9  . M GLY 190 . M ILE 223 ? ? ? ? ? ? 
ens_1 d_4 10 . M SER 225 . M ARG 313 ? ? ? ? ? ? 
ens_1 d_4 11 . M ASP 315 . M SER 317 ? ? ? ? ? ? 
ens_1 d_4 12 . M LEU 319 . M ARG 325 ? ? ? ? ? ? 
ens_1 d_4 13 . M ASP 328 . M GLU 331 ? ? ? ? ? ? 
ens_1 d_4 14 . M ALA 333 . M LYS 338 ? ? ? ? ? ? 
ens_1 d_4 15 . M LYS 340 . M ILE 350 ? ? ? ? ? ? 
ens_1 d_4 16 . M ALA 352 . M ALA 352 ? ? ? ? ? ? 
ens_1 d_4 17 . N ZN  .   . N ZN  .   ? ? ? ? ? ? 
ens_1 d_4 18 . O NAP .   . O NAP .   ? ? ? ? ? ? 
ens_1 d_4 19 . P R2P .   . P R2P .   ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        ens_1 
_struct_ncs_ens.details   ? 
# 
loop_
_struct_ncs_ens_gen.ens_id 
_struct_ncs_ens_gen.dom_id_1 
_struct_ncs_ens_gen.dom_id_2 
_struct_ncs_ens_gen.oper_id 
ens_1 d_2 d_1 1 
ens_1 d_3 d_1 2 
ens_1 d_4 d_1 3 
# 
_struct.entry_id                                   7UUT 
_struct.title                                      
;Ternary complex crystal structure of secondary alcohol dehydrogenases from the Thermoanaerobacter ethanolicus mutants C295A and I86A provides better understanding of catalytic mechanism
;
_struct.pdbx_structure_determination_methodology   ? 
_struct.pdbx_model_details                         ? 
_struct.pdbx_formula_weight                        ? 
_struct.pdbx_formula_weight_method                 ? 
_struct.pdbx_model_type_details                    ? 
_struct.pdbx_CASP_flag                             N 
# 
_struct_keywords.entry_id        7UUT 
_struct_keywords.text            'secondary alcohol dehydrogenases, NADP, 2-pentanol, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 3 ? 
J N N 4 ? 
K N N 5 ? 
L N N 6 ? 
M N N 3 ? 
N N N 4 ? 
O N N 5 ? 
P N N 6 ? 
Q N N 3 ? 
R N N 4 ? 
S N N 5 ? 
T N N 6 ? 
U N N 7 ? 
V N N 7 ? 
W N N 7 ? 
X N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 37  ? GLU A 46  ? CYS A 37  GLU A 46  1 ? 10 
HELX_P HELX_P2  AA2 THR A 92  ? ARG A 97  ? THR A 92  ARG A 97  1 ? 6  
HELX_P HELX_P3  AA3 TYR A 99  ? SER A 103 ? TYR A 99  SER A 103 5 ? 5  
HELX_P HELX_P4  AA4 ASP A 128 ? LEU A 133 ? ASP A 128 LEU A 133 1 ? 6  
HELX_P HELX_P5  AA5 PRO A 141 ? VAL A 146 ? PRO A 141 VAL A 146 1 ? 6  
HELX_P HELX_P6  AA6 ASP A 150 ? ALA A 162 ? ASP A 150 ALA A 162 1 ? 13 
HELX_P HELX_P7  AA7 GLY A 176 ? ARG A 189 ? GLY A 176 ARG A 189 1 ? 14 
HELX_P HELX_P8  AA8 ARG A 200 ? GLY A 211 ? ARG A 200 GLY A 211 1 ? 12 
HELX_P HELX_P9  AA9 ASN A 217 ? GLY A 221 ? ASN A 217 GLY A 221 5 ? 5  
HELX_P HELX_P10 AB1 PRO A 222 ? THR A 231 ? PRO A 222 THR A 231 1 ? 10 
HELX_P HELX_P11 AB2 ALA A 246 ? ILE A 255 ? ALA A 246 ILE A 255 1 ? 10 
HELX_P HELX_P12 AB3 TRP A 281 ? MET A 285 ? TRP A 281 MET A 285 5 ? 5  
HELX_P HELX_P13 AB4 GLY A 298 ? TYR A 311 ? GLY A 298 TYR A 311 1 ? 14 
HELX_P HELX_P14 AB5 ASP A 315 ? LYS A 318 ? ASP A 315 LYS A 318 5 ? 4  
HELX_P HELX_P15 AB6 ASP A 328 ? ASP A 339 ? ASP A 328 ASP A 339 1 ? 12 
HELX_P HELX_P16 AB7 CYS B 37  ? GLU B 46  ? CYS B 37  GLU B 46  1 ? 10 
HELX_P HELX_P17 AB8 THR B 92  ? ARG B 97  ? THR B 92  ARG B 97  1 ? 6  
HELX_P HELX_P18 AB9 TYR B 99  ? SER B 103 ? TYR B 99  SER B 103 5 ? 5  
HELX_P HELX_P19 AC1 ASP B 128 ? LEU B 133 ? ASP B 128 LEU B 133 1 ? 6  
HELX_P HELX_P20 AC2 PRO B 141 ? VAL B 146 ? PRO B 141 VAL B 146 1 ? 6  
HELX_P HELX_P21 AC3 ASP B 150 ? ALA B 162 ? ASP B 150 ALA B 162 1 ? 13 
HELX_P HELX_P22 AC4 GLY B 176 ? ARG B 189 ? GLY B 176 ARG B 189 1 ? 14 
HELX_P HELX_P23 AC5 ARG B 200 ? TYR B 210 ? ARG B 200 TYR B 210 1 ? 11 
HELX_P HELX_P24 AC6 ASN B 217 ? GLY B 221 ? ASN B 217 GLY B 221 5 ? 5  
HELX_P HELX_P25 AC7 PRO B 222 ? THR B 231 ? PRO B 222 THR B 231 1 ? 10 
HELX_P HELX_P26 AC8 ALA B 246 ? ILE B 255 ? ALA B 246 ILE B 255 1 ? 10 
HELX_P HELX_P27 AC9 TRP B 281 ? MET B 285 ? TRP B 281 MET B 285 5 ? 5  
HELX_P HELX_P28 AD1 GLY B 297 ? TYR B 311 ? GLY B 297 TYR B 311 1 ? 15 
HELX_P HELX_P29 AD2 ASP B 315 ? LYS B 318 ? ASP B 315 LYS B 318 5 ? 4  
HELX_P HELX_P30 AD3 ASP B 328 ? ASP B 339 ? ASP B 328 ASP B 339 1 ? 12 
HELX_P HELX_P31 AD4 CYS C 37  ? GLU C 46  ? CYS C 37  GLU C 46  1 ? 10 
HELX_P HELX_P32 AD5 THR C 92  ? ARG C 97  ? THR C 92  ARG C 97  1 ? 6  
HELX_P HELX_P33 AD6 TYR C 99  ? SER C 103 ? TYR C 99  SER C 103 5 ? 5  
HELX_P HELX_P34 AD7 ASP C 128 ? LEU C 133 ? ASP C 128 LEU C 133 1 ? 6  
HELX_P HELX_P35 AD8 PRO C 141 ? VAL C 146 ? PRO C 141 VAL C 146 1 ? 6  
HELX_P HELX_P36 AD9 ASP C 150 ? ALA C 162 ? ASP C 150 ALA C 162 1 ? 13 
HELX_P HELX_P37 AE1 GLY C 176 ? LEU C 188 ? GLY C 176 LEU C 188 1 ? 13 
HELX_P HELX_P38 AE2 ARG C 200 ? GLY C 211 ? ARG C 200 GLY C 211 1 ? 12 
HELX_P HELX_P39 AE3 ASN C 217 ? GLY C 221 ? ASN C 217 GLY C 221 5 ? 5  
HELX_P HELX_P40 AE4 PRO C 222 ? THR C 231 ? PRO C 222 THR C 231 1 ? 10 
HELX_P HELX_P41 AE5 ALA C 246 ? ILE C 255 ? ALA C 246 ILE C 255 1 ? 10 
HELX_P HELX_P42 AE6 TRP C 281 ? MET C 285 ? TRP C 281 MET C 285 5 ? 5  
HELX_P HELX_P43 AE7 GLY C 298 ? TYR C 311 ? GLY C 298 TYR C 311 1 ? 14 
HELX_P HELX_P44 AE8 ASP C 315 ? LYS C 318 ? ASP C 315 LYS C 318 5 ? 4  
HELX_P HELX_P45 AE9 PHE C 327 ? ASP C 339 ? PHE C 327 ASP C 339 1 ? 13 
HELX_P HELX_P46 AF1 CYS D 37  ? GLU D 46  ? CYS D 37  GLU D 46  1 ? 10 
HELX_P HELX_P47 AF2 THR D 92  ? ARG D 97  ? THR D 92  ARG D 97  1 ? 6  
HELX_P HELX_P48 AF3 TYR D 99  ? SER D 103 ? TYR D 99  SER D 103 5 ? 5  
HELX_P HELX_P49 AF4 ASP D 128 ? LEU D 133 ? ASP D 128 LEU D 133 1 ? 6  
HELX_P HELX_P50 AF5 PRO D 141 ? VAL D 146 ? PRO D 141 VAL D 146 1 ? 6  
HELX_P HELX_P51 AF6 ASP D 150 ? ALA D 162 ? ASP D 150 ALA D 162 1 ? 13 
HELX_P HELX_P52 AF7 GLY D 176 ? LEU D 188 ? GLY D 176 LEU D 188 1 ? 13 
HELX_P HELX_P53 AF8 ARG D 200 ? TYR D 210 ? ARG D 200 TYR D 210 1 ? 11 
HELX_P HELX_P54 AF9 ASN D 217 ? GLY D 221 ? ASN D 217 GLY D 221 5 ? 5  
HELX_P HELX_P55 AG1 PRO D 222 ? THR D 231 ? PRO D 222 THR D 231 1 ? 10 
HELX_P HELX_P56 AG2 ASP D 247 ? ILE D 255 ? ASP D 247 ILE D 255 1 ? 9  
HELX_P HELX_P57 AG3 TRP D 281 ? MET D 285 ? TRP D 281 MET D 285 5 ? 5  
HELX_P HELX_P58 AG4 GLY D 297 ? TYR D 311 ? GLY D 297 TYR D 311 1 ? 15 
HELX_P HELX_P59 AG5 ASP D 315 ? LYS D 318 ? ASP D 315 LYS D 318 5 ? 4  
HELX_P HELX_P60 AG6 PHE D 327 ? ASP D 339 ? PHE D 327 ASP D 339 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? B FME 1   C   ? ? ? 1_555 B LYS 2  N   ? ? B FME 1   B LYS 2   1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale2  covale both ? C FME 1   C   ? ? ? 1_555 C LYS 2  N   ? ? C FME 1   C LYS 2   1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale3  covale both ? D FME 1   C   ? ? ? 1_555 D LYS 2  N   ? ? D FME 1   D LYS 2   1_555 ? ? ? ? ? ? ? 1.329 ? ? 
metalc1  metalc ?    ? A CYS 37  SG  ? ? ? 1_555 E ZN  .  ZN  ? ? A CYS 37  A ZN  401 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc2  metalc ?    ? A HIS 59  NE2 ? ? ? 1_555 E ZN  .  ZN  ? ? A HIS 59  A ZN  401 1_555 ? ? ? ? ? ? ? 2.093 ? ? 
metalc3  metalc ?    ? A TYR 99  OH  ? ? ? 1_555 L K   .  K   ? ? A TYR 99  B K   404 1_555 ? ? ? ? ? ? ? 2.974 ? ? 
metalc4  metalc ?    ? A ASP 150 OD2 ? ? ? 1_555 E ZN  .  ZN  ? ? A ASP 150 A ZN  401 1_555 ? ? ? ? ? ? ? 1.927 ? ? 
metalc5  metalc ?    ? A GLY 259 O   ? ? ? 1_555 H K   .  K   ? ? A GLY 259 A K   404 1_555 ? ? ? ? ? ? ? 2.914 ? ? 
metalc6  metalc ?    ? A GLY 260 O   ? ? ? 1_555 H K   .  K   ? ? A GLY 260 A K   404 1_555 ? ? ? ? ? ? ? 3.133 ? ? 
metalc7  metalc ?    ? A HIS 287 O   ? ? ? 1_555 H K   .  K   ? ? A HIS 287 A K   404 1_555 ? ? ? ? ? ? ? 2.814 ? ? 
metalc8  metalc ?    ? A THR 289 OG1 ? ? ? 1_555 H K   .  K   ? ? A THR 289 A K   404 1_555 ? ? ? ? ? ? ? 2.862 ? ? 
metalc9  metalc ?    ? E ZN  .   ZN  ? ? ? 1_555 G 2RP .  O17 ? ? A ZN  401 A 2RP 403 1_555 ? ? ? ? ? ? ? 2.420 ? ? 
metalc10 metalc ?    ? H K   .   K   ? ? ? 1_555 B TYR 99 OH  ? ? A K   404 B TYR 99  1_555 ? ? ? ? ? ? ? 3.197 ? ? 
metalc11 metalc ?    ? H K   .   K   ? ? ? 1_555 V HOH .  O   ? ? A K   404 B HOH 511 1_555 ? ? ? ? ? ? ? 2.977 ? ? 
metalc12 metalc ?    ? U HOH .   O   ? ? ? 1_555 L K   .  K   ? ? A HOH 533 B K   404 1_555 ? ? ? ? ? ? ? 3.271 ? ? 
metalc13 metalc ?    ? B CYS 37  SG  ? ? ? 1_555 I ZN  .  ZN  ? ? B CYS 37  B ZN  401 1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc14 metalc ?    ? B HIS 59  NE2 ? ? ? 1_555 I ZN  .  ZN  ? ? B HIS 59  B ZN  401 1_555 ? ? ? ? ? ? ? 2.027 ? ? 
metalc15 metalc ?    ? B ASP 150 OD2 ? ? ? 1_555 I ZN  .  ZN  ? ? B ASP 150 B ZN  401 1_555 ? ? ? ? ? ? ? 1.830 ? ? 
metalc16 metalc ?    ? B GLY 259 O   ? ? ? 1_555 L K   .  K   ? ? B GLY 259 B K   404 1_555 ? ? ? ? ? ? ? 3.275 ? ? 
metalc17 metalc ?    ? B HIS 287 O   ? ? ? 1_555 L K   .  K   ? ? B HIS 287 B K   404 1_555 ? ? ? ? ? ? ? 2.772 ? ? 
metalc18 metalc ?    ? B THR 289 OG1 ? ? ? 1_555 L K   .  K   ? ? B THR 289 B K   404 1_555 ? ? ? ? ? ? ? 2.758 ? ? 
metalc19 metalc ?    ? I ZN  .   ZN  ? ? ? 1_555 K 2RP .  O17 ? ? B ZN  401 B 2RP 403 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc20 metalc ?    ? L K   .   K   ? ? ? 1_555 V HOH .  O   ? ? B K   404 B HOH 521 1_555 ? ? ? ? ? ? ? 2.879 ? ? 
metalc21 metalc ?    ? C CYS 37  SG  ? ? ? 1_555 M ZN  .  ZN  ? ? C CYS 37  C ZN  401 1_555 ? ? ? ? ? ? ? 2.250 ? ? 
metalc22 metalc ?    ? C HIS 59  NE2 ? ? ? 1_555 M ZN  .  ZN  ? ? C HIS 59  C ZN  401 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
metalc23 metalc ?    ? C TYR 99  OH  ? ? ? 1_555 T K   .  K   ? ? C TYR 99  D K   404 1_555 ? ? ? ? ? ? ? 3.076 ? ? 
metalc24 metalc ?    ? C ASP 150 OD2 ? ? ? 1_555 M ZN  .  ZN  ? ? C ASP 150 C ZN  401 1_555 ? ? ? ? ? ? ? 1.972 ? ? 
metalc25 metalc ?    ? C GLY 259 O   ? ? ? 1_555 P K   .  K   ? ? C GLY 259 C K   404 1_555 ? ? ? ? ? ? ? 2.852 ? ? 
metalc26 metalc ?    ? C GLY 260 O   ? ? ? 1_555 P K   .  K   ? ? C GLY 260 C K   404 1_555 ? ? ? ? ? ? ? 3.102 ? ? 
metalc27 metalc ?    ? C HIS 287 O   ? ? ? 1_555 P K   .  K   ? ? C HIS 287 C K   404 1_555 ? ? ? ? ? ? ? 2.860 ? ? 
metalc28 metalc ?    ? C THR 289 OG1 ? ? ? 1_555 P K   .  K   ? ? C THR 289 C K   404 1_555 ? ? ? ? ? ? ? 2.836 ? ? 
metalc29 metalc ?    ? M ZN  .   ZN  ? ? ? 1_555 O 2RP .  O17 ? ? C ZN  401 C 2RP 403 1_555 ? ? ? ? ? ? ? 2.346 ? ? 
metalc30 metalc ?    ? P K   .   K   ? ? ? 1_555 W HOH .  O   ? ? C K   404 C HOH 507 1_555 ? ? ? ? ? ? ? 2.823 ? ? 
metalc31 metalc ?    ? P K   .   K   ? ? ? 1_555 D TYR 99 OH  ? ? C K   404 D TYR 99  1_555 ? ? ? ? ? ? ? 3.094 ? ? 
metalc32 metalc ?    ? P K   .   K   ? ? ? 1_555 X HOH .  O   ? ? C K   404 D HOH 601 1_555 ? ? ? ? ? ? ? 3.495 ? ? 
metalc33 metalc ?    ? W HOH .   O   ? ? ? 1_555 T K   .  K   ? ? C HOH 592 D K   404 1_555 ? ? ? ? ? ? ? 2.922 ? ? 
metalc34 metalc ?    ? D CYS 37  SG  ? ? ? 1_555 Q ZN  .  ZN  ? ? D CYS 37  D ZN  401 1_555 ? ? ? ? ? ? ? 2.295 ? ? 
metalc35 metalc ?    ? D HIS 59  NE2 ? ? ? 1_555 Q ZN  .  ZN  ? ? D HIS 59  D ZN  401 1_555 ? ? ? ? ? ? ? 1.985 ? ? 
metalc36 metalc ?    ? D ASP 150 OD2 ? ? ? 1_555 Q ZN  .  ZN  ? ? D ASP 150 D ZN  401 1_555 ? ? ? ? ? ? ? 1.850 ? ? 
metalc37 metalc ?    ? D GLY 259 O   ? ? ? 1_555 T K   .  K   ? ? D GLY 259 D K   404 1_555 ? ? ? ? ? ? ? 2.845 ? ? 
metalc38 metalc ?    ? D GLY 260 O   ? ? ? 1_555 T K   .  K   ? ? D GLY 260 D K   404 1_555 ? ? ? ? ? ? ? 3.174 ? ? 
metalc39 metalc ?    ? D HIS 287 O   ? ? ? 1_555 T K   .  K   ? ? D HIS 287 D K   404 1_555 ? ? ? ? ? ? ? 2.890 ? ? 
metalc40 metalc ?    ? D THR 289 OG1 ? ? ? 1_555 T K   .  K   ? ? D THR 289 D K   404 1_555 ? ? ? ? ? ? ? 2.944 ? ? 
metalc41 metalc ?    ? Q ZN  .   ZN  ? ? ? 1_555 S 2RP .  O17 ? ? D ZN  401 D 2RP 403 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc42 metalc ?    ? T K   .   K   ? ? ? 1_555 X HOH .  O   ? ? D K   404 D HOH 596 1_555 ? ? ? ? ? ? ? 3.234 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
AA4 ? 6 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 5 ? 
AA8 ? 4 ? 
AA9 ? 6 ? 
AB1 ? 3 ? 
AB2 ? 5 ? 
AB3 ? 4 ? 
AB4 ? 6 ? 
AB5 ? 2 ? 
AB6 ? 3 ? 
AB7 ? 5 ? 
AB8 ? 4 ? 
AB9 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA4 1 2 ? parallel      
AA4 2 3 ? parallel      
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA4 5 6 ? parallel      
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AA9 5 6 ? parallel      
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB4 1 2 ? parallel      
AB4 2 3 ? parallel      
AB4 3 4 ? parallel      
AB4 4 5 ? parallel      
AB4 5 6 ? parallel      
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? parallel      
AB9 1 2 ? parallel      
AB9 2 3 ? parallel      
AB9 3 4 ? parallel      
AB9 4 5 ? parallel      
AB9 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 11  ? GLU A 16  ? LYS A 11  GLU A 16  
AA1 2 LYS A 2   ? SER A 8   ? LYS A 2   SER A 8   
AA1 3 MET A 55  ? ILE A 56  ? MET A 55  ILE A 56  
AA2 1 PHE A 124 ? VAL A 126 ? PHE A 124 VAL A 126 
AA2 2 ALA A 27  ? ALA A 35  ? ALA A 27  ALA A 35  
AA2 3 GLU A 60  ? VAL A 68  ? GLU A 60  VAL A 68  
AA2 4 ARG A 80  ? VAL A 83  ? ARG A 80  VAL A 83  
AA2 5 ALA A 134 ? HIS A 135 ? ALA A 134 HIS A 135 
AA3 1 PHE A 124 ? VAL A 126 ? PHE A 124 VAL A 126 
AA3 2 ALA A 27  ? ALA A 35  ? ALA A 27  ALA A 35  
AA3 3 LYS A 346 ? ILE A 350 ? LYS A 346 ILE A 350 
AA3 4 VAL A 320 ? PHE A 324 ? VAL A 320 PHE A 324 
AA4 1 ASP A 214 ? VAL A 216 ? ASP A 214 VAL A 216 
AA4 2 ILE A 194 ? VAL A 197 ? ILE A 194 VAL A 197 
AA4 3 VAL A 170 ? LEU A 173 ? VAL A 170 LEU A 173 
AA4 4 VAL A 236 ? ILE A 241 ? VAL A 236 ILE A 241 
AA4 5 VAL A 256 ? ASN A 264 ? VAL A 256 ASN A 264 
AA4 6 THR A 289 ? GLY A 292 ? THR A 289 GLY A 292 
AA5 1 VAL A 273 ? PRO A 277 ? VAL A 273 PRO A 277 
AA5 2 VAL B 273 ? PRO B 277 ? VAL B 273 PRO B 277 
AA6 1 LYS B 11  ? GLU B 16  ? LYS B 11  GLU B 16  
AA6 2 LYS B 2   ? SER B 8   ? LYS B 2   SER B 8   
AA6 3 MET B 55  ? ILE B 56  ? MET B 55  ILE B 56  
AA7 1 PHE B 124 ? VAL B 126 ? PHE B 124 VAL B 126 
AA7 2 ALA B 27  ? ALA B 35  ? ALA B 27  ALA B 35  
AA7 3 GLU B 60  ? VAL B 68  ? GLU B 60  VAL B 68  
AA7 4 ARG B 80  ? VAL B 83  ? ARG B 80  VAL B 83  
AA7 5 ALA B 134 ? HIS B 135 ? ALA B 134 HIS B 135 
AA8 1 PHE B 124 ? VAL B 126 ? PHE B 124 VAL B 126 
AA8 2 ALA B 27  ? ALA B 35  ? ALA B 27  ALA B 35  
AA8 3 LYS B 346 ? ILE B 350 ? LYS B 346 ILE B 350 
AA8 4 VAL B 320 ? ARG B 325 ? VAL B 320 ARG B 325 
AA9 1 ASP B 214 ? VAL B 216 ? ASP B 214 VAL B 216 
AA9 2 ILE B 194 ? VAL B 197 ? ILE B 194 VAL B 197 
AA9 3 VAL B 170 ? LEU B 173 ? VAL B 170 LEU B 173 
AA9 4 VAL B 236 ? ILE B 241 ? VAL B 236 ILE B 241 
AA9 5 VAL B 256 ? ASN B 264 ? VAL B 256 ASN B 264 
AA9 6 THR B 289 ? GLY B 292 ? THR B 289 GLY B 292 
AB1 1 LYS C 11  ? GLU C 16  ? LYS C 11  GLU C 16  
AB1 2 LYS C 2   ? SER C 8   ? LYS C 2   SER C 8   
AB1 3 MET C 55  ? ILE C 56  ? MET C 55  ILE C 56  
AB2 1 PHE C 124 ? VAL C 126 ? PHE C 124 VAL C 126 
AB2 2 ALA C 27  ? ALA C 35  ? ALA C 27  ALA C 35  
AB2 3 GLU C 60  ? VAL C 68  ? GLU C 60  VAL C 68  
AB2 4 ARG C 80  ? VAL C 83  ? ARG C 80  VAL C 83  
AB2 5 ALA C 134 ? HIS C 135 ? ALA C 134 HIS C 135 
AB3 1 PHE C 124 ? VAL C 126 ? PHE C 124 VAL C 126 
AB3 2 ALA C 27  ? ALA C 35  ? ALA C 27  ALA C 35  
AB3 3 LYS C 346 ? ILE C 350 ? LYS C 346 ILE C 350 
AB3 4 VAL C 320 ? ARG C 325 ? VAL C 320 ARG C 325 
AB4 1 ASP C 214 ? VAL C 216 ? ASP C 214 VAL C 216 
AB4 2 ILE C 194 ? VAL C 197 ? ILE C 194 VAL C 197 
AB4 3 VAL C 170 ? LEU C 173 ? VAL C 170 LEU C 173 
AB4 4 VAL C 236 ? ILE C 241 ? VAL C 236 ILE C 241 
AB4 5 VAL C 256 ? ASN C 264 ? VAL C 256 ASN C 264 
AB4 6 THR C 289 ? GLY C 292 ? THR C 289 GLY C 292 
AB5 1 VAL C 273 ? PRO C 277 ? VAL C 273 PRO C 277 
AB5 2 VAL D 273 ? PRO D 277 ? VAL D 273 PRO D 277 
AB6 1 LYS D 11  ? GLU D 16  ? LYS D 11  GLU D 16  
AB6 2 LYS D 2   ? SER D 8   ? LYS D 2   SER D 8   
AB6 3 MET D 55  ? ILE D 56  ? MET D 55  ILE D 56  
AB7 1 PHE D 124 ? VAL D 126 ? PHE D 124 VAL D 126 
AB7 2 ALA D 27  ? ALA D 35  ? ALA D 27  ALA D 35  
AB7 3 GLU D 60  ? VAL D 68  ? GLU D 60  VAL D 68  
AB7 4 ARG D 80  ? VAL D 83  ? ARG D 80  VAL D 83  
AB7 5 ALA D 134 ? HIS D 135 ? ALA D 134 HIS D 135 
AB8 1 PHE D 124 ? VAL D 126 ? PHE D 124 VAL D 126 
AB8 2 ALA D 27  ? ALA D 35  ? ALA D 27  ALA D 35  
AB8 3 LYS D 346 ? ILE D 350 ? LYS D 346 ILE D 350 
AB8 4 VAL D 320 ? ARG D 325 ? VAL D 320 ARG D 325 
AB9 1 ASP D 214 ? VAL D 216 ? ASP D 214 VAL D 216 
AB9 2 ILE D 194 ? VAL D 197 ? ILE D 194 VAL D 197 
AB9 3 VAL D 170 ? LEU D 173 ? VAL D 170 LEU D 173 
AB9 4 VAL D 236 ? ILE D 241 ? VAL D 236 ILE D 241 
AB9 5 VAL D 256 ? ASN D 264 ? VAL D 256 ASN D 264 
AB9 6 THR D 289 ? GLY D 292 ? THR D 289 GLY D 292 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLY A 13  ? O GLY A 13  N ALA A 5   ? N ALA A 5   
AA1 2 3 N MET A 6   ? N MET A 6   O MET A 55  ? O MET A 55  
AA2 1 2 O VAL A 126 ? O VAL A 126 N ALA A 27  ? N ALA A 27  
AA2 2 3 N ARG A 30  ? N ARG A 30  O GLU A 64  ? O GLU A 64  
AA2 3 4 N GLY A 63  ? N GLY A 63  O VAL A 81  ? O VAL A 81  
AA2 4 5 N VAL A 82  ? N VAL A 82  O ALA A 134 ? O ALA A 134 
AA3 1 2 O VAL A 126 ? O VAL A 126 N ALA A 27  ? N ALA A 27  
AA3 2 3 N VAL A 34  ? N VAL A 34  O VAL A 349 ? O VAL A 349 
AA3 3 4 O ILE A 350 ? O ILE A 350 N PHE A 324 ? N PHE A 324 
AA4 1 2 O VAL A 216 ? O VAL A 216 N ALA A 196 ? N ALA A 196 
AA4 2 3 O ILE A 195 ? O ILE A 195 N VAL A 172 ? N VAL A 172 
AA4 3 4 N ALA A 171 ? N ALA A 171 O ILE A 240 ? O ILE A 240 
AA4 4 5 N ALA A 239 ? N ALA A 239 O ALA A 263 ? O ALA A 263 
AA4 5 6 N ILE A 262 ? N ILE A 262 O THR A 289 ? O THR A 289 
AA5 1 2 N LEU A 274 ? N LEU A 274 O VAL B 276 ? O VAL B 276 
AA6 1 2 O GLY B 13  ? O GLY B 13  N ALA B 5   ? N ALA B 5   
AA6 2 3 N MET B 6   ? N MET B 6   O MET B 55  ? O MET B 55  
AA7 1 2 O VAL B 126 ? O VAL B 126 N ALA B 27  ? N ALA B 27  
AA7 2 3 N LEU B 32  ? N LEU B 32  O VAL B 62  ? O VAL B 62  
AA7 3 4 N GLY B 63  ? N GLY B 63  O VAL B 81  ? O VAL B 81  
AA7 4 5 N VAL B 82  ? N VAL B 82  O ALA B 134 ? O ALA B 134 
AA8 1 2 O VAL B 126 ? O VAL B 126 N ALA B 27  ? N ALA B 27  
AA8 2 3 N VAL B 34  ? N VAL B 34  O VAL B 349 ? O VAL B 349 
AA8 3 4 O ILE B 350 ? O ILE B 350 N PHE B 324 ? N PHE B 324 
AA9 1 2 O ASP B 214 ? O ASP B 214 N ALA B 196 ? N ALA B 196 
AA9 2 3 O ILE B 195 ? O ILE B 195 N VAL B 172 ? N VAL B 172 
AA9 3 4 N ALA B 171 ? N ALA B 171 O ILE B 240 ? O ILE B 240 
AA9 4 5 N ALA B 239 ? N ALA B 239 O ALA B 263 ? O ALA B 263 
AA9 5 6 N ILE B 262 ? N ILE B 262 O THR B 289 ? O THR B 289 
AB1 1 2 O GLY C 13  ? O GLY C 13  N ALA C 5   ? N ALA C 5   
AB1 2 3 N MET C 6   ? N MET C 6   O MET C 55  ? O MET C 55  
AB2 1 2 O VAL C 126 ? O VAL C 126 N ALA C 27  ? N ALA C 27  
AB2 2 3 N ARG C 30  ? N ARG C 30  O GLU C 64  ? O GLU C 64  
AB2 3 4 N GLY C 63  ? N GLY C 63  O VAL C 81  ? O VAL C 81  
AB2 4 5 N VAL C 82  ? N VAL C 82  O ALA C 134 ? O ALA C 134 
AB3 1 2 O VAL C 126 ? O VAL C 126 N ALA C 27  ? N ALA C 27  
AB3 2 3 N VAL C 34  ? N VAL C 34  O VAL C 349 ? O VAL C 349 
AB3 3 4 O ILE C 350 ? O ILE C 350 N PHE C 324 ? N PHE C 324 
AB4 1 2 O ASP C 214 ? O ASP C 214 N ALA C 196 ? N ALA C 196 
AB4 2 3 O ILE C 195 ? O ILE C 195 N VAL C 172 ? N VAL C 172 
AB4 3 4 N ALA C 171 ? N ALA C 171 O ILE C 240 ? O ILE C 240 
AB4 4 5 N ALA C 239 ? N ALA C 239 O ALA C 263 ? O ALA C 263 
AB4 5 6 N ILE C 262 ? N ILE C 262 O THR C 289 ? O THR C 289 
AB5 1 2 N LEU C 274 ? N LEU C 274 O VAL D 276 ? O VAL D 276 
AB6 1 2 O LYS D 11  ? O LYS D 11  N SER D 8   ? N SER D 8   
AB6 2 3 N MET D 6   ? N MET D 6   O MET D 55  ? O MET D 55  
AB7 1 2 O VAL D 126 ? O VAL D 126 N ALA D 27  ? N ALA D 27  
AB7 2 3 N LEU D 32  ? N LEU D 32  O VAL D 62  ? O VAL D 62  
AB7 3 4 N GLY D 63  ? N GLY D 63  O VAL D 81  ? O VAL D 81  
AB7 4 5 N VAL D 82  ? N VAL D 82  O ALA D 134 ? O ALA D 134 
AB8 1 2 O VAL D 126 ? O VAL D 126 N ALA D 27  ? N ALA D 27  
AB8 2 3 N VAL D 34  ? N VAL D 34  O VAL D 349 ? O VAL D 349 
AB8 3 4 O ILE D 350 ? O ILE D 350 N PHE D 324 ? N PHE D 324 
AB9 1 2 O ASP D 214 ? O ASP D 214 N ALA D 196 ? N ALA D 196 
AB9 2 3 O ILE D 195 ? O ILE D 195 N VAL D 172 ? N VAL D 172 
AB9 3 4 N ALA D 171 ? N ALA D 171 O ILE D 240 ? O ILE D 240 
AB9 4 5 N ALA D 239 ? N ALA D 239 O ALA D 263 ? O ALA D 263 
AB9 5 6 N ILE D 262 ? N ILE D 262 O LYS D 291 ? O LYS D 291 
# 
_atom_sites.entry_id                    7UUT 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.012520 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008028 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006007 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356  2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
K  ? ? 16.37977 2.54835 ? ? 4.54127  84.28225 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032  2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 4.49882  3.47563 ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P  ? ? 9.51135  5.44231 ? ? 1.42069  35.72801 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732  6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
ZN ? ? 24.64596 5.25405 ? ? 2.14387  29.76375 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A 1 1   ? 23.01938  -4.90887  34.03109  1.000 113.92107 ? 1   MET A N   1 
ATOM   2     C  CA  . MET A 1 1   ? 21.97048  -5.09297  35.02236  1.000 122.23866 ? 1   MET A CA  1 
ATOM   3     C  C   . MET A 1 1   ? 21.27317  -6.43889  34.79656  1.000 128.39631 ? 1   MET A C   1 
ATOM   4     O  O   . MET A 1 1   ? 21.93839  -7.46095  34.63237  1.000 130.14162 ? 1   MET A O   1 
ATOM   5     C  CB  . MET A 1 1   ? 20.98373  -3.93252  34.94880  1.000 120.76274 ? 1   MET A CB  1 
ATOM   6     C  CG  . MET A 1 1   ? 20.17204  -3.69737  36.20484  1.000 146.33842 ? 1   MET A CG  1 
ATOM   7     S  SD  . MET A 1 1   ? 18.65706  -2.85715  35.73642  1.000 150.28356 ? 1   MET A SD  1 
ATOM   8     C  CE  . MET A 1 1   ? 18.33147  -3.67195  34.17424  1.000 117.14067 ? 1   MET A CE  1 
ATOM   9     N  N   . LYS A 1 2   ? 19.94277  -6.44583  34.79022  1.000 128.67679 ? 2   LYS A N   1 
ATOM   10    C  CA  . LYS A 1 2   ? 19.17786  -7.64554  34.48925  1.000 123.48102 ? 2   LYS A CA  1 
ATOM   11    C  C   . LYS A 1 2   ? 18.70903  -7.61239  33.04005  1.000 127.97497 ? 2   LYS A C   1 
ATOM   12    O  O   . LYS A 1 2   ? 18.42647  -6.54983  32.48034  1.000 118.11021 ? 2   LYS A O   1 
ATOM   13    C  CB  . LYS A 1 2   ? 17.98292  -7.78226  35.43619  1.000 120.97596 ? 2   LYS A CB  1 
ATOM   14    C  CG  . LYS A 1 2   ? 18.18240  -8.82383  36.52826  1.000 129.18791 ? 2   LYS A CG  1 
ATOM   15    C  CD  . LYS A 1 2   ? 16.89725  -9.07835  37.29064  1.000 127.68526 ? 2   LYS A CD  1 
ATOM   16    C  CE  . LYS A 1 2   ? 16.72277  -8.06085  38.40956  1.000 129.10020 ? 2   LYS A CE  1 
ATOM   17    N  NZ  . LYS A 1 2   ? 17.32588  -8.52466  39.69088  1.000 133.33209 ? 2   LYS A NZ  1 
ATOM   18    N  N   . GLY A 1 3   ? 18.62028  -8.79576  32.44238  1.000 124.71180 ? 3   GLY A N   1 
ATOM   19    C  CA  . GLY A 1 3   ? 18.21563  -8.93004  31.05871  1.000 112.46204 ? 3   GLY A CA  1 
ATOM   20    C  C   . GLY A 1 3   ? 17.77502  -10.34113 30.74281  1.000 120.29797 ? 3   GLY A C   1 
ATOM   21    O  O   . GLY A 1 3   ? 18.42177  -11.29913 31.17764  1.000 120.78166 ? 3   GLY A O   1 
ATOM   22    N  N   . PHE A 1 4   ? 16.68902  -10.49630 29.99137  1.000 112.44793 ? 4   PHE A N   1 
ATOM   23    C  CA  . PHE A 1 4   ? 16.26696  -11.83188 29.60008  1.000 113.82426 ? 4   PHE A CA  1 
ATOM   24    C  C   . PHE A 1 4   ? 17.24660  -12.35676 28.55913  1.000 112.73940 ? 4   PHE A C   1 
ATOM   25    O  O   . PHE A 1 4   ? 17.34923  -11.80801 27.45682  1.000 123.99840 ? 4   PHE A O   1 
ATOM   26    C  CB  . PHE A 1 4   ? 14.84323  -11.79488 29.05266  1.000 112.36281 ? 4   PHE A CB  1 
ATOM   27    C  CG  . PHE A 1 4   ? 14.19828  -13.14399 28.95410  1.000 121.37389 ? 4   PHE A CG  1 
ATOM   28    C  CD1 . PHE A 1 4   ? 13.94009  -13.88305 30.09714  1.000 118.28151 ? 4   PHE A CD1 1 
ATOM   29    C  CD2 . PHE A 1 4   ? 13.84341  -13.67215 27.72561  1.000 120.41300 ? 4   PHE A CD2 1 
ATOM   30    C  CE1 . PHE A 1 4   ? 13.34526  -15.12542 30.01742  1.000 120.40732 ? 4   PHE A CE1 1 
ATOM   31    C  CE2 . PHE A 1 4   ? 13.24648  -14.91581 27.63889  1.000 124.91422 ? 4   PHE A CE2 1 
ATOM   32    C  CZ  . PHE A 1 4   ? 12.99712  -15.64298 28.78806  1.000 118.68406 ? 4   PHE A CZ  1 
ATOM   33    N  N   . ALA A 1 5   ? 17.96907  -13.41700 28.91378  1.000 115.57749 ? 5   ALA A N   1 
ATOM   34    C  CA  . ALA A 1 5   ? 19.12420  -13.86762 28.15471  1.000 116.87895 ? 5   ALA A CA  1 
ATOM   35    C  C   . ALA A 1 5   ? 19.06782  -15.37093 27.92880  1.000 125.97460 ? 5   ALA A C   1 
ATOM   36    O  O   . ALA A 1 5   ? 18.33014  -16.09916 28.59768  1.000 128.26317 ? 5   ALA A O   1 
ATOM   37    C  CB  . ALA A 1 5   ? 20.43579  -13.50134 28.86452  1.000 116.29305 ? 5   ALA A CB  1 
ATOM   38    N  N   . MET A 1 6   ? 19.87575  -15.82323 26.97264  1.000 123.74908 ? 6   MET A N   1 
ATOM   39    C  CA  . MET A 1 6   ? 20.06031  -17.24547 26.70696  1.000 129.60310 ? 6   MET A CA  1 
ATOM   40    C  C   . MET A 1 6   ? 21.11717  -17.78923 27.66264  1.000 143.56967 ? 6   MET A C   1 
ATOM   41    O  O   . MET A 1 6   ? 22.30522  -17.47464 27.53361  1.000 144.13877 ? 6   MET A O   1 
ATOM   42    C  CB  . MET A 1 6   ? 20.46304  -17.45633 25.24968  1.000 119.08949 ? 6   MET A CB  1 
ATOM   43    C  CG  . MET A 1 6   ? 20.89642  -18.86973 24.89698  1.000 132.31802 ? 6   MET A CG  1 
ATOM   44    S  SD  . MET A 1 6   ? 21.51789  -18.95826 23.20454  1.000 146.36318 ? 6   MET A SD  1 
ATOM   45    C  CE  . MET A 1 6   ? 22.23079  -20.60032 23.17347  1.000 147.09769 ? 6   MET A CE  1 
ATOM   46    N  N   . LEU A 1 7   ? 20.68421  -18.60938 28.62407  1.000 134.94537 ? 7   LEU A N   1 
ATOM   47    C  CA  . LEU A 1 7   ? 21.61108  -19.16178 29.60714  1.000 140.13994 ? 7   LEU A CA  1 
ATOM   48    C  C   . LEU A 1 7   ? 22.54230  -20.17480 28.95946  1.000 145.38935 ? 7   LEU A C   1 
ATOM   49    O  O   . LEU A 1 7   ? 23.76763  -20.10265 29.11224  1.000 145.19935 ? 7   LEU A O   1 
ATOM   50    C  CB  . LEU A 1 7   ? 20.83577  -19.82346 30.74694  1.000 149.18299 ? 7   LEU A CB  1 
ATOM   51    C  CG  . LEU A 1 7   ? 19.66207  -19.07358 31.37468  1.000 143.67276 ? 7   LEU A CG  1 
ATOM   52    C  CD1 . LEU A 1 7   ? 19.03346  -19.89825 32.49243  1.000 140.25110 ? 7   LEU A CD1 1 
ATOM   53    C  CD2 . LEU A 1 7   ? 20.09737  -17.71877 31.88228  1.000 133.51794 ? 7   LEU A CD2 1 
ATOM   54    N  N   . SER A 1 8   ? 21.96962  -21.11974 28.22254  1.000 145.08801 ? 8   SER A N   1 
ATOM   55    C  CA  . SER A 1 8   ? 22.71619  -22.12027 27.48087  1.000 156.49609 ? 8   SER A CA  1 
ATOM   56    C  C   . SER A 1 8   ? 21.84755  -22.55484 26.31042  1.000 155.53552 ? 8   SER A C   1 
ATOM   57    O  O   . SER A 1 8   ? 20.73622  -22.05149 26.12189  1.000 151.81209 ? 8   SER A O   1 
ATOM   58    C  CB  . SER A 1 8   ? 23.09909  -23.30091 28.38109  1.000 157.59595 ? 8   SER A CB  1 
ATOM   59    O  OG  . SER A 1 8   ? 23.63682  -24.37249 27.62655  1.000 158.51906 ? 8   SER A OG  1 
ATOM   60    N  N   . ILE A 1 9   ? 22.36774  -23.47919 25.50413  1.000 163.47671 ? 9   ILE A N   1 
ATOM   61    C  CA  . ILE A 1 9   ? 21.59805  -23.97007 24.36728  1.000 164.87528 ? 9   ILE A CA  1 
ATOM   62    C  C   . ILE A 1 9   ? 20.32656  -24.63550 24.87826  1.000 156.90559 ? 9   ILE A C   1 
ATOM   63    O  O   . ILE A 1 9   ? 20.37651  -25.66190 25.56855  1.000 151.25442 ? 9   ILE A O   1 
ATOM   64    C  CB  . ILE A 1 9   ? 22.44445  -24.92193 23.51523  1.000 164.34418 ? 9   ILE A CB  1 
ATOM   65    C  CG1 . ILE A 1 9   ? 23.65189  -24.17848 22.93291  1.000 159.80263 ? 9   ILE A CG1 1 
ATOM   66    C  CG2 . ILE A 1 9   ? 21.60911  -25.52475 22.39840  1.000 155.81078 ? 9   ILE A CG2 1 
ATOM   67    C  CD1 . ILE A 1 9   ? 24.52257  -25.02511 22.02771  1.000 155.02799 ? 9   ILE A CD1 1 
ATOM   68    N  N   . GLY A 1 10  ? 19.17660  -24.04580 24.54489  1.000 148.18434 ? 10  GLY A N   1 
ATOM   69    C  CA  . GLY A 1 10  ? 17.88769  -24.58774 24.92112  1.000 140.70846 ? 10  GLY A CA  1 
ATOM   70    C  C   . GLY A 1 10  ? 17.29571  -24.07148 26.21865  1.000 137.65511 ? 10  GLY A C   1 
ATOM   71    O  O   . GLY A 1 10  ? 16.18060  -24.47887 26.57148  1.000 139.02422 ? 10  GLY A O   1 
ATOM   72    N  N   . LYS A 1 11  ? 17.99849  -23.20344 26.94725  1.000 133.57397 ? 11  LYS A N   1 
ATOM   73    C  CA  . LYS A 1 11  ? 17.52779  -22.69008 28.22829  1.000 134.69104 ? 11  LYS A CA  1 
ATOM   74    C  C   . LYS A 1 11  ? 17.75700  -21.18560 28.29156  1.000 134.12550 ? 11  LYS A C   1 
ATOM   75    O  O   . LYS A 1 11  ? 18.80004  -20.69170 27.85287  1.000 134.34854 ? 11  LYS A O   1 
ATOM   76    C  CB  . LYS A 1 11  ? 18.22416  -23.38968 29.39937  1.000 144.33502 ? 11  LYS A CB  1 
ATOM   77    C  CG  . LYS A 1 11  ? 17.50014  -23.23328 30.73010  1.000 141.47918 ? 11  LYS A CG  1 
ATOM   78    C  CD  . LYS A 1 11  ? 18.03319  -24.20140 31.77541  1.000 146.56740 ? 11  LYS A CD  1 
ATOM   79    C  CE  . LYS A 1 11  ? 17.44925  -23.91061 33.15109  1.000 148.86843 ? 11  LYS A CE  1 
ATOM   80    N  NZ  . LYS A 1 11  ? 15.96128  -23.95618 33.16837  1.000 148.67213 ? 11  LYS A NZ  1 
ATOM   81    N  N   . VAL A 1 12  ? 16.78675  -20.45975 28.85472  1.000 130.25846 ? 12  VAL A N   1 
ATOM   82    C  CA  . VAL A 1 12  ? 16.85768  -19.00861 28.97500  1.000 127.13326 ? 12  VAL A CA  1 
ATOM   83    C  C   . VAL A 1 12  ? 16.43095  -18.57814 30.37349  1.000 129.08493 ? 12  VAL A C   1 
ATOM   84    O  O   . VAL A 1 12  ? 15.76987  -19.31793 31.10459  1.000 138.29708 ? 12  VAL A O   1 
ATOM   85    C  CB  . VAL A 1 12  ? 15.98401  -18.30064 27.91924  1.000 132.55366 ? 12  VAL A CB  1 
ATOM   86    C  CG1 . VAL A 1 12  ? 16.52840  -18.55155 26.51730  1.000 142.86115 ? 12  VAL A CG1 1 
ATOM   87    C  CG2 . VAL A 1 12  ? 14.54401  -18.77021 28.03364  1.000 127.55906 ? 12  VAL A CG2 1 
ATOM   88    N  N   . GLY A 1 13  ? 16.82368  -17.36035 30.73737  1.000 127.68255 ? 13  GLY A N   1 
ATOM   89    C  CA  . GLY A 1 13  ? 16.48697  -16.80947 32.04198  1.000 128.99880 ? 13  GLY A CA  1 
ATOM   90    C  C   . GLY A 1 13  ? 17.14959  -15.46099 32.23676  1.000 126.75347 ? 13  GLY A C   1 
ATOM   91    O  O   . GLY A 1 13  ? 18.01993  -15.05056 31.46204  1.000 137.10921 ? 13  GLY A O   1 
ATOM   92    N  N   . TRP A 1 14  ? 16.71903  -14.77430 33.29605  1.000 127.79800 ? 14  TRP A N   1 
ATOM   93    C  CA  . TRP A 1 14  ? 17.26069  -13.46565 33.64914  1.000 128.57199 ? 14  TRP A CA  1 
ATOM   94    C  C   . TRP A 1 14  ? 18.62583  -13.62161 34.31350  1.000 130.74471 ? 14  TRP A C   1 
ATOM   95    O  O   . TRP A 1 14  ? 18.82036  -14.49475 35.16441  1.000 132.09505 ? 14  TRP A O   1 
ATOM   96    C  CB  . TRP A 1 14  ? 16.29408  -12.73208 34.58299  1.000 126.97272 ? 14  TRP A CB  1 
ATOM   97    C  CG  . TRP A 1 14  ? 15.03764  -12.25757 33.90253  1.000 125.92847 ? 14  TRP A CG  1 
ATOM   98    C  CD1 . TRP A 1 14  ? 13.87747  -12.95988 33.74671  1.000 132.44562 ? 14  TRP A CD1 1 
ATOM   99    C  CD2 . TRP A 1 14  ? 14.80436  -10.96702 33.32042  1.000 139.37693 ? 14  TRP A CD2 1 
ATOM   100   N  NE1 . TRP A 1 14  ? 12.94596  -12.19766 33.08268  1.000 147.12274 ? 14  TRP A NE1 1 
ATOM   101   C  CE2 . TRP A 1 14  ? 13.48847  -10.96892 32.81244  1.000 143.30834 ? 14  TRP A CE2 1 
ATOM   102   C  CE3 . TRP A 1 14  ? 15.58123  -9.81419  33.17326  1.000 132.34060 ? 14  TRP A CE3 1 
ATOM   103   C  CZ2 . TRP A 1 14  ? 12.93386  -9.86307  32.16728  1.000 125.27167 ? 14  TRP A CZ2 1 
ATOM   104   C  CZ3 . TRP A 1 14  ? 15.02871  -8.71727  32.53046  1.000 125.77176 ? 14  TRP A CZ3 1 
ATOM   105   C  CH2 . TRP A 1 14  ? 13.71816  -8.75031  32.03660  1.000 123.82205 ? 14  TRP A CH2 1 
ATOM   106   N  N   . ILE A 1 15  ? 19.57140  -12.76024 33.92854  1.000 128.48559 ? 15  ILE A N   1 
ATOM   107   C  CA  . ILE A 1 15  ? 20.95067  -12.81219 34.40391  1.000 135.89474 ? 15  ILE A CA  1 
ATOM   108   C  C   . ILE A 1 15  ? 21.36520  -11.43776 34.92607  1.000 133.25200 ? 15  ILE A C   1 
ATOM   109   O  O   . ILE A 1 15  ? 20.58876  -10.48399 34.91244  1.000 124.25276 ? 15  ILE A O   1 
ATOM   110   C  CB  . ILE A 1 15  ? 21.92942  -13.30490 33.31718  1.000 125.82528 ? 15  ILE A CB  1 
ATOM   111   C  CG1 . ILE A 1 15  ? 21.98534  -12.31761 32.15239  1.000 122.38340 ? 15  ILE A CG1 1 
ATOM   112   C  CG2 . ILE A 1 15  ? 21.54691  -14.68921 32.83264  1.000 127.38030 ? 15  ILE A CG2 1 
ATOM   113   C  CD1 . ILE A 1 15  ? 23.11388  -12.58693 31.18737  1.000 122.17993 ? 15  ILE A CD1 1 
ATOM   114   N  N   . GLU A 1 16  ? 22.62181  -11.34554 35.36619  1.000 133.53843 ? 16  GLU A N   1 
ATOM   115   C  CA  . GLU A 1 16  ? 23.17837  -10.13795 35.96470  1.000 131.37784 ? 16  GLU A CA  1 
ATOM   116   C  C   . GLU A 1 16  ? 24.30086  -9.61537  35.08417  1.000 134.48297 ? 16  GLU A C   1 
ATOM   117   O  O   . GLU A 1 16  ? 25.21424  -10.36591 34.72420  1.000 138.38219 ? 16  GLU A O   1 
ATOM   118   C  CB  . GLU A 1 16  ? 23.72464  -10.44620 37.35689  1.000 131.06983 ? 16  GLU A CB  1 
ATOM   119   C  CG  . GLU A 1 16  ? 22.66717  -10.82676 38.38226  1.000 138.34143 ? 16  GLU A CG  1 
ATOM   120   C  CD  . GLU A 1 16  ? 23.27381  -11.23825 39.71460  1.000 146.10273 ? 16  GLU A CD  1 
ATOM   121   O  OE1 . GLU A 1 16  ? 24.51718  -11.22660 39.82932  1.000 138.61496 ? 16  GLU A OE1 1 
ATOM   122   O  OE2 . GLU A 1 16  ? 22.51125  -11.58920 40.63948  1.000 142.11834 ? 16  GLU A OE2 1 
ATOM   123   N  N   . LYS A 1 17  ? 24.22534  -8.33381  34.72807  1.000 141.93036 ? 17  LYS A N   1 
ATOM   124   C  CA  . LYS A 1 17  ? 25.20132  -7.74010  33.82777  1.000 136.64311 ? 17  LYS A CA  1 
ATOM   125   C  C   . LYS A 1 17  ? 25.56774  -6.32419  34.25014  1.000 133.08929 ? 17  LYS A C   1 
ATOM   126   O  O   . LYS A 1 17  ? 25.02205  -5.77906  35.21008  1.000 140.65112 ? 17  LYS A O   1 
ATOM   127   C  CB  . LYS A 1 17  ? 24.63436  -7.73226  32.42123  1.000 131.58272 ? 17  LYS A CB  1 
ATOM   128   C  CG  . LYS A 1 17  ? 24.57783  -9.07204  31.81638  1.000 130.94673 ? 17  LYS A CG  1 
ATOM   129   C  CD  . LYS A 1 17  ? 24.17958  -8.82492  30.42173  1.000 120.00421 ? 17  LYS A CD  1 
ATOM   130   C  CE  . LYS A 1 17  ? 25.26756  -8.06009  29.74919  1.000 120.76597 ? 17  LYS A CE  1 
ATOM   131   N  NZ  . LYS A 1 17  ? 24.84600  -7.94398  28.37732  1.000 136.11629 ? 17  LYS A NZ  1 
ATOM   132   N  N   . GLU A 1 18  ? 26.53615  -5.74179  33.53944  1.000 122.81323 ? 18  GLU A N   1 
ATOM   133   C  CA  . GLU A 1 18  ? 26.90285  -4.33413  33.67140  1.000 124.76891 ? 18  GLU A CA  1 
ATOM   134   C  C   . GLU A 1 18  ? 26.21483  -3.48983  32.59916  1.000 122.71241 ? 18  GLU A C   1 
ATOM   135   O  O   . GLU A 1 18  ? 26.09268  -3.91371  31.44718  1.000 120.19217 ? 18  GLU A O   1 
ATOM   136   C  CB  . GLU A 1 18  ? 28.42145  -4.14214  33.59885  1.000 128.99798 ? 18  GLU A CB  1 
ATOM   137   C  CG  . GLU A 1 18  ? 28.88946  -2.75080  34.04518  1.000 137.88303 ? 18  GLU A CG  1 
ATOM   138   C  CD  . GLU A 1 18  ? 30.36626  -2.70200  34.41659  1.000 145.22175 ? 18  GLU A CD  1 
ATOM   139   O  OE1 . GLU A 1 18  ? 30.71957  -3.13267  35.53622  1.000 135.53147 ? 18  GLU A OE1 1 
ATOM   140   O  OE2 . GLU A 1 18  ? 31.17438  -2.23029  33.58946  1.000 148.08529 ? 18  GLU A OE2 1 
ATOM   141   N  N   . LYS A 1 19  ? 25.76305  -2.30032  32.98741  1.000 117.67456 ? 19  LYS A N   1 
ATOM   142   C  CA  . LYS A 1 19  ? 25.13265  -1.37900  32.04662  1.000 105.44085 ? 19  LYS A CA  1 
ATOM   143   C  C   . LYS A 1 19  ? 26.10815  -1.00828  30.92815  1.000 109.31704 ? 19  LYS A C   1 
ATOM   144   O  O   . LYS A 1 19  ? 27.25195  -0.62633  31.21249  1.000 110.00546 ? 19  LYS A O   1 
ATOM   145   C  CB  . LYS A 1 19  ? 24.65964  -0.12255  32.77696  1.000 105.67413 ? 19  LYS A CB  1 
ATOM   146   C  CG  . LYS A 1 19  ? 24.01315  0.92865   31.89215  1.000 102.69629 ? 19  LYS A CG  1 
ATOM   147   C  CD  . LYS A 1 19  ? 23.54816  2.11245   32.72497  1.000 103.45891 ? 19  LYS A CD  1 
ATOM   148   C  CE  . LYS A 1 19  ? 22.97755  3.22466   31.86111  1.000 110.07238 ? 19  LYS A CE  1 
ATOM   149   N  NZ  . LYS A 1 19  ? 22.46973  4.35937   32.68586  1.000 101.69673 ? 19  LYS A NZ  1 
ATOM   150   N  N   . PRO A 1 20  ? 25.70875  -1.11684  29.65948  1.000 104.93681 ? 20  PRO A N   1 
ATOM   151   C  CA  . PRO A 1 20  ? 26.64973  -0.85797  28.56090  1.000 105.82280 ? 20  PRO A CA  1 
ATOM   152   C  C   . PRO A 1 20  ? 27.06482  0.60420   28.48632  1.000 96.51409  ? 20  PRO A C   1 
ATOM   153   O  O   . PRO A 1 20  ? 26.29649  1.51385   28.80887  1.000 96.17290  ? 20  PRO A O   1 
ATOM   154   C  CB  . PRO A 1 20  ? 25.85800  -1.26886  27.31332  1.000 96.01986  ? 20  PRO A CB  1 
ATOM   155   C  CG  . PRO A 1 20  ? 24.43189  -1.09556  27.70577  1.000 96.30631  ? 20  PRO A CG  1 
ATOM   156   C  CD  . PRO A 1 20  ? 24.36295  -1.45796  29.16633  1.000 103.22891 ? 20  PRO A CD  1 
ATOM   157   N  N   . ALA A 1 21  ? 28.30691  0.82052   28.04561  1.000 95.70931  ? 21  ALA A N   1 
ATOM   158   C  CA  . ALA A 1 21  ? 28.88055  2.15006   27.88011  1.000 94.31362  ? 21  ALA A CA  1 
ATOM   159   C  C   . ALA A 1 21  ? 28.94842  2.54377   26.40740  1.000 95.47331  ? 21  ALA A C   1 
ATOM   160   O  O   . ALA A 1 21  ? 29.32584  1.72551   25.56032  1.000 91.91915  ? 21  ALA A O   1 
ATOM   161   C  CB  . ALA A 1 21  ? 30.28443  2.20734   28.48169  1.000 95.61712  ? 21  ALA A CB  1 
ATOM   162   N  N   . PRO A 1 22  ? 28.59467  3.78556   26.07063  1.000 90.68192  ? 22  PRO A N   1 
ATOM   163   C  CA  . PRO A 1 22  ? 28.61557  4.21321   24.66761  1.000 87.19249  ? 22  PRO A CA  1 
ATOM   164   C  C   . PRO A 1 22  ? 29.98666  4.69865   24.22387  1.000 88.98356  ? 22  PRO A C   1 
ATOM   165   O  O   . PRO A 1 22  ? 30.70792  5.37848   24.95701  1.000 87.31395  ? 22  PRO A O   1 
ATOM   166   C  CB  . PRO A 1 22  ? 27.59787  5.36163   24.64947  1.000 86.22884  ? 22  PRO A CB  1 
ATOM   167   C  CG  . PRO A 1 22  ? 27.70395  5.95881   26.00518  1.000 88.13883  ? 22  PRO A CG  1 
ATOM   168   C  CD  . PRO A 1 22  ? 28.05186  4.83064   26.95721  1.000 102.81350 ? 22  PRO A CD  1 
ATOM   169   N  N   . GLY A 1 23  ? 30.34739  4.33040   22.99091  1.000 84.93481  ? 23  GLY A N   1 
ATOM   170   C  CA  . GLY A 1 23  ? 31.50757  4.88157   22.35318  1.000 83.94019  ? 23  GLY A CA  1 
ATOM   171   C  C   . GLY A 1 23  ? 31.28983  6.32145   21.92208  1.000 82.40684  ? 23  GLY A C   1 
ATOM   172   O  O   . GLY A 1 23  ? 30.20863  6.89787   22.10623  1.000 82.09712  ? 23  GLY A O   1 
ATOM   173   N  N   . PRO A 1 24  ? 32.33894  6.92684   21.35893  1.000 81.59269  ? 24  PRO A N   1 
ATOM   174   C  CA  . PRO A 1 24  ? 32.22420  8.32645   20.91213  1.000 80.32562  ? 24  PRO A CA  1 
ATOM   175   C  C   . PRO A 1 24  ? 31.15225  8.54418   19.85643  1.000 86.48286  ? 24  PRO A C   1 
ATOM   176   O  O   . PRO A 1 24  ? 30.62632  9.65893   19.74128  1.000 84.86914  ? 24  PRO A O   1 
ATOM   177   C  CB  . PRO A 1 24  ? 33.62398  8.63196   20.36076  1.000 82.51365  ? 24  PRO A CB  1 
ATOM   178   C  CG  . PRO A 1 24  ? 34.52315  7.62786   21.01240  1.000 83.88868  ? 24  PRO A CG  1 
ATOM   179   C  CD  . PRO A 1 24  ? 33.69887  6.39220   21.18083  1.000 82.02739  ? 24  PRO A CD  1 
ATOM   180   N  N   . PHE A 1 25  ? 30.81675  7.51500   19.07780  1.000 78.98472  ? 25  PHE A N   1 
ATOM   181   C  CA  . PHE A 1 25  ? 29.80638  7.61047   18.03267  1.000 81.09676  ? 25  PHE A CA  1 
ATOM   182   C  C   . PHE A 1 25  ? 28.54027  6.83678   18.36319  1.000 87.66192  ? 25  PHE A C   1 
ATOM   183   O  O   . PHE A 1 25  ? 27.63132  6.77224   17.52629  1.000 84.82305  ? 25  PHE A O   1 
ATOM   184   C  CB  . PHE A 1 25  ? 30.37391  7.11202   16.69864  1.000 75.45298  ? 25  PHE A CB  1 
ATOM   185   C  CG  . PHE A 1 25  ? 31.54797  7.90122   16.21395  1.000 74.97463  ? 25  PHE A CG  1 
ATOM   186   C  CD1 . PHE A 1 25  ? 32.83341  7.55044   16.58709  1.000 75.91854  ? 25  PHE A CD1 1 
ATOM   187   C  CD2 . PHE A 1 25  ? 31.36835  9.00040   15.39299  1.000 73.70803  ? 25  PHE A CD2 1 
ATOM   188   C  CE1 . PHE A 1 25  ? 33.91850  8.27787   16.14710  1.000 75.53322  ? 25  PHE A CE1 1 
ATOM   189   C  CE2 . PHE A 1 25  ? 32.45043  9.73200   14.94920  1.000 73.42035  ? 25  PHE A CE2 1 
ATOM   190   C  CZ  . PHE A 1 25  ? 33.72745  9.37025   15.32723  1.000 74.29807  ? 25  PHE A CZ  1 
ATOM   191   N  N   . ASP A 1 26  ? 28.45951  6.24301   19.54699  1.000 78.61688  ? 26  ASP A N   1 
ATOM   192   C  CA  . ASP A 1 26  ? 27.35901  5.36628   19.90784  1.000 79.28766  ? 26  ASP A CA  1 
ATOM   193   C  C   . ASP A 1 26  ? 26.36667  6.08902   20.81029  1.000 79.86601  ? 26  ASP A C   1 
ATOM   194   O  O   . ASP A 1 26  ? 26.57416  7.23001   21.22852  1.000 79.93954  ? 26  ASP A O   1 
ATOM   195   C  CB  . ASP A 1 26  ? 27.88936  4.10516   20.59316  1.000 81.11881  ? 26  ASP A CB  1 
ATOM   196   C  CG  . ASP A 1 26  ? 28.97883  3.42091   19.78847  1.000 80.94588  ? 26  ASP A CG  1 
ATOM   197   O  OD1 . ASP A 1 26  ? 28.93006  3.49079   18.54267  1.000 79.24788  ? 26  ASP A OD1 1 
ATOM   198   O  OD2 . ASP A 1 26  ? 29.88234  2.81279   20.40014  1.000 82.36322  ? 26  ASP A OD2 1 
ATOM   199   N  N   . ALA A 1 27  ? 25.26842  5.40052   21.10542  1.000 80.41693  ? 27  ALA A N   1 
ATOM   200   C  CA  . ALA A 1 27  ? 24.24541  5.92527   21.99272  1.000 81.22142  ? 27  ALA A CA  1 
ATOM   201   C  C   . ALA A 1 27  ? 23.66971  4.79486   22.83046  1.000 83.01386  ? 27  ALA A C   1 
ATOM   202   O  O   . ALA A 1 27  ? 23.60276  3.64413   22.39117  1.000 83.05746  ? 27  ALA A O   1 
ATOM   203   C  CB  . ALA A 1 27  ? 23.12387  6.62421   21.21367  1.000 79.55614  ? 27  ALA A CB  1 
ATOM   204   N  N   . ILE A 1 28  ? 23.26432  5.13562   24.04866  1.000 86.19582  ? 28  ILE A N   1 
ATOM   205   C  CA  . ILE A 1 28  ? 22.53721  4.22562   24.92195  1.000 86.93201  ? 28  ILE A CA  1 
ATOM   206   C  C   . ILE A 1 28  ? 21.07009  4.62079   24.88482  1.000 86.10475  ? 28  ILE A C   1 
ATOM   207   O  O   . ILE A 1 28  ? 20.73019  5.79841   25.05652  1.000 88.46562  ? 28  ILE A O   1 
ATOM   208   C  CB  . ILE A 1 28  ? 23.08708  4.25922   26.35671  1.000 89.13761  ? 28  ILE A CB  1 
ATOM   209   C  CG1 . ILE A 1 28  ? 24.58576  3.96407   26.35403  1.000 89.51592  ? 28  ILE A CG1 1 
ATOM   210   C  CG2 . ILE A 1 28  ? 22.35746  3.24727   27.22076  1.000 91.31013  ? 28  ILE A CG2 1 
ATOM   211   C  CD1 . ILE A 1 28  ? 24.94255  2.64065   25.71731  1.000 91.75456  ? 28  ILE A CD1 1 
ATOM   212   N  N   . VAL A 1 29  ? 20.20281  3.64500   24.64530  1.000 86.19413  ? 29  VAL A N   1 
ATOM   213   C  CA  . VAL A 1 29  ? 18.77785  3.88120   24.46521  1.000 91.09849  ? 29  VAL A CA  1 
ATOM   214   C  C   . VAL A 1 29  ? 18.02222  3.09555   25.52506  1.000 87.88719  ? 29  VAL A C   1 
ATOM   215   O  O   . VAL A 1 29  ? 18.34575  1.93446   25.79897  1.000 89.24049  ? 29  VAL A O   1 
ATOM   216   C  CB  . VAL A 1 29  ? 18.31188  3.47973   23.04732  1.000 93.92094  ? 29  VAL A CB  1 
ATOM   217   C  CG1 . VAL A 1 29  ? 16.83066  3.78321   22.85395  1.000 82.72066  ? 29  VAL A CG1 1 
ATOM   218   C  CG2 . VAL A 1 29  ? 19.15119  4.18031   21.98597  1.000 87.41642  ? 29  VAL A CG2 1 
ATOM   219   N  N   . ARG A 1 30  ? 17.03084  3.73831   26.13472  1.000 88.52483  ? 30  ARG A N   1 
ATOM   220   C  CA  . ARG A 1 30  ? 16.18156  2.88514   26.95122  1.000 96.77720  ? 30  ARG A CA  1 
ATOM   221   C  C   . ARG A 1 30  ? 14.91324  2.52524   26.18719  1.000 90.74959  ? 30  ARG A C   1 
ATOM   222   O  O   . ARG A 1 30  ? 14.33201  3.37894   25.50834  1.000 87.44114  ? 30  ARG A O   1 
ATOM   223   C  CB  . ARG A 1 30  ? 15.82169  3.57314   28.27238  1.000 100.39381 ? 30  ARG A CB  1 
ATOM   224   C  CG  . ARG A 1 30  ? 14.92111  4.79570   28.14020  1.000 103.81377 ? 30  ARG A CG  1 
ATOM   225   C  CD  . ARG A 1 30  ? 14.53663  5.37184   29.49669  1.000 103.03941 ? 30  ARG A CD  1 
ATOM   226   N  NE  . ARG A 1 30  ? 13.47370  6.36266   29.37506  1.000 93.65594  ? 30  ARG A NE  1 
ATOM   227   C  CZ  . ARG A 1 30  ? 12.17929  6.07573   29.38473  1.000 93.86745  ? 30  ARG A CZ  1 
ATOM   228   N  NH1 . ARG A 1 30  ? 11.74796  4.83370   29.53254  1.000 94.76076  ? 30  ARG A NH1 1 
ATOM   229   N  NH2 . ARG A 1 30  ? 11.29555  7.05876   29.23801  1.000 93.26851  ? 30  ARG A NH2 1 
ATOM   230   N  N   . PRO A 1 31  ? 14.47482  1.27092   26.25746  1.000 90.30965  ? 31  PRO A N   1 
ATOM   231   C  CA  . PRO A 1 31  ? 13.34856  0.83849   25.42471  1.000 89.00155  ? 31  PRO A CA  1 
ATOM   232   C  C   . PRO A 1 31  ? 12.01232  1.32889   25.95515  1.000 89.57900  ? 31  PRO A C   1 
ATOM   233   O  O   . PRO A 1 31  ? 11.74192  1.29419   27.15731  1.000 96.99847  ? 31  PRO A O   1 
ATOM   234   C  CB  . PRO A 1 31  ? 13.43779  -0.69097  25.48449  1.000 90.40496  ? 31  PRO A CB  1 
ATOM   235   C  CG  . PRO A 1 31  ? 14.07862  -0.96487  26.78850  1.000 93.20825  ? 31  PRO A CG  1 
ATOM   236   C  CD  . PRO A 1 31  ? 15.04980  0.15742   27.03051  1.000 92.74400  ? 31  PRO A CD  1 
ATOM   237   N  N   . LEU A 1 32  ? 11.17073  1.78757   25.03237  1.000 88.81713  ? 32  LEU A N   1 
ATOM   238   C  CA  . LEU A 1 32  ? 9.78800   2.12768   25.33672  1.000 91.75816  ? 32  LEU A CA  1 
ATOM   239   C  C   . LEU A 1 32  ? 8.81087   1.03264   24.93667  1.000 95.45213  ? 32  LEU A C   1 
ATOM   240   O  O   . LEU A 1 32  ? 7.78339   0.86074   25.60076  1.000 105.11277 ? 32  LEU A O   1 
ATOM   241   C  CB  . LEU A 1 32  ? 9.39739   3.43412   24.63720  1.000 89.53472  ? 32  LEU A CB  1 
ATOM   242   C  CG  . LEU A 1 32  ? 10.25733  4.64736   24.99239  1.000 85.72392  ? 32  LEU A CG  1 
ATOM   243   C  CD1 . LEU A 1 32  ? 9.86455   5.85247   24.15329  1.000 83.66159  ? 32  LEU A CD1 1 
ATOM   244   C  CD2 . LEU A 1 32  ? 10.14699  4.95845   26.47581  1.000 98.42722  ? 32  LEU A CD2 1 
ATOM   245   N  N   . ALA A 1 33  ? 9.11316   0.28951   23.87264  1.000 93.91560  ? 33  ALA A N   1 
ATOM   246   C  CA  . ALA A 1 33  ? 8.30158   -0.83638  23.43525  1.000 86.41185  ? 33  ALA A CA  1 
ATOM   247   C  C   . ALA A 1 33  ? 9.20411   -1.84696  22.74333  1.000 86.12549  ? 33  ALA A C   1 
ATOM   248   O  O   . ALA A 1 33  ? 10.06625  -1.46786  21.94675  1.000 84.47060  ? 33  ALA A O   1 
ATOM   249   C  CB  . ALA A 1 33  ? 7.18493   -0.38351  22.49064  1.000 84.28405  ? 33  ALA A CB  1 
ATOM   250   N  N   . VAL A 1 34  ? 9.00535   -3.13137  23.04818  1.000 87.90635  ? 34  VAL A N   1 
ATOM   251   C  CA  . VAL A 1 34  ? 9.80754   -4.19760  22.46327  1.000 88.08688  ? 34  VAL A CA  1 
ATOM   252   C  C   . VAL A 1 34  ? 8.89444   -5.31789  21.98116  1.000 88.99163  ? 34  VAL A C   1 
ATOM   253   O  O   . VAL A 1 34  ? 7.73045   -5.42003  22.37579  1.000 89.09889  ? 34  VAL A O   1 
ATOM   254   C  CB  . VAL A 1 34  ? 10.85516  -4.75365  23.45402  1.000 90.59837  ? 34  VAL A CB  1 
ATOM   255   C  CG1 . VAL A 1 34  ? 11.84997  -3.67173  23.84590  1.000 90.19882  ? 34  VAL A CG1 1 
ATOM   256   C  CG2 . VAL A 1 34  ? 10.17187  -5.32708  24.67960  1.000 93.46514  ? 34  VAL A CG2 1 
ATOM   257   N  N   . ALA A 1 35  ? 9.44427   -6.16515  21.10397  1.000 88.02976  ? 35  ALA A N   1 
ATOM   258   C  CA  . ALA A 1 35  ? 8.71099   -7.29909  20.56010  1.000 91.49051  ? 35  ALA A CA  1 
ATOM   259   C  C   . ALA A 1 35  ? 9.64087   -8.48783  20.35834  1.000 89.92423  ? 35  ALA A C   1 
ATOM   260   O  O   . ALA A 1 35  ? 10.77296  -8.30717  19.88407  1.000 89.13264  ? 35  ALA A O   1 
ATOM   261   C  CB  . ALA A 1 35  ? 8.03407   -6.94250  19.23359  1.000 85.75516  ? 35  ALA A CB  1 
ATOM   262   N  N   . PRO A 1 36  ? 9.20636   -9.69336  20.71127  1.000 92.17879  ? 36  PRO A N   1 
ATOM   263   C  CA  . PRO A 1 36  ? 10.00239  -10.89096 20.42714  1.000 93.72785  ? 36  PRO A CA  1 
ATOM   264   C  C   . PRO A 1 36  ? 9.78986   -11.38676 19.00299  1.000 92.21859  ? 36  PRO A C   1 
ATOM   265   O  O   . PRO A 1 36  ? 8.80820   -11.05305 18.33804  1.000 95.98516  ? 36  PRO A O   1 
ATOM   266   C  CB  . PRO A 1 36  ? 9.47491   -11.90531 21.44531  1.000 96.97235  ? 36  PRO A CB  1 
ATOM   267   C  CG  . PRO A 1 36  ? 8.05334   -11.49510 21.65242  1.000 96.37750  ? 36  PRO A CG  1 
ATOM   268   C  CD  . PRO A 1 36  ? 8.00746   -9.99728  21.51122  1.000 93.77537  ? 36  PRO A CD  1 
ATOM   269   N  N   . CYS A 1 37  ? 10.73649  -12.20579 18.54000  1.000 93.53463  ? 37  CYS A N   1 
ATOM   270   C  CA  . CYS A 1 37  ? 10.71563  -12.71927 17.17618  1.000 104.67275 ? 37  CYS A CA  1 
ATOM   271   C  C   . CYS A 1 37  ? 10.92172  -14.22858 17.16089  1.000 105.32008 ? 37  CYS A C   1 
ATOM   272   O  O   . CYS A 1 37  ? 11.53816  -14.79972 18.06455  1.000 100.95014 ? 37  CYS A O   1 
ATOM   273   C  CB  . CYS A 1 37  ? 11.78272  -12.05545 16.30095  1.000 91.35063  ? 37  CYS A CB  1 
ATOM   274   S  SG  . CYS A 1 37  ? 11.72919  -12.60322 14.58153  1.000 124.29067 ? 37  CYS A SG  1 
ATOM   275   N  N   . THR A 1 38  ? 10.38595  -14.86901 16.11564  1.000 103.43822 ? 38  THR A N   1 
ATOM   276   C  CA  . THR A 1 38  ? 10.56928  -16.30717 15.93716  1.000 101.46048 ? 38  THR A CA  1 
ATOM   277   C  C   . THR A 1 38  ? 12.03436  -16.67405 15.73116  1.000 111.81452 ? 38  THR A C   1 
ATOM   278   O  O   . THR A 1 38  ? 12.44324  -17.79513 16.05500  1.000 113.09023 ? 38  THR A O   1 
ATOM   279   C  CB  . THR A 1 38  ? 9.73640   -16.79870 14.75241  1.000 103.72038 ? 38  THR A CB  1 
ATOM   280   O  OG1 . THR A 1 38  ? 8.43594   -16.19994 14.80051  1.000 107.58565 ? 38  THR A OG1 1 
ATOM   281   C  CG2 . THR A 1 38  ? 9.58504   -18.31357 14.79724  1.000 111.88165 ? 38  THR A CG2 1 
ATOM   282   N  N   . SER A 1 39  ? 12.83502  -15.75218 15.18731  1.000 127.79469 ? 39  SER A N   1 
ATOM   283   C  CA  . SER A 1 39  ? 14.25272  -16.02939 14.97062  1.000 127.01954 ? 39  SER A CA  1 
ATOM   284   C  C   . SER A 1 39  ? 14.98220  -16.27043 16.28509  1.000 124.20218 ? 39  SER A C   1 
ATOM   285   O  O   . SER A 1 39  ? 15.91281  -17.08304 16.33891  1.000 128.09956 ? 39  SER A O   1 
ATOM   286   C  CB  . SER A 1 39  ? 14.90728  -14.88657 14.19315  1.000 120.25347 ? 39  SER A CB  1 
ATOM   287   O  OG  . SER A 1 39  ? 14.27514  -14.69422 12.93837  1.000 115.10330 ? 39  SER A OG  1 
ATOM   288   N  N   . ASP A 1 40  ? 14.58321  -15.56918 17.34871  1.000 101.67735 ? 40  ASP A N   1 
ATOM   289   C  CA  . ASP A 1 40  ? 15.18860  -15.79539 18.65584  1.000 111.77188 ? 40  ASP A CA  1 
ATOM   290   C  C   . ASP A 1 40  ? 14.92554  -17.21373 19.14654  1.000 111.33908 ? 40  ASP A C   1 
ATOM   291   O  O   . ASP A 1 40  ? 15.76014  -17.79525 19.84804  1.000 115.83847 ? 40  ASP A O   1 
ATOM   292   C  CB  . ASP A 1 40  ? 14.64439  -14.77567 19.65733  1.000 104.27804 ? 40  ASP A CB  1 
ATOM   293   C  CG  . ASP A 1 40  ? 15.22745  -13.38851 19.45551  1.000 109.96286 ? 40  ASP A CG  1 
ATOM   294   O  OD1 . ASP A 1 40  ? 16.15658  -13.24447 18.63351  1.000 111.48289 ? 40  ASP A OD1 1 
ATOM   295   O  OD2 . ASP A 1 40  ? 14.74476  -12.43766 20.10692  1.000 107.10199 ? 40  ASP A OD2 1 
ATOM   296   N  N   . ILE A 1 41  ? 13.76992  -17.77900 18.79347  1.000 110.44900 ? 41  ILE A N   1 
ATOM   297   C  CA  . ILE A 1 41  ? 13.47252  -19.17070 19.12298  1.000 108.53991 ? 41  ILE A CA  1 
ATOM   298   C  C   . ILE A 1 41  ? 14.44201  -20.11231 18.41416  1.000 120.32293 ? 41  ILE A C   1 
ATOM   299   O  O   . ILE A 1 41  ? 14.96620  -21.05672 19.01684  1.000 129.63896 ? 41  ILE A O   1 
ATOM   300   C  CB  . ILE A 1 41  ? 12.00802  -19.49659 18.77945  1.000 110.83319 ? 41  ILE A CB  1 
ATOM   301   C  CG1 . ILE A 1 41  ? 11.07134  -18.52459 19.49842  1.000 106.88218 ? 41  ILE A CG1 1 
ATOM   302   C  CG2 . ILE A 1 41  ? 11.67720  -20.93639 19.13780  1.000 119.86061 ? 41  ILE A CG2 1 
ATOM   303   C  CD1 . ILE A 1 41  ? 11.10472  -18.65229 21.00446  1.000 109.61975 ? 41  ILE A CD1 1 
ATOM   304   N  N   . HIS A 1 42  ? 14.69554  -19.87055 17.12186  1.000 120.37950 ? 42  HIS A N   1 
ATOM   305   C  CA  . HIS A 1 42  ? 15.62473  -20.72185 16.37815  1.000 129.06935 ? 42  HIS A CA  1 
ATOM   306   C  C   . HIS A 1 42  ? 17.02372  -20.69032 16.97920  1.000 137.00515 ? 42  HIS A C   1 
ATOM   307   O  O   . HIS A 1 42  ? 17.72799  -21.70689 16.97998  1.000 146.78304 ? 42  HIS A O   1 
ATOM   308   C  CB  . HIS A 1 42  ? 15.67418  -20.31437 14.90430  1.000 126.33454 ? 42  HIS A CB  1 
ATOM   309   C  CG  . HIS A 1 42  ? 14.43967  -20.66412 14.13345  1.000 127.98726 ? 42  HIS A CG  1 
ATOM   310   N  ND1 . HIS A 1 42  ? 14.09281  -20.03539 12.95689  1.000 123.79561 ? 42  HIS A ND1 1 
ATOM   311   C  CD2 . HIS A 1 42  ? 13.48752  -21.60118 14.35367  1.000 125.91095 ? 42  HIS A CD2 1 
ATOM   312   C  CE1 . HIS A 1 42  ? 12.97181  -20.55933 12.49401  1.000 127.40087 ? 42  HIS A CE1 1 
ATOM   313   N  NE2 . HIS A 1 42  ? 12.58366  -21.51148 13.32317  1.000 132.61929 ? 42  HIS A NE2 1 
ATOM   314   N  N   . THR A 1 43  ? 17.45219  -19.53222 17.48124  1.000 137.31687 ? 43  THR A N   1 
ATOM   315   C  CA  . THR A 1 43  ? 18.77616  -19.44528 18.08758  1.000 141.14363 ? 43  THR A CA  1 
ATOM   316   C  C   . THR A 1 43  ? 18.83939  -20.25518 19.37616  1.000 140.54968 ? 43  THR A C   1 
ATOM   317   O  O   . THR A 1 43  ? 19.83495  -20.93981 19.64125  1.000 142.74738 ? 43  THR A O   1 
ATOM   318   C  CB  . THR A 1 43  ? 19.13746  -17.98318 18.35214  1.000 145.55527 ? 43  THR A CB  1 
ATOM   319   O  OG1 . THR A 1 43  ? 19.35139  -17.30874 17.10534  1.000 148.59988 ? 43  THR A OG1 1 
ATOM   320   C  CG2 . THR A 1 43  ? 20.39942  -17.88164 19.20058  1.000 148.39434 ? 43  THR A CG2 1 
ATOM   321   N  N   . VAL A 1 44  ? 17.77407  -20.20856 20.17445  1.000 138.05906 ? 44  VAL A N   1 
ATOM   322   C  CA  . VAL A 1 44  ? 17.78538  -20.84633 21.48584  1.000 143.48725 ? 44  VAL A CA  1 
ATOM   323   C  C   . VAL A 1 44  ? 17.57220  -22.35055 21.36615  1.000 139.69689 ? 44  VAL A C   1 
ATOM   324   O  O   . VAL A 1 44  ? 18.36645  -23.14665 21.87986  1.000 144.14561 ? 44  VAL A O   1 
ATOM   325   C  CB  . VAL A 1 44  ? 16.72335  -20.20136 22.39679  1.000 128.64605 ? 44  VAL A CB  1 
ATOM   326   C  CG1 . VAL A 1 44  ? 16.58276  -20.98808 23.68951  1.000 121.88613 ? 44  VAL A CG1 1 
ATOM   327   C  CG2 . VAL A 1 44  ? 17.07866  -18.75191 22.68384  1.000 132.00533 ? 44  VAL A CG2 1 
ATOM   328   N  N   . PHE A 1 45  ? 16.50345  -22.76597 20.68598  1.000 129.42088 ? 45  PHE A N   1 
ATOM   329   C  CA  . PHE A 1 45  ? 16.06218  -24.15352 20.74625  1.000 138.15045 ? 45  PHE A CA  1 
ATOM   330   C  C   . PHE A 1 45  ? 16.55975  -25.02602 19.60020  1.000 142.41888 ? 45  PHE A C   1 
ATOM   331   O  O   . PHE A 1 45  ? 16.51083  -26.25526 19.72180  1.000 144.58376 ? 45  PHE A O   1 
ATOM   332   C  CB  . PHE A 1 45  ? 14.53119  -24.20962 20.80538  1.000 129.89887 ? 45  PHE A CB  1 
ATOM   333   C  CG  . PHE A 1 45  ? 13.95048  -23.48562 21.98797  1.000 123.71075 ? 45  PHE A CG  1 
ATOM   334   C  CD1 . PHE A 1 45  ? 13.90080  -24.09185 23.23221  1.000 127.44895 ? 45  PHE A CD1 1 
ATOM   335   C  CD2 . PHE A 1 45  ? 13.47439  -22.19289 21.86082  1.000 122.37142 ? 45  PHE A CD2 1 
ATOM   336   C  CE1 . PHE A 1 45  ? 13.37390  -23.42666 24.32298  1.000 127.55051 ? 45  PHE A CE1 1 
ATOM   337   C  CE2 . PHE A 1 45  ? 12.94661  -21.52286 22.94806  1.000 120.15406 ? 45  PHE A CE2 1 
ATOM   338   C  CZ  . PHE A 1 45  ? 12.89703  -22.13995 24.17998  1.000 123.89578 ? 45  PHE A CZ  1 
ATOM   339   N  N   . GLU A 1 46  ? 17.02987  -24.44325 18.49740  1.000 139.55076 ? 46  GLU A N   1 
ATOM   340   C  CA  . GLU A 1 46  ? 17.59636  -25.23425 17.41329  1.000 149.10279 ? 46  GLU A CA  1 
ATOM   341   C  C   . GLU A 1 46  ? 19.10026  -25.06286 17.25009  1.000 153.44019 ? 46  GLU A C   1 
ATOM   342   O  O   . GLU A 1 46  ? 19.71650  -25.84760 16.51996  1.000 151.44879 ? 46  GLU A O   1 
ATOM   343   C  CB  . GLU A 1 46  ? 16.90184  -24.90033 16.08417  1.000 147.43383 ? 46  GLU A CB  1 
ATOM   344   C  CG  . GLU A 1 46  ? 15.46318  -25.38568 16.00094  1.000 142.98094 ? 46  GLU A CG  1 
ATOM   345   C  CD  . GLU A 1 46  ? 14.79561  -25.01122 14.69186  1.000 144.48028 ? 46  GLU A CD  1 
ATOM   346   O  OE1 . GLU A 1 46  ? 15.44604  -24.34252 13.86004  1.000 132.78202 ? 46  GLU A OE1 1 
ATOM   347   O  OE2 . GLU A 1 46  ? 13.62135  -25.38909 14.49338  1.000 147.86773 ? 46  GLU A OE2 1 
ATOM   348   N  N   . GLY A 1 47  ? 19.70280  -24.07544 17.90579  1.000 151.50984 ? 47  GLY A N   1 
ATOM   349   C  CA  . GLY A 1 47  ? 21.13133  -23.83324 17.76246  1.000 157.28817 ? 47  GLY A CA  1 
ATOM   350   C  C   . GLY A 1 47  ? 21.57277  -23.59078 16.33569  1.000 161.78901 ? 47  GLY A C   1 
ATOM   351   O  O   . GLY A 1 47  ? 22.60684  -24.11953 15.90865  1.000 163.43180 ? 47  GLY A O   1 
ATOM   352   N  N   . ALA A 1 48  ? 20.80736  -22.79996 15.58321  1.000 156.94778 ? 48  ALA A N   1 
ATOM   353   C  CA  . ALA A 1 48  ? 21.08248  -22.60605 14.16607  1.000 148.26507 ? 48  ALA A CA  1 
ATOM   354   C  C   . ALA A 1 48  ? 22.27745  -21.69636 13.91033  1.000 149.01735 ? 48  ALA A C   1 
ATOM   355   O  O   . ALA A 1 48  ? 22.88125  -21.78214 12.83499  1.000 142.34743 ? 48  ALA A O   1 
ATOM   356   C  CB  . ALA A 1 48  ? 19.84413  -22.04739 13.46164  1.000 131.98203 ? 48  ALA A CB  1 
ATOM   357   N  N   . ILE A 1 49  ? 22.62988  -20.83152 14.85889  1.000 149.05440 ? 49  ILE A N   1 
ATOM   358   C  CA  . ILE A 1 49  ? 23.77337  -19.93978 14.71131  1.000 156.01375 ? 49  ILE A CA  1 
ATOM   359   C  C   . ILE A 1 49  ? 24.88274  -20.26943 15.71060  1.000 152.93352 ? 49  ILE A C   1 
ATOM   360   O  O   . ILE A 1 49  ? 25.74964  -19.43552 15.96590  1.000 145.48429 ? 49  ILE A O   1 
ATOM   361   C  CB  . ILE A 1 49  ? 23.35270  -18.46573 14.82609  1.000 153.96710 ? 49  ILE A CB  1 
ATOM   362   C  CG1 . ILE A 1 49  ? 22.76669  -18.18394 16.21194  1.000 153.04875 ? 49  ILE A CG1 1 
ATOM   363   C  CG2 . ILE A 1 49  ? 22.36552  -18.10312 13.72709  1.000 145.72569 ? 49  ILE A CG2 1 
ATOM   364   C  CD1 . ILE A 1 49  ? 22.52445  -16.71597 16.47995  1.000 147.01628 ? 49  ILE A CD1 1 
ATOM   365   N  N   . GLY A 1 50  ? 24.87330  -21.46597 16.28342  1.000 150.27579 ? 50  GLY A N   1 
ATOM   366   C  CA  . GLY A 1 50  ? 25.91590  -21.84048 17.21622  1.000 149.93484 ? 50  GLY A CA  1 
ATOM   367   C  C   . GLY A 1 50  ? 25.57347  -21.58214 18.66943  1.000 151.29486 ? 50  GLY A C   1 
ATOM   368   O  O   . GLY A 1 50  ? 24.45546  -21.21427 19.04450  1.000 150.41041 ? 50  GLY A O   1 
ATOM   369   N  N   . GLU A 1 51  ? 26.58931  -21.78755 19.50603  1.000 155.84026 ? 51  GLU A N   1 
ATOM   370   C  CA  . GLU A 1 51  ? 26.45879  -21.68843 20.95376  1.000 151.58081 ? 51  GLU A CA  1 
ATOM   371   C  C   . GLU A 1 51  ? 26.75429  -20.27226 21.43375  1.000 152.53936 ? 51  GLU A C   1 
ATOM   372   O  O   . GLU A 1 51  ? 27.73712  -19.65602 21.00894  1.000 154.90726 ? 51  GLU A O   1 
ATOM   373   C  CB  . GLU A 1 51  ? 27.41308  -22.67301 21.63012  1.000 152.76199 ? 51  GLU A CB  1 
ATOM   374   C  CG  . GLU A 1 51  ? 27.27735  -22.75898 23.13646  1.000 159.18536 ? 51  GLU A CG  1 
ATOM   375   C  CD  . GLU A 1 51  ? 27.97698  -23.97546 23.70582  1.000 162.31501 ? 51  GLU A CD  1 
ATOM   376   O  OE1 . GLU A 1 51  ? 28.34912  -24.86979 22.91754  1.000 158.99059 ? 51  GLU A OE1 1 
ATOM   377   O  OE2 . GLU A 1 51  ? 28.16761  -24.03184 24.93825  1.000 172.85464 ? 51  GLU A OE2 1 
ATOM   378   N  N   . ARG A 1 52  ? 25.90212  -19.76605 22.32203  1.000 146.48879 ? 52  ARG A N   1 
ATOM   379   C  CA  . ARG A 1 52  ? 26.09281  -18.48317 22.98114  1.000 145.08362 ? 52  ARG A CA  1 
ATOM   380   C  C   . ARG A 1 52  ? 26.05706  -18.67781 24.49211  1.000 159.25767 ? 52  ARG A C   1 
ATOM   381   O  O   . ARG A 1 52  ? 25.55947  -19.68906 24.99534  1.000 161.88467 ? 52  ARG A O   1 
ATOM   382   C  CB  . ARG A 1 52  ? 25.03165  -17.46125 22.54946  1.000 143.87552 ? 52  ARG A CB  1 
ATOM   383   C  CG  . ARG A 1 52  ? 25.00236  -17.18085 21.05240  1.000 142.02387 ? 52  ARG A CG  1 
ATOM   384   C  CD  . ARG A 1 52  ? 26.25307  -16.43373 20.60797  1.000 129.19103 ? 52  ARG A CD  1 
ATOM   385   N  NE  . ARG A 1 52  ? 26.15887  -15.96870 19.22912  1.000 130.91861 ? 52  ARG A NE  1 
ATOM   386   C  CZ  . ARG A 1 52  ? 26.44755  -16.70698 18.16602  1.000 138.09171 ? 52  ARG A CZ  1 
ATOM   387   N  NH1 . ARG A 1 52  ? 26.85277  -17.96072 18.28419  1.000 141.16665 ? 52  ARG A NH1 1 
ATOM   388   N  NH2 . ARG A 1 52  ? 26.32760  -16.17341 16.95355  1.000 131.94264 ? 52  ARG A NH2 1 
ATOM   389   N  N   . HIS A 1 53  ? 26.59159  -17.69530 25.21862  1.000 176.23055 ? 53  HIS A N   1 
ATOM   390   C  CA  . HIS A 1 53  ? 26.66369  -17.75067 26.67700  1.000 179.90281 ? 53  HIS A CA  1 
ATOM   391   C  C   . HIS A 1 53  ? 26.17068  -16.43203 27.26019  1.000 169.77914 ? 53  HIS A C   1 
ATOM   392   O  O   . HIS A 1 53  ? 26.83321  -15.39998 27.11005  1.000 180.17670 ? 53  HIS A O   1 
ATOM   393   C  CB  . HIS A 1 53  ? 28.09344  -18.03327 27.14502  1.000 185.75887 ? 53  HIS A CB  1 
ATOM   394   C  CG  . HIS A 1 53  ? 28.61028  -19.38198 26.75023  1.000 195.50298 ? 53  HIS A CG  1 
ATOM   395   N  ND1 . HIS A 1 53  ? 28.18250  -20.54875 27.34632  1.000 192.92109 ? 53  HIS A ND1 1 
ATOM   396   C  CD2 . HIS A 1 53  ? 29.52889  -19.74764 25.82474  1.000 196.30701 ? 53  HIS A CD2 1 
ATOM   397   C  CE1 . HIS A 1 53  ? 28.81130  -21.57524 26.80176  1.000 195.56000 ? 53  HIS A CE1 1 
ATOM   398   N  NE2 . HIS A 1 53  ? 29.63373  -21.11644 25.87563  1.000 198.53391 ? 53  HIS A NE2 1 
ATOM   399   N  N   . ASN A 1 54  ? 25.01746  -16.47234 27.93448  1.000 143.02246 ? 54  ASN A N   1 
ATOM   400   C  CA  . ASN A 1 54  ? 24.48683  -15.33023 28.68657  1.000 135.39625 ? 54  ASN A CA  1 
ATOM   401   C  C   . ASN A 1 54  ? 24.32984  -14.08568 27.80899  1.000 144.52856 ? 54  ASN A C   1 
ATOM   402   O  O   . ASN A 1 54  ? 24.72304  -12.97835 28.18397  1.000 137.12957 ? 54  ASN A O   1 
ATOM   403   C  CB  . ASN A 1 54  ? 25.36146  -15.03766 29.90803  1.000 125.68810 ? 54  ASN A CB  1 
ATOM   404   C  CG  . ASN A 1 54  ? 25.32723  -16.15988 30.92853  1.000 140.57124 ? 54  ASN A CG  1 
ATOM   405   O  OD1 . ASN A 1 54  ? 24.55573  -17.11053 30.79566  1.000 146.79361 ? 54  ASN A OD1 1 
ATOM   406   N  ND2 . ASN A 1 54  ? 26.16261  -16.05382 31.95562  1.000 129.41181 ? 54  ASN A ND2 1 
ATOM   407   N  N   . MET A 1 55  ? 23.74230  -14.27627 26.62886  1.000 143.78655 ? 55  MET A N   1 
ATOM   408   C  CA  . MET A 1 55  ? 23.49278  -13.19609 25.67990  1.000 118.72536 ? 55  MET A CA  1 
ATOM   409   C  C   . MET A 1 55  ? 22.03312  -12.75991 25.75626  1.000 111.48371 ? 55  MET A C   1 
ATOM   410   O  O   . MET A 1 55  ? 21.12721  -13.58166 25.57963  1.000 126.45275 ? 55  MET A O   1 
ATOM   411   C  CB  . MET A 1 55  ? 23.84490  -13.64339 24.26138  1.000 116.16215 ? 55  MET A CB  1 
ATOM   412   C  CG  . MET A 1 55  ? 23.49688  -12.63980 23.17668  1.000 119.09058 ? 55  MET A CG  1 
ATOM   413   S  SD  . MET A 1 55  ? 23.60069  -13.36251 21.52683  1.000 121.28629 ? 55  MET A SD  1 
ATOM   414   C  CE  . MET A 1 55  ? 22.32435  -14.61344 21.62353  1.000 126.25654 ? 55  MET A CE  1 
ATOM   415   N  N   . ILE A 1 56  ? 21.81158  -11.46611 26.01058  1.000 107.24070 ? 56  ILE A N   1 
ATOM   416   C  CA  . ILE A 1 56  ? 20.45759  -10.92254 26.02872  1.000 110.08486 ? 56  ILE A CA  1 
ATOM   417   C  C   . ILE A 1 56  ? 19.81766  -11.07708 24.65314  1.000 121.57090 ? 56  ILE A C   1 
ATOM   418   O  O   . ILE A 1 56  ? 20.46825  -10.88840 23.61678  1.000 116.55491 ? 56  ILE A O   1 
ATOM   419   C  CB  . ILE A 1 56  ? 20.48676  -9.45012  26.47636  1.000 104.35014 ? 56  ILE A CB  1 
ATOM   420   C  CG1 . ILE A 1 56  ? 20.47836  -9.34537  27.99971  1.000 108.59879 ? 56  ILE A CG1 1 
ATOM   421   C  CG2 . ILE A 1 56  ? 19.32246  -8.66527  25.89526  1.000 106.67205 ? 56  ILE A CG2 1 
ATOM   422   C  CD1 . ILE A 1 56  ? 20.51633  -7.91813  28.49518  1.000 105.87306 ? 56  ILE A CD1 1 
ATOM   423   N  N   . LEU A 1 57  ? 18.53212  -11.43111 24.63914  1.000 139.16985 ? 57  LEU A N   1 
ATOM   424   C  CA  . LEU A 1 57  ? 17.78627  -11.64479 23.40958  1.000 146.55166 ? 57  LEU A CA  1 
ATOM   425   C  C   . LEU A 1 57  ? 17.02990  -10.37512 23.01481  1.000 134.11207 ? 57  LEU A C   1 
ATOM   426   O  O   . LEU A 1 57  ? 17.02277  -9.37129  23.73112  1.000 121.79364 ? 57  LEU A O   1 
ATOM   427   C  CB  . LEU A 1 57  ? 16.83056  -12.82868 23.57282  1.000 143.90196 ? 57  LEU A CB  1 
ATOM   428   C  CG  . LEU A 1 57  ? 17.48214  -14.19211 23.81479  1.000 146.45525 ? 57  LEU A CG  1 
ATOM   429   C  CD1 . LEU A 1 57  ? 16.49250  -15.15597 24.45051  1.000 150.15538 ? 57  LEU A CD1 1 
ATOM   430   C  CD2 . LEU A 1 57  ? 18.03510  -14.76556 22.51795  1.000 146.90469 ? 57  LEU A CD2 1 
ATOM   431   N  N   . GLY A 1 58  ? 16.38107  -10.42713 21.85233  1.000 104.18836 ? 58  GLY A N   1 
ATOM   432   C  CA  . GLY A 1 58  ? 15.54535  -9.33384  21.39333  1.000 96.08682  ? 58  GLY A CA  1 
ATOM   433   C  C   . GLY A 1 58  ? 16.25666  -8.39068  20.44616  1.000 95.70027  ? 58  GLY A C   1 
ATOM   434   O  O   . GLY A 1 58  ? 17.39202  -7.98241  20.70702  1.000 92.53100  ? 58  GLY A O   1 
ATOM   435   N  N   . HIS A 1 59  ? 15.59674  -8.03091  19.33982  1.000 89.04199  ? 59  HIS A N   1 
ATOM   436   C  CA  . HIS A 1 59  ? 16.17306  -7.07989  18.39740  1.000 86.50736  ? 59  HIS A CA  1 
ATOM   437   C  C   . HIS A 1 59  ? 15.15716  -6.09535  17.82773  1.000 84.13604  ? 59  HIS A C   1 
ATOM   438   O  O   . HIS A 1 59  ? 15.49488  -5.35913  16.89243  1.000 91.05250  ? 59  HIS A O   1 
ATOM   439   C  CB  . HIS A 1 59  ? 16.86237  -7.82419  17.24792  1.000 86.19387  ? 59  HIS A CB  1 
ATOM   440   C  CG  . HIS A 1 59  ? 16.02343  -8.90401  16.64114  1.000 88.87132  ? 59  HIS A CG  1 
ATOM   441   N  ND1 . HIS A 1 59  ? 16.24118  -10.24250 16.88829  1.000 96.45631  ? 59  HIS A ND1 1 
ATOM   442   C  CD2 . HIS A 1 59  ? 14.95714  -8.84344  15.80973  1.000 85.24441  ? 59  HIS A CD2 1 
ATOM   443   C  CE1 . HIS A 1 59  ? 15.34974  -10.96021 16.22894  1.000 99.68525  ? 59  HIS A CE1 1 
ATOM   444   N  NE2 . HIS A 1 59  ? 14.55855  -10.13529 15.56711  1.000 96.89697  ? 59  HIS A NE2 1 
ATOM   445   N  N   . GLU A 1 60  ? 13.93277  -6.05239  18.34754  1.000 80.57174  ? 60  GLU A N   1 
ATOM   446   C  CA  . GLU A 1 60  ? 12.90258  -5.13327  17.86964  1.000 78.40869  ? 60  GLU A CA  1 
ATOM   447   C  C   . GLU A 1 60  ? 12.52581  -4.20720  19.01631  1.000 78.08178  ? 60  GLU A C   1 
ATOM   448   O  O   . GLU A 1 60  ? 11.94461  -4.65347  20.01126  1.000 91.25779  ? 60  GLU A O   1 
ATOM   449   C  CB  . GLU A 1 60  ? 11.67801  -5.89074  17.35375  1.000 79.80974  ? 60  GLU A CB  1 
ATOM   450   C  CG  . GLU A 1 60  ? 12.00352  -7.07954  16.46436  1.000 80.20201  ? 60  GLU A CG  1 
ATOM   451   C  CD  . GLU A 1 60  ? 10.76153  -7.79317  15.95551  1.000 77.56868  ? 60  GLU A CD  1 
ATOM   452   O  OE1 . GLU A 1 60  ? 9.88708   -7.12292  15.36578  1.000 80.42827  ? 60  GLU A OE1 1 
ATOM   453   O  OE2 . GLU A 1 60  ? 10.66477  -9.02548  16.13114  1.000 77.63559  ? 60  GLU A OE2 1 
ATOM   454   N  N   . ALA A 1 61  ? 12.84962  -2.92267  18.88261  1.000 74.89412  ? 61  ALA A N   1 
ATOM   455   C  CA  . ALA A 1 61  ? 12.62427  -1.99831  19.98341  1.000 82.07315  ? 61  ALA A CA  1 
ATOM   456   C  C   . ALA A 1 61  ? 12.47104  -0.57962  19.45789  1.000 76.15284  ? 61  ALA A C   1 
ATOM   457   O  O   . ALA A 1 61  ? 13.14482  -0.18477  18.50310  1.000 73.73341  ? 61  ALA A O   1 
ATOM   458   C  CB  . ALA A 1 61  ? 13.76954  -2.05672  21.00225  1.000 80.13175  ? 61  ALA A CB  1 
ATOM   459   N  N   . VAL A 1 62  ? 11.57328  0.17018   20.09192  1.000 77.81222  ? 62  VAL A N   1 
ATOM   460   C  CA  . VAL A 1 62  ? 11.44917  1.61289   19.92090  1.000 77.44675  ? 62  VAL A CA  1 
ATOM   461   C  C   . VAL A 1 62  ? 11.71063  2.23973   21.28157  1.000 80.93337  ? 62  VAL A C   1 
ATOM   462   O  O   . VAL A 1 62  ? 11.02342  1.91607   22.25760  1.000 94.40438  ? 62  VAL A O   1 
ATOM   463   C  CB  . VAL A 1 62  ? 10.06561  2.01328   19.38692  1.000 76.31151  ? 62  VAL A CB  1 
ATOM   464   C  CG1 . VAL A 1 62  ? 9.84527   3.50470   19.56081  1.000 76.98520  ? 62  VAL A CG1 1 
ATOM   465   C  CG2 . VAL A 1 62  ? 9.92680   1.61775   17.92315  1.000 73.02350  ? 62  VAL A CG2 1 
ATOM   466   N  N   . GLY A 1 63  ? 12.70526  3.12487   21.35507  1.000 81.11189  ? 63  GLY A N   1 
ATOM   467   C  CA  . GLY A 1 63  ? 13.17152  3.62592   22.63021  1.000 84.42768  ? 63  GLY A CA  1 
ATOM   468   C  C   . GLY A 1 63  ? 13.40192  5.12423   22.61720  1.000 87.06881  ? 63  GLY A C   1 
ATOM   469   O  O   . GLY A 1 63  ? 13.14976  5.80774   21.62308  1.000 87.72996  ? 63  GLY A O   1 
ATOM   470   N  N   . GLU A 1 64  ? 13.89328  5.61796   23.75196  1.000 88.73966  ? 64  GLU A N   1 
ATOM   471   C  CA  . GLU A 1 64  ? 14.24608  7.01877   23.93339  1.000 90.80669  ? 64  GLU A CA  1 
ATOM   472   C  C   . GLU A 1 64  ? 15.73606  7.12182   24.21723  1.000 89.07451  ? 64  GLU A C   1 
ATOM   473   O  O   . GLU A 1 64  ? 16.26341  6.39230   25.06390  1.000 91.11204  ? 64  GLU A O   1 
ATOM   474   C  CB  . GLU A 1 64  ? 13.45677  7.65714   25.07927  1.000 91.74033  ? 64  GLU A CB  1 
ATOM   475   C  CG  . GLU A 1 64  ? 13.87835  9.09164   25.37979  1.000 92.96111  ? 64  GLU A CG  1 
ATOM   476   C  CD  . GLU A 1 64  ? 13.21341  9.66243   26.62235  1.000 114.14321 ? 64  GLU A CD  1 
ATOM   477   O  OE1 . GLU A 1 64  ? 13.30637  9.03192   27.69989  1.000 99.56778  ? 64  GLU A OE1 1 
ATOM   478   O  OE2 . GLU A 1 64  ? 12.59909  10.74583  26.52145  1.000 122.16814 ? 64  GLU A OE2 1 
ATOM   479   N  N   . VAL A 1 65  ? 16.41119  8.01678   23.49874  1.000 87.41023  ? 65  VAL A N   1 
ATOM   480   C  CA  . VAL A 1 65  ? 17.83324  8.23596   23.72019  1.000 91.83410  ? 65  VAL A CA  1 
ATOM   481   C  C   . VAL A 1 65  ? 18.04218  8.86323   25.09142  1.000 95.60103  ? 65  VAL A C   1 
ATOM   482   O  O   . VAL A 1 65  ? 17.39714  9.86038   25.44201  1.000 95.56189  ? 65  VAL A O   1 
ATOM   483   C  CB  . VAL A 1 65  ? 18.41531  9.12348   22.61145  1.000 85.43770  ? 65  VAL A CB  1 
ATOM   484   C  CG1 . VAL A 1 65  ? 19.88500  9.39107   22.86787  1.000 89.05759  ? 65  VAL A CG1 1 
ATOM   485   C  CG2 . VAL A 1 65  ? 18.21566  8.47173   21.25912  1.000 88.97065  ? 65  VAL A CG2 1 
ATOM   486   N  N   . VAL A 1 66  ? 18.94141  8.27455   25.87958  1.000 97.80368  ? 66  VAL A N   1 
ATOM   487   C  CA  . VAL A 1 66  ? 19.29231  8.81768   27.18092  1.000 97.35681  ? 66  VAL A CA  1 
ATOM   488   C  C   . VAL A 1 66  ? 20.73150  9.32338   27.23063  1.000 97.66080  ? 66  VAL A C   1 
ATOM   489   O  O   . VAL A 1 66  ? 21.03174  10.21838  28.02839  1.000 100.13004 ? 66  VAL A O   1 
ATOM   490   C  CB  . VAL A 1 66  ? 19.03915  7.78771   28.30422  1.000 100.16555 ? 66  VAL A CB  1 
ATOM   491   C  CG1 . VAL A 1 66  ? 17.56509  7.41025   28.36392  1.000 100.28241 ? 66  VAL A CG1 1 
ATOM   492   C  CG2 . VAL A 1 66  ? 19.90748  6.55353   28.11322  1.000 99.37820  ? 66  VAL A CG2 1 
ATOM   493   N  N   . GLU A 1 67  ? 21.62022  8.80114   26.38962  1.000 100.38059 ? 67  GLU A N   1 
ATOM   494   C  CA  . GLU A 1 67  ? 23.02093  9.19380   26.39852  1.000 99.40171  ? 67  GLU A CA  1 
ATOM   495   C  C   . GLU A 1 67  ? 23.59108  9.00830   25.00222  1.000 97.32388  ? 67  GLU A C   1 
ATOM   496   O  O   . GLU A 1 67  ? 23.23757  8.05518   24.30411  1.000 95.02879  ? 67  GLU A O   1 
ATOM   497   C  CB  . GLU A 1 67  ? 23.82511  8.36599   27.40849  1.000 103.76680 ? 67  GLU A CB  1 
ATOM   498   C  CG  . GLU A 1 67  ? 25.25850  8.83537   27.60739  1.000 112.41078 ? 67  GLU A CG  1 
ATOM   499   C  CD  . GLU A 1 67  ? 26.04578  7.92701   28.53350  1.000 116.73728 ? 67  GLU A CD  1 
ATOM   500   O  OE1 . GLU A 1 67  ? 25.43307  7.03523   29.15892  1.000 113.94480 ? 67  GLU A OE1 1 
ATOM   501   O  OE2 . GLU A 1 67  ? 27.27947  8.09982   28.62926  1.000 113.90968 ? 67  GLU A OE2 1 
ATOM   502   N  N   . VAL A 1 68  ? 24.47230  9.92591   24.60294  1.000 91.77557  ? 68  VAL A N   1 
ATOM   503   C  CA  . VAL A 1 68  ? 25.13063  9.87517   23.30607  1.000 88.76254  ? 68  VAL A CA  1 
ATOM   504   C  C   . VAL A 1 68  ? 26.62003  10.11207  23.50310  1.000 88.82374  ? 68  VAL A C   1 
ATOM   505   O  O   . VAL A 1 68  ? 27.05866  10.68563  24.50210  1.000 98.43745  ? 68  VAL A O   1 
ATOM   506   C  CB  . VAL A 1 68  ? 24.56200  10.90770  22.30532  1.000 85.75698  ? 68  VAL A CB  1 
ATOM   507   C  CG1 . VAL A 1 68  ? 23.12876  10.57174  21.93744  1.000 84.53294  ? 68  VAL A CG1 1 
ATOM   508   C  CG2 . VAL A 1 68  ? 24.66315  12.31529  22.87212  1.000 87.75696  ? 68  VAL A CG2 1 
ATOM   509   N  N   . GLY A 1 69  ? 27.39736  9.65042   22.53241  1.000 87.62339  ? 69  GLY A N   1 
ATOM   510   C  CA  . GLY A 1 69  ? 28.81587  9.92583   22.51904  1.000 86.81348  ? 69  GLY A CA  1 
ATOM   511   C  C   . GLY A 1 69  ? 29.09928  11.37317  22.16742  1.000 86.50874  ? 69  GLY A C   1 
ATOM   512   O  O   . GLY A 1 69  ? 28.21789  12.14773  21.79235  1.000 85.68006  ? 69  GLY A O   1 
ATOM   513   N  N   . SER A 1 70  ? 30.37031  11.74905  22.31557  1.000 87.35755  ? 70  SER A N   1 
ATOM   514   C  CA  . SER A 1 70  ? 30.77305  13.12817  22.06751  1.000 87.42981  ? 70  SER A CA  1 
ATOM   515   C  C   . SER A 1 70  ? 30.64680  13.52338  20.60082  1.000 91.83755  ? 70  SER A C   1 
ATOM   516   O  O   . SER A 1 70  ? 30.59603  14.72109  20.29967  1.000 83.93401  ? 70  SER A O   1 
ATOM   517   C  CB  . SER A 1 70  ? 32.21015  13.34798  22.54356  1.000 89.11771  ? 70  SER A CB  1 
ATOM   518   O  OG  . SER A 1 70  ? 33.10160  12.44272  21.91683  1.000 88.72004  ? 70  SER A OG  1 
ATOM   519   N  N   . GLU A 1 71  ? 30.59393  12.55404  19.68678  1.000 83.51550  ? 71  GLU A N   1 
ATOM   520   C  CA  . GLU A 1 71  ? 30.55786  12.82930  18.25662  1.000 80.34564  ? 71  GLU A CA  1 
ATOM   521   C  C   . GLU A 1 71  ? 29.17341  12.67634  17.63609  1.000 79.96405  ? 71  GLU A C   1 
ATOM   522   O  O   . GLU A 1 71  ? 29.02393  12.91198  16.43370  1.000 78.93641  ? 71  GLU A O   1 
ATOM   523   C  CB  . GLU A 1 71  ? 31.55105  11.92159  17.52611  1.000 79.99219  ? 71  GLU A CB  1 
ATOM   524   C  CG  . GLU A 1 71  ? 32.97989  12.05848  18.02331  1.000 81.10750  ? 71  GLU A CG  1 
ATOM   525   C  CD  . GLU A 1 71  ? 33.52281  13.46557  17.85835  1.000 84.73735  ? 71  GLU A CD  1 
ATOM   526   O  OE1 . GLU A 1 71  ? 33.33369  14.05640  16.77369  1.000 90.25324  ? 71  GLU A OE1 1 
ATOM   527   O  OE2 . GLU A 1 71  ? 34.13898  13.98114  18.81501  1.000 86.58654  ? 71  GLU A OE2 1 
ATOM   528   N  N   . VAL A 1 72  ? 28.16375  12.28231  18.41151  1.000 82.87207  ? 72  VAL A N   1 
ATOM   529   C  CA  . VAL A 1 72  ? 26.81002  12.17605  17.87840  1.000 76.15392  ? 72  VAL A CA  1 
ATOM   530   C  C   . VAL A 1 72  ? 26.24426  13.57056  17.63928  1.000 76.16274  ? 72  VAL A C   1 
ATOM   531   O  O   . VAL A 1 72  ? 26.23424  14.41800  18.54069  1.000 86.02940  ? 72  VAL A O   1 
ATOM   532   C  CB  . VAL A 1 72  ? 25.91831  11.36583  18.83132  1.000 77.81654  ? 72  VAL A CB  1 
ATOM   533   C  CG1 . VAL A 1 72  ? 24.47370  11.37837  18.35179  1.000 76.44516  ? 72  VAL A CG1 1 
ATOM   534   C  CG2 . VAL A 1 72  ? 26.43290  9.93893   18.95705  1.000 77.68068  ? 72  VAL A CG2 1 
ATOM   535   N  N   . LYS A 1 73  ? 25.75077  13.80948  16.42379  1.000 79.37240  ? 73  LYS A N   1 
ATOM   536   C  CA  . LYS A 1 73  ? 25.30212  15.13092  15.99955  1.000 82.73682  ? 73  LYS A CA  1 
ATOM   537   C  C   . LYS A 1 73  ? 23.79399  15.26169  15.86456  1.000 92.73050  ? 73  LYS A C   1 
ATOM   538   O  O   . LYS A 1 73  ? 23.25606  16.33258  16.15365  1.000 84.69346  ? 73  LYS A O   1 
ATOM   539   C  CB  . LYS A 1 73  ? 25.93208  15.50540  14.64890  1.000 78.02225  ? 73  LYS A CB  1 
ATOM   540   C  CG  . LYS A 1 73  ? 27.44175  15.67539  14.64583  1.000 82.65637  ? 73  LYS A CG  1 
ATOM   541   C  CD  . LYS A 1 73  ? 27.84519  16.83800  15.53996  1.000 95.94415  ? 73  LYS A CD  1 
ATOM   542   C  CE  . LYS A 1 73  ? 29.34773  17.06631  15.53083  1.000 95.71184  ? 73  LYS A CE  1 
ATOM   543   N  NZ  . LYS A 1 73  ? 29.74224  18.13726  16.49261  1.000 100.12250 ? 73  LYS A NZ  1 
ATOM   544   N  N   . ASP A 1 74  ? 23.09680  14.20341  15.45610  1.000 92.69396  ? 74  ASP A N   1 
ATOM   545   C  CA  . ASP A 1 74  ? 21.67938  14.28790  15.13446  1.000 80.57236  ? 74  ASP A CA  1 
ATOM   546   C  C   . ASP A 1 74  ? 20.77723  13.75301  16.23711  1.000 82.13411  ? 74  ASP A C   1 
ATOM   547   O  O   . ASP A 1 74  ? 19.55333  13.76243  16.07233  1.000 76.65130  ? 74  ASP A O   1 
ATOM   548   C  CB  . ASP A 1 74  ? 21.38929  13.53706  13.83003  1.000 72.53682  ? 74  ASP A CB  1 
ATOM   549   C  CG  . ASP A 1 74  ? 22.04193  14.18765  12.62642  1.000 89.62779  ? 74  ASP A CG  1 
ATOM   550   O  OD1 . ASP A 1 74  ? 22.39995  15.38119  12.71849  1.000 94.22578  ? 74  ASP A OD1 1 
ATOM   551   O  OD2 . ASP A 1 74  ? 22.18667  13.51125  11.58489  1.000 89.25101  ? 74  ASP A OD2 1 
ATOM   552   N  N   . PHE A 1 75  ? 21.33840  13.29179  17.35181  1.000 74.69038  ? 75  PHE A N   1 
ATOM   553   C  CA  . PHE A 1 75  ? 20.53311  12.73285  18.42576  1.000 76.82838  ? 75  PHE A CA  1 
ATOM   554   C  C   . PHE A 1 75  ? 21.06525  13.20177  19.77032  1.000 85.61290  ? 75  PHE A C   1 
ATOM   555   O  O   . PHE A 1 75  ? 22.27965  13.26109  19.98317  1.000 87.72515  ? 75  PHE A O   1 
ATOM   556   C  CB  . PHE A 1 75  ? 20.51021  11.20079  18.36175  1.000 75.93958  ? 75  PHE A CB  1 
ATOM   557   C  CG  . PHE A 1 75  ? 19.87396  10.66329  17.11366  1.000 80.57763  ? 75  PHE A CG  1 
ATOM   558   C  CD1 . PHE A 1 75  ? 18.49883  10.52247  17.02839  1.000 72.99527  ? 75  PHE A CD1 1 
ATOM   559   C  CD2 . PHE A 1 75  ? 20.64884  10.30942  16.02089  1.000 77.80743  ? 75  PHE A CD2 1 
ATOM   560   C  CE1 . PHE A 1 75  ? 17.90879  10.03690  15.88059  1.000 69.59334  ? 75  PHE A CE1 1 
ATOM   561   C  CE2 . PHE A 1 75  ? 20.06397  9.82204   14.86983  1.000 70.59077  ? 75  PHE A CE2 1 
ATOM   562   C  CZ  . PHE A 1 75  ? 18.69089  9.68724   14.79982  1.000 69.97444  ? 75  PHE A CZ  1 
ATOM   563   N  N   . LYS A 1 76  ? 20.14737  13.54002  20.66452  1.000 82.57454  ? 76  LYS A N   1 
ATOM   564   C  CA  . LYS A 1 76  ? 20.43959  14.04869  21.99356  1.000 86.11561  ? 76  LYS A CA  1 
ATOM   565   C  C   . LYS A 1 76  ? 19.59952  13.28628  23.00287  1.000 88.22274  ? 76  LYS A C   1 
ATOM   566   O  O   . LYS A 1 76  ? 18.61875  12.63049  22.63347  1.000 95.97566  ? 76  LYS A O   1 
ATOM   567   C  CB  . LYS A 1 76  ? 20.13266  15.55122  22.09783  1.000 88.89159  ? 76  LYS A CB  1 
ATOM   568   C  CG  . LYS A 1 76  ? 18.69439  15.92129  21.75607  1.000 94.06720  ? 76  LYS A CG  1 
ATOM   569   C  CD  . LYS A 1 76  ? 18.51027  17.43043  21.66407  1.000 87.61088  ? 76  LYS A CD  1 
ATOM   570   C  CE  . LYS A 1 76  ? 17.17059  17.79186  21.03778  1.000 93.05351  ? 76  LYS A CE  1 
ATOM   571   N  NZ  . LYS A 1 76  ? 16.02201  17.25457  21.81906  1.000 92.52849  ? 76  LYS A NZ  1 
ATOM   572   N  N   . PRO A 1 77  ? 19.97308  13.32220  24.28140  1.000 91.49838  ? 77  PRO A N   1 
ATOM   573   C  CA  . PRO A 1 77  ? 19.12396  12.70250  25.30687  1.000 101.31403 ? 77  PRO A CA  1 
ATOM   574   C  C   . PRO A 1 77  ? 17.72508  13.30382  25.28657  1.000 94.18041  ? 77  PRO A C   1 
ATOM   575   O  O   . PRO A 1 77  ? 17.55398  14.52430  25.25093  1.000 94.77031  ? 77  PRO A O   1 
ATOM   576   C  CB  . PRO A 1 77  ? 19.86323  13.01446  26.61185  1.000 97.45337  ? 77  PRO A CB  1 
ATOM   577   C  CG  . PRO A 1 77  ? 21.29034  13.13589  26.20155  1.000 96.42427  ? 77  PRO A CG  1 
ATOM   578   C  CD  . PRO A 1 77  ? 21.26831  13.76111  24.83282  1.000 94.66798  ? 77  PRO A CD  1 
ATOM   579   N  N   . GLY A 1 78  ? 16.71964  12.43244  25.29932  1.000 93.85048  ? 78  GLY A N   1 
ATOM   580   C  CA  . GLY A 1 78  ? 15.33658  12.84912  25.23387  1.000 94.03313  ? 78  GLY A CA  1 
ATOM   581   C  C   . GLY A 1 78  ? 14.66294  12.63344  23.89458  1.000 90.50002  ? 78  GLY A C   1 
ATOM   582   O  O   . GLY A 1 78  ? 13.43583  12.76693  23.81356  1.000 90.54151  ? 78  GLY A O   1 
ATOM   583   N  N   . ASP A 1 79  ? 15.41881  12.31492  22.84586  1.000 88.88115  ? 79  ASP A N   1 
ATOM   584   C  CA  . ASP A 1 79  ? 14.81875  12.08433  21.53913  1.000 84.19432  ? 79  ASP A CA  1 
ATOM   585   C  C   . ASP A 1 79  ? 14.11244  10.73342  21.48708  1.000 83.49157  ? 79  ASP A C   1 
ATOM   586   O  O   . ASP A 1 79  ? 14.54976  9.74755   22.08685  1.000 84.53648  ? 79  ASP A O   1 
ATOM   587   C  CB  . ASP A 1 79  ? 15.87409  12.16068  20.43490  1.000 85.71931  ? 79  ASP A CB  1 
ATOM   588   C  CG  . ASP A 1 79  ? 16.39542  13.56925  20.21965  1.000 89.75590  ? 79  ASP A CG  1 
ATOM   589   O  OD1 . ASP A 1 79  ? 15.74055  14.52532  20.68509  1.000 95.11888  ? 79  ASP A OD1 1 
ATOM   590   O  OD2 . ASP A 1 79  ? 17.45687  13.72167  19.57858  1.000 85.56455  ? 79  ASP A OD2 1 
ATOM   591   N  N   . ARG A 1 80  ? 13.00903  10.70244  20.74769  1.000 85.32717  ? 80  ARG A N   1 
ATOM   592   C  CA  . ARG A 1 80  ? 12.19896  9.50745   20.55431  1.000 86.16356  ? 80  ARG A CA  1 
ATOM   593   C  C   . ARG A 1 80  ? 12.60868  8.86398   19.23259  1.000 89.20885  ? 80  ARG A C   1 
ATOM   594   O  O   . ARG A 1 80  ? 12.42806  9.46545   18.16768  1.000 89.00499  ? 80  ARG A O   1 
ATOM   595   C  CB  . ARG A 1 80  ? 10.71793  9.88568   20.54922  1.000 92.91325  ? 80  ARG A CB  1 
ATOM   596   C  CG  . ARG A 1 80  ? 9.75670   8.81537   21.00958  1.000 103.52209 ? 80  ARG A CG  1 
ATOM   597   C  CD  . ARG A 1 80  ? 8.36160   9.40977   21.13515  1.000 98.36868  ? 80  ARG A CD  1 
ATOM   598   N  NE  . ARG A 1 80  ? 7.37904   8.43911   21.59866  1.000 106.63490 ? 80  ARG A NE  1 
ATOM   599   C  CZ  . ARG A 1 80  ? 7.16219   8.14633   22.87334  1.000 101.99386 ? 80  ARG A CZ  1 
ATOM   600   N  NH1 . ARG A 1 80  ? 7.86180   8.71454   23.84108  1.000 91.32015  ? 80  ARG A NH1 1 
ATOM   601   N  NH2 . ARG A 1 80  ? 6.22048   7.26030   23.18455  1.000 109.13587 ? 80  ARG A NH2 1 
ATOM   602   N  N   . VAL A 1 81  ? 13.16052  7.64994   19.29455  1.000 86.52436  ? 81  VAL A N   1 
ATOM   603   C  CA  . VAL A 1 81  ? 13.80366  7.05171   18.13114  1.000 80.74363  ? 81  VAL A CA  1 
ATOM   604   C  C   . VAL A 1 81  ? 13.25376  5.65888   17.85161  1.000 74.56909  ? 81  VAL A C   1 
ATOM   605   O  O   . VAL A 1 81  ? 12.82280  4.93788   18.75695  1.000 74.90193  ? 81  VAL A O   1 
ATOM   606   C  CB  . VAL A 1 81  ? 15.33895  6.98830   18.30342  1.000 74.16989  ? 81  VAL A CB  1 
ATOM   607   C  CG1 . VAL A 1 81  ? 15.92535  8.38924   18.35272  1.000 74.72215  ? 81  VAL A CG1 1 
ATOM   608   C  CG2 . VAL A 1 81  ? 15.70619  6.20007   19.55200  1.000 76.97350  ? 81  VAL A CG2 1 
ATOM   609   N  N   . VAL A 1 82  ? 13.26949  5.29016   16.57109  1.000 69.75150  ? 82  VAL A N   1 
ATOM   610   C  CA  . VAL A 1 82  ? 13.05559  3.91895   16.12165  1.000 68.36166  ? 82  VAL A CA  1 
ATOM   611   C  C   . VAL A 1 82  ? 14.41703  3.27814   15.89571  1.000 67.67273  ? 82  VAL A C   1 
ATOM   612   O  O   . VAL A 1 82  ? 15.26414  3.84142   15.19219  1.000 66.12851  ? 82  VAL A O   1 
ATOM   613   C  CB  . VAL A 1 82  ? 12.21033  3.87461   14.83830  1.000 65.42670  ? 82  VAL A CB  1 
ATOM   614   C  CG1 . VAL A 1 82  ? 12.06061  2.44112   14.35812  1.000 64.09337  ? 82  VAL A CG1 1 
ATOM   615   C  CG2 . VAL A 1 82  ? 10.85387  4.51190   15.07332  1.000 68.29380  ? 82  VAL A CG2 1 
ATOM   616   N  N   . VAL A 1 83  ? 14.63744  2.11506   16.49160  1.000 68.92946  ? 83  VAL A N   1 
ATOM   617   C  CA  . VAL A 1 83  ? 15.92387  1.42844   16.42283  1.000 72.89436  ? 83  VAL A CA  1 
ATOM   618   C  C   . VAL A 1 83  ? 15.78311  0.25556   15.45824  1.000 66.43857  ? 83  VAL A C   1 
ATOM   619   O  O   . VAL A 1 83  ? 15.01374  -0.67333  15.73380  1.000 67.06894  ? 83  VAL A O   1 
ATOM   620   C  CB  . VAL A 1 83  ? 16.38705  0.95027   17.80863  1.000 72.03603  ? 83  VAL A CB  1 
ATOM   621   C  CG1 . VAL A 1 83  ? 17.79287  0.37126   17.72998  1.000 71.92895  ? 83  VAL A CG1 1 
ATOM   622   C  CG2 . VAL A 1 83  ? 16.32623  2.09270   18.81117  1.000 74.51423  ? 83  VAL A CG2 1 
ATOM   623   N  N   . PRO A 1 84  ? 16.49723  0.24973   14.33397  1.000 65.56937  ? 84  PRO A N   1 
ATOM   624   C  CA  . PRO A 1 84  ? 16.41753  -0.88699  13.41019  1.000 66.85064  ? 84  PRO A CA  1 
ATOM   625   C  C   . PRO A 1 84  ? 17.03198  -2.14275  14.00360  1.000 64.56913  ? 84  PRO A C   1 
ATOM   626   O  O   . PRO A 1 84  ? 17.99790  -2.09002  14.76863  1.000 73.16444  ? 84  PRO A O   1 
ATOM   627   C  CB  . PRO A 1 84  ? 17.21519  -0.40878  12.19223  1.000 59.17437  ? 84  PRO A CB  1 
ATOM   628   C  CG  . PRO A 1 84  ? 18.16040  0.60776   12.74675  1.000 60.49726  ? 84  PRO A CG  1 
ATOM   629   C  CD  . PRO A 1 84  ? 17.39442  1.30346   13.83405  1.000 65.14182  ? 84  PRO A CD  1 
ATOM   630   N  N   . ALA A 1 85  ? 16.46093  -3.28957  13.62674  1.000 62.53665  ? 85  ALA A N   1 
ATOM   631   C  CA  . ALA A 1 85  ? 17.01398  -4.56405  14.07171  1.000 65.65675  ? 85  ALA A CA  1 
ATOM   632   C  C   . ALA A 1 85  ? 18.43268  -4.77102  13.55917  1.000 67.09994  ? 85  ALA A C   1 
ATOM   633   O  O   . ALA A 1 85  ? 19.26444  -5.36725  14.25316  1.000 80.31784  ? 85  ALA A O   1 
ATOM   634   C  CB  . ALA A 1 85  ? 16.11413  -5.71285  13.61847  1.000 62.97550  ? 85  ALA A CB  1 
ATOM   635   N  N   . ALA A 1 86  ? 18.73237  -4.27535  12.36485  1.000 65.22996  ? 86  ALA A N   1 
ATOM   636   C  CA  . ALA A 1 86  ? 20.06827  -4.35268  11.79441  1.000 59.20715  ? 86  ALA A CA  1 
ATOM   637   C  C   . ALA A 1 86  ? 20.77301  -3.02072  12.00791  1.000 59.57274  ? 86  ALA A C   1 
ATOM   638   O  O   . ALA A 1 86  ? 20.33405  -1.99022  11.48689  1.000 61.80269  ? 86  ALA A O   1 
ATOM   639   C  CB  . ALA A 1 86  ? 20.00541  -4.70115  10.30799  1.000 67.53912  ? 86  ALA A CB  1 
ATOM   640   N  N   . THR A 1 87  ? 21.86047  -3.04388  12.77787  1.000 61.50889  ? 87  THR A N   1 
ATOM   641   C  CA  . THR A 1 87  ? 22.66425  -1.85985  13.07087  1.000 67.69014  ? 87  THR A CA  1 
ATOM   642   C  C   . THR A 1 87  ? 24.08954  -2.15618  12.62168  1.000 62.93468  ? 87  THR A C   1 
ATOM   643   O  O   . THR A 1 87  ? 24.96909  -2.43380  13.45047  1.000 69.71103  ? 87  THR A O   1 
ATOM   644   C  CB  . THR A 1 87  ? 22.61214  -1.50078  14.55466  1.000 65.41987  ? 87  THR A CB  1 
ATOM   645   O  OG1 . THR A 1 87  ? 23.07009  -2.61446  15.32907  1.000 74.65569  ? 87  THR A OG1 1 
ATOM   646   C  CG2 . THR A 1 87  ? 21.19042  -1.15809  14.97213  1.000 66.02376  ? 87  THR A CG2 1 
ATOM   647   N  N   . PRO A 1 88  ? 24.35546  -2.10918  11.32197  1.000 63.40569  ? 88  PRO A N   1 
ATOM   648   C  CA  . PRO A 1 88  ? 25.64894  -2.56625  10.80919  1.000 67.52661  ? 88  PRO A CA  1 
ATOM   649   C  C   . PRO A 1 88  ? 26.75597  -1.54873  11.05386  1.000 69.28648  ? 88  PRO A C   1 
ATOM   650   O  O   . PRO A 1 88  ? 26.52048  -0.38672  11.38529  1.000 69.12307  ? 88  PRO A O   1 
ATOM   651   C  CB  . PRO A 1 88  ? 25.38313  -2.74057  9.31105   1.000 61.98345  ? 88  PRO A CB  1 
ATOM   652   C  CG  . PRO A 1 88  ? 24.33521  -1.72128  9.01250   1.000 54.05162  ? 88  PRO A CG  1 
ATOM   653   C  CD  . PRO A 1 88  ? 23.45961  -1.65906  10.24013  1.000 61.53666  ? 88  PRO A CD  1 
ATOM   654   N  N   . ASP A 1 89  ? 27.98759  -2.02694  10.89691  1.000 64.25611  ? 89  ASP A N   1 
ATOM   655   C  CA  . ASP A 1 89  ? 29.15441  -1.15791  10.83575  1.000 59.49973  ? 89  ASP A CA  1 
ATOM   656   C  C   . ASP A 1 89  ? 29.21799  -0.54200  9.44335   1.000 71.93705  ? 89  ASP A C   1 
ATOM   657   O  O   . ASP A 1 89  ? 29.30380  -1.26597  8.44552   1.000 74.12173  ? 89  ASP A O   1 
ATOM   658   C  CB  . ASP A 1 89  ? 30.42147  -1.95431  11.14458  1.000 70.10399  ? 89  ASP A CB  1 
ATOM   659   C  CG  . ASP A 1 89  ? 31.68826  -1.12228  11.01933  1.000 90.07594  ? 89  ASP A CG  1 
ATOM   660   O  OD1 . ASP A 1 89  ? 31.59666  0.12396   11.03729  1.000 99.09264  ? 89  ASP A OD1 1 
ATOM   661   O  OD2 . ASP A 1 89  ? 32.78149  -1.71827  10.89872  1.000 89.32322  ? 89  ASP A OD2 1 
ATOM   662   N  N   . TRP A 1 90  ? 29.17001  0.78657   9.36800   1.000 70.22083  ? 90  TRP A N   1 
ATOM   663   C  CA  . TRP A 1 90  ? 29.05420  1.47190   8.08650   1.000 71.14007  ? 90  TRP A CA  1 
ATOM   664   C  C   . TRP A 1 90  ? 30.39799  1.81079   7.45573   1.000 67.01104  ? 90  TRP A C   1 
ATOM   665   O  O   . TRP A 1 90  ? 30.43216  2.55396   6.46932   1.000 64.26036  ? 90  TRP A O   1 
ATOM   666   C  CB  . TRP A 1 90  ? 28.21798  2.74507   8.23931   1.000 64.03529  ? 90  TRP A CB  1 
ATOM   667   C  CG  . TRP A 1 90  ? 26.76292  2.45767   8.39403   1.000 61.99373  ? 90  TRP A CG  1 
ATOM   668   C  CD1 . TRP A 1 90  ? 26.05429  2.40280   9.55867   1.000 60.60253  ? 90  TRP A CD1 1 
ATOM   669   C  CD2 . TRP A 1 90  ? 25.84074  2.14096   7.34608   1.000 62.19083  ? 90  TRP A CD2 1 
ATOM   670   N  NE1 . TRP A 1 90  ? 24.74082  2.09131   9.29775   1.000 66.01701  ? 90  TRP A NE1 1 
ATOM   671   C  CE2 . TRP A 1 90  ? 24.58498  1.92274   7.94673   1.000 60.62829  ? 90  TRP A CE2 1 
ATOM   672   C  CE3 . TRP A 1 90  ? 25.95414  2.02650   5.95626   1.000 59.35819  ? 90  TRP A CE3 1 
ATOM   673   C  CZ2 . TRP A 1 90  ? 23.45007  1.59859   7.20620   1.000 64.24030  ? 90  TRP A CZ2 1 
ATOM   674   C  CZ3 . TRP A 1 90  ? 24.82650  1.70426   5.22170   1.000 57.42812  ? 90  TRP A CZ3 1 
ATOM   675   C  CH2 . TRP A 1 90  ? 23.59099  1.49457   5.84782   1.000 63.51702  ? 90  TRP A CH2 1 
ATOM   676   N  N   . ARG A 1 91  ? 31.49997  1.27208   7.97918   1.000 67.03971  ? 91  ARG A N   1 
ATOM   677   C  CA  . ARG A 1 91  ? 32.83575  1.58118   7.47564   1.000 70.17421  ? 91  ARG A CA  1 
ATOM   678   C  C   . ARG A 1 91  ? 33.58149  0.27537   7.17127   1.000 65.17279  ? 91  ARG A C   1 
ATOM   679   O  O   . ARG A 1 91  ? 34.58685  -0.05540  7.80136   1.000 72.78274  ? 91  ARG A O   1 
ATOM   680   C  CB  . ARG A 1 91  ? 33.59578  2.46061   8.46704   1.000 67.41762  ? 91  ARG A CB  1 
ATOM   681   C  CG  . ARG A 1 91  ? 32.97099  3.83983   8.64001   1.000 62.15212  ? 91  ARG A CG  1 
ATOM   682   C  CD  . ARG A 1 91  ? 33.78698  4.72311   9.56183   1.000 65.04633  ? 91  ARG A CD  1 
ATOM   683   N  NE  . ARG A 1 91  ? 35.19124  4.75704   9.17328   1.000 65.97995  ? 91  ARG A NE  1 
ATOM   684   C  CZ  . ARG A 1 91  ? 36.16956  4.18043   9.85755   1.000 73.98225  ? 91  ARG A CZ  1 
ATOM   685   N  NH1 . ARG A 1 91  ? 35.93654  3.55167   10.99938  1.000 75.63972  ? 91  ARG A NH1 1 
ATOM   686   N  NH2 . ARG A 1 91  ? 37.41241  4.23744   9.38584   1.000 71.45513  ? 91  ARG A NH2 1 
ATOM   687   N  N   . THR A 1 92  ? 33.07444  -0.46436  6.18636   1.000 61.61990  ? 92  THR A N   1 
ATOM   688   C  CA  . THR A 1 92  ? 33.69737  -1.68500  5.69171   1.000 65.88172  ? 92  THR A CA  1 
ATOM   689   C  C   . THR A 1 92  ? 33.58934  -1.70178  4.17231   1.000 80.95061  ? 92  THR A C   1 
ATOM   690   O  O   . THR A 1 92  ? 32.94324  -0.84348  3.56588   1.000 79.56074  ? 92  THR A O   1 
ATOM   691   C  CB  . THR A 1 92  ? 33.04724  -2.94879  6.27532   1.000 73.21247  ? 92  THR A CB  1 
ATOM   692   O  OG1 . THR A 1 92  ? 31.65953  -2.98074  5.91825   1.000 83.08234  ? 92  THR A OG1 1 
ATOM   693   C  CG2 . THR A 1 92  ? 33.18319  -2.99030  7.79258   1.000 68.04092  ? 92  THR A CG2 1 
ATOM   694   N  N   . SER A 1 93  ? 34.22831  -2.69850  3.55224   1.000 92.07192  ? 93  SER A N   1 
ATOM   695   C  CA  . SER A 1 93  ? 34.15830  -2.82177  2.09835   1.000 81.63850  ? 93  SER A CA  1 
ATOM   696   C  C   . SER A 1 93  ? 32.78003  -3.27546  1.63069   1.000 79.93307  ? 93  SER A C   1 
ATOM   697   O  O   . SER A 1 93  ? 32.32047  -2.84752  0.56596   1.000 74.62047  ? 93  SER A O   1 
ATOM   698   C  CB  . SER A 1 93  ? 35.22845  -3.79148  1.59505   1.000 84.61285  ? 93  SER A CB  1 
ATOM   699   O  OG  . SER A 1 93  ? 35.03855  -5.09176  2.12522   1.000 95.81182  ? 93  SER A OG  1 
ATOM   700   N  N   . GLU A 1 94  ? 32.10818  -4.13778  2.40145   1.000 94.21947  ? 94  GLU A N   1 
ATOM   701   C  CA  . GLU A 1 94  ? 30.78651  -4.61728  2.00674   1.000 96.96662  ? 94  GLU A CA  1 
ATOM   702   C  C   . GLU A 1 94  ? 29.75367  -3.49851  1.96230   1.000 90.65065  ? 94  GLU A C   1 
ATOM   703   O  O   . GLU A 1 94  ? 28.75747  -3.61918  1.24012   1.000 86.95895  ? 94  GLU A O   1 
ATOM   704   C  CB  . GLU A 1 94  ? 30.30897  -5.72196  2.95368   1.000 85.49571  ? 94  GLU A CB  1 
ATOM   705   C  CG  . GLU A 1 94  ? 31.10068  -7.01854  2.86429   1.000 91.26794  ? 94  GLU A CG  1 
ATOM   706   C  CD  . GLU A 1 94  ? 32.31012  -7.03885  3.78222   1.000 102.54828 ? 94  GLU A CD  1 
ATOM   707   O  OE1 . GLU A 1 94  ? 32.66964  -5.97155  4.32375   1.000 99.78996  ? 94  GLU A OE1 1 
ATOM   708   O  OE2 . GLU A 1 94  ? 32.89701  -8.12739  3.96766   1.000 107.70799 ? 94  GLU A OE2 1 
ATOM   709   N  N   . VAL A 1 95  ? 29.96189  -2.42173  2.72232   1.000 83.47542  ? 95  VAL A N   1 
ATOM   710   C  CA  . VAL A 1 95  ? 29.06919  -1.27143  2.63563   1.000 74.99411  ? 95  VAL A CA  1 
ATOM   711   C  C   . VAL A 1 95  ? 29.27739  -0.54005  1.31629   1.000 68.72772  ? 95  VAL A C   1 
ATOM   712   O  O   . VAL A 1 95  ? 28.31856  -0.06880  0.69182   1.000 70.67125  ? 95  VAL A O   1 
ATOM   713   C  CB  . VAL A 1 95  ? 29.28069  -0.34280  3.84509   1.000 65.47560  ? 95  VAL A CB  1 
ATOM   714   C  CG1 . VAL A 1 95  ? 28.55961  0.98236   3.64113   1.000 69.67451  ? 95  VAL A CG1 1 
ATOM   715   C  CG2 . VAL A 1 95  ? 28.80031  -1.02159  5.11174   1.000 72.46750  ? 95  VAL A CG2 1 
ATOM   716   N  N   . GLN A 1 96  ? 30.52975  -0.44458  0.86336   1.000 66.26720  ? 96  GLN A N   1 
ATOM   717   C  CA  . GLN A 1 96  ? 30.80943  0.17306   -0.42647  1.000 66.00355  ? 96  GLN A CA  1 
ATOM   718   C  C   . GLN A 1 96  ? 30.27663  -0.65387  -1.59070  1.000 59.06125  ? 96  GLN A C   1 
ATOM   719   O  O   . GLN A 1 96  ? 30.07877  -0.10584  -2.67903  1.000 67.50491  ? 96  GLN A O   1 
ATOM   720   C  CB  . GLN A 1 96  ? 32.31522  0.40451   -0.58182  1.000 60.42564  ? 96  GLN A CB  1 
ATOM   721   C  CG  . GLN A 1 96  ? 32.92913  1.24905   0.52812   1.000 53.97226  ? 96  GLN A CG  1 
ATOM   722   C  CD  . GLN A 1 96  ? 34.32723  1.75098   0.19403   1.000 53.66500  ? 96  GLN A CD  1 
ATOM   723   O  OE1 . GLN A 1 96  ? 34.69755  1.87062   -0.97276  1.000 58.29672  ? 96  GLN A OE1 1 
ATOM   724   N  NE2 . GLN A 1 96  ? 35.10666  2.05385   1.22252   1.000 47.91286  ? 96  GLN A NE2 1 
ATOM   725   N  N   . ARG A 1 97  ? 30.02936  -1.95186  -1.38647  1.000 77.74528  ? 97  ARG A N   1 
ATOM   726   C  CA  . ARG A 1 97  ? 29.40141  -2.78814  -2.40458  1.000 73.05481  ? 97  ARG A CA  1 
ATOM   727   C  C   . ARG A 1 97  ? 27.88288  -2.67968  -2.41183  1.000 74.07316  ? 97  ARG A C   1 
ATOM   728   O  O   . ARG A 1 97  ? 27.24972  -3.18539  -3.34449  1.000 85.54748  ? 97  ARG A O   1 
ATOM   729   C  CB  . ARG A 1 97  ? 29.78919  -4.25946  -2.20955  1.000 81.07218  ? 97  ARG A CB  1 
ATOM   730   C  CG  . ARG A 1 97  ? 31.19403  -4.61174  -2.66667  1.000 74.21258  ? 97  ARG A CG  1 
ATOM   731   C  CD  . ARG A 1 97  ? 31.38977  -6.11545  -2.82982  1.000 70.38350  ? 97  ARG A CD  1 
ATOM   732   N  NE  . ARG A 1 97  ? 31.20993  -6.84519  -1.57985  1.000 83.79472  ? 97  ARG A NE  1 
ATOM   733   C  CZ  . ARG A 1 97  ? 30.21554  -7.69094  -1.34318  1.000 85.86021  ? 97  ARG A CZ  1 
ATOM   734   N  NH1 . ARG A 1 97  ? 29.29132  -7.94457  -2.25712  1.000 74.47823  ? 97  ARG A NH1 1 
ATOM   735   N  NH2 . ARG A 1 97  ? 30.14935  -8.30155  -0.16205  1.000 66.74245  ? 97  ARG A NH2 1 
ATOM   736   N  N   . GLY A 1 98  ? 27.28704  -2.04433  -1.40663  1.000 73.73567  ? 98  GLY A N   1 
ATOM   737   C  CA  . GLY A 1 98  ? 25.84765  -1.88486  -1.35755  1.000 75.22660  ? 98  GLY A CA  1 
ATOM   738   C  C   . GLY A 1 98  ? 25.09514  -2.94895  -0.59209  1.000 77.52496  ? 98  GLY A C   1 
ATOM   739   O  O   . GLY A 1 98  ? 23.89027  -3.11353  -0.81727  1.000 81.57612  ? 98  GLY A O   1 
ATOM   740   N  N   . TYR A 1 99  ? 25.76382  -3.68436  0.30376   1.000 73.04221  ? 99  TYR A N   1 
ATOM   741   C  CA  . TYR A 1 99  ? 25.13844  -4.73498  1.11529   1.000 69.90900  ? 99  TYR A CA  1 
ATOM   742   C  C   . TYR A 1 99  ? 25.55166  -4.52040  2.56751   1.000 68.60235  ? 99  TYR A C   1 
ATOM   743   O  O   . TYR A 1 99  ? 26.40760  -5.23446  3.09541   1.000 67.17451  ? 99  TYR A O   1 
ATOM   744   C  CB  . TYR A 1 99  ? 25.51164  -6.12942  0.60850   1.000 51.93552  ? 99  TYR A CB  1 
ATOM   745   C  CG  . TYR A 1 99  ? 24.83558  -6.47651  -0.69261  1.000 68.52451  ? 99  TYR A CG  1 
ATOM   746   C  CD1 . TYR A 1 99  ? 23.53972  -6.97545  -0.70477  1.000 66.07622  ? 99  TYR A CD1 1 
ATOM   747   C  CD2 . TYR A 1 99  ? 25.47772  -6.28588  -1.90929  1.000 68.03112  ? 99  TYR A CD2 1 
ATOM   748   C  CE1 . TYR A 1 99  ? 22.90382  -7.28616  -1.89019  1.000 63.70328  ? 99  TYR A CE1 1 
ATOM   749   C  CE2 . TYR A 1 99  ? 24.84923  -6.59475  -3.10288  1.000 67.46849  ? 99  TYR A CE2 1 
ATOM   750   C  CZ  . TYR A 1 99  ? 23.56123  -7.09505  -3.08613  1.000 65.67301  ? 99  TYR A CZ  1 
ATOM   751   O  OH  . TYR A 1 99  ? 22.92320  -7.40680  -4.26621  1.000 69.45046  ? 99  TYR A OH  1 
ATOM   752   N  N   . HIS A 1 100 ? 24.93417  -3.52453  3.20987   1.000 68.30677  ? 100 HIS A N   1 
ATOM   753   C  CA  . HIS A 1 100 ? 25.24980  -3.23568  4.60553   1.000 69.31776  ? 100 HIS A CA  1 
ATOM   754   C  C   . HIS A 1 100 ? 24.82711  -4.37273  5.53137   1.000 65.41241  ? 100 HIS A C   1 
ATOM   755   O  O   . HIS A 1 100 ? 25.40457  -4.53127  6.61301   1.000 66.59883  ? 100 HIS A O   1 
ATOM   756   C  CB  . HIS A 1 100 ? 24.59952  -1.91571  5.03164   1.000 59.68352  ? 100 HIS A CB  1 
ATOM   757   C  CG  . HIS A 1 100 ? 23.10116  -1.93509  5.00417   1.000 68.35454  ? 100 HIS A CG  1 
ATOM   758   N  ND1 . HIS A 1 100 ? 22.36902  -1.40573  3.96265   1.000 62.93540  ? 100 HIS A ND1 1 
ATOM   759   C  CD2 . HIS A 1 100 ? 22.19764  -2.40431  5.89797   1.000 58.39508  ? 100 HIS A CD2 1 
ATOM   760   C  CE1 . HIS A 1 100 ? 21.08010  -1.55710  4.21111   1.000 61.03801  ? 100 HIS A CE1 1 
ATOM   761   N  NE2 . HIS A 1 100 ? 20.94913  -2.15979  5.37916   1.000 58.87658  ? 100 HIS A NE2 1 
ATOM   762   N  N   . GLN A 1 101 ? 23.82941  -5.17023  5.13340   1.000 66.44370  ? 101 GLN A N   1 
ATOM   763   C  CA  . GLN A 1 101 ? 23.42798  -6.31432  5.94673   1.000 67.93917  ? 101 GLN A CA  1 
ATOM   764   C  C   . GLN A 1 101 ? 24.57403  -7.28984  6.17386   1.000 65.26062  ? 101 GLN A C   1 
ATOM   765   O  O   . GLN A 1 101 ? 24.56151  -8.02494  7.16756   1.000 61.62460  ? 101 GLN A O   1 
ATOM   766   C  CB  . GLN A 1 101 ? 22.25618  -7.05584  5.29662   1.000 67.29581  ? 101 GLN A CB  1 
ATOM   767   C  CG  . GLN A 1 101 ? 21.00407  -6.22196  5.10021   1.000 58.91547  ? 101 GLN A CG  1 
ATOM   768   C  CD  . GLN A 1 101 ? 20.90034  -5.65464  3.70331   1.000 61.03017  ? 101 GLN A CD  1 
ATOM   769   O  OE1 . GLN A 1 101 ? 21.87642  -5.13960  3.15738   1.000 66.07326  ? 101 GLN A OE1 1 
ATOM   770   N  NE2 . GLN A 1 101 ? 19.71420  -5.74977  3.11173   1.000 58.90690  ? 101 GLN A NE2 1 
ATOM   771   N  N   . HIS A 1 102 ? 25.56831  -7.30311  5.28687   1.000 61.79844  ? 102 HIS A N   1 
ATOM   772   C  CA  . HIS A 1 102 ? 26.70452  -8.20800  5.39159   1.000 66.75954  ? 102 HIS A CA  1 
ATOM   773   C  C   . HIS A 1 102 ? 28.00242  -7.44547  5.62123   1.000 71.31276  ? 102 HIS A C   1 
ATOM   774   O  O   . HIS A 1 102 ? 29.07794  -7.90194  5.22866   1.000 68.19041  ? 102 HIS A O   1 
ATOM   775   C  CB  . HIS A 1 102 ? 26.80730  -9.08684  4.14782   1.000 59.53117  ? 102 HIS A CB  1 
ATOM   776   C  CG  . HIS A 1 102 ? 25.51160  -9.72492  3.76385   1.000 59.35836  ? 102 HIS A CG  1 
ATOM   777   N  ND1 . HIS A 1 102 ? 24.94033  -10.74130 4.49841   1.000 67.82071  ? 102 HIS A ND1 1 
ATOM   778   C  CD2 . HIS A 1 102 ? 24.66666  -9.48231  2.73413   1.000 59.70685  ? 102 HIS A CD2 1 
ATOM   779   C  CE1 . HIS A 1 102 ? 23.80197  -11.10212 3.93443   1.000 65.96676  ? 102 HIS A CE1 1 
ATOM   780   N  NE2 . HIS A 1 102 ? 23.61356  -10.35527 2.86105   1.000 62.63088  ? 102 HIS A NE2 1 
ATOM   781   N  N   . SER A 1 103 ? 27.90564  -6.27900  6.25537   1.000 71.09746  ? 103 SER A N   1 
ATOM   782   C  CA  . SER A 1 103 ? 29.07127  -5.45570  6.55648   1.000 66.53279  ? 103 SER A CA  1 
ATOM   783   C  C   . SER A 1 103 ? 29.93742  -6.15844  7.59363   1.000 74.81369  ? 103 SER A C   1 
ATOM   784   O  O   . SER A 1 103 ? 29.57655  -6.21936  8.77359   1.000 86.08977  ? 103 SER A O   1 
ATOM   785   C  CB  . SER A 1 103 ? 28.62253  -4.08716  7.05746   1.000 70.23310  ? 103 SER A CB  1 
ATOM   786   O  OG  . SER A 1 103 ? 29.73256  -3.27497  7.39215   1.000 75.34827  ? 103 SER A OG  1 
ATOM   787   N  N   . GLY A 1 104 ? 31.08063  -6.68563  7.16205   1.000 76.01231  ? 104 GLY A N   1 
ATOM   788   C  CA  . GLY A 1 104 ? 31.97447  -7.39492  8.05441   1.000 79.63192  ? 104 GLY A CA  1 
ATOM   789   C  C   . GLY A 1 104 ? 31.77964  -8.89343  8.11691   1.000 78.65122  ? 104 GLY A C   1 
ATOM   790   O  O   . GLY A 1 104 ? 32.35533  -9.53765  9.00235   1.000 80.67708  ? 104 GLY A O   1 
ATOM   791   N  N   . GLY A 1 105 ? 30.98957  -9.46827  7.21301   1.000 76.02230  ? 105 GLY A N   1 
ATOM   792   C  CA  . GLY A 1 105 ? 30.72739  -10.89434 7.21365   1.000 71.21544  ? 105 GLY A CA  1 
ATOM   793   C  C   . GLY A 1 105 ? 29.28105  -11.21773 6.89884   1.000 71.22174  ? 105 GLY A C   1 
ATOM   794   O  O   . GLY A 1 105 ? 28.42739  -10.32690 6.91128   1.000 67.37673  ? 105 GLY A O   1 
ATOM   795   N  N   . MET A 1 106 ? 28.99214  -12.48632 6.61499   1.000 68.26821  ? 106 MET A N   1 
ATOM   796   C  CA  . MET A 1 106 ? 27.63230  -12.88788 6.27809   1.000 61.50540  ? 106 MET A CA  1 
ATOM   797   C  C   . MET A 1 106 ? 26.69019  -12.63066 7.44814   1.000 67.72178  ? 106 MET A C   1 
ATOM   798   O  O   . MET A 1 106 ? 26.92962  -13.09595 8.56655   1.000 64.47457  ? 106 MET A O   1 
ATOM   799   C  CB  . MET A 1 106 ? 27.60684  -14.36492 5.88774   1.000 64.93129  ? 106 MET A CB  1 
ATOM   800   C  CG  . MET A 1 106 ? 26.32521  -14.80766 5.20667   1.000 70.13166  ? 106 MET A CG  1 
ATOM   801   S  SD  . MET A 1 106 ? 26.46620  -16.47692 4.54490   1.000 84.20503  ? 106 MET A SD  1 
ATOM   802   C  CE  . MET A 1 106 ? 27.88965  -16.30402 3.46976   1.000 68.85158  ? 106 MET A CE  1 
ATOM   803   N  N   . LEU A 1 107 ? 25.62060  -11.87605 7.18205   1.000 66.96610  ? 107 LEU A N   1 
ATOM   804   C  CA  . LEU A 1 107 ? 24.60275  -11.50736 8.16860   1.000 69.33706  ? 107 LEU A CA  1 
ATOM   805   C  C   . LEU A 1 107 ? 25.16290  -10.64762 9.30110   1.000 70.96050  ? 107 LEU A C   1 
ATOM   806   O  O   . LEU A 1 107 ? 24.51689  -10.49541 10.34367  1.000 75.69504  ? 107 LEU A O   1 
ATOM   807   C  CB  . LEU A 1 107 ? 23.90711  -12.74679 8.75021   1.000 70.95534  ? 107 LEU A CB  1 
ATOM   808   C  CG  . LEU A 1 107 ? 23.36103  -13.78127 7.76162   1.000 77.10354  ? 107 LEU A CG  1 
ATOM   809   C  CD1 . LEU A 1 107 ? 22.71742  -14.94459 8.50549   1.000 71.82446  ? 107 LEU A CD1 1 
ATOM   810   C  CD2 . LEU A 1 107 ? 22.38074  -13.14696 6.78884   1.000 66.82864  ? 107 LEU A CD2 1 
ATOM   811   N  N   . ALA A 1 108 ? 26.35262  -10.06835 9.11879   1.000 70.78306  ? 108 ALA A N   1 
ATOM   812   C  CA  . ALA A 1 108 ? 27.00449  -9.32320  10.19136  1.000 71.01102  ? 108 ALA A CA  1 
ATOM   813   C  C   . ALA A 1 108 ? 26.34655  -7.97959  10.48480  1.000 66.55037  ? 108 ALA A C   1 
ATOM   814   O  O   . ALA A 1 108 ? 26.68291  -7.36054  11.50017  1.000 69.97782  ? 108 ALA A O   1 
ATOM   815   C  CB  . ALA A 1 108 ? 28.48265  -9.10951  9.86216   1.000 70.13124  ? 108 ALA A CB  1 
ATOM   816   N  N   . GLY A 1 109 ? 25.43428  -7.50638  9.63147   1.000 68.69299  ? 109 GLY A N   1 
ATOM   817   C  CA  . GLY A 1 109 ? 24.67605  -6.31325  9.96792   1.000 68.75436  ? 109 GLY A CA  1 
ATOM   818   C  C   . GLY A 1 109 ? 23.68397  -6.52163  11.09248  1.000 77.09926  ? 109 GLY A C   1 
ATOM   819   O  O   . GLY A 1 109 ? 23.29720  -5.55396  11.75749  1.000 71.33972  ? 109 GLY A O   1 
ATOM   820   N  N   . TRP A 1 110 ? 23.27872  -7.76563  11.32735  1.000 83.94831  ? 110 TRP A N   1 
ATOM   821   C  CA  . TRP A 1 110 ? 22.38060  -8.12448  12.42176  1.000 85.08219  ? 110 TRP A CA  1 
ATOM   822   C  C   . TRP A 1 110 ? 23.23059  -8.40313  13.65695  1.000 87.24440  ? 110 TRP A C   1 
ATOM   823   O  O   . TRP A 1 110 ? 23.84890  -9.46403  13.77204  1.000 96.20628  ? 110 TRP A O   1 
ATOM   824   C  CB  . TRP A 1 110 ? 21.52948  -9.32549  12.02294  1.000 84.41254  ? 110 TRP A CB  1 
ATOM   825   C  CG  . TRP A 1 110 ? 20.77434  -9.96465  13.14383  1.000 101.06144 ? 110 TRP A CG  1 
ATOM   826   C  CD1 . TRP A 1 110 ? 20.31783  -9.36438  14.28257  1.000 107.67344 ? 110 TRP A CD1 1 
ATOM   827   C  CD2 . TRP A 1 110 ? 20.38699  -11.34023 13.23288  1.000 106.52273 ? 110 TRP A CD2 1 
ATOM   828   N  NE1 . TRP A 1 110 ? 19.67413  -10.28339 15.07619  1.000 103.76358 ? 110 TRP A NE1 1 
ATOM   829   C  CE2 . TRP A 1 110 ? 19.70205  -11.50371 14.45354  1.000 108.86949 ? 110 TRP A CE2 1 
ATOM   830   C  CE3 . TRP A 1 110 ? 20.55281  -12.45008 12.39779  1.000 108.69959 ? 110 TRP A CE3 1 
ATOM   831   C  CZ2 . TRP A 1 110 ? 19.18225  -12.73135 14.85879  1.000 109.53853 ? 110 TRP A CZ2 1 
ATOM   832   C  CZ3 . TRP A 1 110 ? 20.03792  -13.66829 12.80280  1.000 115.43162 ? 110 TRP A CZ3 1 
ATOM   833   C  CH2 . TRP A 1 110 ? 19.36032  -13.79893 14.02181  1.000 113.59316 ? 110 TRP A CH2 1 
ATOM   834   N  N   . LYS A 1 111 ? 23.26196  -7.44673  14.58734  1.000 78.32609  ? 111 LYS A N   1 
ATOM   835   C  CA  . LYS A 1 111 ? 24.07956  -7.54982  15.79289  1.000 81.60754  ? 111 LYS A CA  1 
ATOM   836   C  C   . LYS A 1 111 ? 23.28513  -7.91431  17.04066  1.000 90.30742  ? 111 LYS A C   1 
ATOM   837   O  O   . LYS A 1 111 ? 23.73985  -8.74746  17.83045  1.000 90.68626  ? 111 LYS A O   1 
ATOM   838   C  CB  . LYS A 1 111 ? 24.82605  -6.23590  16.05091  1.000 79.73700  ? 111 LYS A CB  1 
ATOM   839   C  CG  . LYS A 1 111 ? 25.89105  -5.89416  15.02534  1.000 78.51648  ? 111 LYS A CG  1 
ATOM   840   C  CD  . LYS A 1 111 ? 26.55617  -4.56804  15.36005  1.000 69.04861  ? 111 LYS A CD  1 
ATOM   841   C  CE  . LYS A 1 111 ? 27.65200  -4.23122  14.36353  1.000 75.30336  ? 111 LYS A CE  1 
ATOM   842   N  NZ  . LYS A 1 111 ? 28.75635  -5.22702  14.40266  1.000 76.74898  ? 111 LYS A NZ  1 
ATOM   843   N  N   . PHE A 1 112 ? 22.12217  -7.29787  17.24800  1.000 94.27591  ? 112 PHE A N   1 
ATOM   844   C  CA  . PHE A 1 112 ? 21.33404  -7.54857  18.45010  1.000 83.14275  ? 112 PHE A CA  1 
ATOM   845   C  C   . PHE A 1 112 ? 20.97128  -9.02446  18.57062  1.000 95.10782  ? 112 PHE A C   1 
ATOM   846   O  O   . PHE A 1 112 ? 20.45870  -9.62967  17.62405  1.000 101.30686 ? 112 PHE A O   1 
ATOM   847   C  CB  . PHE A 1 112 ? 20.06459  -6.69778  18.43076  1.000 81.52738  ? 112 PHE A CB  1 
ATOM   848   C  CG  . PHE A 1 112 ? 20.31164  -5.23445  18.65566  1.000 82.77496  ? 112 PHE A CG  1 
ATOM   849   C  CD1 . PHE A 1 112 ? 21.28209  -4.80980  19.54495  1.000 77.64213  ? 112 PHE A CD1 1 
ATOM   850   C  CD2 . PHE A 1 112 ? 19.57764  -4.28201  17.96597  1.000 84.64632  ? 112 PHE A CD2 1 
ATOM   851   C  CE1 . PHE A 1 112 ? 21.51211  -3.46209  19.74777  1.000 83.43389  ? 112 PHE A CE1 1 
ATOM   852   C  CE2 . PHE A 1 112 ? 19.80261  -2.93248  18.16422  1.000 79.25910  ? 112 PHE A CE2 1 
ATOM   853   C  CZ  . PHE A 1 112 ? 20.77116  -2.52183  19.05549  1.000 84.68803  ? 112 PHE A CZ  1 
ATOM   854   N  N   . SER A 1 113 ? 21.24116  -9.59687  19.74835  1.000 100.21162 ? 113 SER A N   1 
ATOM   855   C  CA  . SER A 1 113 ? 20.94393  -11.00092 20.05370  1.000 97.39330  ? 113 SER A CA  1 
ATOM   856   C  C   . SER A 1 113 ? 21.58307  -11.94898 19.03947  1.000 104.50797 ? 113 SER A C   1 
ATOM   857   O  O   . SER A 1 113 ? 21.01982  -12.98920 18.69181  1.000 107.45823 ? 113 SER A O   1 
ATOM   858   C  CB  . SER A 1 113 ? 19.43454  -11.24357 20.14821  1.000 98.65724  ? 113 SER A CB  1 
ATOM   859   O  OG  . SER A 1 113 ? 18.81870  -11.19411 18.87213  1.000 112.50379 ? 113 SER A OG  1 
ATOM   860   N  N   . ASN A 1 114 ? 22.77457  -11.58896 18.56371  1.000 106.69182 ? 114 ASN A N   1 
ATOM   861   C  CA  . ASN A 1 114 ? 23.52768  -12.44509 17.65462  1.000 106.55600 ? 114 ASN A CA  1 
ATOM   862   C  C   . ASN A 1 114 ? 24.99852  -12.45009 18.05338  1.000 109.81369 ? 114 ASN A C   1 
ATOM   863   O  O   . ASN A 1 114 ? 25.54120  -13.49213 18.43443  1.000 117.80095 ? 114 ASN A O   1 
ATOM   864   C  CB  . ASN A 1 114 ? 23.35013  -11.97805 16.20600  1.000 101.38684 ? 114 ASN A CB  1 
ATOM   865   C  CG  . ASN A 1 114 ? 24.04839  -12.88382 15.20492  1.000 108.04929 ? 114 ASN A CG  1 
ATOM   866   O  OD1 . ASN A 1 114 ? 24.44353  -14.00321 15.53040  1.000 117.46324 ? 114 ASN A OD1 1 
ATOM   867   N  ND2 . ASN A 1 114 ? 24.19353  -12.40353 13.97407  1.000 96.89078  ? 114 ASN A ND2 1 
ATOM   868   N  N   . VAL A 1 115 ? 25.64944  -11.29128 17.96849  1.000 105.11949 ? 115 VAL A N   1 
ATOM   869   C  CA  . VAL A 1 115 ? 27.03046  -11.13690 18.40988  1.000 93.63090  ? 115 VAL A CA  1 
ATOM   870   C  C   . VAL A 1 115 ? 27.08060  -9.95901  19.37113  1.000 93.67708  ? 115 VAL A C   1 
ATOM   871   O  O   . VAL A 1 115 ? 28.16060  -9.47438  19.72622  1.000 97.96604  ? 115 VAL A O   1 
ATOM   872   C  CB  . VAL A 1 115 ? 27.98602  -10.92438 17.22159  1.000 90.11665  ? 115 VAL A CB  1 
ATOM   873   C  CG1 . VAL A 1 115 ? 27.91713  -12.10295 16.26615  1.000 94.64596  ? 115 VAL A CG1 1 
ATOM   874   C  CG2 . VAL A 1 115 ? 27.64959  -9.62372  16.50202  1.000 79.89791  ? 115 VAL A CG2 1 
ATOM   875   N  N   . LYS A 1 116 ? 25.90938  -9.50897  19.81506  1.000 94.77133  ? 116 LYS A N   1 
ATOM   876   C  CA  . LYS A 1 116 ? 25.79195  -8.29353  20.60471  1.000 91.13512  ? 116 LYS A CA  1 
ATOM   877   C  C   . LYS A 1 116 ? 24.54145  -8.39693  21.46314  1.000 92.32428  ? 116 LYS A C   1 
ATOM   878   O  O   . LYS A 1 116 ? 23.56216  -9.05486  21.09013  1.000 102.61093 ? 116 LYS A O   1 
ATOM   879   C  CB  . LYS A 1 116 ? 25.73941  -7.04205  19.71760  1.000 101.57783 ? 116 LYS A CB  1 
ATOM   880   C  CG  . LYS A 1 116 ? 25.65733  -5.72491  20.47809  1.000 81.37232  ? 116 LYS A CG  1 
ATOM   881   C  CD  . LYS A 1 116 ? 25.47876  -4.56021  19.52077  1.000 80.73874  ? 116 LYS A CD  1 
ATOM   882   C  CE  . LYS A 1 116 ? 25.76398  -3.22647  20.18599  1.000 79.89704  ? 116 LYS A CE  1 
ATOM   883   N  NZ  . LYS A 1 116 ? 25.70604  -2.10936  19.19958  1.000 84.34481  ? 116 LYS A NZ  1 
ATOM   884   N  N   . ASP A 1 117 ? 24.60845  -7.76220  22.63117  1.000 89.69148  ? 117 ASP A N   1 
ATOM   885   C  CA  . ASP A 1 117 ? 23.51328  -7.77943  23.58948  1.000 92.78895  ? 117 ASP A CA  1 
ATOM   886   C  C   . ASP A 1 117 ? 22.25151  -7.14505  23.01416  1.000 87.54712  ? 117 ASP A C   1 
ATOM   887   O  O   . ASP A 1 117 ? 22.28790  -6.03168  22.48159  1.000 97.21272  ? 117 ASP A O   1 
ATOM   888   C  CB  . ASP A 1 117 ? 23.95606  -7.04229  24.84163  1.000 111.95311 ? 117 ASP A CB  1 
ATOM   889   C  CG  . ASP A 1 117 ? 24.90328  -7.86648  25.66886  1.000 112.84804 ? 117 ASP A CG  1 
ATOM   890   O  OD1 . ASP A 1 117 ? 24.77275  -9.11264  25.65379  1.000 99.51884  ? 117 ASP A OD1 1 
ATOM   891   O  OD2 . ASP A 1 117 ? 25.79091  -7.29749  26.33062  1.000 104.87684 ? 117 ASP A OD2 1 
ATOM   892   N  N   . GLY A 1 118 ? 21.12631  -7.84586  23.15148  1.000 91.88203  ? 118 GLY A N   1 
ATOM   893   C  CA  . GLY A 1 118 ? 19.87117  -7.42223  22.56610  1.000 96.16423  ? 118 GLY A CA  1 
ATOM   894   C  C   . GLY A 1 118 ? 19.20987  -6.27848  23.30761  1.000 87.45564  ? 118 GLY A C   1 
ATOM   895   O  O   . GLY A 1 118 ? 19.82941  -5.55989  24.09548  1.000 89.38661  ? 118 GLY A O   1 
ATOM   896   N  N   . VAL A 1 119 ? 17.90999  -6.12047  23.04363  1.000 88.82162  ? 119 VAL A N   1 
ATOM   897   C  CA  . VAL A 1 119 ? 17.13533  -4.98741  23.53648  1.000 87.44002  ? 119 VAL A CA  1 
ATOM   898   C  C   . VAL A 1 119 ? 16.29751  -5.32524  24.75941  1.000 90.79738  ? 119 VAL A C   1 
ATOM   899   O  O   . VAL A 1 119 ? 15.61685  -4.43834  25.29202  1.000 91.98367  ? 119 VAL A O   1 
ATOM   900   C  CB  . VAL A 1 119 ? 16.23129  -4.41736  22.42448  1.000 84.28934  ? 119 VAL A CB  1 
ATOM   901   C  CG1 . VAL A 1 119 ? 17.06628  -3.96189  21.24100  1.000 82.08955  ? 119 VAL A CG1 1 
ATOM   902   C  CG2 . VAL A 1 119 ? 15.20018  -5.44966  21.99028  1.000 83.38996  ? 119 VAL A CG2 1 
ATOM   903   N  N   . PHE A 1 120 ? 16.30898  -6.57770  25.21540  1.000 92.46923  ? 120 PHE A N   1 
ATOM   904   C  CA  . PHE A 1 120 ? 15.50953  -6.98536  26.37271  1.000 105.78722 ? 120 PHE A CA  1 
ATOM   905   C  C   . PHE A 1 120 ? 16.20073  -6.63406  27.69496  1.000 99.43412  ? 120 PHE A C   1 
ATOM   906   O  O   . PHE A 1 120 ? 16.48474  -7.48512  28.53665  1.000 112.62965 ? 120 PHE A O   1 
ATOM   907   C  CB  . PHE A 1 120 ? 15.18455  -8.47097  26.28986  1.000 106.83358 ? 120 PHE A CB  1 
ATOM   908   C  CG  . PHE A 1 120 ? 14.18708  -8.81117  25.22053  1.000 98.20125  ? 120 PHE A CG  1 
ATOM   909   C  CD1 . PHE A 1 120 ? 13.42950  -7.81641  24.62302  1.000 94.78415  ? 120 PHE A CD1 1 
ATOM   910   C  CD2 . PHE A 1 120 ? 14.00328  -10.12179 24.81505  1.000 94.84204  ? 120 PHE A CD2 1 
ATOM   911   C  CE1 . PHE A 1 120 ? 12.50783  -8.12090  23.64119  1.000 96.67485  ? 120 PHE A CE1 1 
ATOM   912   C  CE2 . PHE A 1 120 ? 13.08393  -10.43284 23.83134  1.000 102.98721 ? 120 PHE A CE2 1 
ATOM   913   C  CZ  . PHE A 1 120 ? 12.33566  -9.43030  23.24303  1.000 95.55381  ? 120 PHE A CZ  1 
ATOM   914   N  N   . GLY A 1 121 ? 16.48096  -5.33994  27.85670  1.000 99.44206  ? 121 GLY A N   1 
ATOM   915   C  CA  . GLY A 1 121 ? 17.04365  -4.81520  29.08505  1.000 102.81314 ? 121 GLY A CA  1 
ATOM   916   C  C   . GLY A 1 121 ? 16.61847  -3.37218  29.25214  1.000 102.88244 ? 121 GLY A C   1 
ATOM   917   O  O   . GLY A 1 121 ? 16.10752  -2.74794  28.32092  1.000 100.64968 ? 121 GLY A O   1 
ATOM   918   N  N   . GLU A 1 122 ? 16.83343  -2.83928  30.45961  1.000 106.27277 ? 122 GLU A N   1 
ATOM   919   C  CA  . GLU A 1 122 ? 16.47686  -1.44603  30.71838  1.000 106.75712 ? 122 GLU A CA  1 
ATOM   920   C  C   . GLU A 1 122 ? 17.26521  -0.48070  29.84486  1.000 104.05608 ? 122 GLU A C   1 
ATOM   921   O  O   . GLU A 1 122 ? 16.81562  0.64994   29.62864  1.000 103.32676 ? 122 GLU A O   1 
ATOM   922   C  CB  . GLU A 1 122 ? 16.65202  -1.09252  32.19574  1.000 111.07816 ? 122 GLU A CB  1 
ATOM   923   C  CG  . GLU A 1 122 ? 15.63029  -1.76111  33.10584  1.000 117.08442 ? 122 GLU A CG  1 
ATOM   924   C  CD  . GLU A 1 122 ? 15.80821  -1.38719  34.56465  1.000 118.38559 ? 122 GLU A CD  1 
ATOM   925   O  OE1 . GLU A 1 122 ? 16.70085  -0.56690  34.86524  1.000 121.34816 ? 122 GLU A OE1 1 
ATOM   926   O  OE2 . GLU A 1 122 ? 15.05715  -1.91676  35.41064  1.000 121.18310 ? 122 GLU A OE2 1 
ATOM   927   N  N   . PHE A 1 123 ? 18.43925  -0.88665  29.36637  1.000 102.74935 ? 123 PHE A N   1 
ATOM   928   C  CA  . PHE A 1 123 ? 19.20125  -0.09963  28.40971  1.000 100.71287 ? 123 PHE A CA  1 
ATOM   929   C  C   . PHE A 1 123 ? 19.86743  -1.03816  27.41368  1.000 97.33303  ? 123 PHE A C   1 
ATOM   930   O  O   . PHE A 1 123 ? 20.08498  -2.22035  27.69028  1.000 98.34275  ? 123 PHE A O   1 
ATOM   931   C  CB  . PHE A 1 123 ? 20.26083  0.77042   29.09997  1.000 101.88327 ? 123 PHE A CB  1 
ATOM   932   C  CG  . PHE A 1 123 ? 19.70068  1.71455   30.12215  1.000 104.71085 ? 123 PHE A CG  1 
ATOM   933   C  CD1 . PHE A 1 123 ? 19.20309  2.95043   29.74175  1.000 103.58570 ? 123 PHE A CD1 1 
ATOM   934   C  CD2 . PHE A 1 123 ? 19.68023  1.37228   31.46445  1.000 108.62924 ? 123 PHE A CD2 1 
ATOM   935   C  CE1 . PHE A 1 123 ? 18.68910  3.82551   30.68140  1.000 119.06139 ? 123 PHE A CE1 1 
ATOM   936   C  CE2 . PHE A 1 123 ? 19.16780  2.24290   32.40841  1.000 111.35911 ? 123 PHE A CE2 1 
ATOM   937   C  CZ  . PHE A 1 123 ? 18.67201  3.47113   32.01783  1.000 110.20232 ? 123 PHE A CZ  1 
ATOM   938   N  N   . PHE A 1 124 ? 20.18449  -0.49747  26.23975  1.000 94.04617  ? 124 PHE A N   1 
ATOM   939   C  CA  . PHE A 1 124 ? 20.95035  -1.24067  25.25137  1.000 93.27274  ? 124 PHE A CA  1 
ATOM   940   C  C   . PHE A 1 124 ? 21.83159  -0.28059  24.46757  1.000 89.44665  ? 124 PHE A C   1 
ATOM   941   O  O   . PHE A 1 124 ? 21.63694  0.93803   24.48887  1.000 89.36579  ? 124 PHE A O   1 
ATOM   942   C  CB  . PHE A 1 124 ? 20.04010  -2.05462  24.31591  1.000 89.08140  ? 124 PHE A CB  1 
ATOM   943   C  CG  . PHE A 1 124 ? 18.97076  -1.24451  23.63397  1.000 87.03666  ? 124 PHE A CG  1 
ATOM   944   C  CD1 . PHE A 1 124 ? 19.21455  -0.62026  22.42216  1.000 85.36166  ? 124 PHE A CD1 1 
ATOM   945   C  CD2 . PHE A 1 124 ? 17.71048  -1.12842  24.19766  1.000 88.43544  ? 124 PHE A CD2 1 
ATOM   946   C  CE1 . PHE A 1 124 ? 18.22383  0.11648   21.79406  1.000 84.47476  ? 124 PHE A CE1 1 
ATOM   947   C  CE2 . PHE A 1 124 ? 16.71831  -0.39375  23.57483  1.000 86.67069  ? 124 PHE A CE2 1 
ATOM   948   C  CZ  . PHE A 1 124 ? 16.97485  0.22818   22.37173  1.000 83.48492  ? 124 PHE A CZ  1 
ATOM   949   N  N   . HIS A 1 125 ? 22.81447  -0.85453  23.78193  1.000 87.87573  ? 125 HIS A N   1 
ATOM   950   C  CA  . HIS A 1 125 ? 23.83655  -0.10005  23.07158  1.000 86.96824  ? 125 HIS A CA  1 
ATOM   951   C  C   . HIS A 1 125 ? 23.53106  -0.09967  21.57841  1.000 87.43778  ? 125 HIS A C   1 
ATOM   952   O  O   . HIS A 1 125 ? 23.30848  -1.16087  20.98593  1.000 80.84972  ? 125 HIS A O   1 
ATOM   953   C  CB  . HIS A 1 125 ? 25.21326  -0.70815  23.33750  1.000 87.20141  ? 125 HIS A CB  1 
ATOM   954   C  CG  . HIS A 1 125 ? 26.33662  0.01114   22.66343  1.000 89.55033  ? 125 HIS A CG  1 
ATOM   955   N  ND1 . HIS A 1 125 ? 26.73928  -0.27899  21.37794  1.000 82.56486  ? 125 HIS A ND1 1 
ATOM   956   C  CD2 . HIS A 1 125 ? 27.15725  0.99392   23.10289  1.000 90.07241  ? 125 HIS A CD2 1 
ATOM   957   C  CE1 . HIS A 1 125 ? 27.75353  0.50105   21.05053  1.000 85.44168  ? 125 HIS A CE1 1 
ATOM   958   N  NE2 . HIS A 1 125 ? 28.02793  1.28148   22.08027  1.000 87.74575  ? 125 HIS A NE2 1 
ATOM   959   N  N   . VAL A 1 126 ? 23.53922  1.08503   20.97201  1.000 81.66866  ? 126 VAL A N   1 
ATOM   960   C  CA  . VAL A 1 126 ? 23.31802  1.24571   19.53802  1.000 77.05700  ? 126 VAL A CA  1 
ATOM   961   C  C   . VAL A 1 126 ? 24.58167  1.84796   18.94491  1.000 75.88678  ? 126 VAL A C   1 
ATOM   962   O  O   . VAL A 1 126 ? 24.93832  2.99201   19.25483  1.000 76.72993  ? 126 VAL A O   1 
ATOM   963   C  CB  . VAL A 1 126 ? 22.09523  2.12062   19.23181  1.000 77.18742  ? 126 VAL A CB  1 
ATOM   964   C  CG1 . VAL A 1 126 ? 21.97247  2.35356   17.73126  1.000 72.47429  ? 126 VAL A CG1 1 
ATOM   965   C  CG2 . VAL A 1 126 ? 20.83531  1.47195   19.77238  1.000 79.48185  ? 126 VAL A CG2 1 
ATOM   966   N  N   . ASN A 1 127 ? 25.25181  1.08735   18.08503  1.000 76.63748  ? 127 ASN A N   1 
ATOM   967   C  CA  . ASN A 1 127 ? 26.46889  1.56007   17.44490  1.000 74.38286  ? 127 ASN A CA  1 
ATOM   968   C  C   . ASN A 1 127 ? 26.13765  2.52094   16.31093  1.000 70.13153  ? 127 ASN A C   1 
ATOM   969   O  O   . ASN A 1 127 ? 25.17478  2.31626   15.56650  1.000 68.17051  ? 127 ASN A O   1 
ATOM   970   C  CB  . ASN A 1 127 ? 27.28746  0.38100   16.91838  1.000 72.41803  ? 127 ASN A CB  1 
ATOM   971   C  CG  . ASN A 1 127 ? 26.51540  -0.47640  15.93800  1.000 69.52539  ? 127 ASN A CG  1 
ATOM   972   O  OD1 . ASN A 1 127 ? 25.53615  -1.12950  16.29790  1.000 76.41178  ? 127 ASN A OD1 1 
ATOM   973   N  ND2 . ASN A 1 127 ? 26.96667  -0.49335  14.69142  1.000 69.48375  ? 127 ASN A ND2 1 
ATOM   974   N  N   . ASP A 1 128 ? 26.93977  3.57920   16.19804  1.000 70.15793  ? 128 ASP A N   1 
ATOM   975   C  CA  . ASP A 1 128 ? 26.81396  4.59509   15.15257  1.000 67.87225  ? 128 ASP A CA  1 
ATOM   976   C  C   . ASP A 1 128 ? 25.39657  5.17690   15.12203  1.000 67.49622  ? 128 ASP A C   1 
ATOM   977   O  O   . ASP A 1 128 ? 24.60631  4.94354   14.20598  1.000 65.24172  ? 128 ASP A O   1 
ATOM   978   C  CB  . ASP A 1 128 ? 27.20853  4.01590   13.79072  1.000 64.94496  ? 128 ASP A CB  1 
ATOM   979   C  CG  . ASP A 1 128 ? 27.73679  5.07143   12.84087  1.000 69.98873  ? 128 ASP A CG  1 
ATOM   980   O  OD1 . ASP A 1 128 ? 27.41044  6.26159   13.03658  1.000 65.52952  ? 128 ASP A OD1 1 
ATOM   981   O  OD2 . ASP A 1 128 ? 28.47129  4.70962   11.89521  1.000 64.09539  ? 128 ASP A OD2 1 
ATOM   982   N  N   . ALA A 1 129 ? 25.11149  5.96347   16.16432  1.000 69.89914  ? 129 ALA A N   1 
ATOM   983   C  CA  . ALA A 1 129 ? 23.76580  6.49494   16.36425  1.000 70.17277  ? 129 ALA A CA  1 
ATOM   984   C  C   . ALA A 1 129 ? 23.30024  7.31247   15.16700  1.000 67.59238  ? 129 ALA A C   1 
ATOM   985   O  O   . ALA A 1 129 ? 22.15908  7.16763   14.71361  1.000 69.01666  ? 129 ALA A O   1 
ATOM   986   C  CB  . ALA A 1 129 ? 23.72257  7.34240   17.63494  1.000 73.28461  ? 129 ALA A CB  1 
ATOM   987   N  N   . ASP A 1 130 ? 24.16621  8.18285   14.64583  1.000 66.85908  ? 130 ASP A N   1 
ATOM   988   C  CA  . ASP A 1 130 ? 23.78524  9.03526   13.52644  1.000 64.63595  ? 130 ASP A CA  1 
ATOM   989   C  C   . ASP A 1 130 ? 23.43809  8.23226   12.27957  1.000 61.64588  ? 130 ASP A C   1 
ATOM   990   O  O   . ASP A 1 130 ? 22.70622  8.72894   11.41644  1.000 59.87651  ? 130 ASP A O   1 
ATOM   991   C  CB  . ASP A 1 130 ? 24.92051  10.01141  13.22210  1.000 68.25084  ? 130 ASP A CB  1 
ATOM   992   C  CG  . ASP A 1 130 ? 25.06106  11.08273  14.28240  1.000 77.95804  ? 130 ASP A CG  1 
ATOM   993   O  OD1 . ASP A 1 130 ? 24.06744  11.34079  14.99433  1.000 72.99461  ? 130 ASP A OD1 1 
ATOM   994   O  OD2 . ASP A 1 130 ? 26.16666  11.64968  14.41716  1.000 77.75896  ? 130 ASP A OD2 1 
ATOM   995   N  N   . MET A 1 131 ? 23.92603  6.99757   12.17676  1.000 61.16456  ? 131 MET A N   1 
ATOM   996   C  CA  . MET A 1 131 ? 23.66545  6.15239   11.02472  1.000 58.49149  ? 131 MET A CA  1 
ATOM   997   C  C   . MET A 1 131 ? 22.65326  5.04969   11.29420  1.000 62.39506  ? 131 MET A C   1 
ATOM   998   O  O   . MET A 1 131 ? 22.16146  4.44037   10.33872  1.000 56.69043  ? 131 MET A O   1 
ATOM   999   C  CB  . MET A 1 131 ? 24.97476  5.52101   10.53016  1.000 57.66276  ? 131 MET A CB  1 
ATOM   1000  C  CG  . MET A 1 131 ? 25.98559  6.53260   10.02395  1.000 57.14855  ? 131 MET A CG  1 
ATOM   1001  S  SD  . MET A 1 131 ? 25.51779  7.22084   8.42665   1.000 64.21325  ? 131 MET A SD  1 
ATOM   1002  C  CE  . MET A 1 131 ? 25.89600  5.84992   7.33403   1.000 55.11511  ? 131 MET A CE  1 
ATOM   1003  N  N   . ASN A 1 132 ? 22.32866  4.77144   12.55931  1.000 62.41987  ? 132 ASN A N   1 
ATOM   1004  C  CA  . ASN A 1 132 ? 21.49337  3.62320   12.88993  1.000 61.52843  ? 132 ASN A CA  1 
ATOM   1005  C  C   . ASN A 1 132 ? 20.30511  3.99497   13.76873  1.000 63.31204  ? 132 ASN A C   1 
ATOM   1006  O  O   . ASN A 1 132 ? 19.74919  3.12239   14.43945  1.000 77.83375  ? 132 ASN A O   1 
ATOM   1007  C  CB  . ASN A 1 132 ? 22.32296  2.52739   13.56283  1.000 63.04616  ? 132 ASN A CB  1 
ATOM   1008  C  CG  . ASN A 1 132 ? 23.16746  1.75108   12.57369  1.000 64.83799  ? 132 ASN A CG  1 
ATOM   1009  O  OD1 . ASN A 1 132 ? 22.73483  1.47666   11.45450  1.000 65.89515  ? 132 ASN A OD1 1 
ATOM   1010  N  ND2 . ASN A 1 132 ? 24.37601  1.38779   12.98208  1.000 64.89264  ? 132 ASN A ND2 1 
ATOM   1011  N  N   . LEU A 1 133 ? 19.91319  5.26600   13.80063  1.000 63.55997  ? 133 LEU A N   1 
ATOM   1012  C  CA  . LEU A 1 133 ? 18.72650  5.68555   14.53063  1.000 65.15287  ? 133 LEU A CA  1 
ATOM   1013  C  C   . LEU A 1 133 ? 17.89116  6.60943   13.65691  1.000 63.39429  ? 133 LEU A C   1 
ATOM   1014  O  O   . LEU A 1 133 ? 18.41938  7.32853   12.80747  1.000 61.79505  ? 133 LEU A O   1 
ATOM   1015  C  CB  . LEU A 1 133 ? 19.08956  6.39699   15.84289  1.000 68.32205  ? 133 LEU A CB  1 
ATOM   1016  C  CG  . LEU A 1 133 ? 19.69986  5.55442   16.96506  1.000 70.76818  ? 133 LEU A CG  1 
ATOM   1017  C  CD1 . LEU A 1 133 ? 19.98888  6.42033   18.18158  1.000 73.84411  ? 133 LEU A CD1 1 
ATOM   1018  C  CD2 . LEU A 1 133 ? 18.78795  4.39680   17.33167  1.000 71.33870  ? 133 LEU A CD2 1 
ATOM   1019  N  N   . ALA A 1 134 ? 16.57892  6.58863   13.87726  1.000 63.81948  ? 134 ALA A N   1 
ATOM   1020  C  CA  . ALA A 1 134 ? 15.65315  7.47994   13.19219  1.000 62.58255  ? 134 ALA A CA  1 
ATOM   1021  C  C   . ALA A 1 134 ? 14.68020  8.05986   14.20628  1.000 77.10776  ? 134 ALA A C   1 
ATOM   1022  O  O   . ALA A 1 134 ? 14.19412  7.34512   15.08660  1.000 71.58039  ? 134 ALA A O   1 
ATOM   1023  C  CB  . ALA A 1 134 ? 14.88467  6.75512   12.08453  1.000 59.93413  ? 134 ALA A CB  1 
ATOM   1024  N  N   . HIS A 1 135 ? 14.40000  9.35446   14.08259  1.000 73.71592  ? 135 HIS A N   1 
ATOM   1025  C  CA  . HIS A 1 135 ? 13.46614  10.00251  14.99352  1.000 70.99632  ? 135 HIS A CA  1 
ATOM   1026  C  C   . HIS A 1 135 ? 12.05214  9.46846   14.79706  1.000 75.45239  ? 135 HIS A C   1 
ATOM   1027  O  O   . HIS A 1 135 ? 11.60897  9.23200   13.67007  1.000 78.25575  ? 135 HIS A O   1 
ATOM   1028  C  CB  . HIS A 1 135 ? 13.49022  11.51628  14.79313  1.000 73.16478  ? 135 HIS A CB  1 
ATOM   1029  C  CG  . HIS A 1 135 ? 14.76145  12.16350  15.24581  1.000 75.10714  ? 135 HIS A CG  1 
ATOM   1030  N  ND1 . HIS A 1 135 ? 15.67803  12.70177  14.36862  1.000 70.67307  ? 135 HIS A ND1 1 
ATOM   1031  C  CD2 . HIS A 1 135 ? 15.27011  12.35464  16.48587  1.000 72.17028  ? 135 HIS A CD2 1 
ATOM   1032  C  CE1 . HIS A 1 135 ? 16.69475  13.20047  15.04900  1.000 69.33256  ? 135 HIS A CE1 1 
ATOM   1033  N  NE2 . HIS A 1 135 ? 16.47248  13.00142  16.33548  1.000 76.16986  ? 135 HIS A NE2 1 
ATOM   1034  N  N   . LEU A 1 136 ? 11.33892  9.28666   15.91034  1.000 79.26162  ? 136 LEU A N   1 
ATOM   1035  C  CA  . LEU A 1 136 ? 9.97699   8.77383   15.87960  1.000 79.36496  ? 136 LEU A CA  1 
ATOM   1036  C  C   . LEU A 1 136 ? 8.99005   9.92345   15.97447  1.000 76.40795  ? 136 LEU A C   1 
ATOM   1037  O  O   . LEU A 1 136 ? 8.99153   10.64502  16.98409  1.000 81.66224  ? 136 LEU A O   1 
ATOM   1038  C  CB  . LEU A 1 136 ? 9.74501   7.79340   17.02299  1.000 73.76523  ? 136 LEU A CB  1 
ATOM   1039  C  CG  . LEU A 1 136 ? 8.29551   7.32289   17.16516  1.000 84.01490  ? 136 LEU A CG  1 
ATOM   1040  C  CD1 . LEU A 1 136 ? 7.85967   6.55281   15.92837  1.000 78.41132  ? 136 LEU A CD1 1 
ATOM   1041  C  CD2 . LEU A 1 136 ? 8.10700   6.48681   18.41985  1.000 78.79783  ? 136 LEU A CD2 1 
ATOM   1042  N  N   . PRO A 1 137 ? 8.13975   10.13205  14.97290  1.000 79.04133  ? 137 PRO A N   1 
ATOM   1043  C  CA  . PRO A 1 137 ? 7.12289   11.18205  15.07745  1.000 78.23776  ? 137 PRO A CA  1 
ATOM   1044  C  C   . PRO A 1 137 ? 6.09752   10.85644  16.15070  1.000 84.60527  ? 137 PRO A C   1 
ATOM   1045  O  O   . PRO A 1 137 ? 5.77251   9.69432   16.40616  1.000 89.07201  ? 137 PRO A O   1 
ATOM   1046  C  CB  . PRO A 1 137 ? 6.47990   11.20052  13.68392  1.000 86.17654  ? 137 PRO A CB  1 
ATOM   1047  C  CG  . PRO A 1 137 ? 7.45131   10.48925  12.78926  1.000 70.24373  ? 137 PRO A CG  1 
ATOM   1048  C  CD  . PRO A 1 137 ? 8.12099   9.47245   13.65865  1.000 76.25410  ? 137 PRO A CD  1 
ATOM   1049  N  N   . LYS A 1 138 ? 5.59581   11.91270  16.79258  1.000 84.70575  ? 138 LYS A N   1 
ATOM   1050  C  CA  . LYS A 1 138 ? 4.57189   11.75503  17.81804  1.000 86.54970  ? 138 LYS A CA  1 
ATOM   1051  C  C   . LYS A 1 138 ? 3.28645   11.14373  17.27358  1.000 82.61574  ? 138 LYS A C   1 
ATOM   1052  O  O   . LYS A 1 138 ? 2.53377   10.53088  18.03797  1.000 85.87541  ? 138 LYS A O   1 
ATOM   1053  C  CB  . LYS A 1 138 ? 4.27231   13.11550  18.44761  1.000 94.72218  ? 138 LYS A CB  1 
ATOM   1054  C  CG  . LYS A 1 138 ? 3.86843   14.16549  17.42107  1.000 98.71402  ? 138 LYS A CG  1 
ATOM   1055  C  CD  . LYS A 1 138 ? 3.76850   15.55543  18.02055  1.000 97.02182  ? 138 LYS A CD  1 
ATOM   1056  C  CE  . LYS A 1 138 ? 3.47074   16.58695  16.94133  1.000 93.51909  ? 138 LYS A CE  1 
ATOM   1057  N  NZ  . LYS A 1 138 ? 3.40548   17.97060  17.48767  1.000 109.49853 ? 138 LYS A NZ  1 
ATOM   1058  N  N   . GLU A 1 139 ? 3.02488   11.28414  15.97210  1.000 81.84034  ? 139 GLU A N   1 
ATOM   1059  C  CA  . GLU A 1 139 ? 1.78579   10.79883  15.37410  1.000 83.00072  ? 139 GLU A CA  1 
ATOM   1060  C  C   . GLU A 1 139 ? 1.73114   9.28102   15.25149  1.000 83.01271  ? 139 GLU A C   1 
ATOM   1061  O  O   . GLU A 1 139 ? 0.65193   8.73828   14.98945  1.000 85.23902  ? 139 GLU A O   1 
ATOM   1062  C  CB  . GLU A 1 139 ? 1.58542   11.43375  13.99536  1.000 82.77518  ? 139 GLU A CB  1 
ATOM   1063  C  CG  . GLU A 1 139 ? 1.31300   12.93318  14.02337  1.000 77.05285  ? 139 GLU A CG  1 
ATOM   1064  C  CD  . GLU A 1 139 ? 2.58041   13.76494  14.11934  1.000 92.29349  ? 139 GLU A CD  1 
ATOM   1065  O  OE1 . GLU A 1 139 ? 3.67330   13.17933  14.27311  1.000 95.48767  ? 139 GLU A OE1 1 
ATOM   1066  O  OE2 . GLU A 1 139 ? 2.48437   15.00792  14.03602  1.000 96.67242  ? 139 GLU A OE2 1 
ATOM   1067  N  N   . ILE A 1 140 ? 2.84881   8.59013   15.43187  1.000 81.94779  ? 140 ILE A N   1 
ATOM   1068  C  CA  . ILE A 1 140 ? 2.92561   7.14100   15.26837  1.000 74.29382  ? 140 ILE A CA  1 
ATOM   1069  C  C   . ILE A 1 140 ? 2.87262   6.49969   16.65010  1.000 80.97891  ? 140 ILE A C   1 
ATOM   1070  O  O   . ILE A 1 140 ? 3.72193   6.81580   17.49803  1.000 77.61012  ? 140 ILE A O   1 
ATOM   1071  C  CB  . ILE A 1 140 ? 4.20078   6.72672   14.52213  1.000 67.01714  ? 140 ILE A CB  1 
ATOM   1072  C  CG1 . ILE A 1 140 ? 4.24792   7.39344   13.14506  1.000 72.82725  ? 140 ILE A CG1 1 
ATOM   1073  C  CG2 . ILE A 1 140 ? 4.28518   5.21303   14.41687  1.000 68.02770  ? 140 ILE A CG2 1 
ATOM   1074  C  CD1 . ILE A 1 140 ? 5.43721   6.98923   12.31040  1.000 67.96811  ? 140 ILE A CD1 1 
ATOM   1075  N  N   . PRO A 1 141 ? 1.90481   5.62927   16.92788  1.000 76.81781  ? 141 PRO A N   1 
ATOM   1076  C  CA  . PRO A 1 141 ? 1.86024   4.96894   18.23554  1.000 76.12742  ? 141 PRO A CA  1 
ATOM   1077  C  C   . PRO A 1 141 ? 2.99057   3.96146   18.38267  1.000 75.81981  ? 141 PRO A C   1 
ATOM   1078  O  O   . PRO A 1 141 ? 3.57692   3.49093   17.40577  1.000 82.66223  ? 141 PRO A O   1 
ATOM   1079  C  CB  . PRO A 1 141 ? 0.49404   4.26973   18.24162  1.000 80.93295  ? 141 PRO A CB  1 
ATOM   1080  C  CG  . PRO A 1 141 ? -0.27205  4.86803   17.08624  1.000 74.33354  ? 141 PRO A CG  1 
ATOM   1081  C  CD  . PRO A 1 141 ? 0.75965   5.25895   16.08113  1.000 72.80891  ? 141 PRO A CD  1 
ATOM   1082  N  N   . LEU A 1 142 ? 3.28627   3.62527   19.64041  1.000 78.81734  ? 142 LEU A N   1 
ATOM   1083  C  CA  . LEU A 1 142 ? 4.41661   2.74601   19.92431  1.000 79.01288  ? 142 LEU A CA  1 
ATOM   1084  C  C   . LEU A 1 142 ? 4.19949   1.35134   19.35141  1.000 84.10121  ? 142 LEU A C   1 
ATOM   1085  O  O   . LEU A 1 142 ? 5.13450   0.74128   18.81863  1.000 81.28310  ? 142 LEU A O   1 
ATOM   1086  C  CB  . LEU A 1 142 ? 4.65990   2.67247   21.43035  1.000 82.82699  ? 142 LEU A CB  1 
ATOM   1087  C  CG  . LEU A 1 142 ? 5.18090   3.95683   22.07151  1.000 84.59383  ? 142 LEU A CG  1 
ATOM   1088  C  CD1 . LEU A 1 142 ? 5.31110   3.78710   23.57681  1.000 96.18950  ? 142 LEU A CD1 1 
ATOM   1089  C  CD2 . LEU A 1 142 ? 6.50922   4.35683   21.45036  1.000 83.72882  ? 142 LEU A CD2 1 
ATOM   1090  N  N   . GLU A 1 143 ? 2.97420   0.82644   19.45917  1.000 83.83593  ? 143 GLU A N   1 
ATOM   1091  C  CA  . GLU A 1 143 ? 2.69480   -0.51633  18.95647  1.000 81.68420  ? 143 GLU A CA  1 
ATOM   1092  C  C   . GLU A 1 143 ? 2.94119   -0.60623  17.45758  1.000 77.97503  ? 143 GLU A C   1 
ATOM   1093  O  O   . GLU A 1 143 ? 3.45476   -1.61702  16.96458  1.000 82.17190  ? 143 GLU A O   1 
ATOM   1094  C  CB  . GLU A 1 143 ? 1.25777   -0.92488  19.28495  1.000 87.23856  ? 143 GLU A CB  1 
ATOM   1095  C  CG  . GLU A 1 143 ? 0.97238   -1.09127  20.76950  1.000 97.65930  ? 143 GLU A CG  1 
ATOM   1096  C  CD  . GLU A 1 143 ? 0.65027   0.21973   21.45960  1.000 115.18299 ? 143 GLU A CD  1 
ATOM   1097  O  OE1 . GLU A 1 143 ? 0.60811   1.26232   20.77206  1.000 108.40718 ? 143 GLU A OE1 1 
ATOM   1098  O  OE2 . GLU A 1 143 ? 0.44152   0.20664   22.69203  1.000 120.25633 ? 143 GLU A OE2 1 
ATOM   1099  N  N   . ALA A 1 144 ? 2.57762   0.43961   16.71431  1.000 71.19471  ? 144 ALA A N   1 
ATOM   1100  C  CA  . ALA A 1 144 ? 2.81043   0.42672   15.27597  1.000 73.37941  ? 144 ALA A CA  1 
ATOM   1101  C  C   . ALA A 1 144 ? 4.28353   0.63944   14.95971  1.000 71.62358  ? 144 ALA A C   1 
ATOM   1102  O  O   . ALA A 1 144 ? 4.83067   -0.00518  14.05766  1.000 67.79949  ? 144 ALA A O   1 
ATOM   1103  C  CB  . ALA A 1 144 ? 1.95440   1.49358   14.59525  1.000 73.21575  ? 144 ALA A CB  1 
ATOM   1104  N  N   . ALA A 1 145 ? 4.94409   1.53142   15.70006  1.000 70.24682  ? 145 ALA A N   1 
ATOM   1105  C  CA  . ALA A 1 145 ? 6.33093   1.85958   15.39558  1.000 68.37259  ? 145 ALA A CA  1 
ATOM   1106  C  C   . ALA A 1 145 ? 7.25831   0.67224   15.61625  1.000 68.48825  ? 145 ALA A C   1 
ATOM   1107  O  O   . ALA A 1 145 ? 8.22740   0.50116   14.86877  1.000 67.04294  ? 145 ALA A O   1 
ATOM   1108  C  CB  . ALA A 1 145 ? 6.78456   3.05058   16.23822  1.000 74.71830  ? 145 ALA A CB  1 
ATOM   1109  N  N   . VAL A 1 146 ? 6.97214   -0.16986  16.61369  1.000 69.81810  ? 146 VAL A N   1 
ATOM   1110  C  CA  . VAL A 1 146 ? 7.85937   -1.29258  16.91404  1.000 70.37946  ? 146 VAL A CA  1 
ATOM   1111  C  C   . VAL A 1 146 ? 7.73427   -2.42155  15.90058  1.000 67.98258  ? 146 VAL A C   1 
ATOM   1112  O  O   . VAL A 1 146 ? 8.51353   -3.38165  15.95331  1.000 75.26937  ? 146 VAL A O   1 
ATOM   1113  C  CB  . VAL A 1 146 ? 7.59743   -1.77015  18.35749  1.000 74.00622  ? 146 VAL A CB  1 
ATOM   1114  C  CG1 . VAL A 1 146 ? 6.28703   -2.53159  18.45360  1.000 74.53319  ? 146 VAL A CG1 1 
ATOM   1115  C  CG2 . VAL A 1 146 ? 8.76751   -2.59681  18.88921  1.000 75.21810  ? 146 VAL A CG2 1 
ATOM   1116  N  N   . MET A 1 147 ? 6.79846   -2.32451  14.95553  1.000 65.86306  ? 147 MET A N   1 
ATOM   1117  C  CA  . MET A 1 147 ? 6.74559   -3.26907  13.84655  1.000 67.63105  ? 147 MET A CA  1 
ATOM   1118  C  C   . MET A 1 147 ? 7.70267   -2.90633  12.72165  1.000 60.55496  ? 147 MET A C   1 
ATOM   1119  O  O   . MET A 1 147 ? 7.97038   -3.75016  11.85978  1.000 63.16148  ? 147 MET A O   1 
ATOM   1120  C  CB  . MET A 1 147 ? 5.32143   -3.35790  13.29345  1.000 68.33023  ? 147 MET A CB  1 
ATOM   1121  C  CG  . MET A 1 147 ? 4.29370   -3.87879  14.28421  1.000 67.31879  ? 147 MET A CG  1 
ATOM   1122  S  SD  . MET A 1 147 ? 4.60937   -5.57925  14.79897  1.000 68.56858  ? 147 MET A SD  1 
ATOM   1123  C  CE  . MET A 1 147 ? 5.38492   -5.34203  16.39432  1.000 69.92441  ? 147 MET A CE  1 
ATOM   1124  N  N   . ILE A 1 148 ? 8.22202   -1.68375  12.71763  1.000 60.43787  ? 148 ILE A N   1 
ATOM   1125  C  CA  . ILE A 1 148 ? 9.12604   -1.19048  11.68075  1.000 58.00843  ? 148 ILE A CA  1 
ATOM   1126  C  C   . ILE A 1 148 ? 10.52211  -1.80545  11.77954  1.000 58.12904  ? 148 ILE A C   1 
ATOM   1127  O  O   . ILE A 1 148 ? 11.07023  -2.20682  10.74312  1.000 55.83730  ? 148 ILE A O   1 
ATOM   1128  C  CB  . ILE A 1 148 ? 9.21307   0.34475   11.72818  1.000 58.17506  ? 148 ILE A CB  1 
ATOM   1129  C  CG1 . ILE A 1 148 ? 7.82308   0.96506   11.57693  1.000 58.07342  ? 148 ILE A CG1 1 
ATOM   1130  C  CG2 . ILE A 1 148 ? 10.15674  0.86409   10.65933  1.000 55.79533  ? 148 ILE A CG2 1 
ATOM   1131  C  CD1 . ILE A 1 148 ? 7.81402   2.47317   11.68388  1.000 58.54214  ? 148 ILE A CD1 1 
ATOM   1132  N  N   . PRO A 1 149 ? 11.14342  -1.90417  12.96834  1.000 60.77100  ? 149 PRO A N   1 
ATOM   1133  C  CA  . PRO A 1 149 ? 12.54611  -2.35964  13.02210  1.000 60.88359  ? 149 PRO A CA  1 
ATOM   1134  C  C   . PRO A 1 149 ? 12.82448  -3.68163  12.33446  1.000 59.47292  ? 149 PRO A C   1 
ATOM   1135  O  O   . PRO A 1 149 ? 13.94516  -3.88836  11.85348  1.000 63.18293  ? 149 PRO A O   1 
ATOM   1136  C  CB  . PRO A 1 149 ? 12.81111  -2.46225  14.52772  1.000 64.34296  ? 149 PRO A CB  1 
ATOM   1137  C  CG  . PRO A 1 149 ? 11.94449  -1.43579  15.11023  1.000 65.65637  ? 149 PRO A CG  1 
ATOM   1138  C  CD  . PRO A 1 149 ? 10.68034  -1.49404  14.30865  1.000 63.85780  ? 149 PRO A CD  1 
ATOM   1139  N  N   . ASP A 1 150 ? 11.85687  -4.59253  12.28510  1.000 59.49247  ? 150 ASP A N   1 
ATOM   1140  C  CA  . ASP A 1 150 ? 12.13326  -5.92782  11.77406  1.000 58.60929  ? 150 ASP A CA  1 
ATOM   1141  C  C   . ASP A 1 150 ? 11.03723  -6.41762  10.83737  1.000 56.62980  ? 150 ASP A C   1 
ATOM   1142  O  O   . ASP A 1 150 ? 11.30859  -6.75544  9.68170   1.000 56.64463  ? 150 ASP A O   1 
ATOM   1143  C  CB  . ASP A 1 150 ? 12.30819  -6.90565  12.93433  1.000 66.35161  ? 150 ASP A CB  1 
ATOM   1144  C  CG  . ASP A 1 150 ? 12.84102  -8.25025  12.49001  1.000 73.90294  ? 150 ASP A CG  1 
ATOM   1145  O  OD1 . ASP A 1 150 ? 13.19077  -8.40196  11.30151  1.000 71.13177  ? 150 ASP A OD1 1 
ATOM   1146  O  OD2 . ASP A 1 150 ? 12.90725  -9.16186  13.33708  1.000 86.37611  ? 150 ASP A OD2 1 
ATOM   1147  N  N   . MET A 1 151 ? 9.79884   -6.46759  11.32760  1.000 60.38094  ? 151 MET A N   1 
ATOM   1148  C  CA  . MET A 1 151 ? 8.72046   -7.06467  10.54790  1.000 56.20785  ? 151 MET A CA  1 
ATOM   1149  C  C   . MET A 1 151 ? 8.47484   -6.29390  9.25700   1.000 57.12401  ? 151 MET A C   1 
ATOM   1150  O  O   . MET A 1 151 ? 8.39774   -6.88419  8.17319   1.000 52.56188  ? 151 MET A O   1 
ATOM   1151  C  CB  . MET A 1 151 ? 7.44893   -7.14109  11.39002  1.000 58.20361  ? 151 MET A CB  1 
ATOM   1152  C  CG  . MET A 1 151 ? 7.60675   -7.94089  12.67452  1.000 61.33928  ? 151 MET A CG  1 
ATOM   1153  S  SD  . MET A 1 151 ? 7.95851   -9.69064  12.37787  1.000 69.86057  ? 151 MET A SD  1 
ATOM   1154  C  CE  . MET A 1 151 ? 9.72997   -9.76538  12.64462  1.000 66.41558  ? 151 MET A CE  1 
ATOM   1155  N  N   . MET A 1 152 ? 8.34660   -4.97059  9.35099   1.000 55.20584  ? 152 MET A N   1 
ATOM   1156  C  CA  . MET A 1 152 ? 8.03427   -4.18410  8.16330   1.000 50.60638  ? 152 MET A CA  1 
ATOM   1157  C  C   . MET A 1 152 ? 9.20019   -4.17976  7.18011   1.000 52.68703  ? 152 MET A C   1 
ATOM   1158  O  O   . MET A 1 152 ? 9.00606   -4.37050  5.97305   1.000 51.59286  ? 152 MET A O   1 
ATOM   1159  C  CB  . MET A 1 152 ? 7.64903   -2.76001  8.56071   1.000 53.59840  ? 152 MET A CB  1 
ATOM   1160  C  CG  . MET A 1 152 ? 7.19665   -1.90802  7.38533   1.000 55.52020  ? 152 MET A CG  1 
ATOM   1161  S  SD  . MET A 1 152 ? 6.60438   -0.28001  7.87964   1.000 65.32236  ? 152 MET A SD  1 
ATOM   1162  C  CE  . MET A 1 152 ? 5.33271   -0.74630  9.03052   1.000 52.76228  ? 152 MET A CE  1 
ATOM   1163  N  N   . THR A 1 153 ? 10.42304  -3.96238  7.67527   1.000 49.45231  ? 153 THR A N   1 
ATOM   1164  C  CA  . THR A 1 153 ? 11.57125  -3.90099  6.77581   1.000 49.63630  ? 153 THR A CA  1 
ATOM   1165  C  C   . THR A 1 153 ? 11.87309  -5.25320  6.13571   1.000 47.59362  ? 153 THR A C   1 
ATOM   1166  O  O   . THR A 1 153 ? 12.33646  -5.29776  4.99131   1.000 48.99689  ? 153 THR A O   1 
ATOM   1167  C  CB  . THR A 1 153 ? 12.80338  -3.36435  7.51005   1.000 49.08692  ? 153 THR A CB  1 
ATOM   1168  O  OG1 . THR A 1 153 ? 13.92079  -3.33747  6.61145   1.000 47.32938  ? 153 THR A OG1 1 
ATOM   1169  C  CG2 . THR A 1 153 ? 13.14377  -4.22589  8.70903   1.000 51.68692  ? 153 THR A CG2 1 
ATOM   1170  N  N   . THR A 1 154 ? 11.61158  -6.36009  6.83738   1.000 48.96446  ? 154 THR A N   1 
ATOM   1171  C  CA  . THR A 1 154 ? 11.83890  -7.67550  6.24261   1.000 47.22898  ? 154 THR A CA  1 
ATOM   1172  C  C   . THR A 1 154 ? 10.81044  -7.97327  5.16213   1.000 45.08513  ? 154 THR A C   1 
ATOM   1173  O  O   . THR A 1 154 ? 11.16570  -8.32012  4.02920   1.000 42.96395  ? 154 THR A O   1 
ATOM   1174  C  CB  . THR A 1 154 ? 11.79315  -8.76711  7.31239   1.000 54.68213  ? 154 THR A CB  1 
ATOM   1175  O  OG1 . THR A 1 154 ? 12.74263  -8.47964  8.34544   1.000 54.82782  ? 154 THR A OG1 1 
ATOM   1176  C  CG2 . THR A 1 154 ? 12.09954  -10.12554 6.69560   1.000 48.97541  ? 154 THR A CG2 1 
ATOM   1177  N  N   . GLY A 1 155 ? 9.52619   -7.84515  5.50008   1.000 50.02286  ? 155 GLY A N   1 
ATOM   1178  C  CA  . GLY A 1 155 ? 8.48284   -8.12799  4.52949   1.000 46.43861  ? 155 GLY A CA  1 
ATOM   1179  C  C   . GLY A 1 155 ? 8.56877   -7.23572  3.30844   1.000 41.23966  ? 155 GLY A C   1 
ATOM   1180  O  O   . GLY A 1 155 ? 8.40955   -7.69983  2.17804   1.000 40.15757  ? 155 GLY A O   1 
ATOM   1181  N  N   . PHE A 1 156 ? 8.82319   -5.94099  3.51895   1.000 44.01412  ? 156 PHE A N   1 
ATOM   1182  C  CA  . PHE A 1 156 ? 8.97501   -5.03565  2.38688   1.000 41.49273  ? 156 PHE A CA  1 
ATOM   1183  C  C   . PHE A 1 156 ? 10.20265  -5.38763  1.55893   1.000 43.10052  ? 156 PHE A C   1 
ATOM   1184  O  O   . PHE A 1 156 ? 10.19730  -5.20396  0.33645   1.000 44.76236  ? 156 PHE A O   1 
ATOM   1185  C  CB  . PHE A 1 156 ? 9.06010   -3.58339  2.86270   1.000 45.58222  ? 156 PHE A CB  1 
ATOM   1186  C  CG  . PHE A 1 156 ? 7.75775   -3.02335  3.38034   1.000 40.94604  ? 156 PHE A CG  1 
ATOM   1187  C  CD1 . PHE A 1 156 ? 6.65657   -3.83637  3.58133   1.000 41.43765  ? 156 PHE A CD1 1 
ATOM   1188  C  CD2 . PHE A 1 156 ? 7.63549   -1.66879  3.64453   1.000 44.75171  ? 156 PHE A CD2 1 
ATOM   1189  C  CE1 . PHE A 1 156 ? 5.46651   -3.31371  4.05693   1.000 44.22605  ? 156 PHE A CE1 1 
ATOM   1190  C  CE2 . PHE A 1 156 ? 6.44786   -1.13940  4.11346   1.000 42.53948  ? 156 PHE A CE2 1 
ATOM   1191  C  CZ  . PHE A 1 156 ? 5.36343   -1.96108  4.32131   1.000 44.82558  ? 156 PHE A CZ  1 
ATOM   1192  N  N   . HIS A 1 157 ? 11.25633  -5.90220  2.19877   1.000 50.04626  ? 157 HIS A N   1 
ATOM   1193  C  CA  . HIS A 1 157 ? 12.43839  -6.31304  1.44811   1.000 42.31714  ? 157 HIS A CA  1 
ATOM   1194  C  C   . HIS A 1 157 ? 12.12119  -7.48528  0.53032   1.000 42.72837  ? 157 HIS A C   1 
ATOM   1195  O  O   . HIS A 1 157 ? 12.62747  -7.55371  -0.59556  1.000 44.62922  ? 157 HIS A O   1 
ATOM   1196  C  CB  . HIS A 1 157 ? 13.57299  -6.67248  2.40601   1.000 42.30436  ? 157 HIS A CB  1 
ATOM   1197  C  CG  . HIS A 1 157 ? 14.90258  -6.82146  1.73570   1.000 47.35341  ? 157 HIS A CG  1 
ATOM   1198  N  ND1 . HIS A 1 157 ? 15.37602  -5.91327  0.81361   1.000 44.71478  ? 157 HIS A ND1 1 
ATOM   1199  C  CD2 . HIS A 1 157 ? 15.86329  -7.76758  1.85861   1.000 51.58512  ? 157 HIS A CD2 1 
ATOM   1200  C  CE1 . HIS A 1 157 ? 16.56933  -6.29460  0.39414   1.000 43.27382  ? 157 HIS A CE1 1 
ATOM   1201  N  NE2 . HIS A 1 157 ? 16.88788  -7.41748  1.01226   1.000 53.65130  ? 157 HIS A NE2 1 
ATOM   1202  N  N   . GLY A 1 158 ? 11.28627  -8.41752  0.99496   1.000 39.80885  ? 158 GLY A N   1 
ATOM   1203  C  CA  . GLY A 1 158 ? 10.84381  -9.49309  0.12582   1.000 38.28614  ? 158 GLY A CA  1 
ATOM   1204  C  C   . GLY A 1 158 ? 10.12662  -8.97303  -1.10317  1.000 41.49126  ? 158 GLY A C   1 
ATOM   1205  O  O   . GLY A 1 158 ? 10.34970  -9.45474  -2.21585  1.000 43.35903  ? 158 GLY A O   1 
ATOM   1206  N  N   . ALA A 1 159 ? 9.26880   -7.96753  -0.92224  1.000 45.24760  ? 159 ALA A N   1 
ATOM   1207  C  CA  . ALA A 1 159 ? 8.59942   -7.36036  -2.06677  1.000 43.45914  ? 159 ALA A CA  1 
ATOM   1208  C  C   . ALA A 1 159 ? 9.59125   -6.62525  -2.96151  1.000 35.93255  ? 159 ALA A C   1 
ATOM   1209  O  O   . ALA A 1 159 ? 9.45930   -6.64981  -4.19056  1.000 42.93705  ? 159 ALA A O   1 
ATOM   1210  C  CB  . ALA A 1 159 ? 7.49542   -6.41885  -1.58772  1.000 35.28525  ? 159 ALA A CB  1 
ATOM   1211  N  N   . GLU A 1 160 ? 10.59059  -5.96487  -2.36680  1.000 38.73210  ? 160 GLU A N   1 
ATOM   1212  C  CA  . GLU A 1 160 ? 11.60899  -5.28601  -3.16756  1.000 34.33495  ? 160 GLU A CA  1 
ATOM   1213  C  C   . GLU A 1 160 ? 12.41874  -6.27858  -3.98992  1.000 38.85725  ? 160 GLU A C   1 
ATOM   1214  O  O   . GLU A 1 160 ? 12.67167  -6.05140  -5.17901  1.000 42.82026  ? 160 GLU A O   1 
ATOM   1215  C  CB  . GLU A 1 160 ? 12.53690  -4.46713  -2.27041  1.000 33.58996  ? 160 GLU A CB  1 
ATOM   1216  C  CG  . GLU A 1 160 ? 11.87856  -3.27706  -1.60643  1.000 42.35212  ? 160 GLU A CG  1 
ATOM   1217  C  CD  . GLU A 1 160 ? 12.75252  -2.64700  -0.53410  1.000 54.11490  ? 160 GLU A CD  1 
ATOM   1218  O  OE1 . GLU A 1 160 ? 13.52247  -3.38357  0.11816   1.000 53.55378  ? 160 GLU A OE1 1 
ATOM   1219  O  OE2 . GLU A 1 160 ? 12.67318  -1.41357  -0.34268  1.000 61.32294  ? 160 GLU A OE2 1 
ATOM   1220  N  N   . LEU A 1 161 ? 12.83483  -7.38725  -3.37196  1.000 39.61049  ? 161 LEU A N   1 
ATOM   1221  C  CA  . LEU A 1 161 ? 13.61106  -8.39277  -4.08960  1.000 38.49673  ? 161 LEU A CA  1 
ATOM   1222  C  C   . LEU A 1 161 ? 12.80708  -9.03249  -5.21057  1.000 36.31588  ? 161 LEU A C   1 
ATOM   1223  O  O   . LEU A 1 161 ? 13.38637  -9.52389  -6.18462  1.000 38.53127  ? 161 LEU A O   1 
ATOM   1224  C  CB  . LEU A 1 161 ? 14.10243  -9.47122  -3.12079  1.000 39.15003  ? 161 LEU A CB  1 
ATOM   1225  C  CG  . LEU A 1 161 ? 15.16495  -9.08819  -2.09010  1.000 39.35200  ? 161 LEU A CG  1 
ATOM   1226  C  CD1 . LEU A 1 161 ? 15.37339  -10.22644 -1.11468  1.000 43.38820  ? 161 LEU A CD1 1 
ATOM   1227  C  CD2 . LEU A 1 161 ? 16.47376  -8.73933  -2.77666  1.000 31.94790  ? 161 LEU A CD2 1 
ATOM   1228  N  N   . ALA A 1 162 ? 11.47847  -9.03819  -5.09388  1.000 35.05096  ? 162 ALA A N   1 
ATOM   1229  C  CA  . ALA A 1 162 ? 10.64577  -9.76309  -6.04495  1.000 39.73319  ? 162 ALA A CA  1 
ATOM   1230  C  C   . ALA A 1 162 ? 10.62780  -9.13506  -7.43280  1.000 37.15961  ? 162 ALA A C   1 
ATOM   1231  O  O   . ALA A 1 162 ? 10.20459  -9.80129  -8.38360  1.000 51.64884  ? 162 ALA A O   1 
ATOM   1232  C  CB  . ALA A 1 162 ? 9.21747   -9.86841  -5.51254  1.000 36.47215  ? 162 ALA A CB  1 
ATOM   1233  N  N   . ASP A 1 163 ? 11.07363  -7.88735  -7.57661  1.000 43.90776  ? 163 ASP A N   1 
ATOM   1234  C  CA  . ASP A 1 163 ? 11.07122  -7.18864  -8.86444  1.000 47.01620  ? 163 ASP A CA  1 
ATOM   1235  C  C   . ASP A 1 163 ? 9.67292   -7.19570  -9.48473  1.000 43.10640  ? 163 ASP A C   1 
ATOM   1236  O  O   . ASP A 1 163 ? 9.44105   -7.71481  -10.57723 1.000 44.05679  ? 163 ASP A O   1 
ATOM   1237  C  CB  . ASP A 1 163 ? 12.10310  -7.78908  -9.82290  1.000 54.26651  ? 163 ASP A CB  1 
ATOM   1238  C  CG  . ASP A 1 163 ? 13.52830  -7.50818  -9.39452  1.000 56.27295  ? 163 ASP A CG  1 
ATOM   1239  O  OD1 . ASP A 1 163 ? 13.75087  -6.49576  -8.69525  1.000 67.39025  ? 163 ASP A OD1 1 
ATOM   1240  O  OD2 . ASP A 1 163 ? 14.42595  -8.29989  -9.75849  1.000 70.91238  ? 163 ASP A OD2 1 
ATOM   1241  N  N   . ILE A 1 164 ? 8.73087   -6.62462  -8.74248  1.000 48.84077  ? 164 ILE A N   1 
ATOM   1242  C  CA  . ILE A 1 164 ? 7.32693   -6.61492  -9.13963  1.000 40.41654  ? 164 ILE A CA  1 
ATOM   1243  C  C   . ILE A 1 164 ? 7.10065   -5.50177  -10.15645 1.000 40.85698  ? 164 ILE A C   1 
ATOM   1244  O  O   . ILE A 1 164 ? 7.40733   -4.33320  -9.89575  1.000 41.50743  ? 164 ILE A O   1 
ATOM   1245  C  CB  . ILE A 1 164 ? 6.41685   -6.43650  -7.91647  1.000 36.95546  ? 164 ILE A CB  1 
ATOM   1246  C  CG1 . ILE A 1 164 ? 6.61789   -7.59337  -6.93704  1.000 42.95688  ? 164 ILE A CG1 1 
ATOM   1247  C  CG2 . ILE A 1 164 ? 4.95813   -6.33765  -8.33601  1.000 36.21904  ? 164 ILE A CG2 1 
ATOM   1248  C  CD1 . ILE A 1 164 ? 5.96174   -7.37005  -5.59437  1.000 44.86088  ? 164 ILE A CD1 1 
ATOM   1249  N  N   . GLU A 1 165 ? 6.56978   -5.86224  -11.31841 1.000 45.14482  ? 165 GLU A N   1 
ATOM   1250  C  CA  . GLU A 1 165 ? 6.10445   -4.88321  -12.28792 1.000 41.67391  ? 165 GLU A CA  1 
ATOM   1251  C  C   . GLU A 1 165 ? 4.65411   -4.51316  -11.98604 1.000 36.76400  ? 165 GLU A C   1 
ATOM   1252  O  O   . GLU A 1 165 ? 3.91951   -5.26848  -11.34594 1.000 41.49300  ? 165 GLU A O   1 
ATOM   1253  C  CB  . GLU A 1 165 ? 6.23845   -5.43393  -13.70686 1.000 38.73902  ? 165 GLU A CB  1 
ATOM   1254  C  CG  . GLU A 1 165 ? 7.66250   -5.82313  -14.07592 1.000 51.16012  ? 165 GLU A CG  1 
ATOM   1255  C  CD  . GLU A 1 165 ? 7.72546   -6.88507  -15.16355 1.000 74.63497  ? 165 GLU A CD  1 
ATOM   1256  O  OE1 . GLU A 1 165 ? 6.75128   -7.65562  -15.30511 1.000 79.12145  ? 165 GLU A OE1 1 
ATOM   1257  O  OE2 . GLU A 1 165 ? 8.75162   -6.95269  -15.87627 1.000 83.27204  ? 165 GLU A OE2 1 
ATOM   1258  N  N   . LEU A 1 166 ? 4.25065   -3.32594  -12.43831 1.000 37.63913  ? 166 LEU A N   1 
ATOM   1259  C  CA  . LEU A 1 166 ? 2.90432   -2.84165  -12.15134 1.000 28.08435  ? 166 LEU A CA  1 
ATOM   1260  C  C   . LEU A 1 166 ? 1.86157   -3.79192  -12.72079 1.000 39.26424  ? 166 LEU A C   1 
ATOM   1261  O  O   . LEU A 1 166 ? 1.89429   -4.13131  -13.90681 1.000 43.78119  ? 166 LEU A O   1 
ATOM   1262  C  CB  . LEU A 1 166 ? 2.69719   -1.44056  -12.72217 1.000 30.28330  ? 166 LEU A CB  1 
ATOM   1263  C  CG  . LEU A 1 166 ? 3.39073   -0.28940  -12.00100 1.000 36.03617  ? 166 LEU A CG  1 
ATOM   1264  C  CD1 . LEU A 1 166 ? 3.01054   1.04405   -12.63301 1.000 27.88054  ? 166 LEU A CD1 1 
ATOM   1265  C  CD2 . LEU A 1 166 ? 3.03936   -0.31126  -10.52378 1.000 45.06919  ? 166 LEU A CD2 1 
ATOM   1266  N  N   . GLY A 1 167 ? 0.94283   -4.23003  -11.86324 1.000 37.10636  ? 167 GLY A N   1 
ATOM   1267  C  CA  . GLY A 1 167 ? -0.11478  -5.13850  -12.24815 1.000 33.08094  ? 167 GLY A CA  1 
ATOM   1268  C  C   . GLY A 1 167 ? 0.24409   -6.60601  -12.20515 1.000 34.66565  ? 167 GLY A C   1 
ATOM   1269  O  O   . GLY A 1 167 ? -0.61139  -7.44472  -12.52308 1.000 34.90073  ? 167 GLY A O   1 
ATOM   1270  N  N   . ALA A 1 168 ? 1.46619   -6.94635  -11.80509 1.000 42.12614  ? 168 ALA A N   1 
ATOM   1271  C  CA  . ALA A 1 168 ? 1.89534   -8.33440  -11.78683 1.000 35.37277  ? 168 ALA A CA  1 
ATOM   1272  C  C   . ALA A 1 168 ? 1.16522   -9.11592  -10.69968 1.000 34.00297  ? 168 ALA A C   1 
ATOM   1273  O  O   . ALA A 1 168 ? 0.66136   -8.55813  -9.72055  1.000 37.20533  ? 168 ALA A O   1 
ATOM   1274  C  CB  . ALA A 1 168 ? 3.40464   -8.43138  -11.56561 1.000 34.98146  ? 168 ALA A CB  1 
ATOM   1275  N  N   . THR A 1 169 ? 1.11522   -10.43036 -10.89189 1.000 31.65273  ? 169 THR A N   1 
ATOM   1276  C  CA  . THR A 1 169 ? 0.51105   -11.34577 -9.93623  1.000 34.44810  ? 169 THR A CA  1 
ATOM   1277  C  C   . THR A 1 169 ? 1.58910   -11.88142 -9.00837  1.000 37.45642  ? 169 THR A C   1 
ATOM   1278  O  O   . THR A 1 169 ? 2.61347   -12.39756 -9.46833  1.000 40.97602  ? 169 THR A O   1 
ATOM   1279  C  CB  . THR A 1 169 ? -0.19457  -12.49511 -10.65566 1.000 31.67147  ? 169 THR A CB  1 
ATOM   1280  O  OG1 . THR A 1 169 ? -1.30561  -11.97740 -11.39893 1.000 39.01422  ? 169 THR A OG1 1 
ATOM   1281  C  CG2 . THR A 1 169 ? -0.68254  -13.53574 -9.66216  1.000 33.33764  ? 169 THR A CG2 1 
ATOM   1282  N  N   . VAL A 1 170 ? 1.36880   -11.73086 -7.70635  1.000 34.46428  ? 170 VAL A N   1 
ATOM   1283  C  CA  . VAL A 1 170 ? 2.36017   -12.06608 -6.69341  1.000 40.61807  ? 170 VAL A CA  1 
ATOM   1284  C  C   . VAL A 1 170 ? 1.75891   -13.08417 -5.73918  1.000 40.34620  ? 170 VAL A C   1 
ATOM   1285  O  O   . VAL A 1 170 ? 0.62728   -12.91285 -5.27037  1.000 46.00957  ? 170 VAL A O   1 
ATOM   1286  C  CB  . VAL A 1 170 ? 2.82946   -10.81519 -5.92742  1.000 38.49054  ? 170 VAL A CB  1 
ATOM   1287  C  CG1 . VAL A 1 170 ? 3.82137   -11.19382 -4.84128  1.000 41.07406  ? 170 VAL A CG1 1 
ATOM   1288  C  CG2 . VAL A 1 170 ? 3.44181   -9.80820  -6.88277  1.000 35.63676  ? 170 VAL A CG2 1 
ATOM   1289  N  N   . ALA A 1 171 ? 2.51610   -14.13605 -5.44946  1.000 38.08474  ? 171 ALA A N   1 
ATOM   1290  C  CA  . ALA A 1 171 ? 2.16391   -15.09204 -4.41484  1.000 41.99551  ? 171 ALA A CA  1 
ATOM   1291  C  C   . ALA A 1 171 ? 3.07123   -14.86795 -3.21560  1.000 41.87639  ? 171 ALA A C   1 
ATOM   1292  O  O   . ALA A 1 171 ? 4.28054   -14.67292 -3.37008  1.000 42.94332  ? 171 ALA A O   1 
ATOM   1293  C  CB  . ALA A 1 171 ? 2.29457   -16.53410 -4.91328  1.000 34.80157  ? 171 ALA A CB  1 
ATOM   1294  N  N   . VAL A 1 172 ? 2.48232   -14.88497 -2.02455  1.000 39.64787  ? 172 VAL A N   1 
ATOM   1295  C  CA  . VAL A 1 172 ? 3.21572   -14.74372 -0.77315  1.000 41.92469  ? 172 VAL A CA  1 
ATOM   1296  C  C   . VAL A 1 172 ? 3.03035   -16.04110 -0.00316  1.000 40.10636  ? 172 VAL A C   1 
ATOM   1297  O  O   . VAL A 1 172 ? 1.92173   -16.35102 0.45149   1.000 48.30702  ? 172 VAL A O   1 
ATOM   1298  C  CB  . VAL A 1 172 ? 2.74457   -13.53442 0.04459   1.000 37.34572  ? 172 VAL A CB  1 
ATOM   1299  C  CG1 . VAL A 1 172 ? 3.52337   -13.44342 1.34476   1.000 39.85397  ? 172 VAL A CG1 1 
ATOM   1300  C  CG2 . VAL A 1 172 ? 2.91550   -12.25600 -0.76234  1.000 35.32385  ? 172 VAL A CG2 1 
ATOM   1301  N  N   . LEU A 1 173 ? 4.10915   -16.80379 0.13590   1.000 46.54282  ? 173 LEU A N   1 
ATOM   1302  C  CA  . LEU A 1 173 ? 4.06593   -18.11315 0.77632   1.000 44.70438  ? 173 LEU A CA  1 
ATOM   1303  C  C   . LEU A 1 173 ? 4.33833   -17.93280 2.26540   1.000 54.84209  ? 173 LEU A C   1 
ATOM   1304  O  O   . LEU A 1 173 ? 5.48213   -17.69934 2.67200   1.000 50.65649  ? 173 LEU A O   1 
ATOM   1305  C  CB  . LEU A 1 173 ? 5.08507   -19.04619 0.12904   1.000 50.33022  ? 173 LEU A CB  1 
ATOM   1306  C  CG  . LEU A 1 173 ? 4.98565   -19.14386 -1.39800  1.000 47.44318  ? 173 LEU A CG  1 
ATOM   1307  C  CD1 . LEU A 1 173 ? 6.05992   -20.06287 -1.95461  1.000 50.72382  ? 173 LEU A CD1 1 
ATOM   1308  C  CD2 . LEU A 1 173 ? 3.60254   -19.62047 -1.82500  1.000 45.65120  ? 173 LEU A CD2 1 
ATOM   1309  N  N   . GLY A 1 174 ? 3.28896   -18.04117 3.07767   1.000 56.82914  ? 174 GLY A N   1 
ATOM   1310  C  CA  . GLY A 1 174 ? 3.41031   -17.80954 4.50338   1.000 52.14956  ? 174 GLY A CA  1 
ATOM   1311  C  C   . GLY A 1 174 ? 2.90547   -16.43743 4.89881   1.000 58.41654  ? 174 GLY A C   1 
ATOM   1312  O  O   . GLY A 1 174 ? 3.36337   -15.42719 4.35911   1.000 55.06198  ? 174 GLY A O   1 
ATOM   1313  N  N   . ILE A 1 175 ? 1.95713   -16.37823 5.83181   1.000 66.68770  ? 175 ILE A N   1 
ATOM   1314  C  CA  . ILE A 1 175 ? 1.39172   -15.09614 6.23424   1.000 53.50783  ? 175 ILE A CA  1 
ATOM   1315  C  C   . ILE A 1 175 ? 1.55016   -14.90076 7.73455   1.000 57.71162  ? 175 ILE A C   1 
ATOM   1316  O  O   . ILE A 1 175 ? 0.60674   -14.49817 8.42470   1.000 61.36002  ? 175 ILE A O   1 
ATOM   1317  C  CB  . ILE A 1 175 ? -0.08564  -14.97407 5.81986   1.000 56.41331  ? 175 ILE A CB  1 
ATOM   1318  C  CG1 . ILE A 1 175 ? -0.87153  -16.21707 6.23089   1.000 62.28092  ? 175 ILE A CG1 1 
ATOM   1319  C  CG2 . ILE A 1 175 ? -0.19527  -14.75467 4.32353   1.000 59.39529  ? 175 ILE A CG2 1 
ATOM   1320  C  CD1 . ILE A 1 175 ? -2.35648  -16.09831 5.96486   1.000 65.86375  ? 175 ILE A CD1 1 
ATOM   1321  N  N   . GLY A 1 176 ? 2.74534   -15.17360 8.24886   1.000 65.45217  ? 176 GLY A N   1 
ATOM   1322  C  CA  . GLY A 1 176 ? 3.12060   -14.69255 9.55434   1.000 63.49570  ? 176 GLY A CA  1 
ATOM   1323  C  C   . GLY A 1 176 ? 3.32632   -13.19316 9.49106   1.000 59.36082  ? 176 GLY A C   1 
ATOM   1324  O  O   . GLY A 1 176 ? 3.03980   -12.55453 8.47395   1.000 54.06656  ? 176 GLY A O   1 
ATOM   1325  N  N   . PRO A 1 177 ? 3.82241   -12.59561 10.57495  1.000 61.09225  ? 177 PRO A N   1 
ATOM   1326  C  CA  . PRO A 1 177 ? 4.05228   -11.14067 10.55527  1.000 57.98705  ? 177 PRO A CA  1 
ATOM   1327  C  C   . PRO A 1 177 ? 4.91769   -10.67850 9.38892   1.000 55.08024  ? 177 PRO A C   1 
ATOM   1328  O  O   . PRO A 1 177 ? 4.62718   -9.63495  8.79126   1.000 57.53989  ? 177 PRO A O   1 
ATOM   1329  C  CB  . PRO A 1 177 ? 4.71535   -10.87367 11.91572  1.000 60.91111  ? 177 PRO A CB  1 
ATOM   1330  C  CG  . PRO A 1 177 ? 5.15419   -12.21368 12.42259  1.000 62.61148  ? 177 PRO A CG  1 
ATOM   1331  C  CD  . PRO A 1 177 ? 4.17694   -13.19425 11.87025  1.000 61.91186  ? 177 PRO A CD  1 
ATOM   1332  N  N   . VAL A 1 178 ? 5.96450   -11.42990 9.03665   1.000 54.49257  ? 178 VAL A N   1 
ATOM   1333  C  CA  . VAL A 1 178 ? 6.79108   -11.06095 7.88838   1.000 51.79008  ? 178 VAL A CA  1 
ATOM   1334  C  C   . VAL A 1 178 ? 5.99641   -11.19504 6.59470   1.000 49.14470  ? 178 VAL A C   1 
ATOM   1335  O  O   . VAL A 1 178 ? 6.03012   -10.31111 5.73080   1.000 51.24758  ? 178 VAL A O   1 
ATOM   1336  C  CB  . VAL A 1 178 ? 8.07730   -11.90756 7.85238   1.000 56.80110  ? 178 VAL A CB  1 
ATOM   1337  C  CG1 . VAL A 1 178 ? 8.80963   -11.71763 6.52755   1.000 49.13322  ? 178 VAL A CG1 1 
ATOM   1338  C  CG2 . VAL A 1 178 ? 8.98629   -11.54039 9.01287   1.000 55.51883  ? 178 VAL A CG2 1 
ATOM   1339  N  N   . GLY A 1 179 ? 5.26675   -12.30010 6.44359   1.000 50.67167  ? 179 GLY A N   1 
ATOM   1340  C  CA  . GLY A 1 179 ? 4.47974   -12.49304 5.23744   1.000 46.96607  ? 179 GLY A CA  1 
ATOM   1341  C  C   . GLY A 1 179 ? 3.37878   -11.46234 5.08391   1.000 46.35603  ? 179 GLY A C   1 
ATOM   1342  O  O   . GLY A 1 179 ? 3.06477   -11.03681 3.96956   1.000 43.97488  ? 179 GLY A O   1 
ATOM   1343  N  N   . LEU A 1 180 ? 2.77402   -11.04829 6.19902   1.000 48.60990  ? 180 LEU A N   1 
ATOM   1344  C  CA  . LEU A 1 180 ? 1.74771   -10.01421 6.12980   1.000 51.73756  ? 180 LEU A CA  1 
ATOM   1345  C  C   . LEU A 1 180 ? 2.33626   -8.69444  5.65032   1.000 51.59320  ? 180 LEU A C   1 
ATOM   1346  O  O   . LEU A 1 180 ? 1.71031   -7.97521  4.86091   1.000 51.02619  ? 180 LEU A O   1 
ATOM   1347  C  CB  . LEU A 1 180 ? 1.07499   -9.85030  7.49289   1.000 51.28527  ? 180 LEU A CB  1 
ATOM   1348  C  CG  . LEU A 1 180 ? 0.27047   -11.06739 7.95226   1.000 52.85029  ? 180 LEU A CG  1 
ATOM   1349  C  CD1 . LEU A 1 180 ? -0.22809  -10.89785 9.37795   1.000 57.84422  ? 180 LEU A CD1 1 
ATOM   1350  C  CD2 . LEU A 1 180 ? -0.89018  -11.32861 7.00692   1.000 51.85339  ? 180 LEU A CD2 1 
ATOM   1351  N  N   . MET A 1 181 ? 3.56018   -8.37749  6.07975   1.000 47.89323  ? 181 MET A N   1 
ATOM   1352  C  CA  . MET A 1 181 ? 4.21338   -7.18183  5.56510   1.000 48.18910  ? 181 MET A CA  1 
ATOM   1353  C  C   . MET A 1 181 ? 4.68298   -7.38201  4.13180   1.000 44.21054  ? 181 MET A C   1 
ATOM   1354  O  O   . MET A 1 181 ? 4.77206   -6.41336  3.36920   1.000 41.45433  ? 181 MET A O   1 
ATOM   1355  C  CB  . MET A 1 181 ? 5.38005   -6.79017  6.46846   1.000 47.68222  ? 181 MET A CB  1 
ATOM   1356  C  CG  . MET A 1 181 ? 4.94951   -6.23056  7.81342   1.000 50.46518  ? 181 MET A CG  1 
ATOM   1357  S  SD  . MET A 1 181 ? 4.09250   -4.64476  7.69249   1.000 50.14769  ? 181 MET A SD  1 
ATOM   1358  C  CE  . MET A 1 181 ? 2.37797   -5.15293  7.72940   1.000 50.60254  ? 181 MET A CE  1 
ATOM   1359  N  N   . ALA A 1 182 ? 4.96563   -8.62626  3.74120   1.000 46.63319  ? 182 ALA A N   1 
ATOM   1360  C  CA  . ALA A 1 182 ? 5.26327   -8.90373  2.34060   1.000 42.40282  ? 182 ALA A CA  1 
ATOM   1361  C  C   . ALA A 1 182 ? 4.03190   -8.69108  1.47124   1.000 44.58603  ? 182 ALA A C   1 
ATOM   1362  O  O   . ALA A 1 182 ? 4.14082   -8.19964  0.34196   1.000 43.75706  ? 182 ALA A O   1 
ATOM   1363  C  CB  . ALA A 1 182 ? 5.79231   -10.32977 2.18575   1.000 39.98389  ? 182 ALA A CB  1 
ATOM   1364  N  N   . VAL A 1 183 ? 2.85121   -9.05023  1.98320   1.000 42.72973  ? 183 VAL A N   1 
ATOM   1365  C  CA  . VAL A 1 183 ? 1.60920   -8.77511  1.26245   1.000 39.10093  ? 183 VAL A CA  1 
ATOM   1366  C  C   . VAL A 1 183 ? 1.42313   -7.27274  1.09404   1.000 42.89501  ? 183 VAL A C   1 
ATOM   1367  O  O   . VAL A 1 183 ? 1.10329   -6.78583  0.00357   1.000 44.75651  ? 183 VAL A O   1 
ATOM   1368  C  CB  . VAL A 1 183 ? 0.41014   -9.41391  1.98672   1.000 45.76808  ? 183 VAL A CB  1 
ATOM   1369  C  CG1 . VAL A 1 183 ? -0.89740  -8.92605  1.37665   1.000 44.98644  ? 183 VAL A CG1 1 
ATOM   1370  C  CG2 . VAL A 1 183 ? 0.49593   -10.93778 1.92948   1.000 40.30144  ? 183 VAL A CG2 1 
ATOM   1371  N  N   . ALA A 1 184 ? 1.61619   -6.51590  2.17758   1.000 43.91751  ? 184 ALA A N   1 
ATOM   1372  C  CA  . ALA A 1 184 ? 1.52261   -5.06256  2.09198   1.000 42.81916  ? 184 ALA A CA  1 
ATOM   1373  C  C   . ALA A 1 184 ? 2.60661   -4.48915  1.18711   1.000 43.14470  ? 184 ALA A C   1 
ATOM   1374  O  O   . ALA A 1 184 ? 2.36164   -3.53342  0.44063   1.000 45.68979  ? 184 ALA A O   1 
ATOM   1375  C  CB  . ALA A 1 184 ? 1.60750   -4.44970  3.48857   1.000 49.55608  ? 184 ALA A CB  1 
ATOM   1376  N  N   . GLY A 1 185 ? 3.81257   -5.06027  1.23668   1.000 40.60005  ? 185 GLY A N   1 
ATOM   1377  C  CA  . GLY A 1 185 ? 4.88061   -4.57785  0.37695   1.000 40.08759  ? 185 GLY A CA  1 
ATOM   1378  C  C   . GLY A 1 185 ? 4.57851   -4.76749  -1.09695  1.000 42.85035  ? 185 GLY A C   1 
ATOM   1379  O  O   . GLY A 1 185 ? 4.87155   -3.89447  -1.91739  1.000 41.44934  ? 185 GLY A O   1 
ATOM   1380  N  N   . ALA A 1 186 ? 3.99858   -5.91490  -1.45538  1.000 42.85840  ? 186 ALA A N   1 
ATOM   1381  C  CA  . ALA A 1 186 ? 3.62008   -6.14583  -2.84508  1.000 44.09818  ? 186 ALA A CA  1 
ATOM   1382  C  C   . ALA A 1 186 ? 2.56500   -5.14638  -3.30069  1.000 44.31285  ? 186 ALA A C   1 
ATOM   1383  O  O   . ALA A 1 186 ? 2.62705   -4.63588  -4.42574  1.000 39.66405  ? 186 ALA A O   1 
ATOM   1384  C  CB  . ALA A 1 186 ? 3.11337   -7.57534  -3.02148  1.000 37.11759  ? 186 ALA A CB  1 
ATOM   1385  N  N   . LYS A 1 187 ? 1.59050   -4.84987  -2.43627  1.000 39.01678  ? 187 LYS A N   1 
ATOM   1386  C  CA  . LYS A 1 187 ? 0.60689   -3.82266  -2.75933  1.000 41.50639  ? 187 LYS A CA  1 
ATOM   1387  C  C   . LYS A 1 187 ? 1.27755   -2.47104  -2.96497  1.000 41.49510  ? 187 LYS A C   1 
ATOM   1388  O  O   . LYS A 1 187 ? 0.85594   -1.68553  -3.82162  1.000 46.36668  ? 187 LYS A O   1 
ATOM   1389  C  CB  . LYS A 1 187 ? -0.44656  -3.73873  -1.65546  1.000 40.78069  ? 187 LYS A CB  1 
ATOM   1390  C  CG  . LYS A 1 187 ? -1.57375  -2.75916  -1.94039  1.000 47.55795  ? 187 LYS A CG  1 
ATOM   1391  C  CD  . LYS A 1 187 ? -2.52822  -2.65302  -0.75924  1.000 51.73593  ? 187 LYS A CD  1 
ATOM   1392  C  CE  . LYS A 1 187 ? -3.64593  -1.66408  -1.04563  1.000 52.31991  ? 187 LYS A CE  1 
ATOM   1393  N  NZ  . LYS A 1 187 ? -3.11753  -0.29421  -1.30281  1.000 72.24555  ? 187 LYS A NZ  1 
ATOM   1394  N  N   . LEU A 1 188 ? 2.33246   -2.18528  -2.19448  1.000 45.16342  ? 188 LEU A N   1 
ATOM   1395  C  CA  . LEU A 1 188 ? 3.05800   -0.93059  -2.36046  1.000 43.99400  ? 188 LEU A CA  1 
ATOM   1396  C  C   . LEU A 1 188 ? 3.89276   -0.91349  -3.63175  1.000 47.99165  ? 188 LEU A C   1 
ATOM   1397  O  O   . LEU A 1 188 ? 4.21199   0.16970   -4.13029  1.000 48.29965  ? 188 LEU A O   1 
ATOM   1398  C  CB  . LEU A 1 188 ? 3.95523   -0.66065  -1.14948  1.000 42.85676  ? 188 LEU A CB  1 
ATOM   1399  C  CG  . LEU A 1 188 ? 3.27080   -0.24565  0.15660   1.000 42.70794  ? 188 LEU A CG  1 
ATOM   1400  C  CD1 . LEU A 1 188 ? 4.28761   -0.11629  1.28045   1.000 41.98279  ? 188 LEU A CD1 1 
ATOM   1401  C  CD2 . LEU A 1 188 ? 2.53519   1.06735   -0.03548  1.000 47.93786  ? 188 LEU A CD2 1 
ATOM   1402  N  N   . ARG A 1 189 ? 4.25299   -2.07817  -4.16502  1.000 38.26279  ? 189 ARG A N   1 
ATOM   1403  C  CA  . ARG A 1 189 ? 4.96482   -2.16362  -5.43143  1.000 38.08423  ? 189 ARG A CA  1 
ATOM   1404  C  C   . ARG A 1 189 ? 4.02706   -2.24849  -6.62896  1.000 38.56612  ? 189 ARG A C   1 
ATOM   1405  O  O   . ARG A 1 189 ? 4.48413   -2.53091  -7.74207  1.000 40.20941  ? 189 ARG A O   1 
ATOM   1406  C  CB  . ARG A 1 189 ? 5.91159   -3.36540  -5.42798  1.000 36.49294  ? 189 ARG A CB  1 
ATOM   1407  C  CG  . ARG A 1 189 ? 7.19976   -3.12206  -4.67300  1.000 48.97536  ? 189 ARG A CG  1 
ATOM   1408  C  CD  . ARG A 1 189 ? 7.69009   -1.71290  -4.92369  1.000 45.07592  ? 189 ARG A CD  1 
ATOM   1409  N  NE  . ARG A 1 189 ? 9.14005   -1.60562  -4.85113  1.000 57.98734  ? 189 ARG A NE  1 
ATOM   1410  C  CZ  . ARG A 1 189 ? 9.81162   -0.46851  -4.97659  1.000 57.69093  ? 189 ARG A CZ  1 
ATOM   1411  N  NH1 . ARG A 1 189 ? 9.18968   0.68561   -5.16349  1.000 45.64737  ? 189 ARG A NH1 1 
ATOM   1412  N  NH2 . ARG A 1 189 ? 11.14030  -0.48924  -4.91009  1.000 59.08278  ? 189 ARG A NH2 1 
ATOM   1413  N  N   . GLY A 1 190 ? 2.73350   -2.01299  -6.42746  1.000 36.83677  ? 190 GLY A N   1 
ATOM   1414  C  CA  . GLY A 1 190 ? 1.80239   -1.97840  -7.53403  1.000 35.55324  ? 190 GLY A CA  1 
ATOM   1415  C  C   . GLY A 1 190 ? 1.32171   -3.32302  -8.00923  1.000 33.90748  ? 190 GLY A C   1 
ATOM   1416  O  O   . GLY A 1 190 ? 0.89497   -3.44153  -9.16146  1.000 43.02438  ? 190 GLY A O   1 
ATOM   1417  N  N   . ALA A 1 191 ? 1.39417   -4.34913  -7.16969  1.000 39.05893  ? 191 ALA A N   1 
ATOM   1418  C  CA  . ALA A 1 191 ? 0.88843   -5.65505  -7.55983  1.000 36.92078  ? 191 ALA A CA  1 
ATOM   1419  C  C   . ALA A 1 191 ? -0.62294  -5.60206  -7.73609  1.000 37.00485  ? 191 ALA A C   1 
ATOM   1420  O  O   . ALA A 1 191 ? -1.32389  -4.87923  -7.02215  1.000 39.37258  ? 191 ALA A O   1 
ATOM   1421  C  CB  . ALA A 1 191 ? 1.26566   -6.70723  -6.51901  1.000 30.50597  ? 191 ALA A CB  1 
ATOM   1422  N  N   . GLY A 1 192 ? -1.12255  -6.35687  -8.70897  1.000 35.85559  ? 192 GLY A N   1 
ATOM   1423  C  CA  . GLY A 1 192 ? -2.55325  -6.49096  -8.87950  1.000 30.38310  ? 192 GLY A CA  1 
ATOM   1424  C  C   . GLY A 1 192 ? -3.08932  -7.60869  -8.01366  1.000 41.96848  ? 192 GLY A C   1 
ATOM   1425  O  O   . GLY A 1 192 ? -3.46167  -7.38769  -6.85653  1.000 42.47389  ? 192 GLY A O   1 
ATOM   1426  N  N   . ARG A 1 193 ? -3.12394  -8.81792  -8.56446  1.000 34.64243  ? 193 ARG A N   1 
ATOM   1427  C  CA  . ARG A 1 193 ? -3.55967  -9.97828  -7.80313  1.000 39.05950  ? 193 ARG A CA  1 
ATOM   1428  C  C   . ARG A 1 193 ? -2.46966  -10.39591 -6.82423  1.000 46.02043  ? 193 ARG A C   1 
ATOM   1429  O  O   . ARG A 1 193 ? -1.31044  -10.57154 -7.21017  1.000 43.40289  ? 193 ARG A O   1 
ATOM   1430  C  CB  . ARG A 1 193 ? -3.88920  -11.12904 -8.75063  1.000 41.28700  ? 193 ARG A CB  1 
ATOM   1431  C  CG  . ARG A 1 193 ? -4.63331  -12.28131 -8.10932  1.000 42.56337  ? 193 ARG A CG  1 
ATOM   1432  C  CD  . ARG A 1 193 ? -5.00448  -13.31855 -9.15268  1.000 40.19561  ? 193 ARG A CD  1 
ATOM   1433  N  NE  . ARG A 1 193 ? -5.98260  -14.27009 -8.64631  1.000 48.16924  ? 193 ARG A NE  1 
ATOM   1434  C  CZ  . ARG A 1 193 ? -6.48785  -15.26909 -9.35492  1.000 46.91273  ? 193 ARG A CZ  1 
ATOM   1435  N  NH1 . ARG A 1 193 ? -6.12052  -15.48218 -10.60751 1.000 57.89412  ? 193 ARG A NH1 1 
ATOM   1436  N  NH2 . ARG A 1 193 ? -7.38644  -16.07172 -8.79411  1.000 53.87542  ? 193 ARG A NH2 1 
ATOM   1437  N  N   . ILE A 1 194 ? -2.83947  -10.56434 -5.55788  1.000 43.89677  ? 194 ILE A N   1 
ATOM   1438  C  CA  . ILE A 1 194 ? -1.92056  -11.02756 -4.52335  1.000 44.42587  ? 194 ILE A CA  1 
ATOM   1439  C  C   . ILE A 1 194 ? -2.53012  -12.27111 -3.89338  1.000 41.69781  ? 194 ILE A C   1 
ATOM   1440  O  O   . ILE A 1 194 ? -3.58970  -12.19904 -3.25686  1.000 47.56544  ? 194 ILE A O   1 
ATOM   1441  C  CB  . ILE A 1 194 ? -1.64649  -9.95034  -3.46653  1.000 46.20066  ? 194 ILE A CB  1 
ATOM   1442  C  CG1 . ILE A 1 194 ? -1.05777  -8.69876  -4.11761  1.000 42.09621  ? 194 ILE A CG1 1 
ATOM   1443  C  CG2 . ILE A 1 194 ? -0.70482  -10.48337 -2.39339  1.000 37.89738  ? 194 ILE A CG2 1 
ATOM   1444  C  CD1 . ILE A 1 194 ? -0.80439  -7.57289  -3.13640  1.000 46.71861  ? 194 ILE A CD1 1 
ATOM   1445  N  N   . ILE A 1 195 ? -1.86644  -13.40894 -4.06923  1.000 34.92108  ? 195 ILE A N   1 
ATOM   1446  C  CA  . ILE A 1 195 ? -2.33209  -14.69018 -3.55431  1.000 37.93145  ? 195 ILE A CA  1 
ATOM   1447  C  C   . ILE A 1 195 ? -1.52909  -15.02824 -2.30630  1.000 46.02960  ? 195 ILE A C   1 
ATOM   1448  O  O   . ILE A 1 195 ? -0.30581  -15.19578 -2.37183  1.000 43.60837  ? 195 ILE A O   1 
ATOM   1449  C  CB  . ILE A 1 195 ? -2.19925  -15.79706 -4.60950  1.000 46.00330  ? 195 ILE A CB  1 
ATOM   1450  C  CG1 . ILE A 1 195 ? -2.92582  -15.39640 -5.89442  1.000 46.94635  ? 195 ILE A CG1 1 
ATOM   1451  C  CG2 . ILE A 1 195 ? -2.73994  -17.10220 -4.06707  1.000 44.92421  ? 195 ILE A CG2 1 
ATOM   1452  C  CD1 . ILE A 1 195 ? -2.75922  -16.38959 -7.01643  1.000 47.09470  ? 195 ILE A CD1 1 
ATOM   1453  N  N   . ALA A 1 196 ? -2.20969  -15.13213 -1.17115  1.000 43.06570  ? 196 ALA A N   1 
ATOM   1454  C  CA  . ALA A 1 196 ? -1.56758  -15.42103 0.10175   1.000 40.32838  ? 196 ALA A CA  1 
ATOM   1455  C  C   . ALA A 1 196 ? -1.81724  -16.86722 0.50173   1.000 46.78574  ? 196 ALA A C   1 
ATOM   1456  O  O   . ALA A 1 196 ? -2.93412  -17.37433 0.36345   1.000 48.79433  ? 196 ALA A O   1 
ATOM   1457  C  CB  . ALA A 1 196 ? -2.07856  -14.47957 1.19183   1.000 48.06646  ? 196 ALA A CB  1 
ATOM   1458  N  N   . VAL A 1 197 ? -0.76752  -17.53284 0.97953   1.000 49.16017  ? 197 VAL A N   1 
ATOM   1459  C  CA  . VAL A 1 197 ? -0.82821  -18.93672 1.37744   1.000 56.93236  ? 197 VAL A CA  1 
ATOM   1460  C  C   . VAL A 1 197 ? -0.69335  -19.00087 2.89303   1.000 57.54938  ? 197 VAL A C   1 
ATOM   1461  O  O   . VAL A 1 197 ? 0.36120   -18.66712 3.44750   1.000 61.59026  ? 197 VAL A O   1 
ATOM   1462  C  CB  . VAL A 1 197 ? 0.25671   -19.77600 0.69057   1.000 49.23063  ? 197 VAL A CB  1 
ATOM   1463  C  CG1 . VAL A 1 197 ? 0.19097   -21.20910 1.17987   1.000 57.94840  ? 197 VAL A CG1 1 
ATOM   1464  C  CG2 . VAL A 1 197 ? 0.09335   -19.71931 -0.82127  1.000 44.52852  ? 197 VAL A CG2 1 
ATOM   1465  N  N   . GLY A 1 198 ? -1.75293  -19.43973 3.56400   1.000 57.63878  ? 198 GLY A N   1 
ATOM   1466  C  CA  . GLY A 1 198 ? -1.73799  -19.54256 5.01325   1.000 74.44570  ? 198 GLY A CA  1 
ATOM   1467  C  C   . GLY A 1 198 ? -3.00560  -20.20128 5.50673   1.000 75.96288  ? 198 GLY A C   1 
ATOM   1468  O  O   . GLY A 1 198 ? -3.95180  -20.42461 4.74598   1.000 69.58511  ? 198 GLY A O   1 
ATOM   1469  N  N   . SER A 1 199 ? -3.01393  -20.50857 6.80600   1.000 70.76334  ? 199 SER A N   1 
ATOM   1470  C  CA  . SER A 1 199 ? -4.14333  -21.24364 7.36818   1.000 78.67807  ? 199 SER A CA  1 
ATOM   1471  C  C   . SER A 1 199 ? -4.76654  -20.58933 8.59386   1.000 75.58398  ? 199 SER A C   1 
ATOM   1472  O  O   . SER A 1 199 ? -5.98515  -20.67609 8.76511   1.000 73.58793  ? 199 SER A O   1 
ATOM   1473  C  CB  . SER A 1 199 ? -3.70375  -22.67225 7.71560   1.000 72.92055  ? 199 SER A CB  1 
ATOM   1474  O  OG  . SER A 1 199 ? -2.58677  -22.66410 8.58666   1.000 90.07291  ? 199 SER A OG  1 
ATOM   1475  N  N   . ARG A 1 200 ? -3.97220  -19.94658 9.44858   1.000 79.98197  ? 200 ARG A N   1 
ATOM   1476  C  CA  . ARG A 1 200 ? -4.50478  -19.40995 10.69693  1.000 68.34076  ? 200 ARG A CA  1 
ATOM   1477  C  C   . ARG A 1 200 ? -5.51263  -18.29833 10.41778  1.000 73.25323  ? 200 ARG A C   1 
ATOM   1478  O  O   . ARG A 1 200 ? -5.20388  -17.36041 9.66931   1.000 72.15699  ? 200 ARG A O   1 
ATOM   1479  C  CB  . ARG A 1 200 ? -3.38786  -18.88792 11.59966  1.000 71.23100  ? 200 ARG A CB  1 
ATOM   1480  C  CG  . ARG A 1 200 ? -2.66074  -19.97598 12.36997  1.000 78.41125  ? 200 ARG A CG  1 
ATOM   1481  C  CD  . ARG A 1 200 ? -1.73017  -19.38239 13.40838  1.000 81.60892  ? 200 ARG A CD  1 
ATOM   1482  N  NE  . ARG A 1 200 ? -0.65161  -18.61413 12.80036  1.000 85.25316  ? 200 ARG A NE  1 
ATOM   1483  C  CZ  . ARG A 1 200 ? 0.14792   -17.79384 13.46789  1.000 98.37705  ? 200 ARG A CZ  1 
ATOM   1484  N  NH1 . ARG A 1 200 ? 0.01186   -17.60630 14.77145  1.000 85.83366  ? 200 ARG A NH1 1 
ATOM   1485  N  NH2 . ARG A 1 200 ? 1.10434   -17.14160 12.81054  1.000 84.84955  ? 200 ARG A NH2 1 
ATOM   1486  N  N   . PRO A 1 201 ? -6.71723  -18.36567 10.99516  1.000 72.05488  ? 201 PRO A N   1 
ATOM   1487  C  CA  . PRO A 1 201 ? -7.75383  -17.37115 10.66099  1.000 72.34134  ? 201 PRO A CA  1 
ATOM   1488  C  C   . PRO A 1 201 ? -7.37851  -15.93815 10.99909  1.000 67.72091  ? 201 PRO A C   1 
ATOM   1489  O  O   . PRO A 1 201 ? -7.74521  -15.02073 10.25373  1.000 72.36827  ? 201 PRO A O   1 
ATOM   1490  C  CB  . PRO A 1 201 ? -8.95994  -17.84548 11.48508  1.000 72.97683  ? 201 PRO A CB  1 
ATOM   1491  C  CG  . PRO A 1 201 ? -8.71548  -19.30806 11.70733  1.000 71.82513  ? 201 PRO A CG  1 
ATOM   1492  C  CD  . PRO A 1 201 ? -7.23125  -19.43193 11.87060  1.000 79.80412  ? 201 PRO A CD  1 
ATOM   1493  N  N   . VAL A 1 202 ? -6.66750  -15.71111 12.10634  1.000 73.69877  ? 202 VAL A N   1 
ATOM   1494  C  CA  . VAL A 1 202 ? -6.29242  -14.34460 12.45771  1.000 73.82816  ? 202 VAL A CA  1 
ATOM   1495  C  C   . VAL A 1 202 ? -5.31191  -13.77782 11.43712  1.000 73.09098  ? 202 VAL A C   1 
ATOM   1496  O  O   . VAL A 1 202 ? -5.29025  -12.56459 11.19118  1.000 62.44991  ? 202 VAL A O   1 
ATOM   1497  C  CB  . VAL A 1 202 ? -5.72899  -14.29104 13.89198  1.000 69.92018  ? 202 VAL A CB  1 
ATOM   1498  C  CG1 . VAL A 1 202 ? -4.36216  -14.95914 13.96983  1.000 73.37688  ? 202 VAL A CG1 1 
ATOM   1499  C  CG2 . VAL A 1 202 ? -5.66099  -12.85172 14.38720  1.000 70.47400  ? 202 VAL A CG2 1 
ATOM   1500  N  N   . CYS A 1 203 ? -4.49448  -14.63685 10.82401  1.000 67.55809  ? 203 CYS A N   1 
ATOM   1501  C  CA  . CYS A 1 203 ? -3.56967  -14.19263 9.78905   1.000 62.25789  ? 203 CYS A CA  1 
ATOM   1502  C  C   . CYS A 1 203 ? -4.27351  -14.01750 8.44893   1.000 67.56058  ? 203 CYS A C   1 
ATOM   1503  O  O   . CYS A 1 203 ? -3.95109  -13.09578 7.69056   1.000 65.01706  ? 203 CYS A O   1 
ATOM   1504  C  CB  . CYS A 1 203 ? -2.41282  -15.18307 9.66410   1.000 63.27897  ? 203 CYS A CB  1 
ATOM   1505  S  SG  . CYS A 1 203 ? -1.40124  -15.31819 11.15185  1.000 76.34061  ? 203 CYS A SG  1 
ATOM   1506  N  N   . VAL A 1 204 ? -5.22280  -14.90133 8.13603   1.000 63.20816  ? 204 VAL A N   1 
ATOM   1507  C  CA  . VAL A 1 204 ? -5.96993  -14.78350 6.88727   1.000 63.89353  ? 204 VAL A CA  1 
ATOM   1508  C  C   . VAL A 1 204 ? -6.75025  -13.47545 6.85191   1.000 61.98182  ? 204 VAL A C   1 
ATOM   1509  O  O   . VAL A 1 204 ? -6.83825  -12.81459 5.80982   1.000 64.98800  ? 204 VAL A O   1 
ATOM   1510  C  CB  . VAL A 1 204 ? -6.88948  -16.00465 6.70611   1.000 57.47077  ? 204 VAL A CB  1 
ATOM   1511  C  CG1 . VAL A 1 204 ? -7.85072  -15.78860 5.54844   1.000 53.53664  ? 204 VAL A CG1 1 
ATOM   1512  C  CG2 . VAL A 1 204 ? -6.05529  -17.25466 6.48572   1.000 64.76334  ? 204 VAL A CG2 1 
ATOM   1513  N  N   . ASP A 1 205 ? -7.33121  -13.08219 7.98706   1.000 64.12459  ? 205 ASP A N   1 
ATOM   1514  C  CA  . ASP A 1 205 ? -8.06798  -11.82308 8.04492   1.000 70.97215  ? 205 ASP A CA  1 
ATOM   1515  C  C   . ASP A 1 205 ? -7.14432  -10.62838 7.82924   1.000 63.61747  ? 205 ASP A C   1 
ATOM   1516  O  O   . ASP A 1 205 ? -7.49886  -9.68123  7.11662   1.000 61.16776  ? 205 ASP A O   1 
ATOM   1517  C  CB  . ASP A 1 205 ? -8.80367  -11.70973 9.38032   1.000 81.54287  ? 205 ASP A CB  1 
ATOM   1518  C  CG  . ASP A 1 205 ? -9.47852  -10.36558 9.56127   1.000 90.62172  ? 205 ASP A CG  1 
ATOM   1519  O  OD1 . ASP A 1 205 ? -10.48290 -10.10893 8.86246   1.000 91.74167  ? 205 ASP A OD1 1 
ATOM   1520  O  OD2 . ASP A 1 205 ? -9.01090  -9.57168  10.40640  1.000 86.38345  ? 205 ASP A OD2 1 
ATOM   1521  N  N   . ALA A 1 206 ? -5.95617  -10.65341 8.43801   1.000 60.01890  ? 206 ALA A N   1 
ATOM   1522  C  CA  . ALA A 1 206 ? -5.01058  -9.55761  8.25785   1.000 60.03550  ? 206 ALA A CA  1 
ATOM   1523  C  C   . ALA A 1 206 ? -4.45513  -9.51706  6.84028   1.000 57.42965  ? 206 ALA A C   1 
ATOM   1524  O  O   . ALA A 1 206 ? -4.15136  -8.43360  6.32944   1.000 55.58512  ? 206 ALA A O   1 
ATOM   1525  C  CB  . ALA A 1 206 ? -3.87163  -9.67155  9.27059   1.000 56.54950  ? 206 ALA A CB  1 
ATOM   1526  N  N   . ALA A 1 207 ? -4.31304  -10.67563 6.19117   1.000 56.86402  ? 207 ALA A N   1 
ATOM   1527  C  CA  . ALA A 1 207 ? -3.81723  -10.69212 4.81816   1.000 47.12709  ? 207 ALA A CA  1 
ATOM   1528  C  C   . ALA A 1 207 ? -4.77466  -9.97133  3.87813   1.000 46.79046  ? 207 ALA A C   1 
ATOM   1529  O  O   . ALA A 1 207 ? -4.34253  -9.22245  2.99491   1.000 57.96669  ? 207 ALA A O   1 
ATOM   1530  C  CB  . ALA A 1 207 ? -3.59064  -12.13081 4.35532   1.000 47.07603  ? 207 ALA A CB  1 
ATOM   1531  N  N   . LYS A 1 208 ? -6.08050  -10.19431 4.04052   1.000 55.02573  ? 208 LYS A N   1 
ATOM   1532  C  CA  . LYS A 1 208 ? -7.05138  -9.44753  3.24751   1.000 54.66806  ? 208 LYS A CA  1 
ATOM   1533  C  C   . LYS A 1 208 ? -6.95335  -7.95621  3.53639   1.000 52.92232  ? 208 LYS A C   1 
ATOM   1534  O  O   . LYS A 1 208 ? -7.09303  -7.12769  2.62843   1.000 58.77733  ? 208 LYS A O   1 
ATOM   1535  C  CB  . LYS A 1 208 ? -8.46623  -9.95283  3.52663   1.000 45.99427  ? 208 LYS A CB  1 
ATOM   1536  C  CG  . LYS A 1 208 ? -8.71182  -11.39585 3.12694   1.000 53.90882  ? 208 LYS A CG  1 
ATOM   1537  C  CD  . LYS A 1 208 ? -10.09769 -11.83603 3.56155   1.000 59.34342  ? 208 LYS A CD  1 
ATOM   1538  C  CE  . LYS A 1 208 ? -10.33241 -13.31073 3.28290   1.000 69.16674  ? 208 LYS A CE  1 
ATOM   1539  N  NZ  . LYS A 1 208 ? -11.66822 -13.74869 3.77508   1.000 68.37717  ? 208 LYS A NZ  1 
ATOM   1540  N  N   . TYR A 1 209 ? -6.70149  -7.59801  4.79781   1.000 54.17278  ? 209 TYR A N   1 
ATOM   1541  C  CA  . TYR A 1 209 ? -6.58608  -6.19111  5.16426   1.000 51.32123  ? 209 TYR A CA  1 
ATOM   1542  C  C   . TYR A 1 209 ? -5.41328  -5.53147  4.44997   1.000 52.47499  ? 209 TYR A C   1 
ATOM   1543  O  O   . TYR A 1 209 ? -5.49004  -4.35744  4.07040   1.000 51.16631  ? 209 TYR A O   1 
ATOM   1544  C  CB  . TYR A 1 209 ? -6.43659  -6.05842  6.68182   1.000 54.19768  ? 209 TYR A CB  1 
ATOM   1545  C  CG  . TYR A 1 209 ? -6.12683  -4.65462  7.15723   1.000 60.18109  ? 209 TYR A CG  1 
ATOM   1546  C  CD1 . TYR A 1 209 ? -7.14403  -3.73504  7.38012   1.000 60.26581  ? 209 TYR A CD1 1 
ATOM   1547  C  CD2 . TYR A 1 209 ? -4.81687  -4.24759  7.37987   1.000 62.82007  ? 209 TYR A CD2 1 
ATOM   1548  C  CE1 . TYR A 1 209 ? -6.86425  -2.44975  7.81273   1.000 70.44124  ? 209 TYR A CE1 1 
ATOM   1549  C  CE2 . TYR A 1 209 ? -4.52734  -2.96367  7.80683   1.000 57.47259  ? 209 TYR A CE2 1 
ATOM   1550  C  CZ  . TYR A 1 209 ? -5.55409  -2.06984  8.02288   1.000 68.80982  ? 209 TYR A CZ  1 
ATOM   1551  O  OH  . TYR A 1 209 ? -5.26962  -0.79338  8.45173   1.000 69.12568  ? 209 TYR A OH  1 
ATOM   1552  N  N   . TYR A 1 210 ? -4.31795  -6.26477  4.26076   1.000 53.40771  ? 210 TYR A N   1 
ATOM   1553  C  CA  . TYR A 1 210 ? -3.11819  -5.70418  3.65067   1.000 51.13075  ? 210 TYR A CA  1 
ATOM   1554  C  C   . TYR A 1 210 ? -3.09010  -5.84566  2.13398   1.000 48.63538  ? 210 TYR A C   1 
ATOM   1555  O  O   . TYR A 1 210 ? -2.12327  -5.40318  1.50462   1.000 56.41064  ? 210 TYR A O   1 
ATOM   1556  C  CB  . TYR A 1 210 ? -1.86449  -6.34216  4.26003   1.000 52.01840  ? 210 TYR A CB  1 
ATOM   1557  C  CG  . TYR A 1 210 ? -1.57234  -5.86252  5.66882   1.000 49.35152  ? 210 TYR A CG  1 
ATOM   1558  C  CD1 . TYR A 1 210 ? -1.30157  -4.52432  5.92336   1.000 53.34893  ? 210 TYR A CD1 1 
ATOM   1559  C  CD2 . TYR A 1 210 ? -1.57116  -6.74552  6.74110   1.000 53.61231  ? 210 TYR A CD2 1 
ATOM   1560  C  CE1 . TYR A 1 210 ? -1.03872  -4.07803  7.20508   1.000 53.14039  ? 210 TYR A CE1 1 
ATOM   1561  C  CE2 . TYR A 1 210 ? -1.30882  -6.30745  8.02882   1.000 56.52637  ? 210 TYR A CE2 1 
ATOM   1562  C  CZ  . TYR A 1 210 ? -1.04370  -4.97208  8.25209   1.000 52.90924  ? 210 TYR A CZ  1 
ATOM   1563  O  OH  . TYR A 1 210 ? -0.78053  -4.52622  9.52649   1.000 64.70785  ? 210 TYR A OH  1 
ATOM   1564  N  N   . GLY A 1 211 ? -4.11062  -6.44753  1.53000   1.000 48.90149  ? 211 GLY A N   1 
ATOM   1565  C  CA  . GLY A 1 211 ? -4.22736  -6.39622  0.08717   1.000 45.42127  ? 211 GLY A CA  1 
ATOM   1566  C  C   . GLY A 1 211 ? -4.35698  -7.72391  -0.62963  1.000 47.21452  ? 211 GLY A C   1 
ATOM   1567  O  O   . GLY A 1 211 ? -4.42397  -7.75022  -1.86254  1.000 56.01033  ? 211 GLY A O   1 
ATOM   1568  N  N   . ALA A 1 212 ? -4.39824  -8.82986  0.10900   1.000 50.37514  ? 212 ALA A N   1 
ATOM   1569  C  CA  . ALA A 1 212 ? -4.50001  -10.13491 -0.53152  1.000 45.60535  ? 212 ALA A CA  1 
ATOM   1570  C  C   . ALA A 1 212 ? -5.85029  -10.27744 -1.22067  1.000 43.33329  ? 212 ALA A C   1 
ATOM   1571  O  O   . ALA A 1 212 ? -6.89759  -10.01807 -0.62240  1.000 45.56160  ? 212 ALA A O   1 
ATOM   1572  C  CB  . ALA A 1 212 ? -4.30646  -11.25179 0.49147   1.000 45.58594  ? 212 ALA A CB  1 
ATOM   1573  N  N   . THR A 1 213 ? -5.82494  -10.68979 -2.48481  1.000 50.28931  ? 213 THR A N   1 
ATOM   1574  C  CA  . THR A 1 213 ? -7.04911  -10.89491 -3.24245  1.000 42.61438  ? 213 THR A CA  1 
ATOM   1575  C  C   . THR A 1 213 ? -7.50946  -12.34150 -3.23492  1.000 51.07322  ? 213 THR A C   1 
ATOM   1576  O  O   . THR A 1 213 ? -8.69369  -12.60210 -3.47464  1.000 49.33008  ? 213 THR A O   1 
ATOM   1577  C  CB  . THR A 1 213 ? -6.85993  -10.44179 -4.69481  1.000 41.43034  ? 213 THR A CB  1 
ATOM   1578  O  OG1 . THR A 1 213 ? -5.82627  -11.22305 -5.30691  1.000 48.37590  ? 213 THR A OG1 1 
ATOM   1579  C  CG2 . THR A 1 213 ? -6.46571  -8.97182  -4.74934  1.000 44.36640  ? 213 THR A CG2 1 
ATOM   1580  N  N   . ASP A 1 214 ? -6.60995  -13.27820 -2.95236  1.000 48.01213  ? 214 ASP A N   1 
ATOM   1581  C  CA  . ASP A 1 214 ? -6.94706  -14.69046 -2.89851  1.000 47.80834  ? 214 ASP A CA  1 
ATOM   1582  C  C   . ASP A 1 214 ? -6.21242  -15.32310 -1.72972  1.000 52.54390  ? 214 ASP A C   1 
ATOM   1583  O  O   . ASP A 1 214 ? -5.07778  -14.94809 -1.42063  1.000 57.37298  ? 214 ASP A O   1 
ATOM   1584  C  CB  . ASP A 1 214 ? -6.57128  -15.40693 -4.20007  1.000 53.37997  ? 214 ASP A CB  1 
ATOM   1585  C  CG  . ASP A 1 214 ? -7.14274  -14.72505 -5.42506  1.000 54.72869  ? 214 ASP A CG  1 
ATOM   1586  O  OD1 . ASP A 1 214 ? -6.59487  -13.67741 -5.82538  1.000 50.10434  ? 214 ASP A OD1 1 
ATOM   1587  O  OD2 . ASP A 1 214 ? -8.13600  -15.23413 -5.98664  1.000 58.31096  ? 214 ASP A OD2 1 
ATOM   1588  N  N   . ILE A 1 215 ? -6.86604  -16.27789 -1.08162  1.000 52.03337  ? 215 ILE A N   1 
ATOM   1589  C  CA  . ILE A 1 215 ? -6.29027  -17.01462 0.03360   1.000 58.95187  ? 215 ILE A CA  1 
ATOM   1590  C  C   . ILE A 1 215 ? -6.24555  -18.48206 -0.35698  1.000 56.28688  ? 215 ILE A C   1 
ATOM   1591  O  O   . ILE A 1 215 ? -7.26758  -19.05111 -0.75802  1.000 60.13389  ? 215 ILE A O   1 
ATOM   1592  C  CB  . ILE A 1 215 ? -7.10261  -16.81913 1.32626   1.000 56.82864  ? 215 ILE A CB  1 
ATOM   1593  C  CG1 . ILE A 1 215 ? -7.22174  -15.33358 1.66643   1.000 53.66232  ? 215 ILE A CG1 1 
ATOM   1594  C  CG2 . ILE A 1 215 ? -6.45990  -17.57566 2.47805   1.000 60.54388  ? 215 ILE A CG2 1 
ATOM   1595  C  CD1 . ILE A 1 215 ? -5.90405  -14.67670 1.99084   1.000 59.34391  ? 215 ILE A CD1 1 
ATOM   1596  N  N   . VAL A 1 216 ? -5.07393  -19.09583 -0.22749  1.000 59.60863  ? 216 VAL A N   1 
ATOM   1597  C  CA  . VAL A 1 216 ? -4.89545  -20.50791 -0.53937  1.000 59.58968  ? 216 VAL A CA  1 
ATOM   1598  C  C   . VAL A 1 216 ? -4.62661  -21.23001 0.77035   1.000 67.56763  ? 216 VAL A C   1 
ATOM   1599  O  O   . VAL A 1 216 ? -3.58962  -21.01953 1.41272   1.000 68.25269  ? 216 VAL A O   1 
ATOM   1600  C  CB  . VAL A 1 216 ? -3.76056  -20.73706 -1.54541  1.000 55.63374  ? 216 VAL A CB  1 
ATOM   1601  C  CG1 . VAL A 1 216 ? -3.45649  -22.21523 -1.66500  1.000 58.28290  ? 216 VAL A CG1 1 
ATOM   1602  C  CG2 . VAL A 1 216 ? -4.13786  -20.16929 -2.89606  1.000 51.19127  ? 216 VAL A CG2 1 
ATOM   1603  N  N   . ASN A 1 217 ? -5.57030  -22.08140 1.15614   1.000 78.96267  ? 217 ASN A N   1 
ATOM   1604  C  CA  . ASN A 1 217 ? -5.49048  -22.90508 2.35293   1.000 77.64744  ? 217 ASN A CA  1 
ATOM   1605  C  C   . ASN A 1 217 ? -5.07545  -24.31736 1.95876   1.000 78.04943  ? 217 ASN A C   1 
ATOM   1606  O  O   . ASN A 1 217 ? -5.63073  -24.88833 1.01435   1.000 81.47562  ? 217 ASN A O   1 
ATOM   1607  C  CB  . ASN A 1 217 ? -6.82972  -22.92185 3.09162   1.000 82.08814  ? 217 ASN A CB  1 
ATOM   1608  C  CG  . ASN A 1 217 ? -6.70303  -23.43291 4.51513   1.000 97.61408  ? 217 ASN A CG  1 
ATOM   1609  O  OD1 . ASN A 1 217 ? -5.80459  -24.21236 4.82980   1.000 98.72786  ? 217 ASN A OD1 1 
ATOM   1610  N  ND2 . ASN A 1 217 ? -7.60698  -22.99680 5.38377   1.000 99.93589  ? 217 ASN A ND2 1 
ATOM   1611  N  N   . TYR A 1 218 ? -4.08711  -24.87058 2.66718   1.000 78.35781  ? 218 TYR A N   1 
ATOM   1612  C  CA  . TYR A 1 218 ? -3.63145  -26.22434 2.36962   1.000 90.97620  ? 218 TYR A CA  1 
ATOM   1613  C  C   . TYR A 1 218 ? -4.74073  -27.24726 2.57990   1.000 88.39125  ? 218 TYR A C   1 
ATOM   1614  O  O   . TYR A 1 218 ? -4.61250  -28.38919 2.12498   1.000 78.62360  ? 218 TYR A O   1 
ATOM   1615  C  CB  . TYR A 1 218 ? -2.43536  -26.60131 3.24301   1.000 92.52682  ? 218 TYR A CB  1 
ATOM   1616  C  CG  . TYR A 1 218 ? -2.79101  -26.81849 4.70107   1.000 90.68957  ? 218 TYR A CG  1 
ATOM   1617  C  CD1 . TYR A 1 218 ? -2.92903  -25.74804 5.57282   1.000 93.16280  ? 218 TYR A CD1 1 
ATOM   1618  C  CD2 . TYR A 1 218 ? -2.98841  -28.10114 5.20320   1.000 90.59178  ? 218 TYR A CD2 1 
ATOM   1619  C  CE1 . TYR A 1 218 ? -3.25871  -25.95037 6.89912   1.000 100.55351 ? 218 TYR A CE1 1 
ATOM   1620  C  CE2 . TYR A 1 218 ? -3.31822  -28.31038 6.52679   1.000 88.26569  ? 218 TYR A CE2 1 
ATOM   1621  C  CZ  . TYR A 1 218 ? -3.45164  -27.22987 7.37219   1.000 87.87728  ? 218 TYR A CZ  1 
ATOM   1622  O  OH  . TYR A 1 218 ? -3.77874  -27.42639 8.69618   1.000 94.00335  ? 218 TYR A OH  1 
ATOM   1623  N  N   . LYS A 1 219 ? -5.82984  -26.85797 3.25516   1.000 98.78810  ? 219 LYS A N   1 
ATOM   1624  C  CA  . LYS A 1 219 ? -6.97018  -27.73625 3.48761   1.000 93.53387  ? 219 LYS A CA  1 
ATOM   1625  C  C   . LYS A 1 219 ? -7.67963  -28.11634 2.19948   1.000 99.29379  ? 219 LYS A C   1 
ATOM   1626  O  O   . LYS A 1 219 ? -8.47426  -29.06230 2.20421   1.000 104.21805 ? 219 LYS A O   1 
ATOM   1627  C  CB  . LYS A 1 219 ? -7.99151  -27.04785 4.39334   1.000 97.96321  ? 219 LYS A CB  1 
ATOM   1628  C  CG  . LYS A 1 219 ? -7.52461  -26.70036 5.79522   1.000 112.54003 ? 219 LYS A CG  1 
ATOM   1629  C  CD  . LYS A 1 219 ? -8.66433  -26.04834 6.57712   1.000 116.97682 ? 219 LYS A CD  1 
ATOM   1630  C  CE  . LYS A 1 219 ? -8.19932  -25.46853 7.90528   1.000 114.20940 ? 219 LYS A CE  1 
ATOM   1631  N  NZ  . LYS A 1 219 ? -9.28842  -24.71548 8.59210   1.000 110.26139 ? 219 LYS A NZ  1 
ATOM   1632  N  N   . ASP A 1 220 ? -7.43099  -27.39177 1.10906   1.000 87.09616  ? 220 ASP A N   1 
ATOM   1633  C  CA  . ASP A 1 220 ? -8.05229  -27.69383 -0.16903  1.000 94.54268  ? 220 ASP A CA  1 
ATOM   1634  C  C   . ASP A 1 220 ? -7.16654  -28.51308 -1.10225  1.000 92.59825  ? 220 ASP A C   1 
ATOM   1635  O  O   . ASP A 1 220 ? -7.65931  -28.98060 -2.13426  1.000 95.39586  ? 220 ASP A O   1 
ATOM   1636  C  CB  . ASP A 1 220 ? -8.47248  -26.39418 -0.86550  1.000 95.46299  ? 220 ASP A CB  1 
ATOM   1637  C  CG  . ASP A 1 220 ? -9.57012  -25.65516 -0.11856  1.000 93.12873  ? 220 ASP A CG  1 
ATOM   1638  O  OD1 . ASP A 1 220 ? -10.48360 -26.32045 0.41762   1.000 99.52968  ? 220 ASP A OD1 1 
ATOM   1639  O  OD2 . ASP A 1 220 ? -9.53077  -24.40728 -0.07578  1.000 95.53450  ? 220 ASP A OD2 1 
ATOM   1640  N  N   . GLY A 1 221 ? -5.88623  -28.69629 -0.78283  1.000 89.85494  ? 221 GLY A N   1 
ATOM   1641  C  CA  . GLY A 1 221 ? -5.01670  -29.47573 -1.62997  1.000 79.16300  ? 221 GLY A CA  1 
ATOM   1642  C  C   . GLY A 1 221 ? -3.58672  -28.97067 -1.65523  1.000 90.86809  ? 221 GLY A C   1 
ATOM   1643  O  O   . GLY A 1 221 ? -3.20565  -28.06543 -0.90477  1.000 86.67522  ? 221 GLY A O   1 
ATOM   1644  N  N   . PRO A 1 222 ? -2.76147  -29.56077 -2.52168  1.000 87.02186  ? 222 PRO A N   1 
ATOM   1645  C  CA  . PRO A 1 222 ? -1.38092  -29.08329 -2.66616  1.000 82.17120  ? 222 PRO A CA  1 
ATOM   1646  C  C   . PRO A 1 222 ? -1.35906  -27.64470 -3.16037  1.000 72.12148  ? 222 PRO A C   1 
ATOM   1647  O  O   . PRO A 1 222 ? -2.17338  -27.24232 -3.99382  1.000 68.94617  ? 222 PRO A O   1 
ATOM   1648  C  CB  . PRO A 1 222 ? -0.77454  -30.04656 -3.69201  1.000 83.74369  ? 222 PRO A CB  1 
ATOM   1649  C  CG  . PRO A 1 222 ? -1.94825  -30.60254 -4.42994  1.000 86.08042  ? 222 PRO A CG  1 
ATOM   1650  C  CD  . PRO A 1 222 ? -3.05179  -30.69072 -3.41932  1.000 82.31448  ? 222 PRO A CD  1 
ATOM   1651  N  N   . ILE A 1 223 ? -0.41585  -26.86685 -2.62488  1.000 68.42011  ? 223 ILE A N   1 
ATOM   1652  C  CA  . ILE A 1 223 ? -0.35421  -25.43949 -2.92937  1.000 62.34953  ? 223 ILE A CA  1 
ATOM   1653  C  C   . ILE A 1 223 ? -0.08398  -25.20936 -4.41170  1.000 65.17078  ? 223 ILE A C   1 
ATOM   1654  O  O   . ILE A 1 223 ? -0.69385  -24.33189 -5.03647  1.000 61.47630  ? 223 ILE A O   1 
ATOM   1655  C  CB  . ILE A 1 223 ? 0.70831   -24.75940 -2.04590  1.000 67.95309  ? 223 ILE A CB  1 
ATOM   1656  C  CG1 . ILE A 1 223 ? 0.34855   -24.91704 -0.56726  1.000 75.46052  ? 223 ILE A CG1 1 
ATOM   1657  C  CG2 . ILE A 1 223 ? 0.84937   -23.28861 -2.40071  1.000 66.20157  ? 223 ILE A CG2 1 
ATOM   1658  C  CD1 . ILE A 1 223 ? 1.47619   -24.54980 0.37342   1.000 82.11467  ? 223 ILE A CD1 1 
ATOM   1659  N  N   . GLU A 1 224 ? 0.82653   -25.99195 -4.99958  1.000 69.65226  ? 224 GLU A N   1 
ATOM   1660  C  CA  . GLU A 1 224 ? 1.16192   -25.81495 -6.41144  1.000 61.36024  ? 224 GLU A CA  1 
ATOM   1661  C  C   . GLU A 1 224 ? -0.07859  -25.92197 -7.28915  1.000 58.51192  ? 224 GLU A C   1 
ATOM   1662  O  O   . GLU A 1 224 ? -0.33428  -25.05486 -8.13093  1.000 61.94108  ? 224 GLU A O   1 
ATOM   1663  C  CB  . GLU A 1 224 ? 2.20793   -26.84540 -6.84307  1.000 56.42995  ? 224 GLU A CB  1 
ATOM   1664  C  CG  . GLU A 1 224 ? 3.53389   -26.76638 -6.09612  1.000 73.11556  ? 224 GLU A CG  1 
ATOM   1665  C  CD  . GLU A 1 224 ? 3.55006   -27.58232 -4.80967  1.000 75.39549  ? 224 GLU A CD  1 
ATOM   1666  O  OE1 . GLU A 1 224 ? 2.46235   -27.92364 -4.29517  1.000 81.50499  ? 224 GLU A OE1 1 
ATOM   1667  O  OE2 . GLU A 1 224 ? 4.65760   -27.88764 -4.31517  1.000 71.28357  ? 224 GLU A OE2 1 
ATOM   1668  N  N   . SER A 1 225 ? -0.87148  -26.97675 -7.09174  1.000 67.95622  ? 225 SER A N   1 
ATOM   1669  C  CA  . SER A 1 225 ? -2.05285  -27.18911 -7.92291  1.000 67.62102  ? 225 SER A CA  1 
ATOM   1670  C  C   . SER A 1 225 ? -3.06564  -26.06328 -7.75642  1.000 59.59268  ? 225 SER A C   1 
ATOM   1671  O  O   . SER A 1 225 ? -3.67514  -25.61893 -8.73656  1.000 63.73789  ? 225 SER A O   1 
ATOM   1672  C  CB  . SER A 1 225 ? -2.69445  -28.53246 -7.58407  1.000 60.27363  ? 225 SER A CB  1 
ATOM   1673  O  OG  . SER A 1 225 ? -1.75570  -29.58375 -7.70668  1.000 84.44266  ? 225 SER A OG  1 
ATOM   1674  N  N   . GLN A 1 226 ? -3.26732  -25.59628 -6.52178  1.000 56.54141  ? 226 GLN A N   1 
ATOM   1675  C  CA  . GLN A 1 226 ? -4.24797  -24.54289 -6.27838  1.000 57.77787  ? 226 GLN A CA  1 
ATOM   1676  C  C   . GLN A 1 226 ? -3.86804  -23.25347 -6.99424  1.000 60.57130  ? 226 GLN A C   1 
ATOM   1677  O  O   . GLN A 1 226 ? -4.70818  -22.61626 -7.63979  1.000 57.21252  ? 226 GLN A O   1 
ATOM   1678  C  CB  . GLN A 1 226 ? -4.39459  -24.29653 -4.77689  1.000 65.43774  ? 226 GLN A CB  1 
ATOM   1679  C  CG  . GLN A 1 226 ? -5.17497  -25.36382 -4.03771  1.000 58.13467  ? 226 GLN A CG  1 
ATOM   1680  C  CD  . GLN A 1 226 ? -5.51399  -24.94984 -2.61877  1.000 74.13428  ? 226 GLN A CD  1 
ATOM   1681  O  OE1 . GLN A 1 226 ? -6.33449  -24.05585 -2.39925  1.000 67.54798  ? 226 GLN A OE1 1 
ATOM   1682  N  NE2 . GLN A 1 226 ? -4.88474  -25.59926 -1.64602  1.000 79.28235  ? 226 GLN A NE2 1 
ATOM   1683  N  N   . ILE A 1 227 ? -2.60003  -22.85477 -6.89756  1.000 60.87416  ? 227 ILE A N   1 
ATOM   1684  C  CA  . ILE A 1 227 ? -2.18546  -21.58806 -7.48966  1.000 57.68071  ? 227 ILE A CA  1 
ATOM   1685  C  C   . ILE A 1 227 ? -2.18718  -21.67967 -9.00989  1.000 54.74951  ? 227 ILE A C   1 
ATOM   1686  O  O   . ILE A 1 227 ? -2.58664  -20.73368 -9.69970  1.000 59.86706  ? 227 ILE A O   1 
ATOM   1687  C  CB  . ILE A 1 227 ? -0.81278  -21.16803 -6.93665  1.000 51.24595  ? 227 ILE A CB  1 
ATOM   1688  C  CG1 . ILE A 1 227 ? -0.94111  -20.80268 -5.45700  1.000 46.43312  ? 227 ILE A CG1 1 
ATOM   1689  C  CG2 . ILE A 1 227 ? -0.24762  -20.00028 -7.72512  1.000 45.18390  ? 227 ILE A CG2 1 
ATOM   1690  C  CD1 . ILE A 1 227 ? 0.34882   -20.33058 -4.83194  1.000 57.69388  ? 227 ILE A CD1 1 
ATOM   1691  N  N   . MET A 1 228 ? -1.75206  -22.81747 -9.55801  1.000 57.83892  ? 228 MET A N   1 
ATOM   1692  C  CA  . MET A 1 228 ? -1.79191  -22.99372 -11.00613 1.000 57.05648  ? 228 MET A CA  1 
ATOM   1693  C  C   . MET A 1 228 ? -3.22675  -22.97173 -11.51867 1.000 62.38844  ? 228 MET A C   1 
ATOM   1694  O  O   . MET A 1 228 ? -3.49464  -22.47259 -12.61754 1.000 64.12553  ? 228 MET A O   1 
ATOM   1695  C  CB  . MET A 1 228 ? -1.09650  -24.29753 -11.40179 1.000 54.02594  ? 228 MET A CB  1 
ATOM   1696  C  CG  . MET A 1 228 ? 0.39529   -24.34160 -11.07906 1.000 47.93010  ? 228 MET A CG  1 
ATOM   1697  S  SD  . MET A 1 228 ? 1.34029   -22.93315 -11.68922 1.000 59.63445  ? 228 MET A SD  1 
ATOM   1698  C  CE  . MET A 1 228 ? 1.24373   -23.20886 -13.45573 1.000 58.59282  ? 228 MET A CE  1 
ATOM   1699  N  N   . ASN A 1 229 ? -4.16646  -23.50542 -10.73630 1.000 58.02739  ? 229 ASN A N   1 
ATOM   1700  C  CA  . ASN A 1 229 ? -5.56771  -23.41470 -11.12683 1.000 52.59038  ? 229 ASN A CA  1 
ATOM   1701  C  C   . ASN A 1 229 ? -6.07037  -21.97746 -11.03980 1.000 60.25555  ? 229 ASN A C   1 
ATOM   1702  O  O   . ASN A 1 229 ? -6.81185  -21.52013 -11.91753 1.000 65.54602  ? 229 ASN A O   1 
ATOM   1703  C  CB  . ASN A 1 229 ? -6.41863  -24.33806 -10.25527 1.000 52.88649  ? 229 ASN A CB  1 
ATOM   1704  C  CG  . ASN A 1 229 ? -6.21864  -25.80516 -10.59219 1.000 68.42237  ? 229 ASN A CG  1 
ATOM   1705  O  OD1 . ASN A 1 229 ? -5.75620  -26.14579 -11.68175 1.000 69.76916  ? 229 ASN A OD1 1 
ATOM   1706  N  ND2 . ASN A 1 229 ? -6.57631  -26.68353 -9.65883  1.000 70.59727  ? 229 ASN A ND2 1 
ATOM   1707  N  N   . LEU A 1 230 ? -5.65741  -21.24148 -10.00308 1.000 59.98270  ? 230 LEU A N   1 
ATOM   1708  C  CA  . LEU A 1 230 ? -6.10287  -19.85833 -9.85570  1.000 53.73314  ? 230 LEU A CA  1 
ATOM   1709  C  C   . LEU A 1 230 ? -5.59944  -18.99359 -10.99964 1.000 53.29231  ? 230 LEU A C   1 
ATOM   1710  O  O   . LEU A 1 230 ? -6.33284  -18.14349 -11.51617 1.000 58.98893  ? 230 LEU A O   1 
ATOM   1711  C  CB  . LEU A 1 230 ? -5.63636  -19.28734 -8.51708  1.000 56.66509  ? 230 LEU A CB  1 
ATOM   1712  C  CG  . LEU A 1 230 ? -6.32805  -19.81622 -7.26101  1.000 54.30269  ? 230 LEU A CG  1 
ATOM   1713  C  CD1 . LEU A 1 230 ? -5.73077  -19.17032 -6.02488  1.000 55.96296  ? 230 LEU A CD1 1 
ATOM   1714  C  CD2 . LEU A 1 230 ? -7.82586  -19.57308 -7.33123  1.000 47.17888  ? 230 LEU A CD2 1 
ATOM   1715  N  N   . THR A 1 231 ? -4.34887  -19.18557 -11.40008 1.000 53.48753  ? 231 THR A N   1 
ATOM   1716  C  CA  . THR A 1 231 ? -3.75798  -18.42672 -12.48854 1.000 55.57534  ? 231 THR A CA  1 
ATOM   1717  C  C   . THR A 1 231 ? -3.99888  -19.07517 -13.84221 1.000 60.29009  ? 231 THR A C   1 
ATOM   1718  O  O   . THR A 1 231 ? -3.39062  -18.65540 -14.83155 1.000 61.15911  ? 231 THR A O   1 
ATOM   1719  C  CB  . THR A 1 231 ? -2.25949  -18.25116 -12.25427 1.000 53.90732  ? 231 THR A CB  1 
ATOM   1720  O  OG1 . THR A 1 231 ? -1.63881  -19.54087 -12.17933 1.000 57.53771  ? 231 THR A OG1 1 
ATOM   1721  C  CG2 . THR A 1 231 ? -2.02086  -17.49837 -10.95341 1.000 46.28453  ? 231 THR A CG2 1 
ATOM   1722  N  N   . GLU A 1 232 ? -4.86085  -20.09347 -13.90102 1.000 66.46662  ? 232 GLU A N   1 
ATOM   1723  C  CA  . GLU A 1 232 ? -5.21558  -20.75933 -15.15429 1.000 58.37756  ? 232 GLU A CA  1 
ATOM   1724  C  C   . GLU A 1 232 ? -3.97768  -21.28602 -15.87728 1.000 59.77154  ? 232 GLU A C   1 
ATOM   1725  O  O   . GLU A 1 232 ? -3.83437  -21.13925 -17.09224 1.000 66.68424  ? 232 GLU A O   1 
ATOM   1726  C  CB  . GLU A 1 232 ? -6.02135  -19.82154 -16.05362 1.000 63.41518  ? 232 GLU A CB  1 
ATOM   1727  C  CG  . GLU A 1 232 ? -7.31855  -19.35332 -15.41695 1.000 75.86107  ? 232 GLU A CG  1 
ATOM   1728  C  CD  . GLU A 1 232 ? -8.09747  -18.40493 -16.30260 1.000 96.62682  ? 232 GLU A CD  1 
ATOM   1729  O  OE1 . GLU A 1 232 ? -7.58694  -18.04668 -17.38596 1.000 102.12686 ? 232 GLU A OE1 1 
ATOM   1730  O  OE2 . GLU A 1 232 ? -9.22076  -18.01863 -15.91385 1.000 99.29155  ? 232 GLU A OE2 1 
ATOM   1731  N  N   . GLY A 1 233 ? -3.06736  -21.89436 -15.11674 1.000 61.76012  ? 233 GLY A N   1 
ATOM   1732  C  CA  . GLY A 1 233 ? -1.85948  -22.47263 -15.66246 1.000 46.04458  ? 233 GLY A CA  1 
ATOM   1733  C  C   . GLY A 1 233 ? -0.74044  -21.49641 -15.94536 1.000 54.49666  ? 233 GLY A C   1 
ATOM   1734  O  O   . GLY A 1 233 ? 0.36130   -21.93426 -16.30296 1.000 59.50372  ? 233 GLY A O   1 
ATOM   1735  N  N   . LYS A 1 234 ? -0.97515  -20.18989 -15.79805 1.000 52.46443  ? 234 LYS A N   1 
ATOM   1736  C  CA  . LYS A 1 234 ? 0.06242   -19.20894 -16.09945 1.000 51.61700  ? 234 LYS A CA  1 
ATOM   1737  C  C   . LYS A 1 234 ? 1.10279   -19.10615 -14.99203 1.000 55.47093  ? 234 LYS A C   1 
ATOM   1738  O  O   . LYS A 1 234 ? 2.25877   -18.75869 -15.26430 1.000 54.83481  ? 234 LYS A O   1 
ATOM   1739  C  CB  . LYS A 1 234 ? -0.55884  -17.83121 -16.35524 1.000 47.48465  ? 234 LYS A CB  1 
ATOM   1740  C  CG  . LYS A 1 234 ? -1.36679  -17.73208 -17.64459 1.000 64.76161  ? 234 LYS A CG  1 
ATOM   1741  C  CD  . LYS A 1 234 ? -1.84100  -16.30276 -17.91994 1.000 63.55496  ? 234 LYS A CD  1 
ATOM   1742  C  CE  . LYS A 1 234 ? -3.23109  -16.03111 -17.35386 1.000 73.81724  ? 234 LYS A CE  1 
ATOM   1743  N  NZ  . LYS A 1 234 ? -3.25680  -15.95413 -15.86634 1.000 82.40664  ? 234 LYS A NZ  1 
ATOM   1744  N  N   . GLY A 1 235 ? 0.71954   -19.38495 -13.75103 1.000 50.94229  ? 235 GLY A N   1 
ATOM   1745  C  CA  . GLY A 1 235 ? 1.60313   -19.14055 -12.63448 1.000 47.05259  ? 235 GLY A CA  1 
ATOM   1746  C  C   . GLY A 1 235 ? 1.58179   -17.68455 -12.20185 1.000 49.44652  ? 235 GLY A C   1 
ATOM   1747  O  O   . GLY A 1 235 ? 0.76130   -16.87287 -12.64258 1.000 43.34142  ? 235 GLY A O   1 
ATOM   1748  N  N   . VAL A 1 236 ? 2.51583   -17.35498 -11.31577 1.000 41.09915  ? 236 VAL A N   1 
ATOM   1749  C  CA  . VAL A 1 236 ? 2.62933   -16.01182 -10.77381 1.000 35.25941  ? 236 VAL A CA  1 
ATOM   1750  C  C   . VAL A 1 236 ? 3.89607   -15.37307 -11.32580 1.000 38.21188  ? 236 VAL A C   1 
ATOM   1751  O  O   . VAL A 1 236 ? 4.83480   -16.05134 -11.75449 1.000 36.20163  ? 236 VAL A O   1 
ATOM   1752  C  CB  . VAL A 1 236 ? 2.63270   -16.00738 -9.22958  1.000 42.47484  ? 236 VAL A CB  1 
ATOM   1753  C  CG1 . VAL A 1 236 ? 1.35476   -16.63487 -8.69632  1.000 35.91794  ? 236 VAL A CG1 1 
ATOM   1754  C  CG2 . VAL A 1 236 ? 3.84971   -16.74068 -8.69175  1.000 37.92896  ? 236 VAL A CG2 1 
ATOM   1755  N  N   . ASP A 1 237 ? 3.90675   -14.03831 -11.33467 1.000 42.83685  ? 237 ASP A N   1 
ATOM   1756  C  CA  . ASP A 1 237 ? 5.08123   -13.30830 -11.79607 1.000 32.95340  ? 237 ASP A CA  1 
ATOM   1757  C  C   . ASP A 1 237 ? 6.20081   -13.32771 -10.76451 1.000 40.07848  ? 237 ASP A C   1 
ATOM   1758  O  O   . ASP A 1 237 ? 7.37961   -13.27100 -11.13224 1.000 41.32261  ? 237 ASP A O   1 
ATOM   1759  C  CB  . ASP A 1 237 ? 4.69812   -11.86906 -12.13833 1.000 31.22529  ? 237 ASP A CB  1 
ATOM   1760  C  CG  . ASP A 1 237 ? 3.67443   -11.79109 -13.25562 1.000 37.22858  ? 237 ASP A CG  1 
ATOM   1761  O  OD1 . ASP A 1 237 ? 4.02027   -12.11595 -14.41529 1.000 44.89825  ? 237 ASP A OD1 1 
ATOM   1762  O  OD2 . ASP A 1 237 ? 2.51215   -11.43061 -12.96508 1.000 35.42341  ? 237 ASP A OD2 1 
ATOM   1763  N  N   . ALA A 1 238 ? 5.85673   -13.40856 -9.48151  1.000 38.63014  ? 238 ALA A N   1 
ATOM   1764  C  CA  . ALA A 1 238 ? 6.84665   -13.45083 -8.41750  1.000 35.18739  ? 238 ALA A CA  1 
ATOM   1765  C  C   . ALA A 1 238 ? 6.24179   -14.15702 -7.21784  1.000 34.86805  ? 238 ALA A C   1 
ATOM   1766  O  O   . ALA A 1 238 ? 5.04078   -14.04915 -6.96242  1.000 42.95593  ? 238 ALA A O   1 
ATOM   1767  C  CB  . ALA A 1 238 ? 7.31649   -12.04787 -8.01583  1.000 36.62329  ? 238 ALA A CB  1 
ATOM   1768  N  N   . ALA A 1 239 ? 7.08295   -14.88571 -6.48771  1.000 40.89029  ? 239 ALA A N   1 
ATOM   1769  C  CA  . ALA A 1 239 ? 6.69420   -15.52783 -5.23884  1.000 38.84303  ? 239 ALA A CA  1 
ATOM   1770  C  C   . ALA A 1 239 ? 7.61523   -15.04601 -4.13027  1.000 43.92190  ? 239 ALA A C   1 
ATOM   1771  O  O   . ALA A 1 239 ? 8.83953   -15.02990 -4.29739  1.000 42.48871  ? 239 ALA A O   1 
ATOM   1772  C  CB  . ALA A 1 239 ? 6.74623   -17.05343 -5.34246  1.000 38.61706  ? 239 ALA A CB  1 
ATOM   1773  N  N   . ILE A 1 240 ? 7.02602   -14.63604 -3.01234  1.000 41.56955  ? 240 ILE A N   1 
ATOM   1774  C  CA  . ILE A 1 240 ? 7.77111   -14.19234 -1.84212  1.000 43.49893  ? 240 ILE A CA  1 
ATOM   1775  C  C   . ILE A 1 240 ? 7.65805   -15.27228 -0.77601  1.000 45.97782  ? 240 ILE A C   1 
ATOM   1776  O  O   . ILE A 1 240 ? 6.55407   -15.58395 -0.31169  1.000 46.46933  ? 240 ILE A O   1 
ATOM   1777  C  CB  . ILE A 1 240 ? 7.26169   -12.84206 -1.31828  1.000 43.48788  ? 240 ILE A CB  1 
ATOM   1778  C  CG1 . ILE A 1 240 ? 7.33196   -11.77968 -2.41430  1.000 42.14119  ? 240 ILE A CG1 1 
ATOM   1779  C  CG2 . ILE A 1 240 ? 8.05436   -12.41221 -0.09920  1.000 41.33909  ? 240 ILE A CG2 1 
ATOM   1780  C  CD1 . ILE A 1 240 ? 6.70598   -10.46625 -2.00823  1.000 39.16411  ? 240 ILE A CD1 1 
ATOM   1781  N  N   . ILE A 1 241 ? 8.79210   -15.85411 -0.40002  1.000 43.60232  ? 241 ILE A N   1 
ATOM   1782  C  CA  . ILE A 1 241 ? 8.83135   -16.87074 0.64360   1.000 46.36646  ? 241 ILE A CA  1 
ATOM   1783  C  C   . ILE A 1 241 ? 9.02039   -16.17772 1.98628   1.000 48.31800  ? 241 ILE A C   1 
ATOM   1784  O  O   . ILE A 1 241 ? 10.01642  -15.47754 2.19860   1.000 47.04901  ? 241 ILE A O   1 
ATOM   1785  C  CB  . ILE A 1 241 ? 9.94948   -17.89120 0.39178   1.000 47.46359  ? 241 ILE A CB  1 
ATOM   1786  C  CG1 . ILE A 1 241 ? 9.76162   -18.57101 -0.96417  1.000 50.34965  ? 241 ILE A CG1 1 
ATOM   1787  C  CG2 . ILE A 1 241 ? 9.96462   -18.92931 1.49867   1.000 50.18478  ? 241 ILE A CG2 1 
ATOM   1788  C  CD1 . ILE A 1 241 ? 10.86386  -19.55502 -1.30618  1.000 50.07978  ? 241 ILE A CD1 1 
ATOM   1789  N  N   . ALA A 1 242 ? 8.06136   -16.37106 2.89522   1.000 50.38643  ? 242 ALA A N   1 
ATOM   1790  C  CA  . ALA A 1 242 ? 8.12958   -15.79470 4.23340   1.000 56.33468  ? 242 ALA A CA  1 
ATOM   1791  C  C   . ALA A 1 242 ? 7.80581   -16.82447 5.30935   1.000 59.19219  ? 242 ALA A C   1 
ATOM   1792  O  O   . ALA A 1 242 ? 7.42586   -16.44966 6.42350   1.000 70.75431  ? 242 ALA A O   1 
ATOM   1793  C  CB  . ALA A 1 242 ? 7.18993   -14.59421 4.35848   1.000 49.96717  ? 242 ALA A CB  1 
ATOM   1794  N  N   . GLY A 1 243 ? 7.94623   -18.10694 5.00090   1.000 60.24182  ? 243 GLY A N   1 
ATOM   1795  C  CA  . GLY A 1 243 ? 7.65589   -19.14770 5.96644   1.000 59.03462  ? 243 GLY A CA  1 
ATOM   1796  C  C   . GLY A 1 243 ? 7.68286   -20.50399 5.30399   1.000 68.85326  ? 243 GLY A C   1 
ATOM   1797  O  O   . GLY A 1 243 ? 7.69211   -20.62876 4.07551   1.000 68.55562  ? 243 GLY A O   1 
ATOM   1798  N  N   . GLY A 1 244 ? 7.70049   -21.52872 6.14592   1.000 80.82427  ? 244 GLY A N   1 
ATOM   1799  C  CA  . GLY A 1 244 ? 7.69390   -22.90619 5.69472   1.000 73.46023  ? 244 GLY A CA  1 
ATOM   1800  C  C   . GLY A 1 244 ? 9.03709   -23.58433 5.90662   1.000 78.48457  ? 244 GLY A C   1 
ATOM   1801  O  O   . GLY A 1 244 ? 9.98290   -23.01827 6.45862   1.000 72.17514  ? 244 GLY A O   1 
ATOM   1802  N  N   . ASN A 1 245 ? 9.08957   -24.83541 5.45839   1.000 85.87309  ? 245 ASN A N   1 
ATOM   1803  C  CA  . ASN A 1 245 ? 10.28932  -25.64987 5.55764   1.000 80.73213  ? 245 ASN A CA  1 
ATOM   1804  C  C   . ASN A 1 245 ? 11.08454  -25.53692 4.25748   1.000 83.27461  ? 245 ASN A C   1 
ATOM   1805  O  O   . ASN A 1 245 ? 10.77521  -24.72125 3.38535   1.000 79.18883  ? 245 ASN A O   1 
ATOM   1806  C  CB  . ASN A 1 245 ? 9.91199   -27.09321 5.87790   1.000 82.56616  ? 245 ASN A CB  1 
ATOM   1807  C  CG  . ASN A 1 245 ? 9.23858   -27.23016 7.22822   1.000 106.24704 ? 245 ASN A CG  1 
ATOM   1808  O  OD1 . ASN A 1 245 ? 9.69508   -26.66632 8.22479   1.000 98.49327  ? 245 ASN A OD1 1 
ATOM   1809  N  ND2 . ASN A 1 245 ? 8.13725   -27.97130 7.26583   1.000 109.29785 ? 245 ASN A ND2 1 
ATOM   1810  N  N   . ALA A 1 246 ? 12.12856  -26.35832 4.11626   1.000 71.60647  ? 246 ALA A N   1 
ATOM   1811  C  CA  . ALA A 1 246 ? 12.96632  -26.28911 2.92288   1.000 70.98216  ? 246 ALA A CA  1 
ATOM   1812  C  C   . ALA A 1 246 ? 12.17314  -26.60024 1.66049   1.000 70.89387  ? 246 ALA A C   1 
ATOM   1813  O  O   . ALA A 1 246 ? 12.49862  -26.09238 0.58120   1.000 59.75407  ? 246 ALA A O   1 
ATOM   1814  C  CB  . ALA A 1 246 ? 14.15226  -27.24429 3.05616   1.000 70.97034  ? 246 ALA A CB  1 
ATOM   1815  N  N   . ASP A 1 247 ? 11.12835  -27.42323 1.77719   1.000 68.36916  ? 247 ASP A N   1 
ATOM   1816  C  CA  . ASP A 1 247 ? 10.33108  -27.80065 0.61705   1.000 62.93159  ? 247 ASP A CA  1 
ATOM   1817  C  C   . ASP A 1 247 ? 9.60584   -26.61443 -0.00376  1.000 66.35533  ? 247 ASP A C   1 
ATOM   1818  O  O   . ASP A 1 247 ? 9.23548   -26.67921 -1.18187  1.000 58.95198  ? 247 ASP A O   1 
ATOM   1819  C  CB  . ASP A 1 247 ? 9.32017   -28.87775 1.01086   1.000 68.50817  ? 247 ASP A CB  1 
ATOM   1820  C  CG  . ASP A 1 247 ? 8.57118   -28.53438 2.28740   1.000 91.59509  ? 247 ASP A CG  1 
ATOM   1821  O  OD1 . ASP A 1 247 ? 7.83950   -27.51969 2.29990   1.000 91.94395  ? 247 ASP A OD1 1 
ATOM   1822  O  OD2 . ASP A 1 247 ? 8.71970   -29.27592 3.28278   1.000 110.29743 ? 247 ASP A OD2 1 
ATOM   1823  N  N   . ILE A 1 248 ? 9.40175   -25.52992 0.75028   1.000 59.76938  ? 248 ILE A N   1 
ATOM   1824  C  CA  . ILE A 1 248 ? 8.68521   -24.38569 0.19915   1.000 65.44900  ? 248 ILE A CA  1 
ATOM   1825  C  C   . ILE A 1 248 ? 9.46806   -23.73010 -0.93120  1.000 58.85919  ? 248 ILE A C   1 
ATOM   1826  O  O   . ILE A 1 248 ? 8.87272   -23.06099 -1.78472  1.000 57.19262  ? 248 ILE A O   1 
ATOM   1827  C  CB  . ILE A 1 248 ? 8.35455   -23.36525 1.30641   1.000 67.88095  ? 248 ILE A CB  1 
ATOM   1828  C  CG1 . ILE A 1 248 ? 7.15993   -22.50341 0.89707   1.000 63.45419  ? 248 ILE A CG1 1 
ATOM   1829  C  CG2 . ILE A 1 248 ? 9.55100   -22.48078 1.60426   1.000 69.19293  ? 248 ILE A CG2 1 
ATOM   1830  C  CD1 . ILE A 1 248 ? 5.88790   -23.28949 0.70415   1.000 71.07490  ? 248 ILE A CD1 1 
ATOM   1831  N  N   . MET A 1 249 ? 10.79129  -23.91631 -0.96876  1.000 58.42782  ? 249 MET A N   1 
ATOM   1832  C  CA  . MET A 1 249 ? 11.57653  -23.41699 -2.09248  1.000 55.35831  ? 249 MET A CA  1 
ATOM   1833  C  C   . MET A 1 249 ? 11.18469  -24.12506 -3.38028  1.000 50.75391  ? 249 MET A C   1 
ATOM   1834  O  O   . MET A 1 249 ? 11.07541  -23.49513 -4.43790  1.000 59.26513  ? 249 MET A O   1 
ATOM   1835  C  CB  . MET A 1 249 ? 13.06756  -23.60020 -1.81420  1.000 52.07793  ? 249 MET A CB  1 
ATOM   1836  C  CG  . MET A 1 249 ? 13.97364  -23.23016 -2.97631  1.000 60.66395  ? 249 MET A CG  1 
ATOM   1837  S  SD  . MET A 1 249 ? 13.88472  -21.47918 -3.39753  1.000 64.84923  ? 249 MET A SD  1 
ATOM   1838  C  CE  . MET A 1 249 ? 14.59193  -20.75838 -1.91539  1.000 47.72017  ? 249 MET A CE  1 
ATOM   1839  N  N   . ALA A 1 250 ? 10.97139  -25.43994 -3.30784  1.000 59.45622  ? 250 ALA A N   1 
ATOM   1840  C  CA  . ALA A 1 250 ? 10.50264  -26.18202 -4.47178  1.000 56.08368  ? 250 ALA A CA  1 
ATOM   1841  C  C   . ALA A 1 250 ? 9.13410   -25.68942 -4.92074  1.000 58.18331  ? 250 ALA A C   1 
ATOM   1842  O  O   . ALA A 1 250 ? 8.88351   -25.53772 -6.12197  1.000 61.39810  ? 250 ALA A O   1 
ATOM   1843  C  CB  . ALA A 1 250 ? 10.45700  -27.67552 -4.15264  1.000 55.94948  ? 250 ALA A CB  1 
ATOM   1844  N  N   . THR A 1 251 ? 8.24063   -25.41802 -3.96715  1.000 55.64827  ? 251 THR A N   1 
ATOM   1845  C  CA  . THR A 1 251 ? 6.92117   -24.89992 -4.31240  1.000 51.45642  ? 251 THR A CA  1 
ATOM   1846  C  C   . THR A 1 251 ? 7.02666   -23.55295 -5.01602  1.000 55.99303  ? 251 THR A C   1 
ATOM   1847  O  O   . THR A 1 251 ? 6.31845   -23.29911 -5.99820  1.000 55.07420  ? 251 THR A O   1 
ATOM   1848  C  CB  . THR A 1 251 ? 6.06154   -24.78095 -3.05463  1.000 56.60193  ? 251 THR A CB  1 
ATOM   1849  O  OG1 . THR A 1 251 ? 5.90721   -26.07470 -2.45994  1.000 63.62443  ? 251 THR A OG1 1 
ATOM   1850  C  CG2 . THR A 1 251 ? 4.68904   -24.21658 -3.39404  1.000 52.69914  ? 251 THR A CG2 1 
ATOM   1851  N  N   . ALA A 1 252 ? 7.91063   -22.67731 -4.53055  1.000 50.07970  ? 252 ALA A N   1 
ATOM   1852  C  CA  . ALA A 1 252 ? 8.05850   -21.36080 -5.14203  1.000 45.69193  ? 252 ALA A CA  1 
ATOM   1853  C  C   . ALA A 1 252 ? 8.52333   -21.47584 -6.58555  1.000 50.13209  ? 252 ALA A C   1 
ATOM   1854  O  O   . ALA A 1 252 ? 8.02259   -20.76723 -7.46615  1.000 47.00711  ? 252 ALA A O   1 
ATOM   1855  C  CB  . ALA A 1 252 ? 9.03584   -20.50963 -4.33280  1.000 44.11212  ? 252 ALA A CB  1 
ATOM   1856  N  N   . VAL A 1 253 ? 9.48642   -22.36040 -6.84644  1.000 50.12943  ? 253 VAL A N   1 
ATOM   1857  C  CA  . VAL A 1 253 ? 9.99036   -22.53140 -8.20513  1.000 45.51794  ? 253 VAL A CA  1 
ATOM   1858  C  C   . VAL A 1 253 ? 8.88877   -23.05620 -9.11798  1.000 43.97797  ? 253 VAL A C   1 
ATOM   1859  O  O   . VAL A 1 253 ? 8.78686   -22.66291 -10.28740 1.000 47.64625  ? 253 VAL A O   1 
ATOM   1860  C  CB  . VAL A 1 253 ? 11.21904  -23.46126 -8.19489  1.000 56.52799  ? 253 VAL A CB  1 
ATOM   1861  C  CG1 . VAL A 1 253 ? 11.67925  -23.76682 -9.61139  1.000 59.21456  ? 253 VAL A CG1 1 
ATOM   1862  C  CG2 . VAL A 1 253 ? 12.34712  -22.84239 -7.37654  1.000 46.97629  ? 253 VAL A CG2 1 
ATOM   1863  N  N   . LYS A 1 254 ? 8.03225   -23.93269 -8.59128  1.000 44.31586  ? 254 LYS A N   1 
ATOM   1864  C  CA  . LYS A 1 254 ? 7.00323   -24.56124 -9.41394  1.000 47.70093  ? 254 LYS A CA  1 
ATOM   1865  C  C   . LYS A 1 254 ? 5.89533   -23.58817 -9.80002  1.000 42.88684  ? 254 LYS A C   1 
ATOM   1866  O  O   . LYS A 1 254 ? 5.31193   -23.72161 -10.88064 1.000 50.45305  ? 254 LYS A O   1 
ATOM   1867  C  CB  . LYS A 1 254 ? 6.41746   -25.76914 -8.68018  1.000 47.63590  ? 254 LYS A CB  1 
ATOM   1868  C  CG  . LYS A 1 254 ? 7.40007   -26.91223 -8.50068  1.000 49.64932  ? 254 LYS A CG  1 
ATOM   1869  C  CD  . LYS A 1 254 ? 6.83357   -28.01039 -7.61460  1.000 52.79692  ? 254 LYS A CD  1 
ATOM   1870  C  CE  . LYS A 1 254 ? 7.86389   -29.10658 -7.37451  1.000 56.54487  ? 254 LYS A CE  1 
ATOM   1871  N  NZ  . LYS A 1 254 ? 7.35672   -30.17108 -6.46320  1.000 64.16100  ? 254 LYS A NZ  1 
ATOM   1872  N  N   . ILE A 1 255 ? 5.59205   -22.60593 -8.94913  1.000 46.74580  ? 255 ILE A N   1 
ATOM   1873  C  CA  . ILE A 1 255 ? 4.47177   -21.70889 -9.22283  1.000 45.35070  ? 255 ILE A CA  1 
ATOM   1874  C  C   . ILE A 1 255 ? 4.87293   -20.43409 -9.95804  1.000 45.84400  ? 255 ILE A C   1 
ATOM   1875  O  O   . ILE A 1 255 ? 4.00024   -19.76312 -10.52709 1.000 43.56608  ? 255 ILE A O   1 
ATOM   1876  C  CB  . ILE A 1 255 ? 3.73615   -21.32868 -7.92528  1.000 42.13969  ? 255 ILE A CB  1 
ATOM   1877  C  CG1 . ILE A 1 255 ? 4.63531   -20.48364 -7.01985  1.000 51.63224  ? 255 ILE A CG1 1 
ATOM   1878  C  CG2 . ILE A 1 255 ? 3.26631   -22.57452 -7.20169  1.000 48.18734  ? 255 ILE A CG2 1 
ATOM   1879  C  CD1 . ILE A 1 255 ? 3.94963   -20.00493 -5.75175  1.000 43.35563  ? 255 ILE A CD1 1 
ATOM   1880  N  N   . VAL A 1 256 ? 6.15663   -20.08251 -9.97021  1.000 47.22284  ? 256 VAL A N   1 
ATOM   1881  C  CA  . VAL A 1 256 ? 6.61679   -18.88745 -10.66917 1.000 40.58308  ? 256 VAL A CA  1 
ATOM   1882  C  C   . VAL A 1 256 ? 6.76976   -19.19983 -12.15135 1.000 43.43473  ? 256 VAL A C   1 
ATOM   1883  O  O   . VAL A 1 256 ? 7.27631   -20.26278 -12.53123 1.000 46.73275  ? 256 VAL A O   1 
ATOM   1884  C  CB  . VAL A 1 256 ? 7.93418   -18.38110 -10.05399 1.000 41.37965  ? 256 VAL A CB  1 
ATOM   1885  C  CG1 . VAL A 1 256 ? 8.53770   -17.28407 -10.89917 1.000 38.50048  ? 256 VAL A CG1 1 
ATOM   1886  C  CG2 . VAL A 1 256 ? 7.68680   -17.86619 -8.65830  1.000 35.48101  ? 256 VAL A CG2 1 
ATOM   1887  N  N   . LYS A 1 257 ? 6.31611   -18.27847 -12.99771 1.000 38.40942  ? 257 LYS A N   1 
ATOM   1888  C  CA  . LYS A 1 257 ? 6.41791   -18.46675 -14.43375 1.000 42.77453  ? 257 LYS A CA  1 
ATOM   1889  C  C   . LYS A 1 257 ? 7.86017   -18.25344 -14.88911 1.000 43.21953  ? 257 LYS A C   1 
ATOM   1890  O  O   . LYS A 1 257 ? 8.65950   -17.64420 -14.17684 1.000 37.36816  ? 257 LYS A O   1 
ATOM   1891  C  CB  . LYS A 1 257 ? 5.49108   -17.49646 -15.16191 1.000 38.39405  ? 257 LYS A CB  1 
ATOM   1892  C  CG  . LYS A 1 257 ? 5.87691   -16.04475 -14.97269 1.000 42.53738  ? 257 LYS A CG  1 
ATOM   1893  C  CD  . LYS A 1 257 ? 4.89516   -15.09980 -15.64009 1.000 46.58578  ? 257 LYS A CD  1 
ATOM   1894  C  CE  . LYS A 1 257 ? 3.48891   -15.27158 -15.09416 1.000 43.58315  ? 257 LYS A CE  1 
ATOM   1895  N  NZ  . LYS A 1 257 ? 2.59491   -14.18218 -15.57440 1.000 40.23816  ? 257 LYS A NZ  1 
ATOM   1896  N  N   . PRO A 1 258 ? 8.22392   -18.76803 -16.06408 1.000 48.07475  ? 258 PRO A N   1 
ATOM   1897  C  CA  . PRO A 1 258 ? 9.56851   -18.50543 -16.59459 1.000 39.80040  ? 258 PRO A CA  1 
ATOM   1898  C  C   . PRO A 1 258 ? 9.83499   -17.01220 -16.70053 1.000 41.29030  ? 258 PRO A C   1 
ATOM   1899  O  O   . PRO A 1 258 ? 8.99211   -16.24359 -17.17015 1.000 38.92731  ? 258 PRO A O   1 
ATOM   1900  C  CB  . PRO A 1 258 ? 9.54147   -19.17900 -17.96815 1.000 43.49789  ? 258 PRO A CB  1 
ATOM   1901  C  CG  . PRO A 1 258 ? 8.54232   -20.27158 -17.81252 1.000 42.98365  ? 258 PRO A CG  1 
ATOM   1902  C  CD  . PRO A 1 258 ? 7.48805   -19.74309 -16.88842 1.000 37.57329  ? 258 PRO A CD  1 
ATOM   1903  N  N   . GLY A 1 259 ? 11.01960  -16.60418 -16.24942 1.000 44.73091  ? 259 GLY A N   1 
ATOM   1904  C  CA  . GLY A 1 259 ? 11.37728  -15.20536 -16.18964 1.000 46.25408  ? 259 GLY A CA  1 
ATOM   1905  C  C   . GLY A 1 259 ? 11.01520  -14.51075 -14.89410 1.000 45.09277  ? 259 GLY A C   1 
ATOM   1906  O  O   . GLY A 1 259 ? 11.42953  -13.36331 -14.68722 1.000 41.15207  ? 259 GLY A O   1 
ATOM   1907  N  N   . GLY A 1 260 ? 10.26689  -15.16481 -14.01259 1.000 38.31138  ? 260 GLY A N   1 
ATOM   1908  C  CA  . GLY A 1 260 ? 9.87569   -14.56820 -12.75586 1.000 43.52369  ? 260 GLY A CA  1 
ATOM   1909  C  C   . GLY A 1 260 ? 10.97540  -14.64782 -11.71678 1.000 36.17790  ? 260 GLY A C   1 
ATOM   1910  O  O   . GLY A 1 260 ? 12.10137  -15.07433 -11.97712 1.000 37.09821  ? 260 GLY A O   1 
ATOM   1911  N  N   . THR A 1 261 ? 10.62191  -14.23950 -10.50165 1.000 37.68843  ? 261 THR A N   1 
ATOM   1912  C  CA  . THR A 1 261 ? 11.57127  -14.12552 -9.40453  1.000 39.04714  ? 261 THR A CA  1 
ATOM   1913  C  C   . THR A 1 261 ? 11.01489  -14.79524 -8.15716  1.000 35.77992  ? 261 THR A C   1 
ATOM   1914  O  O   . THR A 1 261 ? 9.83892   -14.62192 -7.82224  1.000 39.48745  ? 261 THR A O   1 
ATOM   1915  C  CB  . THR A 1 261 ? 11.88390  -12.65313 -9.10481  1.000 30.03646  ? 261 THR A CB  1 
ATOM   1916  O  OG1 . THR A 1 261 ? 12.35252  -12.01589 -10.29791 1.000 43.59255  ? 261 THR A OG1 1 
ATOM   1917  C  CG2 . THR A 1 261 ? 12.95048  -12.53603 -8.03228  1.000 32.60796  ? 261 THR A CG2 1 
ATOM   1918  N  N   . ILE A 1 262 ? 11.86249  -15.56742 -7.47983  1.000 37.39157  ? 262 ILE A N   1 
ATOM   1919  C  CA  . ILE A 1 262 ? 11.57220  -16.09441 -6.15069  1.000 35.87446  ? 262 ILE A CA  1 
ATOM   1920  C  C   . ILE A 1 262 ? 12.36289  -15.26446 -5.14775  1.000 38.08000  ? 262 ILE A C   1 
ATOM   1921  O  O   . ILE A 1 262 ? 13.60014  -15.27011 -5.16238  1.000 37.99791  ? 262 ILE A O   1 
ATOM   1922  C  CB  . ILE A 1 262 ? 11.93143  -17.58502 -6.03435  1.000 37.82769  ? 262 ILE A CB  1 
ATOM   1923  C  CG1 . ILE A 1 262 ? 11.02933  -18.44549 -6.92322  1.000 39.66400  ? 262 ILE A CG1 1 
ATOM   1924  C  CG2 . ILE A 1 262 ? 11.81239  -18.04435 -4.59612  1.000 40.23840  ? 262 ILE A CG2 1 
ATOM   1925  C  CD1 . ILE A 1 262 ? 11.58304  -18.68011 -8.30975  1.000 42.14157  ? 262 ILE A CD1 1 
ATOM   1926  N  N   . ALA A 1 263 ? 11.66096  -14.53808 -4.28553  1.000 36.49537  ? 263 ALA A N   1 
ATOM   1927  C  CA  . ALA A 1 263 ? 12.28993  -13.70190 -3.27148  1.000 36.96603  ? 263 ALA A CA  1 
ATOM   1928  C  C   . ALA A 1 263 ? 12.07074  -14.34360 -1.91146  1.000 39.52464  ? 263 ALA A C   1 
ATOM   1929  O  O   . ALA A 1 263 ? 10.92730  -14.47289 -1.46674  1.000 43.55838  ? 263 ALA A O   1 
ATOM   1930  C  CB  . ALA A 1 263 ? 11.71820  -12.28577 -3.29538  1.000 37.60207  ? 263 ALA A CB  1 
ATOM   1931  N  N   . ASN A 1 264 ? 13.15632  -14.74763 -1.25665  1.000 40.92686  ? 264 ASN A N   1 
ATOM   1932  C  CA  . ASN A 1 264 ? 13.08270  -15.41696 0.03591   1.000 47.66662  ? 264 ASN A CA  1 
ATOM   1933  C  C   . ASN A 1 264 ? 13.53472  -14.47385 1.14494   1.000 44.24213  ? 264 ASN A C   1 
ATOM   1934  O  O   . ASN A 1 264 ? 14.59985  -13.85607 1.04655   1.000 48.19636  ? 264 ASN A O   1 
ATOM   1935  C  CB  . ASN A 1 264 ? 13.94016  -16.68452 0.04134   1.000 48.37776  ? 264 ASN A CB  1 
ATOM   1936  C  CG  . ASN A 1 264 ? 14.00533  -17.33162 1.40501   1.000 50.53078  ? 264 ASN A CG  1 
ATOM   1937  O  OD1 . ASN A 1 264 ? 13.01928  -17.89218 1.87881   1.000 55.02591  ? 264 ASN A OD1 1 
ATOM   1938  N  ND2 . ASN A 1 264 ? 15.16384  -17.25332 2.04931   1.000 63.02162  ? 264 ASN A ND2 1 
ATOM   1939  N  N   . VAL A 1 265 ? 12.73076  -14.37490 2.20255   1.000 46.12767  ? 265 VAL A N   1 
ATOM   1940  C  CA  . VAL A 1 265 ? 13.12607  -13.64839 3.40530   1.000 49.86877  ? 265 VAL A CA  1 
ATOM   1941  C  C   . VAL A 1 265 ? 12.89846  -14.55219 4.60771   1.000 49.89809  ? 265 VAL A C   1 
ATOM   1942  O  O   . VAL A 1 265 ? 12.96028  -14.10581 5.75847   1.000 54.93107  ? 265 VAL A O   1 
ATOM   1943  C  CB  . VAL A 1 265 ? 12.36255  -12.31959 3.55670   1.000 45.86390  ? 265 VAL A CB  1 
ATOM   1944  C  CG1 . VAL A 1 265 ? 12.84861  -11.30674 2.53309   1.000 43.28124  ? 265 VAL A CG1 1 
ATOM   1945  C  CG2 . VAL A 1 265 ? 10.86673  -12.54750 3.43081   1.000 45.89282  ? 265 VAL A CG2 1 
ATOM   1946  N  N   . ASN A 1 266 ? 12.62653  -15.82638 4.34297   1.000 52.71039  ? 266 ASN A N   1 
ATOM   1947  C  CA  . ASN A 1 266 ? 12.43757  -16.80758 5.40081   1.000 64.82439  ? 266 ASN A CA  1 
ATOM   1948  C  C   . ASN A 1 266 ? 13.78673  -17.26351 5.94151   1.000 60.16208  ? 266 ASN A C   1 
ATOM   1949  O  O   . ASN A 1 266 ? 14.74199  -17.46300 5.18567   1.000 65.45331  ? 266 ASN A O   1 
ATOM   1950  C  CB  . ASN A 1 266 ? 11.64251  -18.00669 4.87683   1.000 61.74767  ? 266 ASN A CB  1 
ATOM   1951  C  CG  . ASN A 1 266 ? 11.42315  -19.07898 5.93359   1.000 65.27826  ? 266 ASN A CG  1 
ATOM   1952  O  OD1 . ASN A 1 266 ? 11.25902  -18.78213 7.11413   1.000 67.02067  ? 266 ASN A OD1 1 
ATOM   1953  N  ND2 . ASN A 1 266 ? 11.41797  -20.33635 5.50652   1.000 68.71033  ? 266 ASN A ND2 1 
ATOM   1954  N  N   . TYR A 1 267 ? 13.86700  -17.40022 7.26083   1.000 68.18587  ? 267 TYR A N   1 
ATOM   1955  C  CA  . TYR A 1 267 ? 15.07149  -17.89073 7.92602   1.000 73.72893  ? 267 TYR A CA  1 
ATOM   1956  C  C   . TYR A 1 267 ? 14.92411  -19.40010 8.08664   1.000 69.72917  ? 267 TYR A C   1 
ATOM   1957  O  O   . TYR A 1 267 ? 14.20899  -19.87457 8.97274   1.000 78.56106  ? 267 TYR A O   1 
ATOM   1958  C  CB  . TYR A 1 267 ? 15.26097  -17.19350 9.26850   1.000 82.65763  ? 267 TYR A CB  1 
ATOM   1959  C  CG  . TYR A 1 267 ? 16.42978  -17.69235 10.08554  1.000 87.42177  ? 267 TYR A CG  1 
ATOM   1960  C  CD1 . TYR A 1 267 ? 17.58489  -18.15735 9.47258   1.000 87.15193  ? 267 TYR A CD1 1 
ATOM   1961  C  CD2 . TYR A 1 267 ? 16.37636  -17.70045 11.47264  1.000 96.97095  ? 267 TYR A CD2 1 
ATOM   1962  C  CE1 . TYR A 1 267 ? 18.65349  -18.61086 10.21834  1.000 97.16554  ? 267 TYR A CE1 1 
ATOM   1963  C  CE2 . TYR A 1 267 ? 17.44210  -18.15452 12.22537  1.000 104.08353 ? 267 TYR A CE2 1 
ATOM   1964  C  CZ  . TYR A 1 267 ? 18.57771  -18.60922 11.59061  1.000 97.35926  ? 267 TYR A CZ  1 
ATOM   1965  O  OH  . TYR A 1 267 ? 19.64626  -19.06306 12.32550  1.000 110.19604 ? 267 TYR A OH  1 
ATOM   1966  N  N   . PHE A 1 268 ? 15.58996  -20.15843 7.21720   1.000 67.67961  ? 268 PHE A N   1 
ATOM   1967  C  CA  . PHE A 1 268 ? 15.55344  -21.61510 7.28335   1.000 69.59223  ? 268 PHE A CA  1 
ATOM   1968  C  C   . PHE A 1 268 ? 16.47471  -22.09277 8.39895   1.000 84.37896  ? 268 PHE A C   1 
ATOM   1969  O  O   . PHE A 1 268 ? 17.69227  -21.89185 8.33369   1.000 85.16408  ? 268 PHE A O   1 
ATOM   1970  C  CB  . PHE A 1 268 ? 15.96487  -22.22669 5.94613   1.000 70.71872  ? 268 PHE A CB  1 
ATOM   1971  C  CG  . PHE A 1 268 ? 15.03604  -21.89344 4.81320   1.000 60.02334  ? 268 PHE A CG  1 
ATOM   1972  C  CD1 . PHE A 1 268 ? 13.91878  -22.67388 4.56413   1.000 71.14890  ? 268 PHE A CD1 1 
ATOM   1973  C  CD2 . PHE A 1 268 ? 15.28468  -20.80841 3.99153   1.000 64.79869  ? 268 PHE A CD2 1 
ATOM   1974  C  CE1 . PHE A 1 268 ? 13.06147  -22.37223 3.52168   1.000 67.12296  ? 268 PHE A CE1 1 
ATOM   1975  C  CE2 . PHE A 1 268 ? 14.43237  -20.50234 2.94615   1.000 66.98997  ? 268 PHE A CE2 1 
ATOM   1976  C  CZ  . PHE A 1 268 ? 13.31899  -21.28596 2.71100   1.000 63.32110  ? 268 PHE A CZ  1 
ATOM   1977  N  N   . GLY A 1 269 ? 15.89731  -22.72482 9.41927   1.000 85.40778  ? 269 GLY A N   1 
ATOM   1978  C  CA  . GLY A 1 269 ? 16.65906  -23.11281 10.59023  1.000 90.90117  ? 269 GLY A CA  1 
ATOM   1979  C  C   . GLY A 1 269 ? 17.18150  -24.53539 10.58170  1.000 102.83212 ? 269 GLY A C   1 
ATOM   1980  O  O   . GLY A 1 269 ? 18.13297  -24.84980 11.30472  1.000 103.84657 ? 269 GLY A O   1 
ATOM   1981  N  N   . GLU A 1 270 ? 16.57338  -25.40782 9.77927   1.000 99.48099  ? 270 GLU A N   1 
ATOM   1982  C  CA  . GLU A 1 270 ? 16.95181  -26.81285 9.73883   1.000 101.28494 ? 270 GLU A CA  1 
ATOM   1983  C  C   . GLU A 1 270 ? 17.08399  -27.27704 8.29601   1.000 98.17099  ? 270 GLU A C   1 
ATOM   1984  O  O   . GLU A 1 270 ? 16.52011  -26.68482 7.37251   1.000 86.69358  ? 270 GLU A O   1 
ATOM   1985  C  CB  . GLU A 1 270 ? 15.94062  -27.70595 10.47380  1.000 106.05192 ? 270 GLU A CB  1 
ATOM   1986  C  CG  . GLU A 1 270 ? 14.56034  -27.75066 9.83765   1.000 108.46402 ? 270 GLU A CG  1 
ATOM   1987  C  CD  . GLU A 1 270 ? 13.57544  -28.56739 10.65052  1.000 110.35730 ? 270 GLU A CD  1 
ATOM   1988  O  OE1 . GLU A 1 270 ? 14.00802  -29.23733 11.61239  1.000 120.40494 ? 270 GLU A OE1 1 
ATOM   1989  O  OE2 . GLU A 1 270 ? 12.36869  -28.53576 10.33038  1.000 119.71525 ? 270 GLU A OE2 1 
ATOM   1990  N  N   . GLY A 1 271 ? 17.83586  -28.36000 8.11960   1.000 96.14702  ? 271 GLY A N   1 
ATOM   1991  C  CA  . GLY A 1 271 ? 18.07565  -28.92010 6.80637   1.000 97.34376  ? 271 GLY A CA  1 
ATOM   1992  C  C   . GLY A 1 271 ? 19.42616  -28.52860 6.24655   1.000 100.76549 ? 271 GLY A C   1 
ATOM   1993  O  O   . GLY A 1 271 ? 19.86226  -27.38470 6.40237   1.000 102.12432 ? 271 GLY A O   1 
ATOM   1994  N  N   . GLU A 1 272 ? 20.10072  -29.47409 5.59133   1.000 96.56802  ? 272 GLU A N   1 
ATOM   1995  C  CA  . GLU A 1 272 ? 21.40325  -29.18760 5.00197   1.000 97.54495  ? 272 GLU A CA  1 
ATOM   1996  C  C   . GLU A 1 272 ? 21.28067  -28.52415 3.63703   1.000 88.38624  ? 272 GLU A C   1 
ATOM   1997  O  O   . GLU A 1 272 ? 22.12879  -27.70167 3.27272   1.000 85.18778  ? 272 GLU A O   1 
ATOM   1998  C  CB  . GLU A 1 272 ? 22.22472  -30.47425 4.88151   1.000 99.34532  ? 272 GLU A CB  1 
ATOM   1999  C  CG  . GLU A 1 272 ? 23.63144  -30.26272 4.33542   1.000 110.61980 ? 272 GLU A CG  1 
ATOM   2000  C  CD  . GLU A 1 272 ? 24.39729  -31.55879 4.15518   1.000 119.00753 ? 272 GLU A CD  1 
ATOM   2001  O  OE1 . GLU A 1 272 ? 23.90457  -32.61282 4.60920   1.000 128.69282 ? 272 GLU A OE1 1 
ATOM   2002  O  OE2 . GLU A 1 272 ? 25.49237  -31.52253 3.55461   1.000 124.62340 ? 272 GLU A OE2 1 
ATOM   2003  N  N   . VAL A 1 273 ? 20.23842  -28.85278 2.88084   1.000 85.01976  ? 273 VAL A N   1 
ATOM   2004  C  CA  . VAL A 1 273 ? 20.09630  -28.41213 1.50086   1.000 73.37962  ? 273 VAL A CA  1 
ATOM   2005  C  C   . VAL A 1 273 ? 18.70740  -27.82213 1.30146   1.000 69.94573  ? 273 VAL A C   1 
ATOM   2006  O  O   . VAL A 1 273 ? 17.71702  -28.34555 1.82343   1.000 84.43095  ? 273 VAL A O   1 
ATOM   2007  C  CB  . VAL A 1 273 ? 20.34159  -29.58766 0.52855   1.000 83.40185  ? 273 VAL A CB  1 
ATOM   2008  C  CG1 . VAL A 1 273 ? 19.76006  -29.29884 -0.84152  1.000 78.74355  ? 273 VAL A CG1 1 
ATOM   2009  C  CG2 . VAL A 1 273 ? 21.83084  -29.90174 0.43579   1.000 84.68522  ? 273 VAL A CG2 1 
ATOM   2010  N  N   . LEU A 1 274 ? 18.63754  -26.72809 0.54189   1.000 75.42384  ? 274 LEU A N   1 
ATOM   2011  C  CA  . LEU A 1 274 ? 17.36825  -26.18210 0.08855   1.000 78.93716  ? 274 LEU A CA  1 
ATOM   2012  C  C   . LEU A 1 274 ? 17.10200  -26.68199 -1.32094  1.000 78.03900  ? 274 LEU A C   1 
ATOM   2013  O  O   . LEU A 1 274 ? 17.89400  -26.38532 -2.22924  1.000 76.78176  ? 274 LEU A O   1 
ATOM   2014  C  CB  . LEU A 1 274 ? 17.39148  -24.65837 0.11894   1.000 69.23936  ? 274 LEU A CB  1 
ATOM   2015  C  CG  . LEU A 1 274 ? 17.77270  -24.03106 1.46302   1.000 70.09950  ? 274 LEU A CG  1 
ATOM   2016  C  CD1 . LEU A 1 274 ? 17.72401  -22.51604 1.38450   1.000 74.38653  ? 274 LEU A CD1 1 
ATOM   2017  C  CD2 . LEU A 1 274 ? 16.87306  -24.54165 2.57895   1.000 76.94619  ? 274 LEU A CD2 1 
ATOM   2018  N  N   . PRO A 1 275 ? 16.03324  -27.44637 -1.55333  1.000 86.47005  ? 275 PRO A N   1 
ATOM   2019  C  CA  . PRO A 1 275 ? 15.85901  -28.10771 -2.85489  1.000 82.78700  ? 275 PRO A CA  1 
ATOM   2020  C  C   . PRO A 1 275 ? 15.36536  -27.14861 -3.93097  1.000 74.08385  ? 275 PRO A C   1 
ATOM   2021  O  O   . PRO A 1 275 ? 14.40775  -26.39910 -3.72658  1.000 77.48809  ? 275 PRO A O   1 
ATOM   2022  C  CB  . PRO A 1 275 ? 14.81584  -29.19088 -2.55991  1.000 87.90562  ? 275 PRO A CB  1 
ATOM   2023  C  CG  . PRO A 1 275 ? 14.00895  -28.61766 -1.44153  1.000 90.34725  ? 275 PRO A CG  1 
ATOM   2024  C  CD  . PRO A 1 275 ? 14.97034  -27.81120 -0.60035  1.000 88.84105  ? 275 PRO A CD  1 
ATOM   2025  N  N   . VAL A 1 276 ? 16.02392  -27.18485 -5.08403  1.000 68.70858  ? 276 VAL A N   1 
ATOM   2026  C  CA  . VAL A 1 276 ? 15.58075  -26.49568 -6.28979  1.000 76.00040  ? 276 VAL A CA  1 
ATOM   2027  C  C   . VAL A 1 276 ? 15.22926  -27.56601 -7.32145  1.000 77.43094  ? 276 VAL A C   1 
ATOM   2028  O  O   . VAL A 1 276 ? 16.12243  -28.29112 -7.78544  1.000 80.68389  ? 276 VAL A O   1 
ATOM   2029  C  CB  . VAL A 1 276 ? 16.65066  -25.53445 -6.82437  1.000 70.50739  ? 276 VAL A CB  1 
ATOM   2030  C  CG1 . VAL A 1 276 ? 16.22275  -24.95922 -8.16320  1.000 61.75914  ? 276 VAL A CG1 1 
ATOM   2031  C  CG2 . VAL A 1 276 ? 16.90634  -24.41991 -5.82419  1.000 61.22905  ? 276 VAL A CG2 1 
ATOM   2032  N  N   . PRO A 1 277 ? 13.96040  -27.70992 -7.70719  1.000 73.98778  ? 277 PRO A N   1 
ATOM   2033  C  CA  . PRO A 1 277 ? 13.58990  -28.79139 -8.63308  1.000 78.45582  ? 277 PRO A CA  1 
ATOM   2034  C  C   . PRO A 1 277 ? 14.19252  -28.55020 -10.00825 1.000 73.33253  ? 277 PRO A C   1 
ATOM   2035  O  O   . PRO A 1 277 ? 14.03742  -27.47250 -10.58450 1.000 71.81240  ? 277 PRO A O   1 
ATOM   2036  C  CB  . PRO A 1 277 ? 12.05655  -28.72654 -8.67121  1.000 73.62381  ? 277 PRO A CB  1 
ATOM   2037  C  CG  . PRO A 1 277 ? 11.65879  -27.80997 -7.54488  1.000 70.94850  ? 277 PRO A CG  1 
ATOM   2038  C  CD  . PRO A 1 277 ? 12.80543  -26.87358 -7.34713  1.000 65.85372  ? 277 PRO A CD  1 
ATOM   2039  N  N   . ARG A 1 278 ? 14.88181  -29.56583 -10.53258 1.000 75.19275  ? 278 ARG A N   1 
ATOM   2040  C  CA  . ARG A 1 278 ? 15.58666  -29.39866 -11.79939 1.000 71.96716  ? 278 ARG A CA  1 
ATOM   2041  C  C   . ARG A 1 278 ? 14.61122  -29.13607 -12.94119 1.000 73.20196  ? 278 ARG A C   1 
ATOM   2042  O  O   . ARG A 1 278 ? 14.73494  -28.13805 -13.66019 1.000 66.33663  ? 278 ARG A O   1 
ATOM   2043  C  CB  . ARG A 1 278 ? 16.44472  -30.62942 -12.09521 1.000 74.97463  ? 278 ARG A CB  1 
ATOM   2044  C  CG  . ARG A 1 278 ? 17.23899  -30.51240 -13.38660 1.000 81.40790  ? 278 ARG A CG  1 
ATOM   2045  C  CD  . ARG A 1 278 ? 18.00538  -31.78261 -13.70303 1.000 78.87120  ? 278 ARG A CD  1 
ATOM   2046  N  NE  . ARG A 1 278 ? 17.10516  -32.91440 -13.88359 1.000 85.72919  ? 278 ARG A NE  1 
ATOM   2047  C  CZ  . ARG A 1 278 ? 16.58933  -33.27901 -15.04933 1.000 87.97646  ? 278 ARG A CZ  1 
ATOM   2048  N  NH1 . ARG A 1 278 ? 16.86490  -32.61998 -16.16303 1.000 93.20883  ? 278 ARG A NH1 1 
ATOM   2049  N  NH2 . ARG A 1 278 ? 15.77218  -34.32739 -15.09842 1.000 89.25874  ? 278 ARG A NH2 1 
ATOM   2050  N  N   . LEU A 1 279 ? 13.61993  -30.01540 -13.11010 1.000 71.63587  ? 279 LEU A N   1 
ATOM   2051  C  CA  . LEU A 1 279 ? 12.70978  -29.90741 -14.24786 1.000 65.33925  ? 279 LEU A CA  1 
ATOM   2052  C  C   . LEU A 1 279 ? 11.89881  -28.61756 -14.19438 1.000 71.32377  ? 279 LEU A C   1 
ATOM   2053  O  O   . LEU A 1 279 ? 11.76699  -27.91125 -15.20136 1.000 76.53255  ? 279 LEU A O   1 
ATOM   2054  C  CB  . LEU A 1 279 ? 11.78095  -31.12138 -14.29143 1.000 70.46277  ? 279 LEU A CB  1 
ATOM   2055  C  CG  . LEU A 1 279 ? 12.42394  -32.46650 -14.62832 1.000 73.14103  ? 279 LEU A CG  1 
ATOM   2056  C  CD1 . LEU A 1 279 ? 11.38931  -33.57549 -14.56626 1.000 79.01221  ? 279 LEU A CD1 1 
ATOM   2057  C  CD2 . LEU A 1 279 ? 13.07492  -32.41372 -16.00196 1.000 74.42118  ? 279 LEU A CD2 1 
ATOM   2058  N  N   . GLU A 1 280 ? 11.34784  -28.28930 -13.02361 1.000 67.25802  ? 280 GLU A N   1 
ATOM   2059  C  CA  . GLU A 1 280 ? 10.52206  -27.09258 -12.91336 1.000 63.95940  ? 280 GLU A CA  1 
ATOM   2060  C  C   . GLU A 1 280 ? 11.34549  -25.81412 -12.97519 1.000 67.42598  ? 280 GLU A C   1 
ATOM   2061  O  O   . GLU A 1 280 ? 10.78565  -24.74205 -13.22935 1.000 60.55503  ? 280 GLU A O   1 
ATOM   2062  C  CB  . GLU A 1 280 ? 9.70425   -27.13141 -11.62117 1.000 59.02289  ? 280 GLU A CB  1 
ATOM   2063  C  CG  . GLU A 1 280 ? 8.54959   -28.12940 -11.65143 1.000 69.85836  ? 280 GLU A CG  1 
ATOM   2064  C  CD  . GLU A 1 280 ? 8.97351   -29.54142 -11.27641 1.000 72.86224  ? 280 GLU A CD  1 
ATOM   2065  O  OE1 . GLU A 1 280 ? 10.19020  -29.78199 -11.11770 1.000 73.13692  ? 280 GLU A OE1 1 
ATOM   2066  O  OE2 . GLU A 1 280 ? 8.08665   -30.41398 -11.14712 1.000 78.53710  ? 280 GLU A OE2 1 
ATOM   2067  N  N   . TRP A 1 281 ? 12.65577  -25.90046 -12.75159 1.000 70.46365  ? 281 TRP A N   1 
ATOM   2068  C  CA  . TRP A 1 281 ? 13.55746  -24.77568 -12.94873 1.000 63.06067  ? 281 TRP A CA  1 
ATOM   2069  C  C   . TRP A 1 281 ? 14.11827  -24.72987 -14.36545 1.000 63.91823  ? 281 TRP A C   1 
ATOM   2070  O  O   . TRP A 1 281 ? 15.14107  -24.07528 -14.60070 1.000 59.59618  ? 281 TRP A O   1 
ATOM   2071  C  CB  . TRP A 1 281 ? 14.69359  -24.83115 -11.92410 1.000 61.17597  ? 281 TRP A CB  1 
ATOM   2072  C  CG  . TRP A 1 281 ? 15.30997  -23.50757 -11.61782 1.000 63.42163  ? 281 TRP A CG  1 
ATOM   2073  C  CD1 . TRP A 1 281 ? 14.65902  -22.36164 -11.26463 1.000 53.37453  ? 281 TRP A CD1 1 
ATOM   2074  C  CD2 . TRP A 1 281 ? 16.70689  -23.19570 -11.60790 1.000 62.60946  ? 281 TRP A CD2 1 
ATOM   2075  N  NE1 . TRP A 1 281 ? 15.56466  -21.35030 -11.04909 1.000 59.02890  ? 281 TRP A NE1 1 
ATOM   2076  C  CE2 . TRP A 1 281 ? 16.82926  -21.83680 -11.25313 1.000 59.16393  ? 281 TRP A CE2 1 
ATOM   2077  C  CE3 . TRP A 1 281 ? 17.86550  -23.93166 -11.86893 1.000 60.13918  ? 281 TRP A CE3 1 
ATOM   2078  C  CZ2 . TRP A 1 281 ? 18.06520  -21.19857 -11.15425 1.000 48.09340  ? 281 TRP A CZ2 1 
ATOM   2079  C  CZ3 . TRP A 1 281 ? 19.09201  -23.29679 -11.77275 1.000 61.28938  ? 281 TRP A CZ3 1 
ATOM   2080  C  CH2 . TRP A 1 281 ? 19.18225  -21.94452 -11.41772 1.000 48.90160  ? 281 TRP A CH2 1 
ATOM   2081  N  N   . GLY A 1 282 ? 13.46343  -25.39976 -15.31131 1.000 63.07193  ? 282 GLY A N   1 
ATOM   2082  C  CA  . GLY A 1 282 ? 13.93652  -25.42790 -16.68108 1.000 61.03808  ? 282 GLY A CA  1 
ATOM   2083  C  C   . GLY A 1 282 ? 15.25096  -26.14549 -16.86875 1.000 59.92444  ? 282 GLY A C   1 
ATOM   2084  O  O   . GLY A 1 282 ? 15.99054  -25.83113 -17.80741 1.000 59.18806  ? 282 GLY A O   1 
ATOM   2085  N  N   . CYS A 1 283 ? 15.56104  -27.10804 -15.99707 1.000 60.38768  ? 283 CYS A N   1 
ATOM   2086  C  CA  . CYS A 1 283 ? 16.85041  -27.80064 -15.99577 1.000 72.75518  ? 283 CYS A CA  1 
ATOM   2087  C  C   . CYS A 1 283 ? 18.01425  -26.81916 -15.89141 1.000 68.31376  ? 283 CYS A C   1 
ATOM   2088  O  O   . CYS A 1 283 ? 19.11637  -27.08822 -16.37630 1.000 70.36961  ? 283 CYS A O   1 
ATOM   2089  C  CB  . CYS A 1 283 ? 17.00337  -28.69755 -17.22828 1.000 71.11532  ? 283 CYS A CB  1 
ATOM   2090  S  SG  . CYS A 1 283 ? 15.63576  -29.85894 -17.47315 1.000 69.50900  ? 283 CYS A SG  1 
ATOM   2091  N  N   . GLY A 1 284 ? 17.77187  -25.67572 -15.25820 1.000 59.65887  ? 284 GLY A N   1 
ATOM   2092  C  CA  . GLY A 1 284 ? 18.77240  -24.64378 -15.11315 1.000 60.64460  ? 284 GLY A CA  1 
ATOM   2093  C  C   . GLY A 1 284 ? 18.65402  -23.47359 -16.06241 1.000 60.31609  ? 284 GLY A C   1 
ATOM   2094  O  O   . GLY A 1 284 ? 19.53042  -22.60274 -16.04681 1.000 58.66569  ? 284 GLY A O   1 
ATOM   2095  N  N   . MET A 1 285 ? 17.59896  -23.41663 -16.88575 1.000 59.42119  ? 285 MET A N   1 
ATOM   2096  C  CA  . MET A 1 285 ? 17.53626  -22.41468 -17.94406 1.000 62.59755  ? 285 MET A CA  1 
ATOM   2097  C  C   . MET A 1 285 ? 16.17413  -21.72640 -18.03936 1.000 60.20982  ? 285 MET A C   1 
ATOM   2098  O  O   . MET A 1 285 ? 15.85001  -21.16296 -19.09361 1.000 55.49350  ? 285 MET A O   1 
ATOM   2099  C  CB  . MET A 1 285 ? 17.90042  -23.04130 -19.30041 1.000 57.34385  ? 285 MET A CB  1 
ATOM   2100  C  CG  . MET A 1 285 ? 19.29644  -23.65839 -19.34628 1.000 55.23766  ? 285 MET A CG  1 
ATOM   2101  S  SD  . MET A 1 285 ? 19.65654  -24.52927 -20.88304 1.000 74.81766  ? 285 MET A SD  1 
ATOM   2102  C  CE  . MET A 1 285 ? 18.33148  -25.73299 -20.92974 1.000 69.42796  ? 285 MET A CE  1 
ATOM   2103  N  N   . ALA A 1 286 ? 15.37429  -21.74288 -16.97355 1.000 54.81433  ? 286 ALA A N   1 
ATOM   2104  C  CA  . ALA A 1 286 ? 14.03295  -21.17215 -17.00414 1.000 50.68784  ? 286 ALA A CA  1 
ATOM   2105  C  C   . ALA A 1 286 ? 13.99697  -19.68306 -16.68140 1.000 46.53171  ? 286 ALA A C   1 
ATOM   2106  O  O   . ALA A 1 286 ? 12.90422  -19.10497 -16.64021 1.000 53.30128  ? 286 ALA A O   1 
ATOM   2107  C  CB  . ALA A 1 286 ? 13.11726  -21.92097 -16.03057 1.000 48.32956  ? 286 ALA A CB  1 
ATOM   2108  N  N   . HIS A 1 287 ? 15.15281  -19.05135 -16.45820 1.000 46.85872  ? 287 HIS A N   1 
ATOM   2109  C  CA  . HIS A 1 287 ? 15.23604  -17.63625 -16.07340 1.000 49.75165  ? 287 HIS A CA  1 
ATOM   2110  C  C   . HIS A 1 287 ? 14.41747  -17.32145 -14.82212 1.000 46.29979  ? 287 HIS A C   1 
ATOM   2111  O  O   . HIS A 1 287 ? 13.87864  -16.22079 -14.68388 1.000 49.38030  ? 287 HIS A O   1 
ATOM   2112  C  CB  . HIS A 1 287 ? 14.81545  -16.71258 -17.22258 1.000 45.19489  ? 287 HIS A CB  1 
ATOM   2113  C  CG  . HIS A 1 287 ? 15.86672  -16.53698 -18.27456 1.000 54.79979  ? 287 HIS A CG  1 
ATOM   2114  N  ND1 . HIS A 1 287 ? 15.92701  -17.32023 -19.40785 1.000 55.31576  ? 287 HIS A ND1 1 
ATOM   2115  C  CD2 . HIS A 1 287 ? 16.90651  -15.67356 -18.35936 1.000 49.26715  ? 287 HIS A CD2 1 
ATOM   2116  C  CE1 . HIS A 1 287 ? 16.94823  -16.93697 -20.15296 1.000 48.26914  ? 287 HIS A CE1 1 
ATOM   2117  N  NE2 . HIS A 1 287 ? 17.56102  -15.94202 -19.53710 1.000 44.72245  ? 287 HIS A NE2 1 
ATOM   2118  N  N   . LYS A 1 288 ? 14.31185  -18.27835 -13.90274 1.000 40.11273  ? 288 LYS A N   1 
ATOM   2119  C  CA  . LYS A 1 288 ? 13.63425  -18.06613 -12.62290 1.000 41.51043  ? 288 LYS A CA  1 
ATOM   2120  C  C   . LYS A 1 288 ? 14.67446  -17.63313 -11.59224 1.000 45.68546  ? 288 LYS A C   1 
ATOM   2121  O  O   . LYS A 1 288 ? 15.39104  -18.46389 -11.02840 1.000 48.98417  ? 288 LYS A O   1 
ATOM   2122  C  CB  . LYS A 1 288 ? 12.89705  -19.33001 -12.19325 1.000 49.32772  ? 288 LYS A CB  1 
ATOM   2123  C  CG  . LYS A 1 288 ? 11.77661  -19.73267 -13.14502 1.000 42.77139  ? 288 LYS A CG  1 
ATOM   2124  C  CD  . LYS A 1 288 ? 10.96793  -20.90685 -12.61709 1.000 40.04388  ? 288 LYS A CD  1 
ATOM   2125  C  CE  . LYS A 1 288 ? 10.00929  -21.42053 -13.67960 1.000 49.56877  ? 288 LYS A CE  1 
ATOM   2126  N  NZ  . LYS A 1 288 ? 9.18223   -22.56952 -13.20340 1.000 50.89119  ? 288 LYS A NZ  1 
ATOM   2127  N  N   . THR A 1 289 ? 14.77667  -16.32489 -11.36425 1.000 35.10560  ? 289 THR A N   1 
ATOM   2128  C  CA  . THR A 1 289 ? 15.75823  -15.79132 -10.42520 1.000 34.80447  ? 289 THR A CA  1 
ATOM   2129  C  C   . THR A 1 289 ? 15.35606  -16.08622 -8.98206  1.000 34.51574  ? 289 THR A C   1 
ATOM   2130  O  O   . THR A 1 289 ? 14.19174  -15.93751 -8.59950  1.000 36.81651  ? 289 THR A O   1 
ATOM   2131  C  CB  . THR A 1 289 ? 15.91658  -14.28384 -10.63119 1.000 35.20375  ? 289 THR A CB  1 
ATOM   2132  O  OG1 . THR A 1 289 ? 16.36381  -14.02880 -11.96817 1.000 36.67030  ? 289 THR A OG1 1 
ATOM   2133  C  CG2 . THR A 1 289 ? 16.92936  -13.70782 -9.65869  1.000 32.78286  ? 289 THR A CG2 1 
ATOM   2134  N  N   . ILE A 1 290 ? 16.32736  -16.51975 -8.18073  1.000 34.34117  ? 290 ILE A N   1 
ATOM   2135  C  CA  . ILE A 1 290 ? 16.12235  -16.82102 -6.76686  1.000 37.48449  ? 290 ILE A CA  1 
ATOM   2136  C  C   . ILE A 1 290 ? 16.95779  -15.85023 -5.94055  1.000 36.35876  ? 290 ILE A C   1 
ATOM   2137  O  O   . ILE A 1 290 ? 18.18947  -15.83462 -6.05168  1.000 37.78514  ? 290 ILE A O   1 
ATOM   2138  C  CB  . ILE A 1 290 ? 16.48995  -18.27664 -6.43522  1.000 39.14563  ? 290 ILE A CB  1 
ATOM   2139  C  CG1 . ILE A 1 290 ? 15.73091  -19.23925 -7.35014  1.000 39.92273  ? 290 ILE A CG1 1 
ATOM   2140  C  CG2 . ILE A 1 290 ? 16.17080  -18.58574 -4.98844  1.000 40.80127  ? 290 ILE A CG2 1 
ATOM   2141  C  CD1 . ILE A 1 290 ? 16.15345  -20.68183 -7.20382  1.000 41.69213  ? 290 ILE A CD1 1 
ATOM   2142  N  N   . LYS A 1 291 ? 16.29373  -15.05227 -5.10729  1.000 36.37689  ? 291 LYS A N   1 
ATOM   2143  C  CA  . LYS A 1 291 ? 16.95960  -14.12046 -4.21008  1.000 36.66285  ? 291 LYS A CA  1 
ATOM   2144  C  C   . LYS A 1 291 ? 16.63795  -14.46303 -2.76179  1.000 39.21411  ? 291 LYS A C   1 
ATOM   2145  O  O   . LYS A 1 291 ? 15.55083  -14.95449 -2.44657  1.000 47.78071  ? 291 LYS A O   1 
ATOM   2146  C  CB  . LYS A 1 291 ? 16.53729  -12.67391 -4.48505  1.000 38.22555  ? 291 LYS A CB  1 
ATOM   2147  C  CG  . LYS A 1 291 ? 16.84990  -12.16567 -5.87905  1.000 32.53718  ? 291 LYS A CG  1 
ATOM   2148  C  CD  . LYS A 1 291 ? 16.37952  -10.73042 -6.01918  1.000 42.56572  ? 291 LYS A CD  1 
ATOM   2149  C  CE  . LYS A 1 291 ? 16.56622  -10.20025 -7.42880  1.000 39.29747  ? 291 LYS A CE  1 
ATOM   2150  N  NZ  . LYS A 1 291 ? 15.99395  -8.82896  -7.56173  1.000 38.25855  ? 291 LYS A NZ  1 
ATOM   2151  N  N   . GLY A 1 292 ? 17.58854  -14.18566 -1.87940  1.000 40.06558  ? 292 GLY A N   1 
ATOM   2152  C  CA  . GLY A 1 292 ? 17.37044  -14.37405 -0.46149  1.000 45.38860  ? 292 GLY A CA  1 
ATOM   2153  C  C   . GLY A 1 292 ? 18.24092  -13.44225 0.35137   1.000 46.27660  ? 292 GLY A C   1 
ATOM   2154  O  O   . GLY A 1 292 ? 19.46742  -13.56588 0.32465   1.000 54.11507  ? 292 GLY A O   1 
ATOM   2155  N  N   . GLY A 1 293 ? 17.63452  -12.51277 1.07631   1.000 48.16673  ? 293 GLY A N   1 
ATOM   2156  C  CA  . GLY A 1 293 ? 18.39167  -11.46357 1.73087   1.000 51.26921  ? 293 GLY A CA  1 
ATOM   2157  C  C   . GLY A 1 293 ? 17.91207  -11.18610 3.13866   1.000 57.64556  ? 293 GLY A C   1 
ATOM   2158  O  O   . GLY A 1 293 ? 16.72482  -11.29879 3.45280   1.000 63.49852  ? 293 GLY A O   1 
ATOM   2159  N  N   . LEU A 1 294 ? 18.86743  -10.81808 3.99028   1.000 66.24481  ? 294 LEU A N   1 
ATOM   2160  C  CA  . LEU A 1 294 ? 18.56038  -10.30575 5.31638   1.000 56.72435  ? 294 LEU A CA  1 
ATOM   2161  C  C   . LEU A 1 294 ? 17.93638  -8.91940  5.20115   1.000 57.82082  ? 294 LEU A C   1 
ATOM   2162  O  O   . LEU A 1 294 ? 18.20527  -8.17199  4.25630   1.000 58.27773  ? 294 LEU A O   1 
ATOM   2163  C  CB  . LEU A 1 294 ? 19.83449  -10.24311 6.16312   1.000 67.29098  ? 294 LEU A CB  1 
ATOM   2164  C  CG  . LEU A 1 294 ? 19.76378  -9.74509  7.60976   1.000 67.24971  ? 294 LEU A CG  1 
ATOM   2165  C  CD1 . LEU A 1 294 ? 19.22135  -10.82251 8.53915   1.000 73.52927  ? 294 LEU A CD1 1 
ATOM   2166  C  CD2 . LEU A 1 294 ? 21.12918  -9.26078  8.07486   1.000 69.96961  ? 294 LEU A CD2 1 
ATOM   2167  N  N   . CYS A 1 295 ? 17.09345  -8.57893  6.17140   1.000 64.14743  ? 295 CYS A N   1 
ATOM   2168  C  CA  . CYS A 1 295 ? 16.39326  -7.30420  6.11655   1.000 58.70358  ? 295 CYS A CA  1 
ATOM   2169  C  C   . CYS A 1 295 ? 17.38666  -6.14698  6.20519   1.000 58.25092  ? 295 CYS A C   1 
ATOM   2170  O  O   . CYS A 1 295 ? 18.34853  -6.20783  6.98265   1.000 54.05770  ? 295 CYS A O   1 
ATOM   2171  C  CB  . CYS A 1 295 ? 15.36741  -7.20054  7.24467   1.000 57.74669  ? 295 CYS A CB  1 
ATOM   2172  S  SG  . CYS A 1 295 ? 16.06824  -7.14804  8.90993   1.000 69.18338  ? 295 CYS A SG  1 
ATOM   2173  N  N   . PRO A 1 296 ? 17.19129  -5.08638  5.42514   1.000 57.79072  ? 296 PRO A N   1 
ATOM   2174  C  CA  . PRO A 1 296 ? 18.04953  -3.90555  5.55849   1.000 63.32419  ? 296 PRO A CA  1 
ATOM   2175  C  C   . PRO A 1 296 ? 17.78129  -3.16630  6.85932   1.000 58.36888  ? 296 PRO A C   1 
ATOM   2176  O  O   . PRO A 1 296 ? 16.67171  -3.18497  7.39864   1.000 52.46825  ? 296 PRO A O   1 
ATOM   2177  C  CB  . PRO A 1 296 ? 17.67335  -3.04915  4.34295   1.000 51.89733  ? 296 PRO A CB  1 
ATOM   2178  C  CG  . PRO A 1 296 ? 16.29795  -3.48881  3.98261   1.000 49.20859  ? 296 PRO A CG  1 
ATOM   2179  C  CD  . PRO A 1 296 ? 16.21294  -4.94548  4.33363   1.000 52.84265  ? 296 PRO A CD  1 
ATOM   2180  N  N   . GLY A 1 297 ? 18.82641  -2.51820  7.36545   1.000 54.81518  ? 297 GLY A N   1 
ATOM   2181  C  CA  . GLY A 1 297 ? 18.71828  -1.69705  8.55288   1.000 52.67716  ? 297 GLY A CA  1 
ATOM   2182  C  C   . GLY A 1 297 ? 19.26255  -0.30162  8.32972   1.000 56.74740  ? 297 GLY A C   1 
ATOM   2183  O  O   . GLY A 1 297 ? 19.36673  0.15753   7.18747   1.000 53.36458  ? 297 GLY A O   1 
ATOM   2184  N  N   . GLY A 1 298 ? 19.61499  0.38386   9.41085   1.000 53.19926  ? 298 GLY A N   1 
ATOM   2185  C  CA  . GLY A 1 298 ? 20.15839  1.71971   9.31901   1.000 55.45560  ? 298 GLY A CA  1 
ATOM   2186  C  C   . GLY A 1 298 ? 19.09349  2.79922   9.39498   1.000 49.66895  ? 298 GLY A C   1 
ATOM   2187  O  O   . GLY A 1 298 ? 17.88789  2.54507   9.39537   1.000 49.35168  ? 298 GLY A O   1 
ATOM   2188  N  N   . ARG A 1 299 ? 19.57218  4.04198   9.46266   1.000 57.58731  ? 299 ARG A N   1 
ATOM   2189  C  CA  . ARG A 1 299 ? 18.68581  5.18786   9.64100   1.000 52.18622  ? 299 ARG A CA  1 
ATOM   2190  C  C   . ARG A 1 299 ? 17.77937  5.39336   8.43353   1.000 54.23064  ? 299 ARG A C   1 
ATOM   2191  O  O   . ARG A 1 299 ? 16.55878  5.53005   8.57969   1.000 55.06865  ? 299 ARG A O   1 
ATOM   2192  C  CB  . ARG A 1 299 ? 19.52021  6.44075   9.90671   1.000 59.33717  ? 299 ARG A CB  1 
ATOM   2193  C  CG  . ARG A 1 299 ? 18.76519  7.75311   9.79365   1.000 55.27082  ? 299 ARG A CG  1 
ATOM   2194  C  CD  . ARG A 1 299 ? 19.61814  8.88800   10.33538  1.000 56.32988  ? 299 ARG A CD  1 
ATOM   2195  N  NE  . ARG A 1 299 ? 18.92340  10.16848  10.32190  1.000 61.92212  ? 299 ARG A NE  1 
ATOM   2196  C  CZ  . ARG A 1 299 ? 19.43815  11.29876  10.78642  1.000 66.46725  ? 299 ARG A CZ  1 
ATOM   2197  N  NH1 . ARG A 1 299 ? 20.64972  11.33970  11.31664  1.000 61.64570  ? 299 ARG A NH1 1 
ATOM   2198  N  NH2 . ARG A 1 299 ? 18.72113  12.41624  10.71418  1.000 68.31883  ? 299 ARG A NH2 1 
ATOM   2199  N  N   . LEU A 1 300 ? 18.35791  5.41139   7.22904   1.000 52.42526  ? 300 LEU A N   1 
ATOM   2200  C  CA  . LEU A 1 300 ? 17.57893  5.75403   6.04274   1.000 54.79096  ? 300 LEU A CA  1 
ATOM   2201  C  C   . LEU A 1 300 ? 16.43804  4.77190   5.82609   1.000 50.97592  ? 300 LEU A C   1 
ATOM   2202  O  O   . LEU A 1 300 ? 15.31208  5.17712   5.51560   1.000 45.59182  ? 300 LEU A O   1 
ATOM   2203  C  CB  . LEU A 1 300 ? 18.48141  5.79347   4.81347   1.000 53.09724  ? 300 LEU A CB  1 
ATOM   2204  C  CG  . LEU A 1 300 ? 17.79026  6.15382   3.50079   1.000 52.92254  ? 300 LEU A CG  1 
ATOM   2205  C  CD1 . LEU A 1 300 ? 17.24668  7.57487   3.53730   1.000 51.16542  ? 300 LEU A CD1 1 
ATOM   2206  C  CD2 . LEU A 1 300 ? 18.74692  5.96255   2.35077   1.000 58.19576  ? 300 LEU A CD2 1 
ATOM   2207  N  N   . ARG A 1 301 ? 16.70601  3.47735   6.00194   1.000 53.80438  ? 301 ARG A N   1 
ATOM   2208  C  CA  . ARG A 1 301 ? 15.65140  2.47983   5.87091   1.000 45.13727  ? 301 ARG A CA  1 
ATOM   2209  C  C   . ARG A 1 301 ? 14.51762  2.76212   6.84663   1.000 50.06631  ? 301 ARG A C   1 
ATOM   2210  O  O   . ARG A 1 301 ? 13.33924  2.72095   6.47531   1.000 49.15946  ? 301 ARG A O   1 
ATOM   2211  C  CB  . ARG A 1 301 ? 16.22658  1.08156   6.09505   1.000 50.58773  ? 301 ARG A CB  1 
ATOM   2212  C  CG  . ARG A 1 301 ? 15.19480  -0.03033  6.04195   1.000 48.10912  ? 301 ARG A CG  1 
ATOM   2213  C  CD  . ARG A 1 301 ? 14.50068  -0.08180  4.69344   1.000 48.48955  ? 301 ARG A CD  1 
ATOM   2214  N  NE  . ARG A 1 301 ? 13.82869  -1.35802  4.48621   1.000 54.28312  ? 301 ARG A NE  1 
ATOM   2215  C  CZ  . ARG A 1 301 ? 13.27279  -1.73682  3.34376   1.000 47.62052  ? 301 ARG A CZ  1 
ATOM   2216  N  NH1 . ARG A 1 301 ? 13.26237  -0.94543  2.28344   1.000 44.53357  ? 301 ARG A NH1 1 
ATOM   2217  N  NH2 . ARG A 1 301 ? 12.71216  -2.94006  3.26336   1.000 49.08850  ? 301 ARG A NH2 1 
ATOM   2218  N  N   . MET A 1 302 ? 14.85884  3.06123   8.10389   1.000 50.01963  ? 302 MET A N   1 
ATOM   2219  C  CA  . MET A 1 302 ? 13.83411  3.36954   9.09687   1.000 48.05543  ? 302 MET A CA  1 
ATOM   2220  C  C   . MET A 1 302 ? 13.08817  4.65081   8.74712   1.000 47.79102  ? 302 MET A C   1 
ATOM   2221  O  O   . MET A 1 302 ? 11.86102  4.71496   8.87955   1.000 53.73632  ? 302 MET A O   1 
ATOM   2222  C  CB  . MET A 1 302 ? 14.46170  3.48351   10.48522  1.000 54.17992  ? 302 MET A CB  1 
ATOM   2223  C  CG  . MET A 1 302 ? 15.09314  2.20025   10.99407  1.000 57.46041  ? 302 MET A CG  1 
ATOM   2224  S  SD  . MET A 1 302 ? 13.91319  0.85760   11.22628  1.000 56.26008  ? 302 MET A SD  1 
ATOM   2225  C  CE  . MET A 1 302 ? 14.21721  -0.10706  9.74172   1.000 49.78286  ? 302 MET A CE  1 
ATOM   2226  N  N   . GLU A 1 303 ? 13.80914  5.68251   8.30165   1.000 50.67919  ? 303 GLU A N   1 
ATOM   2227  C  CA  . GLU A 1 303 ? 13.15157  6.93835   7.95712   1.000 49.71944  ? 303 GLU A CA  1 
ATOM   2228  C  C   . GLU A 1 303 ? 12.18041  6.74691   6.80102   1.000 53.36785  ? 303 GLU A C   1 
ATOM   2229  O  O   . GLU A 1 303 ? 11.10166  7.35091   6.78046   1.000 53.55915  ? 303 GLU A O   1 
ATOM   2230  C  CB  . GLU A 1 303 ? 14.18644  8.00758   7.61177   1.000 49.44339  ? 303 GLU A CB  1 
ATOM   2231  C  CG  . GLU A 1 303 ? 14.94940  8.55225   8.80942   1.000 54.41837  ? 303 GLU A CG  1 
ATOM   2232  C  CD  . GLU A 1 303 ? 15.97814  9.59281   8.41467   1.000 52.46424  ? 303 GLU A CD  1 
ATOM   2233  O  OE1 . GLU A 1 303 ? 16.26945  9.71307   7.20440   1.000 55.59221  ? 303 GLU A OE1 1 
ATOM   2234  O  OE2 . GLU A 1 303 ? 16.50381  10.28178  9.31474   1.000 60.15897  ? 303 GLU A OE2 1 
ATOM   2235  N  N   . ARG A 1 304 ? 12.53637  5.89408   5.83715   1.000 47.30022  ? 304 ARG A N   1 
ATOM   2236  C  CA  . ARG A 1 304 ? 11.66362  5.69087   4.68724   1.000 44.14995  ? 304 ARG A CA  1 
ATOM   2237  C  C   . ARG A 1 304 ? 10.39406  4.95293   5.09214   1.000 45.75495  ? 304 ARG A C   1 
ATOM   2238  O  O   . ARG A 1 304 ? 9.29865   5.28953   4.62821   1.000 48.78713  ? 304 ARG A O   1 
ATOM   2239  C  CB  . ARG A 1 304 ? 12.40377  4.90611   3.60146   1.000 42.39348  ? 304 ARG A CB  1 
ATOM   2240  C  CG  . ARG A 1 304 ? 13.58365  5.62701   2.95971   1.000 46.87375  ? 304 ARG A CG  1 
ATOM   2241  C  CD  . ARG A 1 304 ? 13.20740  6.30493   1.66341   1.000 50.14278  ? 304 ARG A CD  1 
ATOM   2242  N  NE  . ARG A 1 304 ? 14.34618  6.97652   1.04453   1.000 52.03064  ? 304 ARG A NE  1 
ATOM   2243  C  CZ  . ARG A 1 304 ? 15.13660  6.42916   0.13017   1.000 50.95622  ? 304 ARG A CZ  1 
ATOM   2244  N  NH1 . ARG A 1 304 ? 14.96398  5.18264   -0.27753  1.000 52.84119  ? 304 ARG A NH1 1 
ATOM   2245  N  NH2 . ARG A 1 304 ? 16.12110  7.15308   -0.39356  1.000 60.13963  ? 304 ARG A NH2 1 
ATOM   2246  N  N   . LEU A 1 305 ? 10.51579  3.96661   5.98508   1.000 49.02068  ? 305 LEU A N   1 
ATOM   2247  C  CA  . LEU A 1 305 ? 9.33854   3.24772   6.45913   1.000 47.91267  ? 305 LEU A CA  1 
ATOM   2248  C  C   . LEU A 1 305 ? 8.50253   4.09076   7.41173   1.000 52.70021  ? 305 LEU A C   1 
ATOM   2249  O  O   . LEU A 1 305 ? 7.27305   3.95820   7.43505   1.000 53.42812  ? 305 LEU A O   1 
ATOM   2250  C  CB  . LEU A 1 305 ? 9.75607   1.93996   7.13067   1.000 46.87786  ? 305 LEU A CB  1 
ATOM   2251  C  CG  . LEU A 1 305 ? 10.54157  0.97353   6.24381   1.000 45.93101  ? 305 LEU A CG  1 
ATOM   2252  C  CD1 . LEU A 1 305 ? 10.61897  -0.39242  6.88876   1.000 45.47278  ? 305 LEU A CD1 1 
ATOM   2253  C  CD2 . LEU A 1 305 ? 9.90729   0.87726   4.86975   1.000 50.00450  ? 305 LEU A CD2 1 
ATOM   2254  N  N   . ILE A 1 306 ? 9.14307   4.95486   8.20176   1.000 53.81477  ? 306 ILE A N   1 
ATOM   2255  C  CA  . ILE A 1 306 ? 8.39471   5.86498   9.06399   1.000 49.05047  ? 306 ILE A CA  1 
ATOM   2256  C  C   . ILE A 1 306 ? 7.50881   6.78083   8.23100   1.000 53.61163  ? 306 ILE A C   1 
ATOM   2257  O  O   . ILE A 1 306 ? 6.35658   7.05017   8.59378   1.000 53.91771  ? 306 ILE A O   1 
ATOM   2258  C  CB  . ILE A 1 306 ? 9.35692   6.66341   9.96165   1.000 56.89722  ? 306 ILE A CB  1 
ATOM   2259  C  CG1 . ILE A 1 306 ? 9.88129   5.78183   11.09782  1.000 57.01200  ? 306 ILE A CG1 1 
ATOM   2260  C  CG2 . ILE A 1 306 ? 8.67425   7.90490   10.51145  1.000 56.82750  ? 306 ILE A CG2 1 
ATOM   2261  C  CD1 . ILE A 1 306 ? 11.00739  6.41433   11.89303  1.000 56.40653  ? 306 ILE A CD1 1 
ATOM   2262  N  N   . ASP A 1 307 ? 8.02373   7.26646   7.09732   1.000 48.47452  ? 307 ASP A N   1 
ATOM   2263  C  CA  . ASP A 1 307 ? 7.20085   8.09370   6.22040   1.000 50.98405  ? 307 ASP A CA  1 
ATOM   2264  C  C   . ASP A 1 307 ? 6.03299   7.29993   5.64874   1.000 52.05322  ? 307 ASP A C   1 
ATOM   2265  O  O   . ASP A 1 307 ? 4.92547   7.83241   5.50588   1.000 55.92286  ? 307 ASP A O   1 
ATOM   2266  C  CB  . ASP A 1 307 ? 8.04598   8.69302   5.09461   1.000 52.91435  ? 307 ASP A CB  1 
ATOM   2267  C  CG  . ASP A 1 307 ? 8.78163   9.95379   5.52306   1.000 61.89729  ? 307 ASP A CG  1 
ATOM   2268  O  OD1 . ASP A 1 307 ? 8.56454   10.40924  6.66644   1.000 68.53291  ? 307 ASP A OD1 1 
ATOM   2269  O  OD2 . ASP A 1 307 ? 9.56394   10.49889  4.71362   1.000 55.85204  ? 307 ASP A OD2 1 
ATOM   2270  N  N   . LEU A 1 308 ? 6.25296   6.02039   5.32824   1.000 51.27990  ? 308 LEU A N   1 
ATOM   2271  C  CA  . LEU A 1 308 ? 5.15547   5.19338   4.83098   1.000 49.69807  ? 308 LEU A CA  1 
ATOM   2272  C  C   . LEU A 1 308 ? 4.05069   5.06120   5.86964   1.000 48.20367  ? 308 LEU A C   1 
ATOM   2273  O  O   . LEU A 1 308 ? 2.86274   5.04309   5.52619   1.000 50.71552  ? 308 LEU A O   1 
ATOM   2274  C  CB  . LEU A 1 308 ? 5.66758   3.81451   4.41403   1.000 51.31809  ? 308 LEU A CB  1 
ATOM   2275  C  CG  . LEU A 1 308 ? 6.47013   3.75377   3.11333   1.000 45.08046  ? 308 LEU A CG  1 
ATOM   2276  C  CD1 . LEU A 1 308 ? 6.96910   2.34187   2.84797   1.000 49.42590  ? 308 LEU A CD1 1 
ATOM   2277  C  CD2 . LEU A 1 308 ? 5.62301   4.24737   1.95430   1.000 38.53682  ? 308 LEU A CD2 1 
ATOM   2278  N  N   . VAL A 1 309 ? 4.42160   4.96151   7.14446   1.000 54.10195  ? 309 VAL A N   1 
ATOM   2279  C  CA  . VAL A 1 309 ? 3.42272   4.91672   8.20493   1.000 51.72997  ? 309 VAL A CA  1 
ATOM   2280  C  C   . VAL A 1 309 ? 2.84625   6.30527   8.45623   1.000 51.89281  ? 309 VAL A C   1 
ATOM   2281  O  O   . VAL A 1 309 ? 1.63637   6.46015   8.65923   1.000 55.58785  ? 309 VAL A O   1 
ATOM   2282  C  CB  . VAL A 1 309 ? 4.04256   4.31480   9.47878   1.000 57.66160  ? 309 VAL A CB  1 
ATOM   2283  C  CG1 . VAL A 1 309 ? 3.00219   4.20685   10.58529  1.000 53.25201  ? 309 VAL A CG1 1 
ATOM   2284  C  CG2 . VAL A 1 309 ? 4.66347   2.95746   9.17207   1.000 55.90529  ? 309 VAL A CG2 1 
ATOM   2285  N  N   . PHE A 1 310 ? 3.70172   7.33123   8.43365   1.000 51.97084  ? 310 PHE A N   1 
ATOM   2286  C  CA  . PHE A 1 310 ? 3.26413   8.69435   8.72234   1.000 51.48828  ? 310 PHE A CA  1 
ATOM   2287  C  C   . PHE A 1 310 ? 2.24166   9.18067   7.70075   1.000 54.97997  ? 310 PHE A C   1 
ATOM   2288  O  O   . PHE A 1 310 ? 1.21264   9.76198   8.06517   1.000 51.98016  ? 310 PHE A O   1 
ATOM   2289  C  CB  . PHE A 1 310 ? 4.47679   9.62551   8.76569   1.000 57.33061  ? 310 PHE A CB  1 
ATOM   2290  C  CG  . PHE A 1 310 ? 4.14440   11.04787  9.12070   1.000 64.50903  ? 310 PHE A CG  1 
ATOM   2291  C  CD1 . PHE A 1 310 ? 3.99990   11.43002  10.44495  1.000 69.97387  ? 310 PHE A CD1 1 
ATOM   2292  C  CD2 . PHE A 1 310 ? 4.00097   12.00858  8.13227   1.000 62.18416  ? 310 PHE A CD2 1 
ATOM   2293  C  CE1 . PHE A 1 310 ? 3.70232   12.74028  10.77544  1.000 69.97575  ? 310 PHE A CE1 1 
ATOM   2294  C  CE2 . PHE A 1 310 ? 3.70525   13.32195  8.45729   1.000 61.22886  ? 310 PHE A CE2 1 
ATOM   2295  C  CZ  . PHE A 1 310 ? 3.55609   13.68729  9.77881   1.000 68.25033  ? 310 PHE A CZ  1 
ATOM   2296  N  N   . TYR A 1 311 ? 2.51510   8.97019   6.41092   1.000 58.38816  ? 311 TYR A N   1 
ATOM   2297  C  CA  . TYR A 1 311 ? 1.59588   9.37206   5.35338   1.000 54.48396  ? 311 TYR A CA  1 
ATOM   2298  C  C   . TYR A 1 311 ? 0.53678   8.31392   5.06382   1.000 55.57289  ? 311 TYR A C   1 
ATOM   2299  O  O   . TYR A 1 311 ? -0.12374  8.37814   4.01861   1.000 49.32488  ? 311 TYR A O   1 
ATOM   2300  C  CB  . TYR A 1 311 ? 2.37005   9.73479   4.08345   1.000 47.14373  ? 311 TYR A CB  1 
ATOM   2301  C  CG  . TYR A 1 311 ? 3.27715   10.92484  4.29469   1.000 51.18349  ? 311 TYR A CG  1 
ATOM   2302  C  CD1 . TYR A 1 311 ? 2.75411   12.20767  4.40809   1.000 49.04147  ? 311 TYR A CD1 1 
ATOM   2303  C  CD2 . TYR A 1 311 ? 4.65405   10.76681  4.39382   1.000 48.93880  ? 311 TYR A CD2 1 
ATOM   2304  C  CE1 . TYR A 1 311 ? 3.57599   13.29934  4.61768   1.000 50.04252  ? 311 TYR A CE1 1 
ATOM   2305  C  CE2 . TYR A 1 311 ? 5.48562   11.85324  4.59881   1.000 54.56314  ? 311 TYR A CE2 1 
ATOM   2306  C  CZ  . TYR A 1 311 ? 4.94156   13.11749  4.70869   1.000 55.82995  ? 311 TYR A CZ  1 
ATOM   2307  O  OH  . TYR A 1 311 ? 5.76457   14.20207  4.91275   1.000 57.65187  ? 311 TYR A OH  1 
ATOM   2308  N  N   . LYS A 1 312 ? 0.36845   7.34704   5.96899   1.000 54.42718  ? 312 LYS A N   1 
ATOM   2309  C  CA  . LYS A 1 312 ? -0.75031  6.40443   5.93946   1.000 53.33663  ? 312 LYS A CA  1 
ATOM   2310  C  C   . LYS A 1 312 ? -0.72818  5.54599   4.67794   1.000 53.18957  ? 312 LYS A C   1 
ATOM   2311  O  O   . LYS A 1 312 ? -1.76753  5.25941   4.08130   1.000 54.83013  ? 312 LYS A O   1 
ATOM   2312  C  CB  . LYS A 1 312 ? -2.08408  7.14189   6.07998   1.000 55.60883  ? 312 LYS A CB  1 
ATOM   2313  C  CG  . LYS A 1 312 ? -2.20454  7.91892   7.38353   1.000 59.34231  ? 312 LYS A CG  1 
ATOM   2314  C  CD  . LYS A 1 312 ? -3.46863  8.76113   7.43007   1.000 76.97112  ? 312 LYS A CD  1 
ATOM   2315  C  CE  . LYS A 1 312 ? -3.53205  9.59060   8.70718   1.000 72.81595  ? 312 LYS A CE  1 
ATOM   2316  N  NZ  . LYS A 1 312 ? -4.68743  10.53112  8.69654   1.000 92.99653  ? 312 LYS A NZ  1 
ATOM   2317  N  N   . ARG A 1 313 ? 0.47058   5.11385   4.27831   1.000 56.17369  ? 313 ARG A N   1 
ATOM   2318  C  CA  . ARG A 1 313 ? 0.58590   4.15193   3.18787   1.000 48.16395  ? 313 ARG A CA  1 
ATOM   2319  C  C   . ARG A 1 313 ? 0.42715   2.71509   3.66732   1.000 51.20528  ? 313 ARG A C   1 
ATOM   2320  O  O   . ARG A 1 313 ? 0.01752   1.84905   2.88677   1.000 51.53069  ? 313 ARG A O   1 
ATOM   2321  C  CB  . ARG A 1 313 ? 1.92764   4.31746   2.47526   1.000 46.59177  ? 313 ARG A CB  1 
ATOM   2322  C  CG  . ARG A 1 313 ? 2.22133   5.73226   2.00624   1.000 45.67889  ? 313 ARG A CG  1 
ATOM   2323  C  CD  . ARG A 1 313 ? 1.09609   6.25681   1.12577   1.000 48.20780  ? 313 ARG A CD  1 
ATOM   2324  N  NE  . ARG A 1 313 ? 1.44571   7.51437   0.47425   1.000 47.64640  ? 313 ARG A NE  1 
ATOM   2325  C  CZ  . ARG A 1 313 ? 0.56570   8.34657   -0.06595  1.000 41.87681  ? 313 ARG A CZ  1 
ATOM   2326  N  NH1 . ARG A 1 313 ? -0.73294  8.09639   -0.03273  1.000 49.67254  ? 313 ARG A NH1 1 
ATOM   2327  N  NH2 . ARG A 1 313 ? 0.99885   9.45918   -0.65031  1.000 38.37900  ? 313 ARG A NH2 1 
ATOM   2328  N  N   . VAL A 1 314 ? 0.73826   2.44399   4.93091   1.000 52.90727  ? 314 VAL A N   1 
ATOM   2329  C  CA  . VAL A 1 314 ? 0.58504   1.11112   5.50209   1.000 47.10398  ? 314 VAL A CA  1 
ATOM   2330  C  C   . VAL A 1 314 ? 0.38504   1.25663   7.00442   1.000 59.85041  ? 314 VAL A C   1 
ATOM   2331  O  O   . VAL A 1 314 ? 1.06056   2.05564   7.66097   1.000 59.33678  ? 314 VAL A O   1 
ATOM   2332  C  CB  . VAL A 1 314 ? 1.79676   0.21260   5.17088   1.000 49.09354  ? 314 VAL A CB  1 
ATOM   2333  C  CG1 . VAL A 1 314 ? 3.09507   0.92272   5.51083   1.000 56.15142  ? 314 VAL A CG1 1 
ATOM   2334  C  CG2 . VAL A 1 314 ? 1.70034   -1.11646  5.90878   1.000 50.82181  ? 314 VAL A CG2 1 
ATOM   2335  N  N   . ASP A 1 315 ? -0.56356  0.49200   7.54569   1.000 59.63806  ? 315 ASP A N   1 
ATOM   2336  C  CA  . ASP A 1 315 ? -0.86189  0.52048   8.97406   1.000 62.37569  ? 315 ASP A CA  1 
ATOM   2337  C  C   . ASP A 1 315 ? -0.44023  -0.80246  9.60411   1.000 59.78675  ? 315 ASP A C   1 
ATOM   2338  O  O   . ASP A 1 315 ? -1.17806  -1.79608  9.51341   1.000 60.05927  ? 315 ASP A O   1 
ATOM   2339  C  CB  . ASP A 1 315 ? -2.35546  0.77476   9.19943   1.000 57.05772  ? 315 ASP A CB  1 
ATOM   2340  C  CG  . ASP A 1 315 ? -2.70053  0.98479   10.65739  1.000 64.87820  ? 315 ASP A CG  1 
ATOM   2341  O  OD1 . ASP A 1 315 ? -1.77219  1.05300   11.49063  1.000 65.71265  ? 315 ASP A OD1 1 
ATOM   2342  O  OD2 . ASP A 1 315 ? -3.90663  1.07365   10.97130  1.000 63.28815  ? 315 ASP A OD2 1 
ATOM   2343  N  N   . PRO A 1 316 ? 0.72709   -0.87351  10.24994  1.000 61.47771  ? 316 PRO A N   1 
ATOM   2344  C  CA  . PRO A 1 316 ? 1.18043   -2.13758  10.84302  1.000 54.78449  ? 316 PRO A CA  1 
ATOM   2345  C  C   . PRO A 1 316 ? 0.50949   -2.49093  12.15776  1.000 64.84240  ? 316 PRO A C   1 
ATOM   2346  O  O   . PRO A 1 316 ? 0.82567   -3.54355  12.72432  1.000 62.71618  ? 316 PRO A O   1 
ATOM   2347  C  CB  . PRO A 1 316 ? 2.67735   -1.88926  11.05373  1.000 56.05589  ? 316 PRO A CB  1 
ATOM   2348  C  CG  . PRO A 1 316 ? 2.75082   -0.42725  11.33073  1.000 63.38659  ? 316 PRO A CG  1 
ATOM   2349  C  CD  . PRO A 1 316 ? 1.71810   0.20283   10.42584  1.000 58.17494  ? 316 PRO A CD  1 
ATOM   2350  N  N   . SER A 1 317 ? -0.38183  -1.63891  12.67116  1.000 66.92942  ? 317 SER A N   1 
ATOM   2351  C  CA  . SER A 1 317 ? -1.01697  -1.91589  13.95378  1.000 65.11894  ? 317 SER A CA  1 
ATOM   2352  C  C   . SER A 1 317 ? -1.87566  -3.17179  13.90609  1.000 66.58654  ? 317 SER A C   1 
ATOM   2353  O  O   . SER A 1 317 ? -2.13626  -3.77027  14.95500  1.000 70.75945  ? 317 SER A O   1 
ATOM   2354  C  CB  . SER A 1 317 ? -1.85319  -0.71431  14.40035  1.000 63.12559  ? 317 SER A CB  1 
ATOM   2355  O  OG  . SER A 1 317 ? -2.86771  -0.41472  13.45877  1.000 78.57469  ? 317 SER A OG  1 
ATOM   2356  N  N   . LYS A 1 318 ? -2.31539  -3.58830  12.71466  1.000 67.33334  ? 318 LYS A N   1 
ATOM   2357  C  CA  . LYS A 1 318 ? -3.07034  -4.83020  12.59547  1.000 65.87771  ? 318 LYS A CA  1 
ATOM   2358  C  C   . LYS A 1 318 ? -2.22915  -6.04272  12.97314  1.000 62.62882  ? 318 LYS A C   1 
ATOM   2359  O  O   . LYS A 1 318 ? -2.78775  -7.07912  13.34933  1.000 64.36594  ? 318 LYS A O   1 
ATOM   2360  C  CB  . LYS A 1 318 ? -3.61217  -4.97901  11.17074  1.000 59.29088  ? 318 LYS A CB  1 
ATOM   2361  C  CG  . LYS A 1 318 ? -4.71138  -6.02278  11.01585  1.000 64.28093  ? 318 LYS A CG  1 
ATOM   2362  C  CD  . LYS A 1 318 ? -5.93163  -5.66082  11.84496  1.000 78.70944  ? 318 LYS A CD  1 
ATOM   2363  C  CE  . LYS A 1 318 ? -7.03822  -6.69362  11.69747  1.000 77.29137  ? 318 LYS A CE  1 
ATOM   2364  N  NZ  . LYS A 1 318 ? -7.55309  -6.75927  10.30603  1.000 71.80787  ? 318 LYS A NZ  1 
ATOM   2365  N  N   . LEU A 1 319 ? -0.89913  -5.93194  12.89071  1.000 63.13134  ? 319 LEU A N   1 
ATOM   2366  C  CA  . LEU A 1 319 ? -0.03120  -7.02546  13.31593  1.000 63.88912  ? 319 LEU A CA  1 
ATOM   2367  C  C   . LEU A 1 319 ? -0.05979  -7.22401  14.82495  1.000 69.52324  ? 319 LEU A C   1 
ATOM   2368  O  O   . LEU A 1 319 ? 0.20310   -8.33254  15.30481  1.000 74.63019  ? 319 LEU A O   1 
ATOM   2369  C  CB  . LEU A 1 319 ? 1.40711   -6.76953  12.87420  1.000 62.54218  ? 319 LEU A CB  1 
ATOM   2370  C  CG  . LEU A 1 319 ? 1.71917   -6.62255  11.39008  1.000 61.86990  ? 319 LEU A CG  1 
ATOM   2371  C  CD1 . LEU A 1 319 ? 3.19174   -6.30049  11.21952  1.000 56.67364  ? 319 LEU A CD1 1 
ATOM   2372  C  CD2 . LEU A 1 319 ? 1.35482   -7.89068  10.64611  1.000 61.78100  ? 319 LEU A CD2 1 
ATOM   2373  N  N   . VAL A 1 320 ? -0.35321  -6.17447  15.58775  1.000 67.16232  ? 320 VAL A N   1 
ATOM   2374  C  CA  . VAL A 1 320 ? -0.28689  -6.25351  17.04375  1.000 77.41333  ? 320 VAL A CA  1 
ATOM   2375  C  C   . VAL A 1 320 ? -1.61076  -6.81247  17.55152  1.000 75.84857  ? 320 VAL A C   1 
ATOM   2376  O  O   . VAL A 1 320 ? -2.65527  -6.16573  17.44202  1.000 72.78840  ? 320 VAL A O   1 
ATOM   2377  C  CB  . VAL A 1 320 ? 0.01657   -4.88975  17.67247  1.000 80.90550  ? 320 VAL A CB  1 
ATOM   2378  C  CG1 . VAL A 1 320 ? 0.16495   -5.02543  19.18037  1.000 74.29227  ? 320 VAL A CG1 1 
ATOM   2379  C  CG2 . VAL A 1 320 ? 1.27629   -4.29751  17.06035  1.000 78.56971  ? 320 VAL A CG2 1 
ATOM   2380  N  N   . THR A 1 321 ? -1.56397  -8.02028  18.11347  1.000 74.56205  ? 321 THR A N   1 
ATOM   2381  C  CA  . THR A 1 321 ? -2.73592  -8.66083  18.68565  1.000 77.57485  ? 321 THR A CA  1 
ATOM   2382  C  C   . THR A 1 321 ? -2.70797  -8.72651  20.20379  1.000 84.66682  ? 321 THR A C   1 
ATOM   2383  O  O   . THR A 1 321 ? -3.77077  -8.85790  20.81758  1.000 90.46145  ? 321 THR A O   1 
ATOM   2384  C  CB  . THR A 1 321 ? -2.88661  -10.08524 18.13225  1.000 80.42431  ? 321 THR A CB  1 
ATOM   2385  O  OG1 . THR A 1 321 ? -1.66452  -10.80725 18.33436  1.000 77.87724  ? 321 THR A OG1 1 
ATOM   2386  C  CG2 . THR A 1 321 ? -3.20926  -10.04867 16.64552  1.000 73.78736  ? 321 THR A CG2 1 
ATOM   2387  N  N   . HIS A 1 322 ? -1.52849  -8.63605  20.81717  1.000 89.63652  ? 322 HIS A N   1 
ATOM   2388  C  CA  . HIS A 1 322 ? -1.36610  -8.71323  22.26130  1.000 84.68590  ? 322 HIS A CA  1 
ATOM   2389  C  C   . HIS A 1 322 ? -0.45672  -7.58551  22.72727  1.000 84.85538  ? 322 HIS A C   1 
ATOM   2390  O  O   . HIS A 1 322 ? 0.57998   -7.31877  22.11199  1.000 82.37528  ? 322 HIS A O   1 
ATOM   2391  C  CB  . HIS A 1 322 ? -0.79730  -10.07422 22.68348  1.000 86.45703  ? 322 HIS A CB  1 
ATOM   2392  C  CG  . HIS A 1 322 ? -1.67093  -11.23321 22.31265  1.000 93.48189  ? 322 HIS A CG  1 
ATOM   2393  N  ND1 . HIS A 1 322 ? -1.91015  -11.59853 21.00482  1.000 92.68037  ? 322 HIS A ND1 1 
ATOM   2394  C  CD2 . HIS A 1 322 ? -2.37875  -12.09692 23.07891  1.000 90.06309  ? 322 HIS A CD2 1 
ATOM   2395  C  CE1 . HIS A 1 322 ? -2.71834  -12.64329 20.98142  1.000 89.98747  ? 322 HIS A CE1 1 
ATOM   2396  N  NE2 . HIS A 1 322 ? -3.01777  -12.96539 22.22711  1.000 93.08908  ? 322 HIS A NE2 1 
ATOM   2397  N  N   . VAL A 1 323 ? -0.85094  -6.92585  23.81663  1.000 92.24973  ? 323 VAL A N   1 
ATOM   2398  C  CA  . VAL A 1 323 ? -0.08829  -5.83098  24.40706  1.000 89.81712  ? 323 VAL A CA  1 
ATOM   2399  C  C   . VAL A 1 323 ? 0.12781   -6.11574  25.88897  1.000 98.73915  ? 323 VAL A C   1 
ATOM   2400  O  O   . VAL A 1 323 ? -0.82838  -6.39884  26.61991  1.000 93.89856  ? 323 VAL A O   1 
ATOM   2401  C  CB  . VAL A 1 323 ? -0.79570  -4.47511  24.21538  1.000 86.66575  ? 323 VAL A CB  1 
ATOM   2402  C  CG1 . VAL A 1 323 ? 0.06797   -3.34812  24.75047  1.000 96.84353  ? 323 VAL A CG1 1 
ATOM   2403  C  CG2 . VAL A 1 323 ? -1.12199  -4.24563  22.74684  1.000 91.13521  ? 323 VAL A CG2 1 
ATOM   2404  N  N   . PHE A 1 324 ? 1.38176   -6.03809  26.32458  1.000 101.95320 ? 324 PHE A N   1 
ATOM   2405  C  CA  . PHE A 1 324 ? 1.79997   -6.23614  27.70769  1.000 99.09531  ? 324 PHE A CA  1 
ATOM   2406  C  C   . PHE A 1 324 ? 2.44634   -4.95499  28.23359  1.000 111.70212 ? 324 PHE A C   1 
ATOM   2407  O  O   . PHE A 1 324 ? 2.62560   -3.97863  27.50138  1.000 114.70234 ? 324 PHE A O   1 
ATOM   2408  C  CB  . PHE A 1 324 ? 2.76710   -7.41799  27.81767  1.000 99.65844  ? 324 PHE A CB  1 
ATOM   2409  C  CG  . PHE A 1 324 ? 2.21977   -8.70212  27.26860  1.000 99.99608  ? 324 PHE A CG  1 
ATOM   2410  C  CD1 . PHE A 1 324 ? 2.36825   -9.01503  25.92725  1.000 100.72910 ? 324 PHE A CD1 1 
ATOM   2411  C  CD2 . PHE A 1 324 ? 1.56095   -9.59808  28.09171  1.000 104.00769 ? 324 PHE A CD2 1 
ATOM   2412  C  CE1 . PHE A 1 324 ? 1.86681   -10.19556 25.41685  1.000 100.44701 ? 324 PHE A CE1 1 
ATOM   2413  C  CE2 . PHE A 1 324 ? 1.05751   -10.78129 27.58763  1.000 110.34069 ? 324 PHE A CE2 1 
ATOM   2414  C  CZ  . PHE A 1 324 ? 1.21096   -11.08048 26.24845  1.000 110.27539 ? 324 PHE A CZ  1 
ATOM   2415  N  N   . ARG A 1 325 ? 2.79798   -4.96042  29.52261  1.000 111.79169 ? 325 ARG A N   1 
ATOM   2416  C  CA  . ARG A 1 325 ? 3.28906   -3.74564  30.17212  1.000 101.78569 ? 325 ARG A CA  1 
ATOM   2417  C  C   . ARG A 1 325 ? 4.51570   -3.92893  31.05959  1.000 106.72575 ? 325 ARG A C   1 
ATOM   2418  O  O   . ARG A 1 325 ? 5.24802   -2.95383  31.26201  1.000 102.45661 ? 325 ARG A O   1 
ATOM   2419  C  CB  . ARG A 1 325 ? 2.17467   -3.09913  31.00370  1.000 102.80259 ? 325 ARG A CB  1 
ATOM   2420  C  CG  . ARG A 1 325 ? 2.49742   -1.68487  31.44810  1.000 112.78962 ? 325 ARG A CG  1 
ATOM   2421  C  CD  . ARG A 1 325 ? 1.38692   -1.07021  32.27634  1.000 132.94476 ? 325 ARG A CD  1 
ATOM   2422  N  NE  . ARG A 1 325 ? 1.73176   0.28304   32.69580  1.000 130.31351 ? 325 ARG A NE  1 
ATOM   2423  C  CZ  . ARG A 1 325 ? 1.51454   1.37330   31.97341  1.000 133.20568 ? 325 ARG A CZ  1 
ATOM   2424  N  NH1 . ARG A 1 325 ? 0.93070   1.31223   30.78711  1.000 127.10909 ? 325 ARG A NH1 1 
ATOM   2425  N  NH2 . ARG A 1 325 ? 1.88866   2.55520   32.45562  1.000 123.66077 ? 325 ARG A NH2 1 
ATOM   2426  N  N   . GLY A 1 326 ? 4.79206   -5.11358  31.59054  1.000 113.32831 ? 326 GLY A N   1 
ATOM   2427  C  CA  . GLY A 1 326 ? 5.87624   -5.28445  32.52997  1.000 123.59034 ? 326 GLY A CA  1 
ATOM   2428  C  C   . GLY A 1 326 ? 7.16847   -5.77675  31.90209  1.000 113.20126 ? 326 GLY A C   1 
ATOM   2429  O  O   . GLY A 1 326 ? 7.17613   -6.39974  30.84373  1.000 112.97766 ? 326 GLY A O   1 
ATOM   2430  N  N   . PHE A 1 327 ? 8.28001   -5.47048  32.57740  1.000 126.89520 ? 327 PHE A N   1 
ATOM   2431  C  CA  . PHE A 1 327 ? 9.53806   -6.13532  32.25663  1.000 122.04069 ? 327 PHE A CA  1 
ATOM   2432  C  C   . PHE A 1 327 ? 9.45147   -7.62755  32.53461  1.000 129.66721 ? 327 PHE A C   1 
ATOM   2433  O  O   . PHE A 1 327 ? 10.08402  -8.42912  31.83759  1.000 126.49281 ? 327 PHE A O   1 
ATOM   2434  C  CB  . PHE A 1 327 ? 10.68630  -5.51978  33.05421  1.000 131.57961 ? 327 PHE A CB  1 
ATOM   2435  C  CG  . PHE A 1 327 ? 11.47139  -4.49589  32.29335  1.000 127.90585 ? 327 PHE A CG  1 
ATOM   2436  C  CD1 . PHE A 1 327 ? 12.48338  -4.88320  31.43053  1.000 127.91214 ? 327 PHE A CD1 1 
ATOM   2437  C  CD2 . PHE A 1 327 ? 11.20448  -3.14631  32.44427  1.000 129.83602 ? 327 PHE A CD2 1 
ATOM   2438  C  CE1 . PHE A 1 327 ? 13.21237  -3.94290  30.72770  1.000 124.77480 ? 327 PHE A CE1 1 
ATOM   2439  C  CE2 . PHE A 1 327 ? 11.93023  -2.20054  31.74475  1.000 133.35787 ? 327 PHE A CE2 1 
ATOM   2440  C  CZ  . PHE A 1 327 ? 12.93574  -2.59969  30.88515  1.000 122.78191 ? 327 PHE A CZ  1 
ATOM   2441  N  N   . ASP A 1 328 ? 8.68436   -8.01663  33.55623  1.000 135.36855 ? 328 ASP A N   1 
ATOM   2442  C  CA  . ASP A 1 328 ? 8.38909   -9.42875  33.76067  1.000 137.35154 ? 328 ASP A CA  1 
ATOM   2443  C  C   . ASP A 1 328 ? 7.53111   -9.98313  32.63061  1.000 132.67399 ? 328 ASP A C   1 
ATOM   2444  O  O   . ASP A 1 328 ? 7.58529   -11.18531 32.34706  1.000 135.15273 ? 328 ASP A O   1 
ATOM   2445  C  CB  . ASP A 1 328 ? 7.70214   -9.63869  35.11166  1.000 139.97703 ? 328 ASP A CB  1 
ATOM   2446  C  CG  . ASP A 1 328 ? 8.47638   -9.02214  36.26329  1.000 142.85005 ? 328 ASP A CG  1 
ATOM   2447  O  OD1 . ASP A 1 328 ? 9.71360   -8.89379  36.14842  1.000 141.14254 ? 328 ASP A OD1 1 
ATOM   2448  O  OD2 . ASP A 1 328 ? 7.84920   -8.67615  37.28786  1.000 138.95258 ? 328 ASP A OD2 1 
ATOM   2449  N  N   . ASN A 1 329 ? 6.74496   -9.12981  31.96834  1.000 121.94953 ? 329 ASN A N   1 
ATOM   2450  C  CA  . ASN A 1 329 ? 5.91086   -9.59072  30.86677  1.000 116.00985 ? 329 ASN A CA  1 
ATOM   2451  C  C   . ASN A 1 329 ? 6.69635   -9.77878  29.57913  1.000 108.31973 ? 329 ASN A C   1 
ATOM   2452  O  O   . ASN A 1 329 ? 6.13981   -10.29839 28.60600  1.000 110.14938 ? 329 ASN A O   1 
ATOM   2453  C  CB  . ASN A 1 329 ? 4.76989   -8.60266  30.60713  1.000 107.53535 ? 329 ASN A CB  1 
ATOM   2454  C  CG  . ASN A 1 329 ? 3.75280   -8.57380  31.72663  1.000 117.62602 ? 329 ASN A CG  1 
ATOM   2455  O  OD1 . ASN A 1 329 ? 3.17865   -7.52725  32.02885  1.000 114.29037 ? 329 ASN A OD1 1 
ATOM   2456  N  ND2 . ASN A 1 329 ? 3.52726   -9.72250  32.35377  1.000 125.53689 ? 329 ASN A ND2 1 
ATOM   2457  N  N   . ILE A 1 330 ? 7.96850   -9.37455  29.55351  1.000 105.79150 ? 330 ILE A N   1 
ATOM   2458  C  CA  . ILE A 1 330 ? 8.83030   -9.69306  28.41988  1.000 107.56981 ? 330 ILE A CA  1 
ATOM   2459  C  C   . ILE A 1 330 ? 8.98288   -11.20161 28.29043  1.000 111.52293 ? 330 ILE A C   1 
ATOM   2460  O  O   . ILE A 1 330 ? 8.98209   -11.75209 27.18192  1.000 110.30796 ? 330 ILE A O   1 
ATOM   2461  C  CB  . ILE A 1 330 ? 10.19060  -8.98563  28.56779  1.000 103.41050 ? 330 ILE A CB  1 
ATOM   2462  C  CG1 . ILE A 1 330 ? 10.02311  -7.47685  28.37461  1.000 96.03731  ? 330 ILE A CG1 1 
ATOM   2463  C  CG2 . ILE A 1 330 ? 11.20613  -9.54441  27.57988  1.000 104.40031 ? 330 ILE A CG2 1 
ATOM   2464  C  CD1 . ILE A 1 330 ? 11.31858  -6.70421  28.45201  1.000 101.41869 ? 330 ILE A CD1 1 
ATOM   2465  N  N   . GLU A 1 331 ? 9.10780   -11.89406 29.42460  1.000 108.77302 ? 331 GLU A N   1 
ATOM   2466  C  CA  . GLU A 1 331 ? 9.16038   -13.35094 29.40173  1.000 120.29307 ? 331 GLU A CA  1 
ATOM   2467  C  C   . GLU A 1 331 ? 7.85600   -13.93934 28.87703  1.000 124.24277 ? 331 GLU A C   1 
ATOM   2468  O  O   . GLU A 1 331 ? 7.87008   -14.90428 28.10420  1.000 125.18755 ? 331 GLU A O   1 
ATOM   2469  C  CB  . GLU A 1 331 ? 9.46724   -13.88447 30.80184  1.000 128.71469 ? 331 GLU A CB  1 
ATOM   2470  C  CG  . GLU A 1 331 ? 9.51180   -15.40271 30.90208  1.000 129.74430 ? 331 GLU A CG  1 
ATOM   2471  C  CD  . GLU A 1 331 ? 9.88414   -15.88653 32.29315  1.000 133.87670 ? 331 GLU A CD  1 
ATOM   2472  O  OE1 . GLU A 1 331 ? 9.48810   -15.22878 33.27882  1.000 136.95355 ? 331 GLU A OE1 1 
ATOM   2473  O  OE2 . GLU A 1 331 ? 10.57113  -16.92472 32.40204  1.000 125.67512 ? 331 GLU A OE2 1 
ATOM   2474  N  N   . LYS A 1 332 ? 6.71688   -13.36194 29.27329  1.000 121.25192 ? 332 LYS A N   1 
ATOM   2475  C  CA  . LYS A 1 332 ? 5.42949   -13.89776 28.83900  1.000 122.29144 ? 332 LYS A CA  1 
ATOM   2476  C  C   . LYS A 1 332 ? 5.22462   -13.71154 27.34043  1.000 121.33683 ? 332 LYS A C   1 
ATOM   2477  O  O   . LYS A 1 332 ? 4.74746   -14.62569 26.65730  1.000 119.96801 ? 332 LYS A O   1 
ATOM   2478  C  CB  . LYS A 1 332 ? 4.29001   -13.24358 29.61945  1.000 125.16562 ? 332 LYS A CB  1 
ATOM   2479  C  CG  . LYS A 1 332 ? 2.91574   -13.77570 29.24038  1.000 128.97485 ? 332 LYS A CG  1 
ATOM   2480  C  CD  . LYS A 1 332 ? 1.82123   -13.19123 30.11564  1.000 132.95652 ? 332 LYS A CD  1 
ATOM   2481  C  CE  . LYS A 1 332 ? 0.45549   -13.71776 29.70164  1.000 130.78983 ? 332 LYS A CE  1 
ATOM   2482  N  NZ  . LYS A 1 332 ? -0.63516  -13.17960 30.56070  1.000 133.59916 ? 332 LYS A NZ  1 
ATOM   2483  N  N   . ALA A 1 333 ? 5.56941   -12.53371 26.81137  1.000 117.12563 ? 333 ALA A N   1 
ATOM   2484  C  CA  . ALA A 1 333 ? 5.48856   -12.32700 25.36896  1.000 97.94850  ? 333 ALA A CA  1 
ATOM   2485  C  C   . ALA A 1 333 ? 6.43193   -13.25940 24.62395  1.000 96.83971  ? 333 ALA A C   1 
ATOM   2486  O  O   . ALA A 1 333 ? 6.11791   -13.70664 23.51531  1.000 105.78755 ? 333 ALA A O   1 
ATOM   2487  C  CB  . ALA A 1 333 ? 5.79654   -10.87112 25.02489  1.000 94.18135  ? 333 ALA A CB  1 
ATOM   2488  N  N   . PHE A 1 334 ? 7.59087   -13.55798 25.21374  1.000 104.66775 ? 334 PHE A N   1 
ATOM   2489  C  CA  . PHE A 1 334 ? 8.50274   -14.52752 24.61738  1.000 104.85622 ? 334 PHE A CA  1 
ATOM   2490  C  C   . PHE A 1 334 ? 7.86670   -15.91140 24.58615  1.000 114.92879 ? 334 PHE A C   1 
ATOM   2491  O  O   . PHE A 1 334 ? 7.95928   -16.62433 23.57919  1.000 109.09021 ? 334 PHE A O   1 
ATOM   2492  C  CB  . PHE A 1 334 ? 9.82543   -14.54758 25.38695  1.000 108.91299 ? 334 PHE A CB  1 
ATOM   2493  C  CG  . PHE A 1 334 ? 10.86101  -15.47474 24.80560  1.000 101.59973 ? 334 PHE A CG  1 
ATOM   2494  C  CD1 . PHE A 1 334 ? 11.68082  -15.05409 23.77204  1.000 108.31991 ? 334 PHE A CD1 1 
ATOM   2495  C  CD2 . PHE A 1 334 ? 11.02634  -16.75763 25.30193  1.000 119.43313 ? 334 PHE A CD2 1 
ATOM   2496  C  CE1 . PHE A 1 334 ? 12.63937  -15.89748 23.23656  1.000 119.43396 ? 334 PHE A CE1 1 
ATOM   2497  C  CE2 . PHE A 1 334 ? 11.98396  -17.60630 24.77029  1.000 114.97856 ? 334 PHE A CE2 1 
ATOM   2498  C  CZ  . PHE A 1 334 ? 12.79128  -17.17421 23.73786  1.000 122.88447 ? 334 PHE A CZ  1 
ATOM   2499  N  N   . MET A 1 335 ? 7.21886   -16.30757 25.68902  1.000 121.21021 ? 335 MET A N   1 
ATOM   2500  C  CA  . MET A 1 335 ? 6.57383   -17.61566 25.75853  1.000 123.70713 ? 335 MET A CA  1 
ATOM   2501  C  C   . MET A 1 335 ? 5.48438   -17.77047 24.70317  1.000 123.03945 ? 335 MET A C   1 
ATOM   2502  O  O   . MET A 1 335 ? 5.27094   -18.87649 24.19220  1.000 122.84293 ? 335 MET A O   1 
ATOM   2503  C  CB  . MET A 1 335 ? 5.96791   -17.81889 27.15010  1.000 134.72931 ? 335 MET A CB  1 
ATOM   2504  C  CG  . MET A 1 335 ? 6.96683   -17.87109 28.29724  1.000 142.48712 ? 335 MET A CG  1 
ATOM   2505  S  SD  . MET A 1 335 ? 8.26792   -19.09665 28.09392  1.000 172.49418 ? 335 MET A SD  1 
ATOM   2506  C  CE  . MET A 1 335 ? 7.42212   -20.56426 28.68189  1.000 158.89786 ? 335 MET A CE  1 
ATOM   2507  N  N   . LEU A 1 336 ? 4.78724   -16.68232 24.36077  1.000 111.07242 ? 336 LEU A N   1 
ATOM   2508  C  CA  . LEU A 1 336 ? 3.79727   -16.75279 23.29024  1.000 102.28219 ? 336 LEU A CA  1 
ATOM   2509  C  C   . LEU A 1 336 ? 4.43834   -17.10704 21.95675  1.000 100.52573 ? 336 LEU A C   1 
ATOM   2510  O  O   . LEU A 1 336 ? 3.83137   -17.81310 21.14389  1.000 107.36989 ? 336 LEU A O   1 
ATOM   2511  C  CB  . LEU A 1 336 ? 3.04138   -15.42970 23.17514  1.000 91.58298  ? 336 LEU A CB  1 
ATOM   2512  C  CG  . LEU A 1 336 ? 2.15601   -15.03858 24.35769  1.000 100.44761 ? 336 LEU A CG  1 
ATOM   2513  C  CD1 . LEU A 1 336 ? 1.28918   -13.84413 23.99016  1.000 97.80165  ? 336 LEU A CD1 1 
ATOM   2514  C  CD2 . LEU A 1 336 ? 1.30140   -16.21650 24.80369  1.000 104.56440 ? 336 LEU A CD2 1 
ATOM   2515  N  N   . MET A 1 337 ? 5.66261   -16.63205 21.71753  1.000 99.59690  ? 337 MET A N   1 
ATOM   2516  C  CA  . MET A 1 337 ? 6.36613   -16.94236 20.47931  1.000 111.77663 ? 337 MET A CA  1 
ATOM   2517  C  C   . MET A 1 337 ? 6.88889   -18.37093 20.45976  1.000 117.51593 ? 337 MET A C   1 
ATOM   2518  O  O   . MET A 1 337 ? 7.08588   -18.93255 19.37593  1.000 112.36127 ? 337 MET A O   1 
ATOM   2519  C  CB  . MET A 1 337 ? 7.51785   -15.96030 20.26760  1.000 102.10441 ? 337 MET A CB  1 
ATOM   2520  C  CG  . MET A 1 337 ? 7.06502   -14.53024 20.03994  1.000 87.25262  ? 337 MET A CG  1 
ATOM   2521  S  SD  . MET A 1 337 ? 6.09049   -14.32858 18.54193  1.000 102.08350 ? 337 MET A SD  1 
ATOM   2522  C  CE  . MET A 1 337 ? 7.36898   -14.39444 17.29378  1.000 103.23747 ? 337 MET A CE  1 
ATOM   2523  N  N   . LYS A 1 338 ? 7.11855   -18.96310 21.63346  1.000 114.95700 ? 338 LYS A N   1 
ATOM   2524  C  CA  . LYS A 1 338 ? 7.62487   -20.32955 21.70286  1.000 122.52991 ? 338 LYS A CA  1 
ATOM   2525  C  C   . LYS A 1 338 ? 6.58387   -21.32508 21.20529  1.000 125.76305 ? 338 LYS A C   1 
ATOM   2526  O  O   . LYS A 1 338 ? 6.87605   -22.17190 20.35208  1.000 118.24970 ? 338 LYS A O   1 
ATOM   2527  C  CB  . LYS A 1 338 ? 8.03679   -20.64662 23.14219  1.000 121.82614 ? 338 LYS A CB  1 
ATOM   2528  C  CG  . LYS A 1 338 ? 8.75836   -21.96809 23.33760  1.000 122.59130 ? 338 LYS A CG  1 
ATOM   2529  C  CD  . LYS A 1 338 ? 8.99663   -22.22713 24.81936  1.000 125.42475 ? 338 LYS A CD  1 
ATOM   2530  C  CE  . LYS A 1 338 ? 9.75390   -23.52312 25.04753  1.000 123.47225 ? 338 LYS A CE  1 
ATOM   2531  N  NZ  . LYS A 1 338 ? 9.01000   -24.69699 24.51573  1.000 128.01417 ? 338 LYS A NZ  1 
ATOM   2532  N  N   . ASP A 1 339 ? 5.36103   -21.23177 21.72013  1.000 134.44286 ? 339 ASP A N   1 
ATOM   2533  C  CA  . ASP A 1 339 ? 4.25058   -22.09443 21.32335  1.000 130.13623 ? 339 ASP A CA  1 
ATOM   2534  C  C   . ASP A 1 339 ? 3.13525   -21.19359 20.80249  1.000 128.12649 ? 339 ASP A C   1 
ATOM   2535  O  O   . ASP A 1 339 ? 2.30552   -20.70797 21.57460  1.000 128.86290 ? 339 ASP A O   1 
ATOM   2536  C  CB  . ASP A 1 339 ? 3.78751   -22.95731 22.49022  1.000 131.52851 ? 339 ASP A CB  1 
ATOM   2537  C  CG  . ASP A 1 339 ? 4.84480   -23.94865 22.93546  1.000 137.55792 ? 339 ASP A CG  1 
ATOM   2538  O  OD1 . ASP A 1 339 ? 5.60421   -24.43723 22.07192  1.000 149.15613 ? 339 ASP A OD1 1 
ATOM   2539  O  OD2 . ASP A 1 339 ? 4.91841   -24.23842 24.14707  1.000 135.04151 ? 339 ASP A OD2 1 
ATOM   2540  N  N   . LYS A 1 340 ? 3.12413   -20.98382 19.48561  1.000 116.95008 ? 340 LYS A N   1 
ATOM   2541  C  CA  . LYS A 1 340 ? 2.24402   -20.05124 18.79059  1.000 108.22249 ? 340 LYS A CA  1 
ATOM   2542  C  C   . LYS A 1 340 ? 0.76729   -20.37791 18.98834  1.000 108.78462 ? 340 LYS A C   1 
ATOM   2543  O  O   . LYS A 1 340 ? 0.28242   -21.39434 18.47271  1.000 109.27808 ? 340 LYS A O   1 
ATOM   2544  C  CB  . LYS A 1 340 ? 2.56934   -20.03705 17.29595  1.000 98.30427  ? 340 LYS A CB  1 
ATOM   2545  C  CG  . LYS A 1 340 ? 3.97220   -19.55999 16.96878  1.000 112.98671 ? 340 LYS A CG  1 
ATOM   2546  C  CD  . LYS A 1 340 ? 3.99781   -18.05999 16.72463  1.000 117.36530 ? 340 LYS A CD  1 
ATOM   2547  C  CE  . LYS A 1 340 ? 5.38184   -17.58367 16.30791  1.000 113.69499 ? 340 LYS A CE  1 
ATOM   2548  N  NZ  . LYS A 1 340 ? 5.77577   -18.10891 14.97074  1.000 107.16336 ? 340 LYS A NZ  1 
ATOM   2549  N  N   . PRO A 1 341 ? 0.02124   -19.55207 19.71973  1.000 102.64483 ? 341 PRO A N   1 
ATOM   2550  C  CA  . PRO A 1 341 ? -1.43301  -19.72405 19.76289  1.000 97.03237  ? 341 PRO A CA  1 
ATOM   2551  C  C   . PRO A 1 341 ? -2.06378  -19.26053 18.45857  1.000 104.80907 ? 341 PRO A C   1 
ATOM   2552  O  O   . PRO A 1 341 ? -1.51453  -18.43593 17.72442  1.000 103.84818 ? 341 PRO A O   1 
ATOM   2553  C  CB  . PRO A 1 341 ? -1.86895  -18.83707 20.93692  1.000 92.13410  ? 341 PRO A CB  1 
ATOM   2554  C  CG  . PRO A 1 341 ? -0.59271  -18.44089 21.64127  1.000 93.67893  ? 341 PRO A CG  1 
ATOM   2555  C  CD  . PRO A 1 341 ? 0.45839   -18.44510 20.58237  1.000 95.01022  ? 341 PRO A CD  1 
ATOM   2556  N  N   . LYS A 1 342 ? -3.24200  -19.81593 18.17069  1.000 95.92575  ? 342 LYS A N   1 
ATOM   2557  C  CA  . LYS A 1 342 ? -3.88739  -19.55589 16.88888  1.000 108.87067 ? 342 LYS A CA  1 
ATOM   2558  C  C   . LYS A 1 342 ? -4.38374  -18.11973 16.74429  1.000 107.02487 ? 342 LYS A C   1 
ATOM   2559  O  O   . LYS A 1 342 ? -4.66989  -17.69425 15.61945  1.000 98.77232  ? 342 LYS A O   1 
ATOM   2560  C  CB  . LYS A 1 342 ? -5.05464  -20.52589 16.68494  1.000 114.59071 ? 342 LYS A CB  1 
ATOM   2561  C  CG  . LYS A 1 342 ? -4.66489  -22.00057 16.62041  1.000 120.68880 ? 342 LYS A CG  1 
ATOM   2562  C  CD  . LYS A 1 342 ? -3.74508  -22.29555 15.44217  1.000 119.25217 ? 342 LYS A CD  1 
ATOM   2563  C  CE  . LYS A 1 342 ? -3.56790  -23.79544 15.24121  1.000 108.20394 ? 342 LYS A CE  1 
ATOM   2564  N  NZ  . LYS A 1 342 ? -2.80498  -24.43422 16.34755  1.000 119.45049 ? 342 LYS A NZ  1 
ATOM   2565  N  N   . ASP A 1 343 ? -4.48069  -17.36089 17.83747  1.000 94.86866  ? 343 ASP A N   1 
ATOM   2566  C  CA  . ASP A 1 343 ? -4.96839  -15.98675 17.78483  1.000 93.16811  ? 343 ASP A CA  1 
ATOM   2567  C  C   . ASP A 1 343 ? -3.85966  -14.94474 17.87017  1.000 94.22823  ? 343 ASP A C   1 
ATOM   2568  O  O   . ASP A 1 343 ? -4.15627  -13.74520 17.90360  1.000 80.58157  ? 343 ASP A O   1 
ATOM   2569  C  CB  . ASP A 1 343 ? -5.97389  -15.74171 18.91387  1.000 90.18811  ? 343 ASP A CB  1 
ATOM   2570  C  CG  . ASP A 1 343 ? -5.34126  -15.85023 20.28941  1.000 102.51653 ? 343 ASP A CG  1 
ATOM   2571  O  OD1 . ASP A 1 343 ? -4.31607  -16.55452 20.41963  1.000 102.77644 ? 343 ASP A OD1 1 
ATOM   2572  O  OD2 . ASP A 1 343 ? -5.86299  -15.22548 21.23852  1.000 100.55565 ? 343 ASP A OD2 1 
ATOM   2573  N  N   . LEU A 1 344 ? -2.60066  -15.36576 17.91190  1.000 94.63983  ? 344 LEU A N   1 
ATOM   2574  C  CA  . LEU A 1 344 ? -1.46977  -14.45814 18.04600  1.000 85.89923  ? 344 LEU A CA  1 
ATOM   2575  C  C   . LEU A 1 344 ? -0.84986  -14.18755 16.68111  1.000 76.34176  ? 344 LEU A C   1 
ATOM   2576  O  O   . LEU A 1 344 ? -0.65062  -15.11452 15.88897  1.000 75.50771  ? 344 LEU A O   1 
ATOM   2577  C  CB  . LEU A 1 344 ? -0.41765  -15.02922 18.99743  1.000 88.73217  ? 344 LEU A CB  1 
ATOM   2578  C  CG  . LEU A 1 344 ? 0.92665   -14.29678 18.99312  1.000 89.20385  ? 344 LEU A CG  1 
ATOM   2579  C  CD1 . LEU A 1 344 ? 0.79274   -12.92157 19.63305  1.000 80.92215  ? 344 LEU A CD1 1 
ATOM   2580  C  CD2 . LEU A 1 344 ? 1.99938   -15.11868 19.68726  1.000 95.32102  ? 344 LEU A CD2 1 
ATOM   2581  N  N   . ILE A 1 345 ? -0.55575  -12.91722 16.40919  1.000 74.30559  ? 345 ILE A N   1 
ATOM   2582  C  CA  . ILE A 1 345 ? 0.27083   -12.54559 15.26677  1.000 73.90366  ? 345 ILE A CA  1 
ATOM   2583  C  C   . ILE A 1 345 ? 1.60852   -12.03435 15.78465  1.000 71.08658  ? 345 ILE A C   1 
ATOM   2584  O  O   . ILE A 1 345 ? 2.65230   -12.65754 15.56021  1.000 70.80101  ? 345 ILE A O   1 
ATOM   2585  C  CB  . ILE A 1 345 ? -0.42018  -11.49329 14.37972  1.000 68.55369  ? 345 ILE A CB  1 
ATOM   2586  C  CG1 . ILE A 1 345 ? -1.68590  -12.07538 13.74582  1.000 69.61509  ? 345 ILE A CG1 1 
ATOM   2587  C  CG2 . ILE A 1 345 ? 0.54224   -10.97822 13.31989  1.000 66.69637  ? 345 ILE A CG2 1 
ATOM   2588  C  CD1 . ILE A 1 345 ? -2.44705  -11.09622 12.88008  1.000 66.22789  ? 345 ILE A CD1 1 
ATOM   2589  N  N   . LYS A 1 346 ? 1.58788   -10.89944 16.48669  1.000 73.56144  ? 346 LYS A N   1 
ATOM   2590  C  CA  . LYS A 1 346 ? 2.80509   -10.31214 17.01399  1.000 78.06619  ? 346 LYS A CA  1 
ATOM   2591  C  C   . LYS A 1 346 ? 2.48527   -9.65993  18.35433  1.000 74.39647  ? 346 LYS A C   1 
ATOM   2592  O  O   . LYS A 1 346 ? 1.56391   -8.82963  18.41969  1.000 74.28955  ? 346 LYS A O   1 
ATOM   2593  C  CB  . LYS A 1 346 ? 3.39281   -9.28198  16.04840  1.000 72.19087  ? 346 LYS A CB  1 
ATOM   2594  C  CG  . LYS A 1 346 ? 4.82841   -8.88994  16.34697  1.000 69.56870  ? 346 LYS A CG  1 
ATOM   2595  C  CD  . LYS A 1 346 ? 5.80863   -9.94604  15.86302  1.000 68.02965  ? 346 LYS A CD  1 
ATOM   2596  C  CE  . LYS A 1 346 ? 7.24397   -9.46058  16.00216  1.000 67.63284  ? 346 LYS A CE  1 
ATOM   2597  N  NZ  . LYS A 1 346 ? 8.23288   -10.52304 15.66493  1.000 74.51316  ? 346 LYS A NZ  1 
ATOM   2598  N  N   . PRO A 1 347 ? 3.20728   -10.00552 19.42669  1.000 76.86303  ? 347 PRO A N   1 
ATOM   2599  C  CA  . PRO A 1 347 ? 2.96843   -9.34708  20.71940  1.000 81.30769  ? 347 PRO A CA  1 
ATOM   2600  C  C   . PRO A 1 347 ? 3.91218   -8.18034  20.97264  1.000 82.26199  ? 347 PRO A C   1 
ATOM   2601  O  O   . PRO A 1 347 ? 5.05488   -8.18495  20.50350  1.000 92.76408  ? 347 PRO A O   1 
ATOM   2602  C  CB  . PRO A 1 347 ? 3.19990   -10.48079 21.72277  1.000 82.68870  ? 347 PRO A CB  1 
ATOM   2603  C  CG  . PRO A 1 347 ? 4.27157   -11.30926 21.07178  1.000 81.47551  ? 347 PRO A CG  1 
ATOM   2604  C  CD  . PRO A 1 347 ? 4.07639   -11.18802 19.56632  1.000 78.70999  ? 347 PRO A CD  1 
ATOM   2605  N  N   . VAL A 1 348 ? 3.45294   -7.18357  21.72798  1.000 80.18818  ? 348 VAL A N   1 
ATOM   2606  C  CA  . VAL A 1 348 ? 4.23542   -5.98943  22.02521  1.000 79.92872  ? 348 VAL A CA  1 
ATOM   2607  C  C   . VAL A 1 348 ? 4.21030   -5.74902  23.52828  1.000 97.38665  ? 348 VAL A C   1 
ATOM   2608  O  O   . VAL A 1 348 ? 3.16058   -5.87249  24.16987  1.000 93.65241  ? 348 VAL A O   1 
ATOM   2609  C  CB  . VAL A 1 348 ? 3.69626   -4.75642  21.26703  1.000 83.26558  ? 348 VAL A CB  1 
ATOM   2610  C  CG1 . VAL A 1 348 ? 4.39118   -3.48364  21.73229  1.000 80.52368  ? 348 VAL A CG1 1 
ATOM   2611  C  CG2 . VAL A 1 348 ? 3.86287   -4.93998  19.76889  1.000 85.62616  ? 348 VAL A CG2 1 
ATOM   2612  N  N   . VAL A 1 349 ? 5.36704   -5.40549  24.08920  1.000 96.33485  ? 349 VAL A N   1 
ATOM   2613  C  CA  . VAL A 1 349 ? 5.49849   -5.08551  25.50567  1.000 87.79737  ? 349 VAL A CA  1 
ATOM   2614  C  C   . VAL A 1 349 ? 5.83671   -3.60606  25.62895  1.000 89.18978  ? 349 VAL A C   1 
ATOM   2615  O  O   . VAL A 1 349 ? 6.89024   -3.16144  25.15727  1.000 95.50325  ? 349 VAL A O   1 
ATOM   2616  C  CB  . VAL A 1 349 ? 6.56838   -5.95349  26.18570  1.000 89.77838  ? 349 VAL A CB  1 
ATOM   2617  C  CG1 . VAL A 1 349 ? 6.75524   -5.52917  27.63422  1.000 93.32850  ? 349 VAL A CG1 1 
ATOM   2618  C  CG2 . VAL A 1 349 ? 6.19268   -7.41984  26.10093  1.000 90.53226  ? 349 VAL A CG2 1 
ATOM   2619  N  N   . ILE A 1 350 ? 4.94955   -2.84742  26.26477  1.000 96.80054  ? 350 ILE A N   1 
ATOM   2620  C  CA  . ILE A 1 350 ? 5.17041   -1.42824  26.51984  1.000 95.73132  ? 350 ILE A CA  1 
ATOM   2621  C  C   . ILE A 1 350 ? 5.85237   -1.29527  27.87290  1.000 97.79863  ? 350 ILE A C   1 
ATOM   2622  O  O   . ILE A 1 350 ? 5.34637   -1.79850  28.87986  1.000 110.60273 ? 350 ILE A O   1 
ATOM   2623  C  CB  . ILE A 1 350 ? 3.84466   -0.65061  26.49776  1.000 89.51951  ? 350 ILE A CB  1 
ATOM   2624  C  CG1 . ILE A 1 350 ? 3.16304   -0.77566  25.13437  1.000 85.88133  ? 350 ILE A CG1 1 
ATOM   2625  C  CG2 . ILE A 1 350 ? 4.08183   0.81006   26.85189  1.000 89.98851  ? 350 ILE A CG2 1 
ATOM   2626  C  CD1 . ILE A 1 350 ? 3.95412   -0.18608  24.00229  1.000 92.65752  ? 350 ILE A CD1 1 
ATOM   2627  N  N   . LEU A 1 351 ? 6.99599   -0.61681  27.90779  1.000 99.38861  ? 351 LEU A N   1 
ATOM   2628  C  CA  . LEU A 1 351 ? 7.79049   -0.56202  29.12967  1.000 103.85671 ? 351 LEU A CA  1 
ATOM   2629  C  C   . LEU A 1 351 ? 7.62933   0.73906   29.90360  1.000 125.99149 ? 351 LEU A C   1 
ATOM   2630  O  O   . LEU A 1 351 ? 7.47822   0.70638   31.12983  1.000 137.03291 ? 351 LEU A O   1 
ATOM   2631  C  CB  . LEU A 1 351 ? 9.26802   -0.79035  28.80418  1.000 98.39946  ? 351 LEU A CB  1 
ATOM   2632  C  CG  . LEU A 1 351 ? 9.55349   -2.21099  28.31419  1.000 108.46007 ? 351 LEU A CG  1 
ATOM   2633  C  CD1 . LEU A 1 351 ? 10.99391  -2.35311  27.87140  1.000 116.61699 ? 351 LEU A CD1 1 
ATOM   2634  C  CD2 . LEU A 1 351 ? 9.21981   -3.22924  29.39643  1.000 107.72390 ? 351 LEU A CD2 1 
ATOM   2635  N  N   . ALA A 1 352 ? 7.65756   1.88161   29.22745  1.000 130.27077 ? 352 ALA A N   1 
ATOM   2636  C  CA  . ALA A 1 352 ? 7.49895   3.16360   29.90534  1.000 144.77730 ? 352 ALA A CA  1 
ATOM   2637  C  C   . ALA A 1 352 ? 6.97297   4.22375   28.94586  1.000 154.10276 ? 352 ALA A C   1 
ATOM   2638  O  O   . ALA A 1 352 ? 6.86138   5.39724   29.30201  1.000 153.93530 ? 352 ALA A O   1 
ATOM   2639  C  CB  . ALA A 1 352 ? 8.81870   3.60951   30.52177  1.000 126.15147 ? 352 ALA A CB  1 
ATOM   2640  O  OXT . ALA A 1 352 ? 6.65041   3.92982   27.79368  1.000 136.15488 ? 352 ALA A OXT 1 
HETATM 2641  N  N   . FME B 2 1   ? 15.36453  -34.84014 -49.76347 1.000 62.43583  ? 1   FME B N   1 
HETATM 2642  C  CN  . FME B 2 1   ? 14.60880  -34.25104 -50.75494 1.000 69.75300  ? 1   FME B CN  1 
HETATM 2643  O  O1  . FME B 2 1   ? 13.94105  -34.91017 -51.57618 1.000 64.77072  ? 1   FME B O1  1 
HETATM 2644  C  CA  . FME B 2 1   ? 16.15732  -34.14822 -48.78089 1.000 55.02508  ? 1   FME B CA  1 
HETATM 2645  C  CB  . FME B 2 1   ? 15.41421  -32.95767 -48.13873 1.000 52.16584  ? 1   FME B CB  1 
HETATM 2646  C  CG  . FME B 2 1   ? 16.33449  -32.09801 -47.31698 1.000 51.92049  ? 1   FME B CG  1 
HETATM 2647  S  SD  . FME B 2 1   ? 15.33373  -31.17465 -46.17894 1.000 56.16751  ? 1   FME B SD  1 
HETATM 2648  C  CE  . FME B 2 1   ? 15.91464  -31.78226 -44.63901 1.000 40.41582  ? 1   FME B CE  1 
HETATM 2649  C  C   . FME B 2 1   ? 16.58704  -35.09508 -47.65940 1.000 48.08813  ? 1   FME B C   1 
HETATM 2650  O  O   . FME B 2 1   ? 15.78430  -35.75828 -47.00251 1.000 48.85696  ? 1   FME B O   1 
ATOM   2651  N  N   . LYS B 2 2   ? 17.89792  -35.16597 -47.44605 1.000 50.33548  ? 2   LYS B N   1 
ATOM   2652  C  CA  . LYS B 2 2   ? 18.46980  -36.02549 -46.40834 1.000 51.61618  ? 2   LYS B CA  1 
ATOM   2653  C  C   . LYS B 2 2   ? 18.75451  -35.26797 -45.12074 1.000 53.05401  ? 2   LYS B C   1 
ATOM   2654  O  O   . LYS B 2 2   ? 18.99832  -34.06096 -45.13312 1.000 55.35095  ? 2   LYS B O   1 
ATOM   2655  C  CB  . LYS B 2 2   ? 19.75685  -36.69394 -46.89650 1.000 49.01189  ? 2   LYS B CB  1 
ATOM   2656  C  CG  . LYS B 2 2   ? 19.67722  -37.24357 -48.30829 1.000 74.51539  ? 2   LYS B CG  1 
ATOM   2657  C  CD  . LYS B 2 2   ? 20.87784  -38.11335 -48.64633 1.000 82.41213  ? 2   LYS B CD  1 
ATOM   2658  C  CE  . LYS B 2 2   ? 20.64127  -38.90384 -49.92407 1.000 71.27277  ? 2   LYS B CE  1 
ATOM   2659  N  NZ  . LYS B 2 2   ? 21.82165  -39.71432 -50.32323 1.000 79.27979  ? 2   LYS B NZ  1 
ATOM   2660  N  N   . GLY B 2 3   ? 18.72517  -35.99350 -44.00726 1.000 52.74280  ? 3   GLY B N   1 
ATOM   2661  C  CA  . GLY B 2 3   ? 18.98137  -35.39856 -42.71274 1.000 47.13885  ? 3   GLY B CA  1 
ATOM   2662  C  C   . GLY B 2 3   ? 19.40038  -36.40480 -41.66152 1.000 55.03807  ? 3   GLY B C   1 
ATOM   2663  O  O   . GLY B 2 3   ? 18.85291  -37.51166 -41.59177 1.000 48.83716  ? 3   GLY B O   1 
ATOM   2664  N  N   . PHE B 2 4   ? 20.41712  -36.05222 -40.87739 1.000 45.30091  ? 4   PHE B N   1 
ATOM   2665  C  CA  . PHE B 2 4   ? 20.83800  -36.87780 -39.75331 1.000 46.88845  ? 4   PHE B CA  1 
ATOM   2666  C  C   . PHE B 2 4   ? 19.85896  -36.68473 -38.60286 1.000 48.31848  ? 4   PHE B C   1 
ATOM   2667  O  O   . PHE B 2 4   ? 19.72059  -35.57316 -38.08027 1.000 53.08171  ? 4   PHE B O   1 
ATOM   2668  C  CB  . PHE B 2 4   ? 22.25962  -36.52633 -39.32450 1.000 44.39135  ? 4   PHE B CB  1 
ATOM   2669  C  CG  . PHE B 2 4   ? 22.87570  -37.53953 -38.40186 1.000 49.39424  ? 4   PHE B CG  1 
ATOM   2670  C  CD1 . PHE B 2 4   ? 23.12535  -38.83131 -38.83915 1.000 53.74863  ? 4   PHE B CD1 1 
ATOM   2671  C  CD2 . PHE B 2 4   ? 23.19741  -37.20566 -37.09719 1.000 59.75406  ? 4   PHE B CD2 1 
ATOM   2672  C  CE1 . PHE B 2 4   ? 23.68936  -39.77014 -37.99372 1.000 56.38095  ? 4   PHE B CE1 1 
ATOM   2673  C  CE2 . PHE B 2 4   ? 23.76227  -38.13976 -36.24681 1.000 59.07741  ? 4   PHE B CE2 1 
ATOM   2674  C  CZ  . PHE B 2 4   ? 24.00901  -39.42315 -36.69656 1.000 57.18056  ? 4   PHE B CZ  1 
ATOM   2675  N  N   . ALA B 2 5   ? 19.18498  -37.75917 -38.20118 1.000 56.65562  ? 5   ALA B N   1 
ATOM   2676  C  CA  . ALA B 2 5   ? 18.05901  -37.64713 -37.28997 1.000 52.69777  ? 5   ALA B CA  1 
ATOM   2677  C  C   . ALA B 2 5   ? 18.17754  -38.64058 -36.14290 1.000 55.46548  ? 5   ALA B C   1 
ATOM   2678  O  O   . ALA B 2 5   ? 18.88936  -39.64510 -36.22130 1.000 55.12787  ? 5   ALA B O   1 
ATOM   2679  C  CB  . ALA B 2 5   ? 16.72905  -37.87587 -38.02668 1.000 48.55543  ? 5   ALA B CB  1 
ATOM   2680  N  N   . MET B 2 6   ? 17.44982  -38.33840 -35.07141 1.000 52.43458  ? 6   MET B N   1 
ATOM   2681  C  CA  . MET B 2 6   ? 17.29087  -39.24121 -33.93846 1.000 55.95240  ? 6   MET B CA  1 
ATOM   2682  C  C   . MET B 2 6   ? 16.12190  -40.17035 -34.23936 1.000 58.13764  ? 6   MET B C   1 
ATOM   2683  O  O   . MET B 2 6   ? 14.96552  -39.73920 -34.23579 1.000 63.68429  ? 6   MET B O   1 
ATOM   2684  C  CB  . MET B 2 6   ? 17.04475  -38.44764 -32.65823 1.000 59.38887  ? 6   MET B CB  1 
ATOM   2685  C  CG  . MET B 2 6   ? 16.65028  -39.29058 -31.45859 1.000 65.15875  ? 6   MET B CG  1 
ATOM   2686  S  SD  . MET B 2 6   ? 16.18047  -38.26886 -30.04756 1.000 76.55101  ? 6   MET B SD  1 
ATOM   2687  C  CE  . MET B 2 6   ? 15.49949  -39.50652 -28.94254 1.000 82.22797  ? 6   MET B CE  1 
ATOM   2688  N  N   . LEU B 2 7   ? 16.41389  -41.44339 -34.50355 1.000 60.28242  ? 7   LEU B N   1 
ATOM   2689  C  CA  . LEU B 2 7   ? 15.33907  -42.38008 -34.81590 1.000 65.95978  ? 7   LEU B CA  1 
ATOM   2690  C  C   . LEU B 2 7   ? 14.51166  -42.69006 -33.57502 1.000 69.86101  ? 7   LEU B C   1 
ATOM   2691  O  O   . LEU B 2 7   ? 13.28073  -42.57355 -33.58706 1.000 71.46721  ? 7   LEU B O   1 
ATOM   2692  C  CB  . LEU B 2 7   ? 15.91623  -43.66257 -35.41611 1.000 63.47864  ? 7   LEU B CB  1 
ATOM   2693  C  CG  . LEU B 2 7   ? 16.94167  -43.48579 -36.53848 1.000 66.01666  ? 7   LEU B CG  1 
ATOM   2694  C  CD1 . LEU B 2 7   ? 17.42472  -44.83727 -37.04555 1.000 59.48379  ? 7   LEU B CD1 1 
ATOM   2695  C  CD2 . LEU B 2 7   ? 16.35297  -42.66599 -37.67356 1.000 65.99630  ? 7   LEU B CD2 1 
ATOM   2696  N  N   . SER B 2 8   ? 15.17715  -43.06638 -32.49035 1.000 73.30928  ? 8   SER B N   1 
ATOM   2697  C  CA  . SER B 2 8   ? 14.53583  -43.32233 -31.20883 1.000 77.85901  ? 8   SER B CA  1 
ATOM   2698  C  C   . SER B 2 8   ? 15.58595  -43.10835 -30.12709 1.000 84.62973  ? 8   SER B C   1 
ATOM   2699  O  O   . SER B 2 8   ? 16.72744  -42.73729 -30.41485 1.000 89.55250  ? 8   SER B O   1 
ATOM   2700  C  CB  . SER B 2 8   ? 13.93346  -44.73058 -31.16115 1.000 77.78436  ? 8   SER B CB  1 
ATOM   2701  O  OG  . SER B 2 8   ? 14.94045  -45.72477 -31.24315 1.000 78.36081  ? 8   SER B OG  1 
ATOM   2702  N  N   . ILE B 2 9   ? 15.18611  -43.32098 -28.87228 1.000 98.46688  ? 9   ILE B N   1 
ATOM   2703  C  CA  . ILE B 2 9   ? 16.12032  -43.17014 -27.76109 1.000 95.39948  ? 9   ILE B CA  1 
ATOM   2704  C  C   . ILE B 2 9   ? 17.26647  -44.15599 -27.93681 1.000 89.13972  ? 9   ILE B C   1 
ATOM   2705  O  O   . ILE B 2 9   ? 17.06369  -45.37626 -27.94043 1.000 90.09546  ? 9   ILE B O   1 
ATOM   2706  C  CB  . ILE B 2 9   ? 15.40676  -43.36736 -26.42044 1.000 101.71960 ? 9   ILE B CB  1 
ATOM   2707  C  CG1 . ILE B 2 9   ? 14.34314  -42.28550 -26.22028 1.000 106.27172 ? 9   ILE B CG1 1 
ATOM   2708  C  CG2 . ILE B 2 9   ? 16.41384  -43.34663 -25.27894 1.000 96.52589  ? 9   ILE B CG2 1 
ATOM   2709  C  CD1 . ILE B 2 9   ? 13.62167  -42.38358 -24.88881 1.000 109.93248 ? 9   ILE B CD1 1 
ATOM   2710  N  N   . GLY B 2 10  ? 18.47640  -43.62827 -28.10890 1.000 79.22525  ? 10  GLY B N   1 
ATOM   2711  C  CA  . GLY B 2 10  ? 19.66461  -44.44103 -28.25119 1.000 77.13399  ? 10  GLY B CA  1 
ATOM   2712  C  C   . GLY B 2 10  ? 20.05854  -44.78697 -29.66957 1.000 78.31160  ? 10  GLY B C   1 
ATOM   2713  O  O   . GLY B 2 10  ? 21.08051  -45.45849 -29.86210 1.000 78.88581  ? 10  GLY B O   1 
ATOM   2714  N  N   . LYS B 2 11  ? 19.29408  -44.35255 -30.66762 1.000 81.29969  ? 11  LYS B N   1 
ATOM   2715  C  CA  . LYS B 2 11  ? 19.55736  -44.70299 -32.05596 1.000 67.82121  ? 11  LYS B CA  1 
ATOM   2716  C  C   . LYS B 2 11  ? 19.48084  -43.46223 -32.93061 1.000 66.44949  ? 11  LYS B C   1 
ATOM   2717  O  O   . LYS B 2 11  ? 18.59491  -42.62118 -32.75351 1.000 63.07704  ? 11  LYS B O   1 
ATOM   2718  C  CB  . LYS B 2 11  ? 18.56055  -45.74976 -32.57515 1.000 70.66230  ? 11  LYS B CB  1 
ATOM   2719  C  CG  . LYS B 2 11  ? 18.65296  -47.09448 -31.87514 1.000 81.74134  ? 11  LYS B CG  1 
ATOM   2720  C  CD  . LYS B 2 11  ? 17.64811  -48.08918 -32.43771 1.000 86.58853  ? 11  LYS B CD  1 
ATOM   2721  C  CE  . LYS B 2 11  ? 17.79085  -49.44834 -31.75832 1.000 98.71795  ? 11  LYS B CE  1 
ATOM   2722  N  NZ  . LYS B 2 11  ? 16.77705  -50.43948 -32.22861 1.000 99.08679  ? 11  LYS B NZ  1 
ATOM   2723  N  N   . VAL B 2 12  ? 20.41031  -43.36127 -33.88137 1.000 63.15427  ? 12  VAL B N   1 
ATOM   2724  C  CA  . VAL B 2 12  ? 20.46841  -42.26488 -34.83734 1.000 64.21171  ? 12  VAL B CA  1 
ATOM   2725  C  C   . VAL B 2 12  ? 20.71941  -42.86190 -36.21451 1.000 61.90097  ? 12  VAL B C   1 
ATOM   2726  O  O   . VAL B 2 12  ? 21.15513  -44.00783 -36.35319 1.000 66.17879  ? 12  VAL B O   1 
ATOM   2727  C  CB  . VAL B 2 12  ? 21.56570  -41.22967 -34.49934 1.000 65.87781  ? 12  VAL B CB  1 
ATOM   2728  C  CG1 . VAL B 2 12  ? 21.23972  -40.49817 -33.20837 1.000 55.35223  ? 12  VAL B CG1 1 
ATOM   2729  C  CG2 . VAL B 2 12  ? 22.91544  -41.91288 -34.40036 1.000 62.18594  ? 12  VAL B CG2 1 
ATOM   2730  N  N   . GLY B 2 13  ? 20.41749  -42.07629 -37.23924 1.000 58.47722  ? 13  GLY B N   1 
ATOM   2731  C  CA  . GLY B 2 13  ? 20.63452  -42.52388 -38.60248 1.000 54.41887  ? 13  GLY B CA  1 
ATOM   2732  C  C   . GLY B 2 13  ? 20.12674  -41.49139 -39.58194 1.000 57.08073  ? 13  GLY B C   1 
ATOM   2733  O  O   . GLY B 2 13  ? 19.42125  -40.54421 -39.21843 1.000 52.50477  ? 13  GLY B O   1 
ATOM   2734  N  N   . TRP B 2 14  ? 20.52530  -41.68011 -40.83627 1.000 57.55011  ? 14  TRP B N   1 
ATOM   2735  C  CA  . TRP B 2 14  ? 20.11953  -40.79623 -41.91805 1.000 56.42803  ? 14  TRP B CA  1 
ATOM   2736  C  C   . TRP B 2 14  ? 18.71243  -41.12816 -42.39038 1.000 54.10706  ? 14  TRP B C   1 
ATOM   2737  O  O   . TRP B 2 14  ? 18.34972  -42.29976 -42.53009 1.000 58.14507  ? 14  TRP B O   1 
ATOM   2738  C  CB  . TRP B 2 14  ? 21.09752  -40.90611 -43.08653 1.000 57.52454  ? 14  TRP B CB  1 
ATOM   2739  C  CG  . TRP B 2 14  ? 22.41253  -40.29640 -42.78786 1.000 56.60484  ? 14  TRP B CG  1 
ATOM   2740  C  CD1 . TRP B 2 14  ? 23.50629  -40.91825 -42.26590 1.000 60.25376  ? 14  TRP B CD1 1 
ATOM   2741  C  CD2 . TRP B 2 14  ? 22.76745  -38.92263 -42.95036 1.000 55.52142  ? 14  TRP B CD2 1 
ATOM   2742  N  NE1 . TRP B 2 14  ? 24.53210  -40.01733 -42.11387 1.000 61.86345  ? 14  TRP B NE1 1 
ATOM   2743  C  CE2 . TRP B 2 14  ? 24.10117  -38.78322 -42.52451 1.000 61.42242  ? 14  TRP B CE2 1 
ATOM   2744  C  CE3 . TRP B 2 14  ? 22.08734  -37.79653 -43.42224 1.000 60.14546  ? 14  TRP B CE3 1 
ATOM   2745  C  CZ2 . TRP B 2 14  ? 24.76939  -37.56417 -42.55851 1.000 62.96215  ? 14  TRP B CZ2 1 
ATOM   2746  C  CZ3 . TRP B 2 14  ? 22.74937  -36.58897 -43.45283 1.000 57.30752  ? 14  TRP B CZ3 1 
ATOM   2747  C  CH2 . TRP B 2 14  ? 24.07742  -36.48066 -43.02635 1.000 61.97122  ? 14  TRP B CH2 1 
ATOM   2748  N  N   . ILE B 2 15  ? 17.91087  -40.08979 -42.62789 1.000 50.95835  ? 15  ILE B N   1 
ATOM   2749  C  CA  . ILE B 2 15  ? 16.54724  -40.27225 -43.09868 1.000 52.15537  ? 15  ILE B CA  1 
ATOM   2750  C  C   . ILE B 2 15  ? 16.30402  -39.38300 -44.31162 1.000 50.84350  ? 15  ILE B C   1 
ATOM   2751  O  O   . ILE B 2 15  ? 17.13534  -38.55872 -44.69460 1.000 54.84451  ? 15  ILE B O   1 
ATOM   2752  C  CB  . ILE B 2 15  ? 15.50284  -39.96143 -42.00880 1.000 51.57684  ? 15  ILE B CB  1 
ATOM   2753  C  CG1 . ILE B 2 15  ? 15.53809  -38.47583 -41.65875 1.000 49.42985  ? 15  ILE B CG1 1 
ATOM   2754  C  CG2 . ILE B 2 15  ? 15.75073  -40.80080 -40.77466 1.000 51.72245  ? 15  ILE B CG2 1 
ATOM   2755  C  CD1 . ILE B 2 15  ? 14.36972  -38.02400 -40.81903 1.000 55.24443  ? 15  ILE B CD1 1 
ATOM   2756  N  N   . GLU B 2 16  ? 15.12759  -39.56266 -44.90225 1.000 51.91293  ? 16  GLU B N   1 
ATOM   2757  C  CA  . GLU B 2 16  ? 14.65678  -38.78375 -46.03591 1.000 56.36429  ? 16  GLU B CA  1 
ATOM   2758  C  C   . GLU B 2 16  ? 13.32201  -38.15910 -45.68333 1.000 57.75339  ? 16  GLU B C   1 
ATOM   2759  O  O   . GLU B 2 16  ? 12.41740  -38.84872 -45.20585 1.000 54.15224  ? 16  GLU B O   1 
ATOM   2760  C  CB  . GLU B 2 16  ? 14.49786  -39.63326 -47.29493 1.000 63.99281  ? 16  GLU B CB  1 
ATOM   2761  C  CG  . GLU B 2 16  ? 15.78342  -40.06550 -47.91999 1.000 72.83663  ? 16  GLU B CG  1 
ATOM   2762  C  CD  . GLU B 2 16  ? 16.35258  -39.00903 -48.84314 1.000 78.88823  ? 16  GLU B CD  1 
ATOM   2763  O  OE1 . GLU B 2 16  ? 15.63552  -38.02818 -49.14678 1.000 77.67484  ? 16  GLU B OE1 1 
ATOM   2764  O  OE2 . GLU B 2 16  ? 17.51692  -39.15763 -49.26081 1.000 77.77031  ? 16  GLU B OE2 1 
ATOM   2765  N  N   . LYS B 2 17  ? 13.20210  -36.86256 -45.92099 1.000 57.50606  ? 17  LYS B N   1 
ATOM   2766  C  CA  . LYS B 2 17  ? 11.95672  -36.15869 -45.69965 1.000 49.14357  ? 17  LYS B CA  1 
ATOM   2767  C  C   . LYS B 2 17  ? 11.72109  -35.28459 -46.91639 1.000 49.73265  ? 17  LYS B C   1 
ATOM   2768  O  O   . LYS B 2 17  ? 12.57798  -35.16360 -47.79805 1.000 55.83453  ? 17  LYS B O   1 
ATOM   2769  C  CB  . LYS B 2 17  ? 11.99189  -35.32315 -44.41546 1.000 55.02350  ? 17  LYS B CB  1 
ATOM   2770  C  CG  . LYS B 2 17  ? 12.95976  -34.16024 -44.47206 1.000 45.94534  ? 17  LYS B CG  1 
ATOM   2771  C  CD  . LYS B 2 17  ? 12.86559  -33.27966 -43.23286 1.000 48.70623  ? 17  LYS B CD  1 
ATOM   2772  C  CE  . LYS B 2 17  ? 11.74697  -32.26054 -43.34840 1.000 51.37436  ? 17  LYS B CE  1 
ATOM   2773  N  NZ  . LYS B 2 17  ? 11.81838  -31.24316 -42.25817 1.000 50.92459  ? 17  LYS B NZ  1 
ATOM   2774  N  N   . GLU B 2 18  ? 10.57288  -34.63448 -46.94528 1.000 59.94363  ? 18  GLU B N   1 
ATOM   2775  C  CA  . GLU B 2 18  ? 10.26949  -33.72268 -48.02744 1.000 49.01763  ? 18  GLU B CA  1 
ATOM   2776  C  C   . GLU B 2 18  ? 10.82618  -32.35758 -47.65554 1.000 54.19009  ? 18  GLU B C   1 
ATOM   2777  O  O   . GLU B 2 18  ? 10.77675  -31.95072 -46.48994 1.000 52.28835  ? 18  GLU B O   1 
ATOM   2778  C  CB  . GLU B 2 18  ? 8.76313   -33.67746 -48.27481 1.000 52.72262  ? 18  GLU B CB  1 
ATOM   2779  C  CG  . GLU B 2 18  ? 8.36659   -33.05639 -49.59076 1.000 73.66943  ? 18  GLU B CG  1 
ATOM   2780  C  CD  . GLU B 2 18  ? 6.97624   -33.47786 -50.01540 1.000 82.85627  ? 18  GLU B CD  1 
ATOM   2781  O  OE1 . GLU B 2 18  ? 6.27384   -34.11175 -49.19702 1.000 77.10560  ? 18  GLU B OE1 1 
ATOM   2782  O  OE2 . GLU B 2 18  ? 6.59452   -33.19448 -51.17126 1.000 97.01067  ? 18  GLU B OE2 1 
ATOM   2783  N  N   . LYS B 2 19  ? 11.40184  -31.67987 -48.63866 1.000 50.10711  ? 19  LYS B N   1 
ATOM   2784  C  CA  . LYS B 2 19  ? 12.00041  -30.37887 -48.39000 1.000 47.68348  ? 19  LYS B CA  1 
ATOM   2785  C  C   . LYS B 2 19  ? 10.95108  -29.42433 -47.82747 1.000 51.55711  ? 19  LYS B C   1 
ATOM   2786  O  O   . LYS B 2 19  ? 9.88341   -29.25710 -48.43235 1.000 61.25012  ? 19  LYS B O   1 
ATOM   2787  C  CB  . LYS B 2 19  ? 12.59807  -29.82984 -49.68313 1.000 51.22665  ? 19  LYS B CB  1 
ATOM   2788  C  CG  . LYS B 2 19  ? 13.23547  -28.46364 -49.56132 1.000 55.25383  ? 19  LYS B CG  1 
ATOM   2789  C  CD  . LYS B 2 19  ? 13.84529  -28.05001 -50.89016 1.000 51.61583  ? 19  LYS B CD  1 
ATOM   2790  C  CE  . LYS B 2 19  ? 14.42920  -26.64972 -50.82338 1.000 66.52537  ? 19  LYS B CE  1 
ATOM   2791  N  NZ  . LYS B 2 19  ? 15.08869  -26.26743 -52.10367 1.000 63.36674  ? 19  LYS B NZ  1 
ATOM   2792  N  N   . PRO B 2 20  ? 11.21035  -28.78752 -46.68869 1.000 51.13838  ? 20  PRO B N   1 
ATOM   2793  C  CA  . PRO B 2 20  ? 10.18344  -27.95292 -46.05770 1.000 55.94437  ? 20  PRO B CA  1 
ATOM   2794  C  C   . PRO B 2 20  ? 9.87049   -26.71468 -46.87894 1.000 50.47769  ? 20  PRO B C   1 
ATOM   2795  O  O   . PRO B 2 20  ? 10.72220  -26.17062 -47.58536 1.000 53.90114  ? 20  PRO B O   1 
ATOM   2796  C  CB  . PRO B 2 20  ? 10.80944  -27.57926 -44.70886 1.000 46.35382  ? 20  PRO B CB  1 
ATOM   2797  C  CG  . PRO B 2 20  ? 12.27489  -27.66146 -44.94850 1.000 46.89210  ? 20  PRO B CG  1 
ATOM   2798  C  CD  . PRO B 2 20  ? 12.46895  -28.79008 -45.92461 1.000 51.79505  ? 20  PRO B CD  1 
ATOM   2799  N  N   . ALA B 2 21  ? 8.61933   -26.28211 -46.78592 1.000 56.78533  ? 21  ALA B N   1 
ATOM   2800  C  CA  . ALA B 2 21  ? 8.14555   -25.09127 -47.47013 1.000 50.89147  ? 21  ALA B CA  1 
ATOM   2801  C  C   . ALA B 2 21  ? 7.99895   -23.94134 -46.48567 1.000 52.79395  ? 21  ALA B C   1 
ATOM   2802  O  O   . ALA B 2 21  ? 7.52535   -24.14197 -45.36082 1.000 53.88890  ? 21  ALA B O   1 
ATOM   2803  C  CB  . ALA B 2 21  ? 6.80092   -25.35186 -48.14954 1.000 47.41664  ? 21  ALA B CB  1 
ATOM   2804  N  N   . PRO B 2 22  ? 8.40714   -22.73646 -46.87316 1.000 57.65792  ? 22  PRO B N   1 
ATOM   2805  C  CA  . PRO B 2 22  ? 8.32640   -21.60041 -45.95056 1.000 44.87219  ? 22  PRO B CA  1 
ATOM   2806  C  C   . PRO B 2 22  ? 6.95287   -20.94945 -45.96977 1.000 45.45093  ? 22  PRO B C   1 
ATOM   2807  O  O   . PRO B 2 22  ? 6.31504   -20.81906 -47.01661 1.000 52.80857  ? 22  PRO B O   1 
ATOM   2808  C  CB  . PRO B 2 22  ? 9.39472   -20.64192 -46.48821 1.000 45.83594  ? 22  PRO B CB  1 
ATOM   2809  C  CG  . PRO B 2 22  ? 9.39108   -20.90078 -47.96367 1.000 48.75186  ? 22  PRO B CG  1 
ATOM   2810  C  CD  . PRO B 2 22  ? 9.03996   -22.36738 -48.15294 1.000 48.56839  ? 22  PRO B CD  1 
ATOM   2811  N  N   . GLY B 2 23  ? 6.49101   -20.54502 -44.78834 1.000 52.39341  ? 23  GLY B N   1 
ATOM   2812  C  CA  . GLY B 2 23  ? 5.34486   -19.68953 -44.70864 1.000 47.89197  ? 23  GLY B CA  1 
ATOM   2813  C  C   . GLY B 2 23  ? 5.68492   -18.29090 -45.18898 1.000 45.55219  ? 23  GLY B C   1 
ATOM   2814  O  O   . GLY B 2 23  ? 6.83802   -17.98836 -45.52173 1.000 47.98080  ? 23  GLY B O   1 
ATOM   2815  N  N   . PRO B 2 24  ? 4.68105   -17.41345 -45.21804 1.000 39.90360  ? 24  PRO B N   1 
ATOM   2816  C  CA  . PRO B 2 24  ? 4.91988   -16.05234 -45.72815 1.000 45.30322  ? 24  PRO B CA  1 
ATOM   2817  C  C   . PRO B 2 24  ? 6.00422   -15.28519 -44.98435 1.000 45.85335  ? 24  PRO B C   1 
ATOM   2818  O  O   . PRO B 2 24  ? 6.60642   -14.37941 -45.57445 1.000 47.92182  ? 24  PRO B O   1 
ATOM   2819  C  CB  . PRO B 2 24  ? 3.54733   -15.37435 -45.59111 1.000 44.34657  ? 24  PRO B CB  1 
ATOM   2820  C  CG  . PRO B 2 24  ? 2.73734   -16.27118 -44.70379 1.000 48.24580  ? 24  PRO B CG  1 
ATOM   2821  C  CD  . PRO B 2 24  ? 3.26086   -17.65230 -44.92155 1.000 42.91554  ? 24  PRO B CD  1 
ATOM   2822  N  N   . PHE B 2 25  ? 6.28891   -15.61745 -43.72571 1.000 37.46997  ? 25  PHE B N   1 
ATOM   2823  C  CA  . PHE B 2 25  ? 7.30872   -14.91797 -42.95543 1.000 35.21162  ? 25  PHE B CA  1 
ATOM   2824  C  C   . PHE B 2 25  ? 8.55513   -15.75404 -42.69921 1.000 42.96126  ? 25  PHE B C   1 
ATOM   2825  O  O   . PHE B 2 25  ? 9.46876   -15.28303 -42.01190 1.000 39.93027  ? 25  PHE B O   1 
ATOM   2826  C  CB  . PHE B 2 25  ? 6.73308   -14.45481 -41.61129 1.000 38.26401  ? 25  PHE B CB  1 
ATOM   2827  C  CG  . PHE B 2 25  ? 5.59275   -13.49198 -41.73667 1.000 43.57295  ? 25  PHE B CG  1 
ATOM   2828  C  CD1 . PHE B 2 25  ? 4.28976   -13.95098 -41.83626 1.000 47.64444  ? 25  PHE B CD1 1 
ATOM   2829  C  CD2 . PHE B 2 25  ? 5.82008   -12.12707 -41.73942 1.000 40.52997  ? 25  PHE B CD2 1 
ATOM   2830  C  CE1 . PHE B 2 25  ? 3.23453   -13.06700 -41.94970 1.000 48.40844  ? 25  PHE B CE1 1 
ATOM   2831  C  CE2 . PHE B 2 25  ? 4.76889   -11.23705 -41.85038 1.000 48.62769  ? 25  PHE B CE2 1 
ATOM   2832  C  CZ  . PHE B 2 25  ? 3.47394   -11.70813 -41.95532 1.000 46.08531  ? 25  PHE B CZ  1 
ATOM   2833  N  N   . ASP B 2 26  ? 8.62839   -16.96804 -43.23090 1.000 39.92644  ? 26  ASP B N   1 
ATOM   2834  C  CA  . ASP B 2 26  ? 9.70708   -17.88335 -42.90132 1.000 42.04655  ? 26  ASP B CA  1 
ATOM   2835  C  C   . ASP B 2 26  ? 10.74166  -17.91048 -44.02432 1.000 43.49433  ? 26  ASP B C   1 
ATOM   2836  O  O   . ASP B 2 26  ? 10.57611  -17.29713 -45.08102 1.000 38.60251  ? 26  ASP B O   1 
ATOM   2837  C  CB  . ASP B 2 26  ? 9.15310   -19.28648 -42.63624 1.000 39.81797  ? 26  ASP B CB  1 
ATOM   2838  C  CG  . ASP B 2 26  ? 8.01042   -19.29011 -41.63543 1.000 43.09487  ? 26  ASP B CG  1 
ATOM   2839  O  OD1 . ASP B 2 26  ? 8.00532   -18.44061 -40.71693 1.000 46.73903  ? 26  ASP B OD1 1 
ATOM   2840  O  OD2 . ASP B 2 26  ? 7.11012   -20.14665 -41.77347 1.000 47.56468  ? 26  ASP B OD2 1 
ATOM   2841  N  N   . ALA B 2 27  ? 11.82359  -18.64807 -43.79177 1.000 36.81338  ? 27  ALA B N   1 
ATOM   2842  C  CA  . ALA B 2 27  ? 12.85810  -18.82830 -44.79682 1.000 40.04508  ? 27  ALA B CA  1 
ATOM   2843  C  C   . ALA B 2 27  ? 13.37687  -20.25611 -44.73365 1.000 41.09610  ? 27  ALA B C   1 
ATOM   2844  O  O   . ALA B 2 27  ? 13.39997  -20.87856 -43.66886 1.000 41.42274  ? 27  ALA B O   1 
ATOM   2845  C  CB  . ALA B 2 27  ? 14.01810  -17.84475 -44.60502 1.000 34.93013  ? 27  ALA B CB  1 
ATOM   2846  N  N   . ILE B 2 28  ? 13.77752  -20.77340 -45.89200 1.000 44.57978  ? 28  ILE B N   1 
ATOM   2847  C  CA  . ILE B 2 28  ? 14.45006  -22.06212 -45.99470 1.000 42.76114  ? 28  ILE B CA  1 
ATOM   2848  C  C   . ILE B 2 28  ? 15.93250  -21.79976 -46.20423 1.000 41.16812  ? 28  ILE B C   1 
ATOM   2849  O  O   . ILE B 2 28  ? 16.31638  -21.03576 -47.09948 1.000 44.30908  ? 28  ILE B O   1 
ATOM   2850  C  CB  . ILE B 2 28  ? 13.87183  -22.91070 -47.14076 1.000 47.07375  ? 28  ILE B CB  1 
ATOM   2851  C  CG1 . ILE B 2 28  ? 12.35984  -23.07805 -46.97689 1.000 48.57366  ? 28  ILE B CG1 1 
ATOM   2852  C  CG2 . ILE B 2 28  ? 14.55477  -24.27037 -47.19617 1.000 37.24371  ? 28  ILE B CG2 1 
ATOM   2853  C  CD1 . ILE B 2 28  ? 11.94735  -23.69593 -45.65693 1.000 49.45556  ? 28  ILE B CD1 1 
ATOM   2854  N  N   . VAL B 2 29  ? 16.76664  -22.42934 -45.38434 1.000 40.07398  ? 29  VAL B N   1 
ATOM   2855  C  CA  . VAL B 2 29  ? 18.20425  -22.20157 -45.39806 1.000 44.18134  ? 29  VAL B CA  1 
ATOM   2856  C  C   . VAL B 2 29  ? 18.90864  -23.52112 -45.67293 1.000 42.15648  ? 29  VAL B C   1 
ATOM   2857  O  O   . VAL B 2 29  ? 18.53503  -24.56131 -45.11948 1.000 45.88620  ? 29  VAL B O   1 
ATOM   2858  C  CB  . VAL B 2 29  ? 18.69541  -21.59248 -44.06712 1.000 40.25927  ? 29  VAL B CB  1 
ATOM   2859  C  CG1 . VAL B 2 29  ? 20.18789  -21.32644 -44.12530 1.000 36.89184  ? 29  VAL B CG1 1 
ATOM   2860  C  CG2 . VAL B 2 29  ? 17.93444  -20.31273 -43.74557 1.000 33.70984  ? 29  VAL B CG2 1 
ATOM   2861  N  N   . ARG B 2 30  ? 19.90729  -23.48146 -46.55290 1.000 39.81903  ? 30  ARG B N   1 
ATOM   2862  C  CA  . ARG B 2 30  ? 20.76376  -24.65593 -46.60642 1.000 43.18049  ? 30  ARG B CA  1 
ATOM   2863  C  C   . ARG B 2 30  ? 22.04215  -24.39930 -45.81663 1.000 46.13423  ? 30  ARG B C   1 
ATOM   2864  O  O   . ARG B 2 30  ? 22.61367  -23.30636 -45.89504 1.000 49.55079  ? 30  ARG B O   1 
ATOM   2865  C  CB  . ARG B 2 30  ? 21.11137  -25.02583 -48.04952 1.000 45.32878  ? 30  ARG B CB  1 
ATOM   2866  C  CG  . ARG B 2 30  ? 21.99547  -24.02849 -48.76785 1.000 49.23772  ? 30  ARG B CG  1 
ATOM   2867  C  CD  . ARG B 2 30  ? 22.38041  -24.51924 -50.15244 1.000 45.04222  ? 30  ARG B CD  1 
ATOM   2868  N  NE  . ARG B 2 30  ? 23.43502  -23.69351 -50.72577 1.000 46.67324  ? 30  ARG B NE  1 
ATOM   2869  C  CZ  . ARG B 2 30  ? 24.73078  -23.89201 -50.52276 1.000 57.53519  ? 30  ARG B CZ  1 
ATOM   2870  N  NH1 . ARG B 2 30  ? 25.16795  -24.89433 -49.77681 1.000 60.14576  ? 30  ARG B NH1 1 
ATOM   2871  N  NH2 . ARG B 2 30  ? 25.60984  -23.06294 -51.07925 1.000 49.06718  ? 30  ARG B NH2 1 
ATOM   2872  N  N   . PRO B 2 31  ? 22.50886  -25.37132 -45.03855 1.000 42.19372  ? 31  PRO B N   1 
ATOM   2873  C  CA  . PRO B 2 31  ? 23.64626  -25.11994 -44.14587 1.000 42.33056  ? 31  PRO B CA  1 
ATOM   2874  C  C   . PRO B 2 31  ? 24.97498  -25.07243 -44.88400 1.000 46.60773  ? 31  PRO B C   1 
ATOM   2875  O  O   . PRO B 2 31  ? 25.24294  -25.87299 -45.78297 1.000 49.56393  ? 31  PRO B O   1 
ATOM   2876  C  CB  . PRO B 2 31  ? 23.59633  -26.30796 -43.17904 1.000 39.98552  ? 31  PRO B CB  1 
ATOM   2877  C  CG  . PRO B 2 31  ? 22.95617  -27.39290 -43.97121 1.000 49.81160  ? 31  PRO B CG  1 
ATOM   2878  C  CD  . PRO B 2 31  ? 21.95826  -26.72736 -44.87282 1.000 44.62364  ? 31  PRO B CD  1 
ATOM   2879  N  N   . LEU B 2 32  ? 25.80897  -24.10780 -44.49385 1.000 47.58074  ? 32  LEU B N   1 
ATOM   2880  C  CA  . LEU B 2 32  ? 27.18961  -24.02628 -44.95917 1.000 54.54182  ? 32  LEU B CA  1 
ATOM   2881  C  C   . LEU B 2 32  ? 28.18034  -24.58765 -43.95343 1.000 55.43483  ? 32  LEU B C   1 
ATOM   2882  O  O   . LEU B 2 32  ? 29.21551  -25.13147 -44.35152 1.000 52.63931  ? 32  LEU B O   1 
ATOM   2883  C  CB  . LEU B 2 32  ? 27.57017  -22.57257 -45.27036 1.000 44.61005  ? 32  LEU B CB  1 
ATOM   2884  C  CG  . LEU B 2 32  ? 26.73877  -21.84622 -46.32926 1.000 53.70124  ? 32  LEU B CG  1 
ATOM   2885  C  CD1 . LEU B 2 32  ? 27.14329  -20.38543 -46.41787 1.000 51.11433  ? 32  LEU B CD1 1 
ATOM   2886  C  CD2 . LEU B 2 32  ? 26.89017  -22.52712 -47.68253 1.000 41.85527  ? 32  LEU B CD2 1 
ATOM   2887  N  N   . ALA B 2 33  ? 27.88340  -24.46022 -42.66353 1.000 48.90213  ? 33  ALA B N   1 
ATOM   2888  C  CA  . ALA B 2 33  ? 28.69917  -25.03433 -41.60750 1.000 44.37203  ? 33  ALA B CA  1 
ATOM   2889  C  C   . ALA B 2 33  ? 27.79098  -25.34463 -40.43120 1.000 44.37078  ? 33  ALA B C   1 
ATOM   2890  O  O   . ALA B 2 33  ? 26.93628  -24.53212 -40.06887 1.000 49.06211  ? 33  ALA B O   1 
ATOM   2891  C  CB  . ALA B 2 33  ? 29.82141  -24.08478 -41.17582 1.000 43.93470  ? 33  ALA B CB  1 
ATOM   2892  N  N   . VAL B 2 34  ? 27.97215  -26.52605 -39.84523 1.000 48.62123  ? 34  VAL B N   1 
ATOM   2893  C  CA  . VAL B 2 34  ? 27.18063  -26.95149 -38.70204 1.000 38.02811  ? 34  VAL B CA  1 
ATOM   2894  C  C   . VAL B 2 34  ? 28.11363  -27.52992 -37.64953 1.000 46.56202  ? 34  VAL B C   1 
ATOM   2895  O  O   . VAL B 2 34  ? 29.25300  -27.90942 -37.93038 1.000 46.66571  ? 34  VAL B O   1 
ATOM   2896  C  CB  . VAL B 2 34  ? 26.09774  -27.97983 -39.08799 1.000 39.02729  ? 34  VAL B CB  1 
ATOM   2897  C  CG1 . VAL B 2 34  ? 25.09944  -27.35915 -40.04922 1.000 37.37031  ? 34  VAL B CG1 1 
ATOM   2898  C  CG2 . VAL B 2 34  ? 26.73632  -29.22035 -39.69958 1.000 40.92435  ? 34  VAL B CG2 1 
ATOM   2899  N  N   . ALA B 2 35  ? 27.60333  -27.60809 -36.42207 1.000 44.72499  ? 35  ALA B N   1 
ATOM   2900  C  CA  . ALA B 2 35  ? 28.35733  -28.13008 -35.29979 1.000 43.53408  ? 35  ALA B CA  1 
ATOM   2901  C  C   . ALA B 2 35  ? 27.42495  -28.92383 -34.39699 1.000 50.67377  ? 35  ALA B C   1 
ATOM   2902  O  O   . ALA B 2 35  ? 26.28379  -28.50092 -34.15555 1.000 53.31880  ? 35  ALA B O   1 
ATOM   2903  C  CB  . ALA B 2 35  ? 29.02336  -27.00878 -34.49235 1.000 38.00028  ? 35  ALA B CB  1 
ATOM   2904  N  N   . PRO B 2 36  ? 27.86682  -30.07311 -33.90119 1.000 49.56822  ? 36  PRO B N   1 
ATOM   2905  C  CA  . PRO B 2 36  ? 27.06840  -30.80510 -32.91925 1.000 48.39058  ? 36  PRO B CA  1 
ATOM   2906  C  C   . PRO B 2 36  ? 27.26785  -30.22665 -31.52673 1.000 54.43118  ? 36  PRO B C   1 
ATOM   2907  O  O   . PRO B 2 36  ? 28.24167  -29.52701 -31.24442 1.000 51.46741  ? 36  PRO B O   1 
ATOM   2908  C  CB  . PRO B 2 36  ? 27.61344  -32.23282 -33.01806 1.000 49.28637  ? 36  PRO B CB  1 
ATOM   2909  C  CG  . PRO B 2 36  ? 29.02876  -32.04595 -33.42809 1.000 53.53285  ? 36  PRO B CG  1 
ATOM   2910  C  CD  . PRO B 2 36  ? 29.07311  -30.81711 -34.30082 1.000 52.22623  ? 36  PRO B CD  1 
ATOM   2911  N  N   . CYS B 2 37  ? 26.31391  -30.52662 -30.65108 1.000 53.74072  ? 37  CYS B N   1 
ATOM   2912  C  CA  . CYS B 2 37  ? 26.31685  -29.99283 -29.29847 1.000 54.86982  ? 37  CYS B CA  1 
ATOM   2913  C  C   . CYS B 2 37  ? 26.12288  -31.11738 -28.29614 1.000 55.95128  ? 37  CYS B C   1 
ATOM   2914  O  O   . CYS B 2 37  ? 25.51875  -32.14789 -28.60352 1.000 64.00867  ? 37  CYS B O   1 
ATOM   2915  C  CB  . CYS B 2 37  ? 25.22329  -28.94132 -29.09312 1.000 50.03707  ? 37  CYS B CB  1 
ATOM   2916  S  SG  . CYS B 2 37  ? 25.25365  -28.19532 -27.44863 1.000 62.92965  ? 37  CYS B SG  1 
ATOM   2917  N  N   . THR B 2 38  ? 26.63798  -30.90016 -27.08334 1.000 60.20198  ? 38  THR B N   1 
ATOM   2918  C  CA  . THR B 2 38  ? 26.44919  -31.87789 -26.01827 1.000 61.78646  ? 38  THR B CA  1 
ATOM   2919  C  C   . THR B 2 38  ? 24.97282  -32.07592 -25.70230 1.000 67.88902  ? 38  THR B C   1 
ATOM   2920  O  O   . THR B 2 38  ? 24.57540  -33.15436 -25.24514 1.000 69.61330  ? 38  THR B O   1 
ATOM   2921  C  CB  . THR B 2 38  ? 27.20765  -31.43990 -24.76423 1.000 65.67812  ? 38  THR B CB  1 
ATOM   2922  O  OG1 . THR B 2 38  ? 28.51131  -30.97247 -25.13277 1.000 83.10327  ? 38  THR B OG1 1 
ATOM   2923  C  CG2 . THR B 2 38  ? 27.35568  -32.60085 -23.79230 1.000 84.89703  ? 38  THR B CG2 1 
ATOM   2924  N  N   . SER B 2 39  ? 24.14543  -31.05798 -25.95755 1.000 67.85522  ? 39  SER B N   1 
ATOM   2925  C  CA  . SER B 2 39  ? 22.71696  -31.17480 -25.68381 1.000 66.26763  ? 39  SER B CA  1 
ATOM   2926  C  C   . SER B 2 39  ? 22.07482  -32.26043 -26.53775 1.000 62.58257  ? 39  SER B C   1 
ATOM   2927  O  O   . SER B 2 39  ? 21.20840  -33.00292 -26.06120 1.000 65.66530  ? 39  SER B O   1 
ATOM   2928  C  CB  . SER B 2 39  ? 22.02749  -29.83280 -25.92928 1.000 59.59562  ? 39  SER B CB  1 
ATOM   2929  O  OG  . SER B 2 39  ? 22.59406  -28.81197 -25.12593 1.000 85.49987  ? 39  SER B OG  1 
ATOM   2930  N  N   . ASP B 2 40  ? 22.48678  -32.37064 -27.80335 1.000 57.56276  ? 40  ASP B N   1 
ATOM   2931  C  CA  . ASP B 2 40  ? 21.95509  -33.42668 -28.65949 1.000 59.28754  ? 40  ASP B CA  1 
ATOM   2932  C  C   . ASP B 2 40  ? 22.38834  -34.81173 -28.19303 1.000 62.94817  ? 40  ASP B C   1 
ATOM   2933  O  O   . ASP B 2 40  ? 21.63749  -35.77990 -28.35920 1.000 66.02135  ? 40  ASP B O   1 
ATOM   2934  C  CB  . ASP B 2 40  ? 22.36777  -33.18906 -30.11131 1.000 61.70723  ? 40  ASP B CB  1 
ATOM   2935  C  CG  . ASP B 2 40  ? 21.55775  -32.08136 -30.77430 1.000 72.82616  ? 40  ASP B CG  1 
ATOM   2936  O  OD1 . ASP B 2 40  ? 20.59266  -31.58124 -30.15171 1.000 72.73602  ? 40  ASP B OD1 1 
ATOM   2937  O  OD2 . ASP B 2 40  ? 21.88512  -31.71487 -31.92353 1.000 59.15326  ? 40  ASP B OD2 1 
ATOM   2938  N  N   . ILE B 2 41  ? 23.59068  -34.93508 -27.62662 1.000 64.87798  ? 41  ILE B N   1 
ATOM   2939  C  CA  . ILE B 2 41  ? 24.00733  -36.21482 -27.05765 1.000 67.03048  ? 41  ILE B CA  1 
ATOM   2940  C  C   . ILE B 2 41  ? 23.09385  -36.59443 -25.89919 1.000 68.27608  ? 41  ILE B C   1 
ATOM   2941  O  O   . ILE B 2 41  ? 22.62932  -37.73571 -25.79810 1.000 72.81182  ? 41  ILE B O   1 
ATOM   2942  C  CB  . ILE B 2 41  ? 25.48197  -36.15741 -26.61940 1.000 68.63202  ? 41  ILE B CB  1 
ATOM   2943  C  CG1 . ILE B 2 41  ? 26.37329  -35.74374 -27.79255 1.000 61.53131  ? 41  ILE B CG1 1 
ATOM   2944  C  CG2 . ILE B 2 41  ? 25.92263  -37.49953 -26.05577 1.000 67.59235  ? 41  ILE B CG2 1 
ATOM   2945  C  CD1 . ILE B 2 41  ? 26.40209  -36.75228 -28.92300 1.000 64.80949  ? 41  ILE B CD1 1 
ATOM   2946  N  N   . HIS B 2 42  ? 22.82001  -35.63580 -25.00937 1.000 67.52370  ? 42  HIS B N   1 
ATOM   2947  C  CA  . HIS B 2 42  ? 21.91084  -35.88544 -23.89419 1.000 78.73853  ? 42  HIS B CA  1 
ATOM   2948  C  C   . HIS B 2 42  ? 20.50371  -36.20255 -24.38730 1.000 76.12532  ? 42  HIS B C   1 
ATOM   2949  O  O   . HIS B 2 42  ? 19.80095  -37.03009 -23.79485 1.000 79.32667  ? 42  HIS B O   1 
ATOM   2950  C  CB  . HIS B 2 42  ? 21.89245  -34.67994 -22.95347 1.000 80.82350  ? 42  HIS B CB  1 
ATOM   2951  C  CG  . HIS B 2 42  ? 23.18133  -34.46501 -22.22197 1.000 94.39521  ? 42  HIS B CG  1 
ATOM   2952  N  ND1 . HIS B 2 42  ? 23.53701  -33.24709 -21.68199 1.000 98.74644  ? 42  HIS B ND1 1 
ATOM   2953  C  CD2 . HIS B 2 42  ? 24.19962  -35.31286 -21.94145 1.000 88.70865  ? 42  HIS B CD2 1 
ATOM   2954  C  CE1 . HIS B 2 42  ? 24.71904  -33.35384 -21.10146 1.000 102.07152 ? 42  HIS B CE1 1 
ATOM   2955  N  NE2 . HIS B 2 42  ? 25.14260  -34.59724 -21.24409 1.000 95.69765  ? 42  HIS B NE2 1 
ATOM   2956  N  N   . THR B 2 43  ? 20.07629  -35.55213 -25.47256 1.000 69.51867  ? 43  THR B N   1 
ATOM   2957  C  CA  . THR B 2 43  ? 18.73579  -35.78203 -26.00237 1.000 70.27438  ? 43  THR B CA  1 
ATOM   2958  C  C   . THR B 2 43  ? 18.59167  -37.19618 -26.54847 1.000 74.73249  ? 43  THR B C   1 
ATOM   2959  O  O   . THR B 2 43  ? 17.56402  -37.85047 -26.33346 1.000 79.79024  ? 43  THR B O   1 
ATOM   2960  C  CB  . THR B 2 43  ? 18.42279  -34.75614 -27.09572 1.000 67.29188  ? 43  THR B CB  1 
ATOM   2961  O  OG1 . THR B 2 43  ? 18.26022  -33.45685 -26.51312 1.000 67.31766  ? 43  THR B OG1 1 
ATOM   2962  C  CG2 . THR B 2 43  ? 17.16035  -35.13807 -27.85756 1.000 72.05845  ? 43  THR B CG2 1 
ATOM   2963  N  N   . VAL B 2 44  ? 19.61722  -37.68937 -27.24033 1.000 72.17918  ? 44  VAL B N   1 
ATOM   2964  C  CA  . VAL B 2 44  ? 19.52296  -38.98469 -27.90328 1.000 74.35183  ? 44  VAL B CA  1 
ATOM   2965  C  C   . VAL B 2 44  ? 19.72598  -40.12507 -26.91365 1.000 72.73077  ? 44  VAL B C   1 
ATOM   2966  O  O   . VAL B 2 44  ? 18.90384  -41.04450 -26.82765 1.000 79.88240  ? 44  VAL B O   1 
ATOM   2967  C  CB  . VAL B 2 44  ? 20.53183  -39.06112 -29.06384 1.000 74.88154  ? 44  VAL B CB  1 
ATOM   2968  C  CG1 . VAL B 2 44  ? 20.58975  -40.47570 -29.62070 1.000 66.04862  ? 44  VAL B CG1 1 
ATOM   2969  C  CG2 . VAL B 2 44  ? 20.15972  -38.06409 -30.15429 1.000 60.66648  ? 44  VAL B CG2 1 
ATOM   2970  N  N   . PHE B 2 45  ? 20.82362  -40.09176 -26.15841 1.000 69.27386  ? 45  PHE B N   1 
ATOM   2971  C  CA  . PHE B 2 45  ? 21.24450  -41.25330 -25.38661 1.000 80.82225  ? 45  PHE B CA  1 
ATOM   2972  C  C   . PHE B 2 45  ? 20.79182  -41.23065 -23.93339 1.000 82.63528  ? 45  PHE B C   1 
ATOM   2973  O  O   . PHE B 2 45  ? 20.79681  -42.28413 -23.28628 1.000 89.36896  ? 45  PHE B O   1 
ATOM   2974  C  CB  . PHE B 2 45  ? 22.77006  -41.38200 -25.43849 1.000 74.86363  ? 45  PHE B CB  1 
ATOM   2975  C  CG  . PHE B 2 45  ? 23.31193  -41.48665 -26.83247 1.000 70.03023  ? 45  PHE B CG  1 
ATOM   2976  C  CD1 . PHE B 2 45  ? 23.29636  -42.69458 -27.50893 1.000 78.18568  ? 45  PHE B CD1 1 
ATOM   2977  C  CD2 . PHE B 2 45  ? 23.82252  -40.37033 -27.47354 1.000 69.84922  ? 45  PHE B CD2 1 
ATOM   2978  C  CE1 . PHE B 2 45  ? 23.78799  -42.78997 -28.79737 1.000 76.79052  ? 45  PHE B CE1 1 
ATOM   2979  C  CE2 . PHE B 2 45  ? 24.31640  -40.45786 -28.76017 1.000 72.56753  ? 45  PHE B CE2 1 
ATOM   2980  C  CZ  . PHE B 2 45  ? 24.29971  -41.67034 -29.42374 1.000 76.60272  ? 45  PHE B CZ  1 
ATOM   2981  N  N   . GLU B 2 46  ? 20.40594  -40.07155 -23.40422 1.000 79.80391  ? 46  GLU B N   1 
ATOM   2982  C  CA  . GLU B 2 46  ? 19.88356  -39.98141 -22.04938 1.000 89.02642  ? 46  GLU B CA  1 
ATOM   2983  C  C   . GLU B 2 46  ? 18.40318  -39.63657 -21.98794 1.000 90.55327  ? 46  GLU B C   1 
ATOM   2984  O  O   . GLU B 2 46  ? 17.81221  -39.72766 -20.90595 1.000 101.60949 ? 46  GLU B O   1 
ATOM   2985  C  CB  . GLU B 2 46  ? 20.68016  -38.95113 -21.23653 1.000 88.89787  ? 46  GLU B CB  1 
ATOM   2986  C  CG  . GLU B 2 46  ? 22.09598  -39.39329 -20.91219 1.000 91.97303  ? 46  GLU B CG  1 
ATOM   2987  C  CD  . GLU B 2 46  ? 22.87218  -38.33991 -20.14868 1.000 116.52338 ? 46  GLU B CD  1 
ATOM   2988  O  OE1 . GLU B 2 46  ? 22.31432  -37.24715 -19.90526 1.000 117.76649 ? 46  GLU B OE1 1 
ATOM   2989  O  OE2 . GLU B 2 46  ? 24.03819  -38.60697 -19.78779 1.000 118.37565 ? 46  GLU B OE2 1 
ATOM   2990  N  N   . GLY B 2 47  ? 17.79145  -39.25462 -23.10513 1.000 84.92054  ? 47  GLY B N   1 
ATOM   2991  C  CA  . GLY B 2 47  ? 16.39365  -38.85179 -23.08585 1.000 92.08716  ? 47  GLY B CA  1 
ATOM   2992  C  C   . GLY B 2 47  ? 16.12676  -37.68537 -22.16113 1.000 99.93140  ? 47  GLY B C   1 
ATOM   2993  O  O   . GLY B 2 47  ? 15.14699  -37.70378 -21.40528 1.000 103.10807 ? 47  GLY B O   1 
ATOM   2994  N  N   . ALA B 2 48  ? 16.98515  -36.66289 -22.20462 1.000 112.06148 ? 48  ALA B N   1 
ATOM   2995  C  CA  . ALA B 2 48  ? 16.89450  -35.55850 -21.25734 1.000 118.51699 ? 48  ALA B CA  1 
ATOM   2996  C  C   . ALA B 2 48  ? 15.71268  -34.64116 -21.54243 1.000 121.29688 ? 48  ALA B C   1 
ATOM   2997  O  O   . ALA B 2 48  ? 15.24394  -33.95575 -20.62682 1.000 123.42037 ? 48  ALA B O   1 
ATOM   2998  C  CB  . ALA B 2 48  ? 18.19774  -34.75762 -21.26075 1.000 105.82728 ? 48  ALA B CB  1 
ATOM   2999  N  N   . ILE B 2 49  ? 15.22142  -34.61267 -22.77830 1.000 105.81410 ? 49  ILE B N   1 
ATOM   3000  C  CA  . ILE B 2 49  ? 14.04749  -33.82654 -23.13405 1.000 107.49235 ? 49  ILE B CA  1 
ATOM   3001  C  C   . ILE B 2 49  ? 12.87929  -34.73367 -23.51457 1.000 102.75739 ? 49  ILE B C   1 
ATOM   3002  O  O   . ILE B 2 49  ? 11.94343  -34.29667 -24.18246 1.000 96.48195  ? 49  ILE B O   1 
ATOM   3003  C  CB  . ILE B 2 49  ? 14.35079  -32.81818 -24.25605 1.000 99.68589  ? 49  ILE B CB  1 
ATOM   3004  C  CG1 . ILE B 2 49  ? 14.76390  -33.53766 -25.54147 1.000 91.05517  ? 49  ILE B CG1 1 
ATOM   3005  C  CG2 . ILE B 2 49  ? 15.42154  -31.83134 -23.82316 1.000 98.32155  ? 49  ILE B CG2 1 
ATOM   3006  C  CD1 . ILE B 2 49  ? 14.86888  -32.61321 -26.73900 1.000 78.31790  ? 49  ILE B CD1 1 
ATOM   3007  N  N   . GLY B 2 50  ? 12.92840  -35.99423 -23.10616 1.000 101.09845 ? 50  GLY B N   1 
ATOM   3008  C  CA  . GLY B 2 50  ? 11.87241  -36.92345 -23.42880 1.000 93.92290  ? 50  GLY B CA  1 
ATOM   3009  C  C   . GLY B 2 50  ? 12.17661  -37.69771 -24.69117 1.000 93.58673  ? 50  GLY B C   1 
ATOM   3010  O  O   . GLY B 2 50  ? 13.25964  -37.61560 -25.27913 1.000 98.13119  ? 50  GLY B O   1 
ATOM   3011  N  N   . GLU B 2 51  ? 11.18315  -38.46694 -25.11765 1.000 91.81737  ? 51  GLU B N   1 
ATOM   3012  C  CA  . GLU B 2 51  ? 11.33187  -39.33021 -26.27754 1.000 95.37412  ? 51  GLU B CA  1 
ATOM   3013  C  C   . GLU B 2 51  ? 10.92596  -38.58396 -27.54136 1.000 91.69353  ? 51  GLU B C   1 
ATOM   3014  O  O   . GLU B 2 51  ? 9.88402   -37.92092 -27.57631 1.000 92.94621  ? 51  GLU B O   1 
ATOM   3015  C  CB  . GLU B 2 51  ? 10.49460  -40.59682 -26.10185 1.000 98.53212  ? 51  GLU B CB  1 
ATOM   3016  C  CG  . GLU B 2 51  ? 10.65300  -41.62107 -27.20551 1.000 102.57461 ? 51  GLU B CG  1 
ATOM   3017  C  CD  . GLU B 2 51  ? 10.13946  -42.98659 -26.79872 1.000 119.46518 ? 51  GLU B CD  1 
ATOM   3018  O  OE1 . GLU B 2 51  ? 10.26704  -43.33971 -25.60667 1.000 119.04846 ? 51  GLU B OE1 1 
ATOM   3019  O  OE2 . GLU B 2 51  ? 9.56114   -43.68453 -27.65791 1.000 128.02511 ? 51  GLU B OE2 1 
ATOM   3020  N  N   . ARG B 2 52  ? 11.75536  -38.69754 -28.57389 1.000 87.58536  ? 52  ARG B N   1 
ATOM   3021  C  CA  . ARG B 2 52  ? 11.48026  -38.14123 -29.88737 1.000 85.43080  ? 52  ARG B CA  1 
ATOM   3022  C  C   . ARG B 2 52  ? 11.52761  -39.25975 -30.91594 1.000 79.06437  ? 52  ARG B C   1 
ATOM   3023  O  O   . ARG B 2 52  ? 12.10916  -40.32321 -30.68196 1.000 85.22991  ? 52  ARG B O   1 
ATOM   3024  C  CB  . ARG B 2 52  ? 12.48729  -37.04719 -30.26959 1.000 79.86577  ? 52  ARG B CB  1 
ATOM   3025  C  CG  . ARG B 2 52  ? 12.55616  -35.87686 -29.30999 1.000 76.18804  ? 52  ARG B CG  1 
ATOM   3026  C  CD  . ARG B 2 52  ? 11.28928  -35.04576 -29.35599 1.000 70.73376  ? 52  ARG B CD  1 
ATOM   3027  N  NE  . ARG B 2 52  ? 11.43796  -33.81043 -28.59701 1.000 79.09116  ? 52  ARG B NE  1 
ATOM   3028  C  CZ  . ARG B 2 52  ? 11.25739  -33.70951 -27.28747 1.000 83.06107  ? 52  ARG B CZ  1 
ATOM   3029  N  NH1 . ARG B 2 52  ? 10.91862  -34.75726 -26.55315 1.000 83.44682  ? 52  ARG B NH1 1 
ATOM   3030  N  NH2 . ARG B 2 52  ? 11.42546  -32.52868 -26.69928 1.000 78.49255  ? 52  ARG B NH2 1 
ATOM   3031  N  N   . HIS B 2 53  ? 10.91082  -39.00903 -32.06616 1.000 72.33759  ? 53  HIS B N   1 
ATOM   3032  C  CA  . HIS B 2 53  ? 10.84404  -39.99393 -33.13997 1.000 78.35545  ? 53  HIS B CA  1 
ATOM   3033  C  C   . HIS B 2 53  ? 11.19448  -39.33464 -34.46532 1.000 69.66300  ? 53  HIS B C   1 
ATOM   3034  O  O   . HIS B 2 53  ? 10.46242  -38.45936 -34.94063 1.000 62.91698  ? 53  HIS B O   1 
ATOM   3035  C  CB  . HIS B 2 53  ? 9.46390   -40.64983 -33.20653 1.000 76.02029  ? 53  HIS B CB  1 
ATOM   3036  C  CG  . HIS B 2 53  ? 9.14451   -41.50434 -32.01947 1.000 83.08209  ? 53  HIS B CG  1 
ATOM   3037  N  ND1 . HIS B 2 53  ? 9.73347   -42.73306 -31.80991 1.000 89.54022  ? 53  HIS B ND1 1 
ATOM   3038  C  CD2 . HIS B 2 53  ? 8.29711   -41.31149 -30.98113 1.000 88.18016  ? 53  HIS B CD2 1 
ATOM   3039  C  CE1 . HIS B 2 53  ? 9.26341   -43.26012 -30.69364 1.000 90.82171  ? 53  HIS B CE1 1 
ATOM   3040  N  NE2 . HIS B 2 53  ? 8.39033   -42.41767 -30.17114 1.000 102.83326 ? 53  HIS B NE2 1 
ATOM   3041  N  N   . ASN B 2 54  ? 12.31824  -39.75580 -35.04863 1.000 65.01707  ? 54  ASN B N   1 
ATOM   3042  C  CA  . ASN B 2 54  ? 12.70481  -39.36284 -36.40232 1.000 65.09506  ? 54  ASN B CA  1 
ATOM   3043  C  C   . ASN B 2 54  ? 12.84215  -37.84876 -36.52817 1.000 59.48153  ? 54  ASN B C   1 
ATOM   3044  O  O   . ASN B 2 54  ? 12.39152  -37.24175 -37.50212 1.000 54.74287  ? 54  ASN B O   1 
ATOM   3045  C  CB  . ASN B 2 54  ? 11.67289  -39.90236 -37.38621 1.000 61.52261  ? 54  ASN B CB  1 
ATOM   3046  C  CG  . ASN B 2 54  ? 11.59572  -41.41091 -37.35708 1.000 69.11077  ? 54  ASN B CG  1 
ATOM   3047  O  OD1 . ASN B 2 54  ? 12.44319  -42.07875 -36.76250 1.000 75.21257  ? 54  ASN B OD1 1 
ATOM   3048  N  ND2 . ASN B 2 54  ? 10.50823  -41.94583 -37.87694 1.000 66.46838  ? 54  ASN B ND2 1 
ATOM   3049  N  N   . MET B 2 55  ? 13.48936  -37.24000 -35.54029 1.000 53.23193  ? 55  MET B N   1 
ATOM   3050  C  CA  . MET B 2 55  ? 13.71831  -35.80315 -35.50549 1.000 55.81279  ? 55  MET B CA  1 
ATOM   3051  C  C   . MET B 2 55  ? 15.14896  -35.49935 -35.93183 1.000 53.24184  ? 55  MET B C   1 
ATOM   3052  O  O   . MET B 2 55  ? 16.10023  -36.01517 -35.33536 1.000 53.06286  ? 55  MET B O   1 
ATOM   3053  C  CB  . MET B 2 55  ? 13.44966  -35.25988 -34.10433 1.000 56.96912  ? 55  MET B CB  1 
ATOM   3054  C  CG  . MET B 2 55  ? 13.79029  -33.80022 -33.93191 1.000 57.05742  ? 55  MET B CG  1 
ATOM   3055  S  SD  . MET B 2 55  ? 13.80810  -33.35289 -32.19113 1.000 68.38813  ? 55  MET B SD  1 
ATOM   3056  C  CE  . MET B 2 55  ? 15.14879  -34.38059 -31.59353 1.000 55.75705  ? 55  MET B CE  1 
ATOM   3057  N  N   . ILE B 2 56  ? 15.29719  -34.65446 -36.95236 1.000 53.54491  ? 56  ILE B N   1 
ATOM   3058  C  CA  . ILE B 2 56  ? 16.62185  -34.25668 -37.41322 1.000 45.34358  ? 56  ILE B CA  1 
ATOM   3059  C  C   . ILE B 2 56  ? 17.30778  -33.44412 -36.32464 1.000 46.93157  ? 56  ILE B C   1 
ATOM   3060  O  O   . ILE B 2 56  ? 16.69908  -32.56000 -35.70814 1.000 52.69867  ? 56  ILE B O   1 
ATOM   3061  C  CB  . ILE B 2 56  ? 16.51805  -33.47423 -38.73036 1.000 45.53971  ? 56  ILE B CB  1 
ATOM   3062  C  CG1 . ILE B 2 56  ? 15.92740  -34.37116 -39.82226 1.000 44.07497  ? 56  ILE B CG1 1 
ATOM   3063  C  CG2 . ILE B 2 56  ? 17.87846  -32.94712 -39.15768 1.000 41.24785  ? 56  ILE B CG2 1 
ATOM   3064  C  CD1 . ILE B 2 56  ? 15.82572  -33.70382 -41.17106 1.000 42.10291  ? 56  ILE B CD1 1 
ATOM   3065  N  N   . LEU B 2 57  ? 18.57894  -33.74775 -36.07719 1.000 48.51462  ? 57  LEU B N   1 
ATOM   3066  C  CA  . LEU B 2 57  ? 19.32106  -33.16535 -34.97207 1.000 46.65585  ? 57  LEU B CA  1 
ATOM   3067  C  C   . LEU B 2 57  ? 20.01464  -31.87249 -35.40531 1.000 40.24008  ? 57  LEU B C   1 
ATOM   3068  O  O   . LEU B 2 57  ? 19.95822  -31.46258 -36.56605 1.000 44.37481  ? 57  LEU B O   1 
ATOM   3069  C  CB  . LEU B 2 57  ? 20.32414  -34.18542 -34.43514 1.000 40.78384  ? 57  LEU B CB  1 
ATOM   3070  C  CG  . LEU B 2 57  ? 19.71050  -35.44984 -33.82544 1.000 45.82333  ? 57  LEU B CG  1 
ATOM   3071  C  CD1 . LEU B 2 57  ? 20.71234  -36.59306 -33.80272 1.000 51.16821  ? 57  LEU B CD1 1 
ATOM   3072  C  CD2 . LEU B 2 57  ? 19.19892  -35.16240 -32.42292 1.000 55.09976  ? 57  LEU B CD2 1 
ATOM   3073  N  N   . GLY B 2 58  ? 20.65932  -31.20532 -34.44924 1.000 41.22802  ? 58  GLY B N   1 
ATOM   3074  C  CA  . GLY B 2 58  ? 21.45719  -30.02767 -34.73966 1.000 38.52500  ? 58  GLY B CA  1 
ATOM   3075  C  C   . GLY B 2 58  ? 20.73479  -28.70964 -34.54916 1.000 42.80439  ? 58  GLY B C   1 
ATOM   3076  O  O   . GLY B 2 58  ? 19.59313  -28.55767 -34.99132 1.000 42.88146  ? 58  GLY B O   1 
ATOM   3077  N  N   . HIS B 2 59  ? 21.38991  -27.74224 -33.89653 1.000 42.67023  ? 59  HIS B N   1 
ATOM   3078  C  CA  . HIS B 2 59  ? 20.81209  -26.41283 -33.74382 1.000 40.83007  ? 59  HIS B CA  1 
ATOM   3079  C  C   . HIS B 2 59  ? 21.84659  -25.30693 -33.91710 1.000 42.72345  ? 59  HIS B C   1 
ATOM   3080  O  O   . HIS B 2 59  ? 21.54420  -24.14439 -33.61752 1.000 36.45426  ? 59  HIS B O   1 
ATOM   3081  C  CB  . HIS B 2 59  ? 20.12949  -26.26071 -32.37782 1.000 42.70348  ? 59  HIS B CB  1 
ATOM   3082  C  CG  . HIS B 2 59  ? 20.98797  -26.67097 -31.22621 1.000 39.71816  ? 59  HIS B CG  1 
ATOM   3083  N  ND1 . HIS B 2 59  ? 20.82023  -27.86527 -30.55966 1.000 48.65534  ? 59  HIS B ND1 1 
ATOM   3084  C  CD2 . HIS B 2 59  ? 22.02268  -26.04280 -30.62047 1.000 42.82170  ? 59  HIS B CD2 1 
ATOM   3085  C  CE1 . HIS B 2 59  ? 21.71762  -27.95680 -29.59423 1.000 60.69518  ? 59  HIS B CE1 1 
ATOM   3086  N  NE2 . HIS B 2 59  ? 22.45882  -26.86324 -29.60916 1.000 42.18258  ? 59  HIS B NE2 1 
ATOM   3087  N  N   . GLU B 2 60  ? 23.05704  -25.62470 -34.36495 1.000 41.43649  ? 60  GLU B N   1 
ATOM   3088  C  CA  . GLU B 2 60  ? 24.10428  -24.63353 -34.59082 1.000 43.71899  ? 60  GLU B CA  1 
ATOM   3089  C  C   . GLU B 2 60  ? 24.46181  -24.66481 -36.06743 1.000 43.14027  ? 60  GLU B C   1 
ATOM   3090  O  O   . GLU B 2 60  ? 25.03775  -25.64720 -36.54733 1.000 42.52558  ? 60  GLU B O   1 
ATOM   3091  C  CB  . GLU B 2 60  ? 25.32780  -24.91955 -33.72863 1.000 36.59631  ? 60  GLU B CB  1 
ATOM   3092  C  CG  . GLU B 2 60  ? 24.99274  -25.27292 -32.30323 1.000 42.45109  ? 60  GLU B CG  1 
ATOM   3093  C  CD  . GLU B 2 60  ? 26.22848  -25.53316 -31.47350 1.000 49.10553  ? 60  GLU B CD  1 
ATOM   3094  O  OE1 . GLU B 2 60  ? 27.11749  -24.65412 -31.42758 1.000 54.67217  ? 60  GLU B OE1 1 
ATOM   3095  O  OE2 . GLU B 2 60  ? 26.31682  -26.62298 -30.87719 1.000 56.18258  ? 60  GLU B OE2 1 
ATOM   3096  N  N   . ALA B 2 61  ? 24.14835  -23.58986 -36.78603 1.000 34.83931  ? 61  ALA B N   1 
ATOM   3097  C  CA  . ALA B 2 61  ? 24.34750  -23.61427 -38.22532 1.000 43.21048  ? 61  ALA B CA  1 
ATOM   3098  C  C   . ALA B 2 61  ? 24.56030  -22.21638 -38.77560 1.000 36.12027  ? 61  ALA B C   1 
ATOM   3099  O  O   . ALA B 2 61  ? 23.89448  -21.26047 -38.36994 1.000 44.01868  ? 61  ALA B O   1 
ATOM   3100  C  CB  . ALA B 2 61  ? 23.15721  -24.25756 -38.94199 1.000 41.58940  ? 61  ALA B CB  1 
ATOM   3101  N  N   . VAL B 2 62  ? 25.50823  -22.11914 -39.69702 1.000 39.43273  ? 62  VAL B N   1 
ATOM   3102  C  CA  . VAL B 2 62  ? 25.62536  -21.00272 -40.61962 1.000 46.13810  ? 62  VAL B CA  1 
ATOM   3103  C  C   . VAL B 2 62  ? 25.17428  -21.51333 -41.97933 1.000 45.24450  ? 62  VAL B C   1 
ATOM   3104  O  O   . VAL B 2 62  ? 25.56510  -22.61068 -42.39319 1.000 47.42939  ? 62  VAL B O   1 
ATOM   3105  C  CB  . VAL B 2 62  ? 27.06429  -20.46738 -40.67231 1.000 41.01094  ? 62  VAL B CB  1 
ATOM   3106  C  CG1 . VAL B 2 62  ? 27.19289  -19.42411 -41.76143 1.000 48.82985  ? 62  VAL B CG1 1 
ATOM   3107  C  CG2 . VAL B 2 62  ? 27.45861  -19.88971 -39.32065 1.000 46.55241  ? 62  VAL B CG2 1 
ATOM   3108  N  N   . GLY B 2 63  ? 24.34059  -20.74084 -42.66804 1.000 38.63892  ? 63  GLY B N   1 
ATOM   3109  C  CA  . GLY B 2 63  ? 23.78679  -21.24993 -43.90243 1.000 48.92205  ? 63  GLY B CA  1 
ATOM   3110  C  C   . GLY B 2 63  ? 23.58738  -20.17637 -44.94713 1.000 45.57309  ? 63  GLY B C   1 
ATOM   3111  O  O   . GLY B 2 63  ? 23.94206  -19.01130 -44.75846 1.000 41.31655  ? 63  GLY B O   1 
ATOM   3112  N  N   . GLU B 2 64  ? 23.02244  -20.59868 -46.07332 1.000 49.89996  ? 64  GLU B N   1 
ATOM   3113  C  CA  . GLU B 2 64  ? 22.67183  -19.71172 -47.17121 1.000 52.28790  ? 64  GLU B CA  1 
ATOM   3114  C  C   . GLU B 2 64  ? 21.16894  -19.78346 -47.39720 1.000 43.07401  ? 64  GLU B C   1 
ATOM   3115  O  O   . GLU B 2 64  ? 20.60772  -20.87688 -47.52470 1.000 45.17898  ? 64  GLU B O   1 
ATOM   3116  C  CB  . GLU B 2 64  ? 23.42431  -20.09350 -48.44987 1.000 45.37749  ? 64  GLU B CB  1 
ATOM   3117  C  CG  . GLU B 2 64  ? 23.03174  -19.27870 -49.66875 1.000 51.40159  ? 64  GLU B CG  1 
ATOM   3118  C  CD  . GLU B 2 64  ? 23.67711  -19.78729 -50.94104 1.000 67.23952  ? 64  GLU B CD  1 
ATOM   3119  O  OE1 . GLU B 2 64  ? 23.53456  -20.99218 -51.24260 1.000 73.76958  ? 64  GLU B OE1 1 
ATOM   3120  O  OE2 . GLU B 2 64  ? 24.33066  -18.98368 -51.63881 1.000 85.99701  ? 64  GLU B OE2 1 
ATOM   3121  N  N   . VAL B 2 65  ? 20.52399  -18.61926 -47.45236 1.000 46.89983  ? 65  VAL B N   1 
ATOM   3122  C  CA  . VAL B 2 65  ? 19.09192  -18.56278 -47.71518 1.000 43.74660  ? 65  VAL B CA  1 
ATOM   3123  C  C   . VAL B 2 65  ? 18.82553  -19.02500 -49.13995 1.000 46.17060  ? 65  VAL B C   1 
ATOM   3124  O  O   . VAL B 2 65  ? 19.46432  -18.55277 -50.08976 1.000 55.14358  ? 65  VAL B O   1 
ATOM   3125  C  CB  . VAL B 2 65  ? 18.56686  -17.13833 -47.48906 1.000 38.48533  ? 65  VAL B CB  1 
ATOM   3126  C  CG1 . VAL B 2 65  ? 17.09041  -17.06572 -47.80462 1.000 38.86406  ? 65  VAL B CG1 1 
ATOM   3127  C  CG2 . VAL B 2 65  ? 18.84089  -16.69213 -46.06252 1.000 33.69653  ? 65  VAL B CG2 1 
ATOM   3128  N  N   . VAL B 2 66  ? 17.88605  -19.95771 -49.30091 1.000 45.83599  ? 66  VAL B N   1 
ATOM   3129  C  CA  . VAL B 2 66  ? 17.50905  -20.42800 -50.62469 1.000 50.97944  ? 66  VAL B CA  1 
ATOM   3130  C  C   . VAL B 2 66  ? 16.08516  -20.02950 -51.01007 1.000 46.71026  ? 66  VAL B C   1 
ATOM   3131  O  O   . VAL B 2 66  ? 15.79533  -19.90294 -52.20567 1.000 52.73605  ? 66  VAL B O   1 
ATOM   3132  C  CB  . VAL B 2 66  ? 17.70097  -21.95612 -50.75326 1.000 47.64896  ? 66  VAL B CB  1 
ATOM   3133  C  CG1 . VAL B 2 66  ? 19.16456  -22.33179 -50.55524 1.000 41.64324  ? 66  VAL B CG1 1 
ATOM   3134  C  CG2 . VAL B 2 66  ? 16.81776  -22.69832 -49.76693 1.000 46.93936  ? 66  VAL B CG2 1 
ATOM   3135  N  N   . GLU B 2 67  ? 15.19544  -19.81582 -50.04385 1.000 48.39305  ? 67  GLU B N   1 
ATOM   3136  C  CA  . GLU B 2 67  ? 13.81380  -19.45390 -50.32838 1.000 45.60945  ? 67  GLU B CA  1 
ATOM   3137  C  C   . GLU B 2 67  ? 13.25605  -18.67631 -49.14639 1.000 45.78545  ? 67  GLU B C   1 
ATOM   3138  O  O   . GLU B 2 67  ? 13.58413  -18.97336 -47.99514 1.000 45.53322  ? 67  GLU B O   1 
ATOM   3139  C  CB  . GLU B 2 67  ? 12.95291  -20.69337 -50.59285 1.000 50.50638  ? 67  GLU B CB  1 
ATOM   3140  C  CG  . GLU B 2 67  ? 11.54726  -20.38388 -51.07052 1.000 46.61380  ? 67  GLU B CG  1 
ATOM   3141  C  CD  . GLU B 2 67  ? 10.69665  -21.63190 -51.20308 1.000 68.47807  ? 67  GLU B CD  1 
ATOM   3142  O  OE1 . GLU B 2 67  ? 11.25737  -22.74454 -51.08625 1.000 66.69984  ? 67  GLU B OE1 1 
ATOM   3143  O  OE2 . GLU B 2 67  ? 9.46999   -21.49993 -51.41665 1.000 67.75610  ? 67  GLU B OE2 1 
ATOM   3144  N  N   . VAL B 2 68  ? 12.41722  -17.67936 -49.43525 1.000 46.84941  ? 68  VAL B N   1 
ATOM   3145  C  CA  . VAL B 2 68  ? 11.77738  -16.87549 -48.40315 1.000 45.62542  ? 68  VAL B CA  1 
ATOM   3146  C  C   . VAL B 2 68  ? 10.29333  -16.74512 -48.71573 1.000 46.40233  ? 68  VAL B C   1 
ATOM   3147  O  O   . VAL B 2 68  ? 9.86005   -16.86466 -49.86329 1.000 47.42622  ? 68  VAL B O   1 
ATOM   3148  C  CB  . VAL B 2 68  ? 12.41493  -15.47778 -48.26649 1.000 45.94835  ? 68  VAL B CB  1 
ATOM   3149  C  CG1 . VAL B 2 68  ? 13.83012  -15.58970 -47.73292 1.000 41.58627  ? 68  VAL B CG1 1 
ATOM   3150  C  CG2 . VAL B 2 68  ? 12.39239  -14.75417 -49.60452 1.000 39.92438  ? 68  VAL B CG2 1 
ATOM   3151  N  N   . GLY B 2 69  ? 9.51388   -16.47777 -47.67296 1.000 47.28225  ? 69  GLY B N   1 
ATOM   3152  C  CA  . GLY B 2 69  ? 8.10260   -16.22412 -47.85769 1.000 41.53281  ? 69  GLY B CA  1 
ATOM   3153  C  C   . GLY B 2 69  ? 7.85010   -14.87690 -48.50434 1.000 46.00188  ? 69  GLY B C   1 
ATOM   3154  O  O   . GLY B 2 69  ? 8.73297   -14.02661 -48.63118 1.000 46.90236  ? 69  GLY B O   1 
ATOM   3155  N  N   . SER B 2 70  ? 6.59410   -14.67525 -48.90684 1.000 49.65367  ? 70  SER B N   1 
ATOM   3156  C  CA  . SER B 2 70  ? 6.23013   -13.45779 -49.62169 1.000 47.47665  ? 70  SER B CA  1 
ATOM   3157  C  C   . SER B 2 70  ? 6.35499   -12.21076 -48.75552 1.000 48.99451  ? 70  SER B C   1 
ATOM   3158  O  O   . SER B 2 70  ? 6.44870   -11.10540 -49.29848 1.000 60.85535  ? 70  SER B O   1 
ATOM   3159  C  CB  . SER B 2 70  ? 4.80695   -13.57777 -50.17399 1.000 51.09166  ? 70  SER B CB  1 
ATOM   3160  O  OG  . SER B 2 70  ? 3.87130   -13.85235 -49.14458 1.000 59.03619  ? 70  SER B OG  1 
ATOM   3161  N  N   . GLU B 2 71  ? 6.36900   -12.35817 -47.43189 1.000 52.01122  ? 71  GLU B N   1 
ATOM   3162  C  CA  . GLU B 2 71  ? 6.42261   -11.22246 -46.52078 1.000 49.16850  ? 71  GLU B CA  1 
ATOM   3163  C  C   . GLU B 2 71  ? 7.80526   -10.99231 -45.92608 1.000 52.67327  ? 71  GLU B C   1 
ATOM   3164  O  O   . GLU B 2 71  ? 7.98344   -10.03594 -45.16515 1.000 49.14720  ? 71  GLU B O   1 
ATOM   3165  C  CB  . GLU B 2 71  ? 5.40196   -11.40429 -45.39292 1.000 43.26731  ? 71  GLU B CB  1 
ATOM   3166  C  CG  . GLU B 2 71  ? 3.96957   -11.55796 -45.87780 1.000 49.47592  ? 71  GLU B CG  1 
ATOM   3167  C  CD  . GLU B 2 71  ? 3.48072   -10.34178 -46.63700 1.000 53.16546  ? 71  GLU B CD  1 
ATOM   3168  O  OE1 . GLU B 2 71  ? 3.70820   -9.21362  -46.14893 1.000 61.40052  ? 71  GLU B OE1 1 
ATOM   3169  O  OE2 . GLU B 2 71  ? 2.87452   -10.51118 -47.71896 1.000 68.37399  ? 71  GLU B OE2 1 
ATOM   3170  N  N   . VAL B 2 72  ? 8.78231   -11.84306 -46.23941 1.000 51.91988  ? 72  VAL B N   1 
ATOM   3171  C  CA  . VAL B 2 72  ? 10.13895  -11.62667 -45.75255 1.000 49.02567  ? 72  VAL B CA  1 
ATOM   3172  C  C   . VAL B 2 72  ? 10.74714  -10.44272 -46.49035 1.000 43.98286  ? 72  VAL B C   1 
ATOM   3173  O  O   . VAL B 2 72  ? 10.75697  -10.39939 -47.72723 1.000 50.72572  ? 72  VAL B O   1 
ATOM   3174  C  CB  . VAL B 2 72  ? 10.98268  -12.89767 -45.92345 1.000 48.58175  ? 72  VAL B CB  1 
ATOM   3175  C  CG1 . VAL B 2 72  ? 12.43001  -12.62168 -45.57164 1.000 44.72613  ? 72  VAL B CG1 1 
ATOM   3176  C  CG2 . VAL B 2 72  ? 10.43024  -14.00841 -45.04380 1.000 46.52256  ? 72  VAL B CG2 1 
ATOM   3177  N  N   . LYS B 2 73  ? 11.25856  -9.47273  -45.73239 1.000 49.86788  ? 73  LYS B N   1 
ATOM   3178  C  CA  . LYS B 2 73  ? 11.70224  -8.20638  -46.30043 1.000 57.20586  ? 73  LYS B CA  1 
ATOM   3179  C  C   . LYS B 2 73  ? 13.20926  -7.99774  -46.27979 1.000 51.21889  ? 73  LYS B C   1 
ATOM   3180  O  O   . LYS B 2 73  ? 13.73712  -7.35766  -47.19134 1.000 50.06894  ? 73  LYS B O   1 
ATOM   3181  C  CB  . LYS B 2 73  ? 11.03059  -7.03581  -45.56833 1.000 51.38959  ? 73  LYS B CB  1 
ATOM   3182  C  CG  . LYS B 2 73  ? 9.50997   -7.04066  -45.68619 1.000 62.67096  ? 73  LYS B CG  1 
ATOM   3183  C  CD  . LYS B 2 73  ? 9.06966   -6.92205  -47.14138 1.000 66.88085  ? 73  LYS B CD  1 
ATOM   3184  C  CE  . LYS B 2 73  ? 7.55288   -6.92157  -47.27016 1.000 63.31737  ? 73  LYS B CE  1 
ATOM   3185  N  NZ  . LYS B 2 73  ? 7.12387   -6.92927  -48.69795 1.000 67.06817  ? 73  LYS B NZ  1 
ATOM   3186  N  N   . ASP B 2 74  ? 13.91702  -8.51503  -45.27805 1.000 42.54987  ? 74  ASP B N   1 
ATOM   3187  C  CA  . ASP B 2 74  ? 15.33075  -8.20848  -45.10330 1.000 48.52631  ? 74  ASP B CA  1 
ATOM   3188  C  C   . ASP B 2 74  ? 16.26233  -9.31934  -45.57395 1.000 45.58268  ? 74  ASP B C   1 
ATOM   3189  O  O   . ASP B 2 74  ? 17.48379  -9.16321  -45.47622 1.000 43.55991  ? 74  ASP B O   1 
ATOM   3190  C  CB  . ASP B 2 74  ? 15.61779  -7.88504  -43.63215 1.000 43.94643  ? 74  ASP B CB  1 
ATOM   3191  C  CG  . ASP B 2 74  ? 14.93764  -6.60826  -43.17425 1.000 48.02837  ? 74  ASP B CG  1 
ATOM   3192  O  OD1 . ASP B 2 74  ? 14.56495  -5.78977  -44.04389 1.000 47.05067  ? 74  ASP B OD1 1 
ATOM   3193  O  OD2 . ASP B 2 74  ? 14.77806  -6.42112  -41.94716 1.000 53.29763  ? 74  ASP B OD2 1 
ATOM   3194  N  N   . PHE B 2 75  ? 15.72987  -10.42383 -46.09058 1.000 44.52564  ? 75  PHE B N   1 
ATOM   3195  C  CA  . PHE B 2 75  ? 16.55516  -11.53876 -46.53217 1.000 38.99742  ? 75  PHE B CA  1 
ATOM   3196  C  C   . PHE B 2 75  ? 16.01401  -12.08113 -47.84472 1.000 47.01483  ? 75  PHE B C   1 
ATOM   3197  O  O   . PHE B 2 75  ? 14.79856  -12.17432 -48.03667 1.000 52.44635  ? 75  PHE B O   1 
ATOM   3198  C  CB  . PHE B 2 75  ? 16.61886  -12.65093 -45.47631 1.000 39.22768  ? 75  PHE B CB  1 
ATOM   3199  C  CG  . PHE B 2 75  ? 17.27891  -12.22664 -44.19142 1.000 44.66054  ? 75  PHE B CG  1 
ATOM   3200  C  CD1 . PHE B 2 75  ? 18.65703  -12.25941 -44.06425 1.000 42.36901  ? 75  PHE B CD1 1 
ATOM   3201  C  CD2 . PHE B 2 75  ? 16.52477  -11.79040 -43.11571 1.000 41.88982  ? 75  PHE B CD2 1 
ATOM   3202  C  CE1 . PHE B 2 75  ? 19.27262  -11.86563 -42.88975 1.000 38.83719  ? 75  PHE B CE1 1 
ATOM   3203  C  CE2 . PHE B 2 75  ? 17.13635  -11.39634 -41.93639 1.000 43.38186  ? 75  PHE B CE2 1 
ATOM   3204  C  CZ  . PHE B 2 75  ? 18.51176  -11.43401 -41.82504 1.000 34.73460  ? 75  PHE B CZ  1 
ATOM   3205  N  N   . LYS B 2 76  ? 16.92614  -12.41345 -48.74558 1.000 43.61263  ? 76  LYS B N   1 
ATOM   3206  C  CA  . LYS B 2 76  ? 16.64197  -12.89784 -50.08515 1.000 42.85525  ? 76  LYS B CA  1 
ATOM   3207  C  C   . LYS B 2 76  ? 17.48502  -14.13211 -50.36513 1.000 52.55833  ? 76  LYS B C   1 
ATOM   3208  O  O   . LYS B 2 76  ? 18.46455  -14.39513 -49.65796 1.000 50.88090  ? 76  LYS B O   1 
ATOM   3209  C  CB  . LYS B 2 76  ? 16.93538  -11.80068 -51.12052 1.000 47.17647  ? 76  LYS B CB  1 
ATOM   3210  C  CG  . LYS B 2 76  ? 18.35285  -11.24964 -51.04493 1.000 53.13610  ? 76  LYS B CG  1 
ATOM   3211  C  CD  . LYS B 2 76  ? 18.52223  -10.01210 -51.91681 1.000 71.90111  ? 76  LYS B CD  1 
ATOM   3212  C  CE  . LYS B 2 76  ? 19.82391  -9.27608  -51.60477 1.000 67.55019  ? 76  LYS B CE  1 
ATOM   3213  N  NZ  . LYS B 2 76  ? 21.03139  -10.12041 -51.82072 1.000 71.68465  ? 76  LYS B NZ  1 
ATOM   3214  N  N   . PRO B 2 77  ? 17.11467  -14.92880 -51.37013 1.000 48.15685  ? 77  PRO B N   1 
ATOM   3215  C  CA  . PRO B 2 77  ? 17.94393  -16.08596 -51.73941 1.000 49.47907  ? 77  PRO B CA  1 
ATOM   3216  C  C   . PRO B 2 77  ? 19.36817  -15.67209 -52.08422 1.000 49.57818  ? 77  PRO B C   1 
ATOM   3217  O  O   . PRO B 2 77  ? 19.59436  -14.74652 -52.86774 1.000 56.38331  ? 77  PRO B O   1 
ATOM   3218  C  CB  . PRO B 2 77  ? 17.21587  -16.66485 -52.95751 1.000 45.73178  ? 77  PRO B CB  1 
ATOM   3219  C  CG  . PRO B 2 77  ? 15.79851  -16.27210 -52.75674 1.000 53.40436  ? 77  PRO B CG  1 
ATOM   3220  C  CD  . PRO B 2 77  ? 15.83595  -14.91519 -52.10546 1.000 51.85333  ? 77  PRO B CD  1 
ATOM   3221  N  N   . GLY B 2 78  ? 20.33324  -16.38504 -51.50495 1.000 44.95586  ? 78  GLY B N   1 
ATOM   3222  C  CA  . GLY B 2 78  ? 21.73758  -16.09564 -51.69789 1.000 45.40639  ? 78  GLY B CA  1 
ATOM   3223  C  C   . GLY B 2 78  ? 22.41608  -15.41719 -50.52671 1.000 53.55847  ? 78  GLY B C   1 
ATOM   3224  O  O   . GLY B 2 78  ? 23.65112  -15.33039 -50.51716 1.000 54.27139  ? 78  GLY B O   1 
ATOM   3225  N  N   . ASP B 2 79  ? 21.65252  -14.93408 -49.54685 1.000 46.19619  ? 79  ASP B N   1 
ATOM   3226  C  CA  . ASP B 2 79  ? 22.24037  -14.27874 -48.38530 1.000 43.47313  ? 79  ASP B CA  1 
ATOM   3227  C  C   . ASP B 2 79  ? 22.86397  -15.30658 -47.44883 1.000 45.20947  ? 79  ASP B C   1 
ATOM   3228  O  O   . ASP B 2 79  ? 22.22524  -16.29980 -47.08419 1.000 44.95928  ? 79  ASP B O   1 
ATOM   3229  C  CB  . ASP B 2 79  ? 21.18405  -13.47195 -47.62918 1.000 40.00699  ? 79  ASP B CB  1 
ATOM   3230  C  CG  . ASP B 2 79  ? 20.69341  -12.27073 -48.40726 1.000 46.27018  ? 79  ASP B CG  1 
ATOM   3231  O  OD1 . ASP B 2 79  ? 21.35456  -11.88493 -49.39391 1.000 54.65665  ? 79  ASP B OD1 1 
ATOM   3232  O  OD2 . ASP B 2 79  ? 19.65459  -11.69588 -48.01481 1.000 53.12448  ? 79  ASP B OD2 1 
ATOM   3233  N  N   . ARG B 2 80  ? 24.11000  -15.06103 -47.05153 1.000 36.49966  ? 80  ARG B N   1 
ATOM   3234  C  CA  . ARG B 2 80  ? 24.76301  -15.88193 -46.04095 1.000 41.27740  ? 80  ARG B CA  1 
ATOM   3235  C  C   . ARG B 2 80  ? 24.37485  -15.37157 -44.66071 1.000 44.31135  ? 80  ARG B C   1 
ATOM   3236  O  O   . ARG B 2 80  ? 24.49950  -14.17578 -44.37573 1.000 47.67180  ? 80  ARG B O   1 
ATOM   3237  C  CB  . ARG B 2 80  ? 26.27896  -15.85140 -46.22870 1.000 45.04181  ? 80  ARG B CB  1 
ATOM   3238  C  CG  . ARG B 2 80  ? 26.72247  -16.34052 -47.60683 1.000 67.58943  ? 80  ARG B CG  1 
ATOM   3239  C  CD  . ARG B 2 80  ? 28.15042  -15.92392 -47.92133 1.000 78.20832  ? 80  ARG B CD  1 
ATOM   3240  N  NE  . ARG B 2 80  ? 29.11011  -16.51415 -46.99636 1.000 88.86036  ? 80  ARG B NE  1 
ATOM   3241  C  CZ  . ARG B 2 80  ? 29.72490  -17.67226 -47.19518 1.000 84.97098  ? 80  ARG B CZ  1 
ATOM   3242  N  NH1 . ARG B 2 80  ? 29.50092  -18.39686 -48.28071 1.000 76.45690  ? 80  ARG B NH1 1 
ATOM   3243  N  NH2 . ARG B 2 80  ? 30.58651  -18.11416 -46.28268 1.000 73.41253  ? 80  ARG B NH2 1 
ATOM   3244  N  N   . VAL B 2 81  ? 23.89046  -16.27294 -43.80810 1.000 41.68362  ? 81  VAL B N   1 
ATOM   3245  C  CA  . VAL B 2 81  ? 23.26356  -15.88288 -42.55314 1.000 39.35297  ? 81  VAL B CA  1 
ATOM   3246  C  C   . VAL B 2 81  ? 23.81317  -16.71138 -41.40222 1.000 35.13247  ? 81  VAL B C   1 
ATOM   3247  O  O   . VAL B 2 81  ? 24.24659  -17.85437 -41.57756 1.000 41.71507  ? 81  VAL B O   1 
ATOM   3248  C  CB  . VAL B 2 81  ? 21.72430  -16.02505 -42.61386 1.000 33.15238  ? 81  VAL B CB  1 
ATOM   3249  C  CG1 . VAL B 2 81  ? 21.13041  -15.04111 -43.61002 1.000 35.97921  ? 81  VAL B CG1 1 
ATOM   3250  C  CG2 . VAL B 2 81  ? 21.33824  -17.45349 -42.97197 1.000 34.84770  ? 81  VAL B CG2 1 
ATOM   3251  N  N   . VAL B 2 82  ? 23.80580  -16.10661 -40.21728 1.000 36.81325  ? 82  VAL B N   1 
ATOM   3252  C  CA  . VAL B 2 82  ? 23.99884  -16.80371 -38.95183 1.000 37.86170  ? 82  VAL B CA  1 
ATOM   3253  C  C   . VAL B 2 82  ? 22.62251  -17.10098 -38.37663 1.000 34.59137  ? 82  VAL B C   1 
ATOM   3254  O  O   . VAL B 2 82  ? 21.79135  -16.19489 -38.24300 1.000 37.18226  ? 82  VAL B O   1 
ATOM   3255  C  CB  . VAL B 2 82  ? 24.83433  -15.96281 -37.97102 1.000 44.27485  ? 82  VAL B CB  1 
ATOM   3256  C  CG1 . VAL B 2 82  ? 24.94545  -16.66395 -36.62675 1.000 33.82835  ? 82  VAL B CG1 1 
ATOM   3257  C  CG2 . VAL B 2 82  ? 26.21216  -15.69651 -38.54779 1.000 45.83898  ? 82  VAL B CG2 1 
ATOM   3258  N  N   . VAL B 2 83  ? 22.37329  -18.35993 -38.04623 1.000 34.55065  ? 83  VAL B N   1 
ATOM   3259  C  CA  . VAL B 2 83  ? 21.07308  -18.81057 -37.55997 1.000 35.12518  ? 83  VAL B CA  1 
ATOM   3260  C  C   . VAL B 2 83  ? 21.18748  -19.04911 -36.05943 1.000 34.91789  ? 83  VAL B C   1 
ATOM   3261  O  O   . VAL B 2 83  ? 21.97661  -19.90038 -35.63679 1.000 33.70889  ? 83  VAL B O   1 
ATOM   3262  C  CB  . VAL B 2 83  ? 20.60381  -20.08244 -38.28180 1.000 36.63719  ? 83  VAL B CB  1 
ATOM   3263  C  CG1 . VAL B 2 83  ? 19.19066  -20.44627 -37.84293 1.000 30.42650  ? 83  VAL B CG1 1 
ATOM   3264  C  CG2 . VAL B 2 83  ? 20.67043  -19.89167 -39.79212 1.000 32.06944  ? 83  VAL B CG2 1 
ATOM   3265  N  N   . PRO B 2 84  ? 20.44922  -18.32393 -35.22445 1.000 41.48226  ? 84  PRO B N   1 
ATOM   3266  C  CA  . PRO B 2 84  ? 20.50703  -18.59087 -33.78614 1.000 36.71739  ? 84  PRO B CA  1 
ATOM   3267  C  C   . PRO B 2 84  ? 19.90825  -19.95043 -33.46867 1.000 35.18467  ? 84  PRO B C   1 
ATOM   3268  O  O   . PRO B 2 84  ? 18.97627  -20.41679 -34.12917 1.000 33.74559  ? 84  PRO B O   1 
ATOM   3269  C  CB  . PRO B 2 84  ? 19.67370  -17.45512 -33.17890 1.000 36.60784  ? 84  PRO B CB  1 
ATOM   3270  C  CG  . PRO B 2 84  ? 18.73202  -17.05826 -34.27755 1.000 32.77804  ? 84  PRO B CG  1 
ATOM   3271  C  CD  . PRO B 2 84  ? 19.53010  -17.22095 -35.54626 1.000 36.31228  ? 84  PRO B CD  1 
ATOM   3272  N  N   . ALA B 2 85  ? 20.47729  -20.60019 -32.45011 1.000 40.16834  ? 85  ALA B N   1 
ATOM   3273  C  CA  . ALA B 2 85  ? 19.92936  -21.87188 -31.99239 1.000 33.92649  ? 85  ALA B CA  1 
ATOM   3274  C  C   . ALA B 2 85  ? 18.51352  -21.70129 -31.46437 1.000 37.70971  ? 85  ALA B C   1 
ATOM   3275  O  O   . ALA B 2 85  ? 17.69569  -22.62319 -31.56258 1.000 36.21209  ? 85  ALA B O   1 
ATOM   3276  C  CB  . ALA B 2 85  ? 20.83434  -22.47855 -30.92065 1.000 36.72121  ? 85  ALA B CB  1 
ATOM   3277  N  N   . ALA B 2 86  ? 18.21850  -20.54401 -30.87976 1.000 35.32492  ? 86  ALA B N   1 
ATOM   3278  C  CA  . ALA B 2 86  ? 16.88221  -20.20121 -30.41547 1.000 37.98142  ? 86  ALA B CA  1 
ATOM   3279  C  C   . ALA B 2 86  ? 16.22813  -19.30742 -31.46047 1.000 36.65936  ? 86  ALA B C   1 
ATOM   3280  O  O   . ALA B 2 86  ? 16.72857  -18.21469 -31.74602 1.000 39.86031  ? 86  ALA B O   1 
ATOM   3281  C  CB  . ALA B 2 86  ? 16.93745  -19.50028 -29.05969 1.000 35.22487  ? 86  ALA B CB  1 
ATOM   3282  N  N   . THR B 2 87  ? 15.13248  -19.78646 -32.05346 1.000 38.44633  ? 87  THR B N   1 
ATOM   3283  C  CA  . THR B 2 87  ? 14.37879  -19.05200 -33.06807 1.000 42.02625  ? 87  THR B CA  1 
ATOM   3284  C  C   . THR B 2 87  ? 12.93942  -18.93392 -32.58318 1.000 45.80835  ? 87  THR B C   1 
ATOM   3285  O  O   . THR B 2 87  ? 12.04589  -19.64489 -33.06888 1.000 41.61265  ? 87  THR B O   1 
ATOM   3286  C  CB  . THR B 2 87  ? 14.44725  -19.74360 -34.42743 1.000 35.58911  ? 87  THR B CB  1 
ATOM   3287  O  OG1 . THR B 2 87  ? 13.94154  -21.07883 -34.30900 1.000 37.97619  ? 87  THR B OG1 1 
ATOM   3288  C  CG2 . THR B 2 87  ? 15.88506  -19.79675 -34.92379 1.000 37.51411  ? 87  THR B CG2 1 
ATOM   3289  N  N   . PRO B 2 88  ? 12.67261  -18.03954 -31.64039 1.000 38.63322  ? 88  PRO B N   1 
ATOM   3290  C  CA  . PRO B 2 88  ? 11.35992  -18.01866 -30.99691 1.000 45.41894  ? 88  PRO B CA  1 
ATOM   3291  C  C   . PRO B 2 88  ? 10.29430  -17.38924 -31.87691 1.000 40.97883  ? 88  PRO B C   1 
ATOM   3292  O  O   . PRO B 2 88  ? 10.57483  -16.67684 -32.84232 1.000 37.69919  ? 88  PRO B O   1 
ATOM   3293  C  CB  . PRO B 2 88  ? 11.60044  -17.15993 -29.75156 1.000 39.71474  ? 88  PRO B CB  1 
ATOM   3294  C  CG  . PRO B 2 88  ? 12.66638  -16.21312 -30.17972 1.000 34.30151  ? 88  PRO B CG  1 
ATOM   3295  C  CD  . PRO B 2 88  ? 13.56103  -16.98785 -31.11365 1.000 36.96308  ? 88  PRO B CD  1 
ATOM   3296  N  N   . ASP B 2 89  ? 9.04885   -17.70083 -31.53730 1.000 41.35571  ? 89  ASP B N   1 
ATOM   3297  C  CA  A ASP B 2 89  ? 7.92458   -16.93869 -32.05643 0.431 43.58460  ? 89  ASP B CA  1 
ATOM   3298  C  CA  B ASP B 2 89  ? 7.91690   -16.94151 -32.04945 0.569 43.52532  ? 89  ASP B CA  1 
ATOM   3299  C  C   . ASP B 2 89  ? 7.89480   -15.59080 -31.34838 1.000 49.29128  ? 89  ASP B C   1 
ATOM   3300  O  O   . ASP B 2 89  ? 7.80843   -15.52753 -30.11784 1.000 49.49527  ? 89  ASP B O   1 
ATOM   3301  C  CB  A ASP B 2 89  ? 6.61715   -17.69978 -31.84951 0.431 47.48322  ? 89  ASP B CB  1 
ATOM   3302  C  CB  B ASP B 2 89  ? 6.61422   -17.70424 -31.81213 0.569 47.52647  ? 89  ASP B CB  1 
ATOM   3303  C  CG  A ASP B 2 89  ? 6.55185   -18.98313 -32.66169 0.431 46.55999  ? 89  ASP B CG  1 
ATOM   3304  C  CG  B ASP B 2 89  ? 5.37930   -16.91547 -32.22638 0.569 46.60541  ? 89  ASP B CG  1 
ATOM   3305  O  OD1 A ASP B 2 89  ? 7.02709   -18.98664 -33.81772 0.431 46.43371  ? 89  ASP B OD1 1 
ATOM   3306  O  OD1 B ASP B 2 89  ? 5.50633   -15.93783 -32.99485 0.569 53.35206  ? 89  ASP B OD1 1 
ATOM   3307  O  OD2 A ASP B 2 89  ? 6.02442   -19.99010 -32.14315 0.431 48.08938  ? 89  ASP B OD2 1 
ATOM   3308  O  OD2 B ASP B 2 89  ? 4.27210   -17.27700 -31.77467 0.569 50.31770  ? 89  ASP B OD2 1 
ATOM   3309  N  N   . TRP B 2 90  ? 7.99153   -14.51524 -32.11810 1.000 47.60671  ? 90  TRP B N   1 
ATOM   3310  C  CA  . TRP B 2 90  ? 8.13103   -13.18683 -31.54348 1.000 45.62726  ? 90  TRP B CA  1 
ATOM   3311  C  C   . TRP B 2 90  ? 6.80083   -12.51710 -31.24612 1.000 48.34755  ? 90  TRP B C   1 
ATOM   3312  O  O   . TRP B 2 90  ? 6.78120   -11.32050 -30.94171 1.000 63.61171  ? 90  TRP B O   1 
ATOM   3313  C  CB  . TRP B 2 90  ? 8.97238   -12.31725 -32.47305 1.000 42.64354  ? 90  TRP B CB  1 
ATOM   3314  C  CG  . TRP B 2 90  ? 10.40249  -12.70406 -32.41252 1.000 42.74847  ? 90  TRP B CG  1 
ATOM   3315  C  CD1 . TRP B 2 90  ? 11.06276  -13.54328 -33.25979 1.000 36.15263  ? 90  TRP B CD1 1 
ATOM   3316  C  CD2 . TRP B 2 90  ? 11.35755  -12.28137 -31.43602 1.000 44.17001  ? 90  TRP B CD2 1 
ATOM   3317  N  NE1 . TRP B 2 90  ? 12.37752  -13.66349 -32.87444 1.000 43.00228  ? 90  TRP B NE1 1 
ATOM   3318  C  CE2 . TRP B 2 90  ? 12.58268  -12.89809 -31.75657 1.000 37.70844  ? 90  TRP B CE2 1 
ATOM   3319  C  CE3 . TRP B 2 90  ? 11.29647  -11.43599 -30.32378 1.000 37.03191  ? 90  TRP B CE3 1 
ATOM   3320  C  CZ2 . TRP B 2 90  ? 13.73602  -12.69847 -31.00545 1.000 41.50167  ? 90  TRP B CZ2 1 
ATOM   3321  C  CZ3 . TRP B 2 90  ? 12.44120  -11.23944 -29.57979 1.000 41.06532  ? 90  TRP B CZ3 1 
ATOM   3322  C  CH2 . TRP B 2 90  ? 13.64571  -11.86733 -29.92380 1.000 43.97504  ? 90  TRP B CH2 1 
ATOM   3323  N  N   . ARG B 2 91  ? 5.69541   -13.26083 -31.29843 1.000 53.07361  ? 91  ARG B N   1 
ATOM   3324  C  CA  . ARG B 2 91  ? 4.36132   -12.70668 -31.09233 1.000 51.41543  ? 91  ARG B CA  1 
ATOM   3325  C  C   . ARG B 2 91  ? 3.66076   -13.48413 -29.97095 1.000 49.37480  ? 91  ARG B C   1 
ATOM   3326  O  O   . ARG B 2 91  ? 2.68549   -14.20084 -30.19866 1.000 54.11171  ? 91  ARG B O   1 
ATOM   3327  C  CB  . ARG B 2 91  ? 3.56495   -12.73551 -32.39080 1.000 47.54858  ? 91  ARG B CB  1 
ATOM   3328  C  CG  . ARG B 2 91  ? 4.16793   -11.86397 -33.48621 1.000 55.01327  ? 91  ARG B CG  1 
ATOM   3329  C  CD  . ARG B 2 91  ? 3.34673   -11.91323 -34.76388 1.000 51.13516  ? 91  ARG B CD  1 
ATOM   3330  N  NE  . ARG B 2 91  ? 1.93449   -11.66043 -34.50749 1.000 53.07390  ? 91  ARG B NE  1 
ATOM   3331  C  CZ  . ARG B 2 91  ? 1.00298   -12.60306 -34.44892 1.000 58.12276  ? 91  ARG B CZ  1 
ATOM   3332  N  NH1 . ARG B 2 91  ? 1.29686   -13.87798 -34.65127 1.000 59.52570  ? 91  ARG B NH1 1 
ATOM   3333  N  NH2 . ARG B 2 91  ? -0.25306  -12.25857 -34.17483 1.000 47.71466  ? 91  ARG B NH2 1 
ATOM   3334  N  N   . THR B 2 92  ? 4.17053   -13.33367 -28.74892 1.000 48.54873  ? 92  THR B N   1 
ATOM   3335  C  CA  . THR B 2 92  ? 3.60043   -13.97178 -27.57015 1.000 56.33266  ? 92  THR B CA  1 
ATOM   3336  C  C   . THR B 2 92  ? 3.63767   -12.99004 -26.40823 1.000 60.52400  ? 92  THR B C   1 
ATOM   3337  O  O   . THR B 2 92  ? 4.24226   -11.91750 -26.49088 1.000 61.60112  ? 92  THR B O   1 
ATOM   3338  C  CB  . THR B 2 92  ? 4.35937   -15.24757 -27.17994 1.000 53.70372  ? 92  THR B CB  1 
ATOM   3339  O  OG1 . THR B 2 92  ? 5.72549   -14.91776 -26.89309 1.000 53.95668  ? 92  THR B OG1 1 
ATOM   3340  C  CG2 . THR B 2 92  ? 4.30600   -16.28649 -28.29989 1.000 48.87539  ? 92  THR B CG2 1 
ATOM   3341  N  N   . SER B 2 93  ? 2.99384   -13.37649 -25.30377 1.000 60.51823  ? 93  SER B N   1 
ATOM   3342  C  CA  . SER B 2 93  ? 3.01614   -12.52950 -24.11612 1.000 62.29382  ? 93  SER B CA  1 
ATOM   3343  C  C   . SER B 2 93  ? 4.38414   -12.54590 -23.44655 1.000 59.33309  ? 93  SER B C   1 
ATOM   3344  O  O   . SER B 2 93  ? 4.82033   -11.52253 -22.90778 1.000 62.94127  ? 93  SER B O   1 
ATOM   3345  C  CB  . SER B 2 93  ? 1.93358   -12.96703 -23.12702 1.000 70.50287  ? 93  SER B CB  1 
ATOM   3346  O  OG  . SER B 2 93  ? 2.15037   -14.29400 -22.67884 1.000 76.19125  ? 93  SER B OG  1 
ATOM   3347  N  N   . GLU B 2 94  ? 5.07722   -13.68859 -23.47378 1.000 71.20096  ? 94  GLU B N   1 
ATOM   3348  C  CA  . GLU B 2 94  ? 6.40091   -13.76752 -22.86429 1.000 72.17725  ? 94  GLU B CA  1 
ATOM   3349  C  C   . GLU B 2 94  ? 7.41311   -12.87297 -23.56579 1.000 69.26393  ? 94  GLU B C   1 
ATOM   3350  O  O   . GLU B 2 94  ? 8.41064   -12.48223 -22.94787 1.000 62.32334  ? 94  GLU B O   1 
ATOM   3351  C  CB  . GLU B 2 94  ? 6.90657   -15.21276 -22.86084 1.000 71.09197  ? 94  GLU B CB  1 
ATOM   3352  C  CG  . GLU B 2 94  ? 6.09600   -16.16738 -21.99190 1.000 73.22766  ? 94  GLU B CG  1 
ATOM   3353  C  CD  . GLU B 2 94  ? 4.98284   -16.86311 -22.75566 1.000 76.47268  ? 94  GLU B CD  1 
ATOM   3354  O  OE1 . GLU B 2 94  ? 4.78166   -16.54349 -23.94843 1.000 65.69331  ? 94  GLU B OE1 1 
ATOM   3355  O  OE2 . GLU B 2 94  ? 4.31380   -17.73716 -22.16179 1.000 88.65444  ? 94  GLU B OE2 1 
ATOM   3356  N  N   . VAL B 2 95  ? 7.18528   -12.54757 -24.84068 1.000 66.75036  ? 95  VAL B N   1 
ATOM   3357  C  CA  . VAL B 2 95  ? 8.06989   -11.61930 -25.53688 1.000 59.47558  ? 95  VAL B CA  1 
ATOM   3358  C  C   . VAL B 2 95  ? 7.85047   -10.19877 -25.02875 1.000 57.72638  ? 95  VAL B C   1 
ATOM   3359  O  O   . VAL B 2 95  ? 8.80548   -9.42835  -24.87166 1.000 56.09060  ? 95  VAL B O   1 
ATOM   3360  C  CB  . VAL B 2 95  ? 7.86610   -11.73193 -27.05880 1.000 58.48107  ? 95  VAL B CB  1 
ATOM   3361  C  CG1 . VAL B 2 95  ? 8.57800   -10.60160 -27.78575 1.000 60.19355  ? 95  VAL B CG1 1 
ATOM   3362  C  CG2 . VAL B 2 95  ? 8.36514   -13.08402 -27.55344 1.000 53.67460  ? 95  VAL B CG2 1 
ATOM   3363  N  N   . GLN B 2 96  ? 6.59368   -9.83312  -24.74629 1.000 56.81252  ? 96  GLN B N   1 
ATOM   3364  C  CA  . GLN B 2 96  ? 6.31211   -8.52822  -24.15574 1.000 56.77431  ? 96  GLN B CA  1 
ATOM   3365  C  C   . GLN B 2 96  ? 6.84843   -8.41772  -22.73034 1.000 48.93969  ? 96  GLN B C   1 
ATOM   3366  O  O   . GLN B 2 96  ? 7.02026   -7.29986  -22.23303 1.000 51.77699  ? 96  GLN B O   1 
ATOM   3367  C  CB  . GLN B 2 96  ? 4.80491   -8.23863  -24.18182 1.000 50.41257  ? 96  GLN B CB  1 
ATOM   3368  C  CG  . GLN B 2 96  ? 4.17342   -8.29158  -25.57561 1.000 39.88466  ? 96  GLN B CG  1 
ATOM   3369  C  CD  . GLN B 2 96  ? 2.77276   -7.67612  -25.64055 1.000 46.16936  ? 96  GLN B CD  1 
ATOM   3370  O  OE1 . GLN B 2 96  ? 2.40665   -6.82892  -24.82682 1.000 50.96750  ? 96  GLN B OE1 1 
ATOM   3371  N  NE2 . GLN B 2 96  ? 1.98904   -8.10408  -26.61888 1.000 42.59429  ? 96  GLN B NE2 1 
ATOM   3372  N  N   . ARG B 2 97  ? 7.10198   -9.54804  -22.05959 1.000 64.86218  ? 97  ARG B N   1 
ATOM   3373  C  CA  . ARG B 2 97  ? 7.75789   -9.55064  -20.75489 1.000 55.13022  ? 97  ARG B CA  1 
ATOM   3374  C  C   . ARG B 2 97  ? 9.27740   -9.50057  -20.85163 1.000 49.12145  ? 97  ARG B C   1 
ATOM   3375  O  O   . ARG B 2 97  ? 9.94126   -9.33793  -19.82135 1.000 51.15442  ? 97  ARG B O   1 
ATOM   3376  C  CB  . ARG B 2 97  ? 7.35302   -10.78671 -19.93983 1.000 55.26758  ? 97  ARG B CB  1 
ATOM   3377  C  CG  . ARG B 2 97  ? 5.96519   -10.71047 -19.32035 1.000 49.68579  ? 97  ARG B CG  1 
ATOM   3378  C  CD  . ARG B 2 97  ? 5.76699   -11.73658 -18.20782 1.000 44.63487  ? 97  ARG B CD  1 
ATOM   3379  N  NE  . ARG B 2 97  ? 5.88862   -13.11099 -18.68241 1.000 60.35532  ? 97  ARG B NE  1 
ATOM   3380  C  CZ  . ARG B 2 97  ? 6.86831   -13.93825 -18.34148 1.000 55.41935  ? 97  ARG B CZ  1 
ATOM   3381  N  NH1 . ARG B 2 97  ? 7.83226   -13.56509 -17.51383 1.000 46.06781  ? 97  ARG B NH1 1 
ATOM   3382  N  NH2 . ARG B 2 97  ? 6.88015   -15.17155 -18.84110 1.000 50.76817  ? 97  ARG B NH2 1 
ATOM   3383  N  N   . GLY B 2 98  ? 9.84355   -9.66440  -22.04339 1.000 50.77155  ? 98  GLY B N   1 
ATOM   3384  C  CA  . GLY B 2 98  ? 11.28115  -9.59959  -22.20906 1.000 54.81527  ? 98  GLY B CA  1 
ATOM   3385  C  C   . GLY B 2 98  ? 12.00991  -10.91949 -22.11244 1.000 65.85504  ? 98  GLY B C   1 
ATOM   3386  O  O   . GLY B 2 98  ? 13.21803  -10.92228 -21.84884 1.000 65.06915  ? 98  GLY B O   1 
ATOM   3387  N  N   . TYR B 2 99  ? 11.31820  -12.04733 -22.30968 1.000 62.14093  ? 99  TYR B N   1 
ATOM   3388  C  CA  . TYR B 2 99  ? 11.92444  -13.38001 -22.23290 1.000 56.43120  ? 99  TYR B CA  1 
ATOM   3389  C  C   . TYR B 2 99  ? 11.50678  -14.17051 -23.46942 1.000 53.67481  ? 99  TYR B C   1 
ATOM   3390  O  O   . TYR B 2 99  ? 10.64608  -15.05136 -23.40327 1.000 44.31968  ? 99  TYR B O   1 
ATOM   3391  C  CB  . TYR B 2 99  ? 11.53239  -14.08523 -20.93405 1.000 60.76737  ? 99  TYR B CB  1 
ATOM   3392  C  CG  . TYR B 2 99  ? 12.19382  -13.47861 -19.72315 1.000 53.85645  ? 99  TYR B CG  1 
ATOM   3393  C  CD1 . TYR B 2 99  ? 13.48341  -13.84537 -19.36015 1.000 51.70216  ? 99  TYR B CD1 1 
ATOM   3394  C  CD2 . TYR B 2 99  ? 11.54226  -12.51871 -18.95867 1.000 51.97414  ? 99  TYR B CD2 1 
ATOM   3395  C  CE1 . TYR B 2 99  ? 14.10113  -13.28620 -18.25819 1.000 53.74935  ? 99  TYR B CE1 1 
ATOM   3396  C  CE2 . TYR B 2 99  ? 12.15184  -11.95167 -17.85568 1.000 50.60113  ? 99  TYR B CE2 1 
ATOM   3397  C  CZ  . TYR B 2 99  ? 13.43187  -12.33855 -17.51011 1.000 56.66799  ? 99  TYR B CZ  1 
ATOM   3398  O  OH  . TYR B 2 99  ? 14.04700  -11.77877 -16.41187 1.000 72.58164  ? 99  TYR B OH  1 
ATOM   3399  N  N   . HIS B 2 100 ? 12.12964  -13.84324 -24.60461 1.000 58.11389  ? 100 HIS B N   1 
ATOM   3400  C  CA  . HIS B 2 100 ? 11.83210  -14.54362 -25.84877 1.000 49.27289  ? 100 HIS B CA  1 
ATOM   3401  C  C   . HIS B 2 100 ? 12.26416  -16.00509 -25.79054 1.000 52.89621  ? 100 HIS B C   1 
ATOM   3402  O  O   . HIS B 2 100 ? 11.67837  -16.84936 -26.47917 1.000 50.82325  ? 100 HIS B O   1 
ATOM   3403  C  CB  . HIS B 2 100 ? 12.51435  -13.83276 -27.01727 1.000 44.34439  ? 100 HIS B CB  1 
ATOM   3404  C  CG  . HIS B 2 100 ? 14.01057  -13.84337 -26.93746 1.000 50.68418  ? 100 HIS B CG  1 
ATOM   3405  N  ND1 . HIS B 2 100 ? 14.73845  -12.76807 -26.47306 1.000 49.13479  ? 100 HIS B ND1 1 
ATOM   3406  C  CD2 . HIS B 2 100 ? 14.91572  -14.79828 -27.26159 1.000 44.07672  ? 100 HIS B CD2 1 
ATOM   3407  C  CE1 . HIS B 2 100 ? 16.02689  -13.05974 -26.51429 1.000 51.22684  ? 100 HIS B CE1 1 
ATOM   3408  N  NE2 . HIS B 2 100 ? 16.16151  -14.28598 -26.98809 1.000 51.06154  ? 100 HIS B NE2 1 
ATOM   3409  N  N   . GLN B 2 101 ? 13.26776  -16.32740 -24.96621 1.000 47.43684  ? 101 GLN B N   1 
ATOM   3410  C  CA  . GLN B 2 101 ? 13.69568  -17.71478 -24.82183 1.000 51.06026  ? 101 GLN B CA  1 
ATOM   3411  C  C   . GLN B 2 101 ? 12.55704  -18.61713 -24.37146 1.000 54.11872  ? 101 GLN B C   1 
ATOM   3412  O  O   . GLN B 2 101 ? 12.60165  -19.82834 -24.61931 1.000 50.89126  ? 101 GLN B O   1 
ATOM   3413  C  CB  . GLN B 2 101 ? 14.85327  -17.82020 -23.82394 1.000 52.07080  ? 101 GLN B CB  1 
ATOM   3414  C  CG  . GLN B 2 101 ? 16.09068  -17.02300 -24.20010 1.000 50.97365  ? 101 GLN B CG  1 
ATOM   3415  C  CD  . GLN B 2 101 ? 16.15211  -15.67875 -23.50269 1.000 47.23000  ? 101 GLN B CD  1 
ATOM   3416  O  OE1 . GLN B 2 101 ? 15.15665  -14.95920 -23.42833 1.000 52.08192  ? 101 GLN B OE1 1 
ATOM   3417  N  NE2 . GLN B 2 101 ? 17.32693  -15.33265 -22.98559 1.000 46.65501  ? 101 GLN B NE2 1 
ATOM   3418  N  N   . HIS B 2 102 ? 11.53749  -18.05225 -23.72402 1.000 49.86013  ? 102 HIS B N   1 
ATOM   3419  C  CA  . HIS B 2 102 ? 10.39223  -18.80534 -23.23191 1.000 57.86578  ? 102 HIS B CA  1 
ATOM   3420  C  C   . HIS B 2 102 ? 9.10849   -18.38237 -23.93844 1.000 56.12605  ? 102 HIS B C   1 
ATOM   3421  O  O   . HIS B 2 102 ? 8.01832   -18.46438 -23.36970 1.000 58.00440  ? 102 HIS B O   1 
ATOM   3422  C  CB  . HIS B 2 102 ? 10.26678  -18.64568 -21.71924 1.000 53.16841  ? 102 HIS B CB  1 
ATOM   3423  C  CG  . HIS B 2 102 ? 11.56229  -18.84227 -20.99949 1.000 53.72584  ? 102 HIS B CG  1 
ATOM   3424  N  ND1 . HIS B 2 102 ? 12.16502  -20.07578 -20.87890 1.000 53.95163  ? 102 HIS B ND1 1 
ATOM   3425  C  CD2 . HIS B 2 102 ? 12.38767  -17.95834 -20.39102 1.000 49.14252  ? 102 HIS B CD2 1 
ATOM   3426  C  CE1 . HIS B 2 102 ? 13.30003  -19.94534 -20.21594 1.000 51.88455  ? 102 HIS B CE1 1 
ATOM   3427  N  NE2 . HIS B 2 102 ? 13.45734  -18.67087 -19.90683 1.000 48.70803  ? 102 HIS B NE2 1 
ATOM   3428  N  N   . SER B 2 103 ? 9.23409   -17.92680 -25.18303 1.000 53.24855  ? 103 SER B N   1 
ATOM   3429  C  CA  . SER B 2 103 ? 8.08850   -17.49699 -25.97716 1.000 56.08108  ? 103 SER B CA  1 
ATOM   3430  C  C   . SER B 2 103 ? 7.20771   -18.70105 -26.29974 1.000 56.05866  ? 103 SER B C   1 
ATOM   3431  O  O   . SER B 2 103 ? 7.56018   -19.53055 -27.14467 1.000 52.83630  ? 103 SER B O   1 
ATOM   3432  C  CB  . SER B 2 103 ? 8.57795   -16.81190 -27.24945 1.000 49.44865  ? 103 SER B CB  1 
ATOM   3433  O  OG  . SER B 2 103 ? 7.49908   -16.40387 -28.06664 1.000 55.84189  ? 103 SER B OG  1 
ATOM   3434  N  N   . GLY B 2 104 ? 6.05390   -18.79042 -25.64165 1.000 54.75509  ? 104 GLY B N   1 
ATOM   3435  C  CA  . GLY B 2 104 ? 5.14699   -19.90404 -25.82717 1.000 51.09012  ? 104 GLY B CA  1 
ATOM   3436  C  C   . GLY B 2 104 ? 5.31067   -21.04491 -24.84686 1.000 59.72857  ? 104 GLY B C   1 
ATOM   3437  O  O   . GLY B 2 104 ? 4.72241   -22.11190 -25.06137 1.000 55.14667  ? 104 GLY B O   1 
ATOM   3438  N  N   . GLY B 2 105 ? 6.08993   -20.86052 -23.78300 1.000 62.90855  ? 105 GLY B N   1 
ATOM   3439  C  CA  . GLY B 2 105 ? 6.31943   -21.91160 -22.81068 1.000 56.70823  ? 105 GLY B CA  1 
ATOM   3440  C  C   . GLY B 2 105 ? 7.76707   -21.96207 -22.36825 1.000 51.72034  ? 105 GLY B C   1 
ATOM   3441  O  O   . GLY B 2 105 ? 8.62365   -21.33100 -22.99030 1.000 52.38686  ? 105 GLY B O   1 
ATOM   3442  N  N   . MET B 2 106 ? 8.05826   -22.70672 -21.30408 1.000 54.85627  ? 106 MET B N   1 
ATOM   3443  C  CA  . MET B 2 106 ? 9.42584   -22.79398 -20.80715 1.000 54.47199  ? 106 MET B CA  1 
ATOM   3444  C  C   . MET B 2 106 ? 10.34332  -23.40569 -21.86100 1.000 57.93820  ? 106 MET B C   1 
ATOM   3445  O  O   . MET B 2 106 ? 10.06598  -24.48525 -22.39269 1.000 58.33210  ? 106 MET B O   1 
ATOM   3446  C  CB  . MET B 2 106 ? 9.46394   -23.61657 -19.52027 1.000 54.79469  ? 106 MET B CB  1 
ATOM   3447  C  CG  . MET B 2 106 ? 10.76203  -23.49487 -18.73770 1.000 49.43530  ? 106 MET B CG  1 
ATOM   3448  S  SD  . MET B 2 106 ? 10.62974  -24.26380 -17.11105 1.000 64.58309  ? 106 MET B SD  1 
ATOM   3449  C  CE  . MET B 2 106 ? 10.22827  -25.95368 -17.55931 1.000 63.36859  ? 106 MET B CE  1 
ATOM   3450  N  N   . LEU B 2 107 ? 11.42635  -22.69044 -22.17772 1.000 56.27366  ? 107 LEU B N   1 
ATOM   3451  C  CA  . LEU B 2 107 ? 12.42559  -23.09555 -23.16852 1.000 49.28061  ? 107 LEU B CA  1 
ATOM   3452  C  C   . LEU B 2 107 ? 11.84504  -23.20105 -24.57529 1.000 53.64921  ? 107 LEU B C   1 
ATOM   3453  O  O   . LEU B 2 107 ? 12.47032  -23.79345 -25.46009 1.000 53.20185  ? 107 LEU B O   1 
ATOM   3454  C  CB  . LEU B 2 107 ? 13.10280  -24.41862 -22.78169 1.000 53.01755  ? 107 LEU B CB  1 
ATOM   3455  C  CG  . LEU B 2 107 ? 13.67964  -24.54316 -21.36757 1.000 63.36281  ? 107 LEU B CG  1 
ATOM   3456  C  CD1 . LEU B 2 107 ? 14.28325  -25.92595 -21.14815 1.000 52.52296  ? 107 LEU B CD1 1 
ATOM   3457  C  CD2 . LEU B 2 107 ? 14.71467  -23.46196 -21.11014 1.000 54.97017  ? 107 LEU B CD2 1 
ATOM   3458  N  N   . ALA B 2 108 ? 10.66030  -22.62572 -24.80837 1.000 54.42535  ? 108 ALA B N   1 
ATOM   3459  C  CA  . ALA B 2 108 ? 9.99085   -22.76639 -26.09771 1.000 48.83466  ? 108 ALA B CA  1 
ATOM   3460  C  C   . ALA B 2 108 ? 10.65963  -21.96925 -27.20946 1.000 53.50009  ? 108 ALA B C   1 
ATOM   3461  O  O   . ALA B 2 108 ? 10.31085  -22.16460 -28.37914 1.000 51.37920  ? 108 ALA B O   1 
ATOM   3462  C  CB  . ALA B 2 108 ? 8.52280   -22.35300 -25.98373 1.000 53.04458  ? 108 ALA B CB  1 
ATOM   3463  N  N   . GLY B 2 109 ? 11.59431  -21.07427 -26.88207 1.000 47.59508  ? 109 GLY B N   1 
ATOM   3464  C  CA  . GLY B 2 109 ? 12.37512  -20.42080 -27.91657 1.000 41.54748  ? 109 GLY B CA  1 
ATOM   3465  C  C   . GLY B 2 109 ? 13.34915  -21.34413 -28.61828 1.000 41.54359  ? 109 GLY B C   1 
ATOM   3466  O  O   . GLY B 2 109 ? 13.78595  -21.03869 -29.73293 1.000 45.67056  ? 109 GLY B O   1 
ATOM   3467  N  N   . TRP B 2 110 ? 13.70290  -22.46154 -27.98660 1.000 45.46918  ? 110 TRP B N   1 
ATOM   3468  C  CA  . TRP B 2 110 ? 14.59430  -23.46330 -28.56836 1.000 43.47701  ? 110 TRP B CA  1 
ATOM   3469  C  C   . TRP B 2 110 ? 13.75190  -24.45094 -29.36982 1.000 46.84493  ? 110 TRP B C   1 
ATOM   3470  O  O   . TRP B 2 110 ? 13.10954  -25.33924 -28.80494 1.000 50.60058  ? 110 TRP B O   1 
ATOM   3471  C  CB  . TRP B 2 110 ? 15.38810  -24.15244 -27.46366 1.000 48.88766  ? 110 TRP B CB  1 
ATOM   3472  C  CG  . TRP B 2 110 ? 16.15535  -25.37256 -27.88982 1.000 69.46448  ? 110 TRP B CG  1 
ATOM   3473  C  CD1 . TRP B 2 110 ? 16.67748  -25.63329 -29.12622 1.000 60.38086  ? 110 TRP B CD1 1 
ATOM   3474  C  CD2 . TRP B 2 110 ? 16.48609  -26.50098 -27.06971 1.000 67.16220  ? 110 TRP B CD2 1 
ATOM   3475  N  NE1 . TRP B 2 110 ? 17.30955  -26.85478 -29.12481 1.000 58.03988  ? 110 TRP B NE1 1 
ATOM   3476  C  CE2 . TRP B 2 110 ? 17.20539  -27.40753 -27.87524 1.000 65.75772  ? 110 TRP B CE2 1 
ATOM   3477  C  CE3 . TRP B 2 110 ? 16.24309  -26.83195 -25.73206 1.000 66.44280  ? 110 TRP B CE3 1 
ATOM   3478  C  CZ2 . TRP B 2 110 ? 17.68496  -28.62153 -27.38709 1.000 70.99289  ? 110 TRP B CZ2 1 
ATOM   3479  C  CZ3 . TRP B 2 110 ? 16.71885  -28.03830 -25.24918 1.000 82.79029  ? 110 TRP B CZ3 1 
ATOM   3480  C  CH2 . TRP B 2 110 ? 17.43188  -28.91834 -26.07486 1.000 80.16837  ? 110 TRP B CH2 1 
ATOM   3481  N  N   . LYS B 2 111 ? 13.76143  -24.30613 -30.69562 1.000 40.27106  ? 111 LYS B N   1 
ATOM   3482  C  CA  . LYS B 2 111 ? 12.95136  -25.14639 -31.57180 1.000 44.18772  ? 111 LYS B CA  1 
ATOM   3483  C  C   . LYS B 2 111 ? 13.74906  -26.23025 -32.29057 1.000 47.85537  ? 111 LYS B C   1 
ATOM   3484  O  O   . LYS B 2 111 ? 13.29247  -27.37541 -32.35843 1.000 58.93372  ? 111 LYS B O   1 
ATOM   3485  C  CB  . LYS B 2 111 ? 12.22380  -24.28049 -32.60634 1.000 45.32161  ? 111 LYS B CB  1 
ATOM   3486  C  CG  . LYS B 2 111 ? 11.16319  -23.35490 -32.02033 1.000 47.20132  ? 111 LYS B CG  1 
ATOM   3487  C  CD  . LYS B 2 111 ? 10.52334  -22.50752 -33.10989 1.000 43.23206  ? 111 LYS B CD  1 
ATOM   3488  C  CE  . LYS B 2 111 ? 9.43283   -21.59795 -32.56259 1.000 40.54181  ? 111 LYS B CE  1 
ATOM   3489  N  NZ  . LYS B 2 111 ? 8.29903   -22.37498 -32.00229 1.000 50.53180  ? 111 LYS B NZ  1 
ATOM   3490  N  N   . PHE B 2 112 ? 14.92111  -25.89817 -32.83597 1.000 50.37841  ? 112 PHE B N   1 
ATOM   3491  C  CA  . PHE B 2 112 ? 15.72377  -26.86629 -33.58171 1.000 44.88032  ? 112 PHE B CA  1 
ATOM   3492  C  C   . PHE B 2 112 ? 16.06897  -28.07741 -32.72344 1.000 44.47647  ? 112 PHE B C   1 
ATOM   3493  O  O   . PHE B 2 112 ? 16.55678  -27.93542 -31.59926 1.000 54.26474  ? 112 PHE B O   1 
ATOM   3494  C  CB  . PHE B 2 112 ? 17.01448  -26.21357 -34.07585 1.000 38.50386  ? 112 PHE B CB  1 
ATOM   3495  C  CG  . PHE B 2 112 ? 16.82690  -25.26112 -35.21725 1.000 36.54725  ? 112 PHE B CG  1 
ATOM   3496  C  CD1 . PHE B 2 112 ? 16.00119  -25.58300 -36.28073 1.000 43.81253  ? 112 PHE B CD1 1 
ATOM   3497  C  CD2 . PHE B 2 112 ? 17.48858  -24.04107 -35.22978 1.000 35.30190  ? 112 PHE B CD2 1 
ATOM   3498  C  CE1 . PHE B 2 112 ? 15.83823  -24.70491 -37.33805 1.000 43.03293  ? 112 PHE B CE1 1 
ATOM   3499  C  CE2 . PHE B 2 112 ? 17.32800  -23.16017 -36.27996 1.000 36.69543  ? 112 PHE B CE2 1 
ATOM   3500  C  CZ  . PHE B 2 112 ? 16.50389  -23.49121 -37.33667 1.000 31.95141  ? 112 PHE B CZ  1 
ATOM   3501  N  N   . SER B 2 113 ? 15.82145  -29.27287 -33.26528 1.000 47.15472  ? 113 SER B N   1 
ATOM   3502  C  CA  . SER B 2 113 ? 16.11285  -30.53495 -32.57674 1.000 52.21166  ? 113 SER B CA  1 
ATOM   3503  C  C   . SER B 2 113 ? 15.43944  -30.58751 -31.20628 1.000 61.07723  ? 113 SER B C   1 
ATOM   3504  O  O   . SER B 2 113 ? 15.97830  -31.14220 -30.24547 1.000 63.42937  ? 113 SER B O   1 
ATOM   3505  C  CB  . SER B 2 113 ? 17.62185  -30.77157 -32.45466 1.000 52.17650  ? 113 SER B CB  1 
ATOM   3506  O  OG  . SER B 2 113 ? 18.21541  -29.89328 -31.50914 1.000 65.70000  ? 113 SER B OG  1 
ATOM   3507  N  N   . ASN B 2 114 ? 14.24564  -30.00297 -31.11967 1.000 62.75602  ? 114 ASN B N   1 
ATOM   3508  C  CA  . ASN B 2 114 ? 13.44767  -30.03551 -29.90155 1.000 53.73722  ? 114 ASN B CA  1 
ATOM   3509  C  C   . ASN B 2 114 ? 11.99090  -30.29525 -30.25728 1.000 53.67138  ? 114 ASN B C   1 
ATOM   3510  O  O   . ASN B 2 114 ? 11.42248  -31.31980 -29.86808 1.000 65.84081  ? 114 ASN B O   1 
ATOM   3511  C  CB  . ASN B 2 114 ? 13.59964  -28.72520 -29.12414 1.000 60.13904  ? 114 ASN B CB  1 
ATOM   3512  C  CG  . ASN B 2 114 ? 12.84806  -28.73509 -27.80407 1.000 69.43280  ? 114 ASN B CG  1 
ATOM   3513  O  OD1 . ASN B 2 114 ? 12.42469  -29.78699 -27.32245 1.000 63.04660  ? 114 ASN B OD1 1 
ATOM   3514  N  ND2 . ASN B 2 114 ? 12.69482  -27.55903 -27.20289 1.000 67.87266  ? 114 ASN B ND2 1 
ATOM   3515  N  N   . VAL B 2 115 ? 11.38217  -29.37604 -31.00317 1.000 53.93131  ? 115 VAL B N   1 
ATOM   3516  C  CA  . VAL B 2 115 ? 10.01246  -29.54430 -31.47432 1.000 54.69460  ? 115 VAL B CA  1 
ATOM   3517  C  C   . VAL B 2 115 ? 9.99112   -29.35583 -32.98576 1.000 55.49659  ? 115 VAL B C   1 
ATOM   3518  O  O   . VAL B 2 115 ? 8.92314   -29.22654 -33.59549 1.000 53.01168  ? 115 VAL B O   1 
ATOM   3519  C  CB  . VAL B 2 115 ? 9.05977   -28.55345 -30.77922 1.000 43.75770  ? 115 VAL B CB  1 
ATOM   3520  C  CG1 . VAL B 2 115 ? 9.08252   -28.75886 -29.27406 1.000 60.23710  ? 115 VAL B CG1 1 
ATOM   3521  C  CG2 . VAL B 2 115 ? 9.44509   -27.12384 -31.12186 1.000 49.56532  ? 115 VAL B CG2 1 
ATOM   3522  N  N   . LYS B 2 116 ? 11.17141  -29.36421 -33.60013 1.000 55.78968  ? 116 LYS B N   1 
ATOM   3523  C  CA  . LYS B 2 116 ? 11.31614  -29.00930 -35.00404 1.000 43.88691  ? 116 LYS B CA  1 
ATOM   3524  C  C   . LYS B 2 116 ? 12.56936  -29.67996 -35.54937 1.000 44.59448  ? 116 LYS B C   1 
ATOM   3525  O  O   . LYS B 2 116 ? 13.55716  -29.84140 -34.82674 1.000 49.51080  ? 116 LYS B O   1 
ATOM   3526  C  CB  . LYS B 2 116 ? 11.40152  -27.48409 -35.14039 1.000 47.96041  ? 116 LYS B CB  1 
ATOM   3527  C  CG  . LYS B 2 116 ? 11.51952  -26.93572 -36.53678 1.000 48.32871  ? 116 LYS B CG  1 
ATOM   3528  C  CD  . LYS B 2 116 ? 11.71564  -25.43302 -36.46463 1.000 41.51014  ? 116 LYS B CD  1 
ATOM   3529  C  CE  . LYS B 2 116 ? 11.45514  -24.77182 -37.79830 1.000 41.45961  ? 116 LYS B CE  1 
ATOM   3530  N  NZ  . LYS B 2 116 ? 11.53138  -23.28953 -37.67766 1.000 36.68486  ? 116 LYS B NZ  1 
ATOM   3531  N  N   . ASP B 2 117 ? 12.52870  -30.05564 -36.83002 1.000 44.06743  ? 117 ASP B N   1 
ATOM   3532  C  CA  . ASP B 2 117 ? 13.69226  -30.68232 -37.45127 1.000 47.72513  ? 117 ASP B CA  1 
ATOM   3533  C  C   . ASP B 2 117 ? 14.89046  -29.74324 -37.39880 1.000 44.30177  ? 117 ASP B C   1 
ATOM   3534  O  O   . ASP B 2 117 ? 14.79139  -28.56369 -37.75117 1.000 37.88827  ? 117 ASP B O   1 
ATOM   3535  C  CB  . ASP B 2 117 ? 13.39607  -31.08230 -38.89933 1.000 45.90441  ? 117 ASP B CB  1 
ATOM   3536  C  CG  . ASP B 2 117 ? 12.63943  -32.39517 -39.00408 1.000 48.16717  ? 117 ASP B CG  1 
ATOM   3537  O  OD1 . ASP B 2 117 ? 12.83110  -33.26295 -38.12610 1.000 52.32108  ? 117 ASP B OD1 1 
ATOM   3538  O  OD2 . ASP B 2 117 ? 11.86705  -32.57203 -39.97236 1.000 51.40155  ? 117 ASP B OD2 1 
ATOM   3539  N  N   . GLY B 2 118 ? 16.02560  -30.27680 -36.95265 1.000 42.95600  ? 118 GLY B N   1 
ATOM   3540  C  CA  . GLY B 2 118 ? 17.21641  -29.48128 -36.73642 1.000 41.69919  ? 118 GLY B CA  1 
ATOM   3541  C  C   . GLY B 2 118 ? 17.93737  -29.07311 -38.00217 1.000 43.67016  ? 118 GLY B C   1 
ATOM   3542  O  O   . GLY B 2 118 ? 17.36441  -29.11309 -39.09462 1.000 45.59840  ? 118 GLY B O   1 
ATOM   3543  N  N   . VAL B 2 119 ? 19.21104  -28.69535 -37.87011 1.000 44.49295  ? 119 VAL B N   1 
ATOM   3544  C  CA  . VAL B 2 119 ? 19.96734  -28.14629 -38.98732 1.000 33.97679  ? 119 VAL B CA  1 
ATOM   3545  C  C   . VAL B 2 119 ? 20.83212  -29.18877 -39.67735 1.000 41.94488  ? 119 VAL B C   1 
ATOM   3546  O  O   . VAL B 2 119 ? 21.48746  -28.86712 -40.67774 1.000 38.46387  ? 119 VAL B O   1 
ATOM   3547  C  CB  . VAL B 2 119 ? 20.83373  -26.95573 -38.53077 1.000 45.11419  ? 119 VAL B CB  1 
ATOM   3548  C  CG1 . VAL B 2 119 ? 19.96039  -25.85522 -37.94126 1.000 38.93776  ? 119 VAL B CG1 1 
ATOM   3549  C  CG2 . VAL B 2 119 ? 21.88368  -27.41056 -37.52660 1.000 37.61198  ? 119 VAL B CG2 1 
ATOM   3550  N  N   . PHE B 2 120 ? 20.85443  -30.42962 -39.18200 1.000 35.38577  ? 120 PHE B N   1 
ATOM   3551  C  CA  . PHE B 2 120 ? 21.66880  -31.48657 -39.78247 1.000 41.89697  ? 120 PHE B CA  1 
ATOM   3552  C  C   . PHE B 2 120 ? 20.94615  -32.10783 -40.97960 1.000 39.73964  ? 120 PHE B C   1 
ATOM   3553  O  O   . PHE B 2 120 ? 20.70543  -33.31100 -41.04664 1.000 45.03219  ? 120 PHE B O   1 
ATOM   3554  C  CB  . PHE B 2 120 ? 22.01908  -32.55619 -38.75533 1.000 41.57801  ? 120 PHE B CB  1 
ATOM   3555  C  CG  . PHE B 2 120 ? 22.96507  -32.09241 -37.68937 1.000 45.32295  ? 120 PHE B CG  1 
ATOM   3556  C  CD1 . PHE B 2 120 ? 23.64100  -30.88874 -37.81383 1.000 44.90628  ? 120 PHE B CD1 1 
ATOM   3557  C  CD2 . PHE B 2 120 ? 23.20451  -32.87994 -36.57459 1.000 41.73506  ? 120 PHE B CD2 1 
ATOM   3558  C  CE1 . PHE B 2 120 ? 24.51330  -30.46446 -36.83230 1.000 37.47296  ? 120 PHE B CE1 1 
ATOM   3559  C  CE2 . PHE B 2 120 ? 24.07980  -32.46622 -35.59298 1.000 43.79892  ? 120 PHE B CE2 1 
ATOM   3560  C  CZ  . PHE B 2 120 ? 24.73613  -31.25537 -35.72158 1.000 48.58144  ? 120 PHE B CZ  1 
ATOM   3561  N  N   . GLY B 2 121 ? 20.60382  -31.25304 -41.94106 1.000 42.57150  ? 121 GLY B N   1 
ATOM   3562  C  CA  . GLY B 2 121 ? 19.95813  -31.70392 -43.15631 1.000 50.59572  ? 121 GLY B CA  1 
ATOM   3563  C  C   . GLY B 2 121 ? 20.33354  -30.79224 -44.30193 1.000 45.87039  ? 121 GLY B C   1 
ATOM   3564  O  O   . GLY B 2 121 ? 20.87202  -29.70287 -44.10316 1.000 49.25253  ? 121 GLY B O   1 
ATOM   3565  N  N   . GLU B 2 122 ? 20.02323  -31.24738 -45.51735 1.000 46.65454  ? 122 GLU B N   1 
ATOM   3566  C  CA  . GLU B 2 122 ? 20.36670  -30.46689 -46.70074 1.000 45.84216  ? 122 GLU B CA  1 
ATOM   3567  C  C   . GLU B 2 122 ? 19.67717  -29.11402 -46.69150 1.000 43.30245  ? 122 GLU B C   1 
ATOM   3568  O  O   . GLU B 2 122 ? 20.18446  -28.15209 -47.27815 1.000 51.98636  ? 122 GLU B O   1 
ATOM   3569  C  CB  . GLU B 2 122 ? 19.99105  -31.23834 -47.95921 1.000 46.25733  ? 122 GLU B CB  1 
ATOM   3570  C  CG  . GLU B 2 122 ? 20.81403  -32.48501 -48.17779 1.000 57.94916  ? 122 GLU B CG  1 
ATOM   3571  C  CD  . GLU B 2 122 ? 20.39095  -33.22824 -49.42016 1.000 55.57493  ? 122 GLU B CD  1 
ATOM   3572  O  OE1 . GLU B 2 122 ? 20.82454  -32.83399 -50.52337 1.000 65.58219  ? 122 GLU B OE1 1 
ATOM   3573  O  OE2 . GLU B 2 122 ? 19.60409  -34.19142 -49.29288 1.000 48.45603  ? 122 GLU B OE2 1 
ATOM   3574  N  N   . PHE B 2 123 ? 18.52428  -29.02520 -46.03684 1.000 47.85047  ? 123 PHE B N   1 
ATOM   3575  C  CA  . PHE B 2 123 ? 17.81992  -27.77171 -45.83416 1.000 45.29927  ? 123 PHE B CA  1 
ATOM   3576  C  C   . PHE B 2 123 ? 17.16090  -27.81468 -44.46502 1.000 49.93829  ? 123 PHE B C   1 
ATOM   3577  O  O   . PHE B 2 123 ? 16.92569  -28.88783 -43.90432 1.000 45.75887  ? 123 PHE B O   1 
ATOM   3578  C  CB  . PHE B 2 123 ? 16.75637  -27.53030 -46.91699 1.000 47.79902  ? 123 PHE B CB  1 
ATOM   3579  C  CG  . PHE B 2 123 ? 17.29715  -27.53930 -48.32129 1.000 46.65715  ? 123 PHE B CG  1 
ATOM   3580  C  CD1 . PHE B 2 123 ? 17.84275  -26.39309 -48.87665 1.000 51.70057  ? 123 PHE B CD1 1 
ATOM   3581  C  CD2 . PHE B 2 123 ? 17.24554  -28.68907 -49.08982 1.000 52.28125  ? 123 PHE B CD2 1 
ATOM   3582  C  CE1 . PHE B 2 123 ? 18.33462  -26.39408 -50.16686 1.000 43.04619  ? 123 PHE B CE1 1 
ATOM   3583  C  CE2 . PHE B 2 123 ? 17.73676  -28.69720 -50.38422 1.000 47.67859  ? 123 PHE B CE2 1 
ATOM   3584  C  CZ  . PHE B 2 123 ? 18.28234  -27.54839 -50.92244 1.000 45.84394  ? 123 PHE B CZ  1 
ATOM   3585  N  N   . PHE B 2 124 ? 16.86998  -26.63491 -43.92199 1.000 44.67099  ? 124 PHE B N   1 
ATOM   3586  C  CA  . PHE B 2 124 ? 16.07787  -26.55842 -42.70487 1.000 41.61871  ? 124 PHE B CA  1 
ATOM   3587  C  C   . PHE B 2 124 ? 15.21956  -25.30284 -42.75298 1.000 46.81606  ? 124 PHE B C   1 
ATOM   3588  O  O   . PHE B 2 124 ? 15.45052  -24.39513 -43.55756 1.000 39.96165  ? 124 PHE B O   1 
ATOM   3589  C  CB  . PHE B 2 124 ? 16.94914  -26.59993 -41.43732 1.000 42.18522  ? 124 PHE B CB  1 
ATOM   3590  C  CG  . PHE B 2 124 ? 18.01968  -25.54486 -41.38101 1.000 35.37647  ? 124 PHE B CG  1 
ATOM   3591  C  CD1 . PHE B 2 124 ? 17.76001  -24.30130 -40.82697 1.000 38.32784  ? 124 PHE B CD1 1 
ATOM   3592  C  CD2 . PHE B 2 124 ? 19.29626  -25.80986 -41.84774 1.000 37.27610  ? 124 PHE B CD2 1 
ATOM   3593  C  CE1 . PHE B 2 124 ? 18.74619  -23.33560 -40.76260 1.000 39.86153  ? 124 PHE B CE1 1 
ATOM   3594  C  CE2 . PHE B 2 124 ? 20.28809  -24.84808 -41.78547 1.000 40.84678  ? 124 PHE B CE2 1 
ATOM   3595  C  CZ  . PHE B 2 124 ? 20.01342  -23.60912 -41.24359 1.000 35.10449  ? 124 PHE B CZ  1 
ATOM   3596  N  N   . HIS B 2 125 ? 14.21770  -25.27304 -41.87800 1.000 39.47601  ? 125 HIS B N   1 
ATOM   3597  C  CA  . HIS B 2 125 ? 13.20015  -24.23194 -41.85282 1.000 41.44454  ? 125 HIS B CA  1 
ATOM   3598  C  C   . HIS B 2 125 ? 13.50135  -23.23900 -40.73849 1.000 40.28928  ? 125 HIS B C   1 
ATOM   3599  O  O   . HIS B 2 125 ? 13.76033  -23.64050 -39.59840 1.000 36.05734  ? 125 HIS B O   1 
ATOM   3600  C  CB  . HIS B 2 125 ? 11.81775  -24.85207 -41.64203 1.000 39.29908  ? 125 HIS B CB  1 
ATOM   3601  C  CG  . HIS B 2 125 ? 10.70033  -23.85785 -41.61718 1.000 38.76799  ? 125 HIS B CG  1 
ATOM   3602  N  ND1 . HIS B 2 125 ? 10.31225  -23.20502 -40.46684 1.000 46.47838  ? 125 HIS B ND1 1 
ATOM   3603  C  CD2 . HIS B 2 125 ? 9.86522   -23.42895 -42.59310 1.000 43.37558  ? 125 HIS B CD2 1 
ATOM   3604  C  CE1 . HIS B 2 125 ? 9.29786   -22.40293 -40.73858 1.000 47.02646  ? 125 HIS B CE1 1 
ATOM   3605  N  NE2 . HIS B 2 125 ? 9.00546   -22.52169 -42.02120 1.000 45.18436  ? 125 HIS B NE2 1 
ATOM   3606  N  N   . VAL B 2 126 ? 13.46739  -21.94881 -41.06654 1.000 39.06322  ? 126 VAL B N   1 
ATOM   3607  C  CA  . VAL B 2 126 ? 13.66346  -20.88183 -40.09007 1.000 30.66222  ? 126 VAL B CA  1 
ATOM   3608  C  C   . VAL B 2 126 ? 12.39002  -20.04861 -40.04154 1.000 34.11802  ? 126 VAL B C   1 
ATOM   3609  O  O   . VAL B 2 126 ? 12.02487  -19.39790 -41.02907 1.000 38.77220  ? 126 VAL B O   1 
ATOM   3610  C  CB  . VAL B 2 126 ? 14.87990  -20.01225 -40.42245 1.000 35.84545  ? 126 VAL B CB  1 
ATOM   3611  C  CG1 . VAL B 2 126 ? 14.97938  -18.85492 -39.44076 1.000 30.36275  ? 126 VAL B CG1 1 
ATOM   3612  C  CG2 . VAL B 2 126 ? 16.14586  -20.85662 -40.39976 1.000 35.35706  ? 126 VAL B CG2 1 
ATOM   3613  N  N   . ASN B 2 127 ? 11.71341  -20.06933 -38.89689 1.000 33.04368  ? 127 ASN B N   1 
ATOM   3614  C  CA  . ASN B 2 127 ? 10.49336  -19.29871 -38.71293 1.000 31.98052  ? 127 ASN B CA  1 
ATOM   3615  C  C   . ASN B 2 127 ? 10.82124  -17.83546 -38.44864 1.000 38.44270  ? 127 ASN B C   1 
ATOM   3616  O  O   . ASN B 2 127 ? 11.75456  -17.52086 -37.70219 1.000 34.64863  ? 127 ASN B O   1 
ATOM   3617  C  CB  . ASN B 2 127 ? 9.68421   -19.86728 -37.54987 1.000 36.40430  ? 127 ASN B CB  1 
ATOM   3618  C  CG  . ASN B 2 127 ? 10.47050  -19.88358 -36.25518 1.000 35.95259  ? 127 ASN B CG  1 
ATOM   3619  O  OD1 . ASN B 2 127 ? 11.45786  -20.60588 -36.12678 1.000 39.65758  ? 127 ASN B OD1 1 
ATOM   3620  N  ND2 . ASN B 2 127 ? 10.03517  -19.08690 -35.28614 1.000 36.20391  ? 127 ASN B ND2 1 
ATOM   3621  N  N   . ASP B 2 128 ? 10.02989  -16.94369 -39.04657 1.000 34.18293  ? 128 ASP B N   1 
ATOM   3622  C  CA  . ASP B 2 128 ? 10.17732  -15.49634 -38.88101 1.000 36.17989  ? 128 ASP B CA  1 
ATOM   3623  C  C   . ASP B 2 128 ? 11.60246  -15.04911 -39.21813 1.000 36.76355  ? 128 ASP B C   1 
ATOM   3624  O  O   . ASP B 2 128 ? 12.38740  -14.65268 -38.35842 1.000 35.44704  ? 128 ASP B O   1 
ATOM   3625  C  CB  . ASP B 2 128 ? 9.78867   -15.07069 -37.45997 1.000 39.76422  ? 128 ASP B CB  1 
ATOM   3626  C  CG  . ASP B 2 128 ? 9.33338   -13.62191 -37.38552 1.000 50.20083  ? 128 ASP B CG  1 
ATOM   3627  O  OD1 . ASP B 2 128 ? 9.72148   -12.82966 -38.27295 1.000 46.48255  ? 128 ASP B OD1 1 
ATOM   3628  O  OD2 . ASP B 2 128 ? 8.59534   -13.27252 -36.43666 1.000 48.56234  ? 128 ASP B OD2 1 
ATOM   3629  N  N   . ALA B 2 129 ? 11.90356  -15.11052 -40.51694 1.000 38.64130  ? 129 ALA B N   1 
ATOM   3630  C  CA  . ALA B 2 129 ? 13.26360  -14.84858 -40.97896 1.000 38.15788  ? 129 ALA B CA  1 
ATOM   3631  C  C   . ALA B 2 129 ? 13.73773  -13.45383 -40.58162 1.000 33.90906  ? 129 ALA B C   1 
ATOM   3632  O  O   . ALA B 2 129 ? 14.85765  -13.28719 -40.08346 1.000 35.73992  ? 129 ALA B O   1 
ATOM   3633  C  CB  . ALA B 2 129 ? 13.34243  -15.03160 -42.49342 1.000 38.23486  ? 129 ALA B CB  1 
ATOM   3634  N  N   . ASP B 2 130 ? 12.89713  -12.43554 -40.78853 1.000 35.91491  ? 130 ASP B N   1 
ATOM   3635  C  CA  . ASP B 2 130 ? 13.31395  -11.06580 -40.49602 1.000 37.49345  ? 130 ASP B CA  1 
ATOM   3636  C  C   . ASP B 2 130 ? 13.63047  -10.84634 -39.02215 1.000 34.74809  ? 130 ASP B C   1 
ATOM   3637  O  O   . ASP B 2 130 ? 14.35261  -9.90004  -38.68935 1.000 44.49451  ? 130 ASP B O   1 
ATOM   3638  C  CB  . ASP B 2 130 ? 12.24171  -10.06939 -40.94104 1.000 45.44481  ? 130 ASP B CB  1 
ATOM   3639  C  CG  . ASP B 2 130 ? 12.17797  -9.91398  -42.44659 1.000 43.00900  ? 130 ASP B CG  1 
ATOM   3640  O  OD1 . ASP B 2 130 ? 13.18010  -10.23552 -43.12000 1.000 37.05440  ? 130 ASP B OD1 1 
ATOM   3641  O  OD2 . ASP B 2 130 ? 11.13292  -9.45257  -42.95526 1.000 48.63421  ? 130 ASP B OD2 1 
ATOM   3642  N  N   . MET B 2 131 ? 13.11320  -11.68844 -38.13272 1.000 35.21079  ? 131 MET B N   1 
ATOM   3643  C  CA  . MET B 2 131 ? 13.37752  -11.54997 -36.70841 1.000 32.69956  ? 131 MET B CA  1 
ATOM   3644  C  C   . MET B 2 131 ? 14.37839  -12.57117 -36.18271 1.000 31.23046  ? 131 MET B C   1 
ATOM   3645  O  O   . MET B 2 131 ? 14.89578  -12.39005 -35.07717 1.000 35.32193  ? 131 MET B O   1 
ATOM   3646  C  CB  . MET B 2 131 ? 12.06909  -11.66588 -35.91357 1.000 29.89339  ? 131 MET B CB  1 
ATOM   3647  C  CG  . MET B 2 131 ? 11.06271  -10.55327 -36.17060 1.000 30.50544  ? 131 MET B CG  1 
ATOM   3648  S  SD  . MET B 2 131 ? 11.51828  -8.99037  -35.39021 1.000 38.44821  ? 131 MET B SD  1 
ATOM   3649  C  CE  . MET B 2 131 ? 11.13526  -9.34204  -33.67661 1.000 39.38445  ? 131 MET B CE  1 
ATOM   3650  N  N   . ASN B 2 132 ? 14.68277  -13.62444 -36.94796 1.000 34.36739  ? 132 ASN B N   1 
ATOM   3651  C  CA  . ASN B 2 132 ? 15.49074  -14.72854 -36.44145 1.000 34.62821  ? 132 ASN B CA  1 
ATOM   3652  C  C   . ASN B 2 132 ? 16.68756  -15.05549 -37.32839 1.000 43.47660  ? 132 ASN B C   1 
ATOM   3653  O  O   . ASN B 2 132 ? 17.23751  -16.15530 -37.22440 1.000 54.10386  ? 132 ASN B O   1 
ATOM   3654  C  CB  . ASN B 2 132 ? 14.63642  -15.98618 -36.26867 1.000 34.28302  ? 132 ASN B CB  1 
ATOM   3655  C  CG  . ASN B 2 132 ? 13.77959  -15.94227 -35.03270 1.000 35.67305  ? 132 ASN B CG  1 
ATOM   3656  O  OD1 . ASN B 2 132 ? 14.20715  -15.45243 -33.98790 1.000 44.40958  ? 132 ASN B OD1 1 
ATOM   3657  N  ND2 . ASN B 2 132 ? 12.56216  -16.46525 -35.13688 1.000 32.09896  ? 132 ASN B ND2 1 
ATOM   3658  N  N   . LEU B 2 133 ? 17.10589  -14.14322 -38.19683 1.000 38.19151  ? 133 LEU B N   1 
ATOM   3659  C  CA  . LEU B 2 133 ? 18.29697  -14.34584 -39.00644 1.000 33.30406  ? 133 LEU B CA  1 
ATOM   3660  C  C   . LEU B 2 133 ? 19.15672  -13.09601 -38.94953 1.000 36.47500  ? 133 LEU B C   1 
ATOM   3661  O  O   . LEU B 2 133 ? 18.65119  -11.98652 -38.77018 1.000 33.81599  ? 133 LEU B O   1 
ATOM   3662  C  CB  . LEU B 2 133 ? 17.96384  -14.66814 -40.47010 1.000 36.46782  ? 133 LEU B CB  1 
ATOM   3663  C  CG  . LEU B 2 133 ? 17.34312  -16.01968 -40.81994 1.000 35.23304  ? 133 LEU B CG  1 
ATOM   3664  C  CD1 . LEU B 2 133 ? 17.12106  -16.11178 -42.32525 1.000 33.18326  ? 133 LEU B CD1 1 
ATOM   3665  C  CD2 . LEU B 2 133 ? 18.21235  -17.16891 -40.33037 1.000 31.48348  ? 133 LEU B CD2 1 
ATOM   3666  N  N   . ALA B 2 134 ? 20.46198  -13.28409 -39.10730 1.000 31.64023  ? 134 ALA B N   1 
ATOM   3667  C  CA  . ALA B 2 134 ? 21.40100  -12.17510 -39.16288 1.000 34.59330  ? 134 ALA B CA  1 
ATOM   3668  C  C   . ALA B 2 134 ? 22.35551  -12.38614 -40.32515 1.000 37.99942  ? 134 ALA B C   1 
ATOM   3669  O  O   . ALA B 2 134 ? 22.82660  -13.50281 -40.55531 1.000 39.43543  ? 134 ALA B O   1 
ATOM   3670  C  CB  . ALA B 2 134 ? 22.18729  -12.04125 -37.85923 1.000 32.41507  ? 134 ALA B CB  1 
ATOM   3671  N  N   . HIS B 2 135 ? 22.63368  -11.31217 -41.05866 1.000 37.32125  ? 135 HIS B N   1 
ATOM   3672  C  CA  . HIS B 2 135 ? 23.55955  -11.40223 -42.17685 1.000 39.80011  ? 135 HIS B CA  1 
ATOM   3673  C  C   . HIS B 2 135 ? 24.96266  -11.70004 -41.66951 1.000 41.33025  ? 135 HIS B C   1 
ATOM   3674  O  O   . HIS B 2 135 ? 25.40330  -11.15306 -40.65503 1.000 44.54571  ? 135 HIS B O   1 
ATOM   3675  C  CB  . HIS B 2 135 ? 23.56362  -10.09890 -42.97130 1.000 39.36080  ? 135 HIS B CB  1 
ATOM   3676  C  CG  . HIS B 2 135 ? 22.28455  -9.82831  -43.69836 1.000 43.07281  ? 135 HIS B CG  1 
ATOM   3677  N  ND1 . HIS B 2 135 ? 21.99806  -10.37738 -44.92949 1.000 40.53025  ? 135 HIS B ND1 1 
ATOM   3678  C  CD2 . HIS B 2 135 ? 21.21829  -9.06027  -43.37136 1.000 37.81167  ? 135 HIS B CD2 1 
ATOM   3679  C  CE1 . HIS B 2 135 ? 20.80936  -9.96156  -45.32876 1.000 37.74203  ? 135 HIS B CE1 1 
ATOM   3680  N  NE2 . HIS B 2 135 ? 20.31574  -9.15968  -44.40243 1.000 40.71803  ? 135 HIS B NE2 1 
ATOM   3681  N  N   . LEU B 2 136 ? 25.66597  -12.57836 -42.37985 1.000 40.43032  ? 136 LEU B N   1 
ATOM   3682  C  CA  . LEU B 2 136 ? 27.02298  -12.93800 -42.00673 1.000 42.85487  ? 136 LEU B CA  1 
ATOM   3683  C  C   . LEU B 2 136 ? 28.00043  -12.16762 -42.87549 1.000 45.37491  ? 136 LEU B C   1 
ATOM   3684  O  O   . LEU B 2 136 ? 27.97945  -12.33318 -44.10519 1.000 40.60721  ? 136 LEU B O   1 
ATOM   3685  C  CB  . LEU B 2 136 ? 27.25154  -14.43676 -42.16324 1.000 45.81921  ? 136 LEU B CB  1 
ATOM   3686  C  CG  . LEU B 2 136 ? 28.69727  -14.86643 -41.90844 1.000 49.87601  ? 136 LEU B CG  1 
ATOM   3687  C  CD1 . LEU B 2 136 ? 29.08716  -14.58215 -40.46205 1.000 40.12432  ? 136 LEU B CD1 1 
ATOM   3688  C  CD2 . LEU B 2 136 ? 28.91022  -16.32439 -42.25076 1.000 51.88164  ? 136 LEU B CD2 1 
ATOM   3689  N  N   . PRO B 2 137 ? 28.85666  -11.32552 -42.30806 1.000 45.74326  ? 137 PRO B N   1 
ATOM   3690  C  CA  . PRO B 2 137 ? 29.86151  -10.64502 -43.12891 1.000 50.97335  ? 137 PRO B CA  1 
ATOM   3691  C  C   . PRO B 2 137 ? 30.86824  -11.63642 -43.68835 1.000 50.95815  ? 137 PRO B C   1 
ATOM   3692  O  O   . PRO B 2 137 ? 31.22543  -12.62719 -43.04593 1.000 54.51681  ? 137 PRO B O   1 
ATOM   3693  C  CB  . PRO B 2 137 ? 30.52744  -9.67109  -42.14839 1.000 48.08490  ? 137 PRO B CB  1 
ATOM   3694  C  CG  . PRO B 2 137 ? 29.57443  -9.56428  -40.98890 1.000 49.42446  ? 137 PRO B CG  1 
ATOM   3695  C  CD  . PRO B 2 137 ? 28.90069  -10.89567 -40.90287 1.000 42.53299  ? 137 PRO B CD  1 
ATOM   3696  N  N   . LYS B 2 138 ? 31.33602  -11.34712 -44.90441 1.000 46.43193  ? 138 LYS B N   1 
ATOM   3697  C  CA  . LYS B 2 138 ? 32.33125  -12.19532 -45.55002 1.000 50.23814  ? 138 LYS B CA  1 
ATOM   3698  C  C   . LYS B 2 138 ? 33.63237  -12.27058 -44.76162 1.000 51.06184  ? 138 LYS B C   1 
ATOM   3699  O  O   . LYS B 2 138 ? 34.39307  -13.22852 -44.93296 1.000 58.47938  ? 138 LYS B O   1 
ATOM   3700  C  CB  . LYS B 2 138 ? 32.60254  -11.68230 -46.96256 1.000 58.15816  ? 138 LYS B CB  1 
ATOM   3701  C  CG  . LYS B 2 138 ? 33.02755  -10.22468 -46.99999 1.000 71.63048  ? 138 LYS B CG  1 
ATOM   3702  C  CD  . LYS B 2 138 ? 33.08903  -9.69632  -48.42306 1.000 79.78858  ? 138 LYS B CD  1 
ATOM   3703  C  CE  . LYS B 2 138 ? 33.40749  -8.20870  -48.44291 1.000 88.01110  ? 138 LYS B CE  1 
ATOM   3704  N  NZ  . LYS B 2 138 ? 33.42762  -7.66790  -49.83041 1.000 106.98401 ? 138 LYS B NZ  1 
ATOM   3705  N  N   . GLU B 2 139 ? 33.90529  -11.28476 -43.90551 1.000 57.02738  ? 139 GLU B N   1 
ATOM   3706  C  CA  . GLU B 2 139 ? 35.15525  -11.23565 -43.15740 1.000 46.78917  ? 139 GLU B CA  1 
ATOM   3707  C  C   . GLU B 2 139 ? 35.23768  -12.28101 -42.05076 1.000 50.71714  ? 139 GLU B C   1 
ATOM   3708  O  O   . GLU B 2 139 ? 36.33036  -12.49788 -41.51644 1.000 53.57228  ? 139 GLU B O   1 
ATOM   3709  C  CB  . GLU B 2 139 ? 35.34981  -9.84311  -42.54737 1.000 53.85043  ? 139 GLU B CB  1 
ATOM   3710  C  CG  . GLU B 2 139 ? 35.58083  -8.72817  -43.55967 1.000 59.06924  ? 139 GLU B CG  1 
ATOM   3711  C  CD  . GLU B 2 139 ? 34.28817  -8.17961  -44.14554 1.000 67.75741  ? 139 GLU B CD  1 
ATOM   3712  O  OE1 . GLU B 2 139 ? 33.20579  -8.72802  -43.84184 1.000 59.95405  ? 139 GLU B OE1 1 
ATOM   3713  O  OE2 . GLU B 2 139 ? 34.35741  -7.20141  -44.91972 1.000 69.81874  ? 139 GLU B OE2 1 
ATOM   3714  N  N   . ILE B 2 140 ? 34.13256  -12.91768 -41.68433 1.000 42.85374  ? 140 ILE B N   1 
ATOM   3715  C  CA  . ILE B 2 140 ? 34.10321  -13.88738 -40.59203 1.000 38.76157  ? 140 ILE B CA  1 
ATOM   3716  C  C   . ILE B 2 140 ? 34.10896  -15.28301 -41.19964 1.000 44.13426  ? 140 ILE B C   1 
ATOM   3717  O  O   . ILE B 2 140 ? 33.19966  -15.60857 -41.97905 1.000 48.78488  ? 140 ILE B O   1 
ATOM   3718  C  CB  . ILE B 2 140 ? 32.88082  -13.68362 -39.68594 1.000 42.00136  ? 140 ILE B CB  1 
ATOM   3719  C  CG1 . ILE B 2 140 ? 32.87778  -12.26414 -39.12270 1.000 39.66194  ? 140 ILE B CG1 1 
ATOM   3720  C  CG2 . ILE B 2 140 ? 32.88890  -14.69120 -38.54756 1.000 33.39343  ? 140 ILE B CG2 1 
ATOM   3721  C  CD1 . ILE B 2 140 ? 31.74927  -11.99138 -38.16944 1.000 41.95070  ? 140 ILE B CD1 1 
ATOM   3722  N  N   . PRO B 2 141 ? 35.09341  -16.12635 -40.89234 1.000 49.82019  ? 141 PRO B N   1 
ATOM   3723  C  CA  . PRO B 2 141 ? 35.10928  -17.47950 -41.45588 1.000 47.35610  ? 141 PRO B CA  1 
ATOM   3724  C  C   . PRO B 2 141 ? 34.00403  -18.33872 -40.86197 1.000 45.21623  ? 141 PRO B C   1 
ATOM   3725  O  O   . PRO B 2 141 ? 33.47024  -18.06293 -39.78462 1.000 57.62724  ? 141 PRO B O   1 
ATOM   3726  C  CB  . PRO B 2 141 ? 36.49510  -18.01677 -41.07141 1.000 44.75432  ? 141 PRO B CB  1 
ATOM   3727  C  CG  . PRO B 2 141 ? 37.28493  -16.81370 -40.62448 1.000 50.47733  ? 141 PRO B CG  1 
ATOM   3728  C  CD  . PRO B 2 141 ? 36.28139  -15.85855 -40.06662 1.000 46.30134  ? 141 PRO B CD  1 
ATOM   3729  N  N   . LEU B 2 142 ? 33.67524  -19.41130 -41.58700 1.000 52.22666  ? 142 LEU B N   1 
ATOM   3730  C  CA  . LEU B 2 142 ? 32.55642  -20.26061 -41.18873 1.000 45.54579  ? 142 LEU B CA  1 
ATOM   3731  C  C   . LEU B 2 142 ? 32.81441  -20.92471 -39.84372 1.000 46.06792  ? 142 LEU B C   1 
ATOM   3732  O  O   . LEU B 2 142 ? 31.90183  -21.03873 -39.01684 1.000 45.45531  ? 142 LEU B O   1 
ATOM   3733  C  CB  . LEU B 2 142 ? 32.28771  -21.31731 -42.25972 1.000 48.14986  ? 142 LEU B CB  1 
ATOM   3734  C  CG  . LEU B 2 142 ? 31.73071  -20.80333 -43.58524 1.000 36.37951  ? 142 LEU B CG  1 
ATOM   3735  C  CD1 . LEU B 2 142 ? 31.58518  -21.94333 -44.58183 1.000 41.66433  ? 142 LEU B CD1 1 
ATOM   3736  C  CD2 . LEU B 2 142 ? 30.40407  -20.09830 -43.36831 1.000 41.40511  ? 142 LEU B CD2 1 
ATOM   3737  N  N   . GLU B 2 143 ? 34.05334  -21.36506 -39.60452 1.000 47.00756  ? 143 GLU B N   1 
ATOM   3738  C  CA  . GLU B 2 143 ? 34.36511  -22.04793 -38.35333 1.000 49.78562  ? 143 GLU B CA  1 
ATOM   3739  C  C   . GLU B 2 143 ? 34.08735  -21.14920 -37.15710 1.000 46.59183  ? 143 GLU B C   1 
ATOM   3740  O  O   . GLU B 2 143 ? 33.53873  -21.60027 -36.14514 1.000 45.08742  ? 143 GLU B O   1 
ATOM   3741  C  CB  . GLU B 2 143 ? 35.82753  -22.50022 -38.34630 1.000 49.08971  ? 143 GLU B CB  1 
ATOM   3742  C  CG  . GLU B 2 143 ? 36.17749  -23.55411 -39.39011 1.000 66.69442  ? 143 GLU B CG  1 
ATOM   3743  C  CD  . GLU B 2 143 ? 36.48345  -22.95861 -40.75716 1.000 71.39395  ? 143 GLU B CD  1 
ATOM   3744  O  OE1 . GLU B 2 143 ? 36.46435  -21.71549 -40.88933 1.000 60.72006  ? 143 GLU B OE1 1 
ATOM   3745  O  OE2 . GLU B 2 143 ? 36.74182  -23.73647 -41.70197 1.000 84.26780  ? 143 GLU B OE2 1 
ATOM   3746  N  N   . ALA B 2 144 ? 34.43159  -19.86623 -37.26491 1.000 44.95084  ? 144 ALA B N   1 
ATOM   3747  C  CA  . ALA B 2 144 ? 34.17110  -18.94188 -36.16992 1.000 41.60478  ? 144 ALA B CA  1 
ATOM   3748  C  C   . ALA B 2 144 ? 32.69534  -18.57854 -36.08821 1.000 42.87083  ? 144 ALA B C   1 
ATOM   3749  O  O   . ALA B 2 144 ? 32.14178  -18.46208 -34.98851 1.000 43.83563  ? 144 ALA B O   1 
ATOM   3750  C  CB  . ALA B 2 144 ? 35.02177  -17.67997 -36.33113 1.000 43.46556  ? 144 ALA B CB  1 
ATOM   3751  N  N   . ALA B 2 145 ? 32.04611  -18.39208 -37.24106 1.000 42.64701  ? 145 ALA B N   1 
ATOM   3752  C  CA  . ALA B 2 145 ? 30.66072  -17.93564 -37.24842 1.000 38.33567  ? 145 ALA B CA  1 
ATOM   3753  C  C   . ALA B 2 145 ? 29.71966  -18.96306 -36.63437 1.000 40.38323  ? 145 ALA B C   1 
ATOM   3754  O  O   . ALA B 2 145 ? 28.72503  -18.58655 -36.00601 1.000 42.53598  ? 145 ALA B O   1 
ATOM   3755  C  CB  . ALA B 2 145 ? 30.22623  -17.60151 -38.67382 1.000 45.64589  ? 145 ALA B CB  1 
ATOM   3756  N  N   . VAL B 2 146 ? 30.00940  -20.25719 -36.80138 1.000 42.01423  ? 146 VAL B N   1 
ATOM   3757  C  CA  . VAL B 2 146 ? 29.12730  -21.29889 -36.27468 1.000 39.93158  ? 146 VAL B CA  1 
ATOM   3758  C  C   . VAL B 2 146 ? 29.25501  -21.47191 -34.76602 1.000 42.88463  ? 146 VAL B C   1 
ATOM   3759  O  O   . VAL B 2 146 ? 28.48091  -22.22959 -34.16598 1.000 42.59644  ? 146 VAL B O   1 
ATOM   3760  C  CB  . VAL B 2 146 ? 29.39776  -22.61284 -37.03517 1.000 37.34760  ? 146 VAL B CB  1 
ATOM   3761  C  CG1 . VAL B 2 146 ? 30.70927  -23.23753 -36.59821 1.000 44.49030  ? 146 VAL B CG1 1 
ATOM   3762  C  CG2 . VAL B 2 146 ? 28.23581  -23.58984 -36.88488 1.000 40.73340  ? 146 VAL B CG2 1 
ATOM   3763  N  N   . MET B 2 147 ? 30.19215  -20.77687 -34.12336 1.000 38.20175  ? 147 MET B N   1 
ATOM   3764  C  CA  . MET B 2 147 ? 30.23745  -20.75677 -32.66645 1.000 41.67352  ? 147 MET B CA  1 
ATOM   3765  C  C   . MET B 2 147 ? 29.29435  -19.72023 -32.07012 1.000 37.91356  ? 147 MET B C   1 
ATOM   3766  O  O   . MET B 2 147 ? 29.02886  -19.75992 -30.86313 1.000 35.47462  ? 147 MET B O   1 
ATOM   3767  C  CB  . MET B 2 147 ? 31.67055  -20.50332 -32.18595 1.000 36.42687  ? 147 MET B CB  1 
ATOM   3768  C  CG  . MET B 2 147 ? 32.67725  -21.58088 -32.59534 1.000 36.40044  ? 147 MET B CG  1 
ATOM   3769  S  SD  . MET B 2 147 ? 32.36303  -23.21835 -31.88992 1.000 44.08468  ? 147 MET B SD  1 
ATOM   3770  C  CE  . MET B 2 147 ? 31.55741  -24.04976 -33.25449 1.000 38.20722  ? 147 MET B CE  1 
ATOM   3771  N  N   . ILE B 2 148 ? 28.79073  -18.79730 -32.88180 1.000 39.74030  ? 148 ILE B N   1 
ATOM   3772  C  CA  . ILE B 2 148 ? 27.89365  -17.73830 -32.42595 1.000 32.03916  ? 148 ILE B CA  1 
ATOM   3773  C  C   . ILE B 2 148 ? 26.49423  -18.25751 -32.09718 1.000 33.90519  ? 148 ILE B C   1 
ATOM   3774  O  O   . ILE B 2 148 ? 25.93491  -17.84350 -31.07247 1.000 36.94609  ? 148 ILE B O   1 
ATOM   3775  C  CB  . ILE B 2 148 ? 27.81649  -16.60746 -33.46310 1.000 34.88575  ? 148 ILE B CB  1 
ATOM   3776  C  CG1 . ILE B 2 148 ? 29.21380  -16.04227 -33.73458 1.000 34.04670  ? 148 ILE B CG1 1 
ATOM   3777  C  CG2 . ILE B 2 148 ? 26.85732  -15.52481 -32.99282 1.000 25.54522  ? 148 ILE B CG2 1 
ATOM   3778  C  CD1 . ILE B 2 148 ? 29.24579  -14.96875 -34.79743 1.000 33.93522  ? 148 ILE B CD1 1 
ATOM   3779  N  N   . PRO B 2 149 ? 25.87417  -19.12813 -32.91521 1.000 37.12932  ? 149 PRO B N   1 
ATOM   3780  C  CA  . PRO B 2 149 ? 24.47255  -19.50629 -32.64990 1.000 38.37371  ? 149 PRO B CA  1 
ATOM   3781  C  C   . PRO B 2 149 ? 24.19266  -20.02470 -31.25278 1.000 32.42195  ? 149 PRO B C   1 
ATOM   3782  O  O   . PRO B 2 149 ? 23.07542  -19.84299 -30.75060 1.000 30.69967  ? 149 PRO B O   1 
ATOM   3783  C  CB  . PRO B 2 149 ? 24.21769  -20.61023 -33.68562 1.000 30.51942  ? 149 PRO B CB  1 
ATOM   3784  C  CG  . PRO B 2 149 ? 25.08006  -20.25886 -34.80440 1.000 27.33809  ? 149 PRO B CG  1 
ATOM   3785  C  CD  . PRO B 2 149 ? 26.34299  -19.73984 -34.17419 1.000 31.15721  ? 149 PRO B CD  1 
ATOM   3786  N  N   . ASP B 2 150 ? 25.16015  -20.67693 -30.61148 1.000 37.24148  ? 150 ASP B N   1 
ATOM   3787  C  CA  . ASP B 2 150 ? 24.88300  -21.36168 -29.35525 1.000 36.12425  ? 150 ASP B CA  1 
ATOM   3788  C  C   . ASP B 2 150 ? 25.96051  -21.13282 -28.30201 1.000 37.41731  ? 150 ASP B C   1 
ATOM   3789  O  O   . ASP B 2 150 ? 25.66628  -20.63763 -27.21136 1.000 36.92026  ? 150 ASP B O   1 
ATOM   3790  C  CB  . ASP B 2 150 ? 24.72134  -22.85786 -29.61975 1.000 44.74099  ? 150 ASP B CB  1 
ATOM   3791  C  CG  . ASP B 2 150 ? 24.19523  -23.60770 -28.42200 1.000 45.87943  ? 150 ASP B CG  1 
ATOM   3792  O  OD1 . ASP B 2 150 ? 23.84902  -22.95962 -27.41535 1.000 50.57294  ? 150 ASP B OD1 1 
ATOM   3793  O  OD2 . ASP B 2 150 ? 24.12352  -24.84973 -28.49535 1.000 57.01550  ? 150 ASP B OD2 1 
ATOM   3794  N  N   . MET B 2 151 ? 27.20646  -21.49615 -28.61241 1.000 41.59241  ? 151 MET B N   1 
ATOM   3795  C  CA  . MET B 2 151 ? 28.26237  -21.44693 -27.60575 1.000 35.70306  ? 151 MET B CA  1 
ATOM   3796  C  C   . MET B 2 151 ? 28.49435  -20.02376 -27.12384 1.000 40.96597  ? 151 MET B C   1 
ATOM   3797  O  O   . MET B 2 151 ? 28.50626  -19.75709 -25.91598 1.000 34.96987  ? 151 MET B O   1 
ATOM   3798  C  CB  . MET B 2 151 ? 29.55514  -22.03951 -28.16781 1.000 38.80748  ? 151 MET B CB  1 
ATOM   3799  C  CG  . MET B 2 151 ? 29.42618  -23.46943 -28.65371 1.000 32.53051  ? 151 MET B CG  1 
ATOM   3800  S  SD  . MET B 2 151 ? 29.04794  -24.62915 -27.32730 1.000 45.46278  ? 151 MET B SD  1 
ATOM   3801  C  CE  . MET B 2 151 ? 27.28102  -24.86249 -27.53107 1.000 46.19351  ? 151 MET B CE  1 
ATOM   3802  N  N   . MET B 2 152 ? 28.65785  -19.08809 -28.05751 1.000 37.19377  ? 152 MET B N   1 
ATOM   3803  C  CA  . MET B 2 152 ? 28.96191  -17.71723 -27.67166 1.000 28.98369  ? 152 MET B CA  1 
ATOM   3804  C  C   . MET B 2 152 ? 27.78675  -17.06770 -26.95363 1.000 37.78545  ? 152 MET B C   1 
ATOM   3805  O  O   . MET B 2 152 ? 27.96295  -16.42381 -25.91237 1.000 35.45669  ? 152 MET B O   1 
ATOM   3806  C  CB  . MET B 2 152 ? 29.34812  -16.89925 -28.89850 1.000 31.99472  ? 152 MET B CB  1 
ATOM   3807  C  CG  . MET B 2 152 ? 29.75304  -15.49068 -28.54852 1.000 35.97780  ? 152 MET B CG  1 
ATOM   3808  S  SD  . MET B 2 152 ? 30.32533  -14.56644 -29.97505 1.000 43.93888  ? 152 MET B SD  1 
ATOM   3809  C  CE  . MET B 2 152 ? 31.64050  -15.63234 -30.54067 1.000 32.25737  ? 152 MET B CE  1 
ATOM   3810  N  N   . THR B 2 153 ? 26.57634  -17.22080 -27.49354 1.000 37.18148  ? 153 THR B N   1 
ATOM   3811  C  CA  . THR B 2 153 ? 25.43023  -16.56880 -26.87395 1.000 33.24836  ? 153 THR B CA  1 
ATOM   3812  C  C   . THR B 2 153 ? 25.12448  -17.16158 -25.50269 1.000 36.80559  ? 153 THR B C   1 
ATOM   3813  O  O   . THR B 2 153 ? 24.68040  -16.43633 -24.60556 1.000 33.71315  ? 153 THR B O   1 
ATOM   3814  C  CB  . THR B 2 153 ? 24.21237  -16.64291 -27.80165 1.000 34.43695  ? 153 THR B CB  1 
ATOM   3815  O  OG1 . THR B 2 153 ? 23.08867  -16.00559 -27.18149 1.000 35.34954  ? 153 THR B OG1 1 
ATOM   3816  C  CG2 . THR B 2 153 ? 23.85737  -18.08007 -28.12536 1.000 33.29920  ? 153 THR B CG2 1 
ATOM   3817  N  N   . THR B 2 154 ? 25.38588  -18.45706 -25.30819 1.000 32.11646  ? 154 THR B N   1 
ATOM   3818  C  CA  . THR B 2 154 ? 25.16387  -19.07120 -24.00141 1.000 33.03760  ? 154 THR B CA  1 
ATOM   3819  C  C   . THR B 2 154 ? 26.20220  -18.60633 -22.99103 1.000 32.11711  ? 154 THR B C   1 
ATOM   3820  O  O   . THR B 2 154 ? 25.85794  -18.13102 -21.90218 1.000 35.49117  ? 154 THR B O   1 
ATOM   3821  C  CB  . THR B 2 154 ? 25.20910  -20.59414 -24.11471 1.000 37.65262  ? 154 THR B CB  1 
ATOM   3822  O  OG1 . THR B 2 154 ? 24.26862  -21.03778 -25.09867 1.000 46.11733  ? 154 THR B OG1 1 
ATOM   3823  C  CG2 . THR B 2 154 ? 24.88418  -21.23446 -22.77348 1.000 36.57173  ? 154 THR B CG2 1 
ATOM   3824  N  N   . GLY B 2 155 ? 27.48373  -18.74620 -23.33405 1.000 37.55352  ? 155 GLY B N   1 
ATOM   3825  C  CA  . GLY B 2 155 ? 28.52974  -18.34559 -22.41178 1.000 35.71577  ? 155 GLY B CA  1 
ATOM   3826  C  C   . GLY B 2 155 ? 28.46321  -16.87209 -22.06784 1.000 31.14086  ? 155 GLY B C   1 
ATOM   3827  O  O   . GLY B 2 155 ? 28.58653  -16.49239 -20.90208 1.000 34.55581  ? 155 GLY B O   1 
ATOM   3828  N  N   . PHE B 2 156 ? 28.24376  -16.02247 -23.07455 1.000 32.45246  ? 156 PHE B N   1 
ATOM   3829  C  CA  . PHE B 2 156 ? 28.11845  -14.59439 -22.80943 1.000 31.56974  ? 156 PHE B CA  1 
ATOM   3830  C  C   . PHE B 2 156 ? 26.89643  -14.30258 -21.95456 1.000 30.16732  ? 156 PHE B C   1 
ATOM   3831  O  O   . PHE B 2 156 ? 26.89770  -13.34614 -21.17288 1.000 32.65554  ? 156 PHE B O   1 
ATOM   3832  C  CB  . PHE B 2 156 ? 28.04838  -13.80498 -24.11957 1.000 28.88766  ? 156 PHE B CB  1 
ATOM   3833  C  CG  . PHE B 2 156 ? 29.35734  -13.72574 -24.86299 1.000 30.71175  ? 156 PHE B CG  1 
ATOM   3834  C  CD1 . PHE B 2 156 ? 30.45715  -14.46587 -24.45833 1.000 33.70752  ? 156 PHE B CD1 1 
ATOM   3835  C  CD2 . PHE B 2 156 ? 29.48641  -12.89798 -25.96719 1.000 35.48416  ? 156 PHE B CD2 1 
ATOM   3836  C  CE1 . PHE B 2 156 ? 31.65714  -14.38601 -25.14514 1.000 32.64129  ? 156 PHE B CE1 1 
ATOM   3837  C  CE2 . PHE B 2 156 ? 30.68273  -12.81150 -26.65477 1.000 29.39681  ? 156 PHE B CE2 1 
ATOM   3838  C  CZ  . PHE B 2 156 ? 31.76848  -13.55640 -26.24402 1.000 29.64897  ? 156 PHE B CZ  1 
ATOM   3839  N  N   . HIS B 2 157 ? 25.84559  -15.11080 -22.08773 1.000 34.41846  ? 157 HIS B N   1 
ATOM   3840  C  CA  . HIS B 2 157 ? 24.66575  -14.90837 -21.25809 1.000 33.39900  ? 157 HIS B CA  1 
ATOM   3841  C  C   . HIS B 2 157 ? 24.97915  -15.17114 -19.79371 1.000 28.27480  ? 157 HIS B C   1 
ATOM   3842  O  O   . HIS B 2 157 ? 24.48890  -14.45888 -18.91011 1.000 34.00252  ? 157 HIS B O   1 
ATOM   3843  C  CB  . HIS B 2 157 ? 23.52928  -15.80888 -21.73376 1.000 34.13440  ? 157 HIS B CB  1 
ATOM   3844  C  CG  . HIS B 2 157 ? 22.20133  -15.45342 -21.14912 1.000 30.24331  ? 157 HIS B CG  1 
ATOM   3845  N  ND1 . HIS B 2 157 ? 21.74363  -14.15534 -21.08640 1.000 34.03174  ? 157 HIS B ND1 1 
ATOM   3846  C  CD2 . HIS B 2 157 ? 21.23348  -16.22218 -20.59916 1.000 34.00435  ? 157 HIS B CD2 1 
ATOM   3847  C  CE1 . HIS B 2 157 ? 20.54933  -14.13974 -20.52246 1.000 34.16267  ? 157 HIS B CE1 1 
ATOM   3848  N  NE2 . HIS B 2 157 ? 20.21789  -15.38096 -20.21712 1.000 33.33732  ? 157 HIS B NE2 1 
ATOM   3849  N  N   . GLY B 2 158 ? 25.80108  -16.18389 -19.51962 1.000 31.95272  ? 158 GLY B N   1 
ATOM   3850  C  CA  . GLY B 2 158 ? 26.23292  -16.41979 -18.15307 1.000 26.45409  ? 158 GLY B CA  1 
ATOM   3851  C  C   . GLY B 2 158 ? 26.95690  -15.22668 -17.56217 1.000 33.38499  ? 158 GLY B C   1 
ATOM   3852  O  O   . GLY B 2 158 ? 26.73540  -14.86560 -16.40398 1.000 38.73034  ? 158 GLY B O   1 
ATOM   3853  N  N   . ALA B 2 159 ? 27.82299  -14.58873 -18.35399 1.000 32.76005  ? 159 ALA B N   1 
ATOM   3854  C  CA  . ALA B 2 159 ? 28.51471  -13.39597 -17.87652 1.000 27.98825  ? 159 ALA B CA  1 
ATOM   3855  C  C   . ALA B 2 159 ? 27.54532  -12.24157 -17.66153 1.000 32.32844  ? 159 ALA B C   1 
ATOM   3856  O  O   . ALA B 2 159 ? 27.69624  -11.47117 -16.70779 1.000 36.13395  ? 159 ALA B O   1 
ATOM   3857  C  CB  . ALA B 2 159 ? 29.61434  -12.99877 -18.85785 1.000 24.82381  ? 159 ALA B CB  1 
ATOM   3858  N  N   . GLU B 2 160 ? 26.54782  -12.10342 -18.53957 1.000 30.67902  ? 160 GLU B N   1 
ATOM   3859  C  CA  . GLU B 2 160 ? 25.53735  -11.06191 -18.37093 1.000 28.73064  ? 160 GLU B CA  1 
ATOM   3860  C  C   . GLU B 2 160 ? 24.71459  -11.28913 -17.11087 1.000 33.41664  ? 160 GLU B C   1 
ATOM   3861  O  O   . GLU B 2 160 ? 24.46255  -10.35366 -16.34185 1.000 37.30807  ? 160 GLU B O   1 
ATOM   3862  C  CB  . GLU B 2 160 ? 24.62401  -11.02077 -19.59333 1.000 27.48393  ? 160 GLU B CB  1 
ATOM   3863  C  CG  . GLU B 2 160 ? 25.29680  -10.54183 -20.85927 1.000 35.66615  ? 160 GLU B CG  1 
ATOM   3864  C  CD  . GLU B 2 160 ? 24.44968  -10.79338 -22.08595 1.000 34.64651  ? 160 GLU B CD  1 
ATOM   3865  O  OE1 . GLU B 2 160 ? 23.72641  -11.80980 -22.10153 1.000 33.96031  ? 160 GLU B OE1 1 
ATOM   3866  O  OE2 . GLU B 2 160 ? 24.48480  -9.96655  -23.02222 1.000 42.60709  ? 160 GLU B OE2 1 
ATOM   3867  N  N   . LEU B 2 161 ? 24.27794  -12.53175 -16.88627 1.000 38.79763  ? 161 LEU B N   1 
ATOM   3868  C  CA  . LEU B 2 161 ? 23.48093  -12.82694 -15.70160 1.000 30.44056  ? 161 LEU B CA  1 
ATOM   3869  C  C   . LEU B 2 161 ? 24.28328  -12.62276 -14.42651 1.000 35.82674  ? 161 LEU B C   1 
ATOM   3870  O  O   . LEU B 2 161 ? 23.70935  -12.31313 -13.37658 1.000 39.42782  ? 161 LEU B O   1 
ATOM   3871  C  CB  . LEU B 2 161 ? 22.94810  -14.25860 -15.76903 1.000 33.71298  ? 161 LEU B CB  1 
ATOM   3872  C  CG  . LEU B 2 161 ? 21.89653  -14.57774 -16.83734 1.000 38.66206  ? 161 LEU B CG  1 
ATOM   3873  C  CD1 . LEU B 2 161 ? 21.61682  -16.07135 -16.87426 1.000 32.10294  ? 161 LEU B CD1 1 
ATOM   3874  C  CD2 . LEU B 2 161 ? 20.60680  -13.80098 -16.59643 1.000 27.26701  ? 161 LEU B CD2 1 
ATOM   3875  N  N   . ALA B 2 162 ? 25.60822  -12.75761 -14.50717 1.000 37.09338  ? 162 ALA B N   1 
ATOM   3876  C  CA  . ALA B 2 162 ? 26.46918  -12.72706 -13.33248 1.000 36.04547  ? 162 ALA B CA  1 
ATOM   3877  C  C   . ALA B 2 162 ? 26.54649  -11.35491 -12.67674 1.000 38.87759  ? 162 ALA B C   1 
ATOM   3878  O  O   . ALA B 2 162 ? 27.01657  -11.26593 -11.53689 1.000 45.93911  ? 162 ALA B O   1 
ATOM   3879  C  CB  . ALA B 2 162 ? 27.87347  -13.20182 -13.71301 1.000 35.25034  ? 162 ALA B CB  1 
ATOM   3880  N  N   . ASP B 2 163 ? 26.10198  -10.29939 -13.35594 1.000 35.43481  ? 163 ASP B N   1 
ATOM   3881  C  CA  . ASP B 2 163 ? 26.12899  -8.93107  -12.83466 1.000 41.80743  ? 163 ASP B CA  1 
ATOM   3882  C  C   . ASP B 2 163 ? 27.54020  -8.53568  -12.40079 1.000 42.31040  ? 163 ASP B C   1 
ATOM   3883  O  O   . ASP B 2 163 ? 27.80067  -8.19625  -11.24378 1.000 36.93403  ? 163 ASP B O   1 
ATOM   3884  C  CB  . ASP B 2 163 ? 25.13465  -8.75732  -11.68372 1.000 43.13462  ? 163 ASP B CB  1 
ATOM   3885  C  CG  . ASP B 2 163 ? 23.69258  -8.84433  -12.14135 1.000 53.66823  ? 163 ASP B CG  1 
ATOM   3886  O  OD1 . ASP B 2 163 ? 23.41977  -8.56473  -13.33143 1.000 51.51955  ? 163 ASP B OD1 1 
ATOM   3887  O  OD2 . ASP B 2 163 ? 22.82896  -9.18536  -11.30309 1.000 62.87148  ? 163 ASP B OD2 1 
ATOM   3888  N  N   . ILE B 2 164 ? 28.45670  -8.60066  -13.36099 1.000 32.76195  ? 164 ILE B N   1 
ATOM   3889  C  CA  . ILE B 2 164 ? 29.86621  -8.32623  -13.10558 1.000 35.55184  ? 164 ILE B CA  1 
ATOM   3890  C  C   . ILE B 2 164 ? 30.08014  -6.81747  -13.09686 1.000 36.26233  ? 164 ILE B C   1 
ATOM   3891  O  O   . ILE B 2 164 ? 29.72998  -6.12323  -14.05768 1.000 39.21151  ? 164 ILE B O   1 
ATOM   3892  C  CB  . ILE B 2 164 ? 30.75470  -9.00462  -14.15690 1.000 36.97736  ? 164 ILE B CB  1 
ATOM   3893  C  CG1 . ILE B 2 164 ? 30.55304  -10.51844 -14.11689 1.000 34.66754  ? 164 ILE B CG1 1 
ATOM   3894  C  CG2 . ILE B 2 164 ? 32.21469  -8.66760  -13.92155 1.000 35.50276  ? 164 ILE B CG2 1 
ATOM   3895  C  CD1 . ILE B 2 164 ? 31.18086  -11.24270 -15.28657 1.000 35.88372  ? 164 ILE B CD1 1 
ATOM   3896  N  N   . GLU B 2 165 ? 30.64217  -6.30730  -12.00745 1.000 37.20467  ? 165 GLU B N   1 
ATOM   3897  C  CA  . GLU B 2 165 ? 31.06857  -4.91970  -11.92676 1.000 38.77796  ? 165 GLU B CA  1 
ATOM   3898  C  C   . GLU B 2 165 ? 32.52952  -4.80422  -12.35617 1.000 34.05250  ? 165 GLU B C   1 
ATOM   3899  O  O   . GLU B 2 165 ? 33.28881  -5.77588  -12.31921 1.000 35.16480  ? 165 GLU B O   1 
ATOM   3900  C  CB  . GLU B 2 165 ? 30.88136  -4.38130  -10.50669 1.000 44.20036  ? 165 GLU B CB  1 
ATOM   3901  C  CG  . GLU B 2 165 ? 29.42801  -4.31362  -10.05874 1.000 55.36986  ? 165 GLU B CG  1 
ATOM   3902  C  CD  . GLU B 2 165 ? 29.27892  -4.22057  -8.55196  1.000 72.05416  ? 165 GLU B CD  1 
ATOM   3903  O  OE1 . GLU B 2 165 ? 30.30448  -4.30164  -7.84419  1.000 81.19245  ? 165 GLU B OE1 1 
ATOM   3904  O  OE2 . GLU B 2 165 ? 28.13412  -4.07211  -8.07321  1.000 84.41475  ? 165 GLU B OE2 1 
ATOM   3905  N  N   . LEU B 2 166 ? 32.91222  -3.60132  -12.78514 1.000 30.96177  ? 166 LEU B N   1 
ATOM   3906  C  CA  . LEU B 2 166 ? 34.26740  -3.37785  -13.27766 1.000 30.03882  ? 166 LEU B CA  1 
ATOM   3907  C  C   . LEU B 2 166 ? 35.28436  -3.74139  -12.20687 1.000 31.48598  ? 166 LEU B C   1 
ATOM   3908  O  O   . LEU B 2 166 ? 35.24143  -3.21029  -11.09352 1.000 35.03177  ? 166 LEU B O   1 
ATOM   3909  C  CB  . LEU B 2 166 ? 34.44483  -1.92074  -13.69879 1.000 26.97850  ? 166 LEU B CB  1 
ATOM   3910  C  CG  . LEU B 2 166 ? 33.78496  -1.46099  -14.99678 1.000 24.14196  ? 166 LEU B CG  1 
ATOM   3911  C  CD1 . LEU B 2 166 ? 34.13010  -0.00658  -15.26133 1.000 25.25173  ? 166 LEU B CD1 1 
ATOM   3912  C  CD2 . LEU B 2 166 ? 34.23365  -2.32639  -16.15236 1.000 29.68915  ? 166 LEU B CD2 1 
ATOM   3913  N  N   . GLY B 2 167 ? 36.20654  -4.63712  -12.55447 1.000 32.56065  ? 167 GLY B N   1 
ATOM   3914  C  CA  . GLY B 2 167 ? 37.24449  -5.08397  -11.65119 1.000 29.15005  ? 167 GLY B CA  1 
ATOM   3915  C  C   . GLY B 2 167 ? 36.86836  -6.22423  -10.73501 1.000 33.87231  ? 167 GLY B C   1 
ATOM   3916  O  O   . GLY B 2 167 ? 37.70624  -6.64441  -9.92594  1.000 35.90000  ? 167 GLY B O   1 
ATOM   3917  N  N   . ALA B 2 168 ? 35.64857  -6.74515  -10.83760 1.000 35.72623  ? 168 ALA B N   1 
ATOM   3918  C  CA  . ALA B 2 168 ? 35.20113  -7.80900  -9.95221  1.000 37.88565  ? 168 ALA B CA  1 
ATOM   3919  C  C   . ALA B 2 168 ? 35.93030  -9.11338  -10.25514 1.000 36.05985  ? 168 ALA B C   1 
ATOM   3920  O  O   . ALA B 2 168 ? 36.46256  -9.32250  -11.34904 1.000 41.30387  ? 168 ALA B O   1 
ATOM   3921  C  CB  . ALA B 2 168 ? 33.69185  -8.02074  -10.08217 1.000 34.22317  ? 168 ALA B CB  1 
ATOM   3922  N  N   . THR B 2 169 ? 35.96011  -9.99196  -9.25615  1.000 40.82430  ? 169 THR B N   1 
ATOM   3923  C  CA  . THR B 2 169 ? 36.55508  -11.31691 -9.38184  1.000 40.20448  ? 169 THR B CA  1 
ATOM   3924  C  C   . THR B 2 169 ? 35.47087  -12.33208 -9.72564  1.000 39.66184  ? 169 THR B C   1 
ATOM   3925  O  O   . THR B 2 169 ? 34.47519  -12.45561 -9.00344  1.000 36.55880  ? 169 THR B O   1 
ATOM   3926  C  CB  . THR B 2 169 ? 37.27184  -11.71816 -8.09356  1.000 29.95886  ? 169 THR B CB  1 
ATOM   3927  O  OG1 . THR B 2 169 ? 38.36314  -10.81808 -7.86319  1.000 47.65090  ? 169 THR B OG1 1 
ATOM   3928  C  CG2 . THR B 2 169 ? 37.81349  -13.13211 -8.20845  1.000 41.58566  ? 169 THR B CG2 1 
ATOM   3929  N  N   . VAL B 2 170 ? 35.67612  -13.06535 -10.81677 1.000 35.02657  ? 170 VAL B N   1 
ATOM   3930  C  CA  . VAL B 2 170 ? 34.68033  -13.97361 -11.37120 1.000 34.76729  ? 170 VAL B CA  1 
ATOM   3931  C  C   . VAL B 2 170 ? 35.27063  -15.37623 -11.41599 1.000 32.65679  ? 170 VAL B C   1 
ATOM   3932  O  O   . VAL B 2 170 ? 36.42417  -15.55584 -11.82046 1.000 41.60924  ? 170 VAL B O   1 
ATOM   3933  C  CB  . VAL B 2 170 ? 34.23791  -13.52096 -12.77584 1.000 31.24019  ? 170 VAL B CB  1 
ATOM   3934  C  CG1 . VAL B 2 170 ? 33.23673  -14.49261 -13.37148 1.000 28.84127  ? 170 VAL B CG1 1 
ATOM   3935  C  CG2 . VAL B 2 170 ? 33.66825  -12.11219 -12.72207 1.000 35.68806  ? 170 VAL B CG2 1 
ATOM   3936  N  N   . ALA B 2 171 ? 34.49493  -16.36150 -10.97409 1.000 34.21714  ? 171 ALA B N   1 
ATOM   3937  C  CA  . ALA B 2 171 ? 34.84373  -17.76661 -11.12709 1.000 35.48471  ? 171 ALA B CA  1 
ATOM   3938  C  C   . ALA B 2 171 ? 33.95320  -18.40070 -12.18704 1.000 38.60643  ? 171 ALA B C   1 
ATOM   3939  O  O   . ALA B 2 171 ? 32.74337  -18.15764 -12.21863 1.000 39.64914  ? 171 ALA B O   1 
ATOM   3940  C  CB  . ALA B 2 171 ? 34.70258  -18.52494 -9.80613  1.000 38.47329  ? 171 ALA B CB  1 
ATOM   3941  N  N   . VAL B 2 172 ? 34.54983  -19.21049 -13.05605 1.000 37.29665  ? 172 VAL B N   1 
ATOM   3942  C  CA  . VAL B 2 172 ? 33.81586  -19.92876 -14.09368 1.000 36.24303  ? 172 VAL B CA  1 
ATOM   3943  C  C   . VAL B 2 172 ? 33.97891  -21.42049 -13.82845 1.000 47.78486  ? 172 VAL B C   1 
ATOM   3944  O  O   . VAL B 2 172 ? 35.08254  -21.96736 -13.95992 1.000 47.65623  ? 172 VAL B O   1 
ATOM   3945  C  CB  . VAL B 2 172 ? 34.29466  -19.55542 -15.50222 1.000 33.51378  ? 172 VAL B CB  1 
ATOM   3946  C  CG1 . VAL B 2 172 ? 33.50323  -20.31194 -16.54946 1.000 34.21109  ? 172 VAL B CG1 1 
ATOM   3947  C  CG2 . VAL B 2 172 ? 34.16037  -18.05932 -15.71881 1.000 31.85235  ? 172 VAL B CG2 1 
ATOM   3948  N  N   . LEU B 2 173 ? 32.88450  -22.07700 -13.44426 1.000 43.42356  ? 173 LEU B N   1 
ATOM   3949  C  CA  . LEU B 2 173 ? 32.89561  -23.49296 -13.09181 1.000 49.68395  ? 173 LEU B CA  1 
ATOM   3950  C  C   . LEU B 2 173 ? 32.59600  -24.30754 -14.34446 1.000 46.15505  ? 173 LEU B C   1 
ATOM   3951  O  O   . LEU B 2 173 ? 31.45662  -24.33361 -14.82010 1.000 55.76306  ? 173 LEU B O   1 
ATOM   3952  C  CB  . LEU B 2 173 ? 31.88539  -23.78047 -11.98402 1.000 40.07008  ? 173 LEU B CB  1 
ATOM   3953  C  CG  . LEU B 2 173 ? 32.03237  -22.88901 -10.74639 1.000 49.33034  ? 173 LEU B CG  1 
ATOM   3954  C  CD1 . LEU B 2 173 ? 30.98834  -23.23174 -9.69770  1.000 52.55580  ? 173 LEU B CD1 1 
ATOM   3955  C  CD2 . LEU B 2 173 ? 33.43563  -22.98931 -10.16408 1.000 43.13829  ? 173 LEU B CD2 1 
ATOM   3956  N  N   . GLY B 2 174 ? 33.62217  -24.95421 -14.88876 1.000 49.83519  ? 174 GLY B N   1 
ATOM   3957  C  CA  . GLY B 2 174 ? 33.47779  -25.69285 -16.12525 1.000 49.26625  ? 174 GLY B CA  1 
ATOM   3958  C  C   . GLY B 2 174 ? 34.01006  -24.90039 -17.29917 1.000 49.02829  ? 174 GLY B C   1 
ATOM   3959  O  O   . GLY B 2 174 ? 33.59339  -23.75878 -17.52071 1.000 47.14665  ? 174 GLY B O   1 
ATOM   3960  N  N   . ILE B 2 175 ? 34.95166  -25.47438 -18.04421 1.000 51.98919  ? 175 ILE B N   1 
ATOM   3961  C  CA  . ILE B 2 175 ? 35.53699  -24.76696 -19.17631 1.000 51.26970  ? 175 ILE B CA  1 
ATOM   3962  C  C   . ILE B 2 175 ? 35.40426  -25.59241 -20.44863 1.000 54.29996  ? 175 ILE B C   1 
ATOM   3963  O  O   . ILE B 2 175 ? 36.36521  -25.73828 -21.21311 1.000 53.46389  ? 175 ILE B O   1 
ATOM   3964  C  CB  . ILE B 2 175 ? 37.00661  -24.39686 -18.90982 1.000 47.54952  ? 175 ILE B CB  1 
ATOM   3965  C  CG1 . ILE B 2 175 ? 37.77842  -25.60020 -18.36724 1.000 59.17560  ? 175 ILE B CG1 1 
ATOM   3966  C  CG2 . ILE B 2 175 ? 37.08648  -23.20869 -17.96396 1.000 47.95814  ? 175 ILE B CG2 1 
ATOM   3967  C  CD1 . ILE B 2 175 ? 39.25744  -25.33864 -18.21564 1.000 64.88822  ? 175 ILE B CD1 1 
ATOM   3968  N  N   . GLY B 2 176 ? 34.21512  -26.13481 -20.68790 1.000 53.85136  ? 176 GLY B N   1 
ATOM   3969  C  CA  . GLY B 2 176 ? 33.86544  -26.60446 -22.00462 1.000 49.93355  ? 176 GLY B CA  1 
ATOM   3970  C  C   . GLY B 2 176 ? 33.67067  -25.40925 -22.91445 1.000 45.52084  ? 176 GLY B C   1 
ATOM   3971  O  O   . GLY B 2 176 ? 33.93851  -24.26735 -22.52755 1.000 51.72861  ? 176 GLY B O   1 
ATOM   3972  N  N   . PRO B 2 177 ? 33.19998  -25.63970 -24.14101 1.000 45.08108  ? 177 PRO B N   1 
ATOM   3973  C  CA  . PRO B 2 177 ? 32.99509  -24.50592 -25.06077 1.000 39.48362  ? 177 PRO B CA  1 
ATOM   3974  C  C   . PRO B 2 177 ? 32.12201  -23.39929 -24.48188 1.000 41.13009  ? 177 PRO B C   1 
ATOM   3975  O  O   . PRO B 2 177 ? 32.43418  -22.21603 -24.66656 1.000 40.51106  ? 177 PRO B O   1 
ATOM   3976  C  CB  . PRO B 2 177 ? 32.36289  -25.16917 -26.29560 1.000 51.12478  ? 177 PRO B CB  1 
ATOM   3977  C  CG  . PRO B 2 177 ? 31.92139  -26.54315 -25.84226 1.000 42.94790  ? 177 PRO B CG  1 
ATOM   3978  C  CD  . PRO B 2 177 ? 32.88079  -26.93236 -24.76886 1.000 43.95053  ? 177 PRO B CD  1 
ATOM   3979  N  N   . VAL B 2 178 ? 31.05491  -23.74870 -23.75948 1.000 34.83910  ? 178 VAL B N   1 
ATOM   3980  C  CA  . VAL B 2 178 ? 30.21646  -22.73293 -23.12940 1.000 43.63921  ? 178 VAL B CA  1 
ATOM   3981  C  C   . VAL B 2 178 ? 30.99669  -21.99755 -22.04659 1.000 47.99595  ? 178 VAL B C   1 
ATOM   3982  O  O   . VAL B 2 178 ? 30.96182  -20.76436 -21.96290 1.000 44.11613  ? 178 VAL B O   1 
ATOM   3983  C  CB  . VAL B 2 178 ? 28.93490  -23.37063 -22.56392 1.000 42.04544  ? 178 VAL B CB  1 
ATOM   3984  C  CG1 . VAL B 2 178 ? 28.19392  -22.37960 -21.68674 1.000 40.84502  ? 178 VAL B CG1 1 
ATOM   3985  C  CG2 . VAL B 2 178 ? 28.04331  -23.85536 -23.69111 1.000 43.96908  ? 178 VAL B CG2 1 
ATOM   3986  N  N   . GLY B 2 179 ? 31.72097  -22.74224 -21.20799 1.000 45.61170  ? 179 GLY B N   1 
ATOM   3987  C  CA  . GLY B 2 179 ? 32.49468  -22.10664 -20.15345 1.000 41.66804  ? 179 GLY B CA  1 
ATOM   3988  C  C   . GLY B 2 179 ? 33.60656  -21.22776 -20.68963 1.000 36.67632  ? 179 GLY B C   1 
ATOM   3989  O  O   . GLY B 2 179 ? 33.89947  -20.16785 -20.12995 1.000 36.06724  ? 179 GLY B O   1 
ATOM   3990  N  N   . LEU B 2 180 ? 34.23267  -21.64604 -21.78947 1.000 36.87343  ? 180 LEU B N   1 
ATOM   3991  C  CA  . LEU B 2 180 ? 35.27067  -20.81805 -22.39125 1.000 40.37179  ? 180 LEU B CA  1 
ATOM   3992  C  C   . LEU B 2 180 ? 34.69206  -19.49926 -22.88401 1.000 39.07520  ? 180 LEU B C   1 
ATOM   3993  O  O   . LEU B 2 180 ? 35.34031  -18.45061 -22.78318 1.000 36.73429  ? 180 LEU B O   1 
ATOM   3994  C  CB  . LEU B 2 180 ? 35.95308  -21.57598 -23.52940 1.000 42.05886  ? 180 LEU B CB  1 
ATOM   3995  C  CG  . LEU B 2 180 ? 36.73956  -22.80384 -23.07145 1.000 47.19671  ? 180 LEU B CG  1 
ATOM   3996  C  CD1 . LEU B 2 180 ? 37.26661  -23.60478 -24.25188 1.000 43.41304  ? 180 LEU B CD1 1 
ATOM   3997  C  CD2 . LEU B 2 180 ? 37.87458  -22.38873 -22.14997 1.000 44.65721  ? 180 LEU B CD2 1 
ATOM   3998  N  N   . MET B 2 181 ? 33.46171  -19.52721 -23.40289 1.000 35.68490  ? 181 MET B N   1 
ATOM   3999  C  CA  . MET B 2 181 ? 32.80741  -18.28464 -23.78968 1.000 33.25821  ? 181 MET B CA  1 
ATOM   4000  C  C   . MET B 2 181 ? 32.33756  -17.49811 -22.57341 1.000 35.14473  ? 181 MET B C   1 
ATOM   4001  O  O   . MET B 2 181 ? 32.22144  -16.26959 -22.64138 1.000 33.25449  ? 181 MET B O   1 
ATOM   4002  C  CB  . MET B 2 181 ? 31.64658  -18.57515 -24.73663 1.000 31.49766  ? 181 MET B CB  1 
ATOM   4003  C  CG  . MET B 2 181 ? 32.08912  -19.02316 -26.12990 1.000 34.54563  ? 181 MET B CG  1 
ATOM   4004  S  SD  . MET B 2 181 ? 32.96234  -17.73579 -27.06053 1.000 40.47952  ? 181 MET B SD  1 
ATOM   4005  C  CE  . MET B 2 181 ? 34.67520  -18.15577 -26.75202 1.000 34.44356  ? 181 MET B CE  1 
ATOM   4006  N  N   . ALA B 2 182 ? 32.06810  -18.17727 -21.45539 1.000 35.66525  ? 182 ALA B N   1 
ATOM   4007  C  CA  . ALA B 2 182 ? 31.78323  -17.45448 -20.21991 1.000 27.04743  ? 182 ALA B CA  1 
ATOM   4008  C  C   . ALA B 2 182 ? 33.01988  -16.72206 -19.71251 1.000 29.53252  ? 182 ALA B C   1 
ATOM   4009  O  O   . ALA B 2 182 ? 32.91338  -15.61027 -19.18364 1.000 39.30759  ? 182 ALA B O   1 
ATOM   4010  C  CB  . ALA B 2 182 ? 31.25430  -18.41064 -19.15476 1.000 27.66142  ? 182 ALA B CB  1 
ATOM   4011  N  N   . VAL B 2 183 ? 34.20144  -17.32849 -19.85775 1.000 41.91410  ? 183 VAL B N   1 
ATOM   4012  C  CA  . VAL B 2 183 ? 35.43872  -16.63722 -19.49730 1.000 36.24371  ? 183 VAL B CA  1 
ATOM   4013  C  C   . VAL B 2 183 ? 35.62714  -15.40650 -20.37474 1.000 37.21916  ? 183 VAL B C   1 
ATOM   4014  O  O   . VAL B 2 183 ? 35.90670  -14.30486 -19.88503 1.000 37.37927  ? 183 VAL B O   1 
ATOM   4015  C  CB  . VAL B 2 183 ? 36.64129  -17.59102 -19.60357 1.000 39.51245  ? 183 VAL B CB  1 
ATOM   4016  C  CG1 . VAL B 2 183 ? 37.94598  -16.81066 -19.47036 1.000 36.41864  ? 183 VAL B CG1 1 
ATOM   4017  C  CG2 . VAL B 2 183 ? 36.55258  -18.68318 -18.54645 1.000 38.06838  ? 183 VAL B CG2 1 
ATOM   4018  N  N   . ALA B 2 184 ? 35.46207  -15.57576 -21.68868 1.000 35.19351  ? 184 ALA B N   1 
ATOM   4019  C  CA  . ALA B 2 184 ? 35.55552  -14.44018 -22.59626 1.000 31.21300  ? 184 ALA B CA  1 
ATOM   4020  C  C   . ALA B 2 184 ? 34.46804  -13.42100 -22.29322 1.000 35.93343  ? 184 ALA B C   1 
ATOM   4021  O  O   . ALA B 2 184 ? 34.70052  -12.20941 -22.37537 1.000 39.45426  ? 184 ALA B O   1 
ATOM   4022  C  CB  . ALA B 2 184 ? 35.46790  -14.92049 -24.04604 1.000 35.62385  ? 184 ALA B CB  1 
ATOM   4023  N  N   . GLY B 2 185 ? 33.27237  -13.89537 -21.93530 1.000 35.08665  ? 185 GLY B N   1 
ATOM   4024  C  CA  . GLY B 2 185 ? 32.20411  -12.98173 -21.56555 1.000 29.68635  ? 185 GLY B CA  1 
ATOM   4025  C  C   . GLY B 2 185 ? 32.52341  -12.19142 -20.31152 1.000 28.77563  ? 185 GLY B C   1 
ATOM   4026  O  O   . GLY B 2 185 ? 32.21721  -11.00181 -20.22372 1.000 32.11224  ? 185 GLY B O   1 
ATOM   4027  N  N   . ALA B 2 186 ? 33.13075  -12.84624 -19.31694 1.000 35.81614  ? 186 ALA B N   1 
ATOM   4028  C  CA  . ALA B 2 186 ? 33.52951  -12.14080 -18.10148 1.000 33.19170  ? 186 ALA B CA  1 
ATOM   4029  C  C   . ALA B 2 186 ? 34.56771  -11.06874 -18.40476 1.000 31.38691  ? 186 ALA B C   1 
ATOM   4030  O  O   . ALA B 2 186 ? 34.50919  -9.96252  -17.85588 1.000 36.73406  ? 186 ALA B O   1 
ATOM   4031  C  CB  . ALA B 2 186 ? 34.06676  -13.13087 -17.06751 1.000 27.90525  ? 186 ALA B CB  1 
ATOM   4032  N  N   . LYS B 2 187 ? 35.52506  -11.37671 -19.28311 1.000 35.01851  ? 187 LYS B N   1 
ATOM   4033  C  CA  . LYS B 2 187 ? 36.48896  -10.37129 -19.71557 1.000 31.91917  ? 187 LYS B CA  1 
ATOM   4034  C  C   . LYS B 2 187 ? 35.80403  -9.20270  -20.41101 1.000 33.21504  ? 187 LYS B C   1 
ATOM   4035  O  O   . LYS B 2 187 ? 36.24127  -8.05295  -20.27464 1.000 37.42491  ? 187 LYS B O   1 
ATOM   4036  C  CB  . LYS B 2 187 ? 37.52414  -11.00582 -20.64448 1.000 30.49239  ? 187 LYS B CB  1 
ATOM   4037  C  CG  . LYS B 2 187 ? 38.62373  -10.05658 -21.08420 1.000 36.82356  ? 187 LYS B CG  1 
ATOM   4038  C  CD  . LYS B 2 187 ? 39.55553  -10.72099 -22.08148 1.000 40.63155  ? 187 LYS B CD  1 
ATOM   4039  C  CE  . LYS B 2 187 ? 40.65151  -9.76707  -22.53873 1.000 51.56870  ? 187 LYS B CE  1 
ATOM   4040  N  NZ  . LYS B 2 187 ? 41.48061  -10.37114 -23.62043 1.000 62.14356  ? 187 LYS B NZ  1 
ATOM   4041  N  N   . LEU B 2 188 ? 34.72169  -9.47169  -21.14429 1.000 35.01657  ? 188 LEU B N   1 
ATOM   4042  C  CA  . LEU B 2 188 ? 34.01740  -8.40234  -21.84229 1.000 34.54013  ? 188 LEU B CA  1 
ATOM   4043  C  C   . LEU B 2 188 ? 33.27072  -7.48872  -20.87918 1.000 39.62678  ? 188 LEU B C   1 
ATOM   4044  O  O   . LEU B 2 188 ? 33.11559  -6.29732  -21.16606 1.000 50.23756  ? 188 LEU B O   1 
ATOM   4045  C  CB  . LEU B 2 188 ? 33.05171  -8.99471  -22.87101 1.000 34.03167  ? 188 LEU B CB  1 
ATOM   4046  C  CG  . LEU B 2 188 ? 33.69191  -9.62073  -24.11382 1.000 33.34002  ? 188 LEU B CG  1 
ATOM   4047  C  CD1 . LEU B 2 188 ? 32.64288  -10.26513 -24.99351 1.000 37.88134  ? 188 LEU B CD1 1 
ATOM   4048  C  CD2 . LEU B 2 188 ? 34.45542  -8.56594  -24.88914 1.000 34.73590  ? 188 LEU B CD2 1 
ATOM   4049  N  N   . ARG B 2 189 ? 32.81478  -8.00593  -19.73704 1.000 30.41721  ? 189 ARG B N   1 
ATOM   4050  C  CA  A ARG B 2 189 ? 32.10741  -7.18826  -18.75968 0.490 34.82110  ? 189 ARG B CA  1 
ATOM   4051  C  CA  B ARG B 2 189 ? 32.10569  -7.21288  -18.74223 0.510 33.62303  ? 189 ARG B CA  1 
ATOM   4052  C  C   . ARG B 2 189 ? 33.04418  -6.53523  -17.75012 1.000 32.89544  ? 189 ARG B C   1 
ATOM   4053  O  O   . ARG B 2 189 ? 32.58270  -6.05502  -16.71027 1.000 36.51940  ? 189 ARG B O   1 
ATOM   4054  C  CB  A ARG B 2 189 ? 31.04478  -8.01637  -18.03498 0.490 33.75301  ? 189 ARG B CB  1 
ATOM   4055  C  CB  B ARG B 2 189 ? 31.09956  -8.08614  -17.98694 0.510 33.72841  ? 189 ARG B CB  1 
ATOM   4056  C  CG  A ARG B 2 189 ? 29.89388  -8.45139  -18.92531 0.490 34.62197  ? 189 ARG B CG  1 
ATOM   4057  C  CG  B ARG B 2 189 ? 30.14172  -8.86760  -18.87788 0.510 34.54193  ? 189 ARG B CG  1 
ATOM   4058  C  CD  A ARG B 2 189 ? 28.56548  -7.82796  -18.51291 0.490 31.97261  ? 189 ARG B CD  1 
ATOM   4059  C  CD  B ARG B 2 189 ? 28.77399  -8.20275  -18.98710 0.510 33.61354  ? 189 ARG B CD  1 
ATOM   4060  N  NE  A ARG B 2 189 ? 28.47421  -6.40559  -18.81975 0.490 38.35286  ? 189 ARG B NE  1 
ATOM   4061  N  NE  B ARG B 2 189 ? 28.78809  -7.00112  -19.81254 0.510 28.29785  ? 189 ARG B NE  1 
ATOM   4062  C  CZ  A ARG B 2 189 ? 28.15140  -5.46512  -17.94160 0.490 33.01622  ? 189 ARG B CZ  1 
ATOM   4063  C  CZ  B ARG B 2 189 ? 27.69925  -6.37923  -20.24741 0.510 35.89203  ? 189 ARG B CZ  1 
ATOM   4064  N  NH1 A ARG B 2 189 ? 27.88211  -5.75905  -16.67956 0.490 29.36877  ? 189 ARG B NH1 1 
ATOM   4065  N  NH1 B ARG B 2 189 ? 26.48610  -6.83684  -19.97679 0.510 31.26011  ? 189 ARG B NH1 1 
ATOM   4066  N  NH2 A ARG B 2 189 ? 28.08414  -4.19971  -18.34342 0.490 34.00800  ? 189 ARG B NH2 1 
ATOM   4067  N  NH2 B ARG B 2 189 ? 27.83030  -5.27235  -20.97443 0.510 26.91815  ? 189 ARG B NH2 1 
ATOM   4068  N  N   . GLY B 2 190 ? 34.34321  -6.49619  -18.03781 1.000 31.77727  ? 190 GLY B N   1 
ATOM   4069  C  CA  . GLY B 2 190 ? 35.27177  -5.77619  -17.18936 1.000 30.69639  ? 190 GLY B CA  1 
ATOM   4070  C  C   . GLY B 2 190 ? 35.76736  -6.51629  -15.97389 1.000 29.73649  ? 190 GLY B C   1 
ATOM   4071  O  O   . GLY B 2 190 ? 36.19791  -5.87493  -15.01037 1.000 35.94067  ? 190 GLY B O   1 
ATOM   4072  N  N   . ALA B 2 191 ? 35.71446  -7.84244  -15.97547 1.000 27.28617  ? 191 ALA B N   1 
ATOM   4073  C  CA  . ALA B 2 191 ? 36.24201  -8.59804  -14.85067 1.000 30.96486  ? 191 ALA B CA  1 
ATOM   4074  C  C   . ALA B 2 191 ? 37.74786  -8.40800  -14.75440 1.000 35.53842  ? 191 ALA B C   1 
ATOM   4075  O  O   . ALA B 2 191 ? 38.43844  -8.26169  -15.76712 1.000 37.53938  ? 191 ALA B O   1 
ATOM   4076  C  CB  . ALA B 2 191 ? 35.91143  -10.08245 -14.99269 1.000 27.15676  ? 191 ALA B CB  1 
ATOM   4077  N  N   . GLY B 2 192 ? 38.25007  -8.36537  -13.52439 1.000 34.50856  ? 192 GLY B N   1 
ATOM   4078  C  CA  . GLY B 2 192 ? 39.67997  -8.34967  -13.30879 1.000 34.67116  ? 192 GLY B CA  1 
ATOM   4079  C  C   . GLY B 2 192 ? 40.19041  -9.77186  -13.25642 1.000 39.85060  ? 192 GLY B C   1 
ATOM   4080  O  O   . GLY B 2 192 ? 40.53984  -10.36276 -14.28467 1.000 38.65776  ? 192 GLY B O   1 
ATOM   4081  N  N   . ARG B 2 193 ? 40.20984  -10.33869 -12.05502 1.000 35.84736  ? 193 ARG B N   1 
ATOM   4082  C  CA  . ARG B 2 193 ? 40.61178  -11.72523 -11.88239 1.000 36.54097  ? 193 ARG B CA  1 
ATOM   4083  C  C   . ARG B 2 193 ? 39.50737  -12.65947 -12.36436 1.000 40.28201  ? 193 ARG B C   1 
ATOM   4084  O  O   . ARG B 2 193 ? 38.33883  -12.49761 -11.99810 1.000 37.07759  ? 193 ARG B O   1 
ATOM   4085  C  CB  . ARG B 2 193 ? 40.93072  -11.99069 -10.41431 1.000 39.58823  ? 193 ARG B CB  1 
ATOM   4086  C  CG  . ARG B 2 193 ? 41.62961  -13.30334 -10.14941 1.000 42.44541  ? 193 ARG B CG  1 
ATOM   4087  C  CD  . ARG B 2 193 ? 42.00764  -13.41008 -8.68956  1.000 48.41936  ? 193 ARG B CD  1 
ATOM   4088  N  NE  . ARG B 2 193 ? 42.94381  -14.49941 -8.45233  1.000 47.86061  ? 193 ARG B NE  1 
ATOM   4089  C  CZ  . ARG B 2 193 ? 43.45648  -14.79630 -7.26678  1.000 52.60097  ? 193 ARG B CZ  1 
ATOM   4090  N  NH1 . ARG B 2 193 ? 43.14189  -14.10253 -6.18501  1.000 60.78014  ? 193 ARG B NH1 1 
ATOM   4091  N  NH2 . ARG B 2 193 ? 44.30571  -15.81398 -7.16413  1.000 51.91986  ? 193 ARG B NH2 1 
ATOM   4092  N  N   . ILE B 2 194 ? 39.87377  -13.62863 -13.20020 1.000 39.58128  ? 194 ILE B N   1 
ATOM   4093  C  CA  . ILE B 2 194 ? 38.95212  -14.65578 -13.67587 1.000 38.80339  ? 194 ILE B CA  1 
ATOM   4094  C  C   . ILE B 2 194 ? 39.54434  -16.01070 -13.32097 1.000 41.32140  ? 194 ILE B C   1 
ATOM   4095  O  O   . ILE B 2 194 ? 40.60746  -16.38403 -13.83331 1.000 44.54498  ? 194 ILE B O   1 
ATOM   4096  C  CB  . ILE B 2 194 ? 38.69210  -14.55653 -15.18691 1.000 35.10550  ? 194 ILE B CB  1 
ATOM   4097  C  CG1 . ILE B 2 194 ? 38.11706  -13.18777 -15.54786 1.000 31.38514  ? 194 ILE B CG1 1 
ATOM   4098  C  CG2 . ILE B 2 194 ? 37.73290  -15.65224 -15.62699 1.000 31.27306  ? 194 ILE B CG2 1 
ATOM   4099  C  CD1 . ILE B 2 194 ? 37.87081  -13.01319 -17.02839 1.000 37.79731  ? 194 ILE B CD1 1 
ATOM   4100  N  N   . ILE B 2 195 ? 38.86112  -16.74328 -12.44906 1.000 48.60102  ? 195 ILE B N   1 
ATOM   4101  C  CA  . ILE B 2 195 ? 39.31284  -18.05110 -11.99300 1.000 44.15196  ? 195 ILE B CA  1 
ATOM   4102  C  C   . ILE B 2 195 ? 38.51620  -19.11361 -12.73442 1.000 47.07614  ? 195 ILE B C   1 
ATOM   4103  O  O   . ILE B 2 195 ? 37.28965  -19.19274 -12.59581 1.000 42.30250  ? 195 ILE B O   1 
ATOM   4104  C  CB  . ILE B 2 195 ? 39.15592  -18.19848 -10.47271 1.000 40.35282  ? 195 ILE B CB  1 
ATOM   4105  C  CG1 . ILE B 2 195 ? 39.87946  -17.05345 -9.75814  1.000 40.14048  ? 195 ILE B CG1 1 
ATOM   4106  C  CG2 . ILE B 2 195 ? 39.69259  -19.54080 -10.01829 1.000 42.57549  ? 195 ILE B CG2 1 
ATOM   4107  C  CD1 . ILE B 2 195 ? 39.70394  -17.05742 -8.25152  1.000 42.37501  ? 195 ILE B CD1 1 
ATOM   4108  N  N   . ALA B 2 196 ? 39.20869  -19.92293 -13.52798 1.000 40.85200  ? 196 ALA B N   1 
ATOM   4109  C  CA  . ALA B 2 196 ? 38.58228  -20.97101 -14.31824 1.000 41.23337  ? 196 ALA B CA  1 
ATOM   4110  C  C   . ALA B 2 196 ? 38.85097  -22.32805 -13.68521 1.000 46.24992  ? 196 ALA B C   1 
ATOM   4111  O  O   . ALA B 2 196 ? 39.97699  -22.61807 -13.27127 1.000 46.79973  ? 196 ALA B O   1 
ATOM   4112  C  CB  . ALA B 2 196 ? 39.09553  -20.94974 -15.75808 1.000 41.69803  ? 196 ALA B CB  1 
ATOM   4113  N  N   . VAL B 2 197 ? 37.81402  -23.15718 -13.61149 1.000 38.97374  ? 197 VAL B N   1 
ATOM   4114  C  CA  . VAL B 2 197 ? 37.89976  -24.47268 -12.98590 1.000 55.03229  ? 197 VAL B CA  1 
ATOM   4115  C  C   . VAL B 2 197 ? 37.79811  -25.52784 -14.07915 1.000 53.57021  ? 197 VAL B C   1 
ATOM   4116  O  O   . VAL B 2 197 ? 36.74924  -25.67702 -14.71859 1.000 54.58348  ? 197 VAL B O   1 
ATOM   4117  C  CB  . VAL B 2 197 ? 36.80918  -24.67041 -11.92718 1.000 46.33095  ? 197 VAL B CB  1 
ATOM   4118  C  CG1 . VAL B 2 197 ? 36.90299  -26.06460 -11.33829 1.000 58.19869  ? 197 VAL B CG1 1 
ATOM   4119  C  CG2 . VAL B 2 197 ? 36.93283  -23.61425 -10.84329 1.000 42.82638  ? 197 VAL B CG2 1 
ATOM   4120  N  N   . GLY B 2 198 ? 38.88071  -26.26972 -14.28556 1.000 55.23044  ? 198 GLY B N   1 
ATOM   4121  C  CA  . GLY B 2 198 ? 38.89945  -27.31753 -15.29208 1.000 64.98959  ? 198 GLY B CA  1 
ATOM   4122  C  C   . GLY B 2 198 ? 40.19433  -28.09467 -15.22262 1.000 61.12448  ? 198 GLY B C   1 
ATOM   4123  O  O   . GLY B 2 198 ? 41.13470  -27.71745 -14.51803 1.000 66.83824  ? 198 GLY B O   1 
ATOM   4124  N  N   . SER B 2 199 ? 40.22976  -29.19292 -15.97269 1.000 66.75582  ? 199 SER B N   1 
ATOM   4125  C  CA  . SER B 2 199 ? 41.37091  -30.10434 -15.93940 1.000 72.55232  ? 199 SER B CA  1 
ATOM   4126  C  C   . SER B 2 199 ? 41.94522  -30.42118 -17.31329 1.000 71.54245  ? 199 SER B C   1 
ATOM   4127  O  O   . SER B 2 199 ? 43.16176  -30.59672 -17.43340 1.000 69.26675  ? 199 SER B O   1 
ATOM   4128  C  CB  . SER B 2 199 ? 40.97264  -31.40981 -15.23501 1.000 77.55080  ? 199 SER B CB  1 
ATOM   4129  O  OG  . SER B 2 199 ? 39.83777  -31.99948 -15.84881 1.000 91.23682  ? 199 SER B OG  1 
ATOM   4130  N  N   . ARG B 2 200 ? 41.10957  -30.50683 -18.34495 1.000 65.54548  ? 200 ARG B N   1 
ATOM   4131  C  CA  . ARG B 2 200 ? 41.58763  -30.91890 -19.65797 1.000 55.80179  ? 200 ARG B CA  1 
ATOM   4132  C  C   . ARG B 2 200 ? 42.57259  -29.89076 -20.20778 1.000 64.51309  ? 200 ARG B C   1 
ATOM   4133  O  O   . ARG B 2 200 ? 42.25122  -28.69460 -20.25452 1.000 60.70998  ? 200 ARG B O   1 
ATOM   4134  C  CB  . ARG B 2 200 ? 40.41645  -31.09953 -20.62093 1.000 65.79703  ? 200 ARG B CB  1 
ATOM   4135  C  CG  . ARG B 2 200 ? 39.68464  -32.41424 -20.44915 1.000 78.32038  ? 200 ARG B CG  1 
ATOM   4136  C  CD  . ARG B 2 200 ? 38.66588  -32.63315 -21.55324 1.000 81.19248  ? 200 ARG B CD  1 
ATOM   4137  N  NE  . ARG B 2 200 ? 37.58275  -31.65870 -21.50892 1.000 84.37114  ? 200 ARG B NE  1 
ATOM   4138  C  CZ  . ARG B 2 200 ? 36.70733  -31.47196 -22.48735 1.000 98.90594  ? 200 ARG B CZ  1 
ATOM   4139  N  NH1 . ARG B 2 200 ? 36.76747  -32.17041 -23.61013 1.000 95.14325  ? 200 ARG B NH1 1 
ATOM   4140  N  NH2 . ARG B 2 200 ? 35.74417  -30.56594 -22.33363 1.000 93.69748  ? 200 ARG B NH2 1 
ATOM   4141  N  N   . PRO B 2 201 ? 43.77054  -30.30934 -20.63165 1.000 65.45298  ? 201 PRO B N   1 
ATOM   4142  C  CA  . PRO B 2 201 ? 44.78177  -29.32414 -21.05784 1.000 57.96256  ? 201 PRO B CA  1 
ATOM   4143  C  C   . PRO B 2 201 ? 44.35182  -28.47083 -22.23848 1.000 63.80544  ? 201 PRO B C   1 
ATOM   4144  O  O   . PRO B 2 201 ? 44.69718  -27.28324 -22.29144 1.000 65.64886  ? 201 PRO B O   1 
ATOM   4145  C  CB  . PRO B 2 201 ? 45.99367  -30.20129 -21.40365 1.000 56.48983  ? 201 PRO B CB  1 
ATOM   4146  C  CG  . PRO B 2 201 ? 45.79087  -31.45485 -20.61246 1.000 58.13257  ? 201 PRO B CG  1 
ATOM   4147  C  CD  . PRO B 2 201 ? 44.30665  -31.68029 -20.61451 1.000 65.66797  ? 201 PRO B CD  1 
ATOM   4148  N  N   . VAL B 2 202 ? 43.60943  -29.03822 -23.19259 1.000 60.86590  ? 202 VAL B N   1 
ATOM   4149  C  CA  . VAL B 2 202 ? 43.17347  -28.24556 -24.33696 1.000 54.46488  ? 202 VAL B CA  1 
ATOM   4150  C  C   . VAL B 2 202 ? 42.20319  -27.15883 -23.89315 1.000 57.68813  ? 202 VAL B C   1 
ATOM   4151  O  O   . VAL B 2 202 ? 42.15343  -26.07717 -24.49266 1.000 51.86710  ? 202 VAL B O   1 
ATOM   4152  C  CB  . VAL B 2 202 ? 42.56023  -29.15482 -25.42125 1.000 60.53806  ? 202 VAL B CB  1 
ATOM   4153  C  CG1 . VAL B 2 202 ? 41.21841  -29.71413 -24.96908 1.000 63.69262  ? 202 VAL B CG1 1 
ATOM   4154  C  CG2 . VAL B 2 202 ? 42.40885  -28.39987 -26.73447 1.000 59.42412  ? 202 VAL B CG2 1 
ATOM   4155  N  N   . CYS B 2 203 ? 41.43409  -27.41233 -22.83120 1.000 63.66087  ? 203 CYS B N   1 
ATOM   4156  C  CA  . CYS B 2 203 ? 40.52019  -26.40202 -22.31311 1.000 51.99519  ? 203 CYS B CA  1 
ATOM   4157  C  C   . CYS B 2 203 ? 41.25387  -25.37503 -21.46696 1.000 52.41943  ? 203 CYS B C   1 
ATOM   4158  O  O   . CYS B 2 203 ? 40.94528  -24.17929 -21.53052 1.000 48.99832  ? 203 CYS B O   1 
ATOM   4159  C  CB  . CYS B 2 203 ? 39.41638  -27.06161 -21.48617 1.000 59.82602  ? 203 CYS B CB  1 
ATOM   4160  S  SG  . CYS B 2 203 ? 38.35185  -28.19345 -22.40170 1.000 61.08479  ? 203 CYS B SG  1 
ATOM   4161  N  N   . VAL B 2 204 ? 42.22226  -25.82795 -20.66868 1.000 47.75275  ? 204 VAL B N   1 
ATOM   4162  C  CA  . VAL B 2 204 ? 43.00301  -24.91015 -19.84541 1.000 53.08435  ? 204 VAL B CA  1 
ATOM   4163  C  C   . VAL B 2 204 ? 43.76406  -23.93232 -20.72648 1.000 52.90048  ? 204 VAL B C   1 
ATOM   4164  O  O   . VAL B 2 204 ? 43.84314  -22.73460 -20.42855 1.000 49.57143  ? 204 VAL B O   1 
ATOM   4165  C  CB  . VAL B 2 204 ? 43.94702  -25.70024 -18.92101 1.000 44.43054  ? 204 VAL B CB  1 
ATOM   4166  C  CG1 . VAL B 2 204 ? 44.93293  -24.76932 -18.23480 1.000 52.10470  ? 204 VAL B CG1 1 
ATOM   4167  C  CG2 . VAL B 2 204 ? 43.14381  -26.48059 -17.89556 1.000 56.50581  ? 204 VAL B CG2 1 
ATOM   4168  N  N   . ASP B 2 205 ? 44.31364  -24.42238 -21.83905 1.000 57.00268  ? 205 ASP B N   1 
ATOM   4169  C  CA  . ASP B 2 205 ? 45.02437  -23.54449 -22.76067 1.000 51.15311  ? 205 ASP B CA  1 
ATOM   4170  C  C   . ASP B 2 205 ? 44.08410  -22.51154 -23.36753 1.000 53.28669  ? 205 ASP B C   1 
ATOM   4171  O  O   . ASP B 2 205 ? 44.43218  -21.33023 -23.47572 1.000 58.60193  ? 205 ASP B O   1 
ATOM   4172  C  CB  . ASP B 2 205 ? 45.69429  -24.37447 -23.85471 1.000 60.05408  ? 205 ASP B CB  1 
ATOM   4173  C  CG  . ASP B 2 205 ? 46.31745  -23.51739 -24.93505 1.000 84.51491  ? 205 ASP B CG  1 
ATOM   4174  O  OD1 . ASP B 2 205 ? 47.35046  -22.86981 -24.66083 1.000 94.43121  ? 205 ASP B OD1 1 
ATOM   4175  O  OD2 . ASP B 2 205 ? 45.76869  -23.48799 -26.05831 1.000 89.86829  ? 205 ASP B OD2 1 
ATOM   4176  N  N   . ALA B 2 206 ? 42.88321  -22.93638 -23.76446 1.000 54.88194  ? 206 ALA B N   1 
ATOM   4177  C  CA  . ALA B 2 206 ? 41.91847  -21.99621 -24.32093 1.000 50.71592  ? 206 ALA B CA  1 
ATOM   4178  C  C   . ALA B 2 206 ? 41.38823  -21.04446 -23.25777 1.000 49.44582  ? 206 ALA B C   1 
ATOM   4179  O  O   . ALA B 2 206 ? 41.08105  -19.88544 -23.56178 1.000 46.70746  ? 206 ALA B O   1 
ATOM   4180  C  CB  . ALA B 2 206 ? 40.76975  -22.75623 -24.98233 1.000 46.77866  ? 206 ALA B CB  1 
ATOM   4181  N  N   . ALA B 2 207 ? 41.27892  -21.50993 -22.01079 1.000 46.91597  ? 207 ALA B N   1 
ATOM   4182  C  CA  . ALA B 2 207 ? 40.80059  -20.64492 -20.93784 1.000 36.44416  ? 207 ALA B CA  1 
ATOM   4183  C  C   . ALA B 2 207 ? 41.75934  -19.48986 -20.68802 1.000 39.55579  ? 207 ALA B C   1 
ATOM   4184  O  O   . ALA B 2 207 ? 41.32849  -18.34847 -20.49265 1.000 43.11641  ? 207 ALA B O   1 
ATOM   4185  C  CB  . ALA B 2 207 ? 40.59145  -21.45790 -19.66238 1.000 48.01127  ? 207 ALA B CB  1 
ATOM   4186  N  N   . LYS B 2 208 ? 43.06472  -19.76520 -20.67417 1.000 49.10708  ? 208 LYS B N   1 
ATOM   4187  C  CA  . LYS B 2 208 ? 44.03046  -18.67882 -20.55842 1.000 41.72354  ? 208 LYS B CA  1 
ATOM   4188  C  C   . LYS B 2 208 ? 43.93285  -17.74015 -21.75324 1.000 45.25603  ? 208 LYS B C   1 
ATOM   4189  O  O   . LYS B 2 208 ? 44.04488  -16.51776 -21.60576 1.000 45.79759  ? 208 LYS B O   1 
ATOM   4190  C  CB  . LYS B 2 208 ? 45.44432  -19.23988 -20.42571 1.000 41.30138  ? 208 LYS B CB  1 
ATOM   4191  C  CG  . LYS B 2 208 ? 45.66408  -20.06714 -19.16978 1.000 46.23295  ? 208 LYS B CG  1 
ATOM   4192  C  CD  . LYS B 2 208 ? 47.04473  -20.70022 -19.15477 1.000 51.34655  ? 208 LYS B CD  1 
ATOM   4193  C  CE  . LYS B 2 208 ? 47.20914  -21.62555 -17.95669 1.000 67.52567  ? 208 LYS B CE  1 
ATOM   4194  N  NZ  . LYS B 2 208 ? 48.52554  -22.32082 -17.93913 1.000 64.91744  ? 208 LYS B NZ  1 
ATOM   4195  N  N   . TYR B 2 209 ? 43.69298  -18.29462 -22.94283 1.000 40.56154  ? 209 TYR B N   1 
ATOM   4196  C  CA  . TYR B 2 209 ? 43.59496  -17.46755 -24.13876 1.000 40.64739  ? 209 TYR B CA  1 
ATOM   4197  C  C   . TYR B 2 209 ? 42.43279  -16.48842 -24.03984 1.000 46.41804  ? 209 TYR B C   1 
ATOM   4198  O  O   . TYR B 2 209 ? 42.53511  -15.34550 -24.50034 1.000 41.65256  ? 209 TYR B O   1 
ATOM   4199  C  CB  . TYR B 2 209 ? 43.45049  -18.35618 -25.37507 1.000 39.93179  ? 209 TYR B CB  1 
ATOM   4200  C  CG  . TYR B 2 209 ? 43.14750  -17.59806 -26.64671 1.000 46.58452  ? 209 TYR B CG  1 
ATOM   4201  C  CD1 . TYR B 2 209 ? 44.16809  -17.03000 -27.39849 1.000 48.90782  ? 209 TYR B CD1 1 
ATOM   4202  C  CD2 . TYR B 2 209 ? 41.84266  -17.45578 -27.10027 1.000 42.96142  ? 209 TYR B CD2 1 
ATOM   4203  C  CE1 . TYR B 2 209 ? 43.89638  -16.33334 -28.56201 1.000 52.83387  ? 209 TYR B CE1 1 
ATOM   4204  C  CE2 . TYR B 2 209 ? 41.56074  -16.76031 -28.26161 1.000 49.98252  ? 209 TYR B CE2 1 
ATOM   4205  C  CZ  . TYR B 2 209 ? 42.59190  -16.20193 -28.98970 1.000 56.36320  ? 209 TYR B CZ  1 
ATOM   4206  O  OH  . TYR B 2 209 ? 42.31821  -15.51195 -30.15084 1.000 63.63265  ? 209 TYR B OH  1 
ATOM   4207  N  N   . TYR B 2 210 ? 41.32567  -16.90596 -23.43204 1.000 42.26447  ? 210 TYR B N   1 
ATOM   4208  C  CA  . TYR B 2 210 ? 40.14933  -16.05305 -23.35681 1.000 40.54686  ? 210 TYR B CA  1 
ATOM   4209  C  C   . TYR B 2 210 ? 40.13119  -15.15341 -22.12836 1.000 39.51997  ? 210 TYR B C   1 
ATOM   4210  O  O   . TYR B 2 210 ? 39.17892  -14.38487 -21.96073 1.000 42.54894  ? 210 TYR B O   1 
ATOM   4211  C  CB  . TYR B 2 210 ? 38.87509  -16.89801 -23.40459 1.000 33.82645  ? 210 TYR B CB  1 
ATOM   4212  C  CG  . TYR B 2 210 ? 38.59521  -17.45028 -24.78502 1.000 40.46906  ? 210 TYR B CG  1 
ATOM   4213  C  CD1 . TYR B 2 210 ? 38.39225  -16.59590 -25.86118 1.000 41.48283  ? 210 TYR B CD1 1 
ATOM   4214  C  CD2 . TYR B 2 210 ? 38.52002  -18.81758 -25.01206 1.000 38.90763  ? 210 TYR B CD2 1 
ATOM   4215  C  CE1 . TYR B 2 210 ? 38.13677  -17.08461 -27.12485 1.000 37.58153  ? 210 TYR B CE1 1 
ATOM   4216  C  CE2 . TYR B 2 210 ? 38.25820  -19.31648 -26.27722 1.000 36.87687  ? 210 TYR B CE2 1 
ATOM   4217  C  CZ  . TYR B 2 210 ? 38.06868  -18.44167 -27.32754 1.000 37.42817  ? 210 TYR B CZ  1 
ATOM   4218  O  OH  . TYR B 2 210 ? 37.80718  -18.92110 -28.58940 1.000 47.60942  ? 210 TYR B OH  1 
ATOM   4219  N  N   . GLY B 2 211 ? 41.14532  -15.22158 -21.27053 1.000 35.43801  ? 211 GLY B N   1 
ATOM   4220  C  CA  . GLY B 2 211 ? 41.27203  -14.23048 -20.21969 1.000 40.00514  ? 211 GLY B CA  1 
ATOM   4221  C  C   . GLY B 2 211 ? 41.40143  -14.75551 -18.80420 1.000 43.01499  ? 211 GLY B C   1 
ATOM   4222  O  O   . GLY B 2 211 ? 41.45966  -13.96371 -17.85967 1.000 40.30203  ? 211 GLY B O   1 
ATOM   4223  N  N   . ALA B 2 212 ? 41.44569  -16.07267 -18.63056 1.000 36.53186  ? 212 ALA B N   1 
ATOM   4224  C  CA  . ALA B 2 212 ? 41.54620  -16.63275 -17.29017 1.000 34.36188  ? 212 ALA B CA  1 
ATOM   4225  C  C   . ALA B 2 212 ? 42.89180  -16.28233 -16.67352 1.000 42.20484  ? 212 ALA B C   1 
ATOM   4226  O  O   . ALA B 2 212 ? 43.93960  -16.44057 -17.30688 1.000 43.71055  ? 212 ALA B O   1 
ATOM   4227  C  CB  . ALA B 2 212 ? 41.35778  -18.14756 -17.32126 1.000 38.05372  ? 212 ALA B CB  1 
ATOM   4228  N  N   . THR B 2 213 ? 42.85969  -15.78351 -15.43951 1.000 44.91962  ? 213 THR B N   1 
ATOM   4229  C  CA  . THR B 2 213 ? 44.07694  -15.45906 -14.71198 1.000 38.25942  ? 213 THR B CA  1 
ATOM   4230  C  C   . THR B 2 213 ? 44.52072  -16.57217 -13.77705 1.000 45.35189  ? 213 THR B C   1 
ATOM   4231  O  O   . THR B 2 213 ? 45.69501  -16.60373 -13.39061 1.000 45.12092  ? 213 THR B O   1 
ATOM   4232  C  CB  . THR B 2 213 ? 43.88649  -14.17328 -13.89867 1.000 39.41120  ? 213 THR B CB  1 
ATOM   4233  O  OG1 . THR B 2 213 ? 42.83201  -14.36545 -12.94914 1.000 45.06065  ? 213 THR B OG1 1 
ATOM   4234  C  CG2 . THR B 2 213 ? 43.52140  -13.01880 -14.80949 1.000 39.10880  ? 213 THR B CG2 1 
ATOM   4235  N  N   . ASP B 2 214 ? 43.61454  -17.47465 -13.40179 1.000 41.19824  ? 214 ASP B N   1 
ATOM   4236  C  CA  . ASP B 2 214 ? 43.93545  -18.59769 -12.53341 1.000 43.19861  ? 214 ASP B CA  1 
ATOM   4237  C  C   . ASP B 2 214 ? 43.18326  -19.82641 -13.01933 1.000 43.84098  ? 214 ASP B C   1 
ATOM   4238  O  O   . ASP B 2 214 ? 42.05074  -19.71934 -13.49665 1.000 44.38115  ? 214 ASP B O   1 
ATOM   4239  C  CB  . ASP B 2 214 ? 43.56786  -18.30882 -11.06988 1.000 43.85087  ? 214 ASP B CB  1 
ATOM   4240  C  CG  . ASP B 2 214 ? 44.15745  -17.00597 -10.56418 1.000 45.56920  ? 214 ASP B CG  1 
ATOM   4241  O  OD1 . ASP B 2 214 ? 43.62086  -15.93268 -10.91959 1.000 46.47742  ? 214 ASP B OD1 1 
ATOM   4242  O  OD2 . ASP B 2 214 ? 45.15477  -17.05324 -9.81300  1.000 52.69291  ? 214 ASP B OD2 1 
ATOM   4243  N  N   . ILE B 2 215 ? 43.81665  -20.98896 -12.89453 1.000 45.72530  ? 215 ILE B N   1 
ATOM   4244  C  CA  . ILE B 2 215 ? 43.22557  -22.26911 -13.26751 1.000 48.67281  ? 215 ILE B CA  1 
ATOM   4245  C  C   . ILE B 2 215 ? 43.16592  -23.13917 -12.02129 1.000 49.98101  ? 215 ILE B C   1 
ATOM   4246  O  O   . ILE B 2 215 ? 44.17354  -23.29603 -11.32261 1.000 54.29312  ? 215 ILE B O   1 
ATOM   4247  C  CB  . ILE B 2 215 ? 44.02575  -22.96811 -14.38247 1.000 47.57819  ? 215 ILE B CB  1 
ATOM   4248  C  CG1 . ILE B 2 215 ? 44.13631  -22.06456 -15.61049 1.000 49.87304  ? 215 ILE B CG1 1 
ATOM   4249  C  CG2 . ILE B 2 215 ? 43.37824  -24.29183 -14.75321 1.000 51.45554  ? 215 ILE B CG2 1 
ATOM   4250  C  CD1 . ILE B 2 215 ? 42.81784  -21.77655 -16.27505 1.000 44.49070  ? 215 ILE B CD1 1 
ATOM   4251  N  N   . VAL B 2 216 ? 41.99425  -23.70066 -11.73932 1.000 51.56675  ? 216 VAL B N   1 
ATOM   4252  C  CA  . VAL B 2 216 ? 41.81669  -24.57918 -10.59033 1.000 52.97304  ? 216 VAL B CA  1 
ATOM   4253  C  C   . VAL B 2 216 ? 41.55939  -25.98172 -11.12105 1.000 65.85845  ? 216 VAL B C   1 
ATOM   4254  O  O   . VAL B 2 216 ? 40.53598  -26.24116 -11.76669 1.000 62.05709  ? 216 VAL B O   1 
ATOM   4255  C  CB  . VAL B 2 216 ? 40.67879  -24.11144 -9.67333  1.000 49.93430  ? 216 VAL B CB  1 
ATOM   4256  C  CG1 . VAL B 2 216 ? 40.38939  -25.16657 -8.61291  1.000 57.77142  ? 216 VAL B CG1 1 
ATOM   4257  C  CG2 . VAL B 2 216 ? 41.03899  -22.78806 -9.01866  1.000 48.99100  ? 216 VAL B CG2 1 
ATOM   4258  N  N   . ASN B 2 217 ? 42.50416  -26.87701 -10.85538 1.000 61.29821  ? 217 ASN B N   1 
ATOM   4259  C  CA  . ASN B 2 217 ? 42.42028  -28.28334 -11.21734 1.000 67.15698  ? 217 ASN B CA  1 
ATOM   4260  C  C   . ASN B 2 217 ? 42.01394  -29.08333 -9.98858  1.000 79.78054  ? 217 ASN B C   1 
ATOM   4261  O  O   . ASN B 2 217 ? 42.60006  -28.91126 -8.91451  1.000 83.81223  ? 217 ASN B O   1 
ATOM   4262  C  CB  . ASN B 2 217 ? 43.75683  -28.78667 -11.76624 1.000 77.04180  ? 217 ASN B CB  1 
ATOM   4263  C  CG  . ASN B 2 217 ? 43.63163  -30.11699 -12.48943 1.000 86.80568  ? 217 ASN B CG  1 
ATOM   4264  O  OD1 . ASN B 2 217 ? 42.74711  -30.92090 -12.19412 1.000 91.57249  ? 217 ASN B OD1 1 
ATOM   4265  N  ND2 . ASN B 2 217 ? 44.51911  -30.35181 -13.44865 1.000 94.30057  ? 217 ASN B ND2 1 
ATOM   4266  N  N   . TYR B 2 218 ? 40.99987  -29.93979 -10.14078 1.000 84.95011  ? 218 TYR B N   1 
ATOM   4267  C  CA  . TYR B 2 218 ? 40.56210  -30.77252 -9.02420  1.000 85.19491  ? 218 TYR B CA  1 
ATOM   4268  C  C   . TYR B 2 218 ? 41.64433  -31.74716 -8.56830  1.000 85.65652  ? 218 TYR B C   1 
ATOM   4269  O  O   . TYR B 2 218 ? 41.53939  -32.30139 -7.46897  1.000 79.99328  ? 218 TYR B O   1 
ATOM   4270  C  CB  . TYR B 2 218 ? 39.29507  -31.54813 -9.39990  1.000 77.33122  ? 218 TYR B CB  1 
ATOM   4271  C  CG  . TYR B 2 218 ? 39.50911  -32.62525 -10.44192 1.000 91.76592  ? 218 TYR B CG  1 
ATOM   4272  C  CD1 . TYR B 2 218 ? 39.38451  -32.34333 -11.79517 1.000 90.41322  ? 218 TYR B CD1 1 
ATOM   4273  C  CD2 . TYR B 2 218 ? 39.83172  -33.92802 -10.07134 1.000 88.51064  ? 218 TYR B CD2 1 
ATOM   4274  C  CE1 . TYR B 2 218 ? 39.57809  -33.32605 -12.75089 1.000 97.33003  ? 218 TYR B CE1 1 
ATOM   4275  C  CE2 . TYR B 2 218 ? 40.03086  -34.91510 -11.02127 1.000 87.49325  ? 218 TYR B CE2 1 
ATOM   4276  C  CZ  . TYR B 2 218 ? 39.90196  -34.60817 -12.35916 1.000 89.55461  ? 218 TYR B CZ  1 
ATOM   4277  O  OH  . TYR B 2 218 ? 40.09575  -35.58598 -13.30850 1.000 102.47407 ? 218 TYR B OH  1 
ATOM   4278  N  N   . LYS B 2 219 ? 42.68277  -31.96334 -9.38071  1.000 93.41408  ? 219 LYS B N   1 
ATOM   4279  C  CA  . LYS B 2 219 ? 43.77143  -32.85324 -8.99551  1.000 90.56060  ? 219 LYS B CA  1 
ATOM   4280  C  C   . LYS B 2 219 ? 44.59259  -32.30313 -7.83598  1.000 91.53631  ? 219 LYS B C   1 
ATOM   4281  O  O   . LYS B 2 219 ? 45.35113  -33.05798 -7.21896  1.000 106.29876 ? 219 LYS B O   1 
ATOM   4282  C  CB  . LYS B 2 219 ? 44.68985  -33.08550 -10.19697 1.000 95.89975  ? 219 LYS B CB  1 
ATOM   4283  C  CG  . LYS B 2 219 ? 44.01955  -33.75614 -11.38587 1.000 104.08134 ? 219 LYS B CG  1 
ATOM   4284  C  CD  . LYS B 2 219 ? 45.00522  -33.94038 -12.53106 1.000 123.41760 ? 219 LYS B CD  1 
ATOM   4285  C  CE  . LYS B 2 219 ? 44.30571  -34.39043 -13.80595 1.000 116.41310 ? 219 LYS B CE  1 
ATOM   4286  N  NZ  . LYS B 2 219 ? 43.60030  -35.69063 -13.63600 1.000 124.70301 ? 219 LYS B NZ  1 
ATOM   4287  N  N   . ASP B 2 220 ? 44.47114  -31.01121 -7.53235  1.000 92.57668  ? 220 ASP B N   1 
ATOM   4288  C  CA  . ASP B 2 220 ? 45.19954  -30.40459 -6.42590  1.000 90.34369  ? 220 ASP B CA  1 
ATOM   4289  C  C   . ASP B 2 220 ? 44.38518  -30.30503 -5.14312  1.000 80.24033  ? 220 ASP B C   1 
ATOM   4290  O  O   . ASP B 2 220 ? 44.94347  -29.93527 -4.10519  1.000 92.20472  ? 220 ASP B O   1 
ATOM   4291  C  CB  . ASP B 2 220 ? 45.70114  -29.01117 -6.82246  1.000 86.35592  ? 220 ASP B CB  1 
ATOM   4292  C  CG  . ASP B 2 220 ? 46.74602  -29.06317 -7.91784  1.000 98.04425  ? 220 ASP B CG  1 
ATOM   4293  O  OD1 . ASP B 2 220 ? 47.60576  -29.96989 -7.87614  1.000 100.49638 ? 220 ASP B OD1 1 
ATOM   4294  O  OD2 . ASP B 2 220 ? 46.69897  -28.20746 -8.82782  1.000 94.50963  ? 220 ASP B OD2 1 
ATOM   4295  N  N   . GLY B 2 221 ? 43.08870  -30.59889 -5.18751  1.000 83.42412  ? 221 GLY B N   1 
ATOM   4296  C  CA  . GLY B 2 221 ? 42.26794  -30.56522 -4.00146  1.000 85.28641  ? 221 GLY B CA  1 
ATOM   4297  C  C   . GLY B 2 221 ? 40.83728  -30.15870 -4.28780  1.000 95.00850  ? 221 GLY B C   1 
ATOM   4298  O  O   . GLY B 2 221 ? 40.43430  -29.97804 -5.44147  1.000 94.60572  ? 221 GLY B O   1 
ATOM   4299  N  N   . PRO B 2 222 ? 40.03763  -30.01504 -3.23142  1.000 99.93086  ? 222 PRO B N   1 
ATOM   4300  C  CA  . PRO B 2 222 ? 38.64889  -29.57121 -3.40940  1.000 88.13691  ? 222 PRO B CA  1 
ATOM   4301  C  C   . PRO B 2 222 ? 38.58256  -28.16591 -3.99333  1.000 85.40352  ? 222 PRO B C   1 
ATOM   4302  O  O   . PRO B 2 222 ? 39.38183  -27.29048 -3.65338  1.000 84.48043  ? 222 PRO B O   1 
ATOM   4303  C  CB  . PRO B 2 222 ? 38.07385  -29.62618 -1.98935  1.000 95.44877  ? 222 PRO B CB  1 
ATOM   4304  C  CG  . PRO B 2 222 ? 39.27138  -29.55847 -1.08919  1.000 99.09363  ? 222 PRO B CG  1 
ATOM   4305  C  CD  . PRO B 2 222 ? 40.36020  -30.28248 -1.81973  1.000 89.59459  ? 222 PRO B CD  1 
ATOM   4306  N  N   . ILE B 2 223 ? 37.61655  -27.96343 -4.89245  1.000 80.82287  ? 223 ILE B N   1 
ATOM   4307  C  CA  . ILE B 2 223 ? 37.49222  -26.68673 -5.59192  1.000 72.71601  ? 223 ILE B CA  1 
ATOM   4308  C  C   . ILE B 2 223 ? 37.16912  -25.56082 -4.61683  1.000 72.38468  ? 223 ILE B C   1 
ATOM   4309  O  O   . ILE B 2 223 ? 37.72019  -24.45750 -4.71896  1.000 69.17887  ? 223 ILE B O   1 
ATOM   4310  C  CB  . ILE B 2 223 ? 36.42930  -26.79440 -6.70034  1.000 67.18585  ? 223 ILE B CB  1 
ATOM   4311  C  CG1 . ILE B 2 223 ? 36.83636  -27.85251 -7.72630  1.000 69.90584  ? 223 ILE B CG1 1 
ATOM   4312  C  CG2 . ILE B 2 223 ? 36.20696  -25.44523 -7.36471  1.000 62.05772  ? 223 ILE B CG2 1 
ATOM   4313  C  CD1 . ILE B 2 223 ? 35.71694  -28.24274 -8.67070  1.000 75.90202  ? 223 ILE B CD1 1 
ATOM   4314  N  N   . GLU B 2 224 ? 36.27136  -25.81621 -3.66040  1.000 68.87243  ? 224 GLU B N   1 
ATOM   4315  C  CA  A GLU B 2 224 ? 35.89046  -24.78097 -2.70375  0.462 65.95644  ? 224 GLU B CA  1 
ATOM   4316  C  CA  B GLU B 2 224 ? 35.89169  -24.77937 -2.70478  0.538 65.93798  ? 224 GLU B CA  1 
ATOM   4317  C  C   . GLU B 2 224 ? 37.10019  -24.28149 -1.92191  1.000 70.96780  ? 224 GLU B C   1 
ATOM   4318  O  O   . GLU B 2 224 ? 37.30746  -23.07082 -1.78119  1.000 66.46249  ? 224 GLU B O   1 
ATOM   4319  C  CB  A GLU B 2 224 ? 34.81698  -25.31202 -1.75090  0.462 66.70130  ? 224 GLU B CB  1 
ATOM   4320  C  CB  B GLU B 2 224 ? 34.82068  -25.30583 -1.75013  0.538 66.70114  ? 224 GLU B CB  1 
ATOM   4321  C  CG  A GLU B 2 224 ? 33.48277  -25.64575 -2.40902  0.462 67.83919  ? 224 GLU B CG  1 
ATOM   4322  C  CG  B GLU B 2 224 ? 34.41141  -24.29892 -0.68738  0.538 62.70070  ? 224 GLU B CG  1 
ATOM   4323  C  CD  A GLU B 2 224 ? 33.36159  -27.10828 -2.80113  0.462 63.12370  ? 224 GLU B CD  1 
ATOM   4324  C  CD  B GLU B 2 224 ? 33.68348  -24.93731 0.47577   0.538 63.35876  ? 224 GLU B CD  1 
ATOM   4325  O  OE1 A GLU B 2 224 ? 34.39475  -27.73060 -3.12603  0.462 66.09695  ? 224 GLU B OE1 1 
ATOM   4326  O  OE1 B GLU B 2 224 ? 33.66502  -26.18436 0.55775   0.538 72.03853  ? 224 GLU B OE1 1 
ATOM   4327  O  OE2 A GLU B 2 224 ? 32.22946  -27.63727 -2.77609  0.462 58.71569  ? 224 GLU B OE2 1 
ATOM   4328  O  OE2 B GLU B 2 224 ? 33.12968  -24.19041 1.30977   0.538 63.17464  ? 224 GLU B OE2 1 
ATOM   4329  N  N   . SER B 2 225 ? 37.91159  -25.20568 -1.40204  1.000 72.81683  ? 225 SER B N   1 
ATOM   4330  C  CA  . SER B 2 225 ? 39.07518  -24.80824 -0.61492  1.000 73.78349  ? 225 SER B CA  1 
ATOM   4331  C  C   . SER B 2 225 ? 40.09470  -24.06039 -1.46461  1.000 69.32397  ? 225 SER B C   1 
ATOM   4332  O  O   . SER B 2 225 ? 40.66681  -23.05883 -1.01836  1.000 67.07425  ? 225 SER B O   1 
ATOM   4333  C  CB  . SER B 2 225 ? 39.71608  -26.03557 0.02910   1.000 75.38121  ? 225 SER B CB  1 
ATOM   4334  O  OG  . SER B 2 225 ? 38.76743  -26.75737 0.79350   1.000 99.57248  ? 225 SER B OG  1 
ATOM   4335  N  N   . GLN B 2 226 ? 40.32868  -24.52577 -2.69328  1.000 68.23925  ? 226 GLN B N   1 
ATOM   4336  C  CA  . GLN B 2 226 ? 41.31036  -23.87534 -3.55373  1.000 63.70215  ? 226 GLN B CA  1 
ATOM   4337  C  C   . GLN B 2 226 ? 40.91248  -22.43665 -3.85146  1.000 59.61101  ? 226 GLN B C   1 
ATOM   4338  O  O   . GLN B 2 226 ? 41.75150  -21.53020 -3.80105  1.000 64.21431  ? 226 GLN B O   1 
ATOM   4339  C  CB  . GLN B 2 226 ? 41.47467  -24.65956 -4.85461  1.000 71.28262  ? 226 GLN B CB  1 
ATOM   4340  C  CG  . GLN B 2 226 ? 42.25046  -25.95488 -4.71855  1.000 64.63008  ? 226 GLN B CG  1 
ATOM   4341  C  CD  . GLN B 2 226 ? 42.60030  -26.56424 -6.06381  1.000 73.50409  ? 226 GLN B CD  1 
ATOM   4342  O  OE1 . GLN B 2 226 ? 43.43488  -26.03573 -6.80042  1.000 63.51254  ? 226 GLN B OE1 1 
ATOM   4343  N  NE2 . GLN B 2 226 ? 41.95698  -27.67803 -6.39443  1.000 86.68512  ? 226 GLN B NE2 1 
ATOM   4344  N  N   . ILE B 2 227 ? 39.63488  -22.20738 -4.16065  1.000 57.34435  ? 227 ILE B N   1 
ATOM   4345  C  CA  . ILE B 2 227 ? 39.19063  -20.86900 -4.53785  1.000 56.77029  ? 227 ILE B CA  1 
ATOM   4346  C  C   . ILE B 2 227 ? 39.20289  -19.93213 -3.33659  1.000 63.38061  ? 227 ILE B C   1 
ATOM   4347  O  O   . ILE B 2 227 ? 39.61006  -18.76868 -3.44713  1.000 60.18387  ? 227 ILE B O   1 
ATOM   4348  C  CB  . ILE B 2 227 ? 37.79976  -20.94068 -5.19146  1.000 56.72118  ? 227 ILE B CB  1 
ATOM   4349  C  CG1 . ILE B 2 227 ? 37.90161  -21.63312 -6.55310  1.000 54.81388  ? 227 ILE B CG1 1 
ATOM   4350  C  CG2 . ILE B 2 227 ? 37.18936  -19.55058 -5.31874  1.000 50.85276  ? 227 ILE B CG2 1 
ATOM   4351  C  CD1 . ILE B 2 227 ? 36.59331  -21.71877 -7.29870  1.000 52.44754  ? 227 ILE B CD1 1 
ATOM   4352  N  N   . MET B 2 228 ? 38.77294  -20.41898 -2.16883  1.000 67.88008  ? 228 MET B N   1 
ATOM   4353  C  CA  . MET B 2 228 ? 38.82548  -19.58535 -0.97181  1.000 59.00736  ? 228 MET B CA  1 
ATOM   4354  C  C   . MET B 2 228 ? 40.26102  -19.23418 -0.60404  1.000 63.41114  ? 228 MET B C   1 
ATOM   4355  O  O   . MET B 2 228 ? 40.52416  -18.13007 -0.11378  1.000 60.11220  ? 228 MET B O   1 
ATOM   4356  C  CB  . MET B 2 228 ? 38.12668  -20.28225 0.19631   1.000 56.81894  ? 228 MET B CB  1 
ATOM   4357  C  CG  . MET B 2 228 ? 36.63532  -20.50284 -0.00444  1.000 57.97412  ? 228 MET B CG  1 
ATOM   4358  S  SD  . MET B 2 228 ? 35.75233  -19.00945 -0.48993  1.000 67.40350  ? 228 MET B SD  1 
ATOM   4359  C  CE  . MET B 2 228 ? 35.90447  -18.03003 0.99905   1.000 62.47749  ? 228 MET B CE  1 
ATOM   4360  N  N   . ASN B 2 229 ? 41.20182  -20.15211 -0.84046  1.000 65.59571  ? 229 ASN B N   1 
ATOM   4361  C  CA  . ASN B 2 229 ? 42.60824  -19.84622 -0.60244  1.000 59.38648  ? 229 ASN B CA  1 
ATOM   4362  C  C   . ASN B 2 229 ? 43.12746  -18.80861 -1.59228  1.000 62.69207  ? 229 ASN B C   1 
ATOM   4363  O  O   . ASN B 2 229 ? 43.91040  -17.92701 -1.21898  1.000 61.86868  ? 229 ASN B O   1 
ATOM   4364  C  CB  . ASN B 2 229 ? 43.43924  -21.12490 -0.67719  1.000 62.11851  ? 229 ASN B CB  1 
ATOM   4365  C  CG  . ASN B 2 229 ? 43.24194  -22.02072 0.53289   1.000 77.71137  ? 229 ASN B CG  1 
ATOM   4366  O  OD1 . ASN B 2 229 ? 42.81506  -21.56599 1.59581   1.000 75.74457  ? 229 ASN B OD1 1 
ATOM   4367  N  ND2 . ASN B 2 229 ? 43.54791  -23.30421 0.37445   1.000 67.46024  ? 229 ASN B ND2 1 
ATOM   4368  N  N   . LEU B 2 230 ? 42.70600  -18.89542 -2.85844  1.000 62.15931  ? 230 LEU B N   1 
ATOM   4369  C  CA  . LEU B 2 230 ? 43.14903  -17.92077 -3.85206  1.000 54.38800  ? 230 LEU B CA  1 
ATOM   4370  C  C   . LEU B 2 230 ? 42.64363  -16.52440 -3.51648  1.000 60.77527  ? 230 LEU B C   1 
ATOM   4371  O  O   . LEU B 2 230 ? 43.38557  -15.54180 -3.63173  1.000 63.10945  ? 230 LEU B O   1 
ATOM   4372  C  CB  . LEU B 2 230 ? 42.67566  -18.33159 -5.24742  1.000 56.71512  ? 230 LEU B CB  1 
ATOM   4373  C  CG  . LEU B 2 230 ? 43.34676  -19.53221 -5.91337  1.000 56.84072  ? 230 LEU B CG  1 
ATOM   4374  C  CD1 . LEU B 2 230 ? 42.70511  -19.80248 -7.25696  1.000 55.68470  ? 230 LEU B CD1 1 
ATOM   4375  C  CD2 . LEU B 2 230 ? 44.83571  -19.28982 -6.07576  1.000 53.22555  ? 230 LEU B CD2 1 
ATOM   4376  N  N   . THR B 2 231 ? 41.38802  -16.41746 -3.09029  1.000 62.86649  ? 231 THR B N   1 
ATOM   4377  C  CA  . THR B 2 231 ? 40.78373  -15.13761 -2.75283  1.000 65.73255  ? 231 THR B CA  1 
ATOM   4378  C  C   . THR B 2 231 ? 41.03153  -14.73645 -1.30444  1.000 66.67442  ? 231 THR B C   1 
ATOM   4379  O  O   . THR B 2 231 ? 40.42533  -13.76947 -0.83091  1.000 66.35257  ? 231 THR B O   1 
ATOM   4380  C  CB  . THR B 2 231 ? 39.28010  -15.17633 -3.03129  1.000 61.18318  ? 231 THR B CB  1 
ATOM   4381  O  OG1 . THR B 2 231 ? 38.67618  -16.21355 -2.24924  1.000 63.06591  ? 231 THR B OG1 1 
ATOM   4382  C  CG2 . THR B 2 231 ? 39.02257  -15.44621 -4.50502  1.000 55.30360  ? 231 THR B CG2 1 
ATOM   4383  N  N   . GLU B 2 232 ? 41.90512  -15.45788 -0.59832  1.000 62.73336  ? 232 GLU B N   1 
ATOM   4384  C  CA  . GLU B 2 232 ? 42.26466  -15.14364 0.78527   1.000 66.21492  ? 232 GLU B CA  1 
ATOM   4385  C  C   . GLU B 2 232 ? 41.03003  -15.07247 1.68137   1.000 70.10256  ? 232 GLU B C   1 
ATOM   4386  O  O   . GLU B 2 232 ? 40.89504  -14.17434 2.51451   1.000 70.99283  ? 232 GLU B O   1 
ATOM   4387  C  CB  . GLU B 2 232 ? 43.07370  -13.84642 0.86623   1.000 75.00646  ? 232 GLU B CB  1 
ATOM   4388  C  CG  . GLU B 2 232 ? 44.38046  -13.88398 0.08750   1.000 86.99227  ? 232 GLU B CG  1 
ATOM   4389  C  CD  . GLU B 2 232 ? 45.16362  -12.58754 0.19066   1.000 103.38775 ? 232 GLU B CD  1 
ATOM   4390  O  OE1 . GLU B 2 232 ? 44.65513  -11.62936 0.81102   1.000 104.88720 ? 232 GLU B OE1 1 
ATOM   4391  O  OE2 . GLU B 2 232 ? 46.29069  -12.52849 -0.34648  1.000 109.35252 ? 232 GLU B OE2 1 
ATOM   4392  N  N   . GLY B 2 233 ? 40.11542  -16.02561 1.50340   1.000 70.52768  ? 233 GLY B N   1 
ATOM   4393  C  CA  . GLY B 2 233 ? 38.91613  -16.09583 2.30815   1.000 65.01218  ? 233 GLY B CA  1 
ATOM   4394  C  C   . GLY B 2 233 ? 37.80536  -15.15898 1.89620   1.000 64.35398  ? 233 GLY B C   1 
ATOM   4395  O  O   . GLY B 2 233 ? 36.71421  -15.22961 2.47656   1.000 64.85111  ? 233 GLY B O   1 
ATOM   4396  N  N   . LYS B 2 234 ? 38.04072  -14.27740 0.92215   1.000 64.96853  ? 234 LYS B N   1 
ATOM   4397  C  CA  . LYS B 2 234 ? 37.01544  -13.32270 0.51792   1.000 60.96055  ? 234 LYS B CA  1 
ATOM   4398  C  C   . LYS B 2 234 ? 35.95388  -13.95313 -0.37184  1.000 62.42308  ? 234 LYS B C   1 
ATOM   4399  O  O   . LYS B 2 234 ? 34.79787  -13.51491 -0.35149  1.000 62.21006  ? 234 LYS B O   1 
ATOM   4400  C  CB  . LYS B 2 234 ? 37.65459  -12.13604 -0.20688  1.000 65.80649  ? 234 LYS B CB  1 
ATOM   4401  C  CG  . LYS B 2 234 ? 38.50446  -11.24008 0.68337   1.000 74.99865  ? 234 LYS B CG  1 
ATOM   4402  C  CD  . LYS B 2 234 ? 39.01517  -10.01363 -0.06967  1.000 80.06561  ? 234 LYS B CD  1 
ATOM   4403  C  CE  . LYS B 2 234 ? 40.38948  -10.25579 -0.68691  1.000 77.45716  ? 234 LYS B CE  1 
ATOM   4404  N  NZ  . LYS B 2 234 ? 40.35183  -11.19948 -1.84023  1.000 79.29245  ? 234 LYS B NZ  1 
ATOM   4405  N  N   . GLY B 2 235 ? 36.31431  -14.97430 -1.14319  1.000 57.09979  ? 235 GLY B N   1 
ATOM   4406  C  CA  . GLY B 2 235 ? 35.41572  -15.50264 -2.14414  1.000 56.45817  ? 235 GLY B CA  1 
ATOM   4407  C  C   . GLY B 2 235 ? 35.44866  -14.67388 -3.41594  1.000 52.05397  ? 235 GLY B C   1 
ATOM   4408  O  O   . GLY B 2 235 ? 36.28602  -13.78762 -3.60250  1.000 54.27908  ? 235 GLY B O   1 
ATOM   4409  N  N   . VAL B 2 236 ? 34.51205  -14.97727 -4.30804  1.000 47.25924  ? 236 VAL B N   1 
ATOM   4410  C  CA  . VAL B 2 236 ? 34.42183  -14.29973 -5.59269  1.000 42.60800  ? 236 VAL B CA  1 
ATOM   4411  C  C   . VAL B 2 236 ? 33.17018  -13.43297 -5.61683  1.000 46.88607  ? 236 VAL B C   1 
ATOM   4412  O  O   . VAL B 2 236 ? 32.21368  -13.64507 -4.86412  1.000 46.81022  ? 236 VAL B O   1 
ATOM   4413  C  CB  . VAL B 2 236 ? 34.42299  -15.29183 -6.77482  1.000 39.57496  ? 236 VAL B CB  1 
ATOM   4414  C  CG1 . VAL B 2 236 ? 35.69476  -16.12823 -6.76266  1.000 38.24983  ? 236 VAL B CG1 1 
ATOM   4415  C  CG2 . VAL B 2 236 ? 33.19088  -16.17814 -6.72858  1.000 44.66444  ? 236 VAL B CG2 1 
ATOM   4416  N  N   . ASP B 2 237 ? 33.19576  -12.42152 -6.48969  1.000 46.20294  ? 237 ASP B N   1 
ATOM   4417  C  CA  . ASP B 2 237 ? 32.04102  -11.54765 -6.66617  1.000 38.41288  ? 237 ASP B CA  1 
ATOM   4418  C  C   . ASP B 2 237 ? 30.93234  -12.21692 -7.46675  1.000 35.55840  ? 237 ASP B C   1 
ATOM   4419  O  O   . ASP B 2 237 ? 29.75424  -11.90280 -7.26519  1.000 39.81359  ? 237 ASP B O   1 
ATOM   4420  C  CB  . ASP B 2 237 ? 32.46692  -10.24497 -7.34813  1.000 33.77427  ? 237 ASP B CB  1 
ATOM   4421  C  CG  . ASP B 2 237 ? 33.46030  -9.45282  -6.52097  1.000 42.43782  ? 237 ASP B CG  1 
ATOM   4422  O  OD1 . ASP B 2 237 ? 33.06347  -8.93429  -5.45511  1.000 56.07679  ? 237 ASP B OD1 1 
ATOM   4423  O  OD2 . ASP B 2 237 ? 34.64127  -9.36066  -6.92438  1.000 42.96699  ? 237 ASP B OD2 1 
ATOM   4424  N  N   . ALA B 2 238 ? 31.28071  -13.12669 -8.37533  1.000 35.19236  ? 238 ALA B N   1 
ATOM   4425  C  CA  . ALA B 2 238 ? 30.28995  -13.83357 -9.17061  1.000 32.35361  ? 238 ALA B CA  1 
ATOM   4426  C  C   . ALA B 2 238 ? 30.86489  -15.17011 -9.61543  1.000 35.98384  ? 238 ALA B C   1 
ATOM   4427  O  O   . ALA B 2 238 ? 32.06734  -15.29310 -9.86585  1.000 36.75197  ? 238 ALA B O   1 
ATOM   4428  C  CB  . ALA B 2 238 ? 29.85390  -13.01107 -10.38836 1.000 41.56648  ? 238 ALA B CB  1 
ATOM   4429  N  N   . ALA B 2 239 ? 29.99487  -16.17343 -9.70466  1.000 35.60341  ? 239 ALA B N   1 
ATOM   4430  C  CA  . ALA B 2 239 ? 30.35342  -17.48883 -10.22026 1.000 40.86553  ? 239 ALA B CA  1 
ATOM   4431  C  C   . ALA B 2 239 ? 29.43754  -17.83386 -11.38189 1.000 41.54178  ? 239 ALA B C   1 
ATOM   4432  O  O   . ALA B 2 239 ? 28.21738  -17.66319 -11.28447 1.000 42.56149  ? 239 ALA B O   1 
ATOM   4433  C  CB  . ALA B 2 239 ? 30.25715  -18.57000 -9.14230  1.000 34.95363  ? 239 ALA B CB  1 
ATOM   4434  N  N   . ILE B 2 240 ? 30.02793  -18.28972 -12.48356 1.000 40.04543  ? 240 ILE B N   1 
ATOM   4435  C  CA  . ILE B 2 240 ? 29.28780  -18.71565 -13.66571 1.000 33.00989  ? 240 ILE B CA  1 
ATOM   4436  C  C   . ILE B 2 240 ? 29.37769  -20.23265 -13.75637 1.000 40.70469  ? 240 ILE B C   1 
ATOM   4437  O  O   . ILE B 2 240 ? 30.47089  -20.78811 -13.92433 1.000 37.97127  ? 240 ILE B O   1 
ATOM   4438  C  CB  . ILE B 2 240 ? 29.83369  -18.05029 -14.93589 1.000 37.87661  ? 240 ILE B CB  1 
ATOM   4439  C  CG1 . ILE B 2 240 ? 29.82383  -16.53238 -14.77048 1.000 34.67276  ? 240 ILE B CG1 1 
ATOM   4440  C  CG2 . ILE B 2 240 ? 29.01384  -18.46682 -16.15090 1.000 31.13493  ? 240 ILE B CG2 1 
ATOM   4441  C  CD1 . ILE B 2 240 ? 30.50325  -15.79319 -15.89996 1.000 28.70127  ? 240 ILE B CD1 1 
ATOM   4442  N  N   . ILE B 2 241 ? 28.23617  -20.90438 -13.64985 1.000 41.71390  ? 241 ILE B N   1 
ATOM   4443  C  CA  . ILE B 2 241 ? 28.18390  -22.35660 -13.75679 1.000 41.12566  ? 241 ILE B CA  1 
ATOM   4444  C  C   . ILE B 2 241 ? 28.00567  -22.71505 -15.22380 1.000 45.22797  ? 241 ILE B C   1 
ATOM   4445  O  O   . ILE B 2 241 ? 26.99838  -22.35390 -15.84194 1.000 50.44269  ? 241 ILE B O   1 
ATOM   4446  C  CB  . ILE B 2 241 ? 27.04683  -22.94027 -12.90750 1.000 44.54816  ? 241 ILE B CB  1 
ATOM   4447  C  CG1 . ILE B 2 241 ? 27.21851  -22.54660 -11.44161 1.000 38.04602  ? 241 ILE B CG1 1 
ATOM   4448  C  CG2 . ILE B 2 241 ? 27.01025  -24.44939 -13.04684 1.000 46.00358  ? 241 ILE B CG2 1 
ATOM   4449  C  CD1 . ILE B 2 241 ? 26.10845  -23.04436 -10.55752 1.000 46.95137  ? 241 ILE B CD1 1 
ATOM   4450  N  N   . ALA B 2 242 ? 28.97579  -23.44081 -15.78177 1.000 46.20347  ? 242 ALA B N   1 
ATOM   4451  C  CA  . ALA B 2 242 ? 28.91655  -23.83237 -17.18475 1.000 43.66456  ? 242 ALA B CA  1 
ATOM   4452  C  C   . ALA B 2 242 ? 29.25144  -25.30435 -17.38645 1.000 53.25959  ? 242 ALA B C   1 
ATOM   4453  O  O   . ALA B 2 242 ? 29.64113  -25.69829 -18.48938 1.000 59.92813  ? 242 ALA B O   1 
ATOM   4454  C  CB  . ALA B 2 242 ? 29.84555  -22.95753 -18.02710 1.000 39.19027  ? 242 ALA B CB  1 
ATOM   4455  N  N   . GLY B 2 243 ? 29.10493  -26.12359 -16.35039 1.000 49.00885  ? 243 GLY B N   1 
ATOM   4456  C  CA  . GLY B 2 243 ? 29.38456  -27.53875 -16.46309 1.000 57.60848  ? 243 GLY B CA  1 
ATOM   4457  C  C   . GLY B 2 243 ? 29.32569  -28.24133 -15.12499 1.000 67.59658  ? 243 GLY B C   1 
ATOM   4458  O  O   . GLY B 2 243 ? 29.34414  -27.59211 -14.07446 1.000 57.29231  ? 243 GLY B O   1 
ATOM   4459  N  N   . GLY B 2 244 ? 29.24565  -29.56495 -15.15264 1.000 71.74228  ? 244 GLY B N   1 
ATOM   4460  C  CA  . GLY B 2 244 ? 29.18852  -30.37310 -13.95113 1.000 73.58253  ? 244 GLY B CA  1 
ATOM   4461  C  C   . GLY B 2 244 ? 27.78872  -30.91678 -13.71621 1.000 73.03575  ? 244 GLY B C   1 
ATOM   4462  O  O   . GLY B 2 244 ? 26.86125  -30.70311 -14.49931 1.000 70.06542  ? 244 GLY B O   1 
ATOM   4463  N  N   . ASN B 2 245 ? 27.65837  -31.64408 -12.61081 1.000 75.85973  ? 245 ASN B N   1 
ATOM   4464  C  CA  . ASN B 2 245 ? 26.38663  -32.21012 -12.19769 1.000 74.97542  ? 245 ASN B CA  1 
ATOM   4465  C  C   . ASN B 2 245 ? 25.71657  -31.27808 -11.19061 1.000 62.35767  ? 245 ASN B C   1 
ATOM   4466  O  O   . ASN B 2 245 ? 26.17055  -30.15608 -10.95216 1.000 73.43188  ? 245 ASN B O   1 
ATOM   4467  C  CB  . ASN B 2 245 ? 26.58686  -33.62189 -11.64536 1.000 80.01941  ? 245 ASN B CB  1 
ATOM   4468  C  CG  . ASN B 2 245 ? 27.07524  -34.59174 -12.70207 1.000 92.14107  ? 245 ASN B CG  1 
ATOM   4469  O  OD1 . ASN B 2 245 ? 28.07401  -35.28665 -12.51374 1.000 102.11106 ? 245 ASN B OD1 1 
ATOM   4470  N  ND2 . ASN B 2 245 ? 26.37013  -34.64017 -13.82820 1.000 96.31357  ? 245 ASN B ND2 1 
ATOM   4471  N  N   . ALA B 2 246 ? 24.62962  -31.75260 -10.57750 1.000 67.17454  ? 246 ALA B N   1 
ATOM   4472  C  CA  . ALA B 2 246 ? 23.86370  -30.91555 -9.65858  1.000 71.98257  ? 246 ALA B CA  1 
ATOM   4473  C  C   . ALA B 2 246 ? 24.70018  -30.44255 -8.47568  1.000 69.85186  ? 246 ALA B C   1 
ATOM   4474  O  O   . ALA B 2 246 ? 24.44724  -29.35992 -7.93460  1.000 68.35794  ? 246 ALA B O   1 
ATOM   4475  C  CB  . ALA B 2 246 ? 22.63218  -31.67553 -9.16516  1.000 71.60507  ? 246 ALA B CB  1 
ATOM   4476  N  N   . ASP B 2 247 ? 25.70474  -31.22350 -8.07012  1.000 66.23675  ? 247 ASP B N   1 
ATOM   4477  C  CA  . ASP B 2 247 ? 26.52087  -30.85437 -6.91830  1.000 67.27595  ? 247 ASP B CA  1 
ATOM   4478  C  C   . ASP B 2 247 ? 27.30850  -29.56813 -7.13867  1.000 69.51174  ? 247 ASP B C   1 
ATOM   4479  O  O   . ASP B 2 247 ? 27.69738  -28.92018 -6.16069  1.000 64.24746  ? 247 ASP B O   1 
ATOM   4480  C  CB  . ASP B 2 247 ? 27.48516  -31.99172 -6.57994  1.000 74.10518  ? 247 ASP B CB  1 
ATOM   4481  C  CG  . ASP B 2 247 ? 28.19877  -32.53411 -7.80777  1.000 88.79138  ? 247 ASP B CG  1 
ATOM   4482  O  OD1 . ASP B 2 247 ? 28.94277  -31.76608 -8.45937  1.000 78.53706  ? 247 ASP B OD1 1 
ATOM   4483  O  OD2 . ASP B 2 247 ? 28.02239  -33.73352 -8.11489  1.000 86.15538  ? 247 ASP B OD2 1 
ATOM   4484  N  N   . ILE B 2 248 ? 27.54797  -29.17773 -8.39347  1.000 65.47626  ? 248 ILE B N   1 
ATOM   4485  C  CA  . ILE B 2 248 ? 28.32061  -27.96967 -8.65463  1.000 65.12490  ? 248 ILE B CA  1 
ATOM   4486  C  C   . ILE B 2 248 ? 27.58110  -26.71811 -8.19738  1.000 62.68816  ? 248 ILE B C   1 
ATOM   4487  O  O   . ILE B 2 248 ? 28.21293  -25.68190 -7.95914  1.000 53.38882  ? 248 ILE B O   1 
ATOM   4488  C  CB  . ILE B 2 248 ? 28.69165  -27.87770 -10.14678 1.000 64.49996  ? 248 ILE B CB  1 
ATOM   4489  C  CG1 . ILE B 2 248 ? 29.93213  -27.00271 -10.32785 1.000 57.47388  ? 248 ILE B CG1 1 
ATOM   4490  C  CG2 . ILE B 2 248 ? 27.53343  -27.32338 -10.95855 1.000 55.65967  ? 248 ILE B CG2 1 
ATOM   4491  C  CD1 . ILE B 2 248 ? 31.16293  -27.55926 -9.64536  1.000 66.15068  ? 248 ILE B CD1 1 
ATOM   4492  N  N   . MET B 2 249 ? 26.25362  -26.78857 -8.06280  1.000 62.44855  ? 249 MET B N   1 
ATOM   4493  C  CA  . MET B 2 249 ? 25.49746  -25.65694 -7.53532  1.000 56.69712  ? 249 MET B CA  1 
ATOM   4494  C  C   . MET B 2 249 ? 25.89182  -25.35444 -6.09486  1.000 53.21066  ? 249 MET B C   1 
ATOM   4495  O  O   . MET B 2 249 ? 26.02209  -24.18580 -5.71122  1.000 52.48049  ? 249 MET B O   1 
ATOM   4496  C  CB  . MET B 2 249 ? 23.99748  -25.94254 -7.63773  1.000 53.74834  ? 249 MET B CB  1 
ATOM   4497  C  CG  . MET B 2 249 ? 23.10139  -24.90078 -6.98018  1.000 55.17361  ? 249 MET B CG  1 
ATOM   4498  S  SD  . MET B 2 249 ? 23.19883  -23.26764 -7.73490  1.000 54.87073  ? 249 MET B SD  1 
ATOM   4499  C  CE  . MET B 2 249 ? 22.48984  -23.60770 -9.34572  1.000 50.33691  ? 249 MET B CE  1 
ATOM   4500  N  N   . ALA B 2 250 ? 26.08681  -26.39695 -5.28258  1.000 56.11836  ? 250 ALA B N   1 
ATOM   4501  C  CA  . ALA B 2 250 ? 26.54180  -26.19584 -3.91038  1.000 55.28261  ? 250 ALA B CA  1 
ATOM   4502  C  C   . ALA B 2 250 ? 27.91443  -25.53812 -3.87264  1.000 55.60045  ? 250 ALA B C   1 
ATOM   4503  O  O   . ALA B 2 250 ? 28.16998  -24.66547 -3.03523  1.000 53.72479  ? 250 ALA B O   1 
ATOM   4504  C  CB  . ALA B 2 250 ? 26.56933  -27.53006 -3.16624  1.000 59.51115  ? 250 ALA B CB  1 
ATOM   4505  N  N   . THR B 2 251 ? 28.81325  -25.94954 -4.76901  1.000 55.47062  ? 251 THR B N   1 
ATOM   4506  C  CA  . THR B 2 251 ? 30.14082  -25.34668 -4.82205  1.000 56.09803  ? 251 THR B CA  1 
ATOM   4507  C  C   . THR B 2 251 ? 30.06401  -23.86098 -5.15451  1.000 55.54414  ? 251 THR B C   1 
ATOM   4508  O  O   . THR B 2 251 ? 30.77469  -23.04630 -4.55418  1.000 53.22087  ? 251 THR B O   1 
ATOM   4509  C  CB  . THR B 2 251 ? 31.00817  -26.08460 -5.84248  1.000 59.78847  ? 251 THR B CB  1 
ATOM   4510  O  OG1 . THR B 2 251 ? 31.14521  -27.45587 -5.44765  1.000 59.47111  ? 251 THR B OG1 1 
ATOM   4511  C  CG2 . THR B 2 251 ? 32.38854  -25.45018 -5.93205  1.000 55.16656  ? 251 THR B CG2 1 
ATOM   4512  N  N   . ALA B 2 252 ? 29.19935  -23.48747 -6.10259  1.000 61.69352  ? 252 ALA B N   1 
ATOM   4513  C  CA  . ALA B 2 252 ? 29.09165  -22.08637 -6.50027  1.000 47.62132  ? 252 ALA B CA  1 
ATOM   4514  C  C   . ALA B 2 252 ? 28.63476  -21.20882 -5.34150  1.000 44.52516  ? 252 ALA B C   1 
ATOM   4515  O  O   . ALA B 2 252 ? 29.16720  -20.11241 -5.13615  1.000 47.14075  ? 252 ALA B O   1 
ATOM   4516  C  CB  . ALA B 2 252 ? 28.13539  -21.94883 -7.68419  1.000 43.75411  ? 252 ALA B CB  1 
ATOM   4517  N  N   . VAL B 2 253 ? 27.64426  -21.66845 -4.57729  1.000 52.91838  ? 253 VAL B N   1 
ATOM   4518  C  CA  . VAL B 2 253 ? 27.15487  -20.88226 -3.44812  1.000 52.91178  ? 253 VAL B CA  1 
ATOM   4519  C  C   . VAL B 2 253 ? 28.25517  -20.70409 -2.40847  1.000 52.53590  ? 253 VAL B C   1 
ATOM   4520  O  O   . VAL B 2 253 ? 28.37490  -19.64362 -1.78162  1.000 52.46269  ? 253 VAL B O   1 
ATOM   4521  C  CB  . VAL B 2 253 ? 25.89904  -21.54305 -2.84884  1.000 48.42011  ? 253 VAL B CB  1 
ATOM   4522  C  CG1 . VAL B 2 253 ? 25.45799  -20.82122 -1.58884  1.000 51.32588  ? 253 VAL B CG1 1 
ATOM   4523  C  CG2 . VAL B 2 253 ? 24.77540  -21.56976 -3.87883  1.000 48.43074  ? 253 VAL B CG2 1 
ATOM   4524  N  N   . LYS B 2 254 ? 29.09555  -21.72744 -2.23179  1.000 53.34855  ? 254 LYS B N   1 
ATOM   4525  C  CA  . LYS B 2 254 ? 30.12501  -21.67798 -1.19897  1.000 52.66539  ? 254 LYS B CA  1 
ATOM   4526  C  C   . LYS B 2 254 ? 31.22614  -20.67677 -1.53252  1.000 54.13667  ? 254 LYS B C   1 
ATOM   4527  O  O   . LYS B 2 254 ? 31.82791  -20.09893 -0.62067  1.000 53.58622  ? 254 LYS B O   1 
ATOM   4528  C  CB  . LYS B 2 254 ? 30.73182  -23.06752 -0.99590  1.000 55.11827  ? 254 LYS B CB  1 
ATOM   4529  C  CG  . LYS B 2 254 ? 29.78484  -24.10324 -0.40927  1.000 54.97203  ? 254 LYS B CG  1 
ATOM   4530  C  CD  . LYS B 2 254 ? 30.43340  -25.48176 -0.40652  1.000 67.99708  ? 254 LYS B CD  1 
ATOM   4531  C  CE  . LYS B 2 254 ? 29.48744  -26.56332 0.08898   1.000 68.54764  ? 254 LYS B CE  1 
ATOM   4532  N  NZ  . LYS B 2 254 ? 30.12548  -27.91398 0.03762   1.000 73.82954  ? 254 LYS B NZ  1 
ATOM   4533  N  N   . ILE B 2 255 ? 31.51541  -20.46334 -2.81764  1.000 47.55553  ? 255 ILE B N   1 
ATOM   4534  C  CA  . ILE B 2 255 ? 32.62737  -19.59344 -3.19052  1.000 54.07887  ? 255 ILE B CA  1 
ATOM   4535  C  C   . ILE B 2 255 ? 32.21147  -18.15001 -3.45787  1.000 49.43108  ? 255 ILE B C   1 
ATOM   4536  O  O   . ILE B 2 255 ? 33.07358  -17.26048 -3.46642  1.000 55.80950  ? 255 ILE B O   1 
ATOM   4537  C  CB  . ILE B 2 255 ? 33.36872  -20.15342 -4.41830  1.000 50.57089  ? 255 ILE B CB  1 
ATOM   4538  C  CG1 . ILE B 2 255 ? 32.46862  -20.12185 -5.65322  1.000 47.32359  ? 255 ILE B CG1 1 
ATOM   4539  C  CG2 . ILE B 2 255 ? 33.85232  -21.57080 -4.14866  1.000 47.12750  ? 255 ILE B CG2 1 
ATOM   4540  C  CD1 . ILE B 2 255 ? 33.16092  -20.58302 -6.91102  1.000 43.22086  ? 255 ILE B CD1 1 
ATOM   4541  N  N   . VAL B 2 256 ? 30.93029  -17.88791 -3.67808  1.000 48.92791  ? 256 VAL B N   1 
ATOM   4542  C  CA  . VAL B 2 256 ? 30.47204  -16.52587 -3.91839  1.000 46.07185  ? 256 VAL B CA  1 
ATOM   4543  C  C   . VAL B 2 256 ? 30.30561  -15.81293 -2.58657  1.000 40.68143  ? 256 VAL B C   1 
ATOM   4544  O  O   . VAL B 2 256 ? 29.78443  -16.38098 -1.62156  1.000 50.87984  ? 256 VAL B O   1 
ATOM   4545  C  CB  . VAL B 2 256 ? 29.16380  -16.53216 -4.72643  1.000 44.35991  ? 256 VAL B CB  1 
ATOM   4546  C  CG1 . VAL B 2 256 ? 28.56246  -15.14527 -4.78455  1.000 46.87275  ? 256 VAL B CG1 1 
ATOM   4547  C  CG2 . VAL B 2 256 ? 29.43467  -17.01974 -6.12189  1.000 42.86549  ? 256 VAL B CG2 1 
ATOM   4548  N  N   . LYS B 2 257 ? 30.76160  -14.56567 -2.52713  1.000 46.59310  ? 257 LYS B N   1 
ATOM   4549  C  CA  . LYS B 2 257 ? 30.64468  -13.77697 -1.31488  1.000 50.62458  ? 257 LYS B CA  1 
ATOM   4550  C  C   . LYS B 2 257 ? 29.20747  -13.29730 -1.12175  1.000 48.91040  ? 257 LYS B C   1 
ATOM   4551  O  O   . LYS B 2 257 ? 28.41849  -13.27403 -2.07019  1.000 45.96437  ? 257 LYS B O   1 
ATOM   4552  C  CB  . LYS B 2 257 ? 31.59900  -12.58650 -1.37120  1.000 51.13376  ? 257 LYS B CB  1 
ATOM   4553  C  CG  . LYS B 2 257 ? 31.29771  -11.60126 -2.48126  1.000 52.54089  ? 257 LYS B CG  1 
ATOM   4554  C  CD  . LYS B 2 257 ? 32.33626  -10.49182 -2.51604  1.000 60.48405  ? 257 LYS B CD  1 
ATOM   4555  C  CE  . LYS B 2 257 ? 33.73895  -11.04729 -2.72568  1.000 53.55245  ? 257 LYS B CE  1 
ATOM   4556  N  NZ  . LYS B 2 257 ? 34.72920  -9.96335  -2.98827  1.000 50.68423  ? 257 LYS B NZ  1 
ATOM   4557  N  N   . PRO B 2 258 ? 28.83901  -12.92730 0.10612   1.000 51.38560  ? 258 PRO B N   1 
ATOM   4558  C  CA  . PRO B 2 258 ? 27.50222  -12.36390 0.33238   1.000 42.33862  ? 258 PRO B CA  1 
ATOM   4559  C  C   . PRO B 2 258 ? 27.26518  -11.15776 -0.56343  1.000 50.58455  ? 258 PRO B C   1 
ATOM   4560  O  O   . PRO B 2 258 ? 28.12400  -10.28400 -0.69790  1.000 52.40770  ? 258 PRO B O   1 
ATOM   4561  C  CB  . PRO B 2 258 ? 27.53062  -11.97353 1.81394   1.000 56.32962  ? 258 PRO B CB  1 
ATOM   4562  C  CG  . PRO B 2 258 ? 28.52289  -12.90301 2.42231   1.000 49.83539  ? 258 PRO B CG  1 
ATOM   4563  C  CD  . PRO B 2 258 ? 29.57574  -13.11899 1.37020   1.000 50.92632  ? 258 PRO B CD  1 
ATOM   4564  N  N   . GLY B 2 259 ? 26.08857  -11.12280 -1.18645  1.000 51.36334  ? 259 GLY B N   1 
ATOM   4565  C  CA  . GLY B 2 259 ? 25.75316  -10.09297 -2.14124  1.000 46.14254  ? 259 GLY B CA  1 
ATOM   4566  C  C   . GLY B 2 259 ? 26.12876  -10.40402 -3.57394  1.000 44.65108  ? 259 GLY B C   1 
ATOM   4567  O  O   . GLY B 2 259 ? 25.73364  -9.65541  -4.47765  1.000 41.90801  ? 259 GLY B O   1 
ATOM   4568  N  N   . GLY B 2 260 ? 26.87359  -11.47811 -3.81535  1.000 44.84247  ? 260 GLY B N   1 
ATOM   4569  C  CA  . GLY B 2 260 ? 27.27071  -11.84208 -5.15688  1.000 36.57326  ? 260 GLY B CA  1 
ATOM   4570  C  C   . GLY B 2 260 ? 26.16530  -12.57169 -5.89358  1.000 40.45690  ? 260 GLY B C   1 
ATOM   4571  O  O   . GLY B 2 260 ? 25.03718  -12.71088 -5.41877  1.000 46.30663  ? 260 GLY B O   1 
ATOM   4572  N  N   . THR B 2 261 ? 26.51066  -13.05731 -7.08364  1.000 42.56839  ? 261 THR B N   1 
ATOM   4573  C  CA  . THR B 2 261 ? 25.54972  -13.69562 -7.97112  1.000 37.94689  ? 261 THR B CA  1 
ATOM   4574  C  C   . THR B 2 261 ? 26.10172  -15.01822 -8.48235  1.000 38.58546  ? 261 THR B C   1 
ATOM   4575  O  O   . THR B 2 261 ? 27.27107  -15.10837 -8.86797  1.000 37.71580  ? 261 THR B O   1 
ATOM   4576  C  CB  . THR B 2 261 ? 25.19602  -12.78291 -9.15746  1.000 30.03058  ? 261 THR B CB  1 
ATOM   4577  O  OG1 . THR B 2 261 ? 24.69930  -11.53359 -8.66568  1.000 43.88833  ? 261 THR B OG1 1 
ATOM   4578  C  CG2 . THR B 2 261 ? 24.13465  -13.42776 -10.03982 1.000 34.50137  ? 261 THR B CG2 1 
ATOM   4579  N  N   . ILE B 2 262 ? 25.25584  -16.04332 -8.47350  1.000 42.90968  ? 262 ILE B N   1 
ATOM   4580  C  CA  . ILE B 2 262 ? 25.53605  -17.30953 -9.14015  1.000 35.23509  ? 262 ILE B CA  1 
ATOM   4581  C  C   . ILE B 2 262 ? 24.72638  -17.32508 -10.43154 1.000 38.44173  ? 262 ILE B C   1 
ATOM   4582  O  O   . ILE B 2 262 ? 23.49057  -17.33390 -10.40124 1.000 33.63326  ? 262 ILE B O   1 
ATOM   4583  C  CB  . ILE B 2 262 ? 25.19423  -18.51722 -8.25496  1.000 41.66733  ? 262 ILE B CB  1 
ATOM   4584  C  CG1 . ILE B 2 262 ? 26.12915  -18.60478 -7.04166  1.000 42.84048  ? 262 ILE B CG1 1 
ATOM   4585  C  CG2 . ILE B 2 262 ? 25.26370  -19.80311 -9.06374  1.000 37.04243  ? 262 ILE B CG2 1 
ATOM   4586  C  CD1 . ILE B 2 262 ? 25.61991  -17.89714 -5.80443  1.000 42.61663  ? 262 ILE B CD1 1 
ATOM   4587  N  N   . ALA B 2 263 ? 25.41590  -17.32843 -11.57007 1.000 35.37772  ? 263 ALA B N   1 
ATOM   4588  C  CA  . ALA B 2 263 ? 24.78343  -17.35144 -12.88491 1.000 31.77817  ? 263 ALA B CA  1 
ATOM   4589  C  C   . ALA B 2 263 ? 25.00067  -18.71995 -13.51222 1.000 34.27750  ? 263 ALA B C   1 
ATOM   4590  O  O   . ALA B 2 263 ? 26.14382  -19.11912 -13.75415 1.000 41.04300  ? 263 ALA B O   1 
ATOM   4591  C  CB  . ALA B 2 263 ? 25.34614  -16.25568 -13.78836 1.000 30.28169  ? 263 ALA B CB  1 
ATOM   4592  N  N   . ASN B 2 264 ? 23.91312  -19.44296 -13.75873 1.000 37.29988  ? 264 ASN B N   1 
ATOM   4593  C  CA  . ASN B 2 264 ? 23.97930  -20.78408 -14.32287 1.000 39.87218  ? 264 ASN B CA  1 
ATOM   4594  C  C   . ASN B 2 264 ? 23.53231  -20.77748 -15.77815 1.000 42.01039  ? 264 ASN B C   1 
ATOM   4595  O  O   . ASN B 2 264 ? 22.47918  -20.22180 -16.10757 1.000 46.98784  ? 264 ASN B O   1 
ATOM   4596  C  CB  . ASN B 2 264 ? 23.11720  -21.76265 -13.52870 1.000 34.87806  ? 264 ASN B CB  1 
ATOM   4597  C  CG  . ASN B 2 264 ? 23.01990  -23.11214 -14.20199 1.000 48.23087  ? 264 ASN B CG  1 
ATOM   4598  O  OD1 . ASN B 2 264 ? 23.99467  -23.86049 -14.25685 1.000 54.21848  ? 264 ASN B OD1 1 
ATOM   4599  N  ND2 . ASN B 2 264 ? 21.84369  -23.43030 -14.72628 1.000 61.62631  ? 264 ASN B ND2 1 
ATOM   4600  N  N   . VAL B 2 265 ? 24.33037  -21.40373 -16.64199 1.000 44.49450  ? 265 VAL B N   1 
ATOM   4601  C  CA  . VAL B 2 265 ? 23.94321  -21.63552 -18.02958 1.000 43.50849  ? 265 VAL B CA  1 
ATOM   4602  C  C   . VAL B 2 265 ? 24.16414  -23.10208 -18.37683 1.000 45.81943  ? 265 VAL B C   1 
ATOM   4603  O  O   . VAL B 2 265 ? 24.07104  -23.49759 -19.54423 1.000 56.37936  ? 265 VAL B O   1 
ATOM   4604  C  CB  . VAL B 2 265 ? 24.70930  -20.70674 -18.98854 1.000 47.17799  ? 265 VAL B CB  1 
ATOM   4605  C  CG1 . VAL B 2 265 ? 24.18296  -19.28307 -18.86555 1.000 37.04527  ? 265 VAL B CG1 1 
ATOM   4606  C  CG2 . VAL B 2 265 ? 26.20434  -20.74637 -18.69346 1.000 40.99181  ? 265 VAL B CG2 1 
ATOM   4607  N  N   . ASN B 2 266 ? 24.43782  -23.91909 -17.36253 1.000 47.71676  ? 266 ASN B N   1 
ATOM   4608  C  CA  . ASN B 2 266 ? 24.63814  -25.34659 -17.56181 1.000 48.84262  ? 266 ASN B CA  1 
ATOM   4609  C  C   . ASN B 2 266 ? 23.30052  -26.06067 -17.70393 1.000 53.62611  ? 266 ASN B C   1 
ATOM   4610  O  O   . ASN B 2 266 ? 22.34609  -25.78023 -16.97308 1.000 55.74997  ? 266 ASN B O   1 
ATOM   4611  C  CB  . ASN B 2 266 ? 25.42669  -25.93934 -16.39258 1.000 57.11250  ? 266 ASN B CB  1 
ATOM   4612  C  CG  . ASN B 2 266 ? 25.65508  -27.43291 -16.53521 1.000 62.14344  ? 266 ASN B CG  1 
ATOM   4613  O  OD1 . ASN B 2 266 ? 25.82895  -27.94414 -17.64051 1.000 58.86873  ? 266 ASN B OD1 1 
ATOM   4614  N  ND2 . ASN B 2 266 ? 25.65759  -28.14177 -15.40963 1.000 65.68443  ? 266 ASN B ND2 1 
ATOM   4615  N  N   . TYR B 2 267 ? 23.23827  -26.99626 -18.64605 1.000 60.68747  ? 267 TYR B N   1 
ATOM   4616  C  CA  . TYR B 2 267 ? 22.03637  -27.79691 -18.86625 1.000 63.48220  ? 267 TYR B CA  1 
ATOM   4617  C  C   . TYR B 2 267 ? 22.15302  -29.05483 -18.01356 1.000 66.61204  ? 267 TYR B C   1 
ATOM   4618  O  O   . TYR B 2 267 ? 22.87957  -29.99065 -18.35747 1.000 79.36962  ? 267 TYR B O   1 
ATOM   4619  C  CB  . TYR B 2 267 ? 21.87082  -28.12667 -20.34621 1.000 71.63177  ? 267 TYR B CB  1 
ATOM   4620  C  CG  . TYR B 2 267 ? 20.72206  -29.05973 -20.66236 1.000 84.46749  ? 267 TYR B CG  1 
ATOM   4621  C  CD1 . TYR B 2 267 ? 19.56150  -29.05242 -19.89901 1.000 86.09567  ? 267 TYR B CD1 1 
ATOM   4622  C  CD2 . TYR B 2 267 ? 20.80483  -29.95770 -21.71953 1.000 88.66992  ? 267 TYR B CD2 1 
ATOM   4623  C  CE1 . TYR B 2 267 ? 18.51724  -29.90544 -20.18227 1.000 86.43795  ? 267 TYR B CE1 1 
ATOM   4624  C  CE2 . TYR B 2 267 ? 19.76313  -30.81479 -22.00996 1.000 87.64376  ? 267 TYR B CE2 1 
ATOM   4625  C  CZ  . TYR B 2 267 ? 18.62273  -30.78235 -21.23636 1.000 91.96931  ? 267 TYR B CZ  1 
ATOM   4626  O  OH  . TYR B 2 267 ? 17.57870  -31.62895 -21.51249 1.000 114.51457 ? 267 TYR B OH  1 
ATOM   4627  N  N   . PHE B 2 268 ? 21.45086  -29.06443 -16.88322 1.000 64.81023  ? 268 PHE B N   1 
ATOM   4628  C  CA  . PHE B 2 268 ? 21.43244  -30.22103 -15.99770 1.000 78.49029  ? 268 PHE B CA  1 
ATOM   4629  C  C   . PHE B 2 268 ? 20.49513  -31.27360 -16.57840 1.000 85.71820  ? 268 PHE B C   1 
ATOM   4630  O  O   . PHE B 2 268 ? 19.28334  -31.04922 -16.67044 1.000 88.79292  ? 268 PHE B O   1 
ATOM   4631  C  CB  . PHE B 2 268 ? 20.98691  -29.80583 -14.59785 1.000 73.09711  ? 268 PHE B CB  1 
ATOM   4632  C  CG  . PHE B 2 268 ? 21.91336  -28.82623 -13.93334 1.000 68.56909  ? 268 PHE B CG  1 
ATOM   4633  C  CD1 . PHE B 2 268 ? 22.99905  -29.26792 -13.19434 1.000 72.12436  ? 268 PHE B CD1 1 
ATOM   4634  C  CD2 . PHE B 2 268 ? 21.70087  -27.46244 -14.05186 1.000 71.85834  ? 268 PHE B CD2 1 
ATOM   4635  C  CE1 . PHE B 2 268 ? 23.85444  -28.36785 -12.58233 1.000 69.40275  ? 268 PHE B CE1 1 
ATOM   4636  C  CE2 . PHE B 2 268 ? 22.55274  -26.55528 -13.44369 1.000 63.39026  ? 268 PHE B CE2 1 
ATOM   4637  C  CZ  . PHE B 2 268 ? 23.63103  -27.00879 -12.70751 1.000 63.91051  ? 268 PHE B CZ  1 
ATOM   4638  N  N   . GLY B 2 269 ? 21.04768  -32.42246 -16.95939 1.000 91.16738  ? 269 GLY B N   1 
ATOM   4639  C  CA  . GLY B 2 269 ? 20.25927  -33.43280 -17.63787 1.000 95.63129  ? 269 GLY B CA  1 
ATOM   4640  C  C   . GLY B 2 269 ? 19.68380  -34.49758 -16.72761 1.000 100.99526 ? 269 GLY B C   1 
ATOM   4641  O  O   . GLY B 2 269 ? 18.70723  -35.16139 -17.08818 1.000 106.06036 ? 269 GLY B O   1 
ATOM   4642  N  N   . GLU B 2 270 ? 20.27590  -34.67631 -15.54884 1.000 91.90646  ? 270 GLU B N   1 
ATOM   4643  C  CA  . GLU B 2 270 ? 19.84556  -35.70304 -14.61199 1.000 101.26824 ? 270 GLU B CA  1 
ATOM   4644  C  C   . GLU B 2 270 ? 19.74837  -35.11785 -13.21145 1.000 104.39769 ? 270 GLU B C   1 
ATOM   4645  O  O   . GLU B 2 270 ? 20.33603  -34.07741 -12.90540 1.000 93.58885  ? 270 GLU B O   1 
ATOM   4646  C  CB  . GLU B 2 270 ? 20.78818  -36.91336 -14.59258 1.000 104.82931 ? 270 GLU B CB  1 
ATOM   4647  C  CG  . GLU B 2 270 ? 22.18506  -36.61390 -14.07939 1.000 112.99237 ? 270 GLU B CG  1 
ATOM   4648  C  CD  . GLU B 2 270 ? 23.09658  -37.82369 -14.15188 1.000 126.52994 ? 270 GLU B CD  1 
ATOM   4649  O  OE1 . GLU B 2 270 ? 22.59303  -38.93361 -14.43236 1.000 126.11684 ? 270 GLU B OE1 1 
ATOM   4650  O  OE2 . GLU B 2 270 ? 24.31618  -37.66396 -13.93259 1.000 130.88525 ? 270 GLU B OE2 1 
ATOM   4651  N  N   . GLY B 2 271 ? 18.98859  -35.80732 -12.36373 1.000 103.60065 ? 271 GLY B N   1 
ATOM   4652  C  CA  . GLY B 2 271 ? 18.78427  -35.38626 -10.99301 1.000 98.16252  ? 271 GLY B CA  1 
ATOM   4653  C  C   . GLY B 2 271 ? 17.45495  -34.69695 -10.77775 1.000 96.10097  ? 271 GLY B C   1 
ATOM   4654  O  O   . GLY B 2 271 ? 17.01218  -33.90572 -11.61449 1.000 100.83930 ? 271 GLY B O   1 
ATOM   4655  N  N   . GLU B 2 272 ? 16.80449  -34.99403 -9.65325  1.000 89.48304  ? 272 GLU B N   1 
ATOM   4656  C  CA  . GLU B 2 272 ? 15.52014  -34.37349 -9.35459  1.000 94.10744  ? 272 GLU B CA  1 
ATOM   4657  C  C   . GLU B 2 272 ? 15.67668  -32.99738 -8.71874  1.000 92.54185  ? 272 GLU B C   1 
ATOM   4658  O  O   . GLU B 2 272 ? 14.83919  -32.11646 -8.94632  1.000 86.57518  ? 272 GLU B O   1 
ATOM   4659  C  CB  . GLU B 2 272 ? 14.69845  -35.28568 -8.44206  1.000 98.58493  ? 272 GLU B CB  1 
ATOM   4660  C  CG  . GLU B 2 272 ? 13.30546  -34.76414 -8.13209  1.000 106.65045 ? 272 GLU B CG  1 
ATOM   4661  C  CD  . GLU B 2 272 ? 12.54784  -35.66195 -7.17666  1.000 116.19898 ? 272 GLU B CD  1 
ATOM   4662  O  OE1 . GLU B 2 272 ? 13.04003  -36.77248 -6.88721  1.000 130.03240 ? 272 GLU B OE1 1 
ATOM   4663  O  OE2 . GLU B 2 272 ? 11.46051  -35.25755 -6.71435  1.000 124.70510 ? 272 GLU B OE2 1 
ATOM   4664  N  N   . VAL B 2 273 ? 16.73607  -32.78720 -7.94033  1.000 91.39385  ? 273 VAL B N   1 
ATOM   4665  C  CA  . VAL B 2 273 ? 16.90685  -31.57484 -7.15006  1.000 82.13021  ? 273 VAL B CA  1 
ATOM   4666  C  C   . VAL B 2 273 ? 18.29896  -31.00235 -7.38414  1.000 76.37525  ? 273 VAL B C   1 
ATOM   4667  O  O   . VAL B 2 273 ? 19.28069  -31.74789 -7.47426  1.000 81.58894  ? 273 VAL B O   1 
ATOM   4668  C  CB  . VAL B 2 273 ? 16.68109  -31.87025 -5.64983  1.000 77.46288  ? 273 VAL B CB  1 
ATOM   4669  C  CG1 . VAL B 2 273 ? 17.24465  -30.76224 -4.77788  1.000 80.49989  ? 273 VAL B CG1 1 
ATOM   4670  C  CG2 . VAL B 2 273 ? 15.19798  -32.08516 -5.36578  1.000 83.63694  ? 273 VAL B CG2 1 
ATOM   4671  N  N   . LEU B 2 274 ? 18.38026  -29.67080 -7.48730  1.000 76.22172  ? 274 LEU B N   1 
ATOM   4672  C  CA  . LEU B 2 274 ? 19.65541  -28.96749 -7.48259  1.000 72.82564  ? 274 LEU B CA  1 
ATOM   4673  C  C   . LEU B 2 274 ? 19.92171  -28.44757 -6.08069  1.000 83.23143  ? 274 LEU B C   1 
ATOM   4674  O  O   . LEU B 2 274 ? 19.15867  -27.59710 -5.59496  1.000 78.78711  ? 274 LEU B O   1 
ATOM   4675  C  CB  . LEU B 2 274 ? 19.64835  -27.81416 -8.47888  1.000 72.16802  ? 274 LEU B CB  1 
ATOM   4676  C  CG  . LEU B 2 274 ? 19.28053  -28.15576 -9.92306  1.000 71.81111  ? 274 LEU B CG  1 
ATOM   4677  C  CD1 . LEU B 2 274 ? 19.36840  -26.91699 -10.79205 1.000 76.09248  ? 274 LEU B CD1 1 
ATOM   4678  C  CD2 . LEU B 2 274 ? 20.16950  -29.26150 -10.46729 1.000 76.76930  ? 274 LEU B CD2 1 
ATOM   4679  N  N   . PRO B 2 275 ? 20.97572  -28.90470 -5.40159  1.000 95.19816  ? 275 PRO B N   1 
ATOM   4680  C  CA  . PRO B 2 275 ? 21.14673  -28.57447 -3.97860  1.000 79.79269  ? 275 PRO B CA  1 
ATOM   4681  C  C   . PRO B 2 275 ? 21.66790  -27.15778 -3.77672  1.000 76.18968  ? 275 PRO B C   1 
ATOM   4682  O  O   . PRO B 2 275 ? 22.63299  -26.73792 -4.41865  1.000 80.54358  ? 275 PRO B O   1 
ATOM   4683  C  CB  . PRO B 2 275 ? 22.16673  -29.61277 -3.49826  1.000 84.87816  ? 275 PRO B CB  1 
ATOM   4684  C  CG  . PRO B 2 275 ? 22.97702  -29.91150 -4.71828  1.000 85.96803  ? 275 PRO B CG  1 
ATOM   4685  C  CD  . PRO B 2 275 ? 22.02449  -29.81883 -5.88763  1.000 94.16197  ? 275 PRO B CD  1 
ATOM   4686  N  N   . VAL B 2 276 ? 21.02243  -26.42378 -2.87487  1.000 71.24744  ? 276 VAL B N   1 
ATOM   4687  C  CA  . VAL B 2 276 ? 21.47978  -25.12153 -2.40931  1.000 77.25172  ? 276 VAL B CA  1 
ATOM   4688  C  C   . VAL B 2 276 ? 21.82480  -25.25759 -0.92460  1.000 77.68831  ? 276 VAL B C   1 
ATOM   4689  O  O   . VAL B 2 276 ? 20.92851  -25.51627 -0.10770  1.000 79.52427  ? 276 VAL B O   1 
ATOM   4690  C  CB  . VAL B 2 276 ? 20.42636  -24.02918 -2.63773  1.000 70.88007  ? 276 VAL B CB  1 
ATOM   4691  C  CG1 . VAL B 2 276 ? 20.87521  -22.71990 -2.00404  1.000 56.18549  ? 276 VAL B CG1 1 
ATOM   4692  C  CG2 . VAL B 2 276 ? 20.16404  -23.84475 -4.12595  1.000 53.77793  ? 276 VAL B CG2 1 
ATOM   4693  N  N   . PRO B 2 277 ? 23.09128  -25.10578 -0.53083  1.000 75.18243  ? 277 PRO B N   1 
ATOM   4694  C  CA  . PRO B 2 277 ? 23.45583  -25.31467 0.88022   1.000 72.40405  ? 277 PRO B CA  1 
ATOM   4695  C  C   . PRO B 2 277 ? 22.83579  -24.23952 1.75877   1.000 67.98704  ? 277 PRO B C   1 
ATOM   4696  O  O   . PRO B 2 277 ? 22.95952  -23.04673 1.47716   1.000 78.71792  ? 277 PRO B O   1 
ATOM   4697  C  CB  . PRO B 2 277 ? 24.98865  -25.22229 0.87621   1.000 67.12653  ? 277 PRO B CB  1 
ATOM   4698  C  CG  . PRO B 2 277 ? 25.39769  -25.25867 -0.56962  1.000 72.90750  ? 277 PRO B CG  1 
ATOM   4699  C  CD  . PRO B 2 277 ? 24.24754  -24.69201 -1.33961  1.000 68.54583  ? 277 PRO B CD  1 
ATOM   4700  N  N   . ARG B 2 278 ? 22.15721  -24.67036 2.82417   1.000 64.04739  ? 278 ARG B N   1 
ATOM   4701  C  CA  . ARG B 2 278 ? 21.43609  -23.72160 3.66790   1.000 76.27726  ? 278 ARG B CA  1 
ATOM   4702  C  C   . ARG B 2 278 ? 22.39301  -22.75057 4.35232   1.000 80.07804  ? 278 ARG B C   1 
ATOM   4703  O  O   . ARG B 2 278 ? 22.24789  -21.52873 4.22813   1.000 75.28084  ? 278 ARG B O   1 
ATOM   4704  C  CB  . ARG B 2 278 ? 20.59334  -24.46857 4.70245   1.000 71.25801  ? 278 ARG B CB  1 
ATOM   4705  C  CG  . ARG B 2 278 ? 19.78221  -23.55088 5.60501   1.000 79.92917  ? 278 ARG B CG  1 
ATOM   4706  C  CD  . ARG B 2 278 ? 19.02578  -24.32555 6.67638   1.000 86.40175  ? 278 ARG B CD  1 
ATOM   4707  N  NE  . ARG B 2 278 ? 19.91706  -25.05425 7.57271   1.000 91.34538  ? 278 ARG B NE  1 
ATOM   4708  C  CZ  . ARG B 2 278 ? 20.39706  -24.56850 8.71023   1.000 92.62339  ? 278 ARG B CZ  1 
ATOM   4709  N  NH1 . ARG B 2 278 ? 20.09201  -23.34923 9.12458   1.000 92.39651  ? 278 ARG B NH1 1 
ATOM   4710  N  NH2 . ARG B 2 278 ? 21.20120  -25.32579 9.45218   1.000 87.06226  ? 278 ARG B NH2 1 
ATOM   4711  N  N   . LEU B 2 279 ? 23.39172  -23.27811 5.06624   1.000 77.14680  ? 279 LEU B N   1 
ATOM   4712  C  CA  . LEU B 2 279 ? 24.28349  -22.42347 5.84797   1.000 80.47953  ? 279 LEU B CA  1 
ATOM   4713  C  C   . LEU B 2 279 ? 25.08638  -21.48204 4.95330   1.000 74.29094  ? 279 LEU B C   1 
ATOM   4714  O  O   . LEU B 2 279 ? 25.20023  -20.28435 5.23954   1.000 75.54936  ? 279 LEU B O   1 
ATOM   4715  C  CB  . LEU B 2 279 ? 25.21280  -23.28366 6.70603   1.000 75.59674  ? 279 LEU B CB  1 
ATOM   4716  C  CG  . LEU B 2 279 ? 24.54467  -24.05201 7.85077   1.000 91.58850  ? 279 LEU B CG  1 
ATOM   4717  C  CD1 . LEU B 2 279 ? 25.55224  -24.92102 8.59194   1.000 83.94974  ? 279 LEU B CD1 1 
ATOM   4718  C  CD2 . LEU B 2 279 ? 23.85342  -23.09293 8.81121   1.000 91.06069  ? 279 LEU B CD2 1 
ATOM   4719  N  N   . GLU B 2 280 ? 25.64831  -22.00405 3.85863   1.000 66.35983  ? 280 GLU B N   1 
ATOM   4720  C  CA  . GLU B 2 280 ? 26.46196  -21.17371 2.97548   1.000 68.54166  ? 280 GLU B CA  1 
ATOM   4721  C  C   . GLU B 2 280 ? 25.62814  -20.18263 2.17382   1.000 68.91664  ? 280 GLU B C   1 
ATOM   4722  O  O   . GLU B 2 280 ? 26.18327  -19.21987 1.63302   1.000 68.23503  ? 280 GLU B O   1 
ATOM   4723  C  CB  . GLU B 2 280 ? 27.28976  -22.04874 2.03004   1.000 64.33185  ? 280 GLU B CB  1 
ATOM   4724  C  CG  . GLU B 2 280 ? 28.48005  -22.73920 2.69257   1.000 68.64618  ? 280 GLU B CG  1 
ATOM   4725  C  CD  . GLU B 2 280 ? 28.11122  -24.04112 3.38065   1.000 85.81583  ? 280 GLU B CD  1 
ATOM   4726  O  OE1 . GLU B 2 280 ? 26.90412  -24.35165 3.47220   1.000 89.10728  ? 280 GLU B OE1 1 
ATOM   4727  O  OE2 . GLU B 2 280 ? 29.03287  -24.75530 3.83381   1.000 87.40090  ? 280 GLU B OE2 1 
ATOM   4728  N  N   . TRP B 2 281 ? 24.31669  -20.39360 2.07812   1.000 70.08649  ? 281 TRP B N   1 
ATOM   4729  C  CA  . TRP B 2 281 ? 23.41528  -19.41764 1.48396   1.000 64.85882  ? 281 TRP B CA  1 
ATOM   4730  C  C   . TRP B 2 281 ? 22.87939  -18.43273 2.51575   1.000 65.30236  ? 281 TRP B C   1 
ATOM   4731  O  O   . TRP B 2 281 ? 21.85580  -17.78336 2.27128   1.000 60.54862  ? 281 TRP B O   1 
ATOM   4732  C  CB  . TRP B 2 281 ? 22.26265  -20.13319 0.77296   1.000 58.78433  ? 281 TRP B CB  1 
ATOM   4733  C  CG  . TRP B 2 281 ? 21.62974  -19.34642 -0.33951  1.000 57.75331  ? 281 TRP B CG  1 
ATOM   4734  C  CD1 . TRP B 2 281 ? 22.26924  -18.72962 -1.37537  1.000 57.09674  ? 281 TRP B CD1 1 
ATOM   4735  C  CD2 . TRP B 2 281 ? 20.22885  -19.12866 -0.54781  1.000 52.99794  ? 281 TRP B CD2 1 
ATOM   4736  N  NE1 . TRP B 2 281 ? 21.35471  -18.12268 -2.20457  1.000 52.10365  ? 281 TRP B NE1 1 
ATOM   4737  C  CE2 . TRP B 2 281 ? 20.09500  -18.35581 -1.71952  1.000 51.73338  ? 281 TRP B CE2 1 
ATOM   4738  C  CE3 . TRP B 2 281 ? 19.07603  -19.50791 0.14499   1.000 55.71205  ? 281 TRP B CE3 1 
ATOM   4739  C  CZ2 . TRP B 2 281 ? 18.85622  -17.95251 -2.21006  1.000 43.83309  ? 281 TRP B CZ2 1 
ATOM   4740  C  CZ3 . TRP B 2 281 ? 17.84707  -19.10605 -0.34232  1.000 55.41925  ? 281 TRP B CZ3 1 
ATOM   4741  C  CH2 . TRP B 2 281 ? 17.74710  -18.33559 -1.50905  1.000 51.88254  ? 281 TRP B CH2 1 
ATOM   4742  N  N   . GLY B 2 282 ? 23.55804  -18.30145 3.65434   1.000 66.28066  ? 282 GLY B N   1 
ATOM   4743  C  CA  . GLY B 2 282 ? 23.10993  -17.41164 4.70749   1.000 66.23769  ? 282 GLY B CA  1 
ATOM   4744  C  C   . GLY B 2 282 ? 21.80949  -17.82957 5.34720   1.000 69.28525  ? 282 GLY B C   1 
ATOM   4745  O  O   . GLY B 2 282 ? 21.08088  -16.97719 5.86752   1.000 67.90080  ? 282 GLY B O   1 
ATOM   4746  N  N   . CYS B 2 283 ? 21.50420  -19.12969 5.33040   1.000 68.33082  ? 283 CYS B N   1 
ATOM   4747  C  CA  . CYS B 2 283 ? 20.22353  -19.65777 5.79903   1.000 71.63763  ? 283 CYS B CA  1 
ATOM   4748  C  C   . CYS B 2 283 ? 19.05357  -18.99960 5.07500   1.000 69.29213  ? 283 CYS B C   1 
ATOM   4749  O  O   . CYS B 2 283 ? 17.95053  -18.89049 5.61744   1.000 66.25215  ? 283 CYS B O   1 
ATOM   4750  C  CB  . CYS B 2 283 ? 20.08378  -19.49812 7.31265   1.000 66.51099  ? 283 CYS B CB  1 
ATOM   4751  S  SG  . CYS B 2 283 ? 21.48185  -20.15784 8.23786   1.000 74.91565  ? 283 CYS B SG  1 
ATOM   4752  N  N   . GLY B 2 284 ? 19.29604  -18.56253 3.84270   1.000 66.70771  ? 284 GLY B N   1 
ATOM   4753  C  CA  . GLY B 2 284 ? 18.30480  -17.87747 3.04614   1.000 59.20889  ? 284 GLY B CA  1 
ATOM   4754  C  C   . GLY B 2 284 ? 18.44674  -16.37390 2.99114   1.000 61.96129  ? 284 GLY B C   1 
ATOM   4755  O  O   . GLY B 2 284 ? 17.59160  -15.71412 2.39157   1.000 59.48684  ? 284 GLY B O   1 
ATOM   4756  N  N   . MET B 2 285 ? 19.50637  -15.80811 3.58212   1.000 61.40296  ? 285 MET B N   1 
ATOM   4757  C  CA  . MET B 2 285 ? 19.58440  -14.36051 3.74066   1.000 63.95123  ? 285 MET B CA  1 
ATOM   4758  C  C   . MET B 2 285 ? 20.95214  -13.79054 3.36439   1.000 63.76176  ? 285 MET B C   1 
ATOM   4759  O  O   . MET B 2 285 ? 21.28421  -12.67711 3.79013   1.000 57.18050  ? 285 MET B O   1 
ATOM   4760  C  CB  . MET B 2 285 ? 19.23725  -13.96889 5.18690   1.000 61.07361  ? 285 MET B CB  1 
ATOM   4761  C  CG  . MET B 2 285 ? 17.85076  -14.41578 5.63916   1.000 60.25523  ? 285 MET B CG  1 
ATOM   4762  S  SD  . MET B 2 285 ? 17.52738  -14.11754 7.38819   1.000 81.80306  ? 285 MET B SD  1 
ATOM   4763  C  CE  . MET B 2 285 ? 18.87222  -15.01901 8.15726   1.000 85.96572  ? 285 MET B CE  1 
ATOM   4764  N  N   . ALA B 2 286 ? 21.74676  -14.50748 2.57103   1.000 63.11014  ? 286 ALA B N   1 
ATOM   4765  C  CA  . ALA B 2 286 ? 23.09423  -14.07010 2.22637   1.000 60.93041  ? 286 ALA B CA  1 
ATOM   4766  C  C   . ALA B 2 286 ? 23.13915  -13.14716 1.01652   1.000 50.03123  ? 286 ALA B C   1 
ATOM   4767  O  O   . ALA B 2 286 ? 24.23565  -12.75305 0.60308   1.000 50.25657  ? 286 ALA B O   1 
ATOM   4768  C  CB  . ALA B 2 286 ? 23.99715  -15.28108 1.96878   1.000 49.81985  ? 286 ALA B CB  1 
ATOM   4769  N  N   . HIS B 2 287 ? 21.98599  -12.79304 0.44506   1.000 48.71802  ? 287 HIS B N   1 
ATOM   4770  C  CA  . HIS B 2 287 ? 21.92655  -11.98435 -0.77508  1.000 52.15704  ? 287 HIS B CA  1 
ATOM   4771  C  C   . HIS B 2 287 ? 22.74638  -12.60963 -1.90116  1.000 49.80614  ? 287 HIS B C   1 
ATOM   4772  O  O   . HIS B 2 287 ? 23.30221  -11.90875 -2.74757  1.000 52.21577  ? 287 HIS B O   1 
ATOM   4773  C  CB  . HIS B 2 287 ? 22.37185  -10.54200 -0.51459  1.000 50.23462  ? 287 HIS B CB  1 
ATOM   4774  C  CG  . HIS B 2 287 ? 21.32379  -9.69128  0.13508   1.000 59.57227  ? 287 HIS B CG  1 
ATOM   4775  N  ND1 . HIS B 2 287 ? 21.21690  -9.55211  1.50281   1.000 58.53087  ? 287 HIS B ND1 1 
ATOM   4776  C  CD2 . HIS B 2 287 ? 20.34712  -8.91899  -0.39804  1.000 52.80742  ? 287 HIS B CD2 1 
ATOM   4777  C  CE1 . HIS B 2 287 ? 20.21644  -8.73628  1.78429   1.000 50.93510  ? 287 HIS B CE1 1 
ATOM   4778  N  NE2 . HIS B 2 287 ? 19.66971  -8.34110  0.64831   1.000 50.18640  ? 287 HIS B NE2 1 
ATOM   4779  N  N   . LYS B 2 288 ? 22.83255  -13.93858 -1.91974  1.000 51.64450  ? 288 LYS B N   1 
ATOM   4780  C  CA  . LYS B 2 288 ? 23.49705  -14.65285 -3.00811  1.000 50.31773  ? 288 LYS B CA  1 
ATOM   4781  C  C   . LYS B 2 288 ? 22.43779  -15.00153 -4.04434  1.000 48.58440  ? 288 LYS B C   1 
ATOM   4782  O  O   . LYS B 2 288 ? 21.72819  -16.00047 -3.91370  1.000 54.45713  ? 288 LYS B O   1 
ATOM   4783  C  CB  . LYS B 2 288 ? 24.21634  -15.89479 -2.49596  1.000 43.35515  ? 288 LYS B CB  1 
ATOM   4784  C  CG  . LYS B 2 288 ? 25.35470  -15.59067 -1.54578  1.000 42.51314  ? 288 LYS B CG  1 
ATOM   4785  C  CD  . LYS B 2 288 ? 26.13847  -16.83979 -1.20216  1.000 47.40491  ? 288 LYS B CD  1 
ATOM   4786  C  CE  . LYS B 2 288 ? 27.13193  -16.55699 -0.09402  1.000 45.97873  ? 288 LYS B CE  1 
ATOM   4787  N  NZ  . LYS B 2 288 ? 27.94110  -17.75701 0.23923   1.000 46.56840  ? 288 LYS B NZ  1 
ATOM   4788  N  N   . THR B 2 289 ? 22.32349  -14.16400 -5.06972  1.000 40.51880  ? 289 THR B N   1 
ATOM   4789  C  CA  . THR B 2 289 ? 21.32580  -14.36683 -6.11006  1.000 41.02572  ? 289 THR B CA  1 
ATOM   4790  C  C   . THR B 2 289 ? 21.71452  -15.53790 -7.00410  1.000 37.03729  ? 289 THR B C   1 
ATOM   4791  O  O   . THR B 2 289 ? 22.87661  -15.68143 -7.39425  1.000 36.96773  ? 289 THR B O   1 
ATOM   4792  C  CB  . THR B 2 289 ? 21.17809  -13.10006 -6.95390  1.000 38.26688  ? 289 THR B CB  1 
ATOM   4793  O  OG1 . THR B 2 289 ? 20.78080  -12.00785 -6.11826  1.000 40.06324  ? 289 THR B OG1 1 
ATOM   4794  C  CG2 . THR B 2 289 ? 20.12745  -13.29554 -8.02420  1.000 37.19135  ? 289 THR B CG2 1 
ATOM   4795  N  N   . ILE B 2 290 ? 20.73745  -16.38507 -7.31919  1.000 34.74631  ? 290 ILE B N   1 
ATOM   4796  C  CA  . ILE B 2 290 ? 20.92959  -17.51990 -8.21513  1.000 39.54507  ? 290 ILE B CA  1 
ATOM   4797  C  C   . ILE B 2 290 ? 20.09014  -17.28303 -9.46209  1.000 38.30516  ? 290 ILE B C   1 
ATOM   4798  O  O   . ILE B 2 290 ? 18.85860  -17.19605 -9.38117  1.000 41.23037  ? 290 ILE B O   1 
ATOM   4799  C  CB  . ILE B 2 290 ? 20.55130  -18.84842 -7.54347  1.000 41.58713  ? 290 ILE B CB  1 
ATOM   4800  C  CG1 . ILE B 2 290 ? 21.33495  -19.03440 -6.24437  1.000 39.35141  ? 290 ILE B CG1 1 
ATOM   4801  C  CG2 . ILE B 2 290 ? 20.77613  -20.01337 -8.49581  1.000 38.58578  ? 290 ILE B CG2 1 
ATOM   4802  C  CD1 . ILE B 2 290 ? 20.90441  -20.24299 -5.44329  1.000 41.43703  ? 290 ILE B CD1 1 
ATOM   4803  N  N   . LYS B 2 291 ? 20.75422  -17.18118 -10.61283 1.000 37.30580  ? 291 LYS B N   1 
ATOM   4804  C  CA  . LYS B 2 291 ? 20.09688  -17.02981 -11.90225 1.000 31.10992  ? 291 LYS B CA  1 
ATOM   4805  C  C   . LYS B 2 291 ? 20.44449  -18.20831 -12.80172 1.000 38.01823  ? 291 LYS B C   1 
ATOM   4806  O  O   . LYS B 2 291 ? 21.54616  -18.76048 -12.72972 1.000 40.91721  ? 291 LYS B O   1 
ATOM   4807  C  CB  . LYS B 2 291 ? 20.51199  -15.73063 -12.59321 1.000 38.66735  ? 291 LYS B CB  1 
ATOM   4808  C  CG  . LYS B 2 291 ? 20.16866  -14.45749 -11.83858 1.000 34.47739  ? 291 LYS B CG  1 
ATOM   4809  C  CD  . LYS B 2 291 ? 20.62831  -13.25748 -12.63932 1.000 37.23417  ? 291 LYS B CD  1 
ATOM   4810  C  CE  . LYS B 2 291 ? 20.40299  -11.95759 -11.90014 1.000 38.07569  ? 291 LYS B CE  1 
ATOM   4811  N  NZ  . LYS B 2 291 ? 20.97668  -10.82836 -12.67800 1.000 42.35321  ? 291 LYS B NZ  1 
ATOM   4812  N  N   . GLY B 2 292 ? 19.50416  -18.57744 -13.66641 1.000 41.46325  ? 292 GLY B N   1 
ATOM   4813  C  CA  . GLY B 2 292 ? 19.74100  -19.63514 -14.63013 1.000 39.97353  ? 292 GLY B CA  1 
ATOM   4814  C  C   . GLY B 2 292 ? 18.88115  -19.47899 -15.86461 1.000 41.73331  ? 292 GLY B C   1 
ATOM   4815  O  O   . GLY B 2 292 ? 17.65508  -19.56748 -15.76938 1.000 52.68786  ? 292 GLY B O   1 
ATOM   4816  N  N   . GLY B 2 293 ? 19.49257  -19.25106 -17.02021 1.000 41.98085  ? 293 GLY B N   1 
ATOM   4817  C  CA  . GLY B 2 293 ? 18.74071  -18.89566 -18.20981 1.000 43.61907  ? 293 GLY B CA  1 
ATOM   4818  C  C   . GLY B 2 293 ? 19.22885  -19.59822 -19.45961 1.000 46.10232  ? 293 GLY B C   1 
ATOM   4819  O  O   . GLY B 2 293 ? 20.41459  -19.89827 -19.61273 1.000 50.47047  ? 293 GLY B O   1 
ATOM   4820  N  N   . LEU B 2 294 ? 18.28206  -19.85927 -20.35963 1.000 54.05144  ? 294 LEU B N   1 
ATOM   4821  C  CA  . LEU B 2 294 ? 18.59408  -20.32696 -21.70386 1.000 49.52738  ? 294 LEU B CA  1 
ATOM   4822  C  C   . LEU B 2 294 ? 19.23787  -19.20888 -22.51933 1.000 51.80454  ? 294 LEU B C   1 
ATOM   4823  O  O   . LEU B 2 294 ? 18.99318  -18.02154 -22.28687 1.000 47.61902  ? 294 LEU B O   1 
ATOM   4824  C  CB  . LEU B 2 294 ? 17.32151  -20.81659 -22.39977 1.000 54.09918  ? 294 LEU B CB  1 
ATOM   4825  C  CG  . LEU B 2 294 ? 17.40076  -21.36805 -23.82508 1.000 49.49074  ? 294 LEU B CG  1 
ATOM   4826  C  CD1 . LEU B 2 294 ? 17.94935  -22.78609 -23.82579 1.000 54.21110  ? 294 LEU B CD1 1 
ATOM   4827  C  CD2 . LEU B 2 294 ? 16.03271  -21.32125 -24.48715 1.000 47.67458  ? 294 LEU B CD2 1 
ATOM   4828  N  N   . CYS B 2 295 ? 20.06078  -19.60077 -23.48926 1.000 48.79616  ? 295 CYS B N   1 
ATOM   4829  C  CA  . CYS B 2 295 ? 20.79700  -18.62570 -24.28355 1.000 45.83886  ? 295 CYS B CA  1 
ATOM   4830  C  C   . CYS B 2 295 ? 19.83850  -17.73815 -25.07406 1.000 45.90169  ? 295 CYS B C   1 
ATOM   4831  O  O   . CYS B 2 295 ? 18.83398  -18.22442 -25.61065 1.000 37.60950  ? 295 CYS B O   1 
ATOM   4832  C  CB  . CYS B 2 295 ? 21.74802  -19.32542 -25.25292 1.000 53.82804  ? 295 CYS B CB  1 
ATOM   4833  S  SG  . CYS B 2 295 ? 20.92170  -20.28774 -26.54971 1.000 50.39037  ? 295 CYS B SG  1 
ATOM   4834  N  N   . PRO B 2 296 ? 20.12201  -16.44520 -25.18377 1.000 36.33335  ? 296 PRO B N   1 
ATOM   4835  C  CA  . PRO B 2 296 ? 19.29300  -15.58898 -26.03123 1.000 38.41761  ? 296 PRO B CA  1 
ATOM   4836  C  C   . PRO B 2 296 ? 19.46906  -15.94170 -27.49953 1.000 47.99366  ? 296 PRO B C   1 
ATOM   4837  O  O   . PRO B 2 296 ? 20.53199  -16.39000 -27.93957 1.000 36.82243  ? 296 PRO B O   1 
ATOM   4838  C  CB  . PRO B 2 296 ? 19.81231  -14.17624 -25.73288 1.000 38.39882  ? 296 PRO B CB  1 
ATOM   4839  C  CG  . PRO B 2 296 ? 20.60351  -14.29774 -24.47512 1.000 34.94640  ? 296 PRO B CG  1 
ATOM   4840  C  CD  . PRO B 2 296 ? 21.16251  -15.68240 -24.48045 1.000 41.06149  ? 296 PRO B CD  1 
ATOM   4841  N  N   . GLY B 2 297 ? 18.39438  -15.75154 -28.25521 1.000 34.84998  ? 297 GLY B N   1 
ATOM   4842  C  CA  . GLY B 2 297 ? 18.43438  -15.95840 -29.68458 1.000 32.30411  ? 297 GLY B CA  1 
ATOM   4843  C  C   . GLY B 2 297 ? 17.89081  -14.75710 -30.42334 1.000 34.48724  ? 297 GLY B C   1 
ATOM   4844  O  O   . GLY B 2 297 ? 17.82640  -13.65686 -29.86877 1.000 36.45470  ? 297 GLY B O   1 
ATOM   4845  N  N   . GLY B 2 298 ? 17.49332  -14.95211 -31.67280 1.000 31.73582  ? 298 GLY B N   1 
ATOM   4846  C  CA  . GLY B 2 298 ? 16.93209  -13.88068 -32.46149 1.000 33.20460  ? 298 GLY B CA  1 
ATOM   4847  C  C   . GLY B 2 298 ? 17.98780  -13.10893 -33.22918 1.000 33.71567  ? 298 GLY B C   1 
ATOM   4848  O  O   . GLY B 2 298 ? 19.19689  -13.25399 -33.02746 1.000 33.65046  ? 298 GLY B O   1 
ATOM   4849  N  N   . ARG B 2 299 ? 17.49570  -12.22845 -34.10230 1.000 37.58290  ? 299 ARG B N   1 
ATOM   4850  C  CA  . ARG B 2 299 ? 18.36812  -11.48591 -35.00670 1.000 33.54958  ? 299 ARG B CA  1 
ATOM   4851  C  C   . ARG B 2 299 ? 19.28736  -10.53838 -34.24813 1.000 34.73228  ? 299 ARG B C   1 
ATOM   4852  O  O   . ARG B 2 299 ? 20.50001  -10.51102 -34.49027 1.000 36.16907  ? 299 ARG B O   1 
ATOM   4853  C  CB  . ARG B 2 299 ? 17.51644  -10.71891 -36.01620 1.000 37.84341  ? 299 ARG B CB  1 
ATOM   4854  C  CG  . ARG B 2 299 ? 18.25935  -9.67879  -36.82510 1.000 30.32657  ? 299 ARG B CG  1 
ATOM   4855  C  CD  . ARG B 2 299 ? 17.36573  -9.20112  -37.95128 1.000 36.20575  ? 299 ARG B CD  1 
ATOM   4856  N  NE  . ARG B 2 299 ? 18.03231  -8.26139  -38.84071 1.000 39.38990  ? 299 ARG B NE  1 
ATOM   4857  C  CZ  . ARG B 2 299 ? 17.46790  -7.73923  -39.91968 1.000 42.01699  ? 299 ARG B CZ  1 
ATOM   4858  N  NH1 . ARG B 2 299 ? 16.22935  -8.04826  -40.26857 1.000 38.56940  ? 299 ARG B NH1 1 
ATOM   4859  N  NH2 . ARG B 2 299 ? 18.16259  -6.88739  -40.66797 1.000 48.27123  ? 299 ARG B NH2 1 
ATOM   4860  N  N   . LEU B 2 300 ? 18.72529  -9.74431  -33.33126 1.000 29.10209  ? 300 LEU B N   1 
ATOM   4861  C  CA  . LEU B 2 300 ? 19.51565  -8.71548  -32.66376 1.000 27.68964  ? 300 LEU B CA  1 
ATOM   4862  C  C   . LEU B 2 300 ? 20.65719  -9.31587  -31.85747 1.000 34.44187  ? 300 LEU B C   1 
ATOM   4863  O  O   . LEU B 2 300 ? 21.78160  -8.79938  -31.88333 1.000 38.23647  ? 300 LEU B O   1 
ATOM   4864  C  CB  . LEU B 2 300 ? 18.62638  -7.87031  -31.75896 1.000 26.23180  ? 300 LEU B CB  1 
ATOM   4865  C  CG  . LEU B 2 300 ? 19.39425  -6.77088  -31.03201 1.000 37.36938  ? 300 LEU B CG  1 
ATOM   4866  C  CD1 . LEU B 2 300 ? 19.96227  -5.77564  -32.03458 1.000 35.62119  ? 300 LEU B CD1 1 
ATOM   4867  C  CD2 . LEU B 2 300 ? 18.50147  -6.09001  -30.01922 1.000 35.16943  ? 300 LEU B CD2 1 
ATOM   4868  N  N   . ARG B 2 301 ? 20.38764  -10.40132 -31.12782 1.000 33.52890  ? 301 ARG B N   1 
ATOM   4869  C  CA  . ARG B 2 301 ? 21.44086  -11.05833 -30.35971 1.000 31.98474  ? 301 ARG B CA  1 
ATOM   4870  C  C   . ARG B 2 301 ? 22.57559  -11.50720 -31.26792 1.000 32.11911  ? 301 ARG B C   1 
ATOM   4871  O  O   . ARG B 2 301 ? 23.75322  -11.28609 -30.96373 1.000 30.78952  ? 301 ARG B O   1 
ATOM   4872  C  CB  . ARG B 2 301 ? 20.86513  -12.24611 -29.59028 1.000 30.77834  ? 301 ARG B CB  1 
ATOM   4873  C  CG  . ARG B 2 301 ? 21.89778  -13.05197 -28.80601 1.000 29.29339  ? 301 ARG B CG  1 
ATOM   4874  C  CD  . ARG B 2 301 ? 22.61498  -12.20572 -27.76069 1.000 27.04707  ? 301 ARG B CD  1 
ATOM   4875  N  NE  . ARG B 2 301 ? 23.24070  -13.05352 -26.75261 1.000 30.86402  ? 301 ARG B NE  1 
ATOM   4876  C  CZ  . ARG B 2 301 ? 23.80066  -12.60899 -25.63706 1.000 23.73888  ? 301 ARG B CZ  1 
ATOM   4877  N  NH1 . ARG B 2 301 ? 23.87518  -11.31634 -25.36685 1.000 26.92307  ? 301 ARG B NH1 1 
ATOM   4878  N  NH2 . ARG B 2 301 ? 24.28467  -13.48392 -24.76261 1.000 29.44077  ? 301 ARG B NH2 1 
ATOM   4879  N  N   . MET B 2 302 ? 22.23374  -12.13079 -32.40012 1.000 30.55995  ? 302 MET B N   1 
ATOM   4880  C  CA  . MET B 2 302 ? 23.25630  -12.58071 -33.33855 1.000 30.58482  ? 302 MET B CA  1 
ATOM   4881  C  C   . MET B 2 302 ? 24.02422  -11.40620 -33.92620 1.000 30.96022  ? 302 MET B C   1 
ATOM   4882  O  O   . MET B 2 302 ? 25.25206  -11.46268 -34.05460 1.000 35.44962  ? 302 MET B O   1 
ATOM   4883  C  CB  . MET B 2 302 ? 22.62032  -13.40451 -34.45931 1.000 30.95615  ? 302 MET B CB  1 
ATOM   4884  C  CG  . MET B 2 302 ? 21.98153  -14.71453 -34.02842 1.000 31.77013  ? 302 MET B CG  1 
ATOM   4885  S  SD  . MET B 2 302 ? 23.15773  -15.92222 -33.38309 1.000 39.42755  ? 302 MET B SD  1 
ATOM   4886  C  CE  . MET B 2 302 ? 22.89384  -15.75002 -31.61723 1.000 35.10216  ? 302 MET B CE  1 
ATOM   4887  N  N   . GLU B 2 303 ? 23.32047  -10.32835 -34.28253 1.000 35.29054  ? 303 GLU B N   1 
ATOM   4888  C  CA  . GLU B 2 303 ? 23.99100  -9.18068  -34.88551 1.000 33.43659  ? 303 GLU B CA  1 
ATOM   4889  C  C   . GLU B 2 303 ? 25.00059  -8.56204  -33.92699 1.000 40.36524  ? 303 GLU B C   1 
ATOM   4890  O  O   . GLU B 2 303 ? 26.08165  -8.13149  -34.34738 1.000 30.11866  ? 303 GLU B O   1 
ATOM   4891  C  CB  . GLU B 2 303 ? 22.96117  -8.14222  -35.33285 1.000 31.50730  ? 303 GLU B CB  1 
ATOM   4892  C  CG  . GLU B 2 303 ? 22.18866  -8.54103  -36.58668 1.000 35.59534  ? 303 GLU B CG  1 
ATOM   4893  C  CD  . GLU B 2 303 ? 21.14554  -7.51291  -36.98867 1.000 40.25474  ? 303 GLU B CD  1 
ATOM   4894  O  OE1 . GLU B 2 303 ? 20.83289  -6.63081  -36.16142 1.000 35.06781  ? 303 GLU B OE1 1 
ATOM   4895  O  OE2 . GLU B 2 303 ? 20.64210  -7.58178  -38.13366 1.000 42.58944  ? 303 GLU B OE2 1 
ATOM   4896  N  N   . ARG B 2 304 ? 24.67211  -8.51396  -32.63312 1.000 33.27131  ? 304 ARG B N   1 
ATOM   4897  C  CA  . ARG B 2 304 ? 25.59601  -7.92489  -31.67019 1.000 26.36516  ? 304 ARG B CA  1 
ATOM   4898  C  C   . ARG B 2 304 ? 26.79858  -8.82652  -31.43105 1.000 28.89807  ? 304 ARG B C   1 
ATOM   4899  O  O   . ARG B 2 304 ? 27.92054  -8.33617  -31.25505 1.000 32.17821  ? 304 ARG B O   1 
ATOM   4900  C  CB  . ARG B 2 304 ? 24.86592  -7.61485  -30.36743 1.000 30.99779  ? 304 ARG B CB  1 
ATOM   4901  C  CG  . ARG B 2 304 ? 23.84872  -6.51466  -30.54901 1.000 35.44912  ? 304 ARG B CG  1 
ATOM   4902  C  CD  . ARG B 2 304 ? 23.18855  -6.11949  -29.26232 1.000 31.31355  ? 304 ARG B CD  1 
ATOM   4903  N  NE  . ARG B 2 304 ? 22.59547  -4.79504  -29.37955 1.000 34.86925  ? 304 ARG B NE  1 
ATOM   4904  C  CZ  . ARG B 2 304 ? 21.77453  -4.26313  -28.48530 1.000 36.75353  ? 304 ARG B CZ  1 
ATOM   4905  N  NH1 . ARG B 2 304 ? 21.40153  -4.93201  -27.40686 1.000 44.07664  ? 304 ARG B NH1 1 
ATOM   4906  N  NH2 . ARG B 2 304 ? 21.32004  -3.02836  -28.67565 1.000 46.26363  ? 304 ARG B NH2 1 
ATOM   4907  N  N   . LEU B 2 305 ? 26.59213  -10.14576 -31.41849 1.000 26.58620  ? 305 LEU B N   1 
ATOM   4908  C  CA  . LEU B 2 305 ? 27.72664  -11.04951 -31.26610 1.000 29.10636  ? 305 LEU B CA  1 
ATOM   4909  C  C   . LEU B 2 305 ? 28.57578  -11.09977 -32.52902 1.000 37.24165  ? 305 LEU B C   1 
ATOM   4910  O  O   . LEU B 2 305 ? 29.79003  -11.31989 -32.44938 1.000 37.42581  ? 305 LEU B O   1 
ATOM   4911  C  CB  . LEU B 2 305 ? 27.25316  -12.44886 -30.88130 1.000 32.89669  ? 305 LEU B CB  1 
ATOM   4912  C  CG  . LEU B 2 305 ? 26.44704  -12.54179 -29.58372 1.000 42.48933  ? 305 LEU B CG  1 
ATOM   4913  C  CD1 . LEU B 2 305 ? 26.35640  -13.98723 -29.14132 1.000 36.43267  ? 305 LEU B CD1 1 
ATOM   4914  C  CD2 . LEU B 2 305 ? 27.02738  -11.66286 -28.48259 1.000 31.26771  ? 305 LEU B CD2 1 
ATOM   4915  N  N   . ILE B 2 306 ? 27.95727  -10.93736 -33.69998 1.000 31.16043  ? 306 ILE B N   1 
ATOM   4916  C  CA  . ILE B 2 306 ? 28.73487  -10.82202 -34.92963 1.000 33.07141  ? 306 ILE B CA  1 
ATOM   4917  C  C   . ILE B 2 306 ? 29.63341  -9.59004  -34.87048 1.000 34.95028  ? 306 ILE B C   1 
ATOM   4918  O  O   . ILE B 2 306 ? 30.80154  -9.63403  -35.27679 1.000 36.78423  ? 306 ILE B O   1 
ATOM   4919  C  CB  . ILE B 2 306 ? 27.79676  -10.79325 -36.15122 1.000 41.44216  ? 306 ILE B CB  1 
ATOM   4920  C  CG1 . ILE B 2 306 ? 27.23985  -12.18976 -36.42919 1.000 40.13957  ? 306 ILE B CG1 1 
ATOM   4921  C  CG2 . ILE B 2 306 ? 28.52474  -10.28226 -37.38255 1.000 41.65251  ? 306 ILE B CG2 1 
ATOM   4922  C  CD1 . ILE B 2 306 ? 26.13365  -12.20383 -37.46413 1.000 38.97615  ? 306 ILE B CD1 1 
ATOM   4923  N  N   . ASP B 2 307 ? 29.11350  -8.47908  -34.33765 1.000 35.30936  ? 307 ASP B N   1 
ATOM   4924  C  CA  . ASP B 2 307 ? 29.92897  -7.27518  -34.20038 1.000 37.55023  ? 307 ASP B CA  1 
ATOM   4925  C  C   . ASP B 2 307 ? 31.09404  -7.49999  -33.24757 1.000 35.88449  ? 307 ASP B C   1 
ATOM   4926  O  O   . ASP B 2 307 ? 32.18581  -6.95714  -33.45344 1.000 40.12587  ? 307 ASP B O   1 
ATOM   4927  C  CB  . ASP B 2 307 ? 29.07806  -6.09980  -33.71978 1.000 38.02577  ? 307 ASP B CB  1 
ATOM   4928  C  CG  . ASP B 2 307 ? 28.33624  -5.41287  -34.84845 1.000 46.82426  ? 307 ASP B CG  1 
ATOM   4929  O  OD1 . ASP B 2 307 ? 28.55279  -5.78784  -36.02206 1.000 47.61940  ? 307 ASP B OD1 1 
ATOM   4930  O  OD2 . ASP B 2 307 ? 27.54739  -4.48512  -34.55992 1.000 51.79737  ? 307 ASP B OD2 1 
ATOM   4931  N  N   . LEU B 2 308 ? 30.87992  -8.28304  -32.18871 1.000 35.96285  ? 308 LEU B N   1 
ATOM   4932  C  CA  . LEU B 2 308 ? 31.97520  -8.57893  -31.27287 1.000 36.53436  ? 308 LEU B CA  1 
ATOM   4933  C  C   . LEU B 2 308 ? 33.09207  -9.32391  -31.98489 1.000 37.85751  ? 308 LEU B C   1 
ATOM   4934  O  O   . LEU B 2 308 ? 34.27613  -9.06982  -31.73580 1.000 38.71570  ? 308 LEU B O   1 
ATOM   4935  C  CB  . LEU B 2 308 ? 31.46392  -9.38710  -30.08189 1.000 28.12215  ? 308 LEU B CB  1 
ATOM   4936  C  CG  . LEU B 2 308 ? 30.61157  -8.56640  -29.11677 1.000 27.64726  ? 308 LEU B CG  1 
ATOM   4937  C  CD1 . LEU B 2 308 ? 30.08846  -9.43438  -27.99341 1.000 27.81957  ? 308 LEU B CD1 1 
ATOM   4938  C  CD2 . LEU B 2 308 ? 31.41222  -7.39331  -28.57245 1.000 27.72937  ? 308 LEU B CD2 1 
ATOM   4939  N  N   . VAL B 2 309 ? 32.73441  -10.23135 -32.89207 1.000 34.52023  ? 309 VAL B N   1 
ATOM   4940  C  CA  . VAL B 2 309 ? 33.74078  -10.94396 -33.66721 1.000 37.26653  ? 309 VAL B CA  1 
ATOM   4941  C  C   . VAL B 2 309 ? 34.32212  -10.04384 -34.74827 1.000 37.15386  ? 309 VAL B C   1 
ATOM   4942  O  O   . VAL B 2 309 ? 35.53296  -10.05662 -34.99752 1.000 46.40039  ? 309 VAL B O   1 
ATOM   4943  C  CB  . VAL B 2 309 ? 33.13122  -12.22504 -34.26354 1.000 29.64534  ? 309 VAL B CB  1 
ATOM   4944  C  CG1 . VAL B 2 309 ? 34.17695  -13.00205 -35.03066 1.000 34.53946  ? 309 VAL B CG1 1 
ATOM   4945  C  CG2 . VAL B 2 309 ? 32.51871  -13.07905 -33.16679 1.000 35.87930  ? 309 VAL B CG2 1 
ATOM   4946  N  N   . PHE B 2 310 ? 33.47149  -9.25095  -35.40250 1.000 34.58606  ? 310 PHE B N   1 
ATOM   4947  C  CA  . PHE B 2 310 ? 33.92697  -8.40340  -36.50030 1.000 40.56706  ? 310 PHE B CA  1 
ATOM   4948  C  C   . PHE B 2 310 ? 34.95034  -7.38292  -36.01859 1.000 39.68619  ? 310 PHE B C   1 
ATOM   4949  O  O   . PHE B 2 310 ? 36.01216  -7.21212  -36.62889 1.000 38.99170  ? 310 PHE B O   1 
ATOM   4950  C  CB  . PHE B 2 310 ? 32.72725  -7.70288  -37.14163 1.000 44.60013  ? 310 PHE B CB  1 
ATOM   4951  C  CG  . PHE B 2 310 ? 33.07932  -6.85228  -38.32659 1.000 43.52721  ? 310 PHE B CG  1 
ATOM   4952  C  CD1 . PHE B 2 310 ? 33.20413  -7.41350  -39.58631 1.000 52.03957  ? 310 PHE B CD1 1 
ATOM   4953  C  CD2 . PHE B 2 310 ? 33.28224  -5.49038  -38.18221 1.000 51.13357  ? 310 PHE B CD2 1 
ATOM   4954  C  CE1 . PHE B 2 310 ? 33.52425  -6.63294  -40.68020 1.000 47.12884  ? 310 PHE B CE1 1 
ATOM   4955  C  CE2 . PHE B 2 310 ? 33.60640  -4.70545  -39.27343 1.000 53.12763  ? 310 PHE B CE2 1 
ATOM   4956  C  CZ  . PHE B 2 310 ? 33.72826  -5.28003  -40.52297 1.000 50.65312  ? 310 PHE B CZ  1 
ATOM   4957  N  N   . TYR B 2 311 ? 34.65432  -6.70064  -34.91681 1.000 37.59863  ? 311 TYR B N   1 
ATOM   4958  C  CA  . TYR B 2 311 ? 35.57403  -5.72005  -34.36014 1.000 41.47549  ? 311 TYR B CA  1 
ATOM   4959  C  C   . TYR B 2 311 ? 36.60626  -6.35176  -33.43281 1.000 37.71037  ? 311 TYR B C   1 
ATOM   4960  O  O   . TYR B 2 311 ? 37.27114  -5.63434  -32.67818 1.000 37.40588  ? 311 TYR B O   1 
ATOM   4961  C  CB  . TYR B 2 311 ? 34.78686  -4.60787  -33.65807 1.000 35.10531  ? 311 TYR B CB  1 
ATOM   4962  C  CG  . TYR B 2 311 ? 33.92409  -3.83712  -34.64140 1.000 37.93811  ? 311 TYR B CG  1 
ATOM   4963  C  CD1 . TYR B 2 311 ? 34.49370  -2.93790  -35.53753 1.000 40.89117  ? 311 TYR B CD1 1 
ATOM   4964  C  CD2 . TYR B 2 311 ? 32.55123  -4.03452  -34.69994 1.000 36.78276  ? 311 TYR B CD2 1 
ATOM   4965  C  CE1 . TYR B 2 311 ? 33.71528  -2.24366  -36.45054 1.000 30.60231  ? 311 TYR B CE1 1 
ATOM   4966  C  CE2 . TYR B 2 311 ? 31.76624  -3.34644  -35.61106 1.000 35.96001  ? 311 TYR B CE2 1 
ATOM   4967  C  CZ  . TYR B 2 311 ? 32.35419  -2.45412  -36.48115 1.000 34.36992  ? 311 TYR B CZ  1 
ATOM   4968  O  OH  . TYR B 2 311 ? 31.57863  -1.76998  -37.38797 1.000 47.59778  ? 311 TYR B OH  1 
ATOM   4969  N  N   . LYS B 2 312 ? 36.74647  -7.67761  -33.48124 1.000 39.43181  ? 312 LYS B N   1 
ATOM   4970  C  CA  . LYS B 2 312 ? 37.85571  -8.39550  -32.85366 1.000 37.24211  ? 312 LYS B CA  1 
ATOM   4971  C  C   . LYS B 2 312 ? 37.87487  -8.21171  -31.33910 1.000 39.31223  ? 312 LYS B C   1 
ATOM   4972  O  O   . LYS B 2 312 ? 38.93110  -8.04562  -30.72400 1.000 38.04923  ? 312 LYS B O   1 
ATOM   4973  C  CB  . LYS B 2 312 ? 39.18522  -7.99369  -33.49453 1.000 42.16822  ? 312 LYS B CB  1 
ATOM   4974  C  CG  . LYS B 2 312 ? 39.20942  -8.35649  -34.97379 1.000 41.99896  ? 312 LYS B CG  1 
ATOM   4975  C  CD  . LYS B 2 312 ? 40.43478  -7.86162  -35.70281 1.000 59.77355  ? 312 LYS B CD  1 
ATOM   4976  C  CE  . LYS B 2 312 ? 40.33504  -8.21198  -37.18329 1.000 54.76414  ? 312 LYS B CE  1 
ATOM   4977  N  NZ  . LYS B 2 312 ? 41.44172  -7.61912  -37.98172 1.000 87.62958  ? 312 LYS B NZ  1 
ATOM   4978  N  N   . ARG B 2 313 ? 36.68807  -8.26182  -30.73212 1.000 35.88641  ? 313 ARG B N   1 
ATOM   4979  C  CA  . ARG B 2 313 ? 36.58875  -8.29253  -29.27960 1.000 32.72737  ? 313 ARG B CA  1 
ATOM   4980  C  C   . ARG B 2 313 ? 36.72190  -9.71000  -28.74121 1.000 39.19205  ? 313 ARG B C   1 
ATOM   4981  O  O   . ARG B 2 313 ? 37.15482  -9.89615  -27.59882 1.000 42.68863  ? 313 ARG B O   1 
ATOM   4982  C  CB  . ARG B 2 313 ? 35.25762  -7.68914  -28.82686 1.000 31.73975  ? 313 ARG B CB  1 
ATOM   4983  C  CG  . ARG B 2 313 ? 34.95510  -6.32030  -29.41582 1.000 29.32155  ? 313 ARG B CG  1 
ATOM   4984  C  CD  . ARG B 2 313 ? 36.08385  -5.33843  -29.15554 1.000 31.69414  ? 313 ARG B CD  1 
ATOM   4985  N  NE  . ARG B 2 313 ? 35.71596  -3.97654  -29.52063 1.000 33.69824  ? 313 ARG B NE  1 
ATOM   4986  C  CZ  . ARG B 2 313 ? 36.58603  -2.99602  -29.71809 1.000 27.99002  ? 313 ARG B CZ  1 
ATOM   4987  N  NH1 . ARG B 2 313 ? 37.88894  -3.19751  -29.61308 1.000 33.76540  ? 313 ARG B NH1 1 
ATOM   4988  N  NH2 . ARG B 2 313 ? 36.13825  -1.78643  -30.04195 1.000 31.82413  ? 313 ARG B NH2 1 
ATOM   4989  N  N   A VAL B 2 314 ? 36.35595  -10.71333 -29.53935 0.054 38.51927  ? 314 VAL B N   1 
ATOM   4990  N  N   B VAL B 2 314 ? 36.35812  -10.70646 -29.54071 0.946 37.96973  ? 314 VAL B N   1 
ATOM   4991  C  CA  A VAL B 2 314 ? 36.41062  -12.12112 -29.14356 0.054 39.09852  ? 314 VAL B CA  1 
ATOM   4992  C  CA  B VAL B 2 314 ? 36.47273  -12.10517 -29.15024 0.946 38.66528  ? 314 VAL B CA  1 
ATOM   4993  C  C   A VAL B 2 314 ? 36.64034  -12.96236 -30.39354 0.054 40.56754  ? 314 VAL B C   1 
ATOM   4994  C  C   B VAL B 2 314 ? 36.69297  -12.92568 -30.41088 0.946 37.67382  ? 314 VAL B C   1 
ATOM   4995  O  O   A VAL B 2 314 ? 35.98000  -12.75646 -31.41631 0.054 39.39899  ? 314 VAL B O   1 
ATOM   4996  O  O   B VAL B 2 314 ? 36.09540  -12.65701 -31.45644 0.946 39.47398  ? 314 VAL B O   1 
ATOM   4997  C  CB  A VAL B 2 314 ? 35.12101  -12.56811 -28.41877 0.054 36.64241  ? 314 VAL B CB  1 
ATOM   4998  C  CB  B VAL B 2 314 ? 35.22842  -12.58409 -28.36766 0.946 36.34337  ? 314 VAL B CB  1 
ATOM   4999  C  CG1 A VAL B 2 314 ? 34.91862  -14.07163 -28.54968 0.054 37.31934  ? 314 VAL B CG1 1 
ATOM   5000  C  CG1 B VAL B 2 314 ? 33.97693  -12.48942 -29.22655 0.946 32.27265  ? 314 VAL B CG1 1 
ATOM   5001  C  CG2 A VAL B 2 314 ? 35.15953  -12.17701 -26.94925 0.054 37.16548  ? 314 VAL B CG2 1 
ATOM   5002  C  CG2 B VAL B 2 314 ? 35.42868  -14.00539 -27.85555 0.946 35.79350  ? 314 VAL B CG2 1 
ATOM   5003  N  N   . ASP B 2 315 ? 37.57731  -13.91234 -30.31542 1.000 42.38718  ? 315 ASP B N   1 
ATOM   5004  C  CA  . ASP B 2 315 ? 37.84316  -14.82894 -31.42101 1.000 41.83491  ? 315 ASP B CA  1 
ATOM   5005  C  C   . ASP B 2 315 ? 37.38079  -16.22767 -31.04053 1.000 39.11162  ? 315 ASP B C   1 
ATOM   5006  O  O   . ASP B 2 315 ? 38.10418  -16.94992 -30.33642 1.000 41.90882  ? 315 ASP B O   1 
ATOM   5007  C  CB  . ASP B 2 315 ? 39.33190  -14.83823 -31.77354 1.000 47.60222  ? 315 ASP B CB  1 
ATOM   5008  C  CG  . ASP B 2 315 ? 39.63403  -15.66763 -33.00552 1.000 53.26251  ? 315 ASP B CG  1 
ATOM   5009  O  OD1 . ASP B 2 315 ? 38.68135  -16.14808 -33.66123 1.000 53.99394  ? 315 ASP B OD1 1 
ATOM   5010  O  OD2 . ASP B 2 315 ? 40.83149  -15.84921 -33.31153 1.000 61.58058  ? 315 ASP B OD2 1 
ATOM   5011  N  N   . PRO B 2 316 ? 36.20214  -16.66706 -31.48449 1.000 38.08269  ? 316 PRO B N   1 
ATOM   5012  C  CA  . PRO B 2 316 ? 35.71779  -17.99775 -31.10699 1.000 41.82516  ? 316 PRO B CA  1 
ATOM   5013  C  C   . PRO B 2 316 ? 36.36957  -19.13838 -31.86904 1.000 44.01961  ? 316 PRO B C   1 
ATOM   5014  O  O   . PRO B 2 316 ? 36.05089  -20.29991 -31.59327 1.000 50.80532  ? 316 PRO B O   1 
ATOM   5015  C  CB  . PRO B 2 316 ? 34.22153  -17.90792 -31.42400 1.000 40.28071  ? 316 PRO B CB  1 
ATOM   5016  C  CG  . PRO B 2 316 ? 34.16338  -16.97562 -32.58161 1.000 43.20429  ? 316 PRO B CG  1 
ATOM   5017  C  CD  . PRO B 2 316 ? 35.22347  -15.93850 -32.31183 1.000 40.46685  ? 316 PRO B CD  1 
ATOM   5018  N  N   . SER B 2 317 ? 37.26530  -18.85091 -32.81674 1.000 50.06747  ? 317 SER B N   1 
ATOM   5019  C  CA  . SER B 2 317 ? 37.88057  -19.91874 -33.59531 1.000 43.93901  ? 317 SER B CA  1 
ATOM   5020  C  C   . SER B 2 317 ? 38.73816  -20.83715 -32.73362 1.000 49.40720  ? 317 SER B C   1 
ATOM   5021  O  O   . SER B 2 317 ? 39.01793  -21.96923 -33.14201 1.000 50.34260  ? 317 SER B O   1 
ATOM   5022  C  CB  . SER B 2 317 ? 38.71647  -19.33226 -34.73231 1.000 44.32935  ? 317 SER B CB  1 
ATOM   5023  O  OG  . SER B 2 317 ? 39.74863  -18.50678 -34.22748 1.000 72.68240  ? 317 SER B OG  1 
ATOM   5024  N  N   . LYS B 2 318 ? 39.16265  -20.37749 -31.55350 1.000 47.78813  ? 318 LYS B N   1 
ATOM   5025  C  CA  . LYS B 2 318 ? 39.92475  -21.23174 -30.65117 1.000 46.76460  ? 318 LYS B CA  1 
ATOM   5026  C  C   . LYS B 2 318 ? 39.08273  -22.37951 -30.10603 1.000 43.52089  ? 318 LYS B C   1 
ATOM   5027  O  O   . LYS B 2 318 ? 39.64192  -23.37577 -29.63664 1.000 51.67890  ? 318 LYS B O   1 
ATOM   5028  C  CB  . LYS B 2 318 ? 40.49737  -20.39313 -29.50407 1.000 49.34414  ? 318 LYS B CB  1 
ATOM   5029  C  CG  . LYS B 2 318 ? 41.56344  -21.08878 -28.67439 1.000 49.87682  ? 318 LYS B CG  1 
ATOM   5030  C  CD  . LYS B 2 318 ? 42.78586  -21.41899 -29.51464 1.000 67.90208  ? 318 LYS B CD  1 
ATOM   5031  C  CE  . LYS B 2 318 ? 43.82375  -22.20356 -28.71979 1.000 65.50489  ? 318 LYS B CE  1 
ATOM   5032  N  NZ  . LYS B 2 318 ? 44.39057  -21.40753 -27.59754 1.000 65.69168  ? 318 LYS B NZ  1 
ATOM   5033  N  N   . LEU B 2 319 ? 37.75333  -22.26752 -30.17068 1.000 43.46148  ? 319 LEU B N   1 
ATOM   5034  C  CA  . LEU B 2 319 ? 36.88785  -23.35422 -29.72198 1.000 48.03829  ? 319 LEU B CA  1 
ATOM   5035  C  C   . LEU B 2 319 ? 36.89862  -24.52767 -30.69148 1.000 47.34729  ? 319 LEU B C   1 
ATOM   5036  O  O   . LEU B 2 319 ? 36.64326  -25.66786 -30.28692 1.000 54.98638  ? 319 LEU B O   1 
ATOM   5037  C  CB  . LEU B 2 319 ? 35.45543  -22.85367 -29.55290 1.000 38.13117  ? 319 LEU B CB  1 
ATOM   5038  C  CG  . LEU B 2 319 ? 35.21880  -21.71709 -28.56389 1.000 36.79110  ? 319 LEU B CG  1 
ATOM   5039  C  CD1 . LEU B 2 319 ? 33.75592  -21.32293 -28.59336 1.000 39.40384  ? 319 LEU B CD1 1 
ATOM   5040  C  CD2 . LEU B 2 319 ? 35.64948  -22.12455 -27.16732 1.000 37.12945  ? 319 LEU B CD2 1 
ATOM   5041  N  N   . VAL B 2 320 ? 37.18092  -24.27652 -31.96579 1.000 47.20246  ? 320 VAL B N   1 
ATOM   5042  C  CA  . VAL B 2 320 ? 37.08973  -25.31452 -32.98705 1.000 50.93183  ? 320 VAL B CA  1 
ATOM   5043  C  C   . VAL B 2 320 ? 38.39727  -26.09650 -32.97797 1.000 52.91711  ? 320 VAL B C   1 
ATOM   5044  O  O   . VAL B 2 320 ? 39.45833  -25.55573 -33.29741 1.000 54.59399  ? 320 VAL B O   1 
ATOM   5045  C  CB  . VAL B 2 320 ? 36.80627  -24.71892 -34.36991 1.000 47.78567  ? 320 VAL B CB  1 
ATOM   5046  C  CG1 . VAL B 2 320 ? 36.62304  -25.81884 -35.39299 1.000 49.70087  ? 320 VAL B CG1 1 
ATOM   5047  C  CG2 . VAL B 2 320 ? 35.57938  -23.82095 -34.31444 1.000 46.05325  ? 320 VAL B CG2 1 
ATOM   5048  N  N   . THR B 2 321 ? 38.32148  -27.37516 -32.60340 1.000 59.11645  ? 321 THR B N   1 
ATOM   5049  C  CA  . THR B 2 321 ? 39.48205  -28.25144 -32.58442 1.000 53.50961  ? 321 THR B CA  1 
ATOM   5050  C  C   . THR B 2 321 ? 39.47783  -29.28064 -33.70251 1.000 57.00702  ? 321 THR B C   1 
ATOM   5051  O  O   . THR B 2 321 ? 40.54360  -29.80071 -34.04477 1.000 62.48708  ? 321 THR B O   1 
ATOM   5052  C  CB  . THR B 2 321 ? 39.57082  -28.98893 -31.24123 1.000 55.36286  ? 321 THR B CB  1 
ATOM   5053  O  OG1 . THR B 2 321 ? 38.33363  -29.66796 -30.99032 1.000 56.21496  ? 321 THR B OG1 1 
ATOM   5054  C  CG2 . THR B 2 321 ? 39.82915  -28.00091 -30.11577 1.000 52.61006  ? 321 THR B CG2 1 
ATOM   5055  N  N   . HIS B 2 322 ? 38.31435  -29.58540 -34.27117 1.000 58.84010  ? 322 HIS B N   1 
ATOM   5056  C  CA  . HIS B 2 322 ? 38.18057  -30.55906 -35.34413 1.000 55.12207  ? 322 HIS B CA  1 
ATOM   5057  C  C   . HIS B 2 322 ? 37.31309  -29.95130 -36.43451 1.000 60.77375  ? 322 HIS B C   1 
ATOM   5058  O  O   . HIS B 2 322 ? 36.27467  -29.34860 -36.14183 1.000 53.02820  ? 322 HIS B O   1 
ATOM   5059  C  CB  . HIS B 2 322 ? 37.56403  -31.86865 -34.83894 1.000 55.42372  ? 322 HIS B CB  1 
ATOM   5060  C  CG  . HIS B 2 322 ? 38.36472  -32.54138 -33.76743 1.000 63.75271  ? 322 HIS B CG  1 
ATOM   5061  N  ND1 . HIS B 2 322 ? 38.54292  -31.99212 -32.51547 1.000 62.67788  ? 322 HIS B ND1 1 
ATOM   5062  C  CD2 . HIS B 2 322 ? 39.03581  -33.71759 -33.76081 1.000 61.84876  ? 322 HIS B CD2 1 
ATOM   5063  C  CE1 . HIS B 2 322 ? 39.28874  -32.80072 -31.78374 1.000 65.61930  ? 322 HIS B CE1 1 
ATOM   5064  N  NE2 . HIS B 2 322 ? 39.60228  -33.85440 -32.51622 1.000 63.25374  ? 322 HIS B NE2 1 
ATOM   5065  N  N   . VAL B 2 323 ? 37.74152  -30.10043 -37.68496 1.000 55.79429  ? 323 VAL B N   1 
ATOM   5066  C  CA  . VAL B 2 323 ? 36.99418  -29.61201 -38.83651 1.000 54.58408  ? 323 VAL B CA  1 
ATOM   5067  C  C   . VAL B 2 323 ? 36.84182  -30.75579 -39.82396 1.000 60.83205  ? 323 VAL B C   1 
ATOM   5068  O  O   . VAL B 2 323 ? 37.83156  -31.39893 -40.19268 1.000 62.88668  ? 323 VAL B O   1 
ATOM   5069  C  CB  . VAL B 2 323 ? 37.68120  -28.40760 -39.50963 1.000 63.43344  ? 323 VAL B CB  1 
ATOM   5070  C  CG1 . VAL B 2 323 ? 36.81301  -27.87031 -40.63760 1.000 60.53909  ? 323 VAL B CG1 1 
ATOM   5071  C  CG2 . VAL B 2 323 ? 37.97297  -27.31501 -38.48958 1.000 54.05660  ? 323 VAL B CG2 1 
ATOM   5072  N  N   . PHE B 2 324 ? 35.60852  -31.01030 -40.24583 1.000 58.15756  ? 324 PHE B N   1 
ATOM   5073  C  CA  . PHE B 2 324 ? 35.31736  -32.03783 -41.22995 1.000 56.68948  ? 324 PHE B CA  1 
ATOM   5074  C  C   . PHE B 2 324 ? 34.71303  -31.40392 -42.47316 1.000 56.86527  ? 324 PHE B C   1 
ATOM   5075  O  O   . PHE B 2 324 ? 34.38771  -30.21430 -42.50541 1.000 67.74079  ? 324 PHE B O   1 
ATOM   5076  C  CB  . PHE B 2 324 ? 34.35894  -33.09385 -40.66907 1.000 56.89352  ? 324 PHE B CB  1 
ATOM   5077  C  CG  . PHE B 2 324 ? 34.85567  -33.76754 -39.42723 1.000 60.99064  ? 324 PHE B CG  1 
ATOM   5078  C  CD1 . PHE B 2 324 ? 34.59489  -33.23155 -38.17911 1.000 61.49315  ? 324 PHE B CD1 1 
ATOM   5079  C  CD2 . PHE B 2 324 ? 35.57620  -34.94727 -39.50845 1.000 67.43618  ? 324 PHE B CD2 1 
ATOM   5080  C  CE1 . PHE B 2 324 ? 35.05004  -33.85679 -37.03345 1.000 66.67911  ? 324 PHE B CE1 1 
ATOM   5081  C  CE2 . PHE B 2 324 ? 36.03428  -35.57648 -38.36787 1.000 66.43604  ? 324 PHE B CE2 1 
ATOM   5082  C  CZ  . PHE B 2 324 ? 35.77080  -35.03100 -37.12872 1.000 61.98806  ? 324 PHE B CZ  1 
ATOM   5083  N  N   . ARG B 2 325 ? 34.55567  -32.22831 -43.50178 1.000 59.00236  ? 325 ARG B N   1 
ATOM   5084  C  CA  . ARG B 2 325 ? 34.12574  -31.76513 -44.81154 1.000 66.30254  ? 325 ARG B CA  1 
ATOM   5085  C  C   . ARG B 2 325 ? 33.10418  -32.74149 -45.36645 1.000 63.07050  ? 325 ARG B C   1 
ATOM   5086  O  O   . ARG B 2 325 ? 33.35533  -33.94908 -45.39574 1.000 74.33082  ? 325 ARG B O   1 
ATOM   5087  C  CB  . ARG B 2 325 ? 35.31730  -31.64462 -45.76845 1.000 75.13093  ? 325 ARG B CB  1 
ATOM   5088  C  CG  . ARG B 2 325 ? 35.02754  -30.85985 -47.03692 1.000 99.02398  ? 325 ARG B CG  1 
ATOM   5089  C  CD  . ARG B 2 325 ? 36.24564  -30.81159 -47.95254 1.000 114.33292 ? 325 ARG B CD  1 
ATOM   5090  N  NE  . ARG B 2 325 ? 35.87785  -30.99965 -49.35194 1.000 125.76268 ? 325 ARG B NE  1 
ATOM   5091  C  CZ  . ARG B 2 325 ? 35.51511  -30.02183 -50.17131 1.000 130.12427 ? 325 ARG B CZ  1 
ATOM   5092  N  NH1 . ARG B 2 325 ? 35.48673  -28.76017 -49.77242 1.000 133.28024 ? 325 ARG B NH1 1 
ATOM   5093  N  NH2 . ARG B 2 325 ? 35.17662  -30.31664 -51.42371 1.000 122.08901 ? 325 ARG B NH2 1 
ATOM   5094  N  N   A GLY B 2 326 ? 31.93529  -32.23555 -45.74157 0.605 63.64820  ? 326 GLY B N   1 
ATOM   5095  N  N   B GLY B 2 326 ? 31.98669  -32.21261 -45.85389 0.395 63.83371  ? 326 GLY B N   1 
ATOM   5096  C  CA  A GLY B 2 326 ? 30.90627  -33.06397 -46.33051 0.605 68.17788  ? 326 GLY B CA  1 
ATOM   5097  C  CA  B GLY B 2 326 ? 31.06463  -33.01875 -46.62388 0.395 69.00133  ? 326 GLY B CA  1 
ATOM   5098  C  C   A GLY B 2 326 ? 29.82533  -33.45577 -45.33346 0.605 64.60535  ? 326 GLY B C   1 
ATOM   5099  C  C   B GLY B 2 326 ? 29.62130  -32.89941 -46.19365 0.395 66.07881  ? 326 GLY B C   1 
ATOM   5100  O  O   A GLY B 2 326 ? 30.03405  -33.49703 -44.11801 0.605 59.50932  ? 326 GLY B O   1 
ATOM   5101  O  O   B GLY B 2 326 ? 28.94936  -31.91445 -46.50870 0.395 70.06446  ? 326 GLY B O   1 
ATOM   5102  N  N   A PHE B 2 327 ? 28.64569  -33.77323 -45.87956 0.605 66.63259  ? 327 PHE B N   1 
ATOM   5103  N  N   B PHE B 2 327 ? 29.14879  -33.91323 -45.47032 0.395 66.89203  ? 327 PHE B N   1 
ATOM   5104  C  CA  A PHE B 2 327 ? 27.48930  -34.09896 -45.04726 0.605 66.51984  ? 327 PHE B CA  1 
ATOM   5105  C  CA  B PHE B 2 327 ? 27.76808  -34.04731 -45.02230 0.395 66.68491  ? 327 PHE B CA  1 
ATOM   5106  C  C   A PHE B 2 327 ? 27.67896  -35.41116 -44.29650 0.605 69.03213  ? 327 PHE B C   1 
ATOM   5107  C  C   B PHE B 2 327 ? 27.66016  -35.40055 -44.33777 0.395 69.01907  ? 327 PHE B C   1 
ATOM   5108  O  O   A PHE B 2 327 ? 27.21773  -35.54751 -43.15745 0.605 70.83695  ? 327 PHE B O   1 
ATOM   5109  O  O   B PHE B 2 327 ? 26.99948  -35.54415 -43.30466 0.395 70.38484  ? 327 PHE B O   1 
ATOM   5110  C  CB  A PHE B 2 327 ? 26.22433  -34.17146 -45.90289 0.605 64.00157  ? 327 PHE B CB  1 
ATOM   5111  C  CB  B PHE B 2 327 ? 26.78704  -33.94223 -46.19346 0.395 64.96732  ? 327 PHE B CB  1 
ATOM   5112  C  CG  A PHE B 2 327 ? 25.41849  -32.90883 -45.90781 0.605 61.46127  ? 327 PHE B CG  1 
ATOM   5113  C  CG  B PHE B 2 327 ? 25.35665  -33.75143 -45.77878 0.395 62.23203  ? 327 PHE B CG  1 
ATOM   5114  C  CD1 A PHE B 2 327 ? 24.73360  -32.50790 -44.77363 0.605 62.90544  ? 327 PHE B CD1 1 
ATOM   5115  C  CD1 B PHE B 2 327 ? 25.00499  -32.74812 -44.89307 0.395 62.87923  ? 327 PHE B CD1 1 
ATOM   5116  C  CD2 A PHE B 2 327 ? 25.32985  -32.13094 -47.05058 0.605 63.71051  ? 327 PHE B CD2 1 
ATOM   5117  C  CD2 B PHE B 2 327 ? 24.35970  -34.55930 -46.29711 0.395 64.21958  ? 327 PHE B CD2 1 
ATOM   5118  C  CE1 A PHE B 2 327 ? 23.98535  -31.34648 -44.77271 0.605 59.01500  ? 327 PHE B CE1 1 
ATOM   5119  C  CE1 B PHE B 2 327 ? 23.68661  -32.56632 -44.51840 0.395 62.35942  ? 327 PHE B CE1 1 
ATOM   5120  C  CE2 A PHE B 2 327 ? 24.58080  -30.96826 -47.05776 0.605 65.94653  ? 327 PHE B CE2 1 
ATOM   5121  C  CE2 B PHE B 2 327 ? 23.04090  -34.38022 -45.92951 0.395 64.01407  ? 327 PHE B CE2 1 
ATOM   5122  C  CZ  A PHE B 2 327 ? 23.90851  -30.57550 -45.91677 0.605 59.79955  ? 327 PHE B CZ  1 
ATOM   5123  C  CZ  B PHE B 2 327 ? 22.70382  -33.38453 -45.03771 0.395 61.77168  ? 327 PHE B CZ  1 
ATOM   5124  N  N   . ASP B 2 328 ? 28.33543  -36.39441 -44.92029 1.000 76.20505  ? 328 ASP B N   1 
ATOM   5125  C  CA  . ASP B 2 328 ? 28.45204  -37.70787 -44.29618 1.000 81.78133  ? 328 ASP B CA  1 
ATOM   5126  C  C   . ASP B 2 328 ? 29.21326  -37.63847 -42.98018 1.000 83.91177  ? 328 ASP B C   1 
ATOM   5127  O  O   . ASP B 2 328 ? 29.00037  -38.47355 -42.09298 1.000 82.67316  ? 328 ASP B O   1 
ATOM   5128  C  CB  . ASP B 2 328 ? 29.14566  -38.67747 -45.25310 1.000 90.30345  ? 328 ASP B CB  1 
ATOM   5129  C  CG  . ASP B 2 328 ? 28.50343  -38.69989 -46.62679 1.000 104.94422 ? 328 ASP B CG  1 
ATOM   5130  O  OD1 . ASP B 2 328 ? 27.29132  -38.40946 -46.72627 1.000 98.85803  ? 328 ASP B OD1 1 
ATOM   5131  O  OD2 . ASP B 2 328 ? 29.21337  -39.00607 -47.60881 1.000 124.32404 ? 328 ASP B OD2 1 
ATOM   5132  N  N   . ASN B 2 329 ? 30.08739  -36.64601 -42.82952 1.000 68.97708  ? 329 ASN B N   1 
ATOM   5133  C  CA  . ASN B 2 329 ? 30.88019  -36.49042 -41.62067 1.000 60.89887  ? 329 ASN B CA  1 
ATOM   5134  C  C   . ASN B 2 329 ? 30.09720  -35.88034 -40.47051 1.000 61.20073  ? 329 ASN B C   1 
ATOM   5135  O  O   . ASN B 2 329 ? 30.64912  -35.75471 -39.37208 1.000 69.98981  ? 329 ASN B O   1 
ATOM   5136  C  CB  . ASN B 2 329 ? 32.11466  -35.63592 -41.91158 1.000 65.75438  ? 329 ASN B CB  1 
ATOM   5137  C  CG  . ASN B 2 329 ? 33.11495  -36.34532 -42.79947 1.000 67.03427  ? 329 ASN B CG  1 
ATOM   5138  O  OD1 . ASN B 2 329 ? 33.32003  -37.55305 -42.67963 1.000 67.06703  ? 329 ASN B OD1 1 
ATOM   5139  N  ND2 . ASN B 2 329 ? 33.74779  -35.59709 -43.69455 1.000 70.02341  ? 329 ASN B ND2 1 
ATOM   5140  N  N   . ILE B 2 330 ? 28.83857  -35.49245 -40.68867 1.000 60.67691  ? 330 ILE B N   1 
ATOM   5141  C  CA  . ILE B 2 330 ? 28.00801  -35.04821 -39.57297 1.000 61.58975  ? 330 ILE B CA  1 
ATOM   5142  C  C   . ILE B 2 330 ? 27.85879  -36.16388 -38.54925 1.000 59.60371  ? 330 ILE B C   1 
ATOM   5143  O  O   . ILE B 2 330 ? 27.91075  -35.92648 -37.33662 1.000 58.81281  ? 330 ILE B O   1 
ATOM   5144  C  CB  . ILE B 2 330 ? 26.64025  -34.55238 -40.07909 1.000 58.78850  ? 330 ILE B CB  1 
ATOM   5145  C  CG1 . ILE B 2 330 ? 26.79768  -33.22454 -40.81802 1.000 59.63489  ? 330 ILE B CG1 1 
ATOM   5146  C  CG2 . ILE B 2 330 ? 25.65570  -34.40225 -38.92874 1.000 55.34564  ? 330 ILE B CG2 1 
ATOM   5147  C  CD1 . ILE B 2 330 ? 25.49188  -32.64554 -41.29161 1.000 55.26015  ? 330 ILE B CD1 1 
ATOM   5148  N  N   . GLU B 2 331 ? 27.69330  -37.40028 -39.01651 1.000 59.59308  ? 331 GLU B N   1 
ATOM   5149  C  CA  . GLU B 2 331 ? 27.62088  -38.52269 -38.08893 1.000 61.47057  ? 331 GLU B CA  1 
ATOM   5150  C  C   . GLU B 2 331 ? 28.93540  -38.70488 -37.33689 1.000 64.63304  ? 331 GLU B C   1 
ATOM   5151  O  O   . GLU B 2 331 ? 28.93634  -38.92860 -36.12035 1.000 66.05712  ? 331 GLU B O   1 
ATOM   5152  C  CB  . GLU B 2 331 ? 27.23520  -39.79577 -38.83960 1.000 63.25809  ? 331 GLU B CB  1 
ATOM   5153  C  CG  . GLU B 2 331 ? 27.15449  -41.02581 -37.95918 1.000 64.84084  ? 331 GLU B CG  1 
ATOM   5154  C  CD  . GLU B 2 331 ? 26.66890  -42.24630 -38.71085 1.000 73.54186  ? 331 GLU B CD  1 
ATOM   5155  O  OE1 . GLU B 2 331 ? 27.00307  -42.38611 -39.90754 1.000 68.24884  ? 331 GLU B OE1 1 
ATOM   5156  O  OE2 . GLU B 2 331 ? 25.93810  -43.05774 -38.10441 1.000 74.33450  ? 331 GLU B OE2 1 
ATOM   5157  N  N   . LYS B 2 332 ? 30.06614  -38.60032 -38.04030 1.000 69.49194  ? 332 LYS B N   1 
ATOM   5158  C  CA  . LYS B 2 332 ? 31.36346  -38.73416 -37.38304 1.000 61.51904  ? 332 LYS B CA  1 
ATOM   5159  C  C   . LYS B 2 332 ? 31.56848  -37.64073 -36.34214 1.000 63.61110  ? 332 LYS B C   1 
ATOM   5160  O  O   . LYS B 2 332 ? 32.01753  -37.91063 -35.22196 1.000 64.25137  ? 332 LYS B O   1 
ATOM   5161  C  CB  . LYS B 2 332 ? 32.48580  -38.70604 -38.42065 1.000 63.41741  ? 332 LYS B CB  1 
ATOM   5162  C  CG  . LYS B 2 332 ? 33.88049  -38.59714 -37.81519 1.000 84.25924  ? 332 LYS B CG  1 
ATOM   5163  C  CD  . LYS B 2 332 ? 34.18177  -39.76856 -36.88468 1.000 97.89383  ? 332 LYS B CD  1 
ATOM   5164  C  CE  . LYS B 2 332 ? 35.37664  -39.47724 -35.98061 1.000 90.56893  ? 332 LYS B CE  1 
ATOM   5165  N  NZ  . LYS B 2 332 ? 36.64285  -39.27231 -36.74000 1.000 83.07234  ? 332 LYS B NZ  1 
ATOM   5166  N  N   . ALA B 2 333 ? 31.24436  -36.39414 -36.69703 1.000 59.33417  ? 333 ALA B N   1 
ATOM   5167  C  CA  . ALA B 2 333 ? 31.38210  -35.29645 -35.74760 1.000 58.34286  ? 333 ALA B CA  1 
ATOM   5168  C  C   . ALA B 2 333 ? 30.40404  -35.43189 -34.58946 1.000 63.51110  ? 333 ALA B C   1 
ATOM   5169  O  O   . ALA B 2 333 ? 30.72440  -35.04003 -33.46075 1.000 61.89422  ? 333 ALA B O   1 
ATOM   5170  C  CB  . ALA B 2 333 ? 31.18377  -33.95776 -36.45683 1.000 53.75217  ? 333 ALA B CB  1 
ATOM   5171  N  N   . PHE B 2 334 ? 29.20974  -35.96958 -34.84791 1.000 60.28576  ? 334 PHE B N   1 
ATOM   5172  C  CA  . PHE B 2 334 ? 28.25419  -36.20089 -33.76986 1.000 61.15327  ? 334 PHE B CA  1 
ATOM   5173  C  C   . PHE B 2 334 ? 28.78696  -37.23395 -32.78513 1.000 65.73144  ? 334 PHE B C   1 
ATOM   5174  O  O   . PHE B 2 334 ? 28.76024  -37.02094 -31.56697 1.000 69.12805  ? 334 PHE B O   1 
ATOM   5175  C  CB  . PHE B 2 334 ? 26.90853  -36.64417 -34.34799 1.000 59.13745  ? 334 PHE B CB  1 
ATOM   5176  C  CG  . PHE B 2 334 ? 25.84970  -36.88046 -33.30823 1.000 57.52591  ? 334 PHE B CG  1 
ATOM   5177  C  CD1 . PHE B 2 334 ? 25.09973  -35.82684 -32.81400 1.000 60.75751  ? 334 PHE B CD1 1 
ATOM   5178  C  CD2 . PHE B 2 334 ? 25.59897  -38.15769 -32.83191 1.000 68.62307  ? 334 PHE B CD2 1 
ATOM   5179  C  CE1 . PHE B 2 334 ? 24.12440  -36.04105 -31.85772 1.000 65.30402  ? 334 PHE B CE1 1 
ATOM   5180  C  CE2 . PHE B 2 334 ? 24.62459  -38.37900 -31.87781 1.000 63.65986  ? 334 PHE B CE2 1 
ATOM   5181  C  CZ  . PHE B 2 334 ? 23.88667  -37.32035 -31.39067 1.000 61.93969  ? 334 PHE B CZ  1 
ATOM   5182  N  N   . MET B 2 335 ? 29.28157  -38.36283 -33.29896 1.000 59.07151  ? 335 MET B N   1 
ATOM   5183  C  CA  . MET B 2 335 ? 29.84358  -39.38819 -32.42532 1.000 68.66042  ? 335 MET B CA  1 
ATOM   5184  C  C   . MET B 2 335 ? 31.06384  -38.87745 -31.67108 1.000 73.14053  ? 335 MET B C   1 
ATOM   5185  O  O   . MET B 2 335 ? 31.35131  -39.35015 -30.56497 1.000 70.75533  ? 335 MET B O   1 
ATOM   5186  C  CB  . MET B 2 335 ? 30.19299  -40.63875 -33.22930 1.000 68.73014  ? 335 MET B CB  1 
ATOM   5187  C  CG  . MET B 2 335 ? 28.97844  -41.33125 -33.82247 1.000 75.92847  ? 335 MET B CG  1 
ATOM   5188  S  SD  . MET B 2 335 ? 27.72519  -41.64390 -32.56144 1.000 89.19571  ? 335 MET B SD  1 
ATOM   5189  C  CE  . MET B 2 335 ? 28.36358  -43.14005 -31.80779 1.000 87.50365  ? 335 MET B CE  1 
ATOM   5190  N  N   . LEU B 2 336 ? 31.79949  -37.92806 -32.25723 1.000 75.12900  ? 336 LEU B N   1 
ATOM   5191  C  CA  . LEU B 2 336 ? 32.92913  -37.32373 -31.55931 1.000 65.34385  ? 336 LEU B CA  1 
ATOM   5192  C  C   . LEU B 2 336 ? 32.48987  -36.64146 -30.26951 1.000 72.74232  ? 336 LEU B C   1 
ATOM   5193  O  O   . LEU B 2 336 ? 33.23576  -36.64175 -29.28314 1.000 80.79412  ? 336 LEU B O   1 
ATOM   5194  C  CB  . LEU B 2 336 ? 33.62916  -36.32118 -32.47613 1.000 57.21113  ? 336 LEU B CB  1 
ATOM   5195  C  CG  . LEU B 2 336 ? 35.12485  -36.09405 -32.26212 1.000 64.31680  ? 336 LEU B CG  1 
ATOM   5196  C  CD1 . LEU B 2 336 ? 35.88017  -37.40693 -32.36993 1.000 62.51589  ? 336 LEU B CD1 1 
ATOM   5197  C  CD2 . LEU B 2 336 ? 35.65789  -35.08169 -33.26129 1.000 56.62282  ? 336 LEU B CD2 1 
ATOM   5198  N  N   . MET B 2 337 ? 31.28477  -36.06178 -30.25468 1.000 69.74623  ? 337 MET B N   1 
ATOM   5199  C  CA  . MET B 2 337 ? 30.77297  -35.42624 -29.04281 1.000 70.94645  ? 337 MET B CA  1 
ATOM   5200  C  C   . MET B 2 337 ? 30.33270  -36.44602 -28.00222 1.000 68.53666  ? 337 MET B C   1 
ATOM   5201  O  O   . MET B 2 337 ? 30.34610  -36.14545 -26.80301 1.000 69.61456  ? 337 MET B O   1 
ATOM   5202  C  CB  . MET B 2 337 ? 29.60052  -34.50240 -29.37817 1.000 68.22059  ? 337 MET B CB  1 
ATOM   5203  C  CG  . MET B 2 337 ? 29.96382  -33.26018 -30.16652 1.000 71.78089  ? 337 MET B CG  1 
ATOM   5204  S  SD  . MET B 2 337 ? 31.00892  -32.12963 -29.23048 1.000 63.47275  ? 337 MET B SD  1 
ATOM   5205  C  CE  . MET B 2 337 ? 29.80426  -31.39174 -28.13299 1.000 66.00087  ? 337 MET B CE  1 
ATOM   5206  N  N   . LYS B 2 338 ? 29.93966  -37.64764 -28.43091 1.000 74.49194  ? 338 LYS B N   1 
ATOM   5207  C  CA  . LYS B 2 338 ? 29.48118  -38.65027 -27.47493 1.000 73.35338  ? 338 LYS B CA  1 
ATOM   5208  C  C   . LYS B 2 338 ? 30.62954  -39.14632 -26.60772 1.000 75.45897  ? 338 LYS B C   1 
ATOM   5209  O  O   . LYS B 2 338 ? 30.54832  -39.11598 -25.37467 1.000 80.09739  ? 338 LYS B O   1 
ATOM   5210  C  CB  . LYS B 2 338 ? 28.81698  -39.81579 -28.20608 1.000 69.68454  ? 338 LYS B CB  1 
ATOM   5211  C  CG  . LYS B 2 338 ? 28.13718  -40.80113 -27.27131 1.000 72.55167  ? 338 LYS B CG  1 
ATOM   5212  C  CD  . LYS B 2 338 ? 27.61103  -42.01232 -28.01762 1.000 82.29973  ? 338 LYS B CD  1 
ATOM   5213  C  CE  . LYS B 2 338 ? 26.89786  -42.96558 -27.07185 1.000 89.41643  ? 338 LYS B CE  1 
ATOM   5214  N  NZ  . LYS B 2 338 ? 27.79950  -43.46452 -25.99603 1.000 98.14571  ? 338 LYS B NZ  1 
ATOM   5215  N  N   . ASP B 2 339 ? 31.70834  -39.60465 -27.23153 1.000 79.55787  ? 339 ASP B N   1 
ATOM   5216  C  CA  . ASP B 2 339 ? 32.89859  -40.05218 -26.51704 1.000 87.47902  ? 339 ASP B CA  1 
ATOM   5217  C  C   . ASP B 2 339 ? 33.95844  -38.96654 -26.67098 1.000 87.79106  ? 339 ASP B C   1 
ATOM   5218  O  O   . ASP B 2 339 ? 34.84882  -39.05830 -27.51455 1.000 92.21143  ? 339 ASP B O   1 
ATOM   5219  C  CB  . ASP B 2 339 ? 33.37799  -41.40103 -27.05183 1.000 104.51712 ? 339 ASP B CB  1 
ATOM   5220  C  CG  . ASP B 2 339 ? 32.36847  -42.50903 -26.81849 1.000 117.46749 ? 339 ASP B CG  1 
ATOM   5221  O  OD1 . ASP B 2 339 ? 31.67205  -42.46854 -25.78118 1.000 122.55816 ? 339 ASP B OD1 1 
ATOM   5222  O  OD2 . ASP B 2 339 ? 32.26718  -43.41684 -27.67017 1.000 116.26253 ? 339 ASP B OD2 1 
ATOM   5223  N  N   . LYS B 2 340 ? 33.85305  -37.92305 -25.84186 1.000 82.95822  ? 340 LYS B N   1 
ATOM   5224  C  CA  . LYS B 2 340 ? 34.75388  -36.77995 -25.95041 1.000 75.12885  ? 340 LYS B CA  1 
ATOM   5225  C  C   . LYS B 2 340 ? 36.21409  -37.13849 -25.72180 1.000 74.23812  ? 340 LYS B C   1 
ATOM   5226  O  O   . LYS B 2 340 ? 36.60204  -37.53573 -24.61420 1.000 81.60219  ? 340 LYS B O   1 
ATOM   5227  C  CB  . LYS B 2 340 ? 34.38899  -35.65004 -24.99139 1.000 87.92576  ? 340 LYS B CB  1 
ATOM   5228  C  CG  . LYS B 2 340 ? 33.06479  -35.00793 -25.26236 1.000 91.01925  ? 340 LYS B CG  1 
ATOM   5229  C  CD  . LYS B 2 340 ? 32.99177  -33.67262 -24.55877 1.000 87.52623  ? 340 LYS B CD  1 
ATOM   5230  C  CE  . LYS B 2 340 ? 31.69315  -32.96607 -24.87348 1.000 92.44797  ? 340 LYS B CE  1 
ATOM   5231  N  NZ  . LYS B 2 340 ? 31.73056  -31.55384 -24.42340 1.000 92.21649  ? 340 LYS B NZ  1 
ATOM   5232  N  N   . PRO B 2 341 ? 37.04531  -37.01797 -26.74951 1.000 75.10749  ? 341 PRO B N   1 
ATOM   5233  C  CA  . PRO B 2 341 ? 38.48687  -37.14394 -26.54696 1.000 73.32217  ? 341 PRO B CA  1 
ATOM   5234  C  C   . PRO B 2 341 ? 39.02044  -35.91493 -25.82719 1.000 73.48390  ? 341 PRO B C   1 
ATOM   5235  O  O   . PRO B 2 341 ? 38.43829  -34.82787 -25.87108 1.000 78.36884  ? 341 PRO B O   1 
ATOM   5236  C  CB  . PRO B 2 341 ? 39.04119  -37.23710 -27.97522 1.000 64.36473  ? 341 PRO B CB  1 
ATOM   5237  C  CG  . PRO B 2 341 ? 37.82764  -37.41150 -28.87261 1.000 63.05864  ? 341 PRO B CG  1 
ATOM   5238  C  CD  . PRO B 2 341 ? 36.71570  -36.73606 -28.15312 1.000 70.04582  ? 341 PRO B CD  1 
ATOM   5239  N  N   . LYS B 2 342 ? 40.15356  -36.10424 -25.14971 1.000 75.07883  ? 342 LYS B N   1 
ATOM   5240  C  CA  . LYS B 2 342 ? 40.70977  -35.04908 -24.31086 1.000 82.24213  ? 342 LYS B CA  1 
ATOM   5241  C  C   . LYS B 2 342 ? 41.20210  -33.84784 -25.10753 1.000 76.60140  ? 342 LYS B C   1 
ATOM   5242  O  O   . LYS B 2 342 ? 41.46581  -32.80025 -24.50740 1.000 81.92374  ? 342 LYS B O   1 
ATOM   5243  C  CB  . LYS B 2 342 ? 41.84807  -35.60506 -23.45466 1.000 93.42122  ? 342 LYS B CB  1 
ATOM   5244  C  CG  . LYS B 2 342 ? 41.41317  -36.68645 -22.48057 1.000 100.57293 ? 342 LYS B CG  1 
ATOM   5245  C  CD  . LYS B 2 342 ? 40.40033  -36.16321 -21.47252 1.000 99.24957  ? 342 LYS B CD  1 
ATOM   5246  C  CE  . LYS B 2 342 ? 40.15476  -37.17829 -20.36426 1.000 103.51215 ? 342 LYS B CE  1 
ATOM   5247  N  NZ  . LYS B 2 342 ? 39.45218  -38.39460 -20.85825 1.000 99.34989  ? 342 LYS B NZ  1 
ATOM   5248  N  N   . ASP B 2 343 ? 41.33364  -33.96905 -26.42800 1.000 68.10528  ? 343 ASP B N   1 
ATOM   5249  C  CA  . ASP B 2 343 ? 41.78753  -32.87706 -27.27737 1.000 71.53275  ? 343 ASP B CA  1 
ATOM   5250  C  C   . ASP B 2 343 ? 40.64080  -32.19222 -28.01137 1.000 66.46723  ? 343 ASP B C   1 
ATOM   5251  O  O   . ASP B 2 343 ? 40.88821  -31.31966 -28.85012 1.000 62.50065  ? 343 ASP B O   1 
ATOM   5252  C  CB  . ASP B 2 343 ? 42.82046  -33.38605 -28.28352 1.000 70.89904  ? 343 ASP B CB  1 
ATOM   5253  C  CG  . ASP B 2 343 ? 42.23727  -34.38578 -29.26007 1.000 71.41802  ? 343 ASP B CG  1 
ATOM   5254  O  OD1 . ASP B 2 343 ? 41.23105  -35.03992 -28.91590 1.000 74.99558  ? 343 ASP B OD1 1 
ATOM   5255  O  OD2 . ASP B 2 343 ? 42.78609  -34.51957 -30.37307 1.000 82.76795  ? 343 ASP B OD2 1 
ATOM   5256  N  N   . LEU B 2 344 ? 39.39899  -32.57587 -27.72561 1.000 60.73553  ? 344 LEU B N   1 
ATOM   5257  C  CA  . LEU B 2 344 ? 38.22686  -32.02665 -28.39278 1.000 58.35894  ? 344 LEU B CA  1 
ATOM   5258  C  C   . LEU B 2 344 ? 37.61235  -30.92145 -27.54607 1.000 59.61473  ? 344 LEU B C   1 
ATOM   5259  O  O   . LEU B 2 344 ? 37.42855  -31.08749 -26.33543 1.000 61.20824  ? 344 LEU B O   1 
ATOM   5260  C  CB  . LEU B 2 344 ? 37.18130  -33.11367 -28.65326 1.000 61.80134  ? 344 LEU B CB  1 
ATOM   5261  C  CG  . LEU B 2 344 ? 35.79542  -32.61080 -29.07738 1.000 56.68453  ? 344 LEU B CG  1 
ATOM   5262  C  CD1 . LEU B 2 344 ? 35.82425  -32.04012 -30.48624 1.000 53.33646  ? 344 LEU B CD1 1 
ATOM   5263  C  CD2 . LEU B 2 344 ? 34.74648  -33.70309 -28.95880 1.000 61.06966  ? 344 LEU B CD2 1 
ATOM   5264  N  N   . ILE B 2 345 ? 37.30258  -29.79620 -28.18602 1.000 54.89445  ? 345 ILE B N   1 
ATOM   5265  C  CA  . ILE B 2 345 ? 36.46034  -28.77157 -27.58467 1.000 58.00964  ? 345 ILE B CA  1 
ATOM   5266  C  C   . ILE B 2 345 ? 35.14858  -28.74039 -28.35586 1.000 50.71773  ? 345 ILE B C   1 
ATOM   5267  O  O   . ILE B 2 345 ? 34.08824  -29.07941 -27.81820 1.000 52.50586  ? 345 ILE B O   1 
ATOM   5268  C  CB  . ILE B 2 345 ? 37.14249  -27.39044 -27.58156 1.000 48.75944  ? 345 ILE B CB  1 
ATOM   5269  C  CG1 . ILE B 2 345 ? 38.39259  -27.40870 -26.70018 1.000 49.67762  ? 345 ILE B CG1 1 
ATOM   5270  C  CG2 . ILE B 2 345 ? 36.17513  -26.31914 -27.10297 1.000 45.99195  ? 345 ILE B CG2 1 
ATOM   5271  C  CD1 . ILE B 2 345 ? 39.13806  -26.09110 -26.67284 1.000 45.76255  ? 345 ILE B CD1 1 
ATOM   5272  N  N   . LYS B 2 346 ? 35.21573  -28.34936 -29.62954 1.000 50.03856  ? 346 LYS B N   1 
ATOM   5273  C  CA  . LYS B 2 346 ? 34.03606  -28.23963 -30.46051 1.000 48.38776  ? 346 LYS B CA  1 
ATOM   5274  C  C   . LYS B 2 346 ? 34.38793  -28.63197 -31.89173 1.000 51.04980  ? 346 LYS B C   1 
ATOM   5275  O  O   . LYS B 2 346 ? 35.36492  -28.09835 -32.44236 1.000 54.66695  ? 346 LYS B O   1 
ATOM   5276  C  CB  . LYS B 2 346 ? 33.48286  -26.81424 -30.42282 1.000 49.78281  ? 346 LYS B CB  1 
ATOM   5277  C  CG  . LYS B 2 346 ? 32.06975  -26.66716 -30.94377 1.000 51.64610  ? 346 LYS B CG  1 
ATOM   5278  C  CD  . LYS B 2 346 ? 31.03973  -27.10252 -29.91611 1.000 49.38033  ? 346 LYS B CD  1 
ATOM   5279  C  CE  . LYS B 2 346 ? 29.63481  -26.77828 -30.39724 1.000 40.83340  ? 346 LYS B CE  1 
ATOM   5280  N  NZ  . LYS B 2 346 ? 28.58805  -27.31298 -29.48497 1.000 53.41839  ? 346 LYS B NZ  1 
ATOM   5281  N  N   . PRO B 2 347 ? 33.65133  -29.56940 -32.50482 1.000 53.29116  ? 347 PRO B N   1 
ATOM   5282  C  CA  . PRO B 2 347 ? 33.90405  -29.90181 -33.91245 1.000 48.38165  ? 347 PRO B CA  1 
ATOM   5283  C  C   . PRO B 2 347 ? 32.97702  -29.15546 -34.86160 1.000 48.46597  ? 347 PRO B C   1 
ATOM   5284  O  O   . PRO B 2 347 ? 31.84740  -28.81595 -34.49671 1.000 50.02173  ? 347 PRO B O   1 
ATOM   5285  C  CB  . PRO B 2 347 ? 33.65121  -31.41027 -33.95299 1.000 51.88932  ? 347 PRO B CB  1 
ATOM   5286  C  CG  . PRO B 2 347 ? 32.56168  -31.60039 -32.94898 1.000 54.86226  ? 347 PRO B CG  1 
ATOM   5287  C  CD  . PRO B 2 347 ? 32.74635  -30.54520 -31.87366 1.000 51.14461  ? 347 PRO B CD  1 
ATOM   5288  N  N   . VAL B 2 348 ? 33.44226  -28.89442 -36.08139 1.000 52.35370  ? 348 VAL B N   1 
ATOM   5289  C  CA  . VAL B 2 348 ? 32.67384  -28.17195 -37.08850 1.000 51.24181  ? 348 VAL B CA  1 
ATOM   5290  C  C   . VAL B 2 348 ? 32.71276  -28.96389 -38.38795 1.000 51.16120  ? 348 VAL B C   1 
ATOM   5291  O  O   . VAL B 2 348 ? 33.75460  -29.51579 -38.75788 1.000 53.43147  ? 348 VAL B O   1 
ATOM   5292  C  CB  . VAL B 2 348 ? 33.21554  -26.74189 -37.30032 1.000 45.40847  ? 348 VAL B CB  1 
ATOM   5293  C  CG1 . VAL B 2 348 ? 32.53369  -26.07044 -38.48360 1.000 45.42065  ? 348 VAL B CG1 1 
ATOM   5294  C  CG2 . VAL B 2 348 ? 33.02619  -25.92023 -36.04246 1.000 52.45898  ? 348 VAL B CG2 1 
ATOM   5295  N  N   . VAL B 2 349 ? 31.57555  -29.03509 -39.07231 1.000 48.98239  ? 349 VAL B N   1 
ATOM   5296  C  CA  . VAL B 2 349 ? 31.47257  -29.70413 -40.36399 1.000 51.00442  ? 349 VAL B CA  1 
ATOM   5297  C  C   . VAL B 2 349 ? 31.21939  -28.63574 -41.41705 1.000 56.24394  ? 349 VAL B C   1 
ATOM   5298  O  O   . VAL B 2 349 ? 30.20426  -27.93002 -41.36223 1.000 51.23184  ? 349 VAL B O   1 
ATOM   5299  C  CB  . VAL B 2 349 ? 30.36029  -30.76142 -40.37042 1.000 51.97539  ? 349 VAL B CB  1 
ATOM   5300  C  CG1 . VAL B 2 349 ? 30.22902  -31.37749 -41.75422 1.000 54.15872  ? 349 VAL B CG1 1 
ATOM   5301  C  CG2 . VAL B 2 349 ? 30.63822  -31.82612 -39.32706 1.000 54.51702  ? 349 VAL B CG2 1 
ATOM   5302  N  N   . ILE B 2 350 ? 32.14248  -28.50741 -42.36710 1.000 53.60406  ? 350 ILE B N   1 
ATOM   5303  C  CA  . ILE B 2 350 ? 32.01256  -27.53572 -43.44660 1.000 57.27771  ? 350 ILE B CA  1 
ATOM   5304  C  C   . ILE B 2 350 ? 31.30531  -28.19400 -44.62297 1.000 64.71188  ? 350 ILE B C   1 
ATOM   5305  O  O   . ILE B 2 350 ? 31.73437  -29.24624 -45.11319 1.000 66.73439  ? 350 ILE B O   1 
ATOM   5306  C  CB  . ILE B 2 350 ? 33.38516  -26.98550 -43.86103 1.000 53.15926  ? 350 ILE B CB  1 
ATOM   5307  C  CG1 . ILE B 2 350 ? 34.05768  -26.30633 -42.67015 1.000 56.11870  ? 350 ILE B CG1 1 
ATOM   5308  C  CG2 . ILE B 2 350 ? 33.22934  -25.98455 -44.98837 1.000 58.18204  ? 350 ILE B CG2 1 
ATOM   5309  C  CD1 . ILE B 2 350 ? 33.29603  -25.11763 -42.14157 1.000 66.54327  ? 350 ILE B CD1 1 
ATOM   5310  N  N   . LEU B 2 351 ? 30.23018  -27.56710 -45.08413 1.000 67.32618  ? 351 LEU B N   1 
ATOM   5311  C  CA  A LEU B 2 351 ? 29.42469  -28.12668 -46.15512 0.465 67.36289  ? 351 LEU B CA  1 
ATOM   5312  C  CA  B LEU B 2 351 ? 29.37224  -28.07289 -46.14171 0.535 67.37724  ? 351 LEU B CA  1 
ATOM   5313  C  C   . LEU B 2 351 ? 29.69799  -27.37574 -47.46048 1.000 76.22789  ? 351 LEU B C   1 
ATOM   5314  O  O   . LEU B 2 351 ? 30.71730  -26.68842 -47.59265 1.000 84.43291  ? 351 LEU B O   1 
ATOM   5315  C  CB  A LEU B 2 351 ? 27.95249  -28.09356 -45.73668 0.465 68.10988  ? 351 LEU B CB  1 
ATOM   5316  C  CB  B LEU B 2 351 ? 27.90430  -27.87011 -45.75524 0.535 68.31098  ? 351 LEU B CB  1 
ATOM   5317  C  CG  A LEU B 2 351 ? 27.67449  -28.92800 -44.48656 0.465 64.29065  ? 351 LEU B CG  1 
ATOM   5318  C  CG  B LEU B 2 351 ? 27.08112  -29.05808 -45.25587 0.535 62.49593  ? 351 LEU B CG  1 
ATOM   5319  C  CD1 A LEU B 2 351 ? 26.28638  -28.65776 -43.95111 0.465 59.52558  ? 351 LEU B CD1 1 
ATOM   5320  C  CD1 B LEU B 2 351 ? 26.55577  -29.86441 -46.42724 0.535 63.11766  ? 351 LEU B CD1 1 
ATOM   5321  C  CD2 A LEU B 2 351 ? 27.85631  -30.40644 -44.79272 0.465 63.07111  ? 351 LEU B CD2 1 
ATOM   5322  C  CD2 B LEU B 2 351 ? 27.89938  -29.92902 -44.31418 0.535 63.65553  ? 351 LEU B CD2 1 
ATOM   5323  N  N   . ALA B 2 352 ? 28.80103  -27.52515 -48.43539 1.000 94.47653  ? 352 ALA B N   1 
ATOM   5324  C  CA  . ALA B 2 352 ? 28.93467  -26.91815 -49.75830 1.000 88.77927  ? 352 ALA B CA  1 
ATOM   5325  C  C   . ALA B 2 352 ? 30.27009  -27.28605 -50.39177 1.000 91.58798  ? 352 ALA B C   1 
ATOM   5326  O  O   . ALA B 2 352 ? 31.19749  -26.47557 -50.42521 1.000 97.67012  ? 352 ALA B O   1 
ATOM   5327  C  CB  . ALA B 2 352 ? 28.77771  -25.39919 -49.67675 1.000 82.00771  ? 352 ALA B CB  1 
ATOM   5328  O  OXT . ALA B 2 352 ? 30.44691  -28.40621 -50.87438 1.000 86.21175  ? 352 ALA B OXT 1 
HETATM 5329  N  N   . FME C 2 1   ? 54.23023  24.68263  5.42837   1.000 63.68627  ? 1   FME C N   1 
HETATM 5330  C  CN  . FME C 2 1   ? 55.20357  25.46539  6.00715   1.000 76.48989  ? 1   FME C CN  1 
HETATM 5331  O  O1  . FME C 2 1   ? 55.03384  26.11996  7.04854   1.000 78.84608  ? 1   FME C O1  1 
HETATM 5332  C  CA  . FME C 2 1   ? 54.45796  23.93841  4.22058   1.000 62.92187  ? 1   FME C CA  1 
HETATM 5333  C  CB  . FME C 2 1   ? 53.69448  22.59732  4.17891   1.000 61.63232  ? 1   FME C CB  1 
HETATM 5334  C  CG  . FME C 2 1   ? 52.21460  22.76016  4.40915   1.000 59.49530  ? 1   FME C CG  1 
HETATM 5335  S  SD  . FME C 2 1   ? 51.44808  21.29252  3.77554   1.000 63.26000  ? 1   FME C SD  1 
HETATM 5336  C  CE  . FME C 2 1   ? 49.92805  21.88276  3.13389   1.000 55.05514  ? 1   FME C CE  1 
HETATM 5337  C  C   . FME C 2 1   ? 54.06299  24.71743  2.96932   1.000 66.04295  ? 1   FME C C   1 
HETATM 5338  O  O   . FME C 2 1   ? 53.27176  25.66069  2.97834   1.000 67.97280  ? 1   FME C O   1 
ATOM   5339  N  N   . LYS C 2 2   ? 54.64949  24.30534  1.84857   1.000 66.69545  ? 2   LYS C N   1 
ATOM   5340  C  CA  . LYS C 2 2   ? 54.36864  24.93631  0.55707   1.000 57.17237  ? 2   LYS C CA  1 
ATOM   5341  C  C   . LYS C 2 2   ? 53.22129  24.26771  -0.17303  1.000 62.80174  ? 2   LYS C C   1 
ATOM   5342  O  O   . LYS C 2 2   ? 52.97802  23.07730  -0.00034  1.000 55.48529  ? 2   LYS C O   1 
ATOM   5343  C  CB  . LYS C 2 2   ? 55.58018  24.89581  -0.36846  1.000 62.38631  ? 2   LYS C CB  1 
ATOM   5344  C  CG  . LYS C 2 2   ? 56.90466  25.23744  0.23156   1.000 78.10057  ? 2   LYS C CG  1 
ATOM   5345  C  CD  . LYS C 2 2   ? 57.96213  25.33251  -0.87290  1.000 89.16919  ? 2   LYS C CD  1 
ATOM   5346  C  CE  . LYS C 2 2   ? 57.78717  24.19766  -1.89591  1.000 72.73776  ? 2   LYS C CE  1 
ATOM   5347  N  NZ  . LYS C 2 2   ? 58.74158  24.27492  -3.03289  1.000 70.14203  ? 2   LYS C NZ  1 
ATOM   5348  N  N   . GLY C 2 3   ? 52.51754  25.04111  -0.99421  1.000 61.40586  ? 3   GLY C N   1 
ATOM   5349  C  CA  . GLY C 2 3   ? 51.43079  24.50330  -1.78852  1.000 54.86684  ? 3   GLY C CA  1 
ATOM   5350  C  C   . GLY C 2 3   ? 51.04046  25.38933  -2.95410  1.000 56.50447  ? 3   GLY C C   1 
ATOM   5351  O  O   . GLY C 2 3   ? 50.92668  26.60813  -2.79578  1.000 66.99579  ? 3   GLY C O   1 
ATOM   5352  N  N   . PHE C 2 4   ? 50.86167  24.80234  -4.13535  1.000 49.62926  ? 4   PHE C N   1 
ATOM   5353  C  CA  . PHE C 2 4   ? 50.36306  25.54662  -5.28553  1.000 52.49459  ? 4   PHE C CA  1 
ATOM   5354  C  C   . PHE C 2 4   ? 48.85460  25.72013  -5.14608  1.000 54.50356  ? 4   PHE C C   1 
ATOM   5355  O  O   . PHE C 2 4   ? 48.11333  24.73100  -5.12717  1.000 49.85257  ? 4   PHE C O   1 
ATOM   5356  C  CB  . PHE C 2 4   ? 50.71434  24.83192  -6.58771  1.000 51.84861  ? 4   PHE C CB  1 
ATOM   5357  C  CG  . PHE C 2 4   ? 50.53491  25.68738  -7.80916  1.000 54.16197  ? 4   PHE C CG  1 
ATOM   5358  C  CD1 . PHE C 2 4   ? 51.31394  26.81788  -7.99465  1.000 55.39495  ? 4   PHE C CD1 1 
ATOM   5359  C  CD2 . PHE C 2 4   ? 49.58515  25.36967  -8.76593  1.000 49.48257  ? 4   PHE C CD2 1 
ATOM   5360  C  CE1 . PHE C 2 4   ? 51.15453  27.61427  -9.11316  1.000 52.67084  ? 4   PHE C CE1 1 
ATOM   5361  C  CE2 . PHE C 2 4   ? 49.42038  26.16345  -9.88915  1.000 51.87567  ? 4   PHE C CE2 1 
ATOM   5362  C  CZ  . PHE C 2 4   ? 50.20816  27.28882  -10.06096 1.000 50.04293  ? 4   PHE C CZ  1 
ATOM   5363  N  N   . ALA C 2 5   ? 48.39295  26.96613  -5.05847  1.000 56.05310  ? 5   ALA C N   1 
ATOM   5364  C  CA  . ALA C 2 5   ? 47.01585  27.23030  -4.67218  1.000 56.61565  ? 5   ALA C CA  1 
ATOM   5365  C  C   . ALA C 2 5   ? 46.34171  28.21875  -5.61077  1.000 55.82882  ? 5   ALA C C   1 
ATOM   5366  O  O   . ALA C 2 5   ? 46.99081  28.98062  -6.33158  1.000 58.71800  ? 5   ALA C O   1 
ATOM   5367  C  CB  . ALA C 2 5   ? 46.93838  27.78237  -3.24193  1.000 60.91068  ? 5   ALA C CB  1 
ATOM   5368  N  N   . MET C 2 6   ? 45.01095  28.18969  -5.57210  1.000 55.24670  ? 6   MET C N   1 
ATOM   5369  C  CA  . MET C 2 6   ? 44.16722  29.17209  -6.24253  1.000 59.35445  ? 6   MET C CA  1 
ATOM   5370  C  C   . MET C 2 6   ? 43.97039  30.35260  -5.29833  1.000 63.72069  ? 6   MET C C   1 
ATOM   5371  O  O   . MET C 2 6   ? 43.30096  30.22631  -4.26742  1.000 73.43781  ? 6   MET C O   1 
ATOM   5372  C  CB  . MET C 2 6   ? 42.82685  28.55644  -6.63369  1.000 53.41795  ? 6   MET C CB  1 
ATOM   5373  C  CG  . MET C 2 6   ? 41.80040  29.56095  -7.13601  1.000 61.53508  ? 6   MET C CG  1 
ATOM   5374  S  SD  . MET C 2 6   ? 40.18696  28.79728  -7.40618  1.000 74.48791  ? 6   MET C SD  1 
ATOM   5375  C  CE  . MET C 2 6   ? 39.16278  30.24414  -7.68286  1.000 75.51929  ? 6   MET C CE  1 
ATOM   5376  N  N   . LEU C 2 7   ? 44.57165  31.49392  -5.63053  1.000 63.00766  ? 7   LEU C N   1 
ATOM   5377  C  CA  . LEU C 2 7   ? 44.42880  32.66566  -4.77391  1.000 72.08831  ? 7   LEU C CA  1 
ATOM   5378  C  C   . LEU C 2 7   ? 43.01776  33.23210  -4.87392  1.000 78.88415  ? 7   LEU C C   1 
ATOM   5379  O  O   . LEU C 2 7   ? 42.35444  33.46965  -3.85744  1.000 75.85915  ? 7   LEU C O   1 
ATOM   5380  C  CB  . LEU C 2 7   ? 45.47260  33.71212  -5.15418  1.000 69.38841  ? 7   LEU C CB  1 
ATOM   5381  C  CG  . LEU C 2 7   ? 46.86882  33.11019  -5.31977  1.000 64.83847  ? 7   LEU C CG  1 
ATOM   5382  C  CD1 . LEU C 2 7   ? 47.89101  34.18199  -5.67274  1.000 67.42045  ? 7   LEU C CD1 1 
ATOM   5383  C  CD2 . LEU C 2 7   ? 47.27236  32.35387  -4.07133  1.000 64.04582  ? 7   LEU C CD2 1 
ATOM   5384  N  N   . SER C 2 8   ? 42.55049  33.45865  -6.09631  1.000 79.74259  ? 8   SER C N   1 
ATOM   5385  C  CA  . SER C 2 8   ? 41.18037  33.86830  -6.37171  1.000 84.63398  ? 8   SER C CA  1 
ATOM   5386  C  C   . SER C 2 8   ? 40.87486  33.45646  -7.80559  1.000 80.40644  ? 8   SER C C   1 
ATOM   5387  O  O   . SER C 2 8   ? 41.71556  32.86557  -8.48865  1.000 79.45854  ? 8   SER C O   1 
ATOM   5388  C  CB  . SER C 2 8   ? 40.98061  35.37011  -6.14860  1.000 81.21661  ? 8   SER C CB  1 
ATOM   5389  O  OG  . SER C 2 8   ? 41.73628  36.13158  -7.07107  1.000 86.49388  ? 8   SER C OG  1 
ATOM   5390  N  N   . ILE C 2 9   ? 39.66078  33.76622  -8.26035  1.000 85.94240  ? 9   ILE C N   1 
ATOM   5391  C  CA  . ILE C 2 9   ? 39.28801  33.44898  -9.63520  1.000 82.25886  ? 9   ILE C CA  1 
ATOM   5392  C  C   . ILE C 2 9   ? 40.24315  34.16743  -10.57834 1.000 77.59361  ? 9   ILE C C   1 
ATOM   5393  O  O   . ILE C 2 9   ? 40.32761  35.40156  -10.58143 1.000 71.25590  ? 9   ILE C O   1 
ATOM   5394  C  CB  . ILE C 2 9   ? 37.82914  33.83093  -9.90744  1.000 89.83838  ? 9   ILE C CB  1 
ATOM   5395  C  CG1 . ILE C 2 9   ? 36.88422  33.01359  -9.02359  1.000 84.28620  ? 9   ILE C CG1 1 
ATOM   5396  C  CG2 . ILE C 2 9   ? 37.48893  33.62566  -11.37911 1.000 79.86983  ? 9   ILE C CG2 1 
ATOM   5397  C  CD1 . ILE C 2 9   ? 35.41616  33.30044  -9.27753  1.000 80.44889  ? 9   ILE C CD1 1 
ATOM   5398  N  N   . GLY C 2 10  ? 40.98870  33.39539  -11.36709 1.000 73.01625  ? 10  GLY C N   1 
ATOM   5399  C  CA  . GLY C 2 10  ? 41.93297  33.95027  -12.31498 1.000 77.38632  ? 10  GLY C CA  1 
ATOM   5400  C  C   . GLY C 2 10  ? 43.35268  34.08132  -11.81181 1.000 74.81489  ? 10  GLY C C   1 
ATOM   5401  O  O   . GLY C 2 10  ? 44.21244  34.56033  -12.56127 1.000 71.56453  ? 10  GLY C O   1 
ATOM   5402  N  N   . LYS C 2 11  ? 43.62625  33.66807  -10.57459 1.000 73.79238  ? 11  LYS C N   1 
ATOM   5403  C  CA  . LYS C 2 11  ? 44.93101  33.84150  -9.95403  1.000 70.17884  ? 11  LYS C CA  1 
ATOM   5404  C  C   . LYS C 2 11  ? 45.40154  32.54015  -9.32169  1.000 69.85069  ? 11  LYS C C   1 
ATOM   5405  O  O   . LYS C 2 11  ? 44.63718  31.86585  -8.62741  1.000 67.07564  ? 11  LYS C O   1 
ATOM   5406  C  CB  . LYS C 2 11  ? 44.85697  34.93670  -8.87281  1.000 76.63680  ? 11  LYS C CB  1 
ATOM   5407  C  CG  . LYS C 2 11  ? 44.53322  36.32738  -9.40398  1.000 88.57698  ? 11  LYS C CG  1 
ATOM   5408  C  CD  . LYS C 2 11  ? 44.39743  37.33202  -8.26989  1.000 88.56391  ? 11  LYS C CD  1 
ATOM   5409  C  CE  . LYS C 2 11  ? 44.12487  38.72725  -8.80105  1.000 97.25800  ? 11  LYS C CE  1 
ATOM   5410  N  NZ  . LYS C 2 11  ? 43.85663  39.71650  -7.71803  1.000 107.43696 ? 11  LYS C NZ  1 
ATOM   5411  N  N   . VAL C 2 12  ? 46.67182  32.20016  -9.55518  1.000 66.68155  ? 12  VAL C N   1 
ATOM   5412  C  CA  . VAL C 2 12  ? 47.30343  31.03353  -8.95063  1.000 63.44126  ? 12  VAL C CA  1 
ATOM   5413  C  C   . VAL C 2 12  ? 48.70643  31.42640  -8.51105  1.000 60.36590  ? 12  VAL C C   1 
ATOM   5414  O  O   . VAL C 2 12  ? 49.29992  32.38408  -9.01367  1.000 69.65695  ? 12  VAL C O   1 
ATOM   5415  C  CB  . VAL C 2 12  ? 47.37747  29.79807  -9.88551  1.000 57.55696  ? 12  VAL C CB  1 
ATOM   5416  C  CG1 . VAL C 2 12  ? 45.99325  29.23988  -10.17719 1.000 54.72337  ? 12  VAL C CG1 1 
ATOM   5417  C  CG2 . VAL C 2 12  ? 48.10457  30.13905  -11.17213 1.000 68.66985  ? 12  VAL C CG2 1 
ATOM   5418  N  N   . GLY C 2 13  ? 49.23473  30.66241  -7.56519  1.000 59.02430  ? 13  GLY C N   1 
ATOM   5419  C  CA  . GLY C 2 13  ? 50.57006  30.90955  -7.05988  1.000 57.80596  ? 13  GLY C CA  1 
ATOM   5420  C  C   . GLY C 2 13  ? 50.85685  30.01082  -5.88195  1.000 59.28888  ? 13  GLY C C   1 
ATOM   5421  O  O   . GLY C 2 13  ? 49.96975  29.34375  -5.34209  1.000 57.29683  ? 13  GLY C O   1 
ATOM   5422  N  N   . TRP C 2 14  ? 52.13038  29.98692  -5.50024  1.000 63.91673  ? 14  TRP C N   1 
ATOM   5423  C  CA  . TRP C 2 14  ? 52.55549  29.22043  -4.33732  1.000 67.09735  ? 14  TRP C CA  1 
ATOM   5424  C  C   . TRP C 2 14  ? 52.21693  29.97156  -3.05722  1.000 66.65929  ? 14  TRP C C   1 
ATOM   5425  O  O   . TRP C 2 14  ? 52.40737  31.18793  -2.96698  1.000 66.99923  ? 14  TRP C O   1 
ATOM   5426  C  CB  . TRP C 2 14  ? 54.05866  28.93999  -4.39415  1.000 58.93735  ? 14  TRP C CB  1 
ATOM   5427  C  CG  . TRP C 2 14  ? 54.42043  27.92053  -5.41084  1.000 53.60204  ? 14  TRP C CG  1 
ATOM   5428  C  CD1 . TRP C 2 14  ? 54.73885  28.14354  -6.71560  1.000 60.56576  ? 14  TRP C CD1 1 
ATOM   5429  C  CD2 . TRP C 2 14  ? 54.49186  26.50232  -5.21413  1.000 59.66229  ? 14  TRP C CD2 1 
ATOM   5430  N  NE1 . TRP C 2 14  ? 55.00410  26.95155  -7.34716  1.000 64.03472  ? 14  TRP C NE1 1 
ATOM   5431  C  CE2 . TRP C 2 14  ? 54.86068  25.92949  -6.44603  1.000 56.43396  ? 14  TRP C CE2 1 
ATOM   5432  C  CE3 . TRP C 2 14  ? 54.28108  25.66246  -4.11503  1.000 64.03580  ? 14  TRP C CE3 1 
ATOM   5433  C  CZ2 . TRP C 2 14  ? 55.02519  24.55781  -6.61116  1.000 59.97740  ? 14  TRP C CZ2 1 
ATOM   5434  C  CZ3 . TRP C 2 14  ? 54.44374  24.29887  -4.28068  1.000 54.13207  ? 14  TRP C CZ3 1 
ATOM   5435  C  CH2 . TRP C 2 14  ? 54.81239  23.76027  -5.51915  1.000 65.50271  ? 14  TRP C CH2 1 
ATOM   5436  N  N   . ILE C 2 15  ? 51.69474  29.24511  -2.06847  1.000 62.99329  ? 15  ILE C N   1 
ATOM   5437  C  CA  . ILE C 2 15  ? 51.34619  29.82079  -0.77944  1.000 65.40763  ? 15  ILE C CA  1 
ATOM   5438  C  C   . ILE C 2 15  ? 51.97431  28.97188  0.31869   1.000 65.40075  ? 15  ILE C C   1 
ATOM   5439  O  O   . ILE C 2 15  ? 52.60814  27.94919  0.06208   1.000 72.38048  ? 15  ILE C O   1 
ATOM   5440  C  CB  . ILE C 2 15  ? 49.82276  29.92673  -0.55661  1.000 72.72198  ? 15  ILE C CB  1 
ATOM   5441  C  CG1 . ILE C 2 15  ? 49.19497  28.53530  -0.44579  1.000 64.63715  ? 15  ILE C CG1 1 
ATOM   5442  C  CG2 . ILE C 2 15  ? 49.17251  30.72361  -1.66514  1.000 67.91162  ? 15  ILE C CG2 1 
ATOM   5443  C  CD1 . ILE C 2 15  ? 47.77034  28.55607  0.08613   1.000 61.70385  ? 15  ILE C CD1 1 
ATOM   5444  N  N   . GLU C 2 16  ? 51.80093  29.42753  1.55363   1.000 65.44379  ? 16  GLU C N   1 
ATOM   5445  C  CA  . GLU C 2 16  ? 52.28659  28.73388  2.73470   1.000 79.15778  ? 16  GLU C CA  1 
ATOM   5446  C  C   . GLU C 2 16  ? 51.12027  28.50682  3.68524   1.000 71.62001  ? 16  GLU C C   1 
ATOM   5447  O  O   . GLU C 2 16  ? 50.35615  29.43515  3.97022   1.000 69.83752  ? 16  GLU C O   1 
ATOM   5448  C  CB  . GLU C 2 16  ? 53.41576  29.52364  3.40588   1.000 78.11926  ? 16  GLU C CB  1 
ATOM   5449  C  CG  . GLU C 2 16  ? 54.69161  29.54892  2.56748   1.000 99.53037  ? 16  GLU C CG  1 
ATOM   5450  C  CD  . GLU C 2 16  ? 55.79926  30.39216  3.17702   1.000 127.32831 ? 16  GLU C CD  1 
ATOM   5451  O  OE1 . GLU C 2 16  ? 55.58127  30.98510  4.25664   1.000 134.23548 ? 16  GLU C OE1 1 
ATOM   5452  O  OE2 . GLU C 2 16  ? 56.89643  30.45091  2.58233   1.000 129.84793 ? 16  GLU C OE2 1 
ATOM   5453  N  N   . LYS C 2 17  ? 50.97240  27.27012  4.15196   1.000 64.43913  ? 17  LYS C N   1 
ATOM   5454  C  CA  . LYS C 2 17  ? 49.92431  26.90993  5.09141   1.000 66.57197  ? 17  LYS C CA  1 
ATOM   5455  C  C   . LYS C 2 17  ? 50.52292  26.03753  6.18214   1.000 65.62217  ? 17  LYS C C   1 
ATOM   5456  O  O   . LYS C 2 17  ? 51.69671  25.65444  6.13520   1.000 69.59413  ? 17  LYS C O   1 
ATOM   5457  C  CB  . LYS C 2 17  ? 48.75090  26.19318  4.41051   1.000 67.79048  ? 17  LYS C CB  1 
ATOM   5458  C  CG  . LYS C 2 17  ? 47.87332  27.10001  3.57509   1.000 72.19627  ? 17  LYS C CG  1 
ATOM   5459  C  CD  . LYS C 2 17  ? 46.59026  26.40051  3.16752   1.000 60.14941  ? 17  LYS C CD  1 
ATOM   5460  C  CE  . LYS C 2 17  ? 45.47719  27.42223  2.98242   1.000 67.73930  ? 17  LYS C CE  1 
ATOM   5461  N  NZ  . LYS C 2 17  ? 44.13103  26.80913  2.81794   1.000 75.97631  ? 17  LYS C NZ  1 
ATOM   5462  N  N   . GLU C 2 18  ? 49.68380  25.68380  7.14516   1.000 69.12293  ? 18  GLU C N   1 
ATOM   5463  C  CA  . GLU C 2 18  ? 50.08212  24.81260  8.23407   1.000 78.76234  ? 18  GLU C CA  1 
ATOM   5464  C  C   . GLU C 2 18  ? 49.93297  23.36316  7.80123   1.000 67.86229  ? 18  GLU C C   1 
ATOM   5465  O  O   . GLU C 2 18  ? 48.96843  23.00313  7.11987   1.000 61.44024  ? 18  GLU C O   1 
ATOM   5466  C  CB  . GLU C 2 18  ? 49.21638  25.08343  9.46492   1.000 78.77023  ? 18  GLU C CB  1 
ATOM   5467  C  CG  . GLU C 2 18  ? 49.70704  24.45210  10.74945  1.000 100.16024 ? 18  GLU C CG  1 
ATOM   5468  C  CD  . GLU C 2 18  ? 49.09044  25.09799  11.97458  1.000 115.81193 ? 18  GLU C CD  1 
ATOM   5469  O  OE1 . GLU C 2 18  ? 48.87671  26.32914  11.95327  1.000 117.89905 ? 18  GLU C OE1 1 
ATOM   5470  O  OE2 . GLU C 2 18  ? 48.81139  24.37584  12.95448  1.000 123.89628 ? 18  GLU C OE2 1 
ATOM   5471  N  N   . LYS C 2 19  ? 50.91485  22.54614  8.16767   1.000 67.27055  ? 19  LYS C N   1 
ATOM   5472  C  CA  . LYS C 2 19  ? 50.86049  21.12927  7.84777   1.000 60.77879  ? 19  LYS C CA  1 
ATOM   5473  C  C   . LYS C 2 19  ? 49.62193  20.52023  8.49357   1.000 65.32726  ? 19  LYS C C   1 
ATOM   5474  O  O   . LYS C 2 19  ? 49.41818  20.68571  9.70382   1.000 72.48311  ? 19  LYS C O   1 
ATOM   5475  C  CB  . LYS C 2 19  ? 52.11734  20.41572  8.34160   1.000 61.58247  ? 19  LYS C CB  1 
ATOM   5476  C  CG  . LYS C 2 19  ? 52.11983  18.92098  8.08432   1.000 61.92901  ? 19  LYS C CG  1 
ATOM   5477  C  CD  . LYS C 2 19  ? 53.41231  18.28054  8.56186   1.000 63.07460  ? 19  LYS C CD  1 
ATOM   5478  C  CE  . LYS C 2 19  ? 53.37537  16.77008  8.37490   1.000 68.00899  ? 19  LYS C CE  1 
ATOM   5479  N  NZ  . LYS C 2 19  ? 54.65774  16.12755  8.77863   1.000 71.15207  ? 19  LYS C NZ  1 
ATOM   5480  N  N   . PRO C 2 20  ? 48.77541  19.82719  7.73771   1.000 59.86709  ? 20  PRO C N   1 
ATOM   5481  C  CA  . PRO C 2 20  ? 47.53449  19.31137  8.32045   1.000 58.19291  ? 20  PRO C CA  1 
ATOM   5482  C  C   . PRO C 2 20  ? 47.80825  18.22045  9.34173   1.000 59.15645  ? 20  PRO C C   1 
ATOM   5483  O  O   . PRO C 2 20  ? 48.77040  17.45555  9.23219   1.000 58.37185  ? 20  PRO C O   1 
ATOM   5484  C  CB  . PRO C 2 20  ? 46.77257  18.76522  7.10699   1.000 54.87860  ? 20  PRO C CB  1 
ATOM   5485  C  CG  . PRO C 2 20  ? 47.83645  18.44287  6.11482   1.000 54.02950  ? 20  PRO C CG  1 
ATOM   5486  C  CD  . PRO C 2 20  ? 48.90460  19.48412  6.31144   1.000 54.61680  ? 20  PRO C CD  1 
ATOM   5487  N  N   . ALA C 2 21  ? 46.94891  18.17116  10.35661  1.000 61.20927  ? 21  ALA C N   1 
ATOM   5488  C  CA  . ALA C 2 21  ? 46.99771  17.17742  11.41626  1.000 62.59676  ? 21  ALA C CA  1 
ATOM   5489  C  C   . ALA C 2 21  ? 45.89983  16.14509  11.21079  1.000 61.63022  ? 21  ALA C C   1 
ATOM   5490  O  O   . ALA C 2 21  ? 44.77175  16.50204  10.85058  1.000 68.17860  ? 21  ALA C O   1 
ATOM   5491  C  CB  . ALA C 2 21  ? 46.82960  17.82960  12.78857  1.000 66.58482  ? 21  ALA C CB  1 
ATOM   5492  N  N   . PRO C 2 22  ? 46.18242  14.86038  11.40542  1.000 61.49365  ? 22  PRO C N   1 
ATOM   5493  C  CA  . PRO C 2 22  ? 45.14977  13.84765  11.17426  1.000 61.75055  ? 22  PRO C CA  1 
ATOM   5494  C  C   . PRO C 2 22  ? 44.25935  13.66030  12.39226  1.000 61.72928  ? 22  PRO C C   1 
ATOM   5495  O  O   . PRO C 2 22  ? 44.71989  13.66637  13.53686  1.000 66.02646  ? 22  PRO C O   1 
ATOM   5496  C  CB  . PRO C 2 22  ? 45.96493  12.58269  10.88113  1.000 57.63718  ? 22  PRO C CB  1 
ATOM   5497  C  CG  . PRO C 2 22  ? 47.20497  12.76257  11.68906  1.000 61.12480  ? 22  PRO C CG  1 
ATOM   5498  C  CD  . PRO C 2 22  ? 47.48343  14.25530  11.74338  1.000 61.30316  ? 22  PRO C CD  1 
ATOM   5499  N  N   . GLY C 2 23  ? 42.95988  13.50962  12.12965  1.000 63.88997  ? 23  GLY C N   1 
ATOM   5500  C  CA  . GLY C 2 23  ? 42.04103  13.06890  13.13678  1.000 63.47081  ? 23  GLY C CA  1 
ATOM   5501  C  C   . GLY C 2 23  ? 42.23440  11.59543  13.44056  1.000 63.36955  ? 23  GLY C C   1 
ATOM   5502  O  O   . GLY C 2 23  ? 43.07089  10.91633  12.83059  1.000 69.00485  ? 23  GLY C O   1 
ATOM   5503  N  N   . PRO C 2 24  ? 41.45421  11.08048  14.39118  1.000 65.71432  ? 24  PRO C N   1 
ATOM   5504  C  CA  . PRO C 2 24  ? 41.61519  9.66537   14.76734  1.000 69.46737  ? 24  PRO C CA  1 
ATOM   5505  C  C   . PRO C 2 24  ? 41.41405  8.69770   13.60917  1.000 69.10757  ? 24  PRO C C   1 
ATOM   5506  O  O   . PRO C 2 24  ? 41.99402  7.60485   13.62361  1.000 68.68550  ? 24  PRO C O   1 
ATOM   5507  C  CB  . PRO C 2 24  ? 40.55065  9.47109   15.85693  1.000 69.25945  ? 24  PRO C CB  1 
ATOM   5508  C  CG  . PRO C 2 24  ? 40.27063  10.84776  16.37173  1.000 71.17917  ? 24  PRO C CG  1 
ATOM   5509  C  CD  . PRO C 2 24  ? 40.43119  11.76232  15.19961  1.000 68.44214  ? 24  PRO C CD  1 
ATOM   5510  N  N   . PHE C 2 25  ? 40.63858  9.07402   12.59180  1.000 60.92051  ? 25  PHE C N   1 
ATOM   5511  C  CA  . PHE C 2 25  ? 40.37816  8.21233   11.44656  1.000 63.12444  ? 25  PHE C CA  1 
ATOM   5512  C  C   . PHE C 2 25  ? 41.05275  8.68453   10.16771  1.000 62.48164  ? 25  PHE C C   1 
ATOM   5513  O  O   . PHE C 2 25  ? 40.84141  8.07413   9.11349   1.000 58.96207  ? 25  PHE C O   1 
ATOM   5514  C  CB  . PHE C 2 25  ? 38.86973  8.09411   11.20160  1.000 59.59601  ? 25  PHE C CB  1 
ATOM   5515  C  CG  . PHE C 2 25  ? 38.11788  7.47481   12.33855  1.000 61.53062  ? 25  PHE C CG  1 
ATOM   5516  C  CD1 . PHE C 2 25  ? 37.62230  8.25838   13.36644  1.000 64.11154  ? 25  PHE C CD1 1 
ATOM   5517  C  CD2 . PHE C 2 25  ? 37.89695  6.10796   12.37546  1.000 63.47387  ? 25  PHE C CD2 1 
ATOM   5518  C  CE1 . PHE C 2 25  ? 36.92567  7.68991   14.41398  1.000 67.08864  ? 25  PHE C CE1 1 
ATOM   5519  C  CE2 . PHE C 2 25  ? 37.20127  5.53335   13.42223  1.000 68.62005  ? 25  PHE C CE2 1 
ATOM   5520  C  CZ  . PHE C 2 25  ? 36.71492  6.32603   14.44189  1.000 67.28813  ? 25  PHE C CZ  1 
ATOM   5521  N  N   . ASP C 2 26  ? 41.84573  9.74887   10.22348  1.000 55.26169  ? 26  ASP C N   1 
ATOM   5522  C  CA  . ASP C 2 26  ? 42.41775  10.35734  9.03476   1.000 54.37430  ? 26  ASP C CA  1 
ATOM   5523  C  C   . ASP C 2 26  ? 43.87953  9.94800   8.87598   1.000 54.35274  ? 26  ASP C C   1 
ATOM   5524  O  O   . ASP C 2 26  ? 44.46640  9.27990   9.73033   1.000 59.05569  ? 26  ASP C O   1 
ATOM   5525  C  CB  . ASP C 2 26  ? 42.28345  11.87960  9.10645   1.000 56.88497  ? 26  ASP C CB  1 
ATOM   5526  C  CG  . ASP C 2 26  ? 40.86406  12.32941  9.40975   1.000 62.15374  ? 26  ASP C CG  1 
ATOM   5527  O  OD1 . ASP C 2 26  ? 39.91023  11.64271  8.97948   1.000 55.88743  ? 26  ASP C OD1 1 
ATOM   5528  O  OD2 . ASP C 2 26  ? 40.70397  13.36933  10.08677  1.000 62.98753  ? 26  ASP C OD2 1 
ATOM   5529  N  N   . ALA C 2 27  ? 44.47594  10.36674  7.76206   1.000 49.87506  ? 27  ALA C N   1 
ATOM   5530  C  CA  . ALA C 2 27  ? 45.88509  10.12002  7.49971   1.000 54.12969  ? 27  ALA C CA  1 
ATOM   5531  C  C   . ALA C 2 27  ? 46.48702  11.32285  6.79048   1.000 52.47887  ? 27  ALA C C   1 
ATOM   5532  O  O   . ALA C 2 27  ? 45.80884  12.02097  6.03276   1.000 54.73465  ? 27  ALA C O   1 
ATOM   5533  C  CB  . ALA C 2 27  ? 46.09992  8.85884   6.65335   1.000 50.49888  ? 27  ALA C CB  1 
ATOM   5534  N  N   . ILE C 2 28  ? 47.76784  11.56360  7.05367   1.000 54.12785  ? 28  ILE C N   1 
ATOM   5535  C  CA  . ILE C 2 28  ? 48.54574  12.56950  6.34199   1.000 52.99107  ? 28  ILE C CA  1 
ATOM   5536  C  C   . ILE C 2 28  ? 49.42222  11.84362  5.33403   1.000 51.78055  ? 28  ILE C C   1 
ATOM   5537  O  O   . ILE C 2 28  ? 50.12070  10.88347  5.68579   1.000 53.05541  ? 28  ILE C O   1 
ATOM   5538  C  CB  . ILE C 2 28  ? 49.39383  13.41604  7.30668   1.000 53.81566  ? 28  ILE C CB  1 
ATOM   5539  C  CG1 . ILE C 2 28  ? 48.51301  14.03000  8.39356   1.000 53.61772  ? 28  ILE C CG1 1 
ATOM   5540  C  CG2 . ILE C 2 28  ? 50.11028  14.52102  6.55030   1.000 50.84475  ? 28  ILE C CG2 1 
ATOM   5541  C  CD1 . ILE C 2 28  ? 47.38105  14.87905  7.85830   1.000 57.28018  ? 28  ILE C CD1 1 
ATOM   5542  N  N   . VAL C 2 29  ? 49.37589  12.28622  4.07997   1.000 52.19491  ? 29  VAL C N   1 
ATOM   5543  C  CA  . VAL C 2 29  ? 50.07407  11.62959  2.98209   1.000 46.88618  ? 29  VAL C CA  1 
ATOM   5544  C  C   . VAL C 2 29  ? 51.03469  12.63103  2.35754   1.000 53.36750  ? 29  VAL C C   1 
ATOM   5545  O  O   . VAL C 2 29  ? 50.66796  13.79138  2.13385   1.000 49.98714  ? 29  VAL C O   1 
ATOM   5546  C  CB  . VAL C 2 29  ? 49.08800  11.09697  1.92467   1.000 46.64851  ? 29  VAL C CB  1 
ATOM   5547  C  CG1 . VAL C 2 29  ? 49.82872  10.34698  0.82685   1.000 46.28991  ? 29  VAL C CG1 1 
ATOM   5548  C  CG2 . VAL C 2 29  ? 48.02179  10.22301  2.56731   1.000 44.92072  ? 29  VAL C CG2 1 
ATOM   5549  N  N   . ARG C 2 30  ? 52.26806  12.18843  2.09328   1.000 45.58074  ? 30  ARG C N   1 
ATOM   5550  C  CA  . ARG C 2 30  ? 53.04012  13.08496  1.24372   1.000 45.84137  ? 30  ARG C CA  1 
ATOM   5551  C  C   . ARG C 2 30  ? 53.01201  12.57965  -0.19350  1.000 51.05853  ? 30  ARG C C   1 
ATOM   5552  O  O   . ARG C 2 30  ? 53.07716  11.36668  -0.42589  1.000 48.70288  ? 30  ARG C O   1 
ATOM   5553  C  CB  . ARG C 2 30  ? 54.49239  13.20564  1.71024   1.000 54.51963  ? 30  ARG C CB  1 
ATOM   5554  C  CG  . ARG C 2 30  ? 55.33402  11.95953  1.51982   1.000 58.18957  ? 30  ARG C CG  1 
ATOM   5555  C  CD  . ARG C 2 30  ? 56.77942  12.21487  1.89781   1.000 61.94083  ? 30  ARG C CD  1 
ATOM   5556  N  NE  . ARG C 2 30  ? 57.64670  11.13200  1.45207   1.000 67.97245  ? 30  ARG C NE  1 
ATOM   5557  C  CZ  . ARG C 2 30  ? 58.19577  11.06805  0.24649   1.000 71.40940  ? 30  ARG C CZ  1 
ATOM   5558  N  NH1 . ARG C 2 30  ? 57.99750  12.01763  -0.65448  1.000 63.59931  ? 30  ARG C NH1 1 
ATOM   5559  N  NH2 . ARG C 2 30  ? 58.96423  10.02703  -0.06266  1.000 70.26758  ? 30  ARG C NH2 1 
ATOM   5560  N  N   . PRO C 2 31  ? 52.88768  13.46296  -1.18146  1.000 47.14640  ? 31  PRO C N   1 
ATOM   5561  C  CA  . PRO C 2 31  ? 52.72237  12.99829  -2.56260  1.000 42.21575  ? 31  PRO C CA  1 
ATOM   5562  C  C   . PRO C 2 31  ? 54.02536  12.48140  -3.15158  1.000 44.10621  ? 31  PRO C C   1 
ATOM   5563  O  O   . PRO C 2 31  ? 55.09823  13.05532  -2.94893  1.000 49.92094  ? 31  PRO C O   1 
ATOM   5564  C  CB  . PRO C 2 31  ? 52.24343  14.25486  -3.29905  1.000 37.76143  ? 31  PRO C CB  1 
ATOM   5565  C  CG  . PRO C 2 31  ? 52.82776  15.37987  -2.51330  1.000 42.50685  ? 31  PRO C CG  1 
ATOM   5566  C  CD  . PRO C 2 31  ? 52.83086  14.93191  -1.07914  1.000 45.37471  ? 31  PRO C CD  1 
ATOM   5567  N  N   . LEU C 2 32  ? 53.92102  11.36406  -3.87001  1.000 49.71438  ? 32  LEU C N   1 
ATOM   5568  C  CA  . LEU C 2 32  ? 55.02986  10.83175  -4.65214  1.000 51.61597  ? 32  LEU C CA  1 
ATOM   5569  C  C   . LEU C 2 32  ? 54.92009  11.17278  -6.12975  1.000 46.31142  ? 32  LEU C C   1 
ATOM   5570  O  O   . LEU C 2 32  ? 55.94587  11.34596  -6.79576  1.000 53.18084  ? 32  LEU C O   1 
ATOM   5571  C  CB  . LEU C 2 32  ? 55.11420  9.30910   -4.49130  1.000 41.10287  ? 32  LEU C CB  1 
ATOM   5572  C  CG  . LEU C 2 32  ? 55.29339  8.80368   -3.05772  1.000 49.56680  ? 32  LEU C CG  1 
ATOM   5573  C  CD1 . LEU C 2 32  ? 55.24352  7.28036   -3.00183  1.000 42.36331  ? 32  LEU C CD1 1 
ATOM   5574  C  CD2 . LEU C 2 32  ? 56.58814  9.32238   -2.47156  1.000 51.44292  ? 32  LEU C CD2 1 
ATOM   5575  N  N   . ALA C 2 33  ? 53.69897  11.26697  -6.64891  1.000 44.04872  ? 33  ALA C N   1 
ATOM   5576  C  CA  . ALA C 2 33  ? 53.44350  11.67844  -8.01930  1.000 36.05349  ? 33  ALA C CA  1 
ATOM   5577  C  C   . ALA C 2 33  ? 52.07880  12.34504  -8.06244  1.000 36.65190  ? 33  ALA C C   1 
ATOM   5578  O  O   . ALA C 2 33  ? 51.13091  11.86832  -7.43554  1.000 39.40070  ? 33  ALA C O   1 
ATOM   5579  C  CB  . ALA C 2 33  ? 53.48951  10.49479  -8.98771  1.000 35.48478  ? 33  ALA C CB  1 
ATOM   5580  N  N   . VAL C 2 34  ? 51.98905  13.46005  -8.78423  1.000 38.00615  ? 34  VAL C N   1 
ATOM   5581  C  CA  . VAL C 2 34  ? 50.74226  14.19715  -8.91488  1.000 38.58862  ? 34  VAL C CA  1 
ATOM   5582  C  C   . VAL C 2 34  ? 50.53359  14.53670  -10.38130 1.000 34.38015  ? 34  VAL C C   1 
ATOM   5583  O  O   . VAL C 2 34  ? 51.45369  14.47258  -11.19807 1.000 40.73173  ? 34  VAL C O   1 
ATOM   5584  C  CB  . VAL C 2 34  ? 50.71416  15.48364  -8.05788  1.000 41.49273  ? 34  VAL C CB  1 
ATOM   5585  C  CG1 . VAL C 2 34  ? 50.82335  15.14572  -6.57533  1.000 35.71676  ? 34  VAL C CG1 1 
ATOM   5586  C  CG2 . VAL C 2 34  ? 51.82153  16.42959  -8.47916  1.000 40.56433  ? 34  VAL C CG2 1 
ATOM   5587  N  N   . ALA C 2 35  ? 49.29493  14.89387  -10.70841 1.000 34.48578  ? 35  ALA C N   1 
ATOM   5588  C  CA  . ALA C 2 35  ? 48.91958  15.25844  -12.05630 1.000 37.43732  ? 35  ALA C CA  1 
ATOM   5589  C  C   . ALA C 2 35  ? 47.90833  16.39102  -11.97523 1.000 41.57589  ? 35  ALA C C   1 
ATOM   5590  O  O   . ALA C 2 35  ? 47.02085  16.36662  -11.10893 1.000 39.01706  ? 35  ALA C O   1 
ATOM   5591  C  CB  . ALA C 2 35  ? 48.31179  14.07438  -12.82136 1.000 31.77397  ? 35  ALA C CB  1 
ATOM   5592  N  N   . PRO C 2 36  ? 48.02814  17.39876  -12.83294 1.000 38.43527  ? 36  PRO C N   1 
ATOM   5593  C  CA  . PRO C 2 36  ? 47.00489  18.44425  -12.89552 1.000 42.28685  ? 36  PRO C CA  1 
ATOM   5594  C  C   . PRO C 2 36  ? 45.82170  17.99344  -13.73813 1.000 48.26631  ? 36  PRO C C   1 
ATOM   5595  O  O   . PRO C 2 36  ? 45.91440  17.07067  -14.55009 1.000 43.75215  ? 36  PRO C O   1 
ATOM   5596  C  CB  . PRO C 2 36  ? 47.73911  19.61713  -13.55047 1.000 40.31520  ? 36  PRO C CB  1 
ATOM   5597  C  CG  . PRO C 2 36  ? 48.75754  18.95725  -14.41225 1.000 39.17252  ? 36  PRO C CG  1 
ATOM   5598  C  CD  . PRO C 2 36  ? 49.17177  17.68834  -13.71267 1.000 41.33406  ? 36  PRO C CD  1 
ATOM   5599  N  N   . CYS C 2 37  ? 44.69551  18.67333  -13.53631 1.000 39.82331  ? 37  CYS C N   1 
ATOM   5600  C  CA  . CYS C 2 37  ? 43.44953  18.30800  -14.18933 1.000 40.07347  ? 37  CYS C CA  1 
ATOM   5601  C  C   . CYS C 2 37  ? 42.81914  19.52196  -14.85114 1.000 41.30757  ? 37  CYS C C   1 
ATOM   5602  O  O   . CYS C 2 37  ? 42.98697  20.65737  -14.39979 1.000 46.72148  ? 37  CYS C O   1 
ATOM   5603  C  CB  . CYS C 2 37  ? 42.45145  17.70179  -13.18729 1.000 34.19162  ? 37  CYS C CB  1 
ATOM   5604  S  SG  . CYS C 2 37  ? 40.89551  17.14540  -13.92371 1.000 52.10215  ? 37  CYS C SG  1 
ATOM   5605  N  N   . THR C 2 38  ? 42.07650  19.26288  -15.92868 1.000 40.47307  ? 38  THR C N   1 
ATOM   5606  C  CA  . THR C 2 38  ? 41.33242  20.33006  -16.58576 1.000 45.19520  ? 38  THR C CA  1 
ATOM   5607  C  C   . THR C 2 38  ? 40.28582  20.92731  -15.65426 1.000 51.24383  ? 38  THR C C   1 
ATOM   5608  O  O   . THR C 2 38  ? 39.92112  22.10006  -15.80116 1.000 49.83656  ? 38  THR C O   1 
ATOM   5609  C  CB  . THR C 2 38  ? 40.67358  19.80133  -17.86245 1.000 47.15627  ? 38  THR C CB  1 
ATOM   5610  O  OG1 . THR C 2 38  ? 41.61354  19.00056  -18.58864 1.000 57.47980  ? 38  THR C OG1 1 
ATOM   5611  C  CG2 . THR C 2 38  ? 40.20633  20.94535  -18.74619 1.000 63.01517  ? 38  THR C CG2 1 
ATOM   5612  N  N   . SER C 2 39  ? 39.80590  20.14196  -14.68337 1.000 43.83297  ? 39  SER C N   1 
ATOM   5613  C  CA  . SER C 2 39  ? 38.78989  20.63297  -13.75548 1.000 56.99046  ? 39  SER C CA  1 
ATOM   5614  C  C   . SER C 2 39  ? 39.30918  21.79969  -12.92282 1.000 52.44029  ? 39  SER C C   1 
ATOM   5615  O  O   . SER C 2 39  ? 38.56618  22.74757  -12.64083 1.000 51.23819  ? 39  SER C O   1 
ATOM   5616  C  CB  . SER C 2 39  ? 38.31369  19.49673  -12.84852 1.000 49.78789  ? 39  SER C CB  1 
ATOM   5617  O  OG  . SER C 2 39  ? 37.78053  18.42151  -13.60586 1.000 51.29627  ? 39  SER C OG  1 
ATOM   5618  N  N   . ASP C 2 40  ? 40.57979  21.74899  -12.51387 1.000 45.35446  ? 40  ASP C N   1 
ATOM   5619  C  CA  . ASP C 2 40  ? 41.15221  22.87744  -11.78837 1.000 50.25770  ? 40  ASP C CA  1 
ATOM   5620  C  C   . ASP C 2 40  ? 41.23829  24.11820  -12.66390 1.000 55.33861  ? 40  ASP C C   1 
ATOM   5621  O  O   . ASP C 2 40  ? 41.10373  25.23907  -12.16161 1.000 57.07187  ? 40  ASP C O   1 
ATOM   5622  C  CB  . ASP C 2 40  ? 42.53332  22.52223  -11.23897 1.000 41.54423  ? 40  ASP C CB  1 
ATOM   5623  C  CG  . ASP C 2 40  ? 42.45904  21.64663  -10.00478 1.000 53.88486  ? 40  ASP C CG  1 
ATOM   5624  O  OD1 . ASP C 2 40  ? 41.33636  21.41756  -9.50553  1.000 55.47400  ? 40  ASP C OD1 1 
ATOM   5625  O  OD2 . ASP C 2 40  ? 43.52301  21.20264  -9.52254  1.000 48.93863  ? 40  ASP C OD2 1 
ATOM   5626  N  N   . ILE C 2 41  ? 41.46027  23.94105  -13.96674 1.000 53.23470  ? 41  ILE C N   1 
ATOM   5627  C  CA  . ILE C 2 41  ? 41.46449  25.08035  -14.87919 1.000 54.10602  ? 41  ILE C CA  1 
ATOM   5628  C  C   . ILE C 2 41  ? 40.09378  25.74716  -14.89563 1.000 61.18166  ? 41  ILE C C   1 
ATOM   5629  O  O   . ILE C 2 41  ? 39.98039  26.97676  -14.81917 1.000 58.52574  ? 41  ILE C O   1 
ATOM   5630  C  CB  . ILE C 2 41  ? 41.89793  24.63394  -16.28664 1.000 49.33690  ? 41  ILE C CB  1 
ATOM   5631  C  CG1 . ILE C 2 41  ? 43.24914  23.91876  -16.21885 1.000 47.49554  ? 41  ILE C CG1 1 
ATOM   5632  C  CG2 . ILE C 2 41  ? 41.98379  25.82749  -17.22132 1.000 53.33281  ? 41  ILE C CG2 1 
ATOM   5633  C  CD1 . ILE C 2 41  ? 44.38709  24.80913  -15.77702 1.000 59.72948  ? 41  ILE C CD1 1 
ATOM   5634  N  N   . HIS C 2 42  ? 39.03019  24.94163  -14.98916 1.000 55.88787  ? 42  HIS C N   1 
ATOM   5635  C  CA  . HIS C 2 42  ? 37.67602  25.48831  -14.96577 1.000 62.39854  ? 42  HIS C CA  1 
ATOM   5636  C  C   . HIS C 2 42  ? 37.38466  26.17825  -13.63956 1.000 61.51612  ? 42  HIS C C   1 
ATOM   5637  O  O   . HIS C 2 42  ? 36.71119  27.21468  -13.60137 1.000 72.57731  ? 42  HIS C O   1 
ATOM   5638  C  CB  . HIS C 2 42  ? 36.65695  24.37345  -15.20424 1.000 64.31104  ? 42  HIS C CB  1 
ATOM   5639  C  CG  . HIS C 2 42  ? 36.72458  23.77032  -16.57184 1.000 76.46306  ? 42  HIS C CG  1 
ATOM   5640  N  ND1 . HIS C 2 42  ? 36.22551  22.51632  -16.85493 1.000 65.60834  ? 42  HIS C ND1 1 
ATOM   5641  C  CD2 . HIS C 2 42  ? 37.24455  24.23951  -17.73074 1.000 75.64147  ? 42  HIS C CD2 1 
ATOM   5642  C  CE1 . HIS C 2 42  ? 36.42920  22.24196  -18.13100 1.000 65.27097  ? 42  HIS C CE1 1 
ATOM   5643  N  NE2 . HIS C 2 42  ? 37.04617  23.27076  -18.68484 1.000 79.24332  ? 42  HIS C NE2 1 
ATOM   5644  N  N   . THR C 2 43  ? 37.88572  25.61329  -12.53979 1.000 59.45465  ? 43  THR C N   1 
ATOM   5645  C  CA  . THR C 2 43  ? 37.63293  26.18569  -11.22261 1.000 61.90182  ? 43  THR C CA  1 
ATOM   5646  C  C   . THR C 2 43  ? 38.33961  27.52414  -11.05174 1.000 68.53437  ? 43  THR C C   1 
ATOM   5647  O  O   . THR C 2 43  ? 37.76373  28.47317  -10.50391 1.000 65.66743  ? 43  THR C O   1 
ATOM   5648  C  CB  . THR C 2 43  ? 38.07468  25.20106  -10.13995 1.000 60.55672  ? 43  THR C CB  1 
ATOM   5649  O  OG1 . THR C 2 43  ? 37.20121  24.06496  -10.14390 1.000 58.63794  ? 43  THR C OG1 1 
ATOM   5650  C  CG2 . THR C 2 43  ? 38.04037  25.85585  -8.76747  1.000 71.63620  ? 43  THR C CG2 1 
ATOM   5651  N  N   . VAL C 2 44  ? 39.57986  27.62492  -11.52625 1.000 60.88949  ? 44  VAL C N   1 
ATOM   5652  C  CA  . VAL C 2 44  ? 40.36713  28.83109  -11.29620 1.000 67.05846  ? 44  VAL C CA  1 
ATOM   5653  C  C   . VAL C 2 44  ? 39.96852  29.93912  -12.26307 1.000 67.84855  ? 44  VAL C C   1 
ATOM   5654  O  O   . VAL C 2 44  ? 39.62104  31.05051  -11.84787 1.000 71.28094  ? 44  VAL C O   1 
ATOM   5655  C  CB  . VAL C 2 44  ? 41.86962  28.51307  -11.40171 1.000 59.06910  ? 44  VAL C CB  1 
ATOM   5656  C  CG1 . VAL C 2 44  ? 42.67079  29.79553  -11.37756 1.000 55.26741  ? 44  VAL C CG1 1 
ATOM   5657  C  CG2 . VAL C 2 44  ? 42.29711  27.59128  -10.27312 1.000 56.36199  ? 44  VAL C CG2 1 
ATOM   5658  N  N   . PHE C 2 45  ? 39.99621  29.65248  -13.56441 1.000 58.15291  ? 45  PHE C N   1 
ATOM   5659  C  CA  . PHE C 2 45  ? 39.89647  30.69337  -14.57870 1.000 67.85134  ? 45  PHE C CA  1 
ATOM   5660  C  C   . PHE C 2 45  ? 38.48720  30.90753  -15.11012 1.000 72.41100  ? 45  PHE C C   1 
ATOM   5661  O  O   . PHE C 2 45  ? 38.23217  31.94325  -15.73440 1.000 77.84672  ? 45  PHE C O   1 
ATOM   5662  C  CB  . PHE C 2 45  ? 40.84367  30.37883  -15.74150 1.000 60.22706  ? 45  PHE C CB  1 
ATOM   5663  C  CG  . PHE C 2 45  ? 42.28460  30.27442  -15.32659 1.000 60.99346  ? 45  PHE C CG  1 
ATOM   5664  C  CD1 . PHE C 2 45  ? 43.05628  31.41476  -15.16532 1.000 61.64950  ? 45  PHE C CD1 1 
ATOM   5665  C  CD2 . PHE C 2 45  ? 42.86080  29.03986  -15.07216 1.000 64.62523  ? 45  PHE C CD2 1 
ATOM   5666  C  CE1 . PHE C 2 45  ? 44.38112  31.32577  -14.77482 1.000 62.14128  ? 45  PHE C CE1 1 
ATOM   5667  C  CE2 . PHE C 2 45  ? 44.18625  28.94371  -14.68065 1.000 58.42021  ? 45  PHE C CE2 1 
ATOM   5668  C  CZ  . PHE C 2 45  ? 44.94686  30.08849  -14.53169 1.000 55.87431  ? 45  PHE C CZ  1 
ATOM   5669  N  N   . GLU C 2 46  ? 37.57228  29.96719  -14.88567 1.000 72.78724  ? 46  GLU C N   1 
ATOM   5670  C  CA  . GLU C 2 46  ? 36.18452  30.13985  -15.28618 1.000 75.25428  ? 46  GLU C CA  1 
ATOM   5671  C  C   . GLU C 2 46  ? 35.23678  30.32130  -14.11063 1.000 72.36074  ? 46  GLU C C   1 
ATOM   5672  O  O   . GLU C 2 46  ? 34.08051  30.70067  -14.32680 1.000 77.64801  ? 46  GLU C O   1 
ATOM   5673  C  CB  . GLU C 2 46  ? 35.72010  28.94184  -16.12803 1.000 81.65950  ? 46  GLU C CB  1 
ATOM   5674  C  CG  . GLU C 2 46  ? 36.35876  28.86595  -17.50544 1.000 91.85711  ? 46  GLU C CG  1 
ATOM   5675  C  CD  . GLU C 2 46  ? 35.92259  27.63861  -18.28465 1.000 107.18363 ? 46  GLU C CD  1 
ATOM   5676  O  OE1 . GLU C 2 46  ? 35.14919  26.82377  -17.73513 1.000 98.25663  ? 46  GLU C OE1 1 
ATOM   5677  O  OE2 . GLU C 2 46  ? 36.35352  27.48919  -19.44787 1.000 115.84951 ? 46  GLU C OE2 1 
ATOM   5678  N  N   . GLY C 2 47  ? 35.69183  30.07604  -12.88503 1.000 71.57438  ? 47  GLY C N   1 
ATOM   5679  C  CA  . GLY C 2 47  ? 34.82318  30.18301  -11.72180 1.000 74.98538  ? 47  GLY C CA  1 
ATOM   5680  C  C   . GLY C 2 47  ? 33.60129  29.29237  -11.78865 1.000 89.34770  ? 47  GLY C C   1 
ATOM   5681  O  O   . GLY C 2 47  ? 32.49221  29.73703  -11.46388 1.000 89.71970  ? 47  GLY C O   1 
ATOM   5682  N  N   . ALA C 2 48  ? 33.77774  28.03570  -12.20626 1.000 81.83096  ? 48  ALA C N   1 
ATOM   5683  C  CA  . ALA C 2 48  ? 32.63124  27.16466  -12.43635 1.000 77.44957  ? 48  ALA C CA  1 
ATOM   5684  C  C   . ALA C 2 48  ? 31.98833  26.67988  -11.14163 1.000 81.87572  ? 48  ALA C C   1 
ATOM   5685  O  O   . ALA C 2 48  ? 30.79999  26.33862  -11.14937 1.000 75.79797  ? 48  ALA C O   1 
ATOM   5686  C  CB  . ALA C 2 48  ? 33.04751  25.97150  -13.29677 1.000 70.80777  ? 48  ALA C CB  1 
ATOM   5687  N  N   . ILE C 2 49  ? 32.73803  26.63080  -10.04013 1.000 77.00165  ? 49  ILE C N   1 
ATOM   5688  C  CA  . ILE C 2 49  ? 32.19819  26.25591  -8.73931  1.000 79.09426  ? 49  ILE C CA  1 
ATOM   5689  C  C   . ILE C 2 49  ? 32.26728  27.41644  -7.74512  1.000 86.75880  ? 49  ILE C C   1 
ATOM   5690  O  O   . ILE C 2 49  ? 32.17403  27.20785  -6.53933  1.000 82.98514  ? 49  ILE C O   1 
ATOM   5691  C  CB  . ILE C 2 49  ? 32.89836  25.00035  -8.18289  1.000 82.61050  ? 49  ILE C CB  1 
ATOM   5692  C  CG1 . ILE C 2 49  ? 34.39796  25.25389  -7.99249  1.000 77.58651  ? 49  ILE C CG1 1 
ATOM   5693  C  CG2 . ILE C 2 49  ? 32.62495  23.79246  -9.06863  1.000 71.55361  ? 49  ILE C CG2 1 
ATOM   5694  C  CD1 . ILE C 2 49  ? 35.12187  24.13731  -7.26946  1.000 73.78177  ? 49  ILE C CD1 1 
ATOM   5695  N  N   . GLY C 2 50  ? 32.41952  28.63955  -8.23997  1.000 81.93296  ? 50  GLY C N   1 
ATOM   5696  C  CA  . GLY C 2 50  ? 32.50244  29.80157  -7.37947  1.000 77.55864  ? 50  GLY C CA  1 
ATOM   5697  C  C   . GLY C 2 50  ? 33.92906  30.18381  -7.04033  1.000 88.65802  ? 50  GLY C C   1 
ATOM   5698  O  O   . GLY C 2 50  ? 34.90925  29.60708  -7.52462  1.000 88.55188  ? 50  GLY C O   1 
ATOM   5699  N  N   . GLU C 2 51  ? 34.03727  31.18075  -6.16533  1.000 84.22242  ? 51  GLU C N   1 
ATOM   5700  C  CA  . GLU C 2 51  ? 35.32642  31.74368  -5.78982  1.000 95.97095  ? 51  GLU C CA  1 
ATOM   5701  C  C   . GLU C 2 51  ? 35.90326  31.03538  -4.57110  1.000 92.34774  ? 51  GLU C C   1 
ATOM   5702  O  O   . GLU C 2 51  ? 35.19078  30.74479  -3.60580  1.000 90.08835  ? 51  GLU C O   1 
ATOM   5703  C  CB  . GLU C 2 51  ? 35.20655  33.24275  -5.51304  1.000 101.64183 ? 51  GLU C CB  1 
ATOM   5704  C  CG  . GLU C 2 51  ? 36.54702  33.91972  -5.27175  1.000 101.79197 ? 51  GLU C CG  1 
ATOM   5705  C  CD  . GLU C 2 51  ? 36.47116  35.42718  -5.38492  1.000 117.99585 ? 51  GLU C CD  1 
ATOM   5706  O  OE1 . GLU C 2 51  ? 35.44527  35.93715  -5.88367  1.000 133.62624 ? 51  GLU C OE1 1 
ATOM   5707  O  OE2 . GLU C 2 51  ? 37.44051  36.10183  -4.97894  1.000 122.26239 ? 51  GLU C OE2 1 
ATOM   5708  N  N   . ARG C 2 52  ? 37.20291  30.76223  -4.62795  1.000 81.58042  ? 52  ARG C N   1 
ATOM   5709  C  CA  . ARG C 2 52  ? 37.94933  30.17519  -3.52884  1.000 75.42380  ? 52  ARG C CA  1 
ATOM   5710  C  C   . ARG C 2 52  ? 39.08452  31.11336  -3.14252  1.000 72.16642  ? 52  ARG C C   1 
ATOM   5711  O  O   . ARG C 2 52  ? 39.47409  31.99662  -3.91149  1.000 81.17338  ? 52  ARG C O   1 
ATOM   5712  C  CB  . ARG C 2 52  ? 38.51360  28.80029  -3.90938  1.000 73.76888  ? 52  ARG C CB  1 
ATOM   5713  C  CG  . ARG C 2 52  ? 37.46713  27.79922  -4.35557  1.000 68.92565  ? 52  ARG C CG  1 
ATOM   5714  C  CD  . ARG C 2 52  ? 36.57602  27.38482  -3.20561  1.000 61.29731  ? 52  ARG C CD  1 
ATOM   5715  N  NE  . ARG C 2 52  ? 35.70161  26.27941  -3.57591  1.000 81.35006  ? 52  ARG C NE  1 
ATOM   5716  C  CZ  . ARG C 2 52  ? 34.54137  26.42191  -4.20212  1.000 86.12344  ? 52  ARG C CZ  1 
ATOM   5717  N  NH1 . ARG C 2 52  ? 34.08618  27.61410  -4.54998  1.000 85.45778  ? 52  ARG C NH1 1 
ATOM   5718  N  NH2 . ARG C 2 52  ? 33.81788  25.34142  -4.48352  1.000 79.86964  ? 52  ARG C NH2 1 
ATOM   5719  N  N   . HIS C 2 53  ? 39.61441  30.91804  -1.93586  1.000 75.78713  ? 53  HIS C N   1 
ATOM   5720  C  CA  . HIS C 2 53  ? 40.68959  31.75492  -1.40807  1.000 81.43847  ? 53  HIS C CA  1 
ATOM   5721  C  C   . HIS C 2 53  ? 41.77822  30.85248  -0.84488  1.000 66.41454  ? 53  HIS C C   1 
ATOM   5722  O  O   . HIS C 2 53  ? 41.55726  30.16407  0.15749   1.000 66.16722  ? 53  HIS C O   1 
ATOM   5723  C  CB  . HIS C 2 53  ? 40.16882  32.70464  -0.32969  1.000 78.42418  ? 53  HIS C CB  1 
ATOM   5724  C  CG  . HIS C 2 53  ? 39.19103  33.71745  -0.83597  1.000 92.04946  ? 53  HIS C CG  1 
ATOM   5725  N  ND1 . HIS C 2 53  ? 39.56640  34.78772  -1.61898  1.000 102.44449 ? 53  HIS C ND1 1 
ATOM   5726  C  CD2 . HIS C 2 53  ? 37.85269  33.82923  -0.66152  1.000 91.31637  ? 53  HIS C CD2 1 
ATOM   5727  C  CE1 . HIS C 2 53  ? 38.50044  35.51192  -1.91027  1.000 107.19130 ? 53  HIS C CE1 1 
ATOM   5728  N  NE2 . HIS C 2 53  ? 37.44787  34.95271  -1.34048  1.000 101.60054 ? 53  HIS C NE2 1 
ATOM   5729  N  N   . ASN C 2 54  ? 42.94454  30.85252  -1.49224  1.000 64.79042  ? 54  ASN C N   1 
ATOM   5730  C  CA  . ASN C 2 54  ? 44.11713  30.11682  -1.01462  1.000 66.96412  ? 54  ASN C CA  1 
ATOM   5731  C  C   . ASN C 2 54  ? 43.79899  28.64774  -0.78708  1.000 60.40647  ? 54  ASN C C   1 
ATOM   5732  O  O   . ASN C 2 54  ? 44.09691  28.07435  0.26163   1.000 61.73843  ? 54  ASN C O   1 
ATOM   5733  C  CB  . ASN C 2 54  ? 44.72392  30.73494  0.23958   1.000 66.12676  ? 54  ASN C CB  1 
ATOM   5734  C  CG  . ASN C 2 54  ? 45.36819  32.05698  -0.03197  1.000 69.09639  ? 54  ASN C CG  1 
ATOM   5735  O  OD1 . ASN C 2 54  ? 45.43331  32.51034  -1.17403  1.000 78.88006  ? 54  ASN C OD1 1 
ATOM   5736  N  ND2 . ASN C 2 54  ? 45.92998  32.64724  0.99916   1.000 72.18219  ? 54  ASN C ND2 1 
ATOM   5737  N  N   . MET C 2 55  ? 43.15657  28.04801  -1.77438  1.000 65.39292  ? 55  MET C N   1 
ATOM   5738  C  CA  . MET C 2 55  ? 42.84713  26.62842  -1.75894  1.000 54.17286  ? 55  MET C CA  1 
ATOM   5739  C  C   . MET C 2 55  ? 43.90459  25.94366  -2.61206  1.000 54.18218  ? 55  MET C C   1 
ATOM   5740  O  O   . MET C 2 55  ? 43.97395  26.17819  -3.82340  1.000 53.84355  ? 55  MET C O   1 
ATOM   5741  C  CB  . MET C 2 55  ? 41.44318  26.37321  -2.30136  1.000 55.36141  ? 55  MET C CB  1 
ATOM   5742  C  CG  . MET C 2 55  ? 41.08771  24.90398  -2.45200  1.000 52.62362  ? 55  MET C CG  1 
ATOM   5743  S  SD  . MET C 2 55  ? 39.60034  24.68500  -3.44286  1.000 62.33665  ? 55  MET C SD  1 
ATOM   5744  C  CE  . MET C 2 55  ? 40.15207  25.33747  -5.01761  1.000 51.28546  ? 55  MET C CE  1 
ATOM   5745  N  N   . ILE C 2 56  ? 44.75330  25.12690  -1.98072  1.000 52.34770  ? 56  ILE C N   1 
ATOM   5746  C  CA  A ILE C 2 56  ? 45.76863  24.37430  -2.71268  0.778 50.86229  ? 56  ILE C CA  1 
ATOM   5747  C  CA  B ILE C 2 56  ? 45.76593  24.43696  -2.76263  0.222 51.07987  ? 56  ILE C CA  1 
ATOM   5748  C  C   . ILE C 2 56  ? 45.08180  23.46917  -3.72201  1.000 50.37257  ? 56  ILE C C   1 
ATOM   5749  O  O   . ILE C 2 56  ? 44.11106  22.77779  -3.38380  1.000 44.07750  ? 56  ILE C O   1 
ATOM   5750  C  CB  A ILE C 2 56  ? 46.63436  23.56403  -1.73606  0.778 47.07354  ? 56  ILE C CB  1 
ATOM   5751  C  CB  B ILE C 2 56  ? 46.81374  23.76097  -1.85891  0.222 47.24893  ? 56  ILE C CB  1 
ATOM   5752  C  CG1 A ILE C 2 56  ? 47.39466  24.49006  -0.79074  0.778 50.05373  ? 56  ILE C CG1 1 
ATOM   5753  C  CG1 B ILE C 2 56  ? 46.88608  22.25150  -2.08286  0.222 46.59925  ? 56  ILE C CG1 1 
ATOM   5754  C  CG2 A ILE C 2 56  ? 47.59896  22.66275  -2.48716  0.778 44.77434  ? 56  ILE C CG2 1 
ATOM   5755  C  CG2 B ILE C 2 56  ? 46.58356  24.10830  -0.40073  0.222 49.92965  ? 56  ILE C CG2 1 
ATOM   5756  C  CD1 A ILE C 2 56  ? 48.22416  23.75063  0.22843   0.778 50.27228  ? 56  ILE C CD1 1 
ATOM   5757  C  CD1 B ILE C 2 56  ? 48.00525  21.60328  -1.30452  0.222 46.51968  ? 56  ILE C CD1 1 
ATOM   5758  N  N   . LEU C 2 57  ? 45.56977  23.46917  -4.95924  1.000 43.09992  ? 57  LEU C N   1 
ATOM   5759  C  CA  . LEU C 2 57  ? 44.93227  22.76149  -6.05516  1.000 47.28822  ? 57  LEU C CA  1 
ATOM   5760  C  C   . LEU C 2 57  ? 45.39492  21.30773  -6.12111  1.000 41.42456  ? 57  LEU C C   1 
ATOM   5761  O  O   . LEU C 2 57  ? 46.22489  20.84894  -5.33288  1.000 45.20275  ? 57  LEU C O   1 
ATOM   5762  C  CB  . LEU C 2 57  ? 45.20488  23.49156  -7.36888  1.000 47.93140  ? 57  LEU C CB  1 
ATOM   5763  C  CG  . LEU C 2 57  ? 44.59191  24.88917  -7.46760  1.000 47.12656  ? 57  LEU C CG  1 
ATOM   5764  C  CD1 . LEU C 2 57  ? 45.30118  25.73049  -8.51485  1.000 48.34418  ? 57  LEU C CD1 1 
ATOM   5765  C  CD2 . LEU C 2 57  ? 43.11125  24.77431  -7.79055  1.000 44.88394  ? 57  LEU C CD2 1 
ATOM   5766  N  N   . GLY C 2 58  ? 44.81800  20.56385  -7.06120  1.000 45.76227  ? 58  GLY C N   1 
ATOM   5767  C  CA  . GLY C 2 58  ? 45.23228  19.20048  -7.31256  1.000 42.26561  ? 58  GLY C CA  1 
ATOM   5768  C  C   . GLY C 2 58  ? 44.38401  18.17249  -6.59722  1.000 39.74547  ? 58  GLY C C   1 
ATOM   5769  O  O   . GLY C 2 58  ? 44.07679  18.32741  -5.41233  1.000 43.32073  ? 58  GLY C O   1 
ATOM   5770  N  N   . HIS C 2 59  ? 43.98372  17.12056  -7.31139  1.000 37.20857  ? 59  HIS C N   1 
ATOM   5771  C  CA  . HIS C 2 59  ? 43.25189  16.02908  -6.68303  1.000 37.66312  ? 59  HIS C CA  1 
ATOM   5772  C  C   . HIS C 2 59  ? 43.66224  14.65777  -7.21003  1.000 43.01275  ? 59  HIS C C   1 
ATOM   5773  O  O   . HIS C 2 59  ? 42.98642  13.66698  -6.89892  1.000 38.11568  ? 59  HIS C O   1 
ATOM   5774  C  CB  . HIS C 2 59  ? 41.73794  16.23246  -6.83995  1.000 38.48698  ? 59  HIS C CB  1 
ATOM   5775  C  CG  . HIS C 2 59  ? 41.31302  16.58182  -8.23069  1.000 45.77973  ? 59  HIS C CG  1 
ATOM   5776  N  ND1 . HIS C 2 59  ? 40.95678  17.86189  -8.59841  1.000 42.55348  ? 59  HIS C ND1 1 
ATOM   5777  C  CD2 . HIS C 2 59  ? 41.18480  15.82073  -9.34281  1.000 45.41911  ? 59  HIS C CD2 1 
ATOM   5778  C  CE1 . HIS C 2 59  ? 40.62772  17.87408  -9.87745  1.000 46.70223  ? 59  HIS C CE1 1 
ATOM   5779  N  NE2 . HIS C 2 59  ? 40.75812  16.64810  -10.35241 1.000 49.39709  ? 59  HIS C NE2 1 
ATOM   5780  N  N   . GLU C 2 60  ? 44.73577  14.55947  -7.99503  1.000 38.29055  ? 60  GLU C N   1 
ATOM   5781  C  CA  . GLU C 2 60  ? 45.20154  13.28216  -8.52979  1.000 38.95299  ? 60  GLU C CA  1 
ATOM   5782  C  C   . GLU C 2 60  ? 46.60123  13.02822  -7.99838  1.000 41.09773  ? 60  GLU C C   1 
ATOM   5783  O  O   . GLU C 2 60  ? 47.55555  13.69567  -8.41121  1.000 39.95988  ? 60  GLU C O   1 
ATOM   5784  C  CB  . GLU C 2 60  ? 45.20618  13.29209  -10.05513 1.000 34.89627  ? 60  GLU C CB  1 
ATOM   5785  C  CG  . GLU C 2 60  ? 43.97930  13.91724  -10.66894 1.000 32.04176  ? 60  GLU C CG  1 
ATOM   5786  C  CD  . GLU C 2 60  ? 44.02083  13.87986  -12.17787 1.000 40.66858  ? 60  GLU C CD  1 
ATOM   5787  O  OE1 . GLU C 2 60  ? 44.17814  12.77477  -12.73729 1.000 40.94166  ? 60  GLU C OE1 1 
ATOM   5788  O  OE2 . GLU C 2 60  ? 43.92758  14.95369  -12.80469 1.000 48.73533  ? 60  GLU C OE2 1 
ATOM   5789  N  N   . ALA C 2 61  ? 46.73835  12.04505  -7.11535  1.000 44.37813  ? 61  ALA C N   1 
ATOM   5790  C  CA  . ALA C 2 61  ? 48.03248  11.85215  -6.48725  1.000 37.48468  ? 61  ALA C CA  1 
ATOM   5791  C  C   . ALA C 2 61  ? 48.18731  10.42644  -5.98908  1.000 43.34532  ? 61  ALA C C   1 
ATOM   5792  O  O   . ALA C 2 61  ? 47.23078  9.81763   -5.50077  1.000 43.53461  ? 61  ALA C O   1 
ATOM   5793  C  CB  . ALA C 2 61  ? 48.22838  12.83020  -5.32204  1.000 39.66150  ? 61  ALA C CB  1 
ATOM   5794  N  N   . VAL C 2 62  ? 49.39910  9.90415   -6.14176  1.000 40.20484  ? 62  VAL C N   1 
ATOM   5795  C  CA  A VAL C 2 62  ? 49.84072  8.70699   -5.44061  0.120 43.41079  ? 62  VAL C CA  1 
ATOM   5796  C  CA  B VAL C 2 62  ? 49.85819  8.70191   -5.45646  0.880 43.25518  ? 62  VAL C CA  1 
ATOM   5797  C  C   . VAL C 2 62  ? 50.90511  9.14128   -4.44531  1.000 41.92123  ? 62  VAL C C   1 
ATOM   5798  O  O   . VAL C 2 62  ? 51.83587  9.87590   -4.79611  1.000 51.16660  ? 62  VAL C O   1 
ATOM   5799  C  CB  A VAL C 2 62  ? 50.36621  7.62869   -6.40490  0.120 40.91356  ? 62  VAL C CB  1 
ATOM   5800  C  CB  B VAL C 2 62  ? 50.44094  7.67310   -6.44035  0.880 40.84137  ? 62  VAL C CB  1 
ATOM   5801  C  CG1 A VAL C 2 62  ? 49.20375  6.91523   -7.07804  0.120 41.38904  ? 62  VAL C CG1 1 
ATOM   5802  C  CG1 B VAL C 2 62  ? 51.05416  6.51868   -5.68348  0.880 36.51282  ? 62  VAL C CG1 1 
ATOM   5803  C  CG2 A VAL C 2 62  ? 51.27899  8.23844   -7.44560  0.120 40.60319  ? 62  VAL C CG2 1 
ATOM   5804  C  CG2 B VAL C 2 62  ? 49.36455  7.17975   -7.39426  0.880 41.73348  ? 62  VAL C CG2 1 
ATOM   5805  N  N   . GLY C 2 63  ? 50.75317  8.71539   -3.19484  1.000 46.38408  ? 63  GLY C N   1 
ATOM   5806  C  CA  . GLY C 2 63  ? 51.59344  9.23507   -2.13867  1.000 49.99448  ? 63  GLY C CA  1 
ATOM   5807  C  C   . GLY C 2 63  ? 52.05880  8.16990   -1.16882  1.000 48.18779  ? 63  GLY C C   1 
ATOM   5808  O  O   . GLY C 2 63  ? 51.79475  6.97863   -1.33676  1.000 50.62702  ? 63  GLY C O   1 
ATOM   5809  N  N   . GLU C 2 64  ? 52.77725  8.63650   -0.15291  1.000 47.31995  ? 64  GLU C N   1 
ATOM   5810  C  CA  . GLU C 2 64  ? 53.27046  7.80927   0.93460   1.000 59.10208  ? 64  GLU C CA  1 
ATOM   5811  C  C   . GLU C 2 64  ? 52.66692  8.31049   2.23618   1.000 52.73058  ? 64  GLU C C   1 
ATOM   5812  O  O   . GLU C 2 64  ? 52.71394  9.51124   2.52399   1.000 54.82659  ? 64  GLU C O   1 
ATOM   5813  C  CB  . GLU C 2 64  ? 54.79875  7.85410   1.00375   1.000 53.66000  ? 64  GLU C CB  1 
ATOM   5814  C  CG  . GLU C 2 64  ? 55.38509  7.11618   2.18649   1.000 57.00542  ? 64  GLU C CG  1 
ATOM   5815  C  CD  . GLU C 2 64  ? 56.88205  7.31358   2.30871   1.000 72.33701  ? 64  GLU C CD  1 
ATOM   5816  O  OE1 . GLU C 2 64  ? 57.32838  8.48092   2.33490   1.000 66.55623  ? 64  GLU C OE1 1 
ATOM   5817  O  OE2 . GLU C 2 64  ? 57.61190  6.30241   2.38069   1.000 78.47776  ? 64  GLU C OE2 1 
ATOM   5818  N  N   . VAL C 2 65  ? 52.09301  7.39590   3.01409   1.000 51.14929  ? 65  VAL C N   1 
ATOM   5819  C  CA  . VAL C 2 65  ? 51.53612  7.77033   4.30546   1.000 49.63933  ? 65  VAL C CA  1 
ATOM   5820  C  C   . VAL C 2 65  ? 52.66726  8.16192   5.24325   1.000 55.79223  ? 65  VAL C C   1 
ATOM   5821  O  O   . VAL C 2 65  ? 53.65335  7.42832   5.39421   1.000 56.11794  ? 65  VAL C O   1 
ATOM   5822  C  CB  . VAL C 2 65  ? 50.70570  6.62070   4.89031   1.000 59.28942  ? 65  VAL C CB  1 
ATOM   5823  C  CG1 . VAL C 2 65  ? 50.16664  7.01488   6.24865   1.000 50.63971  ? 65  VAL C CG1 1 
ATOM   5824  C  CG2 . VAL C 2 65  ? 49.57963  6.25019   3.94980   1.000 44.98226  ? 65  VAL C CG2 1 
ATOM   5825  N  N   . VAL C 2 66  ? 52.53160  9.32155   5.87830   1.000 49.50599  ? 66  VAL C N   1 
ATOM   5826  C  CA  . VAL C 2 66  ? 53.51359  9.77667   6.84967   1.000 52.35529  ? 66  VAL C CA  1 
ATOM   5827  C  C   . VAL C 2 66  ? 52.96452  9.78824   8.26982   1.000 62.29854  ? 66  VAL C C   1 
ATOM   5828  O  O   . VAL C 2 66  ? 53.75642  9.70352   9.22176   1.000 66.53272  ? 66  VAL C O   1 
ATOM   5829  C  CB  . VAL C 2 66  ? 54.07028  11.16689  6.47785   1.000 57.03787  ? 66  VAL C CB  1 
ATOM   5830  C  CG1 . VAL C 2 66  ? 54.78599  11.11164  5.13990   1.000 56.41671  ? 66  VAL C CG1 1 
ATOM   5831  C  CG2 . VAL C 2 66  ? 52.95407  12.19563  6.43935   1.000 57.07022  ? 66  VAL C CG2 1 
ATOM   5832  N  N   . GLU C 2 67  ? 51.65129  9.89854   8.44776   1.000 61.68750  ? 67  GLU C N   1 
ATOM   5833  C  CA  . GLU C 2 67  ? 51.05241  9.92238   9.77214   1.000 63.74055  ? 67  GLU C CA  1 
ATOM   5834  C  C   . GLU C 2 67  ? 49.61833  9.42755   9.66009   1.000 55.48286  ? 67  GLU C C   1 
ATOM   5835  O  O   . GLU C 2 67  ? 48.94816  9.68155   8.65641   1.000 55.69450  ? 67  GLU C O   1 
ATOM   5836  C  CB  . GLU C 2 67  ? 51.11119  11.32991  10.37844  1.000 67.64571  ? 67  GLU C CB  1 
ATOM   5837  C  CG  . GLU C 2 67  ? 50.70492  11.40634  11.83860  1.000 69.94365  ? 67  GLU C CG  1 
ATOM   5838  C  CD  . GLU C 2 67  ? 50.71265  12.82977  12.36356  1.000 85.83855  ? 67  GLU C CD  1 
ATOM   5839  O  OE1 . GLU C 2 67  ? 51.19829  13.72512  11.63742  1.000 79.03497  ? 67  GLU C OE1 1 
ATOM   5840  O  OE2 . GLU C 2 67  ? 50.24185  13.05188  13.50148  1.000 82.94912  ? 67  GLU C OE2 1 
ATOM   5841  N  N   . VAL C 2 68  ? 49.16262  8.69839   10.68015  1.000 62.34339  ? 68  VAL C N   1 
ATOM   5842  C  CA  . VAL C 2 68  ? 47.79974  8.18857   10.72931  1.000 60.94352  ? 68  VAL C CA  1 
ATOM   5843  C  C   . VAL C 2 68  ? 47.20948  8.47964   12.09970  1.000 59.78525  ? 68  VAL C C   1 
ATOM   5844  O  O   . VAL C 2 68  ? 47.92404  8.66955   13.08596  1.000 71.92450  ? 68  VAL C O   1 
ATOM   5845  C  CB  . VAL C 2 68  ? 47.71768  6.67609   10.43634  1.000 56.30377  ? 68  VAL C CB  1 
ATOM   5846  C  CG1 . VAL C 2 68  ? 48.09196  6.39180   9.00270   1.000 53.36656  ? 68  VAL C CG1 1 
ATOM   5847  C  CG2 . VAL C 2 68  ? 48.61618  5.90791   11.39032  1.000 59.16352  ? 68  VAL C CG2 1 
ATOM   5848  N  N   . GLY C 2 69  ? 45.88280  8.51530   12.14724  1.000 59.50882  ? 69  GLY C N   1 
ATOM   5849  C  CA  . GLY C 2 69  ? 45.19108  8.65471   13.40876  1.000 68.06952  ? 69  GLY C CA  1 
ATOM   5850  C  C   . GLY C 2 69  ? 45.24553  7.38339   14.23383  1.000 74.54930  ? 69  GLY C C   1 
ATOM   5851  O  O   . GLY C 2 69  ? 45.63504  6.30877   13.77168  1.000 73.15596  ? 69  GLY C O   1 
ATOM   5852  N  N   . SER C 2 70  ? 44.82525  7.51628   15.49402  1.000 71.43364  ? 70  SER C N   1 
ATOM   5853  C  CA  . SER C 2 70  ? 44.88360  6.39152   16.41967  1.000 79.04103  ? 70  SER C CA  1 
ATOM   5854  C  C   . SER C 2 70  ? 43.92907  5.26695   16.03521  1.000 74.84631  ? 70  SER C C   1 
ATOM   5855  O  O   . SER C 2 70  ? 44.12525  4.12937   16.47651  1.000 81.42322  ? 70  SER C O   1 
ATOM   5856  C  CB  . SER C 2 70  ? 44.59261  6.86875   17.84435  1.000 74.21339  ? 70  SER C CB  1 
ATOM   5857  O  OG  . SER C 2 70  ? 43.33843  7.52063   17.91844  1.000 78.21683  ? 70  SER C OG  1 
ATOM   5858  N  N   . GLU C 2 71  ? 42.90960  5.55098   15.22604  1.000 70.68228  ? 71  GLU C N   1 
ATOM   5859  C  CA  . GLU C 2 71  ? 41.91775  4.55379   14.84453  1.000 73.49090  ? 71  GLU C CA  1 
ATOM   5860  C  C   . GLU C 2 71  ? 42.12676  4.00951   13.43807  1.000 75.99113  ? 71  GLU C C   1 
ATOM   5861  O  O   . GLU C 2 71  ? 41.36320  3.13967   13.00806  1.000 67.56360  ? 71  GLU C O   1 
ATOM   5862  C  CB  . GLU C 2 71  ? 40.50524  5.13345   14.96788  1.000 71.24284  ? 71  GLU C CB  1 
ATOM   5863  C  CG  . GLU C 2 71  ? 40.17183  5.63383   16.36170  1.000 75.10424  ? 71  GLU C CG  1 
ATOM   5864  C  CD  . GLU C 2 71  ? 40.23956  4.53336   17.40281  1.000 82.39359  ? 71  GLU C CD  1 
ATOM   5865  O  OE1 . GLU C 2 71  ? 39.70278  3.43526   17.14164  1.000 90.38804  ? 71  GLU C OE1 1 
ATOM   5866  O  OE2 . GLU C 2 71  ? 40.83201  4.76394   18.47910  1.000 91.96687  ? 71  GLU C OE2 1 
ATOM   5867  N  N   . VAL C 2 72  ? 43.12525  4.50481   12.70639  1.000 73.20120  ? 72  VAL C N   1 
ATOM   5868  C  CA  . VAL C 2 72  ? 43.41925  3.95823   11.38773  1.000 71.59902  ? 72  VAL C CA  1 
ATOM   5869  C  C   . VAL C 2 72  ? 44.03300  2.57632   11.55761  1.000 66.68417  ? 72  VAL C C   1 
ATOM   5870  O  O   . VAL C 2 72  ? 45.01547  2.40147   12.28994  1.000 74.08636  ? 72  VAL C O   1 
ATOM   5871  C  CB  . VAL C 2 72  ? 44.34872  4.89807   10.60640  1.000 65.95663  ? 72  VAL C CB  1 
ATOM   5872  C  CG1 . VAL C 2 72  ? 44.78017  4.25131   9.29998   1.000 57.42033  ? 72  VAL C CG1 1 
ATOM   5873  C  CG2 . VAL C 2 72  ? 43.65349  6.22748   10.34681  1.000 55.27863  ? 72  VAL C CG2 1 
ATOM   5874  N  N   . LYS C 2 73  ? 43.45358  1.58469   10.88304  1.000 63.54588  ? 73  LYS C N   1 
ATOM   5875  C  CA  . LYS C 2 73  ? 43.81829  0.19073   11.09700  1.000 63.62997  ? 73  LYS C CA  1 
ATOM   5876  C  C   . LYS C 2 73  ? 44.55449  -0.45394  9.93181   1.000 60.70063  ? 73  LYS C C   1 
ATOM   5877  O  O   . LYS C 2 73  ? 45.39955  -1.31999  10.16292  1.000 68.43278  ? 73  LYS C O   1 
ATOM   5878  C  CB  . LYS C 2 73  ? 42.56356  -0.63198  11.41759  1.000 63.99206  ? 73  LYS C CB  1 
ATOM   5879  C  CG  . LYS C 2 73  ? 41.86274  -0.17168  12.69263  1.000 78.87290  ? 73  LYS C CG  1 
ATOM   5880  C  CD  . LYS C 2 73  ? 40.55278  -0.90753  12.93251  1.000 91.54461  ? 73  LYS C CD  1 
ATOM   5881  C  CE  . LYS C 2 73  ? 39.77395  -0.28432  14.08804  1.000 85.18757  ? 73  LYS C CE  1 
ATOM   5882  N  NZ  . LYS C 2 73  ? 40.56864  -0.23415  15.34850  1.000 80.78008  ? 73  LYS C NZ  1 
ATOM   5883  N  N   . ASP C 2 74  ? 44.26282  -0.06539  8.69316   1.000 57.25588  ? 74  ASP C N   1 
ATOM   5884  C  CA  . ASP C 2 74  ? 44.81149  -0.74492  7.52672   1.000 63.93494  ? 74  ASP C CA  1 
ATOM   5885  C  C   . ASP C 2 74  ? 45.96224  0.00212   6.86824   1.000 61.08370  ? 74  ASP C C   1 
ATOM   5886  O  O   . ASP C 2 74  ? 46.50196  -0.48505  5.87057   1.000 57.50461  ? 74  ASP C O   1 
ATOM   5887  C  CB  . ASP C 2 74  ? 43.71184  -0.98649  6.48881   1.000 52.11832  ? 74  ASP C CB  1 
ATOM   5888  C  CG  . ASP C 2 74  ? 42.66735  -1.96789  6.96675   1.000 53.82176  ? 74  ASP C CG  1 
ATOM   5889  O  OD1 . ASP C 2 74  ? 42.95622  -2.73740  7.90830   1.000 60.88112  ? 74  ASP C OD1 1 
ATOM   5890  O  OD2 . ASP C 2 74  ? 41.55937  -1.97548  6.39361   1.000 60.75841  ? 74  ASP C OD2 1 
ATOM   5891  N  N   . PHE C 2 75  ? 46.35850  1.15750   7.39458   1.000 58.98911  ? 75  PHE C N   1 
ATOM   5892  C  CA  . PHE C 2 75  ? 47.41822  1.94636   6.78448   1.000 54.16757  ? 75  PHE C CA  1 
ATOM   5893  C  C   . PHE C 2 75  ? 48.32665  2.49480   7.87155   1.000 59.42024  ? 75  PHE C C   1 
ATOM   5894  O  O   . PHE C 2 75  ? 47.85458  2.94377   8.91975   1.000 62.42515  ? 75  PHE C O   1 
ATOM   5895  C  CB  . PHE C 2 75  ? 46.83944  3.08678   5.93707   1.000 48.62463  ? 75  PHE C CB  1 
ATOM   5896  C  CG  . PHE C 2 75  ? 46.01067  2.60917   4.78038   1.000 54.32657  ? 75  PHE C CG  1 
ATOM   5897  C  CD1 . PHE C 2 75  ? 46.60774  2.25456   3.58085   1.000 47.18711  ? 75  PHE C CD1 1 
ATOM   5898  C  CD2 . PHE C 2 75  ? 44.63576  2.48880   4.89974   1.000 52.76644  ? 75  PHE C CD2 1 
ATOM   5899  C  CE1 . PHE C 2 75  ? 45.84977  1.80082   2.52124   1.000 42.66720  ? 75  PHE C CE1 1 
ATOM   5900  C  CE2 . PHE C 2 75  ? 43.87010  2.03422   3.83766   1.000 53.40889  ? 75  PHE C CE2 1 
ATOM   5901  C  CZ  . PHE C 2 75  ? 44.47967  1.68831   2.64964   1.000 42.69697  ? 75  PHE C CZ  1 
ATOM   5902  N  N   . LYS C 2 76  ? 49.62463  2.45789   7.61191   1.000 57.63756  ? 76  LYS C N   1 
ATOM   5903  C  CA  . LYS C 2 76  ? 50.65366  2.87233   8.54931   1.000 55.76589  ? 76  LYS C CA  1 
ATOM   5904  C  C   . LYS C 2 76  ? 51.62212  3.80446   7.84328   1.000 60.66321  ? 76  LYS C C   1 
ATOM   5905  O  O   . LYS C 2 76  ? 51.66897  3.84153   6.60868   1.000 56.90105  ? 76  LYS C O   1 
ATOM   5906  C  CB  . LYS C 2 76  ? 51.40897  1.65440   9.10504   1.000 65.38502  ? 76  LYS C CB  1 
ATOM   5907  C  CG  . LYS C 2 76  ? 52.02903  0.77944   8.02969   1.000 70.26835  ? 76  LYS C CG  1 
ATOM   5908  C  CD  . LYS C 2 76  ? 52.56412  -0.52311  8.59845   1.000 76.49303  ? 76  LYS C CD  1 
ATOM   5909  C  CE  . LYS C 2 76  ? 52.88798  -1.50890  7.48409   1.000 83.28620  ? 76  LYS C CE  1 
ATOM   5910  N  NZ  . LYS C 2 76  ? 53.90510  -0.97368  6.53766   1.000 81.71029  ? 76  LYS C NZ  1 
ATOM   5911  N  N   . PRO C 2 77  ? 52.39621  4.58718   8.59542   1.000 60.46648  ? 77  PRO C N   1 
ATOM   5912  C  CA  . PRO C 2 77  ? 53.40839  5.43843   7.95966   1.000 60.18332  ? 77  PRO C CA  1 
ATOM   5913  C  C   . PRO C 2 77  ? 54.37253  4.60947   7.12323   1.000 64.45586  ? 77  PRO C C   1 
ATOM   5914  O  O   . PRO C 2 77  ? 54.89074  3.58431   7.57176   1.000 70.40169  ? 77  PRO C O   1 
ATOM   5915  C  CB  . PRO C 2 77  ? 54.10831  6.10082   9.14999   1.000 58.54479  ? 77  PRO C CB  1 
ATOM   5916  C  CG  . PRO C 2 77  ? 53.07140  6.12827   10.21398  1.000 59.83277  ? 77  PRO C CG  1 
ATOM   5917  C  CD  . PRO C 2 77  ? 52.27394  4.86632   10.03808  1.000 59.21813  ? 77  PRO C CD  1 
ATOM   5918  N  N   . GLY C 2 78  ? 54.59939  5.05888   5.89069   1.000 58.39720  ? 78  GLY C N   1 
ATOM   5919  C  CA  . GLY C 2 78  ? 55.46003  4.36761   4.95888   1.000 57.84107  ? 78  GLY C CA  1 
ATOM   5920  C  C   . GLY C 2 78  ? 54.73670  3.59859   3.87538   1.000 59.36219  ? 78  GLY C C   1 
ATOM   5921  O  O   . GLY C 2 78  ? 55.38096  3.17986   2.90493   1.000 64.71182  ? 78  GLY C O   1 
ATOM   5922  N  N   . ASP C 2 79  ? 53.42537  3.40544   4.00346   1.000 58.26067  ? 79  ASP C N   1 
ATOM   5923  C  CA  . ASP C 2 79  ? 52.67473  2.68699   2.98236   1.000 58.92274  ? 79  ASP C CA  1 
ATOM   5924  C  C   . ASP C 2 79  ? 52.48876  3.57079   1.75573   1.000 54.17012  ? 79  ASP C C   1 
ATOM   5925  O  O   . ASP C 2 79  ? 52.11241  4.74098   1.87491   1.000 59.59108  ? 79  ASP C O   1 
ATOM   5926  C  CB  . ASP C 2 79  ? 51.31035  2.24995   3.51985   1.000 64.07557  ? 79  ASP C CB  1 
ATOM   5927  C  CG  . ASP C 2 79  ? 51.41108  1.17431   4.58943   1.000 70.69037  ? 79  ASP C CG  1 
ATOM   5928  O  OD1 . ASP C 2 79  ? 52.48596  0.54709   4.71677   1.000 73.59736  ? 79  ASP C OD1 1 
ATOM   5929  O  OD2 . ASP C 2 79  ? 50.40170  0.94801   5.29408   1.000 58.03622  ? 79  ASP C OD2 1 
ATOM   5930  N  N   . ARG C 2 80  ? 52.75431  3.01194   0.57626   1.000 50.21841  ? 80  ARG C N   1 
ATOM   5931  C  CA  . ARG C 2 80  ? 52.50706  3.70078   -0.68500  1.000 41.74328  ? 80  ARG C CA  1 
ATOM   5932  C  C   . ARG C 2 80  ? 51.07052  3.42773   -1.11240  1.000 50.44206  ? 80  ARG C C   1 
ATOM   5933  O  O   . ARG C 2 80  ? 50.65992  2.26771   -1.22963  1.000 50.73164  ? 80  ARG C O   1 
ATOM   5934  C  CB  . ARG C 2 80  ? 53.50027  3.24554   -1.75239  1.000 47.30027  ? 80  ARG C CB  1 
ATOM   5935  C  CG  . ARG C 2 80  ? 54.94728  3.51568   -1.36964  1.000 56.37566  ? 80  ARG C CG  1 
ATOM   5936  C  CD  . ARG C 2 80  ? 55.93432  2.69559   -2.18720  1.000 68.24275  ? 80  ARG C CD  1 
ATOM   5937  N  NE  . ARG C 2 80  ? 56.33205  3.35056   -3.42849  1.000 73.98451  ? 80  ARG C NE  1 
ATOM   5938  C  CZ  . ARG C 2 80  ? 55.91425  2.98959   -4.63421  1.000 68.15442  ? 80  ARG C CZ  1 
ATOM   5939  N  NH1 . ARG C 2 80  ? 55.06097  1.99080   -4.80077  1.000 71.63710  ? 80  ARG C NH1 1 
ATOM   5940  N  NH2 . ARG C 2 80  ? 56.36970  3.64190   -5.70028  1.000 66.07015  ? 80  ARG C NH2 1 
ATOM   5941  N  N   . VAL C 2 81  ? 50.30571  4.49203   -1.33569  1.000 53.89427  ? 81  VAL C N   1 
ATOM   5942  C  CA  . VAL C 2 81  ? 48.86691  4.38000   -1.52307  1.000 44.55681  ? 81  VAL C CA  1 
ATOM   5943  C  C   . VAL C 2 81  ? 48.42894  5.15933   -2.75469  1.000 39.28588  ? 81  VAL C C   1 
ATOM   5944  O  O   . VAL C 2 81  ? 49.03704  6.16571   -3.13388  1.000 38.36043  ? 81  VAL C O   1 
ATOM   5945  C  CB  . VAL C 2 81  ? 48.10011  4.87355   -0.27530  1.000 40.74746  ? 81  VAL C CB  1 
ATOM   5946  C  CG1 . VAL C 2 81  ? 48.36033  3.95378   0.90672   1.000 52.60493  ? 81  VAL C CG1 1 
ATOM   5947  C  CG2 . VAL C 2 81  ? 48.50836  6.30182   0.06830   1.000 41.02376  ? 81  VAL C CG2 1 
ATOM   5948  N  N   . VAL C 2 82  ? 47.35137  4.68909   -3.37157  1.000 38.12485  ? 82  VAL C N   1 
ATOM   5949  C  CA  . VAL C 2 82  ? 46.63999  5.45259   -4.38699  1.000 34.00773  ? 82  VAL C CA  1 
ATOM   5950  C  C   . VAL C 2 82  ? 45.49968  6.18706   -3.69909  1.000 40.26558  ? 82  VAL C C   1 
ATOM   5951  O  O   . VAL C 2 82  ? 44.68449  5.57421   -2.99978  1.000 40.03200  ? 82  VAL C O   1 
ATOM   5952  C  CB  . VAL C 2 82  ? 46.10802  4.53856   -5.50225  1.000 35.59904  ? 82  VAL C CB  1 
ATOM   5953  C  CG1 . VAL C 2 82  ? 45.32280  5.35661   -6.50873  1.000 36.53842  ? 82  VAL C CG1 1 
ATOM   5954  C  CG2 . VAL C 2 82  ? 47.24746  3.78718   -6.17821  1.000 39.01203  ? 82  VAL C CG2 1 
ATOM   5955  N  N   . VAL C 2 83  ? 45.44286  7.49625   -3.88968  1.000 36.35819  ? 83  VAL C N   1 
ATOM   5956  C  CA  . VAL C 2 83  ? 44.45599  8.34701   -3.22890  1.000 31.16189  ? 83  VAL C CA  1 
ATOM   5957  C  C   . VAL C 2 83  ? 43.40554  8.72671   -4.26516  1.000 37.35492  ? 83  VAL C C   1 
ATOM   5958  O  O   . VAL C 2 83  ? 43.74410  9.38313   -5.25812  1.000 43.87384  ? 83  VAL C O   1 
ATOM   5959  C  CB  . VAL C 2 83  ? 45.10767  9.60046   -2.62543  1.000 36.28645  ? 83  VAL C CB  1 
ATOM   5960  C  CG1 . VAL C 2 83  ? 44.08812  10.38910  -1.81522  1.000 40.44939  ? 83  VAL C CG1 1 
ATOM   5961  C  CG2 . VAL C 2 83  ? 46.31553  9.22635   -1.77212  1.000 35.20239  ? 83  VAL C CG2 1 
ATOM   5962  N  N   . PRO C 2 84  ? 42.14737  8.32916   -4.08996  1.000 38.24172  ? 84  PRO C N   1 
ATOM   5963  C  CA  . PRO C 2 84  ? 41.11558  8.72677   -5.05158  1.000 32.60315  ? 84  PRO C CA  1 
ATOM   5964  C  C   . PRO C 2 84  ? 40.85529  10.22167  -4.99421  1.000 33.67256  ? 84  PRO C C   1 
ATOM   5965  O  O   . PRO C 2 84  ? 40.96960  10.85632  -3.94315  1.000 34.82915  ? 84  PRO C O   1 
ATOM   5966  C  CB  . PRO C 2 84  ? 39.88652  7.93165   -4.59765  1.000 37.31328  ? 84  PRO C CB  1 
ATOM   5967  C  CG  . PRO C 2 84  ? 40.12461  7.67867   -3.14353  1.000 33.39282  ? 84  PRO C CG  1 
ATOM   5968  C  CD  . PRO C 2 84  ? 41.60803  7.47842   -3.01877  1.000 32.96529  ? 84  PRO C CD  1 
ATOM   5969  N  N   . ALA C 2 85  ? 40.51042  10.78855  -6.15413  1.000 26.92497  ? 85  ALA C N   1 
ATOM   5970  C  CA  . ALA C 2 85  ? 40.15244  12.20109  -6.19290  1.000 31.63625  ? 85  ALA C CA  1 
ATOM   5971  C  C   . ALA C 2 85  ? 38.92153  12.48277  -5.34478  1.000 37.52362  ? 85  ALA C C   1 
ATOM   5972  O  O   . ALA C 2 85  ? 38.81082  13.56220  -4.75225  1.000 44.35617  ? 85  ALA C O   1 
ATOM   5973  C  CB  . ALA C 2 85  ? 39.91948  12.64666  -7.63560  1.000 37.72639  ? 85  ALA C CB  1 
ATOM   5974  N  N   . ALA C 2 86  ? 37.99411  11.52991  -5.26834  1.000 34.01718  ? 86  ALA C N   1 
ATOM   5975  C  CA  . ALA C 2 86  ? 36.81261  11.64603  -4.42457  1.000 32.81356  ? 86  ALA C CA  1 
ATOM   5976  C  C   . ALA C 2 86  ? 37.05082  10.86807  -3.13851  1.000 37.18065  ? 86  ALA C C   1 
ATOM   5977  O  O   . ALA C 2 86  ? 37.21317  9.64286   -3.17203  1.000 38.55628  ? 86  ALA C O   1 
ATOM   5978  C  CB  . ALA C 2 86  ? 35.56896  11.12762  -5.14483  1.000 30.82421  ? 86  ALA C CB  1 
ATOM   5979  N  N   . THR C 2 87  ? 37.07431  11.58457  -2.01064  1.000 39.19919  ? 87  THR C N   1 
ATOM   5980  C  CA  . THR C 2 87  ? 37.28130  11.01437  -0.68037  1.000 38.62077  ? 87  THR C CA  1 
ATOM   5981  C  C   . THR C 2 87  ? 36.09466  11.40701  0.19328   1.000 41.27719  ? 87  THR C C   1 
ATOM   5982  O  O   . THR C 2 87  ? 36.20561  12.31218  1.03370   1.000 46.12734  ? 87  THR C O   1 
ATOM   5983  C  CB  . THR C 2 87  ? 38.58747  11.50443  -0.05560  1.000 35.87699  ? 87  THR C CB  1 
ATOM   5984  O  OG1 . THR C 2 87  ? 38.56528  12.93451  0.02798   1.000 37.83247  ? 87  THR C OG1 1 
ATOM   5985  C  CG2 . THR C 2 87  ? 39.78467  11.07256  -0.89308  1.000 32.58374  ? 87  THR C CG2 1 
ATOM   5986  N  N   . PRO C 2 88  ? 34.95008  10.75108  0.03326   1.000 46.18395  ? 88  PRO C N   1 
ATOM   5987  C  CA  . PRO C 2 88  ? 33.73732  11.20889  0.71548   1.000 42.52464  ? 88  PRO C CA  1 
ATOM   5988  C  C   . PRO C 2 88  ? 33.71907  10.85013  2.19554   1.000 51.31364  ? 88  PRO C C   1 
ATOM   5989  O  O   . PRO C 2 88  ? 34.43619  9.96682   2.67014   1.000 46.12307  ? 88  PRO C O   1 
ATOM   5990  C  CB  . PRO C 2 88  ? 32.62035  10.47556  -0.03502  1.000 40.42433  ? 88  PRO C CB  1 
ATOM   5991  C  CG  . PRO C 2 88  ? 33.26331  9.20903   -0.48814  1.000 40.86505  ? 88  PRO C CG  1 
ATOM   5992  C  CD  . PRO C 2 88  ? 34.69626  9.56789   -0.81134  1.000 38.60590  ? 88  PRO C CD  1 
ATOM   5993  N  N   . ASP C 2 89  ? 32.88559  11.58544  2.92855   1.000 47.61179  ? 89  ASP C N   1 
ATOM   5994  C  CA  . ASP C 2 89  ? 32.47751  11.16828  4.26218   1.000 42.47132  ? 89  ASP C CA  1 
ATOM   5995  C  C   . ASP C 2 89  ? 31.53188  9.98297   4.12002   1.000 47.17669  ? 89  ASP C C   1 
ATOM   5996  O  O   . ASP C 2 89  ? 30.48286  10.09435  3.47762   1.000 57.48119  ? 89  ASP C O   1 
ATOM   5997  C  CB  . ASP C 2 89  ? 31.80083  12.32849  4.99214   1.000 48.38571  ? 89  ASP C CB  1 
ATOM   5998  C  CG  . ASP C 2 89  ? 31.41390  11.98526  6.42485   1.000 63.28989  ? 89  ASP C CG  1 
ATOM   5999  O  OD1 . ASP C 2 89  ? 31.81872  10.91320  6.92385   1.000 74.38876  ? 89  ASP C OD1 1 
ATOM   6000  O  OD2 . ASP C 2 89  ? 30.69918  12.79525  7.05627   1.000 63.52452  ? 89  ASP C OD2 1 
ATOM   6001  N  N   . TRP C 2 90  ? 31.90510  8.84340   4.69124   1.000 45.32887  ? 90  TRP C N   1 
ATOM   6002  C  CA  . TRP C 2 90  ? 31.13594  7.62245   4.49700   1.000 53.41113  ? 90  TRP C CA  1 
ATOM   6003  C  C   . TRP C 2 90  ? 30.01230  7.44473   5.50853   1.000 51.69019  ? 90  TRP C C   1 
ATOM   6004  O  O   . TRP C 2 90  ? 29.33262  6.41421   5.47631   1.000 57.24677  ? 90  TRP C O   1 
ATOM   6005  C  CB  . TRP C 2 90  ? 32.06687  6.40521   4.52627   1.000 46.65187  ? 90  TRP C CB  1 
ATOM   6006  C  CG  . TRP C 2 90  ? 32.87358  6.28248   3.27675   1.000 56.47185  ? 90  TRP C CG  1 
ATOM   6007  C  CD1 . TRP C 2 90  ? 34.15668  6.70346   3.08151   1.000 50.88011  ? 90  TRP C CD1 1 
ATOM   6008  C  CD2 . TRP C 2 90  ? 32.43867  5.72477   2.03026   1.000 49.72074  ? 90  TRP C CD2 1 
ATOM   6009  N  NE1 . TRP C 2 90  ? 34.55231  6.43067   1.79208   1.000 45.98711  ? 90  TRP C NE1 1 
ATOM   6010  C  CE2 . TRP C 2 90  ? 33.51489  5.83074   1.12694   1.000 46.86943  ? 90  TRP C CE2 1 
ATOM   6011  C  CE3 . TRP C 2 90  ? 31.24419  5.14187   1.59251   1.000 47.51807  ? 90  TRP C CE3 1 
ATOM   6012  C  CZ2 . TRP C 2 90  ? 33.43349  5.37479   -0.18757  1.000 44.86985  ? 90  TRP C CZ2 1 
ATOM   6013  C  CZ3 . TRP C 2 90  ? 31.16452  4.68947   0.28532   1.000 47.36946  ? 90  TRP C CZ3 1 
ATOM   6014  C  CH2 . TRP C 2 90  ? 32.25270  4.80961   -0.58870  1.000 46.67509  ? 90  TRP C CH2 1 
ATOM   6015  N  N   . ARG C 2 91  ? 29.78246  8.41990   6.37941   1.000 58.37026  ? 91  ARG C N   1 
ATOM   6016  C  CA  A ARG C 2 91  ? 28.74695  8.33756   7.40712   0.555 56.01998  ? 91  ARG C CA  1 
ATOM   6017  C  CA  B ARG C 2 91  ? 28.75647  8.34635   7.41674   0.445 56.01740  ? 91  ARG C CA  1 
ATOM   6018  C  C   . ARG C 2 91  ? 27.73623  9.46118   7.18764   1.000 59.19398  ? 91  ARG C C   1 
ATOM   6019  O  O   . ARG C 2 91  ? 27.60870  10.37468  8.00819   1.000 60.58834  ? 91  ARG C O   1 
ATOM   6020  C  CB  A ARG C 2 91  ? 29.36749  8.40127   8.80401   0.555 58.43849  ? 91  ARG C CB  1 
ATOM   6021  C  CB  B ARG C 2 91  ? 29.38911  8.44696   8.81075   0.445 58.46604  ? 91  ARG C CB  1 
ATOM   6022  C  CG  A ARG C 2 91  ? 30.05724  7.11823   9.23763   0.555 57.81736  ? 91  ARG C CG  1 
ATOM   6023  C  CG  B ARG C 2 91  ? 30.06724  7.17866   9.30624   0.445 57.84771  ? 91  ARG C CG  1 
ATOM   6024  C  CD  A ARG C 2 91  ? 30.63317  7.23547   10.64583  0.555 59.75113  ? 91  ARG C CD  1 
ATOM   6025  C  CD  B ARG C 2 91  ? 30.92663  7.47310   10.53496  0.445 60.05865  ? 91  ARG C CD  1 
ATOM   6026  N  NE  A ARG C 2 91  ? 29.61749  7.55962   11.64108  0.555 55.76224  ? 91  ARG C NE  1 
ATOM   6027  N  NE  B ARG C 2 91  ? 31.16434  6.29396   11.36056  0.445 60.96999  ? 91  ARG C NE  1 
ATOM   6028  C  CZ  A ARG C 2 91  ? 29.41364  8.77269   12.13576  0.555 57.56076  ? 91  ARG C CZ  1 
ATOM   6029  C  CZ  B ARG C 2 91  ? 32.03678  6.24311   12.35893  0.445 62.70698  ? 91  ARG C CZ  1 
ATOM   6030  N  NH1 A ARG C 2 91  ? 30.14144  9.80751   11.74971  0.555 56.52626  ? 91  ARG C NH1 1 
ATOM   6031  N  NH1 B ARG C 2 91  ? 32.80227  7.27891   12.66157  0.445 57.94440  ? 91  ARG C NH1 1 
ATOM   6032  N  NH2 A ARG C 2 91  ? 28.45670  8.95183   13.04163  0.555 63.81454  ? 91  ARG C NH2 1 
ATOM   6033  N  NH2 B ARG C 2 91  ? 32.14597  5.12416   13.06996  0.445 61.18114  ? 91  ARG C NH2 1 
ATOM   6034  N  N   . THR C 2 92  ? 27.01024  9.38652   6.07264   1.000 57.11681  ? 92  THR C N   1 
ATOM   6035  C  CA  . THR C 2 92  ? 25.97397  10.36015  5.75062   1.000 56.09359  ? 92  THR C CA  1 
ATOM   6036  C  C   . THR C 2 92  ? 24.75092  9.63594   5.20061   1.000 68.29588  ? 92  THR C C   1 
ATOM   6037  O  O   . THR C 2 92  ? 24.78045  8.43157   4.93123   1.000 65.88659  ? 92  THR C O   1 
ATOM   6038  C  CB  . THR C 2 92  ? 26.45466  11.40171  4.72677   1.000 59.47680  ? 92  THR C CB  1 
ATOM   6039  O  OG1 . THR C 2 92  ? 26.83505  10.74214  3.51163   1.000 57.08900  ? 92  THR C OG1 1 
ATOM   6040  C  CG2 . THR C 2 92  ? 27.63581  12.19523  5.26635   1.000 57.15928  ? 92  THR C CG2 1 
ATOM   6041  N  N   . SER C 2 93  ? 23.66270  10.39325  5.02539   1.000 62.79522  ? 93  SER C N   1 
ATOM   6042  C  CA  . SER C 2 93  ? 22.44901  9.82180   4.44865   1.000 66.68235  ? 93  SER C CA  1 
ATOM   6043  C  C   . SER C 2 93  ? 22.60234  9.56250   2.95300   1.000 66.50446  ? 93  SER C C   1 
ATOM   6044  O  O   . SER C 2 93  ? 22.02689  8.60088   2.42921   1.000 60.31458  ? 93  SER C O   1 
ATOM   6045  C  CB  . SER C 2 93  ? 21.25710  10.74156  4.71563   1.000 67.52337  ? 93  SER C CB  1 
ATOM   6046  O  OG  . SER C 2 93  ? 21.44690  12.01013  4.11413   1.000 73.11025  ? 93  SER C OG  1 
ATOM   6047  N  N   . GLU C 2 94  ? 23.36618  10.40433  2.25060   1.000 64.06313  ? 94  GLU C N   1 
ATOM   6048  C  CA  A GLU C 2 94  ? 23.57756  10.20099  0.82184   0.448 63.56950  ? 94  GLU C CA  1 
ATOM   6049  C  CA  B GLU C 2 94  ? 23.58197  10.20438  0.82212   0.552 63.59594  ? 94  GLU C CA  1 
ATOM   6050  C  C   . GLU C 2 94  ? 24.39447  8.94922   0.53208   1.000 64.82523  ? 94  GLU C C   1 
ATOM   6051  O  O   . GLU C 2 94  ? 24.29935  8.40479   -0.57445  1.000 57.64029  ? 94  GLU C O   1 
ATOM   6052  C  CB  A GLU C 2 94  ? 24.26360  11.42188  0.20232   0.448 60.59688  ? 94  GLU C CB  1 
ATOM   6053  C  CB  B GLU C 2 94  ? 24.27785  11.42757  0.22334   0.552 60.61222  ? 94  GLU C CB  1 
ATOM   6054  C  CG  A GLU C 2 94  ? 23.41471  12.68988  0.18246   0.448 61.66621  ? 94  GLU C CG  1 
ATOM   6055  C  CG  B GLU C 2 94  ? 24.12466  12.68789  1.06482   0.552 62.15718  ? 94  GLU C CG  1 
ATOM   6056  C  CD  A GLU C 2 94  ? 23.53675  13.51170  1.45751   0.448 59.28152  ? 94  GLU C CD  1 
ATOM   6057  C  CD  B GLU C 2 94  ? 23.41249  13.80769  0.33007   0.552 61.40193  ? 94  GLU C CD  1 
ATOM   6058  O  OE1 A GLU C 2 94  ? 24.10650  13.00816  2.44864   0.448 53.94858  ? 94  GLU C OE1 1 
ATOM   6059  O  OE1 B GLU C 2 94  ? 23.24148  13.70330  -0.90479  0.552 54.06343  ? 94  GLU C OE1 1 
ATOM   6060  O  OE2 A GLU C 2 94  ? 23.06573  14.66874  1.46482   0.448 58.14630  ? 94  GLU C OE2 1 
ATOM   6061  O  OE2 B GLU C 2 94  ? 23.02366  14.79299  0.99303   0.552 59.02942  ? 94  GLU C OE2 1 
ATOM   6062  N  N   . VAL C 2 95  ? 25.19606  8.48661   1.49402   1.000 65.14922  ? 95  VAL C N   1 
ATOM   6063  C  CA  . VAL C 2 95  ? 25.91116  7.22708   1.32323   1.000 60.19473  ? 95  VAL C CA  1 
ATOM   6064  C  C   . VAL C 2 95  ? 24.94556  6.05445   1.44137   1.000 60.93501  ? 95  VAL C C   1 
ATOM   6065  O  O   . VAL C 2 95  ? 25.05332  5.06596   0.70513   1.000 61.54788  ? 95  VAL C O   1 
ATOM   6066  C  CB  . VAL C 2 95  ? 27.06629  7.12877   2.33732   1.000 59.60461  ? 95  VAL C CB  1 
ATOM   6067  C  CG1 . VAL C 2 95  ? 27.63857  5.71986   2.37210   1.000 54.83239  ? 95  VAL C CG1 1 
ATOM   6068  C  CG2 . VAL C 2 95  ? 28.15651  8.12664   1.98166   1.000 49.91806  ? 95  VAL C CG2 1 
ATOM   6069  N  N   . GLN C 2 96  ? 23.97210  6.15319   2.35151   1.000 54.18527  ? 96  GLN C N   1 
ATOM   6070  C  CA  . GLN C 2 96  ? 22.96445  5.10712   2.47548   1.000 59.64271  ? 96  GLN C CA  1 
ATOM   6071  C  C   . GLN C 2 96  ? 22.05059  5.03398   1.25648   1.000 59.81679  ? 96  GLN C C   1 
ATOM   6072  O  O   . GLN C 2 96  ? 21.42625  3.99155   1.03250   1.000 66.68877  ? 96  GLN C O   1 
ATOM   6073  C  CB  . GLN C 2 96  ? 22.13521  5.31706   3.74465   1.000 55.63724  ? 96  GLN C CB  1 
ATOM   6074  C  CG  . GLN C 2 96  ? 22.95910  5.37330   5.02537   1.000 58.39033  ? 96  GLN C CG  1 
ATOM   6075  C  CD  . GLN C 2 96  ? 22.11197  5.22657   6.28011   1.000 62.53393  ? 96  GLN C CD  1 
ATOM   6076  O  OE1 . GLN C 2 96  ? 21.02295  4.65480   6.24415   1.000 71.43493  ? 96  GLN C OE1 1 
ATOM   6077  N  NE2 . GLN C 2 96  ? 22.61032  5.74373   7.39722   1.000 60.58376  ? 96  GLN C NE2 1 
ATOM   6078  N  N   . ARG C 2 97  ? 21.95928  6.10786   0.46468   1.000 66.04681  ? 97  ARG C N   1 
ATOM   6079  C  CA  . ARG C 2 97  ? 21.22186  6.07289   -0.79531  1.000 64.64760  ? 97  ARG C CA  1 
ATOM   6080  C  C   . ARG C 2 97  ? 22.04487  5.50829   -1.94528  1.000 52.24130  ? 97  ARG C C   1 
ATOM   6081  O  O   . ARG C 2 97  ? 21.49063  5.27577   -3.02486  1.000 60.90423  ? 97  ARG C O   1 
ATOM   6082  C  CB  . ARG C 2 97  ? 20.72217  7.47438   -1.17867  1.000 60.97226  ? 97  ARG C CB  1 
ATOM   6083  C  CG  . ARG C 2 97  ? 19.50721  7.95228   -0.39517  1.000 59.41347  ? 97  ARG C CG  1 
ATOM   6084  C  CD  . ARG C 2 97  ? 18.79936  9.13385   -1.05791  1.000 53.99738  ? 97  ARG C CD  1 
ATOM   6085  N  NE  . ARG C 2 97  ? 19.65086  10.31332  -1.16447  1.000 60.73839  ? 97  ARG C NE  1 
ATOM   6086  C  CZ  . ARG C 2 97  ? 20.09525  10.81647  -2.30910  1.000 59.23490  ? 97  ARG C CZ  1 
ATOM   6087  N  NH1 . ARG C 2 97  ? 19.77913  10.27133  -3.47399  1.000 45.62959  ? 97  ARG C NH1 1 
ATOM   6088  N  NH2 . ARG C 2 97  ? 20.87691  11.89334  -2.28507  1.000 48.23287  ? 97  ARG C NH2 1 
ATOM   6089  N  N   . GLY C 2 98  ? 23.34487  5.30394   -1.75375  1.000 57.74764  ? 98  GLY C N   1 
ATOM   6090  C  CA  . GLY C 2 98  ? 24.18404  4.74260   -2.79410  1.000 54.92618  ? 98  GLY C CA  1 
ATOM   6091  C  C   . GLY C 2 98  ? 24.87605  5.74697   -3.68508  1.000 54.81868  ? 98  GLY C C   1 
ATOM   6092  O  O   . GLY C 2 98  ? 25.28986  5.38698   -4.79423  1.000 55.62161  ? 98  GLY C O   1 
ATOM   6093  N  N   . TYR C 2 99  ? 25.02261  6.99765   -3.23830  1.000 62.22638  ? 99  TYR C N   1 
ATOM   6094  C  CA  . TYR C 2 99  ? 25.67656  8.05463   -4.01541  1.000 55.21252  ? 99  TYR C CA  1 
ATOM   6095  C  C   . TYR C 2 99  ? 26.69914  8.73514   -3.10637  1.000 50.25617  ? 99  TYR C C   1 
ATOM   6096  O  O   . TYR C 2 99  ? 26.47704  9.84154   -2.60888  1.000 52.24478  ? 99  TYR C O   1 
ATOM   6097  C  CB  . TYR C 2 99  ? 24.64710  9.03881   -4.58166  1.000 42.72184  ? 99  TYR C CB  1 
ATOM   6098  C  CG  . TYR C 2 99  ? 23.81103  8.43065   -5.68154  1.000 45.52943  ? 99  TYR C CG  1 
ATOM   6099  C  CD1 . TYR C 2 99  ? 24.28800  8.36975   -6.98896  1.000 40.34175  ? 99  TYR C CD1 1 
ATOM   6100  C  CD2 . TYR C 2 99  ? 22.55146  7.90607   -5.41590  1.000 51.11673  ? 99  TYR C CD2 1 
ATOM   6101  C  CE1 . TYR C 2 99  ? 23.53203  7.80189   -8.00217  1.000 45.00967  ? 99  TYR C CE1 1 
ATOM   6102  C  CE2 . TYR C 2 99  ? 21.78474  7.33747   -6.42567  1.000 51.22126  ? 99  TYR C CE2 1 
ATOM   6103  C  CZ  . TYR C 2 99  ? 22.28044  7.28934   -7.71467  1.000 46.42077  ? 99  TYR C CZ  1 
ATOM   6104  O  OH  . TYR C 2 99  ? 21.52301  6.72636   -8.71868  1.000 60.93369  ? 99  TYR C OH  1 
ATOM   6105  N  N   . HIS C 2 100 ? 27.82847  8.05552   -2.88914  1.000 48.64804  ? 100 HIS C N   1 
ATOM   6106  C  CA  . HIS C 2 100 ? 28.87448  8.60938   -2.03726  1.000 47.07872  ? 100 HIS C CA  1 
ATOM   6107  C  C   . HIS C 2 100 ? 29.49638  9.86176   -2.64527  1.000 49.72364  ? 100 HIS C C   1 
ATOM   6108  O  O   . HIS C 2 100 ? 30.01091  10.71136  -1.90782  1.000 52.35520  ? 100 HIS C O   1 
ATOM   6109  C  CB  . HIS C 2 100 ? 29.95005  7.55558   -1.77331  1.000 44.76362  ? 100 HIS C CB  1 
ATOM   6110  C  CG  . HIS C 2 100 ? 30.69348  7.12908   -3.00139  1.000 44.40565  ? 100 HIS C CG  1 
ATOM   6111  N  ND1 . HIS C 2 100 ? 30.39940  5.96870   -3.68471  1.000 47.78239  ? 100 HIS C ND1 1 
ATOM   6112  C  CD2 . HIS C 2 100 ? 31.72441  7.70510   -3.66533  1.000 40.50110  ? 100 HIS C CD2 1 
ATOM   6113  C  CE1 . HIS C 2 100 ? 31.21342  5.85039   -4.71965  1.000 47.94841  ? 100 HIS C CE1 1 
ATOM   6114  N  NE2 . HIS C 2 100 ? 32.02716  6.89091   -4.73076  1.000 43.92834  ? 100 HIS C NE2 1 
ATOM   6115  N  N   . GLN C 2 101 ? 29.45307  10.00137  -3.97660  1.000 41.62462  ? 101 GLN C N   1 
ATOM   6116  C  CA  . GLN C 2 101 ? 29.98354  11.20111  -4.61933  1.000 42.21305  ? 101 GLN C CA  1 
ATOM   6117  C  C   . GLN C 2 101 ? 29.30982  12.47120  -4.12166  1.000 47.58260  ? 101 GLN C C   1 
ATOM   6118  O  O   . GLN C 2 101 ? 29.89933  13.55342  -4.21969  1.000 42.57360  ? 101 GLN C O   1 
ATOM   6119  C  CB  . GLN C 2 101 ? 29.82959  11.11880  -6.13835  1.000 40.95768  ? 101 GLN C CB  1 
ATOM   6120  C  CG  . GLN C 2 101 ? 30.53814  9.94972   -6.79741  1.000 43.29801  ? 101 GLN C CG  1 
ATOM   6121  C  CD  . GLN C 2 101 ? 29.61241  8.77640   -7.05672  1.000 43.74538  ? 101 GLN C CD  1 
ATOM   6122  O  OE1 . GLN C 2 101 ? 28.82839  8.38278   -6.19131  1.000 44.25406  ? 101 GLN C OE1 1 
ATOM   6123  N  NE2 . GLN C 2 101 ? 29.68609  8.22205   -8.26335  1.000 43.53091  ? 101 GLN C NE2 1 
ATOM   6124  N  N   . HIS C 2 102 ? 28.08898  12.36712  -3.59980  1.000 48.71975  ? 102 HIS C N   1 
ATOM   6125  C  CA  . HIS C 2 102 ? 27.34552  13.51409  -3.09865  1.000 47.01470  ? 102 HIS C CA  1 
ATOM   6126  C  C   . HIS C 2 102 ? 27.10361  13.39890  -1.59941  1.000 45.90554  ? 102 HIS C C   1 
ATOM   6127  O  O   . HIS C 2 102 ? 26.12027  13.92488  -1.07685  1.000 50.06781  ? 102 HIS C O   1 
ATOM   6128  C  CB  . HIS C 2 102 ? 26.03310  13.66586  -3.86316  1.000 46.43948  ? 102 HIS C CB  1 
ATOM   6129  C  CG  . HIS C 2 102 ? 26.20704  13.59627  -5.34673  1.000 47.53819  ? 102 HIS C CG  1 
ATOM   6130  N  ND1 . HIS C 2 102 ? 26.79857  14.60861  -6.07127  1.000 47.93213  ? 102 HIS C ND1 1 
ATOM   6131  C  CD2 . HIS C 2 102 ? 25.91079  12.61979  -6.23642  1.000 48.43152  ? 102 HIS C CD2 1 
ATOM   6132  C  CE1 . HIS C 2 102 ? 26.84127  14.26772  -7.34592  1.000 40.84888  ? 102 HIS C CE1 1 
ATOM   6133  N  NE2 . HIS C 2 102 ? 26.30831  13.06593  -7.47371  1.000 45.92289  ? 102 HIS C NE2 1 
ATOM   6134  N  N   . SER C 2 103 ? 28.00862  12.71856  -0.90051  1.000 46.04356  ? 103 SER C N   1 
ATOM   6135  C  CA  . SER C 2 103 ? 27.89918  12.53208  0.54187   1.000 52.92425  ? 103 SER C CA  1 
ATOM   6136  C  C   . SER C 2 103 ? 28.05907  13.87605  1.24446   1.000 52.50296  ? 103 SER C C   1 
ATOM   6137  O  O   . SER C 2 103 ? 29.16132  14.43004  1.30101   1.000 46.42841  ? 103 SER C O   1 
ATOM   6138  C  CB  . SER C 2 103 ? 28.95118  11.53512  1.01596   1.000 53.59713  ? 103 SER C CB  1 
ATOM   6139  O  OG  . SER C 2 103 ? 28.88891  11.35703  2.41832   1.000 61.21232  ? 103 SER C OG  1 
ATOM   6140  N  N   . GLY C 2 104 ? 26.95861  14.40259  1.77567   1.000 56.77957  ? 104 GLY C N   1 
ATOM   6141  C  CA  . GLY C 2 104 ? 26.95606  15.68768  2.44299   1.000 51.15408  ? 104 GLY C CA  1 
ATOM   6142  C  C   . GLY C 2 104 ? 26.59309  16.86761  1.56994   1.000 58.59324  ? 104 GLY C C   1 
ATOM   6143  O  O   . GLY C 2 104 ? 26.73040  18.01306  2.01930   1.000 61.58782  ? 104 GLY C O   1 
ATOM   6144  N  N   . GLY C 2 105 ? 26.11682  16.62793  0.34815   1.000 52.04077  ? 105 GLY C N   1 
ATOM   6145  C  CA  . GLY C 2 105 ? 25.75869  17.69521  -0.56535  1.000 47.28390  ? 105 GLY C CA  1 
ATOM   6146  C  C   . GLY C 2 105 ? 26.18632  17.39461  -1.98573  1.000 48.22400  ? 105 GLY C C   1 
ATOM   6147  O  O   . GLY C 2 105 ? 26.97976  16.47789  -2.21380  1.000 44.50942  ? 105 GLY C O   1 
ATOM   6148  N  N   . MET C 2 106 ? 25.68572  18.16643  -2.94789  1.000 40.97940  ? 106 MET C N   1 
ATOM   6149  C  CA  . MET C 2 106 ? 26.02876  17.92998  -4.34395  1.000 45.26874  ? 106 MET C CA  1 
ATOM   6150  C  C   . MET C 2 106 ? 27.52866  18.08648  -4.55311  1.000 45.42677  ? 106 MET C C   1 
ATOM   6151  O  O   . MET C 2 106 ? 28.11320  19.11559  -4.20137  1.000 57.96929  ? 106 MET C O   1 
ATOM   6152  C  CB  . MET C 2 106 ? 25.26079  18.89526  -5.24661  1.000 42.09004  ? 106 MET C CB  1 
ATOM   6153  C  CG  . MET C 2 106 ? 25.29655  18.52820  -6.72417  1.000 43.80986  ? 106 MET C CG  1 
ATOM   6154  S  SD  . MET C 2 106 ? 24.15800  19.54134  -7.68952  1.000 59.79627  ? 106 MET C SD  1 
ATOM   6155  C  CE  . MET C 2 106 ? 24.71368  21.19097  -7.26075  1.000 59.26589  ? 106 MET C CE  1 
ATOM   6156  N  N   . LEU C 2 107 ? 28.14738  17.04900  -5.11409  1.000 47.41614  ? 107 LEU C N   1 
ATOM   6157  C  CA  . LEU C 2 107 ? 29.58020  16.97044  -5.38600  1.000 42.16629  ? 107 LEU C CA  1 
ATOM   6158  C  C   . LEU C 2 107 ? 30.42693  17.00413  -4.11600  1.000 47.87996  ? 107 LEU C C   1 
ATOM   6159  O  O   . LEU C 2 107 ? 31.64949  17.18075  -4.19863  1.000 47.01836  ? 107 LEU C O   1 
ATOM   6160  C  CB  . LEU C 2 107 ? 30.02597  18.09803  -6.33013  1.000 44.34009  ? 107 LEU C CB  1 
ATOM   6161  C  CG  . LEU C 2 107 ? 29.22341  18.30186  -7.61767  1.000 50.08187  ? 107 LEU C CG  1 
ATOM   6162  C  CD1 . LEU C 2 107 ? 29.76673  19.48187  -8.40019  1.000 56.73312  ? 107 LEU C CD1 1 
ATOM   6163  C  CD2 . LEU C 2 107 ? 29.24830  17.04722  -8.46764  1.000 44.52952  ? 107 LEU C CD2 1 
ATOM   6164  N  N   . ALA C 2 108 ? 29.81802  16.81028  -2.94116  1.000 46.83813  ? 108 ALA C N   1 
ATOM   6165  C  CA  . ALA C 2 108 ? 30.54223  16.94741  -1.68126  1.000 43.40524  ? 108 ALA C CA  1 
ATOM   6166  C  C   . ALA C 2 108 ? 31.50377  15.79904  -1.40646  1.000 44.43871  ? 108 ALA C C   1 
ATOM   6167  O  O   . ALA C 2 108 ? 32.31255  15.90883  -0.47805  1.000 48.74023  ? 108 ALA C O   1 
ATOM   6168  C  CB  . ALA C 2 108 ? 29.56083  17.08186  -0.51831  1.000 44.90033  ? 108 ALA C CB  1 
ATOM   6169  N  N   . GLY C 2 109 ? 31.42155  14.69784  -2.15702  1.000 43.94834  ? 109 GLY C N   1 
ATOM   6170  C  CA  . GLY C 2 109 ? 32.43825  13.66547  -2.05728  1.000 37.60369  ? 109 GLY C CA  1 
ATOM   6171  C  C   . GLY C 2 109 ? 33.76753  14.07963  -2.64773  1.000 41.36787  ? 109 GLY C C   1 
ATOM   6172  O  O   . GLY C 2 109 ? 34.80391  13.50943  -2.29003  1.000 41.53077  ? 109 GLY C O   1 
ATOM   6173  N  N   . TRP C 2 110 ? 33.75426  15.05748  -3.54941  1.000 46.19540  ? 110 TRP C N   1 
ATOM   6174  C  CA  . TRP C 2 110 ? 34.95990  15.62354  -4.14777  1.000 42.98740  ? 110 TRP C CA  1 
ATOM   6175  C  C   . TRP C 2 110 ? 35.41716  16.75615  -3.23908  1.000 44.36114  ? 110 TRP C C   1 
ATOM   6176  O  O   . TRP C 2 110 ? 34.84432  17.84723  -3.25573  1.000 45.68145  ? 110 TRP C O   1 
ATOM   6177  C  CB  . TRP C 2 110 ? 34.66481  16.10515  -5.56517  1.000 48.41232  ? 110 TRP C CB  1 
ATOM   6178  C  CG  . TRP C 2 110 ? 35.73695  16.95252  -6.19306  1.000 56.59060  ? 110 TRP C CG  1 
ATOM   6179  C  CD1 . TRP C 2 110 ? 37.07947  16.90268  -5.94919  1.000 53.54952  ? 110 TRP C CD1 1 
ATOM   6180  C  CD2 . TRP C 2 110 ? 35.54358  17.99417  -7.16039  1.000 61.68598  ? 110 TRP C CD2 1 
ATOM   6181  N  NE1 . TRP C 2 110 ? 37.73409  17.84386  -6.70939  1.000 60.44638  ? 110 TRP C NE1 1 
ATOM   6182  C  CE2 . TRP C 2 110 ? 36.81359  18.52872  -7.45912  1.000 62.77304  ? 110 TRP C CE2 1 
ATOM   6183  C  CE3 . TRP C 2 110 ? 34.41890  18.52609  -7.80246  1.000 62.78570  ? 110 TRP C CE3 1 
ATOM   6184  C  CZ2 . TRP C 2 110 ? 36.99102  19.56590  -8.37506  1.000 64.28873  ? 110 TRP C CZ2 1 
ATOM   6185  C  CZ3 . TRP C 2 110 ? 34.59636  19.55898  -8.70906  1.000 67.13565  ? 110 TRP C CZ3 1 
ATOM   6186  C  CH2 . TRP C 2 110 ? 35.87258  20.06656  -8.98732  1.000 72.15989  ? 110 TRP C CH2 1 
ATOM   6187  N  N   . LYS C 2 111 ? 36.45110  16.50067  -2.43715  1.000 45.18430  ? 111 LYS C N   1 
ATOM   6188  C  CA  . LYS C 2 111 ? 36.93165  17.47878  -1.46678  1.000 45.62737  ? 111 LYS C CA  1 
ATOM   6189  C  C   . LYS C 2 111 ? 38.20016  18.19174  -1.92247  1.000 46.06635  ? 111 LYS C C   1 
ATOM   6190  O  O   . LYS C 2 111 ? 38.28940  19.41693  -1.80280  1.000 54.40808  ? 111 LYS C O   1 
ATOM   6191  C  CB  . LYS C 2 111 ? 37.17884  16.79719  -0.11336  1.000 38.99955  ? 111 LYS C CB  1 
ATOM   6192  C  CG  . LYS C 2 111 ? 35.92790  16.27185  0.57947   1.000 39.96436  ? 111 LYS C CG  1 
ATOM   6193  C  CD  . LYS C 2 111 ? 36.29173  15.57860  1.88852   1.000 40.07814  ? 111 LYS C CD  1 
ATOM   6194  C  CE  . LYS C 2 111 ? 35.06109  15.06830  2.63242   1.000 43.30503  ? 111 LYS C CE  1 
ATOM   6195  N  NZ  . LYS C 2 111 ? 34.15393  16.17038  3.06259   1.000 56.34757  ? 111 LYS C NZ  1 
ATOM   6196  N  N   . PHE C 2 112 ? 39.17941  17.44941  -2.44610  1.000 44.01912  ? 112 PHE C N   1 
ATOM   6197  C  CA  . PHE C 2 112 ? 40.44182  18.04453  -2.87494  1.000 42.98386  ? 112 PHE C CA  1 
ATOM   6198  C  C   . PHE C 2 112 ? 40.20853  19.11205  -3.93529  1.000 44.09823  ? 112 PHE C C   1 
ATOM   6199  O  O   . PHE C 2 112 ? 39.55315  18.85983  -4.95109  1.000 59.31081  ? 112 PHE C O   1 
ATOM   6200  C  CB  . PHE C 2 112 ? 41.37043  16.96940  -3.43708  1.000 41.44812  ? 112 PHE C CB  1 
ATOM   6201  C  CG  . PHE C 2 112 ? 41.96976  16.06925  -2.40202  1.000 42.44339  ? 112 PHE C CG  1 
ATOM   6202  C  CD1 . PHE C 2 112 ? 42.46477  16.58390  -1.21461  1.000 46.11278  ? 112 PHE C CD1 1 
ATOM   6203  C  CD2 . PHE C 2 112 ? 42.05569  14.70354  -2.62585  1.000 38.71873  ? 112 PHE C CD2 1 
ATOM   6204  C  CE1 . PHE C 2 112 ? 43.02569  15.75047  -0.26256  1.000 46.69103  ? 112 PHE C CE1 1 
ATOM   6205  C  CE2 . PHE C 2 112 ? 42.61644  13.86478  -1.67932  1.000 47.06653  ? 112 PHE C CE2 1 
ATOM   6206  C  CZ  . PHE C 2 112 ? 43.10359  14.38838  -0.49635  1.000 37.17723  ? 112 PHE C CZ  1 
ATOM   6207  N  N   . SER C 2 113 ? 40.77494  20.29881  -3.70797  1.000 47.56509  ? 113 SER C N   1 
ATOM   6208  C  CA  . SER C 2 113 ? 40.65555  21.42407  -4.63984  1.000 52.98021  ? 113 SER C CA  1 
ATOM   6209  C  C   . SER C 2 113 ? 39.19188  21.74124  -4.94844  1.000 60.11330  ? 113 SER C C   1 
ATOM   6210  O  O   . SER C 2 113 ? 38.83825  22.10914  -6.07224  1.000 55.87547  ? 113 SER C O   1 
ATOM   6211  C  CB  . SER C 2 113 ? 41.44707  21.16958  -5.92907  1.000 50.16917  ? 113 SER C CB  1 
ATOM   6212  O  OG  . SER C 2 113 ? 40.83057  20.18196  -6.73919  1.000 52.21420  ? 113 SER C OG  1 
ATOM   6213  N  N   . ASN C 2 114 ? 38.32764  21.57439  -3.94828  1.000 61.93974  ? 114 ASN C N   1 
ATOM   6214  C  CA  . ASN C 2 114 ? 36.92177  21.94556  -4.05395  1.000 54.40765  ? 114 ASN C CA  1 
ATOM   6215  C  C   . ASN C 2 114 ? 36.48205  22.60628  -2.75627  1.000 51.25110  ? 114 ASN C C   1 
ATOM   6216  O  O   . ASN C 2 114 ? 36.13120  23.79029  -2.74114  1.000 75.95228  ? 114 ASN C O   1 
ATOM   6217  C  CB  . ASN C 2 114 ? 36.05078  20.72551  -4.36900  1.000 58.01178  ? 114 ASN C CB  1 
ATOM   6218  C  CG  . ASN C 2 114 ? 34.57801  21.08057  -4.53954  1.000 58.61710  ? 114 ASN C CG  1 
ATOM   6219  O  OD1 . ASN C 2 114 ? 34.21825  22.24779  -4.68943  1.000 58.35203  ? 114 ASN C OD1 1 
ATOM   6220  N  ND2 . ASN C 2 114 ? 33.72091  20.06716  -4.52057  1.000 50.04928  ? 114 ASN C ND2 1 
ATOM   6221  N  N   . VAL C 2 115 ? 36.50928  21.85160  -1.65986  1.000 54.69110  ? 115 VAL C N   1 
ATOM   6222  C  CA  . VAL C 2 115 ? 36.17805  22.38721  -0.34337  1.000 58.85364  ? 115 VAL C CA  1 
ATOM   6223  C  C   . VAL C 2 115 ? 37.29971  22.05889  0.63113   1.000 50.62268  ? 115 VAL C C   1 
ATOM   6224  O  O   . VAL C 2 115 ? 37.13169  22.16984  1.85028   1.000 65.40921  ? 115 VAL C O   1 
ATOM   6225  C  CB  . VAL C 2 115 ? 34.83155  21.83852  0.16367   1.000 62.47915  ? 115 VAL C CB  1 
ATOM   6226  C  CG1 . VAL C 2 115 ? 33.70986  22.20623  -0.79887  1.000 59.65697  ? 115 VAL C CG1 1 
ATOM   6227  C  CG2 . VAL C 2 115 ? 34.91045  20.32843  0.35578   1.000 53.45133  ? 115 VAL C CG2 1 
ATOM   6228  N  N   . LYS C 2 116 ? 38.44898  21.64949  0.10280   1.000 53.86460  ? 116 LYS C N   1 
ATOM   6229  C  CA  . LYS C 2 116 ? 39.53572  21.15373  0.93274   1.000 52.55580  ? 116 LYS C CA  1 
ATOM   6230  C  C   . LYS C 2 116 ? 40.84820  21.36184  0.19537   1.000 52.67484  ? 116 LYS C C   1 
ATOM   6231  O  O   . LYS C 2 116 ? 40.89418  21.32236  -1.03815  1.000 54.28276  ? 116 LYS C O   1 
ATOM   6232  C  CB  . LYS C 2 116 ? 39.33366  19.67084  1.26711   1.000 53.09227  ? 116 LYS C CB  1 
ATOM   6233  C  CG  . LYS C 2 116 ? 40.39022  19.04707  2.15990   1.000 46.49313  ? 116 LYS C CG  1 
ATOM   6234  C  CD  . LYS C 2 116 ? 40.13163  17.55276  2.28954   1.000 44.04631  ? 116 LYS C CD  1 
ATOM   6235  C  CE  . LYS C 2 116 ? 40.90407  16.93968  3.44196   1.000 47.97994  ? 116 LYS C CE  1 
ATOM   6236  N  NZ  . LYS C 2 116 ? 40.54056  15.50655  3.62256   1.000 44.03750  ? 116 LYS C NZ  1 
ATOM   6237  N  N   . ASP C 2 117 ? 41.91226  21.59398  0.96014   1.000 51.55801  ? 117 ASP C N   1 
ATOM   6238  C  CA  . ASP C 2 117 ? 43.22540  21.78397  0.36021   1.000 53.09623  ? 117 ASP C CA  1 
ATOM   6239  C  C   . ASP C 2 117 ? 43.62117  20.53861  -0.42320  1.000 52.01645  ? 117 ASP C C   1 
ATOM   6240  O  O   . ASP C 2 117 ? 43.52674  19.41547  0.08204   1.000 44.95363  ? 117 ASP C O   1 
ATOM   6241  C  CB  . ASP C 2 117 ? 44.26468  22.09288  1.43954   1.000 49.21060  ? 117 ASP C CB  1 
ATOM   6242  C  CG  . ASP C 2 117 ? 44.20631  23.53723  1.91393   1.000 63.80938  ? 117 ASP C CG  1 
ATOM   6243  O  OD1 . ASP C 2 117 ? 43.82769  24.41329  1.10434   1.000 54.27465  ? 117 ASP C OD1 1 
ATOM   6244  O  OD2 . ASP C 2 117 ? 44.56061  23.80085  3.08579   1.000 55.44366  ? 117 ASP C OD2 1 
ATOM   6245  N  N   . GLY C 2 118 ? 44.05209  20.74549  -1.66713  1.000 49.05932  ? 118 GLY C N   1 
ATOM   6246  C  CA  . GLY C 2 118 ? 44.36989  19.66447  -2.57747  1.000 49.03912  ? 118 GLY C CA  1 
ATOM   6247  C  C   . GLY C 2 118 ? 45.69069  18.98150  -2.28400  1.000 43.34319  ? 118 GLY C C   1 
ATOM   6248  O  O   . GLY C 2 118 ? 46.24954  19.07713  -1.18889  1.000 39.88348  ? 118 GLY C O   1 
ATOM   6249  N  N   . VAL C 2 119 ? 46.19845  18.27809  -3.30072  1.000 42.66764  ? 119 VAL C N   1 
ATOM   6250  C  CA  . VAL C 2 119 ? 47.38638  17.44471  -3.15249  1.000 41.67582  ? 119 VAL C CA  1 
ATOM   6251  C  C   . VAL C 2 119 ? 48.65435  18.12665  -3.64672  1.000 44.83875  ? 119 VAL C C   1 
ATOM   6252  O  O   . VAL C 2 119 ? 49.74299  17.55154  -3.51210  1.000 43.10114  ? 119 VAL C O   1 
ATOM   6253  C  CB  . VAL C 2 119 ? 47.20865  16.09218  -3.87336  1.000 40.16838  ? 119 VAL C CB  1 
ATOM   6254  C  CG1 . VAL C 2 119 ? 46.00662  15.33522  -3.31509  1.000 40.00998  ? 119 VAL C CG1 1 
ATOM   6255  C  CG2 . VAL C 2 119 ? 47.06881  16.30072  -5.37242  1.000 35.07175  ? 119 VAL C CG2 1 
ATOM   6256  N  N   . PHE C 2 120 ? 48.55596  19.33238  -4.21223  1.000 43.57620  ? 120 PHE C N   1 
ATOM   6257  C  CA  . PHE C 2 120 ? 49.73288  20.05374  -4.70324  1.000 38.08835  ? 120 PHE C CA  1 
ATOM   6258  C  C   . PHE C 2 120 ? 50.43688  20.77515  -3.55060  1.000 49.03152  ? 120 PHE C C   1 
ATOM   6259  O  O   . PHE C 2 120 ? 50.65416  21.98687  -3.56400  1.000 53.22411  ? 120 PHE C O   1 
ATOM   6260  C  CB  . PHE C 2 120 ? 49.34225  21.03536  -5.80032  1.000 44.87724  ? 120 PHE C CB  1 
ATOM   6261  C  CG  . PHE C 2 120 ? 48.92758  20.38311  -7.08749  1.000 43.37189  ? 120 PHE C CG  1 
ATOM   6262  C  CD1 . PHE C 2 120 ? 49.18673  19.04283  -7.32086  1.000 42.47756  ? 120 PHE C CD1 1 
ATOM   6263  C  CD2 . PHE C 2 120 ? 48.28570  21.11961  -8.07145  1.000 36.45212  ? 120 PHE C CD2 1 
ATOM   6264  C  CE1 . PHE C 2 120 ? 48.81024  18.44843  -8.50967  1.000 34.17603  ? 120 PHE C CE1 1 
ATOM   6265  C  CE2 . PHE C 2 120 ? 47.90844  20.53257  -9.26136  1.000 37.52309  ? 120 PHE C CE2 1 
ATOM   6266  C  CZ  . PHE C 2 120 ? 48.16898  19.19426  -9.48099  1.000 38.54720  ? 120 PHE C CZ  1 
ATOM   6267  N  N   . GLY C 2 121 ? 50.81319  19.99025  -2.54262  1.000 51.25874  ? 121 GLY C N   1 
ATOM   6268  C  CA  . GLY C 2 121 ? 51.51074  20.51479  -1.38672  1.000 53.96240  ? 121 GLY C CA  1 
ATOM   6269  C  C   . GLY C 2 121 ? 52.42605  19.45879  -0.80878  1.000 59.53072  ? 121 GLY C C   1 
ATOM   6270  O  O   . GLY C 2 121 ? 52.37456  18.28689  -1.18630  1.000 49.66387  ? 121 GLY C O   1 
ATOM   6271  N  N   . GLU C 2 122 ? 53.28203  19.89485  0.11818   1.000 57.17151  ? 122 GLU C N   1 
ATOM   6272  C  CA  . GLU C 2 122 ? 54.22952  18.96984  0.72955   1.000 54.93357  ? 122 GLU C CA  1 
ATOM   6273  C  C   . GLU C 2 122 ? 53.51624  17.84760  1.47322   1.000 56.38950  ? 122 GLU C C   1 
ATOM   6274  O  O   . GLU C 2 122 ? 54.02451  16.72160  1.53803   1.000 55.06625  ? 122 GLU C O   1 
ATOM   6275  C  CB  . GLU C 2 122 ? 55.15003  19.74244  1.66945   1.000 51.69765  ? 122 GLU C CB  1 
ATOM   6276  C  CG  . GLU C 2 122 ? 56.07366  20.70026  0.94098   1.000 51.54919  ? 122 GLU C CG  1 
ATOM   6277  C  CD  . GLU C 2 122 ? 56.95445  21.49448  1.87903   1.000 70.37489  ? 122 GLU C CD  1 
ATOM   6278  O  OE1 . GLU C 2 122 ? 56.87193  21.28443  3.10843   1.000 77.53905  ? 122 GLU C OE1 1 
ATOM   6279  O  OE2 . GLU C 2 122 ? 57.73408  22.33205  1.38341   1.000 80.75941  ? 122 GLU C OE2 1 
ATOM   6280  N  N   . PHE C 2 123 ? 52.32569  18.12261  2.00094   1.000 52.41757  ? 123 PHE C N   1 
ATOM   6281  C  CA  . PHE C 2 123 ? 51.48883  17.11010  2.62576   1.000 50.17792  ? 123 PHE C CA  1 
ATOM   6282  C  C   . PHE C 2 123 ? 50.03411  17.44651  2.33873   1.000 52.83109  ? 123 PHE C C   1 
ATOM   6283  O  O   . PHE C 2 123 ? 49.69157  18.59162  2.03019   1.000 48.52463  ? 123 PHE C O   1 
ATOM   6284  C  CB  . PHE C 2 123 ? 51.71325  17.02377  4.14343   1.000 58.62837  ? 123 PHE C CB  1 
ATOM   6285  C  CG  . PHE C 2 123 ? 53.13750  16.73834  4.54487   1.000 60.86088  ? 123 PHE C CG  1 
ATOM   6286  C  CD1 . PHE C 2 123 ? 53.61322  15.43557  4.58521   1.000 57.33048  ? 123 PHE C CD1 1 
ATOM   6287  C  CD2 . PHE C 2 123 ? 53.98819  17.76894  4.91964   1.000 63.61538  ? 123 PHE C CD2 1 
ATOM   6288  C  CE1 . PHE C 2 123 ? 54.91775  15.16759  4.96646   1.000 50.95563  ? 123 PHE C CE1 1 
ATOM   6289  C  CE2 . PHE C 2 123 ? 55.29452  17.50719  5.30614   1.000 55.23127  ? 123 PHE C CE2 1 
ATOM   6290  C  CZ  . PHE C 2 123 ? 55.75862  16.20398  5.32869   1.000 59.31720  ? 123 PHE C CZ  1 
ATOM   6291  N  N   . PHE C 2 124 ? 49.17364  16.43759  2.44717   1.000 44.67089  ? 124 PHE C N   1 
ATOM   6292  C  CA  . PHE C 2 124 ? 47.74394  16.68866  2.35964   1.000 42.88483  ? 124 PHE C CA  1 
ATOM   6293  C  C   . PHE C 2 124 ? 47.01024  15.73504  3.28901   1.000 48.54695  ? 124 PHE C C   1 
ATOM   6294  O  O   . PHE C 2 124 ? 47.55599  14.72373  3.73939   1.000 49.82022  ? 124 PHE C O   1 
ATOM   6295  C  CB  . PHE C 2 124 ? 47.22115  16.56354  0.92334   1.000 48.46844  ? 124 PHE C CB  1 
ATOM   6296  C  CG  . PHE C 2 124 ? 47.51664  15.24147  0.27502   1.000 46.31615  ? 124 PHE C CG  1 
ATOM   6297  C  CD1 . PHE C 2 124 ? 46.62309  14.18816  0.38107   1.000 46.72461  ? 124 PHE C CD1 1 
ATOM   6298  C  CD2 . PHE C 2 124 ? 48.67740  15.05847  -0.45935  1.000 49.11419  ? 124 PHE C CD2 1 
ATOM   6299  C  CE1 . PHE C 2 124 ? 46.88723  12.97443  -0.22056  1.000 36.31081  ? 124 PHE C CE1 1 
ATOM   6300  C  CE2 . PHE C 2 124 ? 48.94589  13.84457  -1.06483  1.000 40.22866  ? 124 PHE C CE2 1 
ATOM   6301  C  CZ  . PHE C 2 124 ? 48.04861  12.80345  -0.94620  1.000 37.52166  ? 124 PHE C CZ  1 
ATOM   6302  N  N   . HIS C 2 125 ? 45.75516  16.07630  3.55989   1.000 49.06963  ? 125 HIS C N   1 
ATOM   6303  C  CA  . HIS C 2 125 ? 44.92320  15.38540  4.53459   1.000 48.60785  ? 125 HIS C CA  1 
ATOM   6304  C  C   . HIS C 2 125 ? 43.95674  14.45148  3.81795   1.000 53.20423  ? 125 HIS C C   1 
ATOM   6305  O  O   . HIS C 2 125 ? 43.30233  14.85445  2.85004   1.000 50.68780  ? 125 HIS C O   1 
ATOM   6306  C  CB  . HIS C 2 125 ? 44.14932  16.40395  5.37196   1.000 48.40884  ? 125 HIS C CB  1 
ATOM   6307  C  CG  . HIS C 2 125 ? 43.28271  15.79407  6.42728   1.000 55.25377  ? 125 HIS C CG  1 
ATOM   6308  N  ND1 . HIS C 2 125 ? 41.99308  15.37471  6.17966   1.000 54.89020  ? 125 HIS C ND1 1 
ATOM   6309  C  CD2 . HIS C 2 125 ? 43.50651  15.56753  7.74309   1.000 51.77576  ? 125 HIS C CD2 1 
ATOM   6310  C  CE1 . HIS C 2 125 ? 41.46686  14.89699  7.29306   1.000 54.35851  ? 125 HIS C CE1 1 
ATOM   6311  N  NE2 . HIS C 2 125 ? 42.36354  15.00503  8.25729   1.000 59.55723  ? 125 HIS C NE2 1 
ATOM   6312  N  N   . VAL C 2 126 ? 43.87754  13.20589  4.28043   1.000 54.52785  ? 126 VAL C N   1 
ATOM   6313  C  CA  . VAL C 2 126 ? 42.93666  12.22573  3.74363   1.000 49.12251  ? 126 VAL C CA  1 
ATOM   6314  C  C   . VAL C 2 126 ? 41.98582  11.82983  4.86359   1.000 49.91970  ? 126 VAL C C   1 
ATOM   6315  O  O   . VAL C 2 126 ? 42.40637  11.23694  5.86566   1.000 51.12462  ? 126 VAL C O   1 
ATOM   6316  C  CB  . VAL C 2 126 ? 43.64004  10.99202  3.16659   1.000 44.98366  ? 126 VAL C CB  1 
ATOM   6317  C  CG1 . VAL C 2 126 ? 42.60545  9.96381   2.74271   1.000 40.21352  ? 126 VAL C CG1 1 
ATOM   6318  C  CG2 . VAL C 2 126 ? 44.51557  11.38244  1.99068   1.000 44.07866  ? 126 VAL C CG2 1 
ATOM   6319  N  N   . ASN C 2 127 ? 40.70795  12.15899  4.69989   1.000 51.92880  ? 127 ASN C N   1 
ATOM   6320  C  CA  . ASN C 2 127 ? 39.70110  11.79444  5.68407   1.000 48.39143  ? 127 ASN C CA  1 
ATOM   6321  C  C   . ASN C 2 127 ? 39.31865  10.32959  5.53014   1.000 47.27803  ? 127 ASN C C   1 
ATOM   6322  O  O   . ASN C 2 127 ? 39.16520  9.82732   4.41256   1.000 48.04842  ? 127 ASN C O   1 
ATOM   6323  C  CB  . ASN C 2 127 ? 38.46295  12.67405  5.53003   1.000 53.61116  ? 127 ASN C CB  1 
ATOM   6324  C  CG  . ASN C 2 127 ? 37.87434  12.60354  4.13723   1.000 49.29299  ? 127 ASN C CG  1 
ATOM   6325  O  OD1 . ASN C 2 127 ? 38.49120  13.05182  3.16982   1.000 48.88879  ? 127 ASN C OD1 1 
ATOM   6326  N  ND2 . ASN C 2 127 ? 36.67706  12.03701  4.02485   1.000 46.55454  ? 127 ASN C ND2 1 
ATOM   6327  N  N   . ASP C 2 128 ? 39.15968  9.65026   6.66396   1.000 46.99367  ? 128 ASP C N   1 
ATOM   6328  C  CA  . ASP C 2 128 ? 38.75311  8.24613   6.71348   1.000 44.64315  ? 128 ASP C CA  1 
ATOM   6329  C  C   . ASP C 2 128 ? 39.67507  7.38193   5.84574   1.000 44.84878  ? 128 ASP C C   1 
ATOM   6330  O  O   . ASP C 2 128 ? 39.29915  6.87141   4.79109   1.000 49.81630  ? 128 ASP C O   1 
ATOM   6331  C  CB  . ASP C 2 128 ? 37.28651  8.10631   6.29572   1.000 50.51815  ? 128 ASP C CB  1 
ATOM   6332  C  CG  . ASP C 2 128 ? 36.61319  6.90276   6.92438   1.000 65.02780  ? 128 ASP C CG  1 
ATOM   6333  O  OD1 . ASP C 2 128 ? 37.32772  5.94761   7.29929   1.000 66.80484  ? 128 ASP C OD1 1 
ATOM   6334  O  OD2 . ASP C 2 128 ? 35.36881  6.91872   7.05315   1.000 54.71630  ? 128 ASP C OD2 1 
ATOM   6335  N  N   . ALA C 2 129 ? 40.90618  7.23070   6.34365   1.000 53.07115  ? 129 ALA C N   1 
ATOM   6336  C  CA  . ALA C 2 129 ? 41.95931  6.56142   5.58241   1.000 44.33504  ? 129 ALA C CA  1 
ATOM   6337  C  C   . ALA C 2 129 ? 41.57366  5.13210   5.21693   1.000 47.97825  ? 129 ALA C C   1 
ATOM   6338  O  O   . ALA C 2 129 ? 41.75325  4.70408   4.07041   1.000 50.10676  ? 129 ALA C O   1 
ATOM   6339  C  CB  . ALA C 2 129 ? 43.26418  6.57692   6.37831   1.000 51.37269  ? 129 ALA C CB  1 
ATOM   6340  N  N   . ASP C 2 130 ? 41.04612  4.37400   6.18246   1.000 50.48098  ? 130 ASP C N   1 
ATOM   6341  C  CA  . ASP C 2 130 ? 40.69153  2.98076   5.92959   1.000 50.64977  ? 130 ASP C CA  1 
ATOM   6342  C  C   . ASP C 2 130 ? 39.60428  2.83650   4.86988   1.000 52.05349  ? 130 ASP C C   1 
ATOM   6343  O  O   . ASP C 2 130 ? 39.48180  1.76595   4.26424   1.000 46.77169  ? 130 ASP C O   1 
ATOM   6344  C  CB  . ASP C 2 130 ? 40.24436  2.30852   7.22893   1.000 48.02808  ? 130 ASP C CB  1 
ATOM   6345  C  CG  . ASP C 2 130 ? 41.39728  2.03267   8.16907   1.000 57.22337  ? 130 ASP C CG  1 
ATOM   6346  O  OD1 . ASP C 2 130 ? 42.54722  1.96132   7.68809   1.000 65.64909  ? 130 ASP C OD1 1 
ATOM   6347  O  OD2 . ASP C 2 130 ? 41.15593  1.88192   9.38612   1.000 55.61318  ? 130 ASP C OD2 1 
ATOM   6348  N  N   . MET C 2 131 ? 38.82052  3.88615   4.62681   1.000 50.91068  ? 131 MET C N   1 
ATOM   6349  C  CA  . MET C 2 131 ? 37.75534  3.85449   3.63543   1.000 42.87610  ? 131 MET C CA  1 
ATOM   6350  C  C   . MET C 2 131 ? 38.10296  4.59513   2.35205   1.000 42.23872  ? 131 MET C C   1 
ATOM   6351  O  O   . MET C 2 131 ? 37.41983  4.39792   1.34118   1.000 43.96473  ? 131 MET C O   1 
ATOM   6352  C  CB  . MET C 2 131 ? 36.47437  4.45950   4.22154   1.000 45.23656  ? 131 MET C CB  1 
ATOM   6353  C  CG  . MET C 2 131 ? 35.87891  3.67640   5.37207   1.000 53.69095  ? 131 MET C CG  1 
ATOM   6354  S  SD  . MET C 2 131 ? 35.06293  2.18195   4.79621   1.000 55.04952  ? 131 MET C SD  1 
ATOM   6355  C  CE  . MET C 2 131 ? 33.56307  2.86528   4.08840   1.000 51.35283  ? 131 MET C CE  1 
ATOM   6356  N  N   . ASN C 2 132 ? 39.15097  5.42392   2.35713   1.000 35.87570  ? 132 ASN C N   1 
ATOM   6357  C  CA  . ASN C 2 132 ? 39.44343  6.29796   1.22662   1.000 43.18521  ? 132 ASN C CA  1 
ATOM   6358  C  C   . ASN C 2 132 ? 40.88002  6.16873   0.73064   1.000 47.74187  ? 132 ASN C C   1 
ATOM   6359  O  O   . ASN C 2 132 ? 41.36472  7.06146   0.02911   1.000 47.56814  ? 132 ASN C O   1 
ATOM   6360  C  CB  . ASN C 2 132 ? 39.15326  7.75527   1.59255   1.000 42.27231  ? 132 ASN C CB  1 
ATOM   6361  C  CG  . ASN C 2 132 ? 37.67400  8.07471   1.57951   1.000 44.31886  ? 132 ASN C CG  1 
ATOM   6362  O  OD1 . ASN C 2 132 ? 36.93168  7.59493   0.72229   1.000 40.59747  ? 132 ASN C OD1 1 
ATOM   6363  N  ND2 . ASN C 2 132 ? 37.23697  8.89146   2.53124   1.000 47.06208  ? 132 ASN C ND2 1 
ATOM   6364  N  N   . LEU C 2 133 ? 41.57005  5.08299   1.06661   1.000 46.11066  ? 133 LEU C N   1 
ATOM   6365  C  CA  . LEU C 2 133 ? 42.91436  4.83168   0.56929   1.000 36.63138  ? 133 LEU C CA  1 
ATOM   6366  C  C   . LEU C 2 133 ? 42.99443  3.39943   0.06883   1.000 43.72346  ? 133 LEU C C   1 
ATOM   6367  O  O   . LEU C 2 133 ? 42.28223  2.51786   0.55298   1.000 43.00388  ? 133 LEU C O   1 
ATOM   6368  C  CB  . LEU C 2 133 ? 43.98451  5.05943   1.64831   1.000 33.68965  ? 133 LEU C CB  1 
ATOM   6369  C  CG  . LEU C 2 133 ? 44.27328  6.48621   2.12394   1.000 47.64517  ? 133 LEU C CG  1 
ATOM   6370  C  CD1 . LEU C 2 133 ? 45.36037  6.48580   3.19551   1.000 45.71566  ? 133 LEU C CD1 1 
ATOM   6371  C  CD2 . LEU C 2 133 ? 44.66892  7.38426   0.96275   1.000 45.95831  ? 133 LEU C CD2 1 
ATOM   6372  N  N   . ALA C 2 134 ? 43.86742  3.17403   -0.90648  1.000 43.30638  ? 134 ALA C N   1 
ATOM   6373  C  CA  . ALA C 2 134 ? 44.11450  1.84159   -1.43259  1.000 40.41795  ? 134 ALA C CA  1 
ATOM   6374  C  C   . ALA C 2 134 ? 45.61254  1.61930   -1.55463  1.000 45.27240  ? 134 ALA C C   1 
ATOM   6375  O  O   . ALA C 2 134 ? 46.34766  2.51899   -1.97016  1.000 44.84331  ? 134 ALA C O   1 
ATOM   6376  C  CB  . ALA C 2 134 ? 43.44256  1.64624   -2.79190  1.000 42.25309  ? 134 ALA C CB  1 
ATOM   6377  N  N   . HIS C 2 135 ? 46.06144  0.42582   -1.17433  1.000 42.02693  ? 135 HIS C N   1 
ATOM   6378  C  CA  . HIS C 2 135 ? 47.47275  0.09205   -1.28693  1.000 45.46667  ? 135 HIS C CA  1 
ATOM   6379  C  C   . HIS C 2 135 ? 47.88749  0.01597   -2.74907  1.000 40.59141  ? 135 HIS C C   1 
ATOM   6380  O  O   . HIS C 2 135 ? 47.15127  -0.49573  -3.59563  1.000 49.44991  ? 135 HIS C O   1 
ATOM   6381  C  CB  . HIS C 2 135 ? 47.76798  -1.23665  -0.59446  1.000 54.29952  ? 135 HIS C CB  1 
ATOM   6382  C  CG  . HIS C 2 135 ? 47.65121  -1.18058  0.89469   1.000 48.28121  ? 135 HIS C CG  1 
ATOM   6383  N  ND1 . HIS C 2 135 ? 48.66981  -0.72294  1.70111   1.000 46.83763  ? 135 HIS C ND1 1 
ATOM   6384  C  CD2 . HIS C 2 135 ? 46.64148  -1.53132  1.72524   1.000 49.96542  ? 135 HIS C CD2 1 
ATOM   6385  C  CE1 . HIS C 2 135 ? 48.29034  -0.78742  2.96489   1.000 51.81495  ? 135 HIS C CE1 1 
ATOM   6386  N  NE2 . HIS C 2 135 ? 47.06364  -1.27540  3.00717   1.000 45.42121  ? 135 HIS C NE2 1 
ATOM   6387  N  N   . LEU C 2 136 ? 49.08471  0.51915   -3.04172  1.000 48.32998  ? 136 LEU C N   1 
ATOM   6388  C  CA  . LEU C 2 136 ? 49.60278  0.50130   -4.40005  1.000 49.61054  ? 136 LEU C CA  1 
ATOM   6389  C  C   . LEU C 2 136 ? 50.54225  -0.67915  -4.56450  1.000 49.31929  ? 136 LEU C C   1 
ATOM   6390  O  O   . LEU C 2 136 ? 51.56595  -0.74466  -3.86427  1.000 50.45802  ? 136 LEU C O   1 
ATOM   6391  C  CB  . LEU C 2 136 ? 50.33449  1.80020   -4.71389  1.000 46.25754  ? 136 LEU C CB  1 
ATOM   6392  C  CG  . LEU C 2 136 ? 51.05459  1.81675   -6.06139  1.000 43.79359  ? 136 LEU C CG  1 
ATOM   6393  C  CD1 . LEU C 2 136 ? 50.06139  1.67650   -7.20423  1.000 43.58296  ? 136 LEU C CD1 1 
ATOM   6394  C  CD2 . LEU C 2 136 ? 51.87753  3.08170   -6.20521  1.000 55.33068  ? 136 LEU C CD2 1 
ATOM   6395  N  N   . PRO C 2 137 ? 50.24632  -1.62565  -5.44936  1.000 47.07372  ? 137 PRO C N   1 
ATOM   6396  C  CA  . PRO C 2 137 ? 51.18045  -2.73062  -5.67954  1.000 46.69648  ? 137 PRO C CA  1 
ATOM   6397  C  C   . PRO C 2 137 ? 52.45796  -2.23095  -6.32798  1.000 49.15390  ? 137 PRO C C   1 
ATOM   6398  O  O   . PRO C 2 137 ? 52.44794  -1.29553  -7.13178  1.000 41.90359  ? 137 PRO C O   1 
ATOM   6399  C  CB  . PRO C 2 137 ? 50.41163  -3.66192  -6.62588  1.000 44.92386  ? 137 PRO C CB  1 
ATOM   6400  C  CG  . PRO C 2 137 ? 48.98257  -3.24003  -6.52186  1.000 50.27220  ? 137 PRO C CG  1 
ATOM   6401  C  CD  . PRO C 2 137 ? 49.01488  -1.76990  -6.23893  1.000 49.51557  ? 137 PRO C CD  1 
ATOM   6402  N  N   . LYS C 2 138 ? 53.57013  -2.87927  -5.97299  1.000 49.36860  ? 138 LYS C N   1 
ATOM   6403  C  CA  . LYS C 2 138 ? 54.85786  -2.53111  -6.56211  1.000 45.79138  ? 138 LYS C CA  1 
ATOM   6404  C  C   . LYS C 2 138 ? 54.87071  -2.73706  -8.07141  1.000 52.28443  ? 138 LYS C C   1 
ATOM   6405  O  O   . LYS C 2 138 ? 55.70448  -2.14117  -8.76180  1.000 49.54361  ? 138 LYS C O   1 
ATOM   6406  C  CB  . LYS C 2 138 ? 55.97439  -3.35927  -5.92491  1.000 56.66901  ? 138 LYS C CB  1 
ATOM   6407  C  CG  . LYS C 2 138 ? 55.76492  -4.86255  -6.03538  1.000 64.22353  ? 138 LYS C CG  1 
ATOM   6408  C  CD  . LYS C 2 138 ? 56.80064  -5.63456  -5.23146  1.000 72.66748  ? 138 LYS C CD  1 
ATOM   6409  C  CE  . LYS C 2 138 ? 56.52240  -7.12969  -5.26961  1.000 66.52298  ? 138 LYS C CE  1 
ATOM   6410  N  NZ  . LYS C 2 138 ? 57.51039  -7.88668  -4.45480  1.000 85.19927  ? 138 LYS C NZ  1 
ATOM   6411  N  N   . GLU C 2 139 ? 53.97518  -3.57846  -8.59426  1.000 47.29710  ? 139 GLU C N   1 
ATOM   6412  C  CA  . GLU C 2 139 ? 53.96548  -3.88736  -10.01834 1.000 52.82679  ? 139 GLU C CA  1 
ATOM   6413  C  C   . GLU C 2 139 ? 53.45715  -2.73210  -10.87349 1.000 48.92627  ? 139 GLU C C   1 
ATOM   6414  O  O   . GLU C 2 139 ? 53.65824  -2.75287  -12.09218 1.000 58.73544  ? 139 GLU C O   1 
ATOM   6415  C  CB  . GLU C 2 139 ? 53.10960  -5.13335  -10.27563 1.000 53.56401  ? 139 GLU C CB  1 
ATOM   6416  C  CG  . GLU C 2 139 ? 53.68340  -6.44158  -9.71455  1.000 55.76891  ? 139 GLU C CG  1 
ATOM   6417  C  CD  . GLU C 2 139 ? 53.37343  -6.66800  -8.23460  1.000 66.11081  ? 139 GLU C CD  1 
ATOM   6418  O  OE1 . GLU C 2 139 ? 52.80185  -5.76620  -7.58240  1.000 63.35053  ? 139 GLU C OE1 1 
ATOM   6419  O  OE2 . GLU C 2 139 ? 53.70192  -7.76115  -7.72292  1.000 68.47318  ? 139 GLU C OE2 1 
ATOM   6420  N  N   . ILE C 2 140 ? 52.80924  -1.73748  -10.27895 1.000 45.31098  ? 140 ILE C N   1 
ATOM   6421  C  CA  . ILE C 2 140 ? 52.23982  -0.60823  -11.01264 1.000 42.88225  ? 140 ILE C CA  1 
ATOM   6422  C  C   . ILE C 2 140 ? 53.16277  0.59312   -10.83574 1.000 44.81049  ? 140 ILE C C   1 
ATOM   6423  O  O   . ILE C 2 140 ? 53.37306  1.03218   -9.69456  1.000 50.15016  ? 140 ILE C O   1 
ATOM   6424  C  CB  . ILE C 2 140 ? 50.81786  -0.28135  -10.53578 1.000 41.21316  ? 140 ILE C CB  1 
ATOM   6425  C  CG1 . ILE C 2 140 ? 49.90380  -1.49734  -10.69492 1.000 39.68523  ? 140 ILE C CG1 1 
ATOM   6426  C  CG2 . ILE C 2 140 ? 50.25922  0.90717   -11.29982 1.000 44.68474  ? 140 ILE C CG2 1 
ATOM   6427  C  CD1 . ILE C 2 140 ? 48.45990  -1.22383  -10.31196 1.000 36.14081  ? 140 ILE C CD1 1 
ATOM   6428  N  N   . PRO C 2 141 ? 53.72313  1.14926   -11.90713 1.000 44.62034  ? 141 PRO C N   1 
ATOM   6429  C  CA  . PRO C 2 141 ? 54.58867  2.32573   -11.76433 1.000 39.12237  ? 141 PRO C CA  1 
ATOM   6430  C  C   . PRO C 2 141 ? 53.79078  3.57215   -11.40494 1.000 47.74812  ? 141 PRO C C   1 
ATOM   6431  O  O   . PRO C 2 141 ? 52.57447  3.64749   -11.59481 1.000 43.49037  ? 141 PRO C O   1 
ATOM   6432  C  CB  . PRO C 2 141 ? 55.23784  2.46259   -13.14494 1.000 43.51380  ? 141 PRO C CB  1 
ATOM   6433  C  CG  . PRO C 2 141 ? 54.28955  1.78485   -14.07844 1.000 44.62377  ? 141 PRO C CG  1 
ATOM   6434  C  CD  . PRO C 2 141 ? 53.63065  0.68399   -13.30155 1.000 43.79995  ? 141 PRO C CD  1 
ATOM   6435  N  N   . LEU C 2 142 ? 54.51116  4.57450   -10.88921 1.000 45.16971  ? 142 LEU C N   1 
ATOM   6436  C  CA  . LEU C 2 142 ? 53.85354  5.78290   -10.39379 1.000 44.20946  ? 142 LEU C CA  1 
ATOM   6437  C  C   . LEU C 2 142 ? 53.12556  6.52913   -11.50796 1.000 40.99694  ? 142 LEU C C   1 
ATOM   6438  O  O   . LEU C 2 142 ? 52.01354  7.02907   -11.30113 1.000 35.07179  ? 142 LEU C O   1 
ATOM   6439  C  CB  . LEU C 2 142 ? 54.87587  6.69860   -9.72025  1.000 42.02165  ? 142 LEU C CB  1 
ATOM   6440  C  CG  . LEU C 2 142 ? 55.49059  6.23745   -8.39512  1.000 44.82662  ? 142 LEU C CG  1 
ATOM   6441  C  CD1 . LEU C 2 142 ? 56.54679  7.22008   -7.92179  1.000 48.40824  ? 142 LEU C CD1 1 
ATOM   6442  C  CD2 . LEU C 2 142 ? 54.41159  6.07323   -7.33763  1.000 45.42913  ? 142 LEU C CD2 1 
ATOM   6443  N  N   . GLU C 2 143 ? 53.73185  6.61173   -12.69727 1.000 40.68830  ? 143 GLU C N   1 
ATOM   6444  C  CA  . GLU C 2 143 ? 53.10757  7.34520   -13.79640 1.000 34.16635  ? 143 GLU C CA  1 
ATOM   6445  C  C   . GLU C 2 143 ? 51.76283  6.74401   -14.16768 1.000 40.78044  ? 143 GLU C C   1 
ATOM   6446  O  O   . GLU C 2 143 ? 50.80667  7.47141   -14.46357 1.000 37.30880  ? 143 GLU C O   1 
ATOM   6447  C  CB  . GLU C 2 143 ? 54.02732  7.36193   -15.01693 1.000 40.54123  ? 143 GLU C CB  1 
ATOM   6448  C  CG  . GLU C 2 143 ? 55.32133  8.13387   -14.83155 1.000 47.24795  ? 143 GLU C CG  1 
ATOM   6449  C  CD  . GLU C 2 143 ? 56.40353  7.31599   -14.15384 1.000 48.76331  ? 143 GLU C CD  1 
ATOM   6450  O  OE1 . GLU C 2 143 ? 56.15022  6.13143   -13.84865 1.000 52.42156  ? 143 GLU C OE1 1 
ATOM   6451  O  OE2 . GLU C 2 143 ? 57.51055  7.85537   -13.93791 1.000 67.66489  ? 143 GLU C OE2 1 
ATOM   6452  N  N   . ALA C 2 144 ? 51.67341  5.41528   -14.17098 1.000 41.55727  ? 144 ALA C N   1 
ATOM   6453  C  CA  . ALA C 2 144 ? 50.41342  4.75631   -14.48051 1.000 40.15400  ? 144 ALA C CA  1 
ATOM   6454  C  C   . ALA C 2 144 ? 49.44126  4.84733   -13.31289 1.000 36.56875  ? 144 ALA C C   1 
ATOM   6455  O  O   . ALA C 2 144 ? 48.24778  5.09211   -13.51370 1.000 32.54582  ? 144 ALA C O   1 
ATOM   6456  C  CB  . ALA C 2 144 ? 50.66832  3.29683   -14.85102 1.000 29.18040  ? 144 ALA C CB  1 
ATOM   6457  N  N   . ALA C 2 145 ? 49.94385  4.69500   -12.08464 1.000 39.01927  ? 145 ALA C N   1 
ATOM   6458  C  CA  . ALA C 2 145 ? 49.06022  4.64338   -10.92524 1.000 33.37580  ? 145 ALA C CA  1 
ATOM   6459  C  C   . ALA C 2 145 ? 48.31776  5.95421   -10.71967 1.000 36.74032  ? 145 ALA C C   1 
ATOM   6460  O  O   . ALA C 2 145 ? 47.16681  5.94909   -10.27030 1.000 35.59294  ? 145 ALA C O   1 
ATOM   6461  C  CB  . ALA C 2 145 ? 49.86119  4.29224   -9.67166  1.000 39.06877  ? 145 ALA C CB  1 
ATOM   6462  N  N   . VAL C 2 146 ? 48.94897  7.08672   -11.04605 1.000 35.25642  ? 146 VAL C N   1 
ATOM   6463  C  CA  . VAL C 2 146 ? 48.31690  8.38564   -10.82193 1.000 37.85884  ? 146 VAL C CA  1 
ATOM   6464  C  C   . VAL C 2 146 ? 47.22775  8.67700   -11.84560 1.000 36.57655  ? 146 VAL C C   1 
ATOM   6465  O  O   . VAL C 2 146 ? 46.52316  9.68860   -11.72339 1.000 34.19901  ? 146 VAL C O   1 
ATOM   6466  C  CB  . VAL C 2 146 ? 49.42763  9.45921   -10.75808 1.000 36.98367  ? 146 VAL C CB  1 
ATOM   6467  C  CG1 . VAL C 2 146 ? 49.99519  9.76031   -12.13490 1.000 37.37477  ? 146 VAL C CG1 1 
ATOM   6468  C  CG2 . VAL C 2 146 ? 48.93856  10.72230  -10.05742 1.000 38.83085  ? 146 VAL C CG2 1 
ATOM   6469  N  N   . MET C 2 147 ? 47.03987  7.80356   -12.83798 1.000 30.52970  ? 147 MET C N   1 
ATOM   6470  C  CA  . MET C 2 147 ? 45.89609  7.91425   -13.73730 1.000 33.07209  ? 147 MET C CA  1 
ATOM   6471  C  C   . MET C 2 147 ? 44.63606  7.28978   -13.15642 1.000 30.81273  ? 147 MET C C   1 
ATOM   6472  O  O   . MET C 2 147 ? 43.53722  7.54743   -13.66087 1.000 28.19413  ? 147 MET C O   1 
ATOM   6473  C  CB  . MET C 2 147 ? 46.20905  7.25539   -15.08092 1.000 30.35890  ? 147 MET C CB  1 
ATOM   6474  C  CG  . MET C 2 147 ? 47.37613  7.88744   -15.82573 1.000 26.92549  ? 147 MET C CG  1 
ATOM   6475  S  SD  . MET C 2 147 ? 47.05027  9.60916   -16.24447 1.000 35.67830  ? 147 MET C SD  1 
ATOM   6476  C  CE  . MET C 2 147 ? 47.99180  10.47228  -14.98598 1.000 32.87201  ? 147 MET C CE  1 
ATOM   6477  N  N   . ILE C 2 148 ? 44.77240  6.48068   -12.11284 1.000 33.69600  ? 148 ILE C N   1 
ATOM   6478  C  CA  . ILE C 2 148 ? 43.64733  5.79941   -11.47800 1.000 30.81106  ? 148 ILE C CA  1 
ATOM   6479  C  C   . ILE C 2 148 ? 42.78346  6.74835   -10.64623 1.000 32.25543  ? 148 ILE C C   1 
ATOM   6480  O  O   . ILE C 2 148 ? 41.54956  6.66088   -10.73290 1.000 32.29898  ? 148 ILE C O   1 
ATOM   6481  C  CB  . ILE C 2 148 ? 44.14381  4.62496   -10.62122 1.000 26.68150  ? 148 ILE C CB  1 
ATOM   6482  C  CG1 . ILE C 2 148 ? 44.97294  3.66950   -11.47656 1.000 28.61634  ? 148 ILE C CG1 1 
ATOM   6483  C  CG2 . ILE C 2 148 ? 42.96663  3.88474   -10.01330 1.000 32.53405  ? 148 ILE C CG2 1 
ATOM   6484  C  CD1 . ILE C 2 148 ? 45.56242  2.50947   -10.70210 1.000 35.99434  ? 148 ILE C CD1 1 
ATOM   6485  N  N   . PRO C 2 149 ? 43.35242  7.65111   -9.82538  1.000 34.02990  ? 149 PRO C N   1 
ATOM   6486  C  CA  . PRO C 2 149 ? 42.50273  8.45269   -8.92447  1.000 30.48462  ? 149 PRO C CA  1 
ATOM   6487  C  C   . PRO C 2 149 ? 41.37128  9.20919   -9.59200  1.000 32.19576  ? 149 PRO C C   1 
ATOM   6488  O  O   . PRO C 2 149 ? 40.31903  9.39661   -8.96661  1.000 28.99951  ? 149 PRO C O   1 
ATOM   6489  C  CB  . PRO C 2 149 ? 43.50535  9.43141   -8.29559  1.000 30.20798  ? 149 PRO C CB  1 
ATOM   6490  C  CG  . PRO C 2 149 ? 44.76121  8.68326   -8.26458  1.000 34.61098  ? 149 PRO C CG  1 
ATOM   6491  C  CD  . PRO C 2 149 ? 44.78089  7.90881   -9.55382  1.000 36.69593  ? 149 PRO C CD  1 
ATOM   6492  N  N   . ASP C 2 150 ? 41.54006  9.63940   -10.84101 1.000 31.28016  ? 150 ASP C N   1 
ATOM   6493  C  CA  . ASP C 2 150 ? 40.57205  10.53800  -11.45403 1.000 25.84902  ? 150 ASP C CA  1 
ATOM   6494  C  C   . ASP C 2 150 ? 40.23798  10.12235  -12.88189 1.000 36.16684  ? 150 ASP C C   1 
ATOM   6495  O  O   . ASP C 2 150 ? 39.06973  9.88209   -13.20253 1.000 34.74615  ? 150 ASP C O   1 
ATOM   6496  C  CB  . ASP C 2 150 ? 41.11813  11.96779  -11.41332 1.000 34.28162  ? 150 ASP C CB  1 
ATOM   6497  C  CG  . ASP C 2 150 ? 40.08625  13.00605  -11.78943 1.000 40.74670  ? 150 ASP C CG  1 
ATOM   6498  O  OD1 . ASP C 2 150 ? 38.91255  12.63801  -11.98366 1.000 46.98129  ? 150 ASP C OD1 1 
ATOM   6499  O  OD2 . ASP C 2 150 ? 40.45207  14.19919  -11.87309 1.000 43.31222  ? 150 ASP C OD2 1 
ATOM   6500  N  N   . MET C 2 151 ? 41.25280  10.03291  -13.74484 1.000 33.40743  ? 151 MET C N   1 
ATOM   6501  C  CA  . MET C 2 151 ? 41.00429  9.78703   -15.16383 1.000 29.58238  ? 151 MET C CA  1 
ATOM   6502  C  C   . MET C 2 151 ? 40.34325  8.43253   -15.38954 1.000 30.27623  ? 151 MET C C   1 
ATOM   6503  O  O   . MET C 2 151 ? 39.33030  8.33059   -16.09329 1.000 27.39060  ? 151 MET C O   1 
ATOM   6504  C  CB  . MET C 2 151 ? 42.31489  9.88757   -15.94462 1.000 32.99505  ? 151 MET C CB  1 
ATOM   6505  C  CG  . MET C 2 151 ? 43.01978  11.23053  -15.78174 1.000 31.81819  ? 151 MET C CG  1 
ATOM   6506  S  SD  . MET C 2 151 ? 42.05623  12.59913  -16.46613 1.000 36.88808  ? 151 MET C SD  1 
ATOM   6507  C  CE  . MET C 2 151 ? 41.30021  13.30105  -14.99864 1.000 42.80464  ? 151 MET C CE  1 
ATOM   6508  N  N   . MET C 2 152 ? 40.90239  7.37656   -14.80086 1.000 24.91729  ? 152 MET C N   1 
ATOM   6509  C  CA  . MET C 2 152 ? 40.36810  6.04012   -15.03965 1.000 26.85097  ? 152 MET C CA  1 
ATOM   6510  C  C   . MET C 2 152 ? 38.98294  5.87475   -14.42206 1.000 32.50110  ? 152 MET C C   1 
ATOM   6511  O  O   . MET C 2 152 ? 38.07242  5.33083   -15.05826 1.000 28.22377  ? 152 MET C O   1 
ATOM   6512  C  CB  . MET C 2 152 ? 41.33240  4.98252   -14.50765 1.000 22.55763  ? 152 MET C CB  1 
ATOM   6513  C  CG  . MET C 2 152 ? 40.88411  3.57276   -14.81775 1.000 30.09150  ? 152 MET C CG  1 
ATOM   6514  S  SD  . MET C 2 152 ? 42.06448  2.31048   -14.32834 1.000 38.27373  ? 152 MET C SD  1 
ATOM   6515  C  CE  . MET C 2 152 ? 43.51217  2.84864   -15.21376 1.000 32.72798  ? 152 MET C CE  1 
ATOM   6516  N  N   . THR C 2 153 ? 38.80280  6.32189   -13.17541 1.000 28.34065  ? 153 THR C N   1 
ATOM   6517  C  CA  . THR C 2 153 ? 37.50511  6.14729   -12.52997 1.000 25.95206  ? 153 THR C CA  1 
ATOM   6518  C  C   . THR C 2 153 ? 36.41980  6.99332   -13.19015 1.000 25.85889  ? 153 THR C C   1 
ATOM   6519  O  O   . THR C 2 153 ? 35.26094  6.56644   -13.25275 1.000 29.47945  ? 153 THR C O   1 
ATOM   6520  C  CB  . THR C 2 153 ? 37.60420  6.46221   -11.03312 1.000 23.81509  ? 153 THR C CB  1 
ATOM   6521  O  OG1 . THR C 2 153 ? 36.31326  6.32292   -10.42230 1.000 28.39650  ? 153 THR C OG1 1 
ATOM   6522  C  CG2 . THR C 2 153 ? 38.12488  7.87031   -10.79995 1.000 26.98498  ? 153 THR C CG2 1 
ATOM   6523  N  N   . THR C 2 154 ? 36.76829  8.17456   -13.70532 1.000 27.12775  ? 154 THR C N   1 
ATOM   6524  C  CA  . THR C 2 154 ? 35.77866  8.99815   -14.39417 1.000 23.55609  ? 154 THR C CA  1 
ATOM   6525  C  C   . THR C 2 154 ? 35.40308  8.39383   -15.74016 1.000 25.34694  ? 154 THR C C   1 
ATOM   6526  O  O   . THR C 2 154 ? 34.21661  8.25354   -16.05944 1.000 26.51137  ? 154 THR C O   1 
ATOM   6527  C  CB  . THR C 2 154 ? 36.30002  10.42052  -14.58772 1.000 30.77673  ? 154 THR C CB  1 
ATOM   6528  O  OG1 . THR C 2 154 ? 36.67448  10.97001  -13.32031 1.000 29.64819  ? 154 THR C OG1 1 
ATOM   6529  C  CG2 . THR C 2 154 ? 35.22139  11.29149  -15.21936 1.000 26.33894  ? 154 THR C CG2 1 
ATOM   6530  N  N   . GLY C 2 155 ? 36.40360  8.06591   -16.55967 1.000 24.43589  ? 155 GLY C N   1 
ATOM   6531  C  CA  . GLY C 2 155 ? 36.11729  7.48906   -17.86167 1.000 25.15254  ? 155 GLY C CA  1 
ATOM   6532  C  C   . GLY C 2 155 ? 35.36556  6.17752   -17.76402 1.000 30.48673  ? 155 GLY C C   1 
ATOM   6533  O  O   . GLY C 2 155 ? 34.42644  5.92927   -18.52454 1.000 26.49990  ? 155 GLY C O   1 
ATOM   6534  N  N   . PHE C 2 156 ? 35.77524  5.31248   -16.83568 1.000 25.69108  ? 156 PHE C N   1 
ATOM   6535  C  CA  . PHE C 2 156 ? 35.05119  4.06386   -16.64067 1.000 25.73934  ? 156 PHE C CA  1 
ATOM   6536  C  C   . PHE C 2 156 ? 33.64192  4.32046   -16.13188 1.000 29.11588  ? 156 PHE C C   1 
ATOM   6537  O  O   . PHE C 2 156 ? 32.71985  3.56289   -16.45161 1.000 30.13205  ? 156 PHE C O   1 
ATOM   6538  C  CB  . PHE C 2 156 ? 35.80903  3.15616   -15.67242 1.000 20.97591  ? 156 PHE C CB  1 
ATOM   6539  C  CG  . PHE C 2 156 ? 37.06274  2.55716   -16.24804 1.000 23.18841  ? 156 PHE C CG  1 
ATOM   6540  C  CD1 . PHE C 2 156 ? 37.54240  2.95441   -17.48840 1.000 27.95570  ? 156 PHE C CD1 1 
ATOM   6541  C  CD2 . PHE C 2 156 ? 37.76126  1.59401   -15.54696 1.000 22.78245  ? 156 PHE C CD2 1 
ATOM   6542  C  CE1 . PHE C 2 156 ? 38.69514  2.39907   -18.01861 1.000 31.98929  ? 156 PHE C CE1 1 
ATOM   6543  C  CE2 . PHE C 2 156 ? 38.91704  1.03088   -16.07086 1.000 34.01676  ? 156 PHE C CE2 1 
ATOM   6544  C  CZ  . PHE C 2 156 ? 39.38395  1.43433   -17.30970 1.000 27.83299  ? 156 PHE C CZ  1 
ATOM   6545  N  N   . HIS C 2 157 ? 33.45091  5.38551   -15.35039 1.000 29.48563  ? 157 HIS C N   1 
ATOM   6546  C  CA  . HIS C 2 157 ? 32.11252  5.70591   -14.87213 1.000 23.87068  ? 157 HIS C CA  1 
ATOM   6547  C  C   . HIS C 2 157 ? 31.19761  6.09640   -16.02196 1.000 28.11971  ? 157 HIS C C   1 
ATOM   6548  O  O   . HIS C 2 157 ? 30.00735  5.76701   -16.01171 1.000 28.73597  ? 157 HIS C O   1 
ATOM   6549  C  CB  . HIS C 2 157 ? 32.17474  6.82212   -13.83438 1.000 26.50485  ? 157 HIS C CB  1 
ATOM   6550  C  CG  . HIS C 2 157 ? 30.90022  7.00319   -13.07182 1.000 27.47358  ? 157 HIS C CG  1 
ATOM   6551  N  ND1 . HIS C 2 157 ? 30.18975  5.94194   -12.55255 1.000 26.79560  ? 157 HIS C ND1 1 
ATOM   6552  C  CD2 . HIS C 2 157 ? 30.22287  8.12015   -12.71574 1.000 29.21089  ? 157 HIS C CD2 1 
ATOM   6553  C  CE1 . HIS C 2 157 ? 29.12236  6.39709   -11.92172 1.000 25.34277  ? 157 HIS C CE1 1 
ATOM   6554  N  NE2 . HIS C 2 157 ? 29.11897  7.71508   -12.00539 1.000 33.64024  ? 157 HIS C NE2 1 
ATOM   6555  N  N   . GLY C 2 158 ? 31.72862  6.80963   -17.01603 1.000 27.15387  ? 158 GLY C N   1 
ATOM   6556  C  CA  . GLY C 2 158 ? 30.92812  7.10990   -18.19007 1.000 27.05856  ? 158 GLY C CA  1 
ATOM   6557  C  C   . GLY C 2 158 ? 30.44247  5.85531   -18.88802 1.000 23.86776  ? 158 GLY C C   1 
ATOM   6558  O  O   . GLY C 2 158 ? 29.27972  5.76351   -19.28627 1.000 27.12068  ? 158 GLY C O   1 
ATOM   6559  N  N   . ALA C 2 159 ? 31.32012  4.86165   -19.02256 1.000 27.13312  ? 159 ALA C N   1 
ATOM   6560  C  CA  . ALA C 2 159 ? 30.91127  3.59602   -19.62220 1.000 22.46167  ? 159 ALA C CA  1 
ATOM   6561  C  C   . ALA C 2 159 ? 29.90450  2.86221   -18.74250 1.000 28.20597  ? 159 ALA C C   1 
ATOM   6562  O  O   . ALA C 2 159 ? 28.96224  2.24268   -19.25246 1.000 31.15529  ? 159 ALA C O   1 
ATOM   6563  C  CB  . ALA C 2 159 ? 32.14058  2.72983   -19.88089 1.000 19.62762  ? 159 ALA C CB  1 
ATOM   6564  N  N   . GLU C 2 160 ? 30.08156  2.92319   -17.41940 1.000 27.87109  ? 160 GLU C N   1 
ATOM   6565  C  CA  . GLU C 2 160 ? 29.12319  2.29454   -16.51460 1.000 24.77831  ? 160 GLU C CA  1 
ATOM   6566  C  C   . GLU C 2 160 ? 27.75340  2.94740   -16.63211 1.000 25.69434  ? 160 GLU C C   1 
ATOM   6567  O  O   . GLU C 2 160 ? 26.72828  2.25678   -16.68357 1.000 32.95853  ? 160 GLU C O   1 
ATOM   6568  C  CB  . GLU C 2 160 ? 29.62424  2.38086   -15.07242 1.000 31.22667  ? 160 GLU C CB  1 
ATOM   6569  C  CG  . GLU C 2 160 ? 30.88067  1.57411   -14.78647 1.000 31.87394  ? 160 GLU C CG  1 
ATOM   6570  C  CD  . GLU C 2 160 ? 31.47935  1.89180   -13.42228 1.000 38.90793  ? 160 GLU C CD  1 
ATOM   6571  O  OE1 . GLU C 2 160 ? 31.35278  3.04784   -12.96399 1.000 36.22199  ? 160 GLU C OE1 1 
ATOM   6572  O  OE2 . GLU C 2 160 ? 32.07394  0.98348   -12.80355 1.000 41.49385  ? 160 GLU C OE2 1 
ATOM   6573  N  N   . LEU C 2 161 ? 27.71619  4.28267   -16.67183 1.000 27.15186  ? 161 LEU C N   1 
ATOM   6574  C  CA  . LEU C 2 161 ? 26.44545  4.98527   -16.79566 1.000 22.10685  ? 161 LEU C CA  1 
ATOM   6575  C  C   . LEU C 2 161 ? 25.77187  4.70150   -18.13144 1.000 27.05900  ? 161 LEU C C   1 
ATOM   6576  O  O   . LEU C 2 161 ? 24.54289  4.76698   -18.22959 1.000 27.54457  ? 161 LEU C O   1 
ATOM   6577  C  CB  . LEU C 2 161 ? 26.65986  6.49187   -16.62713 1.000 25.22276  ? 161 LEU C CB  1 
ATOM   6578  C  CG  . LEU C 2 161 ? 27.07697  6.99157   -15.24265 1.000 26.55270  ? 161 LEU C CG  1 
ATOM   6579  C  CD1 . LEU C 2 161 ? 27.41453  8.47502   -15.28250 1.000 26.38588  ? 161 LEU C CD1 1 
ATOM   6580  C  CD2 . LEU C 2 161 ? 25.98033  6.72725   -14.23383 1.000 23.42400  ? 161 LEU C CD2 1 
ATOM   6581  N  N   . ALA C 2 162 ? 26.54967  4.36844   -19.16065 1.000 28.89776  ? 162 ALA C N   1 
ATOM   6582  C  CA  . ALA C 2 162 ? 26.00904  4.23222   -20.50666 1.000 28.97465  ? 162 ALA C CA  1 
ATOM   6583  C  C   . ALA C 2 162 ? 25.07882  3.03429   -20.66995 1.000 29.52913  ? 162 ALA C C   1 
ATOM   6584  O  O   . ALA C 2 162 ? 24.38153  2.96121   -21.68567 1.000 31.83295  ? 162 ALA C O   1 
ATOM   6585  C  CB  . ALA C 2 162 ? 27.15655  4.14395   -21.51714 1.000 23.52276  ? 162 ALA C CB  1 
ATOM   6586  N  N   . ASP C 2 163 ? 25.05363  2.10080   -19.71944 1.000 30.76063  ? 163 ASP C N   1 
ATOM   6587  C  CA  . ASP C 2 163 ? 24.20796  0.90654   -19.79468 1.000 40.01737  ? 163 ASP C CA  1 
ATOM   6588  C  C   . ASP C 2 163 ? 24.45306  0.14667   -21.09562 1.000 38.52325  ? 163 ASP C C   1 
ATOM   6589  O  O   . ASP C 2 163 ? 23.53827  -0.11987  -21.87630 1.000 46.13801  ? 163 ASP C O   1 
ATOM   6590  C  CB  . ASP C 2 163 ? 22.72299  1.26061   -19.66523 1.000 45.63416  ? 163 ASP C CB  1 
ATOM   6591  C  CG  . ASP C 2 163 ? 22.35132  1.72914   -18.28170 1.000 56.84054  ? 163 ASP C CG  1 
ATOM   6592  O  OD1 . ASP C 2 163 ? 23.04945  1.34719   -17.31816 1.000 70.20785  ? 163 ASP C OD1 1 
ATOM   6593  O  OD2 . ASP C 2 163 ? 21.35049  2.47107   -18.16024 1.000 63.02821  ? 163 ASP C OD2 1 
ATOM   6594  N  N   . ILE C 2 164 ? 25.71182  -0.21444  -21.30717 1.000 37.90734  ? 164 ILE C N   1 
ATOM   6595  C  CA  . ILE C 2 164 ? 26.13025  -0.85329  -22.55022 1.000 33.45864  ? 164 ILE C CA  1 
ATOM   6596  C  C   . ILE C 2 164 ? 25.79440  -2.33796  -22.50745 1.000 33.59332  ? 164 ILE C C   1 
ATOM   6597  O  O   . ILE C 2 164 ? 26.14592  -3.04247  -21.55292 1.000 36.78848  ? 164 ILE C O   1 
ATOM   6598  C  CB  . ILE C 2 164 ? 27.63208  -0.63242  -22.78376 1.000 29.22138  ? 164 ILE C CB  1 
ATOM   6599  C  CG1 . ILE C 2 164 ? 27.92338  0.86175   -22.92752 1.000 34.74324  ? 164 ILE C CG1 1 
ATOM   6600  C  CG2 . ILE C 2 164 ? 28.12187  -1.41924  -23.99204 1.000 25.69007  ? 164 ILE C CG2 1 
ATOM   6601  C  CD1 . ILE C 2 164 ? 29.39623  1.20803   -22.89408 1.000 25.34997  ? 164 ILE C CD1 1 
ATOM   6602  N  N   . GLU C 2 165 ? 25.10127  -2.81308  -23.53503 1.000 31.10282  ? 165 GLU C N   1 
ATOM   6603  C  CA  A GLU C 2 165 ? 24.87663  -4.23727  -23.73198 0.531 33.09943  ? 165 GLU C CA  1 
ATOM   6604  C  CA  B GLU C 2 165 ? 24.89090  -4.23887  -23.71482 0.469 33.87949  ? 165 GLU C CA  1 
ATOM   6605  C  C   . GLU C 2 165 ? 25.97676  -4.81784  -24.61743 1.000 32.99826  ? 165 GLU C C   1 
ATOM   6606  O  O   . GLU C 2 165 ? 26.62626  -4.10478  -25.38804 1.000 30.99004  ? 165 GLU C O   1 
ATOM   6607  C  CB  A GLU C 2 165 ? 23.50356  -4.49413  -24.36019 0.531 37.49408  ? 165 GLU C CB  1 
ATOM   6608  C  CB  B GLU C 2 165 ? 23.50190  -4.50755  -24.29334 0.469 37.41729  ? 165 GLU C CB  1 
ATOM   6609  C  CG  A GLU C 2 165 ? 22.31242  -4.16013  -23.46105 0.531 44.09088  ? 165 GLU C CG  1 
ATOM   6610  C  CG  B GLU C 2 165 ? 22.38698  -4.34271  -23.26862 0.469 44.21611  ? 165 GLU C CG  1 
ATOM   6611  C  CD  A GLU C 2 165 ? 21.89737  -5.31538  -22.55738 0.531 47.51788  ? 165 GLU C CD  1 
ATOM   6612  C  CD  B GLU C 2 165 ? 21.17610  -3.62058  -23.82132 0.469 41.04043  ? 165 GLU C CD  1 
ATOM   6613  O  OE1 A GLU C 2 165 ? 22.00948  -6.48641  -22.98288 0.531 42.82369  ? 165 GLU C OE1 1 
ATOM   6614  O  OE1 B GLU C 2 165 ? 21.04774  -3.53352  -25.06029 0.469 43.11151  ? 165 GLU C OE1 1 
ATOM   6615  O  OE2 A GLU C 2 165 ? 21.45433  -5.04943  -21.41866 0.531 44.14821  ? 165 GLU C OE2 1 
ATOM   6616  O  OE2 B GLU C 2 165 ? 20.35617  -3.13177  -23.01357 0.469 44.39160  ? 165 GLU C OE2 1 
ATOM   6617  N  N   . LEU C 2 166 ? 26.17899  -6.13038  -24.49798 1.000 31.41287  ? 166 LEU C N   1 
ATOM   6618  C  CA  . LEU C 2 166 ? 27.22984  -6.80654  -25.25349 1.000 29.14254  ? 166 LEU C CA  1 
ATOM   6619  C  C   . LEU C 2 166 ? 27.04297  -6.59546  -26.75049 1.000 31.04011  ? 166 LEU C C   1 
ATOM   6620  O  O   . LEU C 2 166 ? 25.97225  -6.86577  -27.30168 1.000 32.40214  ? 166 LEU C O   1 
ATOM   6621  C  CB  . LEU C 2 166 ? 27.23157  -8.30105  -24.93476 1.000 30.52620  ? 166 LEU C CB  1 
ATOM   6622  C  CG  . LEU C 2 166 ? 27.76052  -8.73172  -23.56848 1.000 33.99549  ? 166 LEU C CG  1 
ATOM   6623  C  CD1 . LEU C 2 166 ? 27.74117  -10.24215 -23.47458 1.000 34.00348  ? 166 LEU C CD1 1 
ATOM   6624  C  CD2 . LEU C 2 166 ? 29.16211  -8.20565  -23.33575 1.000 38.10446  ? 166 LEU C CD2 1 
ATOM   6625  N  N   . GLY C 2 167 ? 28.08849  -6.09695  -27.40481 1.000 32.25850  ? 167 GLY C N   1 
ATOM   6626  C  CA  . GLY C 2 167 ? 28.05132  -5.84869  -28.82821 1.000 23.71139  ? 167 GLY C CA  1 
ATOM   6627  C  C   . GLY C 2 167 ? 27.46426  -4.51950  -29.24062 1.000 28.35029  ? 167 GLY C C   1 
ATOM   6628  O  O   . GLY C 2 167 ? 27.39364  -4.24597  -30.44659 1.000 30.26606  ? 167 GLY C O   1 
ATOM   6629  N  N   . ALA C 2 168 ? 27.05799  -3.67773  -28.29019 1.000 33.69253  ? 168 ALA C N   1 
ATOM   6630  C  CA  . ALA C 2 168 ? 26.42953  -2.40897  -28.62525 1.000 24.00280  ? 168 ALA C CA  1 
ATOM   6631  C  C   . ALA C 2 168 ? 27.43671  -1.45057  -29.24799 1.000 27.33370  ? 168 ALA C C   1 
ATOM   6632  O  O   . ALA C 2 168 ? 28.64936  -1.56055  -29.04969 1.000 30.99666  ? 168 ALA C O   1 
ATOM   6633  C  CB  . ALA C 2 168 ? 25.80687  -1.76619  -27.38694 1.000 33.08790  ? 168 ALA C CB  1 
ATOM   6634  N  N   . THR C 2 169 ? 26.90855  -0.49352  -30.00876 1.000 32.97923  ? 169 THR C N   1 
ATOM   6635  C  CA  . THR C 2 169 ? 27.71062  0.53895   -30.65131 1.000 28.90939  ? 169 THR C CA  1 
ATOM   6636  C  C   . THR C 2 169 ? 27.74224  1.76864   -29.75356 1.000 31.44618  ? 169 THR C C   1 
ATOM   6637  O  O   . THR C 2 169 ? 26.69066  2.31022   -29.39315 1.000 33.12045  ? 169 THR C O   1 
ATOM   6638  C  CB  . THR C 2 169 ? 27.13211  0.89785   -32.02004 1.000 30.48727  ? 169 THR C CB  1 
ATOM   6639  O  OG1 . THR C 2 169 ? 27.20338  -0.24037  -32.88697 1.000 40.02604  ? 169 THR C OG1 1 
ATOM   6640  C  CG2 . THR C 2 169 ? 27.90910  2.04869   -32.64088 1.000 36.12839  ? 169 THR C CG2 1 
ATOM   6641  N  N   . VAL C 2 170 ? 28.94012  2.21598   -29.40183 1.000 25.93029  ? 170 VAL C N   1 
ATOM   6642  C  CA  . VAL C 2 170 ? 29.11576  3.29745   -28.44377 1.000 31.02997  ? 170 VAL C CA  1 
ATOM   6643  C  C   . VAL C 2 170 ? 29.90089  4.41114   -29.11440 1.000 30.13606  ? 170 VAL C C   1 
ATOM   6644  O  O   . VAL C 2 170 ? 30.91122  4.15214   -29.77864 1.000 31.17491  ? 170 VAL C O   1 
ATOM   6645  C  CB  . VAL C 2 170 ? 29.82965  2.81323   -27.16824 1.000 30.22613  ? 170 VAL C CB  1 
ATOM   6646  C  CG1 . VAL C 2 170 ? 30.04259  3.97079   -26.20564 1.000 29.19233  ? 170 VAL C CG1 1 
ATOM   6647  C  CG2 . VAL C 2 170 ? 29.02882  1.71364   -26.50911 1.000 24.89205  ? 170 VAL C CG2 1 
ATOM   6648  N  N   . ALA C 2 171 ? 29.43267  5.64311   -28.94422 1.000 27.82061  ? 171 ALA C N   1 
ATOM   6649  C  CA  . ALA C 2 171 ? 30.15659  6.83206   -29.36008 1.000 27.83419  ? 171 ALA C CA  1 
ATOM   6650  C  C   . ALA C 2 171 ? 30.73037  7.51753   -28.12912 1.000 29.49842  ? 171 ALA C C   1 
ATOM   6651  O  O   . ALA C 2 171 ? 30.06238  7.60543   -27.09338 1.000 30.57041  ? 171 ALA C O   1 
ATOM   6652  C  CB  . ALA C 2 171 ? 29.24553  7.80042   -30.11968 1.000 23.96343  ? 171 ALA C CB  1 
ATOM   6653  N  N   . VAL C 2 172 ? 31.97874  7.96913   -28.23347 1.000 26.81618  ? 172 VAL C N   1 
ATOM   6654  C  CA  . VAL C 2 172 ? 32.64806  8.70972   -27.16917 1.000 24.14795  ? 172 VAL C CA  1 
ATOM   6655  C  C   . VAL C 2 172 ? 32.96604  10.09530  -27.71011 1.000 28.65150  ? 172 VAL C C   1 
ATOM   6656  O  O   . VAL C 2 172 ? 33.84640  10.24877  -28.56760 1.000 32.90239  ? 172 VAL C O   1 
ATOM   6657  C  CB  . VAL C 2 172 ? 33.91989  8.00580   -26.67801 1.000 26.90425  ? 172 VAL C CB  1 
ATOM   6658  C  CG1 . VAL C 2 172 ? 34.57443  8.81683   -25.56989 1.000 23.25312  ? 172 VAL C CG1 1 
ATOM   6659  C  CG2 . VAL C 2 172 ? 33.59971  6.59886   -26.18849 1.000 28.42354  ? 172 VAL C CG2 1 
ATOM   6660  N  N   . LEU C 2 173 ? 32.27534  11.10774  -27.19395 1.000 28.37297  ? 173 LEU C N   1 
ATOM   6661  C  CA  . LEU C 2 173 ? 32.42856  12.48038  -27.67265 1.000 27.57982  ? 173 LEU C CA  1 
ATOM   6662  C  C   . LEU C 2 173 ? 33.51334  13.15263  -26.84477 1.000 34.98023  ? 173 LEU C C   1 
ATOM   6663  O  O   . LEU C 2 173 ? 33.28867  13.52163  -25.68957 1.000 33.87965  ? 173 LEU C O   1 
ATOM   6664  C  CB  . LEU C 2 173 ? 31.10728  13.23247  -27.57717 1.000 21.14444  ? 173 LEU C CB  1 
ATOM   6665  C  CG  . LEU C 2 173 ? 29.92170  12.53833  -28.24429 1.000 33.43894  ? 173 LEU C CG  1 
ATOM   6666  C  CD1 . LEU C 2 173 ? 28.65751  13.35144  -28.07524 1.000 26.68734  ? 173 LEU C CD1 1 
ATOM   6667  C  CD2 . LEU C 2 173 ? 30.20816  12.29994  -29.71501 1.000 32.88741  ? 173 LEU C CD2 1 
ATOM   6668  N  N   . GLY C 2 174 ? 34.69236  13.32177  -27.44104 1.000 31.86261  ? 174 GLY C N   1 
ATOM   6669  C  CA  . GLY C 2 174 ? 35.83044  13.88826  -26.74375 1.000 36.73727  ? 174 GLY C CA  1 
ATOM   6670  C  C   . GLY C 2 174 ? 36.80826  12.82346  -26.29912 1.000 39.85428  ? 174 GLY C C   1 
ATOM   6671  O  O   . GLY C 2 174 ? 36.42315  11.88301  -25.59836 1.000 38.23818  ? 174 GLY C O   1 
ATOM   6672  N  N   . ILE C 2 175 ? 38.07108  12.94216  -26.71213 1.000 35.19630  ? 175 ILE C N   1 
ATOM   6673  C  CA  . ILE C 2 175 ? 39.07150  11.94101  -26.36216 1.000 36.85884  ? 175 ILE C CA  1 
ATOM   6674  C  C   . ILE C 2 175 ? 40.27211  12.57991  -25.67505 1.000 41.50699  ? 175 ILE C C   1 
ATOM   6675  O  O   . ILE C 2 175 ? 41.42632  12.27808  -26.00078 1.000 35.44816  ? 175 ILE C O   1 
ATOM   6676  C  CB  . ILE C 2 175 ? 39.49628  11.12765  -27.59749 1.000 31.73615  ? 175 ILE C CB  1 
ATOM   6677  C  CG1 . ILE C 2 175 ? 39.80169  12.04981  -28.77800 1.000 36.53906  ? 175 ILE C CG1 1 
ATOM   6678  C  CG2 . ILE C 2 175 ? 38.40615  10.13360  -27.96709 1.000 37.14733  ? 175 ILE C CG2 1 
ATOM   6679  C  CD1 . ILE C 2 175 ? 40.33449  11.31611  -29.98197 1.000 32.91223  ? 175 ILE C CD1 1 
ATOM   6680  N  N   . GLY C 2 176 ? 40.00905  13.45285  -24.70564 1.000 41.21126  ? 176 GLY C N   1 
ATOM   6681  C  CA  . GLY C 2 176 ? 41.01269  13.82155  -23.73744 1.000 36.31915  ? 176 GLY C CA  1 
ATOM   6682  C  C   . GLY C 2 176 ? 41.25479  12.63722  -22.82346 1.000 30.37602  ? 176 GLY C C   1 
ATOM   6683  O  O   . GLY C 2 176 ? 40.71872  11.54864  -23.04692 1.000 34.39367  ? 176 GLY C O   1 
ATOM   6684  N  N   . PRO C 2 177 ? 42.04998  12.81922  -21.76768 1.000 36.57037  ? 177 PRO C N   1 
ATOM   6685  C  CA  . PRO C 2 177 ? 42.32693  11.68404  -20.86801 1.000 27.92270  ? 177 PRO C CA  1 
ATOM   6686  C  C   . PRO C 2 177 ? 41.07267  10.99814  -20.33437 1.000 33.79879  ? 177 PRO C C   1 
ATOM   6687  O  O   . PRO C 2 177 ? 41.04992  9.76608   -20.23995 1.000 27.33485  ? 177 PRO C O   1 
ATOM   6688  C  CB  . PRO C 2 177 ? 43.16551  12.32179  -19.74933 1.000 32.00083  ? 177 PRO C CB  1 
ATOM   6689  C  CG  . PRO C 2 177 ? 42.97344  13.80645  -19.89176 1.000 39.87025  ? 177 PRO C CG  1 
ATOM   6690  C  CD  . PRO C 2 177 ? 42.74589  14.04508  -21.34652 1.000 34.60798  ? 177 PRO C CD  1 
ATOM   6691  N  N   . VAL C 2 178 ? 40.02697  11.75213  -19.98916 1.000 30.24120  ? 178 VAL C N   1 
ATOM   6692  C  CA  . VAL C 2 178 ? 38.78416  11.13298  -19.53185 1.000 26.22901  ? 178 VAL C CA  1 
ATOM   6693  C  C   . VAL C 2 178 ? 38.11547  10.36965  -20.66759 1.000 27.17679  ? 178 VAL C C   1 
ATOM   6694  O  O   . VAL C 2 178 ? 37.65603  9.23571   -20.48804 1.000 30.02780  ? 178 VAL C O   1 
ATOM   6695  C  CB  . VAL C 2 178 ? 37.83818  12.18977  -18.93872 1.000 31.75065  ? 178 VAL C CB  1 
ATOM   6696  C  CG1 . VAL C 2 178 ? 36.45637  11.58642  -18.70247 1.000 28.84576  ? 178 VAL C CG1 1 
ATOM   6697  C  CG2 . VAL C 2 178 ? 38.41183  12.75108  -17.64975 1.000 36.07956  ? 178 VAL C CG2 1 
ATOM   6698  N  N   . GLY C 2 179 ? 38.04860  10.97874  -21.85361 1.000 30.79367  ? 179 GLY C N   1 
ATOM   6699  C  CA  . GLY C 2 179 ? 37.41546  10.30994  -22.98163 1.000 28.98939  ? 179 GLY C CA  1 
ATOM   6700  C  C   . GLY C 2 179 ? 38.14503  9.05329   -23.41302 1.000 29.26193  ? 179 GLY C C   1 
ATOM   6701  O  O   . GLY C 2 179 ? 37.52115  8.07719   -23.83402 1.000 30.28059  ? 179 GLY C O   1 
ATOM   6702  N  N   . LEU C 2 180 ? 39.47695  9.06373   -23.32539 1.000 32.52395  ? 180 LEU C N   1 
ATOM   6703  C  CA  . LEU C 2 180 ? 40.25323  7.87601   -23.66797 1.000 28.06505  ? 180 LEU C CA  1 
ATOM   6704  C  C   . LEU C 2 180 ? 39.95053  6.72973   -22.71402 1.000 27.84554  ? 180 LEU C C   1 
ATOM   6705  O  O   . LEU C 2 180 ? 39.89951  5.56506   -23.12561 1.000 27.73492  ? 180 LEU C O   1 
ATOM   6706  C  CB  . LEU C 2 180 ? 41.74697  8.20921   -23.65928 1.000 30.79853  ? 180 LEU C CB  1 
ATOM   6707  C  CG  . LEU C 2 180 ? 42.17414  9.19694   -24.74979 1.000 27.79002  ? 180 LEU C CG  1 
ATOM   6708  C  CD1 . LEU C 2 180 ? 43.61311  9.63585   -24.59435 1.000 29.17576  ? 180 LEU C CD1 1 
ATOM   6709  C  CD2 . LEU C 2 180 ? 41.96005  8.56337   -26.10999 1.000 30.93599  ? 180 LEU C CD2 1 
ATOM   6710  N  N   . MET C 2 181 ? 39.73974  7.04100   -21.43335 1.000 30.49840  ? 181 MET C N   1 
ATOM   6711  C  CA  . MET C 2 181 ? 39.33732  6.01256   -20.48315 1.000 23.61913  ? 181 MET C CA  1 
ATOM   6712  C  C   . MET C 2 181 ? 37.88631  5.60334   -20.68375 1.000 24.49302  ? 181 MET C C   1 
ATOM   6713  O  O   . MET C 2 181 ? 37.51076  4.47628   -20.34086 1.000 31.23272  ? 181 MET C O   1 
ATOM   6714  C  CB  . MET C 2 181 ? 39.57781  6.50104   -19.05584 1.000 29.04426  ? 181 MET C CB  1 
ATOM   6715  C  CG  . MET C 2 181 ? 41.04994  6.55425   -18.65785 1.000 38.37315  ? 181 MET C CG  1 
ATOM   6716  S  SD  . MET C 2 181 ? 41.82326  4.92753   -18.52143 1.000 32.32231  ? 181 MET C SD  1 
ATOM   6717  C  CE  . MET C 2 181 ? 42.61479  4.70932   -20.11425 1.000 20.96374  ? 181 MET C CE  1 
ATOM   6718  N  N   . ALA C 2 182 ? 37.05496  6.49239   -21.23170 1.000 25.13555  ? 182 ALA C N   1 
ATOM   6719  C  CA  . ALA C 2 182 ? 35.70666  6.08098   -21.61032 1.000 25.09527  ? 182 ALA C CA  1 
ATOM   6720  C  C   . ALA C 2 182 ? 35.75162  5.08291   -22.75787 1.000 26.30817  ? 182 ALA C C   1 
ATOM   6721  O  O   . ALA C 2 182 ? 34.93153  4.15812   -22.81774 1.000 30.61359  ? 182 ALA C O   1 
ATOM   6722  C  CB  . ALA C 2 182 ? 34.85889  7.29648   -21.98349 1.000 20.21714  ? 182 ALA C CB  1 
ATOM   6723  N  N   . VAL C 2 183 ? 36.69887  5.26167   -23.68430 1.000 29.52438  ? 183 VAL C N   1 
ATOM   6724  C  CA  . VAL C 2 183 ? 36.90344  4.28026   -24.74725 1.000 25.01301  ? 183 VAL C CA  1 
ATOM   6725  C  C   . VAL C 2 183 ? 37.31684  2.94169   -24.15200 1.000 23.99955  ? 183 VAL C C   1 
ATOM   6726  O  O   . VAL C 2 183 ? 36.75861  1.89107   -24.48943 1.000 28.24477  ? 183 VAL C O   1 
ATOM   6727  C  CB  . VAL C 2 183 ? 37.94921  4.79344   -25.75491 1.000 35.88208  ? 183 VAL C CB  1 
ATOM   6728  C  CG1 . VAL C 2 183 ? 38.36490  3.68250   -26.72116 1.000 21.83927  ? 183 VAL C CG1 1 
ATOM   6729  C  CG2 . VAL C 2 183 ? 37.40670  5.99817   -26.51127 1.000 24.58749  ? 183 VAL C CG2 1 
ATOM   6730  N  N   . ALA C 2 184 ? 38.29717  2.96188   -23.24566 1.000 25.57917  ? 184 ALA C N   1 
ATOM   6731  C  CA  . ALA C 2 184 ? 38.71670  1.72905   -22.58990 1.000 24.66449  ? 184 ALA C CA  1 
ATOM   6732  C  C   . ALA C 2 184 ? 37.59573  1.14773   -21.74201 1.000 24.14477  ? 184 ALA C C   1 
ATOM   6733  O  O   . ALA C 2 184 ? 37.40894  -0.07400  -21.69960 1.000 33.28263  ? 184 ALA C O   1 
ATOM   6734  C  CB  . ALA C 2 184 ? 39.95325  1.98323   -21.73268 1.000 21.88983  ? 184 ALA C CB  1 
ATOM   6735  N  N   . GLY C 2 185 ? 36.83794  2.00561   -21.05851 1.000 23.47080  ? 185 GLY C N   1 
ATOM   6736  C  CA  . GLY C 2 185 ? 35.72473  1.51228   -20.26252 1.000 24.24183  ? 185 GLY C CA  1 
ATOM   6737  C  C   . GLY C 2 185 ? 34.64594  0.86643   -21.10770 1.000 27.42685  ? 185 GLY C C   1 
ATOM   6738  O  O   . GLY C 2 185 ? 34.07201  -0.15688  -20.72615 1.000 28.49449  ? 185 GLY C O   1 
ATOM   6739  N  N   . ALA C 2 186 ? 34.34142  1.46376   -22.26129 1.000 28.66473  ? 186 ALA C N   1 
ATOM   6740  C  CA  . ALA C 2 186 ? 33.34966  0.86911   -23.15131 1.000 27.05609  ? 186 ALA C CA  1 
ATOM   6741  C  C   . ALA C 2 186 ? 33.80655  -0.49633  -23.64366 1.000 25.89510  ? 186 ALA C C   1 
ATOM   6742  O  O   . ALA C 2 186 ? 33.00288  -1.43170  -23.74045 1.000 31.36610  ? 186 ALA C O   1 
ATOM   6743  C  CB  . ALA C 2 186 ? 33.06963  1.80153   -24.32844 1.000 25.11714  ? 186 ALA C CB  1 
ATOM   6744  N  N   . LYS C 2 187 ? 35.09393  -0.62887  -23.96950 1.000 29.17970  ? 187 LYS C N   1 
ATOM   6745  C  CA  . LYS C 2 187 ? 35.62943  -1.93683  -24.33290 1.000 36.06021  ? 187 LYS C CA  1 
ATOM   6746  C  C   . LYS C 2 187 ? 35.49059  -2.91485  -23.17404 1.000 30.61575  ? 187 LYS C C   1 
ATOM   6747  O  O   . LYS C 2 187 ? 35.20123  -4.09896  -23.38097 1.000 33.84111  ? 187 LYS C O   1 
ATOM   6748  C  CB  . LYS C 2 187 ? 37.09417  -1.79504  -24.75608 1.000 27.05534  ? 187 LYS C CB  1 
ATOM   6749  C  CG  . LYS C 2 187 ? 37.76584  -3.07081  -25.25398 1.000 32.83339  ? 187 LYS C CG  1 
ATOM   6750  C  CD  . LYS C 2 187 ? 39.23942  -2.80769  -25.56096 1.000 30.98043  ? 187 LYS C CD  1 
ATOM   6751  C  CE  . LYS C 2 187 ? 39.95894  -4.05360  -26.05680 1.000 46.25644  ? 187 LYS C CE  1 
ATOM   6752  N  NZ  . LYS C 2 187 ? 39.94698  -5.15137  -25.04962 1.000 55.59558  ? 187 LYS C NZ  1 
ATOM   6753  N  N   . LEU C 2 188 ? 35.67306  -2.42765  -21.94243 1.000 33.68295  ? 188 LEU C N   1 
ATOM   6754  C  CA  . LEU C 2 188 ? 35.52296  -3.25204  -20.74867 1.000 28.85998  ? 188 LEU C CA  1 
ATOM   6755  C  C   . LEU C 2 188 ? 34.06926  -3.55282  -20.41802 1.000 35.81946  ? 188 LEU C C   1 
ATOM   6756  O  O   . LEU C 2 188 ? 33.81389  -4.29468  -19.46785 1.000 47.61071  ? 188 LEU C O   1 
ATOM   6757  C  CB  . LEU C 2 188 ? 36.18071  -2.57774  -19.54480 1.000 25.95200  ? 188 LEU C CB  1 
ATOM   6758  C  CG  . LEU C 2 188 ? 37.70769  -2.50371  -19.48039 1.000 32.60346  ? 188 LEU C CG  1 
ATOM   6759  C  CD1 . LEU C 2 188 ? 38.11276  -1.70770  -18.25440 1.000 29.70908  ? 188 LEU C CD1 1 
ATOM   6760  C  CD2 . LEU C 2 188 ? 38.32287  -3.87868  -19.44141 1.000 31.40817  ? 188 LEU C CD2 1 
ATOM   6761  N  N   . ARG C 2 189 ? 33.11146  -2.97369  -21.13539 1.000 33.01700  ? 189 ARG C N   1 
ATOM   6762  C  CA  A ARG C 2 189 ? 31.70694  -3.32216  -20.96182 0.566 32.23598  ? 189 ARG C CA  1 
ATOM   6763  C  CA  B ARG C 2 189 ? 31.70363  -3.30742  -20.97167 0.434 32.57521  ? 189 ARG C CA  1 
ATOM   6764  C  C   . ARG C 2 189 ? 31.16746  -4.12035  -22.14159 1.000 33.07559  ? 189 ARG C C   1 
ATOM   6765  O  O   . ARG C 2 189 ? 29.94818  -4.29044  -22.26279 1.000 33.43557  ? 189 ARG C O   1 
ATOM   6766  C  CB  A ARG C 2 189 ? 30.86518  -2.06474  -20.73534 0.566 33.49706  ? 189 ARG C CB  1 
ATOM   6767  C  CB  B ARG C 2 189 ? 30.87529  -2.03624  -20.77839 0.434 34.32469  ? 189 ARG C CB  1 
ATOM   6768  C  CG  A ARG C 2 189 ? 31.25854  -1.26382  -19.49832 0.566 33.17416  ? 189 ARG C CG  1 
ATOM   6769  C  CG  B ARG C 2 189 ? 30.91155  -1.50171  -19.35820 0.434 33.69870  ? 189 ARG C CG  1 
ATOM   6770  C  CD  A ARG C 2 189 ? 30.42431  -1.62352  -18.27060 0.566 32.89040  ? 189 ARG C CD  1 
ATOM   6771  C  CD  B ARG C 2 189 ? 30.18256  -2.44460  -18.41792 0.434 33.66507  ? 189 ARG C CD  1 
ATOM   6772  N  NE  A ARG C 2 189 ? 30.80858  -2.88968  -17.65600 0.566 32.21942  ? 189 ARG C NE  1 
ATOM   6773  N  NE  B ARG C 2 189 ? 28.75562  -2.48599  -18.71323 0.434 35.37457  ? 189 ARG C NE  1 
ATOM   6774  C  CZ  A ARG C 2 189 ? 30.38864  -3.29610  -16.46408 0.566 34.99870  ? 189 ARG C CZ  1 
ATOM   6775  C  CZ  B ARG C 2 189 ? 27.90250  -3.35355  -18.18747 0.434 34.57180  ? 189 ARG C CZ  1 
ATOM   6776  N  NH1 A ARG C 2 189 ? 29.58106  -2.55273  -15.72517 0.566 33.89952  ? 189 ARG C NH1 1 
ATOM   6777  N  NH1 B ARG C 2 189 ? 28.30121  -4.28858  -17.34009 0.434 33.66252  ? 189 ARG C NH1 1 
ATOM   6778  N  NH2 A ARG C 2 189 ? 30.79052  -4.47603  -16.00024 0.566 27.22525  ? 189 ARG C NH2 1 
ATOM   6779  N  NH2 B ARG C 2 189 ? 26.61726  -3.28255  -18.52303 0.434 29.47760  ? 189 ARG C NH2 1 
ATOM   6780  N  N   . GLY C 2 190 ? 32.04925  -4.62189  -23.00465 1.000 34.35380  ? 190 GLY C N   1 
ATOM   6781  C  CA  . GLY C 2 190 ? 31.64383  -5.46820  -24.10662 1.000 32.34995  ? 190 GLY C CA  1 
ATOM   6782  C  C   . GLY C 2 190 ? 31.13742  -4.73777  -25.32313 1.000 31.42079  ? 190 GLY C C   1 
ATOM   6783  O  O   . GLY C 2 190 ? 30.44338  -5.34143  -26.14617 1.000 30.38699  ? 190 GLY C O   1 
ATOM   6784  N  N   . ALA C 2 191 ? 31.47950  -3.46408  -25.47989 1.000 27.57554  ? 191 ALA C N   1 
ATOM   6785  C  CA  . ALA C 2 191 ? 31.06022  -2.73259  -26.66259 1.000 29.78046  ? 191 ALA C CA  1 
ATOM   6786  C  C   . ALA C 2 191 ? 31.70981  -3.32957  -27.90307 1.000 30.02794  ? 191 ALA C C   1 
ATOM   6787  O  O   . ALA C 2 191 ? 32.82864  -3.84710  -27.85857 1.000 32.72175  ? 191 ALA C O   1 
ATOM   6788  C  CB  . ALA C 2 191 ? 31.42075  -1.25102  -26.54146 1.000 25.01104  ? 191 ALA C CB  1 
ATOM   6789  N  N   . GLY C 2 192 ? 30.96918  -3.30744  -29.00428 1.000 28.29840  ? 192 GLY C N   1 
ATOM   6790  C  CA  . GLY C 2 192 ? 31.52725  -3.71180  -30.27592 1.000 32.35997  ? 192 GLY C CA  1 
ATOM   6791  C  C   . GLY C 2 192 ? 32.19866  -2.53852  -30.95527 1.000 31.45193  ? 192 GLY C C   1 
ATOM   6792  O  O   . GLY C 2 192 ? 33.38579  -2.27873  -30.74567 1.000 33.85820  ? 192 GLY C O   1 
ATOM   6793  N  N   . ARG C 2 193 ? 31.43434  -1.81019  -31.75976 1.000 29.00096  ? 193 ARG C N   1 
ATOM   6794  C  CA  . ARG C 2 193 ? 31.95469  -0.62847  -32.42983 1.000 31.78910  ? 193 ARG C CA  1 
ATOM   6795  C  C   . ARG C 2 193 ? 32.08693  0.52262   -31.43970 1.000 33.79815  ? 193 ARG C C   1 
ATOM   6796  O  O   . ARG C 2 193 ? 31.15010  0.82426   -30.69444 1.000 33.70492  ? 193 ARG C O   1 
ATOM   6797  C  CB  . ARG C 2 193 ? 31.03129  -0.24366  -33.58451 1.000 32.71113  ? 193 ARG C CB  1 
ATOM   6798  C  CG  . ARG C 2 193 ? 31.60460  0.77280   -34.54989 1.000 36.21029  ? 193 ARG C CG  1 
ATOM   6799  C  CD  . ARG C 2 193 ? 30.66845  0.97768   -35.73153 1.000 33.55953  ? 193 ARG C CD  1 
ATOM   6800  N  NE  . ARG C 2 193 ? 31.32830  1.68493   -36.82116 1.000 33.89678  ? 193 ARG C NE  1 
ATOM   6801  C  CZ  . ARG C 2 193 ? 30.75962  1.97085   -37.98433 1.000 39.95997  ? 193 ARG C CZ  1 
ATOM   6802  N  NH1 . ARG C 2 193 ? 29.51033  1.62170   -38.24883 1.000 38.16997  ? 193 ARG C NH1 1 
ATOM   6803  N  NH2 . ARG C 2 193 ? 31.46107  2.62645   -38.90420 1.000 43.21885  ? 193 ARG C NH2 1 
ATOM   6804  N  N   . ILE C 2 194 ? 33.25176  1.16407   -31.42542 1.000 26.50598  ? 194 ILE C N   1 
ATOM   6805  C  CA  . ILE C 2 194 ? 33.48829  2.34053   -30.59744 1.000 32.51732  ? 194 ILE C CA  1 
ATOM   6806  C  C   . ILE C 2 194 ? 33.91254  3.47253   -31.52324 1.000 25.43734  ? 194 ILE C C   1 
ATOM   6807  O  O   . ILE C 2 194 ? 34.98150  3.41337   -32.14432 1.000 33.45737  ? 194 ILE C O   1 
ATOM   6808  C  CB  . ILE C 2 194 ? 34.54172  2.09065   -29.50995 1.000 35.41155  ? 194 ILE C CB  1 
ATOM   6809  C  CG1 . ILE C 2 194 ? 34.10472  0.94553   -28.59578 1.000 30.28892  ? 194 ILE C CG1 1 
ATOM   6810  C  CG2 . ILE C 2 194 ? 34.75923  3.35433   -28.68661 1.000 25.58695  ? 194 ILE C CG2 1 
ATOM   6811  C  CD1 . ILE C 2 194 ? 35.12459  0.61472   -27.52674 1.000 26.62603  ? 194 ILE C CD1 1 
ATOM   6812  N  N   . ILE C 2 195 ? 33.08343  4.50646   -31.60637 1.000 31.51035  ? 195 ILE C N   1 
ATOM   6813  C  CA  . ILE C 2 195 ? 33.33387  5.66223   -32.45608 1.000 25.87717  ? 195 ILE C CA  1 
ATOM   6814  C  C   . ILE C 2 195 ? 33.86486  6.77976   -31.56872 1.000 29.58063  ? 195 ILE C C   1 
ATOM   6815  O  O   . ILE C 2 195 ? 33.16139  7.25163   -30.66634 1.000 32.59043  ? 195 ILE C O   1 
ATOM   6816  C  CB  . ILE C 2 195 ? 32.05616  6.09749   -33.19048 1.000 32.68972  ? 195 ILE C CB  1 
ATOM   6817  C  CG1 . ILE C 2 195 ? 31.46055  4.92145   -33.97233 1.000 27.93430  ? 195 ILE C CG1 1 
ATOM   6818  C  CG2 . ILE C 2 195 ? 32.33304  7.29610   -34.09477 1.000 31.01362  ? 195 ILE C CG2 1 
ATOM   6819  C  CD1 . ILE C 2 195 ? 30.14605  5.24182   -34.64063 1.000 29.86885  ? 195 ILE C CD1 1 
ATOM   6820  N  N   . ALA C 2 196 ? 35.10056  7.20632   -31.81420 1.000 32.51712  ? 196 ALA C N   1 
ATOM   6821  C  CA  . ALA C 2 196 ? 35.73285  8.25064   -31.01691 1.000 24.26590  ? 196 ALA C CA  1 
ATOM   6822  C  C   . ALA C 2 196 ? 35.72553  9.56140   -31.78807 1.000 34.79734  ? 196 ALA C C   1 
ATOM   6823  O  O   . ALA C 2 196 ? 36.07094  9.59336   -32.97399 1.000 34.43266  ? 196 ALA C O   1 
ATOM   6824  C  CB  . ALA C 2 196 ? 37.16529  7.86618   -30.64791 1.000 30.67639  ? 196 ALA C CB  1 
ATOM   6825  N  N   . VAL C 2 197 ? 35.34422  10.63997  -31.11302 1.000 31.12986  ? 197 VAL C N   1 
ATOM   6826  C  CA  . VAL C 2 197 ? 35.24638  11.95558  -31.73088 1.000 40.83111  ? 197 VAL C CA  1 
ATOM   6827  C  C   . VAL C 2 197 ? 36.35298  12.82630  -31.15494 1.000 39.77608  ? 197 VAL C C   1 
ATOM   6828  O  O   . VAL C 2 197 ? 36.36907  13.11779  -29.95326 1.000 40.32904  ? 197 VAL C O   1 
ATOM   6829  C  CB  . VAL C 2 197 ? 33.86631  12.58532  -31.51825 1.000 37.83867  ? 197 VAL C CB  1 
ATOM   6830  C  CG1 . VAL C 2 197 ? 33.82915  13.97499  -32.13016 1.000 46.79996  ? 197 VAL C CG1 1 
ATOM   6831  C  CG2 . VAL C 2 197 ? 32.79586  11.69605  -32.13659 1.000 35.86551  ? 197 VAL C CG2 1 
ATOM   6832  N  N   . GLY C 2 198 ? 37.29013  13.22296  -32.00711 1.000 39.61505  ? 198 GLY C N   1 
ATOM   6833  C  CA  . GLY C 2 198 ? 38.39856  14.06232  -31.58916 1.000 44.47814  ? 198 GLY C CA  1 
ATOM   6834  C  C   . GLY C 2 198 ? 39.22410  14.44940  -32.79304 1.000 50.76656  ? 198 GLY C C   1 
ATOM   6835  O  O   . GLY C 2 198 ? 39.02794  13.93702  -33.89795 1.000 57.05466  ? 198 GLY C O   1 
ATOM   6836  N  N   . SER C 2 199 ? 40.16124  15.35198  -32.56276 1.000 54.27784  ? 199 SER C N   1 
ATOM   6837  C  CA  . SER C 2 199 ? 40.96706  15.86972  -33.66348 1.000 58.59664  ? 199 SER C CA  1 
ATOM   6838  C  C   . SER C 2 199 ? 42.46180  15.74060  -33.41813 1.000 52.03512  ? 199 SER C C   1 
ATOM   6839  O  O   . SER C 2 199 ? 43.21477  15.52262  -34.37095 1.000 53.42056  ? 199 SER C O   1 
ATOM   6840  C  CB  . SER C 2 199 ? 40.61564  17.34222  -33.93163 1.000 57.93838  ? 199 SER C CB  1 
ATOM   6841  O  OG  . SER C 2 199 ? 40.76972  18.13035  -32.76303 1.000 65.07377  ? 199 SER C OG  1 
ATOM   6842  N  N   . ARG C 2 200 ? 42.90663  15.87575  -32.17366 1.000 47.17300  ? 200 ARG C N   1 
ATOM   6843  C  CA  . ARG C 2 200 ? 44.33367  15.87593  -31.87310 1.000 48.50446  ? 200 ARG C CA  1 
ATOM   6844  C  C   . ARG C 2 200 ? 44.95178  14.51781  -32.19349 1.000 46.67924  ? 200 ARG C C   1 
ATOM   6845  O  O   . ARG C 2 200 ? 44.45790  13.48716  -31.71697 1.000 42.48261  ? 200 ARG C O   1 
ATOM   6846  C  CB  . ARG C 2 200 ? 44.54702  16.23641  -30.40494 1.000 51.05091  ? 200 ARG C CB  1 
ATOM   6847  C  CG  . ARG C 2 200 ? 44.46552  17.72974  -30.12666 1.000 55.70210  ? 200 ARG C CG  1 
ATOM   6848  C  CD  . ARG C 2 200 ? 44.83881  18.04464  -28.69006 1.000 57.36100  ? 200 ARG C CD  1 
ATOM   6849  N  NE  . ARG C 2 200 ? 43.86339  17.50329  -27.74964 1.000 52.82669  ? 200 ARG C NE  1 
ATOM   6850  C  CZ  . ARG C 2 200 ? 44.05704  17.40829  -26.44114 1.000 61.75458  ? 200 ARG C CZ  1 
ATOM   6851  N  NH1 . ARG C 2 200 ? 45.19317  17.79130  -25.88221 1.000 71.03145  ? 200 ARG C NH1 1 
ATOM   6852  N  NH2 . ARG C 2 200 ? 43.08074  16.93127  -25.67234 1.000 62.12157  ? 200 ARG C NH2 1 
ATOM   6853  N  N   . PRO C 2 201 ? 46.02279  14.47276  -32.99345 1.000 51.17820  ? 201 PRO C N   1 
ATOM   6854  C  CA  . PRO C 2 201 ? 46.58063  13.16904  -33.39886 1.000 46.86227  ? 201 PRO C CA  1 
ATOM   6855  C  C   . PRO C 2 201 ? 47.08195  12.33042  -32.23864 1.000 43.84209  ? 201 PRO C C   1 
ATOM   6856  O  O   . PRO C 2 201 ? 46.93965  11.10083  -32.25965 1.000 43.71656  ? 201 PRO C O   1 
ATOM   6857  C  CB  . PRO C 2 201 ? 47.72252  13.56311  -34.34472 1.000 45.79075  ? 201 PRO C CB  1 
ATOM   6858  C  CG  . PRO C 2 201 ? 47.34233  14.91496  -34.84945 1.000 47.44767  ? 201 PRO C CG  1 
ATOM   6859  C  CD  . PRO C 2 201 ? 46.67107  15.59259  -33.69407 1.000 48.79721  ? 201 PRO C CD  1 
ATOM   6860  N  N   . VAL C 2 202 ? 47.66984  12.95953  -31.22055 1.000 41.30512  ? 202 VAL C N   1 
ATOM   6861  C  CA  . VAL C 2 202 ? 48.15489  12.18565  -30.08535 1.000 41.37609  ? 202 VAL C CA  1 
ATOM   6862  C  C   . VAL C 2 202 ? 46.98422  11.54509  -29.35200 1.000 44.52009  ? 202 VAL C C   1 
ATOM   6863  O  O   . VAL C 2 202 ? 47.11895  10.45403  -28.78406 1.000 40.85866  ? 202 VAL C O   1 
ATOM   6864  C  CB  . VAL C 2 202 ? 49.01352  13.07379  -29.16250 1.000 42.37961  ? 202 VAL C CB  1 
ATOM   6865  C  CG1 . VAL C 2 202 ? 48.15133  14.09022  -28.41770 1.000 49.05091  ? 202 VAL C CG1 1 
ATOM   6866  C  CG2 . VAL C 2 202 ? 49.82736  12.22674  -28.20113 1.000 51.62291  ? 202 VAL C CG2 1 
ATOM   6867  N  N   . CYS C 2 203 ? 45.81222  12.18790  -29.37736 1.000 49.10741  ? 203 CYS C N   1 
ATOM   6868  C  CA  . CYS C 2 203 ? 44.62503  11.60361  -28.76546 1.000 41.65278  ? 203 CYS C CA  1 
ATOM   6869  C  C   . CYS C 2 203 ? 44.00839  10.54519  -29.66497 1.000 35.81912  ? 203 CYS C C   1 
ATOM   6870  O  O   . CYS C 2 203 ? 43.55685  9.50195   -29.17883 1.000 35.79292  ? 203 CYS C O   1 
ATOM   6871  C  CB  . CYS C 2 203 ? 43.59431  12.68977  -28.45898 1.000 38.57192  ? 203 CYS C CB  1 
ATOM   6872  S  SG  . CYS C 2 203 ? 44.13390  13.93365  -27.26575 1.000 42.17624  ? 203 CYS C SG  1 
ATOM   6873  N  N   . VAL C 2 204 ? 43.99405  10.79488  -30.97705 1.000 35.03741  ? 204 VAL C N   1 
ATOM   6874  C  CA  . VAL C 2 204 ? 43.46207  9.81538   -31.92127 1.000 41.58121  ? 204 VAL C CA  1 
ATOM   6875  C  C   . VAL C 2 204 ? 44.26664  8.52516   -31.85153 1.000 39.10206  ? 204 VAL C C   1 
ATOM   6876  O  O   . VAL C 2 204 ? 43.70718  7.42238   -31.89880 1.000 39.10681  ? 204 VAL C O   1 
ATOM   6877  C  CB  . VAL C 2 204 ? 43.45166  10.39935  -33.34750 1.000 39.44764  ? 204 VAL C CB  1 
ATOM   6878  C  CG1 . VAL C 2 204 ? 43.13961  9.31332   -34.37159 1.000 37.78963  ? 204 VAL C CG1 1 
ATOM   6879  C  CG2 . VAL C 2 204 ? 42.44820  11.53711  -33.44906 1.000 35.87836  ? 204 VAL C CG2 1 
ATOM   6880  N  N   . ASP C 2 205 ? 45.58987  8.64329   -31.71708 1.000 34.72035  ? 205 ASP C N   1 
ATOM   6881  C  CA  . ASP C 2 205 ? 46.43467  7.46002   -31.60621 1.000 38.38197  ? 205 ASP C CA  1 
ATOM   6882  C  C   . ASP C 2 205 ? 46.11020  6.67152   -30.34309 1.000 38.51402  ? 205 ASP C C   1 
ATOM   6883  O  O   . ASP C 2 205 ? 46.02356  5.43806   -30.37444 1.000 38.48027  ? 205 ASP C O   1 
ATOM   6884  C  CB  . ASP C 2 205 ? 47.90615  7.87462   -31.61924 1.000 41.67414  ? 205 ASP C CB  1 
ATOM   6885  C  CG  . ASP C 2 205 ? 48.84835  6.71108   -31.35858 1.000 55.32246  ? 205 ASP C CG  1 
ATOM   6886  O  OD1 . ASP C 2 205 ? 49.00415  5.84942   -32.25132 1.000 63.79366  ? 205 ASP C OD1 1 
ATOM   6887  O  OD2 . ASP C 2 205 ? 49.42912  6.65416   -30.25309 1.000 55.21244  ? 205 ASP C OD2 1 
ATOM   6888  N  N   . ALA C 2 206 ? 45.91922  7.36687   -29.22046 1.000 37.37497  ? 206 ALA C N   1 
ATOM   6889  C  CA  . ALA C 2 206 ? 45.57919  6.67808   -27.98195 1.000 30.20246  ? 206 ALA C CA  1 
ATOM   6890  C  C   . ALA C 2 206 ? 44.17255  6.09460   -28.02805 1.000 34.58051  ? 206 ALA C C   1 
ATOM   6891  O  O   . ALA C 2 206 ? 43.93028  5.03108   -27.44711 1.000 31.80784  ? 206 ALA C O   1 
ATOM   6892  C  CB  . ALA C 2 206 ? 45.72668  7.62906   -26.79466 1.000 32.44439  ? 206 ALA C CB  1 
ATOM   6893  N  N   . ALA C 2 207 ? 43.23982  6.75369   -28.72325 1.000 32.66718  ? 207 ALA C N   1 
ATOM   6894  C  CA  . ALA C 2 207 ? 41.88873  6.20935   -28.82971 1.000 30.10239  ? 207 ALA C CA  1 
ATOM   6895  C  C   . ALA C 2 207 ? 41.90000  4.87482   -29.55768 1.000 30.58187  ? 207 ALA C C   1 
ATOM   6896  O  O   . ALA C 2 207 ? 41.23121  3.92388   -29.13722 1.000 31.89359  ? 207 ALA C O   1 
ATOM   6897  C  CB  . ALA C 2 207 ? 40.96519  7.19970   -29.54242 1.000 24.39395  ? 207 ALA C CB  1 
ATOM   6898  N  N   . LYS C 2 208 ? 42.67049  4.78004   -30.64421 1.000 30.55489  ? 208 LYS C N   1 
ATOM   6899  C  CA  . LYS C 2 208 ? 42.81784  3.50185   -31.32922 1.000 30.15927  ? 208 LYS C CA  1 
ATOM   6900  C  C   . LYS C 2 208 ? 43.45138  2.46078   -30.41690 1.000 31.44712  ? 208 LYS C C   1 
ATOM   6901  O  O   . LYS C 2 208 ? 43.06441  1.28800   -30.44000 1.000 35.40178  ? 208 LYS C O   1 
ATOM   6902  C  CB  . LYS C 2 208 ? 43.64354  3.68231   -32.60257 1.000 28.87871  ? 208 LYS C CB  1 
ATOM   6903  C  CG  . LYS C 2 208 ? 42.97226  4.57214   -33.63876 1.000 40.25945  ? 208 LYS C CG  1 
ATOM   6904  C  CD  . LYS C 2 208 ? 43.86859  4.81978   -34.84684 1.000 38.83912  ? 208 LYS C CD  1 
ATOM   6905  C  CE  . LYS C 2 208 ? 43.20917  5.79552   -35.81520 1.000 52.69068  ? 208 LYS C CE  1 
ATOM   6906  N  NZ  . LYS C 2 208 ? 44.06521  6.10459   -36.99521 1.000 54.81464  ? 208 LYS C NZ  1 
ATOM   6907  N  N   . TYR C 2 209 ? 44.41614  2.87253   -29.59238 1.000 34.56246  ? 209 TYR C N   1 
ATOM   6908  C  CA  . TYR C 2 209 ? 45.05698  1.92712   -28.68432 1.000 30.14641  ? 209 TYR C CA  1 
ATOM   6909  C  C   . TYR C 2 209 ? 44.07008  1.37611   -27.65984 1.000 32.43612  ? 209 TYR C C   1 
ATOM   6910  O  O   . TYR C 2 209 ? 44.13702  0.19529   -27.29653 1.000 36.49445  ? 209 TYR C O   1 
ATOM   6911  C  CB  . TYR C 2 209 ? 46.24055  2.59176   -27.98280 1.000 31.83303  ? 209 TYR C CB  1 
ATOM   6912  C  CG  . TYR C 2 209 ? 46.84258  1.74811   -26.88174 1.000 34.72878  ? 209 TYR C CG  1 
ATOM   6913  C  CD1 . TYR C 2 209 ? 47.78883  0.77093   -27.16575 1.000 30.83704  ? 209 TYR C CD1 1 
ATOM   6914  C  CD2 . TYR C 2 209 ? 46.46639  1.93157   -25.55778 1.000 32.55521  ? 209 TYR C CD2 1 
ATOM   6915  C  CE1 . TYR C 2 209 ? 48.34081  -0.00491  -26.15799 1.000 38.84683  ? 209 TYR C CE1 1 
ATOM   6916  C  CE2 . TYR C 2 209 ? 47.00532  1.16169   -24.54922 1.000 35.71931  ? 209 TYR C CE2 1 
ATOM   6917  C  CZ  . TYR C 2 209 ? 47.94330  0.20006   -24.84927 1.000 40.11844  ? 209 TYR C CZ  1 
ATOM   6918  O  OH  . TYR C 2 209 ? 48.48074  -0.55853  -23.83314 1.000 52.08050  ? 209 TYR C OH  1 
ATOM   6919  N  N   . TYR C 2 210 ? 43.14761  2.20615   -27.18294 1.000 29.73482  ? 210 TYR C N   1 
ATOM   6920  C  CA  . TYR C 2 210 ? 42.21966  1.78102   -26.14238 1.000 27.61940  ? 210 TYR C CA  1 
ATOM   6921  C  C   . TYR C 2 210 ? 40.95152  1.14994   -26.69012 1.000 28.19017  ? 210 TYR C C   1 
ATOM   6922  O  O   . TYR C 2 210 ? 40.10680  0.71664   -25.89964 1.000 30.49397  ? 210 TYR C O   1 
ATOM   6923  C  CB  . TYR C 2 210 ? 41.86490  2.96117   -25.22886 1.000 27.60475  ? 210 TYR C CB  1 
ATOM   6924  C  CG  . TYR C 2 210 ? 42.99844  3.32352   -24.29748 1.000 28.13390  ? 210 TYR C CG  1 
ATOM   6925  C  CD1 . TYR C 2 210 ? 43.46276  2.40937   -23.35835 1.000 22.77842  ? 210 TYR C CD1 1 
ATOM   6926  C  CD2 . TYR C 2 210 ? 43.62316  4.56425   -24.36906 1.000 29.05948  ? 210 TYR C CD2 1 
ATOM   6927  C  CE1 . TYR C 2 210 ? 44.50842  2.72157   -22.50884 1.000 25.59110  ? 210 TYR C CE1 1 
ATOM   6928  C  CE2 . TYR C 2 210 ? 44.67877  4.88416   -23.52137 1.000 33.55766  ? 210 TYR C CE2 1 
ATOM   6929  C  CZ  . TYR C 2 210 ? 45.11216  3.95739   -22.59145 1.000 30.88728  ? 210 TYR C CZ  1 
ATOM   6930  O  OH  . TYR C 2 210 ? 46.15879  4.25764   -21.74425 1.000 31.64489  ? 210 TYR C OH  1 
ATOM   6931  N  N   . GLY C 2 211 ? 40.80301  1.05801   -28.00976 1.000 28.10152  ? 211 GLY C N   1 
ATOM   6932  C  CA  . GLY C 2 211 ? 39.70571  0.28687   -28.55712 1.000 25.88174  ? 211 GLY C CA  1 
ATOM   6933  C  C   . GLY C 2 211 ? 38.81430  0.98811   -29.56261 1.000 37.07336  ? 211 GLY C C   1 
ATOM   6934  O  O   . GLY C 2 211 ? 37.81432  0.40964   -29.99966 1.000 35.91051  ? 211 GLY C O   1 
ATOM   6935  N  N   . ALA C 2 212 ? 39.13291  2.22802   -29.92797 1.000 35.33516  ? 212 ALA C N   1 
ATOM   6936  C  CA  . ALA C 2 212 ? 38.29859  2.93904   -30.88826 1.000 30.22229  ? 212 ALA C CA  1 
ATOM   6937  C  C   . ALA C 2 212 ? 38.40031  2.27048   -32.25129 1.000 31.07909  ? 212 ALA C C   1 
ATOM   6938  O  O   . ALA C 2 212 ? 39.49913  1.98772   -32.73590 1.000 32.64183  ? 212 ALA C O   1 
ATOM   6939  C  CB  . ALA C 2 212 ? 38.70882  4.40678   -30.98629 1.000 27.82434  ? 212 ALA C CB  1 
ATOM   6940  N  N   . THR C 2 213 ? 37.24754  1.99736   -32.85930 1.000 31.52364  ? 213 THR C N   1 
ATOM   6941  C  CA  . THR C 2 213 ? 37.19552  1.39955   -34.18534 1.000 35.77604  ? 213 THR C CA  1 
ATOM   6942  C  C   . THR C 2 213 ? 37.01126  2.42691   -35.29027 1.000 34.87026  ? 213 THR C C   1 
ATOM   6943  O  O   . THR C 2 213 ? 37.33087  2.13636   -36.44729 1.000 38.63519  ? 213 THR C O   1 
ATOM   6944  C  CB  . THR C 2 213 ? 36.05628  0.37417   -34.25706 1.000 38.75326  ? 213 THR C CB  1 
ATOM   6945  O  OG1 . THR C 2 213 ? 34.80741  1.03060   -33.99731 1.000 37.60037  ? 213 THR C OG1 1 
ATOM   6946  C  CG2 . THR C 2 213 ? 36.26370  -0.72555  -33.22080 1.000 30.63565  ? 213 THR C CG2 1 
ATOM   6947  N  N   . ASP C 2 214 ? 36.51029  3.61383   -34.95814 1.000 34.19021  ? 214 ASP C N   1 
ATOM   6948  C  CA  . ASP C 2 214 ? 36.29993  4.68076   -35.92149 1.000 33.98033  ? 214 ASP C CA  1 
ATOM   6949  C  C   . ASP C 2 214 ? 36.67182  6.00959   -35.28105 1.000 29.30745  ? 214 ASP C C   1 
ATOM   6950  O  O   . ASP C 2 214 ? 36.46384  6.21981   -34.08303 1.000 31.69433  ? 214 ASP C O   1 
ATOM   6951  C  CB  . ASP C 2 214 ? 34.84235  4.72150   -36.40854 1.000 36.01829  ? 214 ASP C CB  1 
ATOM   6952  C  CG  . ASP C 2 214 ? 34.36090  3.37684   -36.93089 1.000 41.88917  ? 214 ASP C CG  1 
ATOM   6953  O  OD1 . ASP C 2 214 ? 34.06008  2.49157   -36.09988 1.000 36.92762  ? 214 ASP C OD1 1 
ATOM   6954  O  OD2 . ASP C 2 214 ? 34.29368  3.20376   -38.16975 1.000 39.57872  ? 214 ASP C OD2 1 
ATOM   6955  N  N   . ILE C 2 215 ? 37.22010  6.90823   -36.09089 1.000 32.91103  ? 215 ILE C N   1 
ATOM   6956  C  CA  . ILE C 2 215 ? 37.59759  8.24393   -35.64745 1.000 39.14675  ? 215 ILE C CA  1 
ATOM   6957  C  C   . ILE C 2 215 ? 36.79143  9.26134   -36.44153 1.000 36.92117  ? 215 ILE C C   1 
ATOM   6958  O  O   . ILE C 2 215 ? 36.79032  9.23367   -37.67805 1.000 42.48786  ? 215 ILE C O   1 
ATOM   6959  C  CB  . ILE C 2 215 ? 39.10697  8.49796   -35.82122 1.000 41.21593  ? 215 ILE C CB  1 
ATOM   6960  C  CG1 . ILE C 2 215 ? 39.92143  7.44806   -35.05903 1.000 36.10037  ? 215 ILE C CG1 1 
ATOM   6961  C  CG2 . ILE C 2 215 ? 39.46217  9.91264   -35.37515 1.000 32.30924  ? 215 ILE C CG2 1 
ATOM   6962  C  CD1 . ILE C 2 215 ? 39.73963  7.50540   -33.55328 1.000 29.07657  ? 215 ILE C CD1 1 
ATOM   6963  N  N   . VAL C 2 216 ? 36.11056  10.15270  -35.72879 1.000 38.18846  ? 216 VAL C N   1 
ATOM   6964  C  CA  . VAL C 2 216 ? 35.33764  11.24290  -36.31395 1.000 40.20640  ? 216 VAL C CA  1 
ATOM   6965  C  C   . VAL C 2 216 ? 35.99365  12.54822  -35.88864 1.000 41.58680  ? 216 VAL C C   1 
ATOM   6966  O  O   . VAL C 2 216 ? 36.07719  12.83985  -34.68950 1.000 44.96802  ? 216 VAL C O   1 
ATOM   6967  C  CB  . VAL C 2 216 ? 33.86359  11.20469  -35.88094 1.000 39.14039  ? 216 VAL C CB  1 
ATOM   6968  C  CG1 . VAL C 2 216 ? 33.15413  12.47138  -36.32197 1.000 38.45317  ? 216 VAL C CG1 1 
ATOM   6969  C  CG2 . VAL C 2 216 ? 33.17472  9.97729   -36.45394 1.000 30.37136  ? 216 VAL C CG2 1 
ATOM   6970  N  N   . ASN C 2 217 ? 36.46285  13.32978  -36.85650 1.000 49.39817  ? 217 ASN C N   1 
ATOM   6971  C  CA  . ASN C 2 217 ? 37.07163  14.62134  -36.56758 1.000 66.05835  ? 217 ASN C CA  1 
ATOM   6972  C  C   . ASN C 2 217 ? 36.00579  15.69648  -36.73320 1.000 68.08610  ? 217 ASN C C   1 
ATOM   6973  O  O   . ASN C 2 217 ? 35.49716  15.90057  -37.84090 1.000 65.57372  ? 217 ASN C O   1 
ATOM   6974  C  CB  . ASN C 2 217 ? 38.24597  14.87322  -37.51467 1.000 59.50134  ? 217 ASN C CB  1 
ATOM   6975  C  CG  . ASN C 2 217 ? 39.13769  16.00398  -37.05744 1.000 63.35736  ? 217 ASN C CG  1 
ATOM   6976  O  OD1 . ASN C 2 217 ? 38.69554  16.91877  -36.36597 1.000 74.75273  ? 217 ASN C OD1 1 
ATOM   6977  N  ND2 . ASN C 2 217 ? 40.40246  15.95472  -37.45592 1.000 61.95383  ? 217 ASN C ND2 1 
ATOM   6978  N  N   . TYR C 2 218 ? 35.69380  16.40694  -35.64079 1.000 88.35738  ? 218 TYR C N   1 
ATOM   6979  C  CA  . TYR C 2 218 ? 34.67411  17.44791  -35.72570 1.000 98.20743  ? 218 TYR C CA  1 
ATOM   6980  C  C   . TYR C 2 218 ? 35.13388  18.63873  -36.55225 1.000 89.17088  ? 218 TYR C C   1 
ATOM   6981  O  O   . TYR C 2 218 ? 34.29362  19.38069  -37.06961 1.000 100.57317 ? 218 TYR C O   1 
ATOM   6982  C  CB  . TYR C 2 218 ? 34.23126  17.88574  -34.32105 1.000 109.10385 ? 218 TYR C CB  1 
ATOM   6983  C  CG  . TYR C 2 218 ? 35.26278  18.61400  -33.48279 1.000 113.28722 ? 218 TYR C CG  1 
ATOM   6984  C  CD1 . TYR C 2 218 ? 35.45079  19.98749  -33.60642 1.000 111.80542 ? 218 TYR C CD1 1 
ATOM   6985  C  CD2 . TYR C 2 218 ? 36.02213  17.93123  -32.53803 1.000 96.87828  ? 218 TYR C CD2 1 
ATOM   6986  C  CE1 . TYR C 2 218 ? 36.38474  20.65575  -32.83164 1.000 108.32464 ? 218 TYR C CE1 1 
ATOM   6987  C  CE2 . TYR C 2 218 ? 36.95703  18.59064  -31.75800 1.000 95.35293  ? 218 TYR C CE2 1 
ATOM   6988  C  CZ  . TYR C 2 218 ? 37.13353  19.95258  -31.90850 1.000 105.48810 ? 218 TYR C CZ  1 
ATOM   6989  O  OH  . TYR C 2 218 ? 38.06171  20.61322  -31.13544 1.000 93.04694  ? 218 TYR C OH  1 
ATOM   6990  N  N   . LYS C 2 219 ? 36.44285  18.83619  -36.68958 1.000 82.39778  ? 219 LYS C N   1 
ATOM   6991  C  CA  . LYS C 2 219 ? 36.96397  19.84665  -37.59720 1.000 89.07095  ? 219 LYS C CA  1 
ATOM   6992  C  C   . LYS C 2 219 ? 36.82291  19.42417  -39.05448 1.000 80.93557  ? 219 LYS C C   1 
ATOM   6993  O  O   . LYS C 2 219 ? 37.04305  20.24671  -39.94865 1.000 96.73548  ? 219 LYS C O   1 
ATOM   6994  C  CB  . LYS C 2 219 ? 38.41201  20.17467  -37.23278 1.000 85.18854  ? 219 LYS C CB  1 
ATOM   6995  C  CG  . LYS C 2 219 ? 38.51819  20.81552  -35.85055 1.000 75.94713  ? 219 LYS C CG  1 
ATOM   6996  C  CD  . LYS C 2 219 ? 39.94523  21.16483  -35.47912 1.000 88.87684  ? 219 LYS C CD  1 
ATOM   6997  C  CE  . LYS C 2 219 ? 40.02696  21.61534  -34.02770 1.000 83.09077  ? 219 LYS C CE  1 
ATOM   6998  N  NZ  . LYS C 2 219 ? 41.43304  21.79280  -33.57283 1.000 75.31011  ? 219 LYS C NZ  1 
ATOM   6999  N  N   . ASP C 2 220 ? 36.47833  18.16036  -39.30454 1.000 76.36853  ? 220 ASP C N   1 
ATOM   7000  C  CA  . ASP C 2 220 ? 36.29271  17.61268  -40.64158 1.000 85.13574  ? 220 ASP C CA  1 
ATOM   7001  C  C   . ASP C 2 220 ? 34.84309  17.70331  -41.11284 1.000 91.44610  ? 220 ASP C C   1 
ATOM   7002  O  O   . ASP C 2 220 ? 34.56334  17.42261  -42.28431 1.000 87.21995  ? 220 ASP C O   1 
ATOM   7003  C  CB  . ASP C 2 220 ? 36.78158  16.15206  -40.66152 1.000 80.33395  ? 220 ASP C CB  1 
ATOM   7004  C  CG  . ASP C 2 220 ? 36.83261  15.55603  -42.05684 1.000 84.14698  ? 220 ASP C CG  1 
ATOM   7005  O  OD1 . ASP C 2 220 ? 35.79297  15.05051  -42.53117 1.000 77.63766  ? 220 ASP C OD1 1 
ATOM   7006  O  OD2 . ASP C 2 220 ? 37.91677  15.58696  -42.67680 1.000 99.77406  ? 220 ASP C OD2 1 
ATOM   7007  N  N   . GLY C 2 221 ? 33.92622  18.12077  -40.24168 1.000 81.66006  ? 221 GLY C N   1 
ATOM   7008  C  CA  . GLY C 2 221 ? 32.53441  18.27395  -40.59400 1.000 73.25825  ? 221 GLY C CA  1 
ATOM   7009  C  C   . GLY C 2 221 ? 31.62153  18.06592  -39.40242 1.000 81.12300  ? 221 GLY C C   1 
ATOM   7010  O  O   . GLY C 2 221 ? 32.07903  17.85288  -38.27498 1.000 88.57971  ? 221 GLY C O   1 
ATOM   7011  N  N   . PRO C 2 222 ? 30.30841  18.12460  -39.62549 1.000 72.57040  ? 222 PRO C N   1 
ATOM   7012  C  CA  . PRO C 2 222 ? 29.37116  17.94033  -38.51096 1.000 60.88040  ? 222 PRO C CA  1 
ATOM   7013  C  C   . PRO C 2 222 ? 29.47496  16.54547  -37.91788 1.000 56.49272  ? 222 PRO C C   1 
ATOM   7014  O  O   . PRO C 2 222 ? 29.56037  15.54805  -38.63732 1.000 61.98368  ? 222 PRO C O   1 
ATOM   7015  C  CB  . PRO C 2 222 ? 28.00045  18.17310  -39.15709 1.000 61.91659  ? 222 PRO C CB  1 
ATOM   7016  C  CG  . PRO C 2 222 ? 28.29044  18.97713  -40.39013 1.000 60.73565  ? 222 PRO C CG  1 
ATOM   7017  C  CD  . PRO C 2 222 ? 29.61925  18.48241  -40.87567 1.000 58.40877  ? 222 PRO C CD  1 
ATOM   7018  N  N   . ILE C 2 223 ? 29.45527  16.48531  -36.58610 1.000 53.48160  ? 223 ILE C N   1 
ATOM   7019  C  CA  . ILE C 2 223 ? 29.57358  15.20287  -35.90122 1.000 50.08629  ? 223 ILE C CA  1 
ATOM   7020  C  C   . ILE C 2 223 ? 28.36125  14.33105  -36.20160 1.000 41.91104  ? 223 ILE C C   1 
ATOM   7021  O  O   . ILE C 2 223 ? 28.49493  13.14550  -36.52808 1.000 44.80950  ? 223 ILE C O   1 
ATOM   7022  C  CB  . ILE C 2 223 ? 29.75792  15.41844  -34.38780 1.000 55.21548  ? 223 ILE C CB  1 
ATOM   7023  C  CG1 . ILE C 2 223 ? 31.05316  16.18316  -34.10888 1.000 62.76497  ? 223 ILE C CG1 1 
ATOM   7024  C  CG2 . ILE C 2 223 ? 29.72553  14.09461  -33.63817 1.000 49.59260  ? 223 ILE C CG2 1 
ATOM   7025  C  CD1 . ILE C 2 223 ? 31.16513  16.69058  -32.68299 1.000 70.49592  ? 223 ILE C CD1 1 
ATOM   7026  N  N   . GLU C 2 224 ? 27.16134  14.91567  -36.11088 1.000 47.87666  ? 224 GLU C N   1 
ATOM   7027  C  CA  . GLU C 2 224 ? 25.92707  14.15358  -36.28571 1.000 45.11475  ? 224 GLU C CA  1 
ATOM   7028  C  C   . GLU C 2 224 ? 25.89879  13.44946  -37.63438 1.000 47.04564  ? 224 GLU C C   1 
ATOM   7029  O  O   . GLU C 2 224 ? 25.70317  12.23152  -37.70623 1.000 48.03757  ? 224 GLU C O   1 
ATOM   7030  C  CB  . GLU C 2 224 ? 24.70974  15.07217  -36.14574 1.000 46.82985  ? 224 GLU C CB  1 
ATOM   7031  C  CG  . GLU C 2 224 ? 24.59014  15.79419  -34.80836 1.000 54.49191  ? 224 GLU C CG  1 
ATOM   7032  C  CD  . GLU C 2 224 ? 25.46426  17.03562  -34.72517 1.000 64.67177  ? 224 GLU C CD  1 
ATOM   7033  O  OE1 . GLU C 2 224 ? 26.10052  17.38842  -35.74189 1.000 66.77929  ? 224 GLU C OE1 1 
ATOM   7034  O  OE2 . GLU C 2 224 ? 25.51679  17.65855  -33.64217 1.000 62.45541  ? 224 GLU C OE2 1 
ATOM   7035  N  N   . SER C 2 225 ? 26.10001  14.20364  -38.71787 1.000 48.14627  ? 225 SER C N   1 
ATOM   7036  C  CA  . SER C 2 225 ? 26.02140  13.61550  -40.05051 1.000 46.04405  ? 225 SER C CA  1 
ATOM   7037  C  C   . SER C 2 225 ? 27.05616  12.51202  -40.23591 1.000 48.03766  ? 225 SER C C   1 
ATOM   7038  O  O   . SER C 2 225 ? 26.74779  11.45196  -40.79284 1.000 47.51452  ? 225 SER C O   1 
ATOM   7039  C  CB  . SER C 2 225 ? 26.19995  14.69989  -41.10989 1.000 49.90680  ? 225 SER C CB  1 
ATOM   7040  O  OG  . SER C 2 225 ? 26.33807  14.12302  -42.39506 1.000 70.33295  ? 225 SER C OG  1 
ATOM   7041  N  N   . GLN C 2 226 ? 28.28423  12.73373  -39.76015 1.000 42.20470  ? 226 GLN C N   1 
ATOM   7042  C  CA  . GLN C 2 226 ? 29.33018  11.72543  -39.90796 1.000 45.50936  ? 226 GLN C CA  1 
ATOM   7043  C  C   . GLN C 2 226 ? 28.96645  10.44556  -39.16615 1.000 45.41264  ? 226 GLN C C   1 
ATOM   7044  O  O   . GLN C 2 226 ? 29.11834  9.33969   -39.69798 1.000 49.55261  ? 226 GLN C O   1 
ATOM   7045  C  CB  . GLN C 2 226 ? 30.66652  12.27453  -39.40789 1.000 44.44809  ? 226 GLN C CB  1 
ATOM   7046  C  CG  . GLN C 2 226 ? 31.32871  13.26632  -40.34219 1.000 52.39371  ? 226 GLN C CG  1 
ATOM   7047  C  CD  . GLN C 2 226 ? 32.74940  13.59348  -39.92342 1.000 58.55220  ? 226 GLN C CD  1 
ATOM   7048  O  OE1 . GLN C 2 226 ? 33.64353  12.75044  -40.01095 1.000 51.91866  ? 226 GLN C OE1 1 
ATOM   7049  N  NE2 . GLN C 2 226 ? 32.96690  14.82548  -39.47575 1.000 53.47174  ? 226 GLN C NE2 1 
ATOM   7050  N  N   . ILE C 2 227 ? 28.48201  10.57558  -37.93097 1.000 38.31765  ? 227 ILE C N   1 
ATOM   7051  C  CA  . ILE C 2 227 ? 28.15943  9.39048   -37.14529 1.000 44.29969  ? 227 ILE C CA  1 
ATOM   7052  C  C   . ILE C 2 227 ? 26.92380  8.69527   -37.70658 1.000 43.37035  ? 227 ILE C C   1 
ATOM   7053  O  O   . ILE C 2 227 ? 26.86697  7.46081   -37.77241 1.000 42.13871  ? 227 ILE C O   1 
ATOM   7054  C  CB  . ILE C 2 227 ? 27.98951  9.76675   -35.66365 1.000 41.70692  ? 227 ILE C CB  1 
ATOM   7055  C  CG1 . ILE C 2 227 ? 29.33850  10.17559  -35.07305 1.000 37.51150  ? 227 ILE C CG1 1 
ATOM   7056  C  CG2 . ILE C 2 227 ? 27.39380  8.61216   -34.87659 1.000 37.96975  ? 227 ILE C CG2 1 
ATOM   7057  C  CD1 . ILE C 2 227 ? 29.27780  10.51277  -33.60550 1.000 45.13388  ? 227 ILE C CD1 1 
ATOM   7058  N  N   . MET C 2 228 ? 25.92167  9.46872   -38.13572 1.000 41.87999  ? 228 MET C N   1 
ATOM   7059  C  CA  . MET C 2 228 ? 24.74824  8.85792   -38.75108 1.000 44.13435  ? 228 MET C CA  1 
ATOM   7060  C  C   . MET C 2 228 ? 25.11342  8.12911   -40.03841 1.000 49.29474  ? 228 MET C C   1 
ATOM   7061  O  O   . MET C 2 228 ? 24.51932  7.09123   -40.35078 1.000 58.68215  ? 228 MET C O   1 
ATOM   7062  C  CB  . MET C 2 228 ? 23.67366  9.91236   -39.02170 1.000 41.40065  ? 228 MET C CB  1 
ATOM   7063  C  CG  . MET C 2 228 ? 23.09314  10.57510  -37.77367 1.000 44.40835  ? 228 MET C CG  1 
ATOM   7064  S  SD  . MET C 2 228 ? 22.52033  9.41446   -36.51420 1.000 51.51881  ? 228 MET C SD  1 
ATOM   7065  C  CE  . MET C 2 228 ? 21.13055  8.67239   -37.36512 1.000 39.67661  ? 228 MET C CE  1 
ATOM   7066  N  N   . ASN C 2 229 ? 26.08674  8.64942   -40.79441 1.000 50.03150  ? 229 ASN C N   1 
ATOM   7067  C  CA  . ASN C 2 229 ? 26.55577  7.94226   -41.98337 1.000 52.05902  ? 229 ASN C CA  1 
ATOM   7068  C  C   . ASN C 2 229 ? 27.29096  6.66084   -41.61003 1.000 45.48120  ? 229 ASN C C   1 
ATOM   7069  O  O   . ASN C 2 229 ? 27.16011  5.64134   -42.29711 1.000 55.50088  ? 229 ASN C O   1 
ATOM   7070  C  CB  . ASN C 2 229 ? 27.47121  8.83846   -42.82298 1.000 52.83205  ? 229 ASN C CB  1 
ATOM   7071  C  CG  . ASN C 2 229 ? 26.71674  9.92856   -43.56445 1.000 65.99426  ? 229 ASN C CG  1 
ATOM   7072  O  OD1 . ASN C 2 229 ? 25.50850  9.83585   -43.77105 1.000 78.77415  ? 229 ASN C OD1 1 
ATOM   7073  N  ND2 . ASN C 2 229 ? 27.43883  10.95998  -43.99256 1.000 63.00427  ? 229 ASN C ND2 1 
ATOM   7074  N  N   . LEU C 2 230 ? 28.08394  6.69843   -40.53691 1.000 41.08656  ? 230 LEU C N   1 
ATOM   7075  C  CA  . LEU C 2 230 ? 28.82358  5.50985   -40.12169 1.000 47.94121  ? 230 LEU C CA  1 
ATOM   7076  C  C   . LEU C 2 230 ? 27.88609  4.39570   -39.68072 1.000 45.95299  ? 230 LEU C C   1 
ATOM   7077  O  O   . LEU C 2 230 ? 28.10811  3.22417   -40.00700 1.000 49.64955  ? 230 LEU C O   1 
ATOM   7078  C  CB  . LEU C 2 230 ? 29.79748  5.85997   -38.99751 1.000 42.72614  ? 230 LEU C CB  1 
ATOM   7079  C  CG  . LEU C 2 230 ? 31.01026  6.69037   -39.40888 1.000 39.96947  ? 230 LEU C CG  1 
ATOM   7080  C  CD1 . LEU C 2 230 ? 31.87452  7.00190   -38.20028 1.000 32.44023  ? 230 LEU C CD1 1 
ATOM   7081  C  CD2 . LEU C 2 230 ? 31.80785  5.96132   -40.47436 1.000 36.91919  ? 230 LEU C CD2 1 
ATOM   7082  N  N   . THR C 2 231 ? 26.84096  4.73789   -38.93476 1.000 47.27070  ? 231 THR C N   1 
ATOM   7083  C  CA  . THR C 2 231 ? 25.88758  3.76185   -38.43368 1.000 47.16208  ? 231 THR C CA  1 
ATOM   7084  C  C   . THR C 2 231 ? 24.74851  3.49570   -39.40524 1.000 47.05000  ? 231 THR C C   1 
ATOM   7085  O  O   . THR C 2 231 ? 23.77803  2.83055   -39.02920 1.000 50.14747  ? 231 THR C O   1 
ATOM   7086  C  CB  . THR C 2 231 ? 25.32479  4.22451   -37.09208 1.000 42.23194  ? 231 THR C CB  1 
ATOM   7087  O  OG1 . THR C 2 231 ? 24.69235  5.49812   -37.26074 1.000 43.33970  ? 231 THR C OG1 1 
ATOM   7088  C  CG2 . THR C 2 231 ? 26.43731  4.34063   -36.06233 1.000 41.80664  ? 231 THR C CG2 1 
ATOM   7089  N  N   . GLU C 2 232 ? 24.84478  3.99991   -40.63739 1.000 51.82280  ? 232 GLU C N   1 
ATOM   7090  C  CA  . GLU C 2 232 ? 23.82979  3.77337   -41.66760 1.000 46.69340  ? 232 GLU C CA  1 
ATOM   7091  C  C   . GLU C 2 232 ? 22.44478  4.20537   -41.19042 1.000 46.17271  ? 232 GLU C C   1 
ATOM   7092  O  O   . GLU C 2 232 ? 21.44949  3.50915   -41.39941 1.000 43.77710  ? 232 GLU C O   1 
ATOM   7093  C  CB  . GLU C 2 232 ? 23.82043  2.31323   -42.12549 1.000 46.31391  ? 232 GLU C CB  1 
ATOM   7094  C  CG  . GLU C 2 232 ? 25.13934  1.85130   -42.72849 1.000 67.80156  ? 232 GLU C CG  1 
ATOM   7095  C  CD  . GLU C 2 232 ? 25.10056  0.40496   -43.18769 1.000 94.43732  ? 232 GLU C CD  1 
ATOM   7096  O  OE1 . GLU C 2 232 ? 24.06834  -0.26323  -42.96654 1.000 105.42792 ? 232 GLU C OE1 1 
ATOM   7097  O  OE2 . GLU C 2 232 ? 26.09841  -0.06022  -43.78016 1.000 94.79126  ? 232 GLU C OE2 1 
ATOM   7098  N  N   . GLY C 2 233 ? 22.38338  5.36596   -40.53649 1.000 48.73529  ? 233 GLY C N   1 
ATOM   7099  C  CA  . GLY C 2 233 ? 21.13756  5.92024   -40.05454 1.000 43.14178  ? 233 GLY C CA  1 
ATOM   7100  C  C   . GLY C 2 233 ? 20.62706  5.35013   -38.74872 1.000 50.32382  ? 233 GLY C C   1 
ATOM   7101  O  O   . GLY C 2 233 ? 19.63093  5.86117   -38.22007 1.000 47.54715  ? 233 GLY C O   1 
ATOM   7102  N  N   . LYS C 2 234 ? 21.27403  4.32008   -38.19871 1.000 43.58376  ? 234 LYS C N   1 
ATOM   7103  C  CA  . LYS C 2 234 ? 20.77857  3.71042   -36.96906 1.000 46.29177  ? 234 LYS C CA  1 
ATOM   7104  C  C   . LYS C 2 234 ? 21.10854  4.54258   -35.73674 1.000 41.94266  ? 234 LYS C C   1 
ATOM   7105  O  O   . LYS C 2 234 ? 20.36607  4.50466   -34.75040 1.000 42.43565  ? 234 LYS C O   1 
ATOM   7106  C  CB  . LYS C 2 234 ? 21.36298  2.30567   -36.79608 1.000 55.44095  ? 234 LYS C CB  1 
ATOM   7107  C  CG  . LYS C 2 234 ? 20.89327  1.27810   -37.82046 1.000 48.59088  ? 234 LYS C CG  1 
ATOM   7108  C  CD  . LYS C 2 234 ? 21.42200  -0.11706  -37.48224 1.000 58.58544  ? 234 LYS C CD  1 
ATOM   7109  C  CE  . LYS C 2 234 ? 22.76200  -0.40813  -38.15554 1.000 70.20826  ? 234 LYS C CE  1 
ATOM   7110  N  NZ  . LYS C 2 234 ? 23.89879  0.36748   -37.57068 1.000 67.12890  ? 234 LYS C NZ  1 
ATOM   7111  N  N   . GLY C 2 235 ? 22.20066  5.28921   -35.76603 1.000 48.50419  ? 235 GLY C N   1 
ATOM   7112  C  CA  . GLY C 2 235 ? 22.66911  5.94430   -34.56954 1.000 34.20090  ? 235 GLY C CA  1 
ATOM   7113  C  C   . GLY C 2 235 ? 23.44363  4.97075   -33.70227 1.000 34.06668  ? 235 GLY C C   1 
ATOM   7114  O  O   . GLY C 2 235 ? 23.75035  3.84164   -34.09480 1.000 40.39625  ? 235 GLY C O   1 
ATOM   7115  N  N   . VAL C 2 236 ? 23.76601  5.42341   -32.49768 1.000 31.28907  ? 236 VAL C N   1 
ATOM   7116  C  CA  . VAL C 2 236 ? 24.52615  4.61592   -31.55828 1.000 24.98626  ? 236 VAL C CA  1 
ATOM   7117  C  C   . VAL C 2 236 ? 23.61804  4.23074   -30.39819 1.000 30.22510  ? 236 VAL C C   1 
ATOM   7118  O  O   . VAL C 2 236 ? 22.61983  4.89564   -30.10156 1.000 33.48667  ? 236 VAL C O   1 
ATOM   7119  C  CB  . VAL C 2 236 ? 25.79709  5.34113   -31.06068 1.000 31.82214  ? 236 VAL C CB  1 
ATOM   7120  C  CG1 . VAL C 2 236 ? 26.71241  5.67171   -32.22989 1.000 25.06941  ? 236 VAL C CG1 1 
ATOM   7121  C  CG2 . VAL C 2 236 ? 25.43500  6.60980   -30.29183 1.000 26.23252  ? 236 VAL C CG2 1 
ATOM   7122  N  N   . ASP C 2 237 ? 23.97743  3.12860   -29.73431 1.000 27.26649  ? 237 ASP C N   1 
ATOM   7123  C  CA  . ASP C 2 237 ? 23.20903  2.67628   -28.57999 1.000 27.92085  ? 237 ASP C CA  1 
ATOM   7124  C  C   . ASP C 2 237 ? 23.46787  3.55196   -27.36847 1.000 29.99452  ? 237 ASP C C   1 
ATOM   7125  O  O   . ASP C 2 237 ? 22.59069  3.70467   -26.51150 1.000 38.94584  ? 237 ASP C O   1 
ATOM   7126  C  CB  . ASP C 2 237 ? 23.56093  1.22666   -28.25443 1.000 25.60216  ? 237 ASP C CB  1 
ATOM   7127  C  CG  . ASP C 2 237 ? 23.23727  0.28963   -29.38581 1.000 39.91155  ? 237 ASP C CG  1 
ATOM   7128  O  OD1 . ASP C 2 237 ? 22.03471  0.08652   -29.65780 1.000 45.63460  ? 237 ASP C OD1 1 
ATOM   7129  O  OD2 . ASP C 2 237 ? 24.18638  -0.21896  -30.02264 1.000 37.02377  ? 237 ASP C OD2 1 
ATOM   7130  N  N   . ALA C 2 238 ? 24.65899  4.12923   -27.27891 1.000 26.17702  ? 238 ALA C N   1 
ATOM   7131  C  CA  . ALA C 2 238 ? 25.00183  4.98926   -26.16296 1.000 25.02409  ? 238 ALA C CA  1 
ATOM   7132  C  C   . ALA C 2 238 ? 26.06123  5.97308   -26.61494 1.000 25.04743  ? 238 ALA C C   1 
ATOM   7133  O  O   . ALA C 2 238 ? 26.91798  5.65209   -27.44066 1.000 32.93443  ? 238 ALA C O   1 
ATOM   7134  C  CB  . ALA C 2 238 ? 25.50834  4.18537   -24.96126 1.000 33.85880  ? 238 ALA C CB  1 
ATOM   7135  N  N   . ALA C 2 239 ? 25.98814  7.17809   -26.06646 1.000 28.94584  ? 239 ALA C N   1 
ATOM   7136  C  CA  . ALA C 2 239 ? 26.98934  8.20309   -26.28578 1.000 23.73805  ? 239 ALA C CA  1 
ATOM   7137  C  C   . ALA C 2 239 ? 27.53434  8.61813   -24.93291 1.000 34.17529  ? 239 ALA C C   1 
ATOM   7138  O  O   . ALA C 2 239 ? 26.76381  8.91196   -24.01142 1.000 31.87615  ? 239 ALA C O   1 
ATOM   7139  C  CB  . ALA C 2 239 ? 26.41030  9.41343   -27.02025 1.000 28.26078  ? 239 ALA C CB  1 
ATOM   7140  N  N   . ILE C 2 240 ? 28.85530  8.64036   -24.81762 1.000 32.12592  ? 240 ILE C N   1 
ATOM   7141  C  CA  . ILE C 2 240 ? 29.53567  9.06607   -23.60330 1.000 29.66886  ? 240 ILE C CA  1 
ATOM   7142  C  C   . ILE C 2 240 ? 30.12012  10.44038  -23.87868 1.000 23.47130  ? 240 ILE C C   1 
ATOM   7143  O  O   . ILE C 2 240 ? 30.97055  10.59139  -24.76403 1.000 30.82291  ? 240 ILE C O   1 
ATOM   7144  C  CB  . ILE C 2 240 ? 30.62997  8.07120   -23.18820 1.000 27.69496  ? 240 ILE C CB  1 
ATOM   7145  C  CG1 . ILE C 2 240 ? 30.04669  6.66763   -23.02199 1.000 22.75804  ? 240 ILE C CG1 1 
ATOM   7146  C  CG2 . ILE C 2 240 ? 31.30001  8.52214   -21.90533 1.000 26.84708  ? 240 ILE C CG2 1 
ATOM   7147  C  CD1 . ILE C 2 240 ? 31.09928  5.60166   -22.77535 1.000 21.87204  ? 240 ILE C CD1 1 
ATOM   7148  N  N   . ILE C 2 241 ? 29.65956  11.44548  -23.13986 1.000 32.06854  ? 241 ILE C N   1 
ATOM   7149  C  CA  . ILE C 2 241 ? 30.17467  12.80480  -23.27666 1.000 27.35712  ? 241 ILE C CA  1 
ATOM   7150  C  C   . ILE C 2 241 ? 31.36466  12.97604  -22.34268 1.000 30.24007  ? 241 ILE C C   1 
ATOM   7151  O  O   . ILE C 2 241 ? 31.23027  12.84613  -21.11998 1.000 32.46800  ? 241 ILE C O   1 
ATOM   7152  C  CB  . ILE C 2 241 ? 29.09560  13.85171  -22.96956 1.000 31.13949  ? 241 ILE C CB  1 
ATOM   7153  C  CG1 . ILE C 2 241 ? 27.90013  13.69817  -23.90923 1.000 30.09828  ? 241 ILE C CG1 1 
ATOM   7154  C  CG2 . ILE C 2 241 ? 29.69413  15.25188  -23.05368 1.000 24.19889  ? 241 ILE C CG2 1 
ATOM   7155  C  CD1 . ILE C 2 241 ? 26.77944  14.66436  -23.59693 1.000 29.54727  ? 241 ILE C CD1 1 
ATOM   7156  N  N   . ALA C 2 242 ? 32.52676  13.29621  -22.91351 1.000 28.64538  ? 242 ALA C N   1 
ATOM   7157  C  CA  . ALA C 2 242 ? 33.73605  13.50446  -22.12717 1.000 28.64899  ? 242 ALA C CA  1 
ATOM   7158  C  C   . ALA C 2 242 ? 34.47075  14.77587  -22.53215 1.000 36.95320  ? 242 ALA C C   1 
ATOM   7159  O  O   . ALA C 2 242 ? 35.67510  14.88801  -22.29524 1.000 42.88763  ? 242 ALA C O   1 
ATOM   7160  C  CB  . ALA C 2 242 ? 34.66970  12.29946  -22.23850 1.000 27.38121  ? 242 ALA C CB  1 
ATOM   7161  N  N   . GLY C 2 243 ? 33.78135  15.72577  -23.14739 1.000 38.67740  ? 243 GLY C N   1 
ATOM   7162  C  CA  . GLY C 2 243 ? 34.41662  16.96453  -23.54676 1.000 31.84016  ? 243 GLY C CA  1 
ATOM   7163  C  C   . GLY C 2 243 ? 33.48259  17.77245  -24.41288 1.000 45.24629  ? 243 GLY C C   1 
ATOM   7164  O  O   . GLY C 2 243 ? 32.46474  17.28052  -24.90633 1.000 49.41393  ? 243 GLY C O   1 
ATOM   7165  N  N   . GLY C 2 244 ? 33.84502  19.03379  -24.58633 1.000 48.75487  ? 244 GLY C N   1 
ATOM   7166  C  CA  . GLY C 2 244 ? 33.09078  19.95583  -25.41084 1.000 45.60524  ? 244 GLY C CA  1 
ATOM   7167  C  C   . GLY C 2 244 ? 32.33868  20.97275  -24.56982 1.000 56.40546  ? 244 GLY C C   1 
ATOM   7168  O  O   . GLY C 2 244 ? 32.39698  20.98036  -23.33853 1.000 49.10428  ? 244 GLY C O   1 
ATOM   7169  N  N   . ASN C 2 245 ? 31.61173  21.83440  -25.27547 1.000 53.40380  ? 245 ASN C N   1 
ATOM   7170  C  CA  . ASN C 2 245 ? 30.82607  22.88288  -24.64509 1.000 58.86316  ? 245 ASN C CA  1 
ATOM   7171  C  C   . ASN C 2 245 ? 29.38977  22.39997  -24.45267 1.000 55.39887  ? 245 ASN C C   1 
ATOM   7172  O  O   . ASN C 2 245 ? 29.07895  21.22145  -24.63781 1.000 50.79977  ? 245 ASN C O   1 
ATOM   7173  C  CB  . ASN C 2 245 ? 30.90228  24.16434  -25.46928 1.000 56.76110  ? 245 ASN C CB  1 
ATOM   7174  C  CG  . ASN C 2 245 ? 32.30607  24.72867  -25.52879 1.000 70.67306  ? 245 ASN C CG  1 
ATOM   7175  O  OD1 . ASN C 2 245 ? 32.83360  25.00496  -26.60716 1.000 68.44004  ? 245 ASN C OD1 1 
ATOM   7176  N  ND2 . ASN C 2 245 ? 32.92551  24.89255  -24.36458 1.000 62.95758  ? 245 ASN C ND2 1 
ATOM   7177  N  N   . ALA C 2 246 ? 28.49694  23.31570  -24.06759 1.000 52.43954  ? 246 ALA C N   1 
ATOM   7178  C  CA  . ALA C 2 246 ? 27.11387  22.93866  -23.79572 1.000 43.18776  ? 246 ALA C CA  1 
ATOM   7179  C  C   . ALA C 2 246 ? 26.43581  22.34554  -25.02367 1.000 41.07013  ? 246 ALA C C   1 
ATOM   7180  O  O   . ALA C 2 246 ? 25.53169  21.51435  -24.89129 1.000 57.45583  ? 246 ALA C O   1 
ATOM   7181  C  CB  . ALA C 2 246 ? 26.33329  24.15252  -23.28978 1.000 45.99986  ? 246 ALA C CB  1 
ATOM   7182  N  N   . ASP C 2 247 ? 26.85835  22.75297  -26.22198 1.000 55.65233  ? 247 ASP C N   1 
ATOM   7183  C  CA  . ASP C 2 247 ? 26.23795  22.26382  -27.44743 1.000 47.33090  ? 247 ASP C CA  1 
ATOM   7184  C  C   . ASP C 2 247 ? 26.43843  20.76762  -27.65439 1.000 45.01883  ? 247 ASP C C   1 
ATOM   7185  O  O   . ASP C 2 247 ? 25.66130  20.14887  -28.38945 1.000 48.81707  ? 247 ASP C O   1 
ATOM   7186  C  CB  . ASP C 2 247 ? 26.79461  23.02952  -28.64573 1.000 55.48452  ? 247 ASP C CB  1 
ATOM   7187  C  CG  . ASP C 2 247 ? 28.30906  23.12594  -28.61780 1.000 70.38409  ? 247 ASP C CG  1 
ATOM   7188  O  OD1 . ASP C 2 247 ? 28.97793  22.06978  -28.68084 1.000 68.14093  ? 247 ASP C OD1 1 
ATOM   7189  O  OD2 . ASP C 2 247 ? 28.83081  24.25820  -28.52608 1.000 84.34771  ? 247 ASP C OD2 1 
ATOM   7190  N  N   . ILE C 2 248 ? 27.45109  20.16805  -27.02179 1.000 44.55054  ? 248 ILE C N   1 
ATOM   7191  C  CA  . ILE C 2 248 ? 27.70505  18.74391  -27.21962 1.000 48.96004  ? 248 ILE C CA  1 
ATOM   7192  C  C   . ILE C 2 248 ? 26.57610  17.88466  -26.66571 1.000 40.35908  ? 248 ILE C C   1 
ATOM   7193  O  O   . ILE C 2 248 ? 26.41912  16.73110  -27.08493 1.000 39.20324  ? 248 ILE C O   1 
ATOM   7194  C  CB  . ILE C 2 248 ? 29.05775  18.33752  -26.59890 1.000 43.99144  ? 248 ILE C CB  1 
ATOM   7195  C  CG1 . ILE C 2 248 ? 29.58891  17.06806  -27.26646 1.000 37.19399  ? 248 ILE C CG1 1 
ATOM   7196  C  CG2 . ILE C 2 248 ? 28.93596  18.13585  -25.09871 1.000 36.70678  ? 248 ILE C CG2 1 
ATOM   7197  C  CD1 . ILE C 2 248 ? 29.88135  17.23918  -28.74253 1.000 43.51046  ? 248 ILE C CD1 1 
ATOM   7198  N  N   . MET C 2 249 ? 25.78500  18.41472  -25.72775 1.000 42.03616  ? 249 MET C N   1 
ATOM   7199  C  CA  . MET C 2 249 ? 24.62262  17.68223  -25.23496 1.000 40.12585  ? 249 MET C CA  1 
ATOM   7200  C  C   . MET C 2 249 ? 23.58944  17.48576  -26.33822 1.000 35.55231  ? 249 MET C C   1 
ATOM   7201  O  O   . MET C 2 249 ? 23.00128  16.40513  -26.46705 1.000 37.12255  ? 249 MET C O   1 
ATOM   7202  C  CB  . MET C 2 249 ? 24.00751  18.42444  -24.04856 1.000 41.69462  ? 249 MET C CB  1 
ATOM   7203  C  CG  . MET C 2 249 ? 22.71813  17.81253  -23.53236 1.000 45.32654  ? 249 MET C CG  1 
ATOM   7204  S  SD  . MET C 2 249 ? 22.96094  16.15602  -22.86375 1.000 45.30304  ? 249 MET C SD  1 
ATOM   7205  C  CE  . MET C 2 249 ? 23.96617  16.50945  -21.42271 1.000 44.57259  ? 249 MET C CE  1 
ATOM   7206  N  N   . ALA C 2 250 ? 23.34879  18.52465  -27.14041 1.000 43.65207  ? 250 ALA C N   1 
ATOM   7207  C  CA  . ALA C 2 250 ? 22.45195  18.38113  -28.28162 1.000 46.63652  ? 250 ALA C CA  1 
ATOM   7208  C  C   . ALA C 2 250 ? 22.99356  17.36303  -29.27688 1.000 40.64011  ? 250 ALA C C   1 
ATOM   7209  O  O   . ALA C 2 250 ? 22.23669  16.55335  -29.82433 1.000 34.86230  ? 250 ALA C O   1 
ATOM   7210  C  CB  . ALA C 2 250 ? 22.23954  19.73604  -28.95540 1.000 47.47241  ? 250 ALA C CB  1 
ATOM   7211  N  N   . THR C 2 251 ? 24.30676  17.38120  -29.51180 1.000 35.65048  ? 251 THR C N   1 
ATOM   7212  C  CA  . THR C 2 251 ? 24.91677  16.41581  -30.41963 1.000 38.15996  ? 251 THR C CA  1 
ATOM   7213  C  C   . THR C 2 251 ? 24.71611  14.98979  -29.92631 1.000 36.74100  ? 251 THR C C   1 
ATOM   7214  O  O   . THR C 2 251 ? 24.40248  14.08942  -30.71482 1.000 36.89319  ? 251 THR C O   1 
ATOM   7215  C  CB  . THR C 2 251 ? 26.40814  16.71686  -30.57064 1.000 37.50839  ? 251 THR C CB  1 
ATOM   7216  O  OG1 . THR C 2 251 ? 26.57627  18.02555  -31.12722 1.000 45.48900  ? 251 THR C OG1 1 
ATOM   7217  C  CG2 . THR C 2 251 ? 27.08040  15.68943  -31.47049 1.000 39.80021  ? 251 THR C CG2 1 
ATOM   7218  N  N   . ALA C 2 252 ? 24.88908  14.76467  -28.62212 1.000 34.66859  ? 252 ALA C N   1 
ATOM   7219  C  CA  . ALA C 2 252 ? 24.73379  13.41888  -28.08286 1.000 31.78546  ? 252 ALA C CA  1 
ATOM   7220  C  C   . ALA C 2 252 ? 23.31070  12.91246  -28.26658 1.000 35.89091  ? 252 ALA C C   1 
ATOM   7221  O  O   . ALA C 2 252 ? 23.10086  11.76933  -28.69165 1.000 31.78141  ? 252 ALA C O   1 
ATOM   7222  C  CB  . ALA C 2 252 ? 25.12578  13.39758  -26.60577 1.000 27.74232  ? 252 ALA C CB  1 
ATOM   7223  N  N   . VAL C 2 253 ? 22.31814  13.75902  -27.98047 1.000 33.16786  ? 253 VAL C N   1 
ATOM   7224  C  CA  . VAL C 2 253 ? 20.92594  13.34016  -28.11656 1.000 30.61591  ? 253 VAL C CA  1 
ATOM   7225  C  C   . VAL C 2 253 ? 20.60922  13.00592  -29.56848 1.000 36.17507  ? 253 VAL C C   1 
ATOM   7226  O  O   . VAL C 2 253 ? 19.86733  12.05873  -29.85468 1.000 36.59195  ? 253 VAL C O   1 
ATOM   7227  C  CB  . VAL C 2 253 ? 19.98452  14.42702  -27.56248 1.000 33.99073  ? 253 VAL C CB  1 
ATOM   7228  C  CG1 . VAL C 2 253 ? 18.53024  14.07896  -27.84304 1.000 29.82916  ? 253 VAL C CG1 1 
ATOM   7229  C  CG2 . VAL C 2 253 ? 20.20500  14.59980  -26.06952 1.000 34.43816  ? 253 VAL C CG2 1 
ATOM   7230  N  N   . LYS C 2 254 ? 21.19099  13.75272  -30.50931 1.000 32.54013  ? 254 LYS C N   1 
ATOM   7231  C  CA  . LYS C 2 254 ? 20.85663  13.54622  -31.91442 1.000 35.59280  ? 254 LYS C CA  1 
ATOM   7232  C  C   . LYS C 2 254 ? 21.40867  12.23030  -32.45282 1.000 36.93600  ? 254 LYS C C   1 
ATOM   7233  O  O   . LYS C 2 254 ? 20.80181  11.63210  -33.34975 1.000 33.01870  ? 254 LYS C O   1 
ATOM   7234  C  CB  . LYS C 2 254 ? 21.36015  14.72130  -32.75188 1.000 29.26026  ? 254 LYS C CB  1 
ATOM   7235  C  CG  . LYS C 2 254 ? 20.62483  16.02229  -32.46540 1.000 40.33258  ? 254 LYS C CG  1 
ATOM   7236  C  CD  . LYS C 2 254 ? 21.23977  17.19921  -33.19748 1.000 47.92948  ? 254 LYS C CD  1 
ATOM   7237  C  CE  . LYS C 2 254 ? 20.53093  18.49712  -32.83540 1.000 49.49024  ? 254 LYS C CE  1 
ATOM   7238  N  NZ  . LYS C 2 254 ? 21.14001  19.67879  -33.51015 1.000 61.80929  ? 254 LYS C NZ  1 
ATOM   7239  N  N   . ILE C 2 255 ? 22.54224  11.75841  -31.92943 1.000 35.84775  ? 255 ILE C N   1 
ATOM   7240  C  CA  . ILE C 2 255 ? 23.15588  10.55178  -32.47834 1.000 39.61509  ? 255 ILE C CA  1 
ATOM   7241  C  C   . ILE C 2 255 ? 22.73064  9.27219   -31.76393 1.000 35.52151  ? 255 ILE C C   1 
ATOM   7242  O  O   . ILE C 2 255 ? 22.90450  8.17980   -32.32242 1.000 35.54672  ? 255 ILE C O   1 
ATOM   7243  C  CB  . ILE C 2 255 ? 24.69262  10.64884  -32.46701 1.000 39.06142  ? 255 ILE C CB  1 
ATOM   7244  C  CG1 . ILE C 2 255 ? 25.22982  10.67346  -31.03521 1.000 33.09860  ? 255 ILE C CG1 1 
ATOM   7245  C  CG2 . ILE C 2 255 ? 25.15469  11.88187  -33.22324 1.000 35.02191  ? 255 ILE C CG2 1 
ATOM   7246  C  CD1 . ILE C 2 255 ? 26.74707  10.67748  -30.96248 1.000 27.53917  ? 255 ILE C CD1 1 
ATOM   7247  N  N   . VAL C 2 256 ? 22.16936  9.36786   -30.56160 1.000 33.58969  ? 256 VAL C N   1 
ATOM   7248  C  CA  . VAL C 2 256 ? 21.72542  8.18194   -29.83648 1.000 28.34113  ? 256 VAL C CA  1 
ATOM   7249  C  C   . VAL C 2 256 ? 20.36686  7.74756   -30.36497 1.000 36.28849  ? 256 VAL C C   1 
ATOM   7250  O  O   . VAL C 2 256 ? 19.48890  8.58026   -30.62213 1.000 36.44764  ? 256 VAL C O   1 
ATOM   7251  C  CB  . VAL C 2 256 ? 21.67394  8.45930   -28.32339 1.000 32.29020  ? 256 VAL C CB  1 
ATOM   7252  C  CG1 . VAL C 2 256 ? 21.00296  7.31345   -27.59016 1.000 28.16717  ? 256 VAL C CG1 1 
ATOM   7253  C  CG2 . VAL C 2 256 ? 23.06045  8.66231   -27.78683 1.000 32.20718  ? 256 VAL C CG2 1 
ATOM   7254  N  N   . LYS C 2 257 ? 20.18928  6.43810   -30.54051 1.000 30.07548  ? 257 LYS C N   1 
ATOM   7255  C  CA  . LYS C 2 257 ? 18.92077  5.91974   -31.02157 1.000 29.94450  ? 257 LYS C CA  1 
ATOM   7256  C  C   . LYS C 2 257 ? 17.87008  5.97039   -29.91126 1.000 36.78092  ? 257 LYS C C   1 
ATOM   7257  O  O   . LYS C 2 257 ? 18.20729  6.07611   -28.72892 1.000 34.91286  ? 257 LYS C O   1 
ATOM   7258  C  CB  . LYS C 2 257 ? 19.09333  4.49184   -31.53063 1.000 28.01210  ? 257 LYS C CB  1 
ATOM   7259  C  CG  . LYS C 2 257 ? 19.47706  3.48986   -30.46335 1.000 39.60840  ? 257 LYS C CG  1 
ATOM   7260  C  CD  . LYS C 2 257 ? 19.74341  2.12196   -31.07062 1.000 33.41024  ? 257 LYS C CD  1 
ATOM   7261  C  CE  . LYS C 2 257 ? 20.87508  2.19960   -32.08321 1.000 39.57486  ? 257 LYS C CE  1 
ATOM   7262  N  NZ  . LYS C 2 257 ? 21.33685  0.85752   -32.53002 1.000 40.26708  ? 257 LYS C NZ  1 
ATOM   7263  N  N   . PRO C 2 258 ? 16.58569  5.92587   -30.27030 1.000 33.66014  ? 258 PRO C N   1 
ATOM   7264  C  CA  . PRO C 2 258 ? 15.53841  5.88087   -29.24206 1.000 33.73782  ? 258 PRO C CA  1 
ATOM   7265  C  C   . PRO C 2 258 ? 15.75068  4.70483   -28.30086 1.000 36.75772  ? 258 PRO C C   1 
ATOM   7266  O  O   . PRO C 2 258 ? 16.02970  3.58450   -28.73249 1.000 35.56984  ? 258 PRO C O   1 
ATOM   7267  C  CB  . PRO C 2 258 ? 14.25095  5.72615   -30.05781 1.000 34.25368  ? 258 PRO C CB  1 
ATOM   7268  C  CG  . PRO C 2 258 ? 14.56626  6.33681   -31.36926 1.000 30.34852  ? 258 PRO C CG  1 
ATOM   7269  C  CD  . PRO C 2 258 ? 16.01597  6.02973   -31.62654 1.000 28.14830  ? 258 PRO C CD  1 
ATOM   7270  N  N   . GLY C 2 259 ? 15.62665  4.97053   -27.00188 1.000 31.07004  ? 259 GLY C N   1 
ATOM   7271  C  CA  . GLY C 2 259 ? 15.87768  3.96396   -25.99682 1.000 33.63575  ? 259 GLY C CA  1 
ATOM   7272  C  C   . GLY C 2 259 ? 17.31009  3.87707   -25.51823 1.000 30.78737  ? 259 GLY C C   1 
ATOM   7273  O  O   . GLY C 2 259 ? 17.57864  3.15114   -24.55175 1.000 39.94241  ? 259 GLY C O   1 
ATOM   7274  N  N   . GLY C 2 260 ? 18.23502  4.58620   -26.15976 1.000 26.79072  ? 260 GLY C N   1 
ATOM   7275  C  CA  . GLY C 2 260 ? 19.62791  4.56919   -25.77643 1.000 30.70114  ? 260 GLY C CA  1 
ATOM   7276  C  C   . GLY C 2 260 ? 19.89521  5.48111   -24.59587 1.000 32.04141  ? 260 GLY C C   1 
ATOM   7277  O  O   . GLY C 2 260 ? 18.98701  6.03061   -23.97126 1.000 31.72765  ? 260 GLY C O   1 
ATOM   7278  N  N   . THR C 2 261 ? 21.18046  5.64892   -24.29342 1.000 33.67372  ? 261 THR C N   1 
ATOM   7279  C  CA  . THR C 2 261 ? 21.59952  6.39210   -23.11532 1.000 33.79653  ? 261 THR C CA  1 
ATOM   7280  C  C   . THR C 2 261 ? 22.66120  7.41993   -23.47485 1.000 29.46938  ? 261 THR C C   1 
ATOM   7281  O  O   . THR C 2 261 ? 23.59550  7.12788   -24.22325 1.000 29.02839  ? 261 THR C O   1 
ATOM   7282  C  CB  . THR C 2 261 ? 22.14411  5.44777   -22.03543 1.000 29.52945  ? 261 THR C CB  1 
ATOM   7283  O  OG1 . THR C 2 261 ? 21.15746  4.45745   -21.73103 1.000 34.94615  ? 261 THR C OG1 1 
ATOM   7284  C  CG2 . THR C 2 261 ? 22.47111  6.21966   -20.76277 1.000 32.09482  ? 261 THR C CG2 1 
ATOM   7285  N  N   . ILE C 2 262 ? 22.50780  8.62634   -22.93707 1.000 30.36590  ? 262 ILE C N   1 
ATOM   7286  C  CA  . ILE C 2 262 ? 23.54842  9.64475   -22.96787 1.000 26.71870  ? 262 ILE C CA  1 
ATOM   7287  C  C   . ILE C 2 262 ? 24.17844  9.66424   -21.58637 1.000 27.42576  ? 262 ILE C C   1 
ATOM   7288  O  O   . ILE C 2 262 ? 23.50876  9.98715   -20.59753 1.000 35.68080  ? 262 ILE C O   1 
ATOM   7289  C  CB  . ILE C 2 262 ? 22.99107  11.03049  -23.33050 1.000 27.84496  ? 262 ILE C CB  1 
ATOM   7290  C  CG1 . ILE C 2 262 ? 22.46831  11.05827  -24.76696 1.000 26.73000  ? 262 ILE C CG1 1 
ATOM   7291  C  CG2 . ILE C 2 262 ? 24.07308  12.09098  -23.14801 1.000 22.80568  ? 262 ILE C CG2 1 
ATOM   7292  C  CD1 . ILE C 2 262 ? 21.00921  10.70829  -24.89573 1.000 32.20786  ? 262 ILE C CD1 1 
ATOM   7293  N  N   . ALA C 2 263 ? 25.45071  9.29690   -21.50868 1.000 31.44957  ? 263 ALA C N   1 
ATOM   7294  C  CA  . ALA C 2 263 ? 26.18900  9.26369   -20.25269 1.000 28.15258  ? 263 ALA C CA  1 
ATOM   7295  C  C   . ALA C 2 263 ? 27.20423  10.39653  -20.25981 1.000 25.21084  ? 263 ALA C C   1 
ATOM   7296  O  O   . ALA C 2 263 ? 28.15691  10.37565  -21.04390 1.000 33.73287  ? 263 ALA C O   1 
ATOM   7297  C  CB  . ALA C 2 263 ? 26.87759  7.91454   -20.06881 1.000 24.24910  ? 263 ALA C CB  1 
ATOM   7298  N  N   . ASN C 2 264 ? 27.02608  11.36578  -19.36726 1.000 28.54193  ? 264 ASN C N   1 
ATOM   7299  C  CA  . ASN C 2 264 ? 27.91611  12.51286  -19.28002 1.000 28.29854  ? 264 ASN C CA  1 
ATOM   7300  C  C   . ASN C 2 264 ? 28.82593  12.38701  -18.06838 1.000 32.73429  ? 264 ASN C C   1 
ATOM   7301  O  O   . ASN C 2 264 ? 28.35818  12.11062  -16.95819 1.000 34.86406  ? 264 ASN C O   1 
ATOM   7302  C  CB  . ASN C 2 264 ? 27.14464  13.82899  -19.18761 1.000 31.37471  ? 264 ASN C CB  1 
ATOM   7303  C  CG  . ASN C 2 264 ? 28.05640  15.00068  -18.87627 1.000 32.10275  ? 264 ASN C CG  1 
ATOM   7304  O  OD1 . ASN C 2 264 ? 28.85955  15.41758  -19.71088 1.000 27.83054  ? 264 ASN C OD1 1 
ATOM   7305  N  ND2 . ASN C 2 264 ? 27.94998  15.52888  -17.66068 1.000 38.62073  ? 264 ASN C ND2 1 
ATOM   7306  N  N   . VAL C 2 265 ? 30.12147  12.59430  -18.29068 1.000 32.10630  ? 265 VAL C N   1 
ATOM   7307  C  CA  . VAL C 2 265 ? 31.09939  12.71184  -17.21557 1.000 32.18592  ? 265 VAL C CA  1 
ATOM   7308  C  C   . VAL C 2 265 ? 31.90993  13.97717  -17.45361 1.000 35.00616  ? 265 VAL C C   1 
ATOM   7309  O  O   . VAL C 2 265 ? 32.91232  14.22811  -16.77613 1.000 41.93795  ? 265 VAL C O   1 
ATOM   7310  C  CB  . VAL C 2 265 ? 32.00224  11.46866  -17.13031 1.000 34.20296  ? 265 VAL C CB  1 
ATOM   7311  C  CG1 . VAL C 2 265 ? 31.23195  10.30725  -16.55558 1.000 31.54452  ? 265 VAL C CG1 1 
ATOM   7312  C  CG2 . VAL C 2 265 ? 32.52493  11.10399  -18.50907 1.000 29.14646  ? 265 VAL C CG2 1 
ATOM   7313  N  N   . ASN C 2 266 ? 31.46439  14.79278  -18.40423 1.000 32.71060  ? 266 ASN C N   1 
ATOM   7314  C  CA  . ASN C 2 266 ? 32.13182  16.04766  -18.70210 1.000 30.02847  ? 266 ASN C CA  1 
ATOM   7315  C  C   . ASN C 2 266 ? 31.74065  17.10281  -17.67762 1.000 38.65659  ? 266 ASN C C   1 
ATOM   7316  O  O   . ASN C 2 266 ? 30.57666  17.21145  -17.28461 1.000 44.14539  ? 266 ASN C O   1 
ATOM   7317  C  CB  . ASN C 2 266 ? 31.76792  16.52329  -20.10977 1.000 35.23410  ? 266 ASN C CB  1 
ATOM   7318  C  CG  . ASN C 2 266 ? 32.43474  17.83572  -20.47647 1.000 46.04124  ? 266 ASN C CG  1 
ATOM   7319  O  OD1 . ASN C 2 266 ? 33.56887  18.09659  -20.08791 1.000 47.13140  ? 266 ASN C OD1 1 
ATOM   7320  N  ND2 . ASN C 2 266 ? 31.72227  18.67697  -21.21519 1.000 50.90461  ? 266 ASN C ND2 1 
ATOM   7321  N  N   . TYR C 2 267 ? 32.72913  17.86999  -17.23721 1.000 46.77773  ? 267 TYR C N   1 
ATOM   7322  C  CA  . TYR C 2 267 ? 32.53562  18.97153  -16.29635 1.000 46.70000  ? 267 TYR C CA  1 
ATOM   7323  C  C   . TYR C 2 267 ? 32.33990  20.25040  -17.10242 1.000 45.48864  ? 267 TYR C C   1 
ATOM   7324  O  O   . TYR C 2 267 ? 33.30109  20.83286  -17.60878 1.000 45.38681  ? 267 TYR C O   1 
ATOM   7325  C  CB  . TYR C 2 267 ? 33.72873  19.04140  -15.34818 1.000 55.28757  ? 267 TYR C CB  1 
ATOM   7326  C  CG  . TYR C 2 267 ? 33.80446  20.22046  -14.41058 1.000 57.78005  ? 267 TYR C CG  1 
ATOM   7327  C  CD1 . TYR C 2 267 ? 32.66293  20.85445  -13.94104 1.000 61.47451  ? 267 TYR C CD1 1 
ATOM   7328  C  CD2 . TYR C 2 267 ? 35.03973  20.67640  -13.96422 1.000 62.84319  ? 267 TYR C CD2 1 
ATOM   7329  C  CE1 . TYR C 2 267 ? 32.75598  21.93162  -13.07628 1.000 66.61863  ? 267 TYR C CE1 1 
ATOM   7330  C  CE2 . TYR C 2 267 ? 35.14202  21.74022  -13.10117 1.000 55.95110  ? 267 TYR C CE2 1 
ATOM   7331  C  CZ  . TYR C 2 267 ? 34.00044  22.36461  -12.65920 1.000 66.48225  ? 267 TYR C CZ  1 
ATOM   7332  O  OH  . TYR C 2 267 ? 34.11411  23.42587  -11.79608 1.000 70.85254  ? 267 TYR C OH  1 
ATOM   7333  N  N   . PHE C 2 268 ? 31.08649  20.68328  -17.23057 1.000 44.70652  ? 268 PHE C N   1 
ATOM   7334  C  CA  . PHE C 2 268 ? 30.76283  21.90621  -17.95843 1.000 51.76572  ? 268 PHE C CA  1 
ATOM   7335  C  C   . PHE C 2 268 ? 31.08530  23.12025  -17.09459 1.000 58.75334  ? 268 PHE C C   1 
ATOM   7336  O  O   . PHE C 2 268 ? 30.48801  23.30943  -16.02901 1.000 57.05769  ? 268 PHE C O   1 
ATOM   7337  C  CB  . PHE C 2 268 ? 29.29178  21.91340  -18.36903 1.000 53.12144  ? 268 PHE C CB  1 
ATOM   7338  C  CG  . PHE C 2 268 ? 28.92294  20.81255  -19.32296 1.000 51.10850  ? 268 PHE C CG  1 
ATOM   7339  C  CD1 . PHE C 2 268 ? 29.05872  20.98845  -20.69200 1.000 54.92613  ? 268 PHE C CD1 1 
ATOM   7340  C  CD2 . PHE C 2 268 ? 28.44182  19.60307  -18.85256 1.000 43.02316  ? 268 PHE C CD2 1 
ATOM   7341  C  CE1 . PHE C 2 268 ? 28.72258  19.97597  -21.57513 1.000 47.69975  ? 268 PHE C CE1 1 
ATOM   7342  C  CE2 . PHE C 2 268 ? 28.10269  18.58386  -19.73076 1.000 47.82079  ? 268 PHE C CE2 1 
ATOM   7343  C  CZ  . PHE C 2 268 ? 28.24294  18.77299  -21.09339 1.000 47.14182  ? 268 PHE C CZ  1 
ATOM   7344  N  N   . GLY C 2 269 ? 32.02503  23.94284  -17.55310 1.000 62.40171  ? 269 GLY C N   1 
ATOM   7345  C  CA  . GLY C 2 269 ? 32.49057  25.06519  -16.76312 1.000 67.56300  ? 269 GLY C CA  1 
ATOM   7346  C  C   . GLY C 2 269 ? 31.80120  26.38369  -17.05283 1.000 67.16464  ? 269 GLY C C   1 
ATOM   7347  O  O   . GLY C 2 269 ? 31.83520  27.29598  -16.22081 1.000 69.32695  ? 269 GLY C O   1 
ATOM   7348  N  N   . GLU C 2 270 ? 31.18002  26.50752  -18.22462 1.000 67.45806  ? 270 GLU C N   1 
ATOM   7349  C  CA  . GLU C 2 270 ? 30.54963  27.75346  -18.63945 1.000 76.05997  ? 270 GLU C CA  1 
ATOM   7350  C  C   . GLU C 2 270 ? 29.16187  27.48323  -19.20299 1.000 72.08599  ? 270 GLU C C   1 
ATOM   7351  O  O   . GLU C 2 270 ? 28.84844  26.37219  -19.63717 1.000 66.12105  ? 270 GLU C O   1 
ATOM   7352  C  CB  . GLU C 2 270 ? 31.39795  28.49333  -19.68219 1.000 69.61084  ? 270 GLU C CB  1 
ATOM   7353  C  CG  . GLU C 2 270 ? 32.63459  29.16423  -19.10823 1.000 92.19677  ? 270 GLU C CG  1 
ATOM   7354  C  CD  . GLU C 2 270 ? 33.56311  29.68860  -20.18445 1.000 103.31332 ? 270 GLU C CD  1 
ATOM   7355  O  OE1 . GLU C 2 270 ? 33.40495  29.27622  -21.35353 1.000 100.19608 ? 270 GLU C OE1 1 
ATOM   7356  O  OE2 . GLU C 2 270 ? 34.44802  30.51142  -19.86175 1.000 106.34953 ? 270 GLU C OE2 1 
ATOM   7357  N  N   . GLY C 2 271 ? 28.32961  28.52338  -19.19051 1.000 65.39915  ? 271 GLY C N   1 
ATOM   7358  C  CA  . GLY C 2 271 ? 26.97535  28.40722  -19.69320 1.000 70.79130  ? 271 GLY C CA  1 
ATOM   7359  C  C   . GLY C 2 271 ? 25.95027  28.22640  -18.59465 1.000 71.18206  ? 271 GLY C C   1 
ATOM   7360  O  O   . GLY C 2 271 ? 26.20439  27.52226  -17.61417 1.000 77.23048  ? 271 GLY C O   1 
ATOM   7361  N  N   . GLU C 2 272 ? 24.78663  28.86058  -18.73794 1.000 66.04087  ? 272 GLU C N   1 
ATOM   7362  C  CA  . GLU C 2 272 ? 23.75091  28.71639  -17.72238 1.000 57.08295  ? 272 GLU C CA  1 
ATOM   7363  C  C   . GLU C 2 272 ? 22.92769  27.44675  -17.91074 1.000 59.02584  ? 272 GLU C C   1 
ATOM   7364  O  O   . GLU C 2 272 ? 22.50355  26.84091  -16.92060 1.000 56.78811  ? 272 GLU C O   1 
ATOM   7365  C  CB  . GLU C 2 272 ? 22.83457  29.93940  -17.73119 1.000 65.50682  ? 272 GLU C CB  1 
ATOM   7366  C  CG  . GLU C 2 272 ? 21.76521  29.91630  -16.65466 1.000 77.96830  ? 272 GLU C CG  1 
ATOM   7367  C  CD  . GLU C 2 272 ? 20.82893  31.10201  -16.74232 1.000 95.36579  ? 272 GLU C CD  1 
ATOM   7368  O  OE1 . GLU C 2 272 ? 21.11269  32.02632  -17.53505 1.000 100.10211 ? 272 GLU C OE1 1 
ATOM   7369  O  OE2 . GLU C 2 272 ? 19.80745  31.10630  -16.02214 1.000 98.98321  ? 272 GLU C OE2 1 
ATOM   7370  N  N   . VAL C 2 273 ? 22.70629  27.01992  -19.15403 1.000 57.44956  ? 273 VAL C N   1 
ATOM   7371  C  CA  . VAL C 2 273 ? 21.82670  25.89794  -19.46338 1.000 63.17165  ? 273 VAL C CA  1 
ATOM   7372  C  C   . VAL C 2 273 ? 22.53979  24.94293  -20.41125 1.000 59.94960  ? 273 VAL C C   1 
ATOM   7373  O  O   . VAL C 2 273 ? 23.29220  25.37182  -21.29344 1.000 58.75976  ? 273 VAL C O   1 
ATOM   7374  C  CB  . VAL C 2 273 ? 20.48854  26.36667  -20.07816 1.000 55.39131  ? 273 VAL C CB  1 
ATOM   7375  C  CG1 . VAL C 2 273 ? 19.64784  27.08941  -19.03891 1.000 62.93655  ? 273 VAL C CG1 1 
ATOM   7376  C  CG2 . VAL C 2 273 ? 20.73553  27.26957  -21.27475 1.000 58.05238  ? 273 VAL C CG2 1 
ATOM   7377  N  N   . LEU C 2 274 ? 22.31782  23.64246  -20.21181 1.000 50.18537  ? 274 LEU C N   1 
ATOM   7378  C  CA  . LEU C 2 274 ? 22.74792  22.63421  -21.16808 1.000 52.05474  ? 274 LEU C CA  1 
ATOM   7379  C  C   . LEU C 2 274 ? 21.57150  22.28662  -22.06497 1.000 54.70994  ? 274 LEU C C   1 
ATOM   7380  O  O   . LEU C 2 274 ? 20.56921  21.74841  -21.56869 1.000 56.84308  ? 274 LEU C O   1 
ATOM   7381  C  CB  . LEU C 2 274 ? 23.24980  21.38566  -20.45195 1.000 45.56522  ? 274 LEU C CB  1 
ATOM   7382  C  CG  . LEU C 2 274 ? 24.34030  21.56268  -19.39321 1.000 48.97794  ? 274 LEU C CG  1 
ATOM   7383  C  CD1 . LEU C 2 274 ? 24.74448  20.21395  -18.82345 1.000 48.78418  ? 274 LEU C CD1 1 
ATOM   7384  C  CD2 . LEU C 2 274 ? 25.54994  22.30139  -19.95309 1.000 54.43681  ? 274 LEU C CD2 1 
ATOM   7385  N  N   . PRO C 2 275 ? 21.63741  22.55563  -23.36973 1.000 55.36621  ? 275 PRO C N   1 
ATOM   7386  C  CA  . PRO C 2 275 ? 20.44587  22.41108  -24.21911 1.000 52.82198  ? 275 PRO C CA  1 
ATOM   7387  C  C   . PRO C 2 275 ? 20.16503  20.95322  -24.55876 1.000 47.52891  ? 275 PRO C C   1 
ATOM   7388  O  O   . PRO C 2 275 ? 21.06638  20.20138  -24.93617 1.000 49.21690  ? 275 PRO C O   1 
ATOM   7389  C  CB  . PRO C 2 275 ? 20.80726  23.21438  -25.47301 1.000 58.60077  ? 275 PRO C CB  1 
ATOM   7390  C  CG  . PRO C 2 275 ? 22.29821  23.10542  -25.54920 1.000 64.52493  ? 275 PRO C CG  1 
ATOM   7391  C  CD  . PRO C 2 275 ? 22.79062  23.08389  -24.12005 1.000 61.56575  ? 275 PRO C CD  1 
ATOM   7392  N  N   . VAL C 2 276 ? 18.90361  20.55929  -24.42027 1.000 55.10778  ? 276 VAL C N   1 
ATOM   7393  C  CA  . VAL C 2 276 ? 18.40424  19.26961  -24.87785 1.000 41.62523  ? 276 VAL C CA  1 
ATOM   7394  C  C   . VAL C 2 276 ? 17.43462  19.54214  -26.02731 1.000 53.10067  ? 276 VAL C C   1 
ATOM   7395  O  O   . VAL C 2 276 ? 16.38248  20.16220  -25.81178 1.000 52.26800  ? 276 VAL C O   1 
ATOM   7396  C  CB  . VAL C 2 276 ? 17.72234  18.48352  -23.74972 1.000 50.81871  ? 276 VAL C CB  1 
ATOM   7397  C  CG1 . VAL C 2 276 ? 17.05952  17.22975  -24.29975 1.000 43.73040  ? 276 VAL C CG1 1 
ATOM   7398  C  CG2 . VAL C 2 276 ? 18.72940  18.11604  -22.67413 1.000 39.91324  ? 276 VAL C CG2 1 
ATOM   7399  N  N   . PRO C 2 277 ? 17.74595  19.12195  -27.25389 1.000 54.83840  ? 277 PRO C N   1 
ATOM   7400  C  CA  . PRO C 2 277 ? 16.86686  19.44213  -28.38914 1.000 52.68029  ? 277 PRO C CA  1 
ATOM   7401  C  C   . PRO C 2 277 ? 15.52774  18.73142  -28.25089 1.000 52.13852  ? 277 PRO C C   1 
ATOM   7402  O  O   . PRO C 2 277 ? 15.47424  17.51996  -28.03103 1.000 56.53525  ? 277 PRO C O   1 
ATOM   7403  C  CB  . PRO C 2 277 ? 17.65719  18.93776  -29.60214 1.000 54.19896  ? 277 PRO C CB  1 
ATOM   7404  C  CG  . PRO C 2 277 ? 18.53200  17.85439  -29.04787 1.000 47.65082  ? 277 PRO C CG  1 
ATOM   7405  C  CD  . PRO C 2 277 ? 18.89204  18.28709  -27.65341 1.000 39.64240  ? 277 PRO C CD  1 
ATOM   7406  N  N   . ARG C 2 278 ? 14.44246  19.50053  -28.37468 1.000 54.24134  ? 278 ARG C N   1 
ATOM   7407  C  CA  . ARG C 2 278 ? 13.11027  18.95019  -28.13889 1.000 51.12663  ? 278 ARG C CA  1 
ATOM   7408  C  C   . ARG C 2 278 ? 12.76672  17.86284  -29.14876 1.000 49.96254  ? 278 ARG C C   1 
ATOM   7409  O  O   . ARG C 2 278 ? 12.38970  16.74800  -28.77008 1.000 48.33943  ? 278 ARG C O   1 
ATOM   7410  C  CB  . ARG C 2 278 ? 12.06287  20.06294  -28.17696 1.000 50.27658  ? 278 ARG C CB  1 
ATOM   7411  C  CG  . ARG C 2 278 ? 10.64096  19.57070  -27.93824 1.000 50.76027  ? 278 ARG C CG  1 
ATOM   7412  C  CD  . ARG C 2 278 ? 9.62878   20.69984  -28.06743 1.000 64.21915  ? 278 ARG C CD  1 
ATOM   7413  N  NE  . ARG C 2 278 ? 9.63852   21.29483  -29.39943 1.000 69.69194  ? 278 ARG C NE  1 
ATOM   7414  C  CZ  . ARG C 2 278 ? 8.85892   20.91217  -30.40233 1.000 72.16015  ? 278 ARG C CZ  1 
ATOM   7415  N  NH1 . ARG C 2 278 ? 7.97926   19.93294  -30.26166 1.000 58.95959  ? 278 ARG C NH1 1 
ATOM   7416  N  NH2 . ARG C 2 278 ? 8.96676   21.52580  -31.57734 1.000 71.67472  ? 278 ARG C NH2 1 
ATOM   7417  N  N   . LEU C 2 279 ? 12.88176  18.17226  -30.44284 1.000 57.45749  ? 279 LEU C N   1 
ATOM   7418  C  CA  . LEU C 2 279 ? 12.45532  17.22829  -31.47339 1.000 56.33273  ? 279 LEU C CA  1 
ATOM   7419  C  C   . LEU C 2 279 ? 13.29428  15.95484  -31.44618 1.000 50.96485  ? 279 LEU C C   1 
ATOM   7420  O  O   . LEU C 2 279 ? 12.75698  14.84329  -31.51551 1.000 52.39833  ? 279 LEU C O   1 
ATOM   7421  C  CB  . LEU C 2 279 ? 12.51783  17.89158  -32.84817 1.000 46.29394  ? 279 LEU C CB  1 
ATOM   7422  C  CG  . LEU C 2 279 ? 11.49470  19.00951  -33.06123 1.000 64.11382  ? 279 LEU C CG  1 
ATOM   7423  C  CD1 . LEU C 2 279 ? 11.66907  19.64947  -34.42760 1.000 51.16542  ? 279 LEU C CD1 1 
ATOM   7424  C  CD2 . LEU C 2 279 ? 10.07235  18.49080  -32.88135 1.000 65.93862  ? 279 LEU C CD2 1 
ATOM   7425  N  N   . GLU C 2 280 ? 14.61803  16.09438  -31.34229 1.000 48.81773  ? 280 GLU C N   1 
ATOM   7426  C  CA  . GLU C 2 280 ? 15.48271  14.91937  -31.34814 1.000 49.03750  ? 280 GLU C CA  1 
ATOM   7427  C  C   . GLU C 2 280 ? 15.39412  14.11863  -30.05403 1.000 50.46529  ? 280 GLU C C   1 
ATOM   7428  O  O   . GLU C 2 280 ? 15.80710  12.95361  -30.03458 1.000 42.45228  ? 280 GLU C O   1 
ATOM   7429  C  CB  . GLU C 2 280 ? 16.92816  15.33150  -31.61824 1.000 48.14856  ? 280 GLU C CB  1 
ATOM   7430  C  CG  . GLU C 2 280 ? 17.17806  15.73547  -33.06222 1.000 51.53178  ? 280 GLU C CG  1 
ATOM   7431  C  CD  . GLU C 2 280 ? 16.83152  17.18800  -33.33396 1.000 54.31834  ? 280 GLU C CD  1 
ATOM   7432  O  OE1 . GLU C 2 280 ? 16.26810  17.84745  -32.43307 1.000 52.42840  ? 280 GLU C OE1 1 
ATOM   7433  O  OE2 . GLU C 2 280 ? 17.11774  17.66994  -34.45214 1.000 65.25773  ? 280 GLU C OE2 1 
ATOM   7434  N  N   . TRP C 2 281 ? 14.87607  14.71188  -28.97672 1.000 47.62752  ? 281 TRP C N   1 
ATOM   7435  C  CA  . TRP C 2 281 ? 14.57224  13.98318  -27.75274 1.000 45.15630  ? 281 TRP C CA  1 
ATOM   7436  C  C   . TRP C 2 281 ? 13.15261  13.42139  -27.76184 1.000 51.84254  ? 281 TRP C C   1 
ATOM   7437  O  O   . TRP C 2 281 ? 12.60155  13.12196  -26.69466 1.000 43.74646  ? 281 TRP C O   1 
ATOM   7438  C  CB  . TRP C 2 281 ? 14.78239  14.88368  -26.53022 1.000 44.40855  ? 281 TRP C CB  1 
ATOM   7439  C  CG  . TRP C 2 281 ? 15.07964  14.14067  -25.25313 1.000 38.87197  ? 281 TRP C CG  1 
ATOM   7440  C  CD1 . TRP C 2 281 ? 16.03825  13.19042  -25.06243 1.000 40.22342  ? 281 TRP C CD1 1 
ATOM   7441  C  CD2 . TRP C 2 281 ? 14.41298  14.29527  -23.99079 1.000 41.14330  ? 281 TRP C CD2 1 
ATOM   7442  N  NE1 . TRP C 2 281 ? 16.01079  12.74057  -23.76148 1.000 45.85849  ? 281 TRP C NE1 1 
ATOM   7443  C  CE2 . TRP C 2 281 ? 15.02173  13.40211  -23.08370 1.000 37.45377  ? 281 TRP C CE2 1 
ATOM   7444  C  CE3 . TRP C 2 281 ? 13.36334  15.10151  -23.54084 1.000 46.11597  ? 281 TRP C CE3 1 
ATOM   7445  C  CZ2 . TRP C 2 281 ? 14.61349  13.28983  -21.75600 1.000 36.09497  ? 281 TRP C CZ2 1 
ATOM   7446  C  CZ3 . TRP C 2 281 ? 12.95685  14.98866  -22.21942 1.000 45.77682  ? 281 TRP C CZ3 1 
ATOM   7447  C  CH2 . TRP C 2 281 ? 13.58276  14.08933  -21.34330 1.000 38.66446  ? 281 TRP C CH2 1 
ATOM   7448  N  N   . GLY C 2 282 ? 12.55207  13.28314  -28.94328 1.000 50.42930  ? 282 GLY C N   1 
ATOM   7449  C  CA  . GLY C 2 282 ? 11.20116  12.76727  -29.06071 1.000 43.26699  ? 282 GLY C CA  1 
ATOM   7450  C  C   . GLY C 2 282 ? 10.14024  13.65310  -28.45694 1.000 47.30410  ? 282 GLY C C   1 
ATOM   7451  O  O   . GLY C 2 282 ? 9.08654   13.15308  -28.05101 1.000 48.10162  ? 282 GLY C O   1 
ATOM   7452  N  N   . CYS C 2 283 ? 10.38638  14.96407  -28.39563 1.000 49.19533  ? 283 CYS C N   1 
ATOM   7453  C  CA  . CYS C 2 283 ? 9.49858   15.90901  -27.71752 1.000 52.58348  ? 283 CYS C CA  1 
ATOM   7454  C  C   . CYS C 2 283 ? 9.26360   15.50607  -26.26340 1.000 50.78671  ? 283 CYS C C   1 
ATOM   7455  O  O   . CYS C 2 283 ? 8.21561   15.80335  -25.68426 1.000 52.35980  ? 283 CYS C O   1 
ATOM   7456  C  CB  . CYS C 2 283 ? 8.16952   16.05902  -28.46474 1.000 55.46554  ? 283 CYS C CB  1 
ATOM   7457  S  SG  . CYS C 2 283 ? 8.36118   16.45590  -30.22288 1.000 61.84550  ? 283 CYS C SG  1 
ATOM   7458  N  N   . GLY C 2 284 ? 10.24306  14.82337  -25.67007 1.000 47.43169  ? 284 GLY C N   1 
ATOM   7459  C  CA  . GLY C 2 284 ? 10.15558  14.34339  -24.30862 1.000 48.46820  ? 284 GLY C CA  1 
ATOM   7460  C  C   . GLY C 2 284 ? 9.82856   12.87279  -24.15278 1.000 51.52690  ? 284 GLY C C   1 
ATOM   7461  O  O   . GLY C 2 284 ? 9.66584   12.41253  -23.01638 1.000 46.25349  ? 284 GLY C O   1 
ATOM   7462  N  N   . MET C 2 285 ? 9.74308   12.11292  -25.25052 1.000 45.51416  ? 285 MET C N   1 
ATOM   7463  C  CA  . MET C 2 285 ? 9.22652   10.75194  -25.16485 1.000 40.21682  ? 285 MET C CA  1 
ATOM   7464  C  C   . MET C 2 285 ? 10.05915  9.73892   -25.94552 1.000 41.05004  ? 285 MET C C   1 
ATOM   7465  O  O   . MET C 2 285 ? 9.55286   8.65660   -26.26466 1.000 42.62435  ? 285 MET C O   1 
ATOM   7466  C  CB  . MET C 2 285 ? 7.77780   10.70371  -25.66506 1.000 42.76814  ? 285 MET C CB  1 
ATOM   7467  C  CG  . MET C 2 285 ? 6.82209   11.61285  -24.90082 1.000 45.74689  ? 285 MET C CG  1 
ATOM   7468  S  SD  . MET C 2 285 ? 5.17348   11.66446  -25.61880 1.000 55.58048  ? 285 MET C SD  1 
ATOM   7469  C  CE  . MET C 2 285 ? 5.53375   12.21307  -27.28680 1.000 58.36193  ? 285 MET C CE  1 
ATOM   7470  N  N   . ALA C 2 286 ? 11.31566  10.04661  -26.25268 1.000 40.96328  ? 286 ALA C N   1 
ATOM   7471  C  CA  . ALA C 2 286 ? 12.14835  9.16938   -27.06325 1.000 46.55499  ? 286 ALA C CA  1 
ATOM   7472  C  C   . ALA C 2 286 ? 12.87411  8.10807   -26.24955 1.000 40.90902  ? 286 ALA C C   1 
ATOM   7473  O  O   . ALA C 2 286 ? 13.66341  7.34871   -26.82199 1.000 42.71323  ? 286 ALA C O   1 
ATOM   7474  C  CB  . ALA C 2 286 ? 13.17368  9.99200   -27.84962 1.000 36.86322  ? 286 ALA C CB  1 
ATOM   7475  N  N   . HIS C 2 287 ? 12.63995  8.04834   -24.93688 1.000 34.25088  ? 287 HIS C N   1 
ATOM   7476  C  CA  . HIS C 2 287 ? 13.34685  7.12259   -24.04751 1.000 35.21882  ? 287 HIS C CA  1 
ATOM   7477  C  C   . HIS C 2 287 ? 14.85682  7.27072   -24.17006 1.000 43.13584  ? 287 HIS C C   1 
ATOM   7478  O  O   . HIS C 2 287 ? 15.60659  6.30569   -24.00699 1.000 41.66427  ? 287 HIS C O   1 
ATOM   7479  C  CB  . HIS C 2 287 ? 12.92969  5.66941   -24.29277 1.000 38.80626  ? 287 HIS C CB  1 
ATOM   7480  C  CG  . HIS C 2 287 ? 11.60356  5.31460   -23.69379 1.000 37.93543  ? 287 HIS C CG  1 
ATOM   7481  N  ND1 . HIS C 2 287 ? 10.42241  5.39436   -24.39960 1.000 36.17905  ? 287 HIS C ND1 1 
ATOM   7482  C  CD2 . HIS C 2 287 ? 11.26958  4.90140   -22.44771 1.000 33.49143  ? 287 HIS C CD2 1 
ATOM   7483  C  CE1 . HIS C 2 287 ? 9.41953   5.02434   -23.62200 1.000 38.16685  ? 287 HIS C CE1 1 
ATOM   7484  N  NE2 . HIS C 2 287 ? 9.90624   4.72782   -22.42994 1.000 42.34652  ? 287 HIS C NE2 1 
ATOM   7485  N  N   . LYS C 2 288 ? 15.32528  8.47978   -24.45792 1.000 36.03041  ? 288 LYS C N   1 
ATOM   7486  C  CA  . LYS C 2 288 ? 16.76065  8.73738   -24.49730 1.000 33.26118  ? 288 LYS C CA  1 
ATOM   7487  C  C   . LYS C 2 288 ? 17.17195  9.21005   -23.10912 1.000 39.27719  ? 288 LYS C C   1 
ATOM   7488  O  O   . LYS C 2 288 ? 17.03430  10.38778  -22.76943 1.000 38.93599  ? 288 LYS C O   1 
ATOM   7489  C  CB  . LYS C 2 288 ? 17.10652  9.74297   -25.58802 1.000 32.64482  ? 288 LYS C CB  1 
ATOM   7490  C  CG  . LYS C 2 288 ? 16.79874  9.22421   -26.98983 1.000 36.36155  ? 288 LYS C CG  1 
ATOM   7491  C  CD  . LYS C 2 288 ? 17.30948  10.16573  -28.06836 1.000 33.55034  ? 288 LYS C CD  1 
ATOM   7492  C  CE  . LYS C 2 288 ? 16.81693  9.74289   -29.43917 1.000 36.09211  ? 288 LYS C CE  1 
ATOM   7493  N  NZ  . LYS C 2 288 ? 17.33342  10.64636  -30.50396 1.000 38.65130  ? 288 LYS C NZ  1 
ATOM   7494  N  N   . THR C 2 289 ? 17.66706  8.27726   -22.30106 1.000 31.68770  ? 289 THR C N   1 
ATOM   7495  C  CA  . THR C 2 289 ? 18.04470  8.58635   -20.93205 1.000 34.73736  ? 289 THR C CA  1 
ATOM   7496  C  C   . THR C 2 289 ? 19.31592  9.42348   -20.90484 1.000 32.63029  ? 289 THR C C   1 
ATOM   7497  O  O   . THR C 2 289 ? 20.28256  9.14361   -21.61736 1.000 32.46514  ? 289 THR C O   1 
ATOM   7498  C  CB  . THR C 2 289 ? 18.24475  7.29264   -20.14170 1.000 33.90115  ? 289 THR C CB  1 
ATOM   7499  O  OG1 . THR C 2 289 ? 17.02238  6.54889   -20.13415 1.000 36.87291  ? 289 THR C OG1 1 
ATOM   7500  C  CG2 . THR C 2 289 ? 18.64864  7.58777   -18.71152 1.000 31.94396  ? 289 THR C CG2 1 
ATOM   7501  N  N   . ILE C 2 290 ? 19.30818  10.46319  -20.07879 1.000 27.08838  ? 290 ILE C N   1 
ATOM   7502  C  CA  . ILE C 2 290 ? 20.45423  11.34239  -19.90748 1.000 26.89304  ? 290 ILE C CA  1 
ATOM   7503  C  C   . ILE C 2 290 ? 20.95338  11.18036  -18.48123 1.000 30.08682  ? 290 ILE C C   1 
ATOM   7504  O  O   . ILE C 2 290 ? 20.21198  11.42943  -17.52187 1.000 35.46115  ? 290 ILE C O   1 
ATOM   7505  C  CB  . ILE C 2 290 ? 20.10150  12.80414  -20.21145 1.000 28.92596  ? 290 ILE C CB  1 
ATOM   7506  C  CG1 . ILE C 2 290 ? 19.50437  12.91292  -21.61366 1.000 32.63478  ? 290 ILE C CG1 1 
ATOM   7507  C  CG2 . ILE C 2 290 ? 21.34073  13.68043  -20.07822 1.000 31.80569  ? 290 ILE C CG2 1 
ATOM   7508  C  CD1 . ILE C 2 290 ? 18.96275  14.27794  -21.94506 1.000 31.92321  ? 290 ILE C CD1 1 
ATOM   7509  N  N   . LYS C 2 291 ? 22.20034  10.74631  -18.34581 1.000 28.28453  ? 291 LYS C N   1 
ATOM   7510  C  CA  . LYS C 2 291 ? 22.85751  10.60166  -17.05869 1.000 33.37523  ? 291 LYS C CA  1 
ATOM   7511  C  C   . LYS C 2 291 ? 24.07050  11.51753  -16.99335 1.000 30.77414  ? 291 LYS C C   1 
ATOM   7512  O  O   . LYS C 2 291 ? 24.70614  11.81158  -18.00943 1.000 33.12654  ? 291 LYS C O   1 
ATOM   7513  C  CB  . LYS C 2 291 ? 23.29785  9.15710   -16.82091 1.000 27.61109  ? 291 LYS C CB  1 
ATOM   7514  C  CG  . LYS C 2 291 ? 22.16331  8.15572   -16.80192 1.000 26.62801  ? 291 LYS C CG  1 
ATOM   7515  C  CD  . LYS C 2 291 ? 22.71559  6.77626   -16.54994 1.000 30.15980  ? 291 LYS C CD  1 
ATOM   7516  C  CE  . LYS C 2 291 ? 21.64088  5.71833   -16.59958 1.000 34.17444  ? 291 LYS C CE  1 
ATOM   7517  N  NZ  . LYS C 2 291 ? 22.25516  4.37117   -16.44529 1.000 33.44134  ? 291 LYS C NZ  1 
ATOM   7518  N  N   . GLY C 2 292 ? 24.37889  11.97953  -15.79068 1.000 31.86325  ? 292 GLY C N   1 
ATOM   7519  C  CA  . GLY C 2 292 ? 25.57177  12.77277  -15.59053 1.000 30.99894  ? 292 GLY C CA  1 
ATOM   7520  C  C   . GLY C 2 292 ? 26.06187  12.65193  -14.16736 1.000 35.63854  ? 292 GLY C C   1 
ATOM   7521  O  O   . GLY C 2 292 ? 25.37214  13.10002  -13.25009 1.000 40.44547  ? 292 GLY C O   1 
ATOM   7522  N  N   . GLY C 2 293 ? 27.23631  12.07166  -13.95622 1.000 35.44362  ? 293 GLY C N   1 
ATOM   7523  C  CA  . GLY C 2 293 ? 27.67591  11.75191  -12.61144 1.000 38.24856  ? 293 GLY C CA  1 
ATOM   7524  C  C   . GLY C 2 293 ? 29.13195  12.08478  -12.36911 1.000 38.18123  ? 293 GLY C C   1 
ATOM   7525  O  O   . GLY C 2 293 ? 29.97864  11.97417  -13.25867 1.000 37.87931  ? 293 GLY C O   1 
ATOM   7526  N  N   . LEU C 2 294 ? 29.41217  12.48869  -11.13068 1.000 37.59433  ? 294 LEU C N   1 
ATOM   7527  C  CA  . LEU C 2 294 ? 30.77976  12.64462  -10.66185 1.000 33.46396  ? 294 LEU C CA  1 
ATOM   7528  C  C   . LEU C 2 294 ? 31.42779  11.27588  -10.50186 1.000 35.50229  ? 294 LEU C C   1 
ATOM   7529  O  O   . LEU C 2 294 ? 30.75958  10.28032  -10.20819 1.000 34.82218  ? 294 LEU C O   1 
ATOM   7530  C  CB  . LEU C 2 294 ? 30.79931  13.38904  -9.32706  1.000 43.01949  ? 294 LEU C CB  1 
ATOM   7531  C  CG  . LEU C 2 294 ? 32.13982  13.68678  -8.65295  1.000 47.43910  ? 294 LEU C CG  1 
ATOM   7532  C  CD1 . LEU C 2 294 ? 32.82152  14.88036  -9.30176  1.000 46.42224  ? 294 LEU C CD1 1 
ATOM   7533  C  CD2 . LEU C 2 294 ? 31.94149  13.91584  -7.17082  1.000 50.79663  ? 294 LEU C CD2 1 
ATOM   7534  N  N   . CYS C 2 295 ? 32.74435  11.23520  -10.67945 1.000 36.10851  ? 295 CYS C N   1 
ATOM   7535  C  CA  . CYS C 2 295 ? 33.45208  9.96470   -10.62881 1.000 37.22405  ? 295 CYS C CA  1 
ATOM   7536  C  C   . CYS C 2 295 ? 33.34531  9.34980   -9.23642  1.000 35.78184  ? 295 CYS C C   1 
ATOM   7537  O  O   . CYS C 2 295 ? 33.41232  10.06668  -8.22771  1.000 35.07670  ? 295 CYS C O   1 
ATOM   7538  C  CB  . CYS C 2 295 ? 34.92353  10.14381  -10.99608 1.000 37.98604  ? 295 CYS C CB  1 
ATOM   7539  S  SG  . CYS C 2 295 ? 35.88358  11.11871  -9.82211  1.000 40.94599  ? 295 CYS C SG  1 
ATOM   7540  N  N   . PRO C 2 296 ? 33.16804  8.03823   -9.14202  1.000 32.81724  ? 296 PRO C N   1 
ATOM   7541  C  CA  . PRO C 2 296 ? 33.19781  7.39103   -7.83155  1.000 38.04273  ? 296 PRO C CA  1 
ATOM   7542  C  C   . PRO C 2 296 ? 34.59897  7.40378   -7.24417  1.000 44.11649  ? 296 PRO C C   1 
ATOM   7543  O  O   . PRO C 2 296 ? 35.60504  7.39614   -7.95856  1.000 37.21782  ? 296 PRO C O   1 
ATOM   7544  C  CB  . PRO C 2 296 ? 32.72305  5.96376   -8.12723  1.000 38.57092  ? 296 PRO C CB  1 
ATOM   7545  C  CG  . PRO C 2 296 ? 32.99884  5.76119   -9.56544  1.000 33.49323  ? 296 PRO C CG  1 
ATOM   7546  C  CD  . PRO C 2 296 ? 32.84055  7.09482   -10.22313 1.000 29.94239  ? 296 PRO C CD  1 
ATOM   7547  N  N   . GLY C 2 297 ? 34.64965  7.44928   -5.91859  1.000 37.41687  ? 297 GLY C N   1 
ATOM   7548  C  CA  . GLY C 2 297 ? 35.90223  7.38471   -5.20261  1.000 39.18388  ? 297 GLY C CA  1 
ATOM   7549  C  C   . GLY C 2 297 ? 35.87201  6.31441   -4.13558  1.000 36.26708  ? 297 GLY C C   1 
ATOM   7550  O  O   . GLY C 2 297 ? 35.06109  5.38476   -4.19729  1.000 37.44140  ? 297 GLY C O   1 
ATOM   7551  N  N   . GLY C 2 298 ? 36.74964  6.43941   -3.14876  1.000 34.92248  ? 298 GLY C N   1 
ATOM   7552  C  CA  . GLY C 2 298 ? 36.81419  5.49505   -2.05711  1.000 43.32085  ? 298 GLY C CA  1 
ATOM   7553  C  C   . GLY C 2 298 ? 37.78563  4.35820   -2.31428  1.000 36.45817  ? 298 GLY C C   1 
ATOM   7554  O  O   . GLY C 2 298 ? 38.31931  4.17330   -3.41199  1.000 36.84231  ? 298 GLY C O   1 
ATOM   7555  N  N   . ARG C 2 299 ? 37.99424  3.56659   -1.25988  1.000 38.45527  ? 299 ARG C N   1 
ATOM   7556  C  CA  . ARG C 2 299 ? 38.97878  2.49065   -1.30223  1.000 36.56505  ? 299 ARG C CA  1 
ATOM   7557  C  C   . ARG C 2 299 ? 38.59105  1.41435   -2.30691  1.000 35.22007  ? 299 ARG C C   1 
ATOM   7558  O  O   . ARG C 2 299 ? 39.41111  1.00570   -3.13865  1.000 37.02929  ? 299 ARG C O   1 
ATOM   7559  C  CB  . ARG C 2 299 ? 39.13928  1.88757   0.09098   1.000 36.55543  ? 299 ARG C CB  1 
ATOM   7560  C  CG  . ARG C 2 299 ? 39.88493  0.57161   0.11734   1.000 37.25412  ? 299 ARG C CG  1 
ATOM   7561  C  CD  . ARG C 2 299 ? 40.23169  0.20196   1.54534   1.000 48.27791  ? 299 ARG C CD  1 
ATOM   7562  N  NE  . ARG C 2 299 ? 41.02694  -1.01563  1.62350   1.000 50.27786  ? 299 ARG C NE  1 
ATOM   7563  C  CZ  . ARG C 2 299 ? 41.50294  -1.51938  2.75274   1.000 50.57949  ? 299 ARG C CZ  1 
ATOM   7564  N  NH1 . ARG C 2 299 ? 41.28460  -0.93031  3.91715   1.000 51.44801  ? 299 ARG C NH1 1 
ATOM   7565  N  NH2 . ARG C 2 299 ? 42.21887  -2.63920  2.71284   1.000 59.55966  ? 299 ARG C NH2 1 
ATOM   7566  N  N   . LEU C 2 300 ? 37.34400  0.93943   -2.24371  1.000 34.25210  ? 300 LEU C N   1 
ATOM   7567  C  CA  . LEU C 2 300 ? 36.93856  -0.18820  -3.07887  1.000 36.96838  ? 300 LEU C CA  1 
ATOM   7568  C  C   . LEU C 2 300 ? 37.05266  0.14030   -4.56106  1.000 35.63887  ? 300 LEU C C   1 
ATOM   7569  O  O   . LEU C 2 300 ? 37.51786  -0.68987  -5.35169  1.000 39.30603  ? 300 LEU C O   1 
ATOM   7570  C  CB  . LEU C 2 300 ? 35.51298  -0.61136  -2.73469  1.000 36.62733  ? 300 LEU C CB  1 
ATOM   7571  C  CG  . LEU C 2 300 ? 34.99495  -1.79015  -3.55095  1.000 36.93627  ? 300 LEU C CG  1 
ATOM   7572  C  CD1 . LEU C 2 300 ? 35.83185  -3.02648  -3.27634  1.000 38.67841  ? 300 LEU C CD1 1 
ATOM   7573  C  CD2 . LEU C 2 300 ? 33.53872  -2.04014  -3.22707  1.000 33.83524  ? 300 LEU C CD2 1 
ATOM   7574  N  N   . ARG C 2 301 ? 36.63233  1.34541   -4.95681  1.000 38.72281  ? 301 ARG C N   1 
ATOM   7575  C  CA  . ARG C 2 301 ? 36.75927  1.76060   -6.35178  1.000 27.05184  ? 301 ARG C CA  1 
ATOM   7576  C  C   . ARG C 2 301 ? 38.21131  1.71874   -6.80387  1.000 32.98976  ? 301 ARG C C   1 
ATOM   7577  O  O   . ARG C 2 301 ? 38.52526  1.19528   -7.87794  1.000 31.39673  ? 301 ARG C O   1 
ATOM   7578  C  CB  . ARG C 2 301 ? 36.19132  3.16630   -6.52874  1.000 31.82644  ? 301 ARG C CB  1 
ATOM   7579  C  CG  . ARG C 2 301 ? 36.33220  3.72348   -7.93069  1.000 32.69178  ? 301 ARG C CG  1 
ATOM   7580  C  CD  . ARG C 2 301 ? 35.59853  2.86276   -8.94360  1.000 34.70622  ? 301 ARG C CD  1 
ATOM   7581  N  NE  . ARG C 2 301 ? 35.35378  3.58684   -10.18513 1.000 31.26376  ? 301 ARG C NE  1 
ATOM   7582  C  CZ  . ARG C 2 301 ? 34.58649  3.13919   -11.16855 1.000 28.20899  ? 301 ARG C CZ  1 
ATOM   7583  N  NH1 . ARG C 2 301 ? 33.99806  1.95757   -11.10045 1.000 25.18940  ? 301 ARG C NH1 1 
ATOM   7584  N  NH2 . ARG C 2 301 ? 34.39189  3.90297   -12.23984 1.000 28.82688  ? 301 ARG C NH2 1 
ATOM   7585  N  N   . MET C 2 302 ? 39.11590  2.25772   -5.98299  1.000 36.75713  ? 302 MET C N   1 
ATOM   7586  C  CA  . MET C 2 302 ? 40.53247  2.24552   -6.32970  1.000 34.21158  ? 302 MET C CA  1 
ATOM   7587  C  C   . MET C 2 302 ? 41.06392  0.82121   -6.40806  1.000 35.64081  ? 302 MET C C   1 
ATOM   7588  O  O   . MET C 2 302 ? 41.86220  0.49718   -7.29436  1.000 39.07872  ? 302 MET C O   1 
ATOM   7589  C  CB  . MET C 2 302 ? 41.33085  3.05470   -5.30584  1.000 33.80226  ? 302 MET C CB  1 
ATOM   7590  C  CG  . MET C 2 302 ? 41.00261  4.54183   -5.25064  1.000 34.44542  ? 302 MET C CG  1 
ATOM   7591  S  SD  . MET C 2 302 ? 41.42058  5.44143   -6.75913  1.000 37.11034  ? 302 MET C SD  1 
ATOM   7592  C  CE  . MET C 2 302 ? 39.82204  5.60014   -7.54948  1.000 25.91342  ? 302 MET C CE  1 
ATOM   7593  N  N   . GLU C 2 303 ? 40.64505  -0.03996  -5.47568  1.000 37.35757  ? 303 GLU C N   1 
ATOM   7594  C  CA  . GLU C 2 303 ? 41.13161  -1.41677  -5.46114  1.000 44.36730  ? 303 GLU C CA  1 
ATOM   7595  C  C   . GLU C 2 303 ? 40.71494  -2.17443  -6.71631  1.000 39.45515  ? 303 GLU C C   1 
ATOM   7596  O  O   . GLU C 2 303 ? 41.48426  -2.98548  -7.24537  1.000 38.38396  ? 303 GLU C O   1 
ATOM   7597  C  CB  . GLU C 2 303 ? 40.62796  -2.13254  -4.20882  1.000 35.47448  ? 303 GLU C CB  1 
ATOM   7598  C  CG  . GLU C 2 303 ? 41.32496  -1.68591  -2.93780  1.000 42.05759  ? 303 GLU C CG  1 
ATOM   7599  C  CD  . GLU C 2 303 ? 40.78358  -2.36994  -1.70172  1.000 44.38753  ? 303 GLU C CD  1 
ATOM   7600  O  OE1 . GLU C 2 303 ? 39.70213  -2.99069  -1.79448  1.000 53.10541  ? 303 GLU C OE1 1 
ATOM   7601  O  OE2 . GLU C 2 303 ? 41.43817  -2.28482  -0.63779  1.000 51.06524  ? 303 GLU C OE2 1 
ATOM   7602  N  N   . ARG C 2 304 ? 39.49930  -1.93414  -7.20458  1.000 35.51602  ? 304 ARG C N   1 
ATOM   7603  C  CA  . ARG C 2 304 ? 39.04173  -2.65201  -8.38870  1.000 32.52806  ? 304 ARG C CA  1 
ATOM   7604  C  C   . ARG C 2 304 ? 39.73917  -2.15708  -9.64763  1.000 37.31101  ? 304 ARG C C   1 
ATOM   7605  O  O   . ARG C 2 304 ? 40.04273  -2.95195  -10.54497 1.000 37.96134  ? 304 ARG C O   1 
ATOM   7606  C  CB  . ARG C 2 304 ? 37.52735  -2.54314  -8.51584  1.000 35.27348  ? 304 ARG C CB  1 
ATOM   7607  C  CG  . ARG C 2 304 ? 36.82252  -3.28571  -7.41014  1.000 40.78195  ? 304 ARG C CG  1 
ATOM   7608  C  CD  . ARG C 2 304 ? 35.33342  -3.29799  -7.59528  1.000 35.70333  ? 304 ARG C CD  1 
ATOM   7609  N  NE  . ARG C 2 304 ? 34.73773  -4.38791  -6.83439  1.000 41.75450  ? 304 ARG C NE  1 
ATOM   7610  C  CZ  . ARG C 2 304 ? 33.43676  -4.53572  -6.64280  1.000 40.88289  ? 304 ARG C CZ  1 
ATOM   7611  N  NH1 . ARG C 2 304 ? 32.56709  -3.66195  -7.12168  1.000 45.34702  ? 304 ARG C NH1 1 
ATOM   7612  N  NH2 . ARG C 2 304 ? 32.99801  -5.58556  -5.95379  1.000 60.71666  ? 304 ARG C NH2 1 
ATOM   7613  N  N   . LEU C 2 305 ? 40.00503  -0.85207  -9.73812  1.000 32.76275  ? 305 LEU C N   1 
ATOM   7614  C  CA  . LEU C 2 305 ? 40.73563  -0.34784  -10.89566 1.000 33.95868  ? 305 LEU C CA  1 
ATOM   7615  C  C   . LEU C 2 305 ? 42.19620  -0.77112  -10.85271 1.000 37.80341  ? 305 LEU C C   1 
ATOM   7616  O  O   . LEU C 2 305 ? 42.79889  -1.02959  -11.90110 1.000 38.54465  ? 305 LEU C O   1 
ATOM   7617  C  CB  . LEU C 2 305 ? 40.63295  1.17337   -10.96393 1.000 32.46460  ? 305 LEU C CB  1 
ATOM   7618  C  CG  . LEU C 2 305 ? 39.22101  1.75198   -11.04425 1.000 29.36471  ? 305 LEU C CG  1 
ATOM   7619  C  CD1 . LEU C 2 305 ? 39.28449  3.21284   -11.43551 1.000 32.98261  ? 305 LEU C CD1 1 
ATOM   7620  C  CD2 . LEU C 2 305 ? 38.35817  0.96481   -12.00736 1.000 28.17887  ? 305 LEU C CD2 1 
ATOM   7621  N  N   . ILE C 2 306 ? 42.77502  -0.85731  -9.65435  1.000 30.02451  ? 306 ILE C N   1 
ATOM   7622  C  CA  . ILE C 2 306 ? 44.12575  -1.39040  -9.51446  1.000 40.31781  ? 306 ILE C CA  1 
ATOM   7623  C  C   . ILE C 2 306 ? 44.17212  -2.83746  -9.98832  1.000 36.72068  ? 306 ILE C C   1 
ATOM   7624  O  O   . ILE C 2 306 ? 45.12880  -3.26236  -10.64966 1.000 36.87585  ? 306 ILE C O   1 
ATOM   7625  C  CB  . ILE C 2 306 ? 44.60337  -1.23861  -8.05739  1.000 38.82238  ? 306 ILE C CB  1 
ATOM   7626  C  CG1 . ILE C 2 306 ? 44.98038  0.22071   -7.77920  1.000 38.82276  ? 306 ILE C CG1 1 
ATOM   7627  C  CG2 . ILE C 2 306 ? 45.75463  -2.18378  -7.76107  1.000 41.22860  ? 306 ILE C CG2 1 
ATOM   7628  C  CD1 . ILE C 2 306 ? 45.24994  0.54037   -6.31321  1.000 33.44190  ? 306 ILE C CD1 1 
ATOM   7629  N  N   . ASP C 2 307 ? 43.13292  -3.61353  -9.66976  1.000 34.12975  ? 307 ASP C N   1 
ATOM   7630  C  CA  . ASP C 2 307 ? 43.07010  -4.99348  -10.13765 1.000 37.18046  ? 307 ASP C CA  1 
ATOM   7631  C  C   . ASP C 2 307 ? 42.96874  -5.05473  -11.65801 1.000 40.25691  ? 307 ASP C C   1 
ATOM   7632  O  O   . ASP C 2 307 ? 43.56024  -5.93678  -12.29263 1.000 38.90561  ? 307 ASP C O   1 
ATOM   7633  C  CB  . ASP C 2 307 ? 41.88353  -5.70890  -9.49348  1.000 36.69504  ? 307 ASP C CB  1 
ATOM   7634  C  CG  . ASP C 2 307 ? 42.18471  -6.19515  -8.08970  1.000 40.52270  ? 307 ASP C CG  1 
ATOM   7635  O  OD1 . ASP C 2 307 ? 43.34315  -6.06385  -7.64070  1.000 56.59896  ? 307 ASP C OD1 1 
ATOM   7636  O  OD2 . ASP C 2 307 ? 41.25648  -6.71196  -7.43374  1.000 62.38925  ? 307 ASP C OD2 1 
ATOM   7637  N  N   . LEU C 2 308 ? 42.22554  -4.12195  -12.26123 1.000 35.24471  ? 308 LEU C N   1 
ATOM   7638  C  CA  . LEU C 2 308 ? 42.13641  -4.07721  -13.71761 1.000 36.19936  ? 308 LEU C CA  1 
ATOM   7639  C  C   . LEU C 2 308 ? 43.49985  -3.81762  -14.34044 1.000 34.87437  ? 308 LEU C C   1 
ATOM   7640  O  O   . LEU C 2 308 ? 43.83324  -4.38689  -15.38515 1.000 39.67083  ? 308 LEU C O   1 
ATOM   7641  C  CB  . LEU C 2 308 ? 41.14276  -3.00317  -14.15191 1.000 31.05262  ? 308 LEU C CB  1 
ATOM   7642  C  CG  . LEU C 2 308 ? 39.66859  -3.30592  -13.91337 1.000 28.67636  ? 308 LEU C CG  1 
ATOM   7643  C  CD1 . LEU C 2 308 ? 38.81784  -2.11202  -14.31915 1.000 29.34136  ? 308 LEU C CD1 1 
ATOM   7644  C  CD2 . LEU C 2 308 ? 39.25023  -4.55404  -14.67842 1.000 32.09768  ? 308 LEU C CD2 1 
ATOM   7645  N  N   . VAL C 2 309 ? 44.30859  -2.97233  -13.70477 1.000 38.48433  ? 309 VAL C N   1 
ATOM   7646  C  CA  . VAL C 2 309 ? 45.65655  -2.72143  -14.19974 1.000 38.30568  ? 309 VAL C CA  1 
ATOM   7647  C  C   . VAL C 2 309 ? 46.56579  -3.90350  -13.89172 1.000 39.73484  ? 309 VAL C C   1 
ATOM   7648  O  O   . VAL C 2 309 ? 47.38842  -4.30326  -14.72353 1.000 37.85950  ? 309 VAL C O   1 
ATOM   7649  C  CB  . VAL C 2 309 ? 46.20015  -1.41181  -13.59855 1.000 34.36182  ? 309 VAL C CB  1 
ATOM   7650  C  CG1 . VAL C 2 309 ? 47.58712  -1.10889  -14.13326 1.000 30.94296  ? 309 VAL C CG1 1 
ATOM   7651  C  CG2 . VAL C 2 309 ? 45.25351  -0.25889  -13.89475 1.000 36.27054  ? 309 VAL C CG2 1 
ATOM   7652  N  N   . PHE C 2 310 ? 46.42346  -4.48553  -12.69943 1.000 36.60358  ? 310 PHE C N   1 
ATOM   7653  C  CA  . PHE C 2 310 ? 47.29395  -5.58294  -12.29216 1.000 41.44380  ? 310 PHE C CA  1 
ATOM   7654  C  C   . PHE C 2 310 ? 47.13192  -6.78971  -13.21264 1.000 42.92230  ? 310 PHE C C   1 
ATOM   7655  O  O   . PHE C 2 310 ? 48.12198  -7.38464  -13.65394 1.000 37.87782  ? 310 PHE C O   1 
ATOM   7656  C  CB  . PHE C 2 310 ? 47.00412  -5.95899  -10.83974 1.000 36.68602  ? 310 PHE C CB  1 
ATOM   7657  C  CG  . PHE C 2 310 ? 47.90173  -7.03134  -10.29942 1.000 44.19184  ? 310 PHE C CG  1 
ATOM   7658  C  CD1 . PHE C 2 310 ? 49.15346  -6.71552  -9.79882  1.000 50.80007  ? 310 PHE C CD1 1 
ATOM   7659  C  CD2 . PHE C 2 310 ? 47.49253  -8.35330  -10.28086 1.000 45.46231  ? 310 PHE C CD2 1 
ATOM   7660  C  CE1 . PHE C 2 310 ? 49.98210  -7.70052  -9.29474  1.000 49.94972  ? 310 PHE C CE1 1 
ATOM   7661  C  CE2 . PHE C 2 310 ? 48.31867  -9.34280  -9.77770  1.000 43.38722  ? 310 PHE C CE2 1 
ATOM   7662  C  CZ  . PHE C 2 310 ? 49.56226  -9.01545  -9.28432  1.000 37.63131  ? 310 PHE C CZ  1 
ATOM   7663  N  N   . TYR C 2 311 ? 45.89117  -7.17152  -13.51028 1.000 43.13601  ? 311 TYR C N   1 
ATOM   7664  C  CA  . TYR C 2 311 ? 45.62428  -8.29393  -14.40251 1.000 42.20040  ? 311 TYR C CA  1 
ATOM   7665  C  C   . TYR C 2 311 ? 45.61573  -7.88610  -15.87283 1.000 39.89990  ? 311 TYR C C   1 
ATOM   7666  O  O   . TYR C 2 311 ? 45.15271  -8.66018  -16.71756 1.000 41.11124  ? 311 TYR C O   1 
ATOM   7667  C  CB  . TYR C 2 311 ? 44.30014  -8.96488  -14.01982 1.000 41.15190  ? 311 TYR C CB  1 
ATOM   7668  C  CG  . TYR C 2 311 ? 44.34431  -9.56863  -12.63587 1.000 44.26582  ? 311 TYR C CG  1 
ATOM   7669  C  CD1 . TYR C 2 311 ? 45.02824  -10.75525 -12.39389 1.000 42.45160  ? 311 TYR C CD1 1 
ATOM   7670  C  CD2 . TYR C 2 311 ? 43.74155  -8.92912  -11.56091 1.000 44.44973  ? 311 TYR C CD2 1 
ATOM   7671  C  CE1 . TYR C 2 311 ? 45.08499  -11.30088 -11.12207 1.000 41.67239  ? 311 TYR C CE1 1 
ATOM   7672  C  CE2 . TYR C 2 311 ? 43.79608  -9.46299  -10.28608 1.000 45.78437  ? 311 TYR C CE2 1 
ATOM   7673  C  CZ  . TYR C 2 311 ? 44.46744  -10.64728 -10.07067 1.000 52.42530  ? 311 TYR C CZ  1 
ATOM   7674  O  OH  . TYR C 2 311 ? 44.51865  -11.17404 -8.79857  1.000 52.91371  ? 311 TYR C OH  1 
ATOM   7675  N  N   . LYS C 2 312 ? 46.12164  -6.69217  -16.18606 1.000 37.30970  ? 312 LYS C N   1 
ATOM   7676  C  CA  . LYS C 2 312 ? 46.39889  -6.26445  -17.55801 1.000 36.70203  ? 312 LYS C CA  1 
ATOM   7677  C  C   . LYS C 2 312 ? 45.13175  -6.19115  -18.40858 1.000 40.43785  ? 312 LYS C C   1 
ATOM   7678  O  O   . LYS C 2 312 ? 45.11796  -6.59173  -19.57491 1.000 42.44375  ? 312 LYS C O   1 
ATOM   7679  C  CB  . LYS C 2 312 ? 47.44844  -7.17179  -18.20148 1.000 37.20457  ? 312 LYS C CB  1 
ATOM   7680  C  CG  . LYS C 2 312 ? 48.77915  -7.14692  -17.45683 1.000 42.81815  ? 312 LYS C CG  1 
ATOM   7681  C  CD  . LYS C 2 312 ? 49.75883  -8.15732  -18.01814 1.000 60.44354  ? 312 LYS C CD  1 
ATOM   7682  C  CE  . LYS C 2 312 ? 51.05215  -8.17865  -17.21636 1.000 64.72362  ? 312 LYS C CE  1 
ATOM   7683  N  NZ  . LYS C 2 312 ? 51.95095  -9.27555  -17.67094 1.000 66.03494  ? 312 LYS C NZ  1 
ATOM   7684  N  N   . ARG C 2 313 ? 44.05297  -5.66930  -17.82199 1.000 35.90089  ? 313 ARG C N   1 
ATOM   7685  C  CA  . ARG C 2 313 ? 42.86549  -5.37219  -18.61197 1.000 33.85269  ? 313 ARG C CA  1 
ATOM   7686  C  C   . ARG C 2 313 ? 42.96258  -4.00121  -19.26768 1.000 37.46229  ? 313 ARG C C   1 
ATOM   7687  O  O   . ARG C 2 313 ? 42.42929  -3.80569  -20.36383 1.000 42.18959  ? 313 ARG C O   1 
ATOM   7688  C  CB  . ARG C 2 313 ? 41.60987  -5.44508  -17.74355 1.000 35.44194  ? 313 ARG C CB  1 
ATOM   7689  C  CG  . ARG C 2 313 ? 41.46909  -6.73162  -16.95146 1.000 35.43230  ? 313 ARG C CG  1 
ATOM   7690  C  CD  . ARG C 2 313 ? 41.53876  -7.95148  -17.84845 1.000 36.32963  ? 313 ARG C CD  1 
ATOM   7691  N  NE  . ARG C 2 313 ? 41.19589  -9.16850  -17.12346 1.000 41.97954  ? 313 ARG C NE  1 
ATOM   7692  C  CZ  . ARG C 2 313 ? 41.48491  -10.39457 -17.53695 1.000 36.40772  ? 313 ARG C CZ  1 
ATOM   7693  N  NH1 . ARG C 2 313 ? 42.14362  -10.60690 -18.66415 1.000 39.76279  ? 313 ARG C NH1 1 
ATOM   7694  N  NH2 . ARG C 2 313 ? 41.10721  -11.43322 -16.79868 1.000 35.83536  ? 313 ARG C NH2 1 
ATOM   7695  N  N   . VAL C 2 314 ? 43.61906  -3.04784  -18.60683 1.000 35.04616  ? 314 VAL C N   1 
ATOM   7696  C  CA  A VAL C 2 314 ? 43.84108  -1.70701  -19.13837 0.422 37.96162  ? 314 VAL C CA  1 
ATOM   7697  C  CA  B VAL C 2 314 ? 43.84985  -1.71427  -19.14934 0.578 38.02167  ? 314 VAL C CA  1 
ATOM   7698  C  C   . VAL C 2 314 ? 45.23973  -1.26282  -18.73436 1.000 38.54056  ? 314 VAL C C   1 
ATOM   7699  O  O   . VAL C 2 314 ? 45.69740  -1.55768  -17.62482 1.000 32.83203  ? 314 VAL C O   1 
ATOM   7700  C  CB  A VAL C 2 314 ? 42.77947  -0.70366  -18.62968 0.422 37.13742  ? 314 VAL C CB  1 
ATOM   7701  C  CB  B VAL C 2 314 ? 42.79619  -0.69214  -18.67139 0.578 35.29167  ? 314 VAL C CB  1 
ATOM   7702  C  CG1 A VAL C 2 314 ? 43.15780  0.72563   -18.98669 0.422 36.80579  ? 314 VAL C CG1 1 
ATOM   7703  C  CG1 B VAL C 2 314 ? 41.48787  -0.88840  -19.40625 0.578 44.87845  ? 314 VAL C CG1 1 
ATOM   7704  C  CG2 A VAL C 2 314 ? 41.42501  -1.02566  -19.21019 0.422 44.57379  ? 314 VAL C CG2 1 
ATOM   7705  C  CG2 B VAL C 2 314 ? 42.59629  -0.79674  -17.16914 0.578 33.43107  ? 314 VAL C CG2 1 
ATOM   7706  N  N   . ASP C 2 315 ? 45.91901  -0.55882  -19.63482 1.000 37.56777  ? 315 ASP C N   1 
ATOM   7707  C  CA  . ASP C 2 315 ? 47.20522  0.06660   -19.33314 1.000 34.36692  ? 315 ASP C CA  1 
ATOM   7708  C  C   . ASP C 2 315 ? 47.03553  1.56952   -19.49732 1.000 35.11415  ? 315 ASP C C   1 
ATOM   7709  O  O   . ASP C 2 315 ? 47.00527  2.07476   -20.63426 1.000 37.74634  ? 315 ASP C O   1 
ATOM   7710  C  CB  . ASP C 2 315 ? 48.31616  -0.46068  -20.23772 1.000 37.40169  ? 315 ASP C CB  1 
ATOM   7711  C  CG  . ASP C 2 315 ? 49.68253  0.05218   -19.83500 1.000 44.01580  ? 315 ASP C CG  1 
ATOM   7712  O  OD1 . ASP C 2 315 ? 49.78560  0.73777   -18.79325 1.000 40.68236  ? 315 ASP C OD1 1 
ATOM   7713  O  OD2 . ASP C 2 315 ? 50.65895  -0.23361  -20.55634 1.000 55.99611  ? 315 ASP C OD2 1 
ATOM   7714  N  N   . PRO C 2 316 ? 46.88987  2.32172   -18.40434 1.000 31.53091  ? 316 PRO C N   1 
ATOM   7715  C  CA  . PRO C 2 316 ? 46.69352  3.77188   -18.51009 1.000 35.12544  ? 316 PRO C CA  1 
ATOM   7716  C  C   . PRO C 2 316 ? 47.95855  4.55212   -18.82265 1.000 36.46883  ? 316 PRO C C   1 
ATOM   7717  O  O   . PRO C 2 316 ? 47.88250  5.78007   -18.94018 1.000 34.83356  ? 316 PRO C O   1 
ATOM   7718  C  CB  . PRO C 2 316 ? 46.17452  4.14004   -17.11500 1.000 32.54555  ? 316 PRO C CB  1 
ATOM   7719  C  CG  . PRO C 2 316 ? 46.88331  3.16716   -16.22204 1.000 30.50258  ? 316 PRO C CG  1 
ATOM   7720  C  CD  . PRO C 2 316 ? 46.92153  1.87193   -17.00143 1.000 32.63250  ? 316 PRO C CD  1 
ATOM   7721  N  N   . SER C 2 317 ? 49.10650  3.88014   -18.97071 1.000 37.72810  ? 317 SER C N   1 
ATOM   7722  C  CA  . SER C 2 317 ? 50.37042  4.58538   -19.16000 1.000 35.15934  ? 317 SER C CA  1 
ATOM   7723  C  C   . SER C 2 317 ? 50.35665  5.44411   -20.41132 1.000 39.79907  ? 317 SER C C   1 
ATOM   7724  O  O   . SER C 2 317 ? 51.01418  6.48982   -20.45258 1.000 38.87098  ? 317 SER C O   1 
ATOM   7725  C  CB  . SER C 2 317 ? 51.52960  3.59076   -19.24725 1.000 29.80866  ? 317 SER C CB  1 
ATOM   7726  O  OG  . SER C 2 317 ? 51.52291  2.68794   -18.15768 1.000 44.56819  ? 317 SER C OG  1 
ATOM   7727  N  N   . LYS C 2 318 ? 49.61394  5.03118   -21.43505 1.000 35.90148  ? 318 LYS C N   1 
ATOM   7728  C  CA  A LYS C 2 318 ? 49.61425  5.78507   -22.68029 0.615 41.75264  ? 318 LYS C CA  1 
ATOM   7729  C  CA  B LYS C 2 318 ? 49.57628  5.76737   -22.69126 0.385 41.98445  ? 318 LYS C CA  1 
ATOM   7730  C  C   . LYS C 2 318 ? 48.88809  7.11940   -22.56164 1.000 43.32302  ? 318 LYS C C   1 
ATOM   7731  O  O   . LYS C 2 318 ? 48.95859  7.92283   -23.49664 1.000 42.35217  ? 318 LYS C O   1 
ATOM   7732  C  CB  A LYS C 2 318 ? 49.00694  4.94185   -23.80264 0.615 40.30067  ? 318 LYS C CB  1 
ATOM   7733  C  CB  B LYS C 2 318 ? 48.88008  4.91957   -23.75305 0.385 40.25484  ? 318 LYS C CB  1 
ATOM   7734  C  CG  A LYS C 2 318 ? 49.79926  5.01583   -25.10044 0.615 40.46932  ? 318 LYS C CG  1 
ATOM   7735  C  CG  B LYS C 2 318 ? 49.24663  3.44731   -23.67254 0.385 39.87331  ? 318 LYS C CG  1 
ATOM   7736  C  CD  A LYS C 2 318 ? 49.35915  3.96517   -26.10011 0.615 40.15385  ? 318 LYS C CD  1 
ATOM   7737  C  CD  B LYS C 2 318 ? 50.62718  3.16439   -24.23034 0.385 41.52676  ? 318 LYS C CD  1 
ATOM   7738  C  CE  A LYS C 2 318 ? 49.94567  4.24210   -27.46996 0.615 41.40410  ? 318 LYS C CE  1 
ATOM   7739  C  CE  B LYS C 2 318 ? 51.06739  1.74221   -23.90721 0.385 47.56874  ? 318 LYS C CE  1 
ATOM   7740  N  NZ  A LYS C 2 318 ? 49.53398  5.58475   -27.96251 0.615 40.15258  ? 318 LYS C NZ  1 
ATOM   7741  N  NZ  B LYS C 2 318 ? 52.40075  1.40940   -24.48462 0.385 42.94957  ? 318 LYS C NZ  1 
ATOM   7742  N  N   . LEU C 2 319 ? 48.21036  7.37991   -21.43893 1.000 37.24871  ? 319 LEU C N   1 
ATOM   7743  C  CA  . LEU C 2 319 ? 47.63711  8.70016   -21.20358 1.000 35.53285  ? 319 LEU C CA  1 
ATOM   7744  C  C   . LEU C 2 319 ? 48.71645  9.72271   -20.88447 1.000 35.19533  ? 319 LEU C C   1 
ATOM   7745  O  O   . LEU C 2 319 ? 48.51424  10.92302  -21.08950 1.000 35.93075  ? 319 LEU C O   1 
ATOM   7746  C  CB  . LEU C 2 319 ? 46.63263  8.64731   -20.05090 1.000 30.69105  ? 319 LEU C CB  1 
ATOM   7747  C  CG  . LEU C 2 319 ? 45.42107  7.73074   -20.18972 1.000 32.66829  ? 319 LEU C CG  1 
ATOM   7748  C  CD1 . LEU C 2 319 ? 44.60303  7.76029   -18.91763 1.000 26.25439  ? 319 LEU C CD1 1 
ATOM   7749  C  CD2 . LEU C 2 319 ? 44.58540  8.16601   -21.38010 1.000 28.27592  ? 319 LEU C CD2 1 
ATOM   7750  N  N   . VAL C 2 320 ? 49.84667  9.27256   -20.35475 1.000 31.03079  ? 320 VAL C N   1 
ATOM   7751  C  CA  . VAL C 2 320 ? 50.89966  10.15960  -19.87921 1.000 41.34524  ? 320 VAL C CA  1 
ATOM   7752  C  C   . VAL C 2 320 ? 51.81352  10.52277  -21.04309 1.000 42.27747  ? 320 VAL C C   1 
ATOM   7753  O  O   . VAL C 2 320 ? 52.50388  9.65872   -21.59464 1.000 42.67584  ? 320 VAL C O   1 
ATOM   7754  C  CB  . VAL C 2 320 ? 51.69198  9.50571   -18.73891 1.000 37.62191  ? 320 VAL C CB  1 
ATOM   7755  C  CG1 . VAL C 2 320 ? 52.70733  10.47869  -18.18345 1.000 35.67048  ? 320 VAL C CG1 1 
ATOM   7756  C  CG2 . VAL C 2 320 ? 50.74440  9.01504   -17.64970 1.000 30.48660  ? 320 VAL C CG2 1 
ATOM   7757  N  N   . THR C 2 321 ? 51.83101  11.80753  -21.40770 1.000 39.76838  ? 321 THR C N   1 
ATOM   7758  C  CA  . THR C 2 321 ? 52.69597  12.30104  -22.47097 1.000 41.50162  ? 321 THR C CA  1 
ATOM   7759  C  C   . THR C 2 321 ? 53.86988  13.11927  -21.96137 1.000 37.46490  ? 321 THR C C   1 
ATOM   7760  O  O   . THR C 2 321 ? 54.87420  13.24195  -22.67017 1.000 39.30218  ? 321 THR C O   1 
ATOM   7761  C  CB  . THR C 2 321 ? 51.89641  13.16262  -23.46185 1.000 37.41720  ? 321 THR C CB  1 
ATOM   7762  O  OG1 . THR C 2 321 ? 51.19711  14.18738  -22.74628 1.000 41.00275  ? 321 THR C OG1 1 
ATOM   7763  C  CG2 . THR C 2 321 ? 50.89653  12.31636  -24.22831 1.000 33.81328  ? 321 THR C CG2 1 
ATOM   7764  N  N   . HIS C 2 322 ? 53.77467  13.66756  -20.75628 1.000 41.58489  ? 322 HIS C N   1 
ATOM   7765  C  CA  . HIS C 2 322 ? 54.82628  14.48728  -20.17625 1.000 36.52309  ? 322 HIS C CA  1 
ATOM   7766  C  C   . HIS C 2 322 ? 55.07623  14.02226  -18.75324 1.000 40.86151  ? 322 HIS C C   1 
ATOM   7767  O  O   . HIS C 2 322 ? 54.12335  13.79171  -18.00186 1.000 42.37723  ? 322 HIS C O   1 
ATOM   7768  C  CB  . HIS C 2 322 ? 54.43135  15.96924  -20.16269 1.000 40.63992  ? 322 HIS C CB  1 
ATOM   7769  C  CG  . HIS C 2 322 ? 54.18369  16.55072  -21.51917 1.000 38.98932  ? 322 HIS C CG  1 
ATOM   7770  N  ND1 . HIS C 2 322 ? 53.15730  16.12805  -22.33562 1.000 37.60481  ? 322 HIS C ND1 1 
ATOM   7771  C  CD2 . HIS C 2 322 ? 54.80360  17.55467  -22.18342 1.000 37.38806  ? 322 HIS C CD2 1 
ATOM   7772  C  CE1 . HIS C 2 322 ? 53.17429  16.82590  -23.45722 1.000 39.72201  ? 322 HIS C CE1 1 
ATOM   7773  N  NE2 . HIS C 2 322 ? 54.15989  17.70204  -23.38785 1.000 44.86894  ? 322 HIS C NE2 1 
ATOM   7774  N  N   . VAL C 2 323 ? 56.34761  13.86777  -18.38949 1.000 39.94049  ? 323 VAL C N   1 
ATOM   7775  C  CA  . VAL C 2 323 ? 56.73351  13.56014  -17.01861 1.000 39.32406  ? 323 VAL C CA  1 
ATOM   7776  C  C   . VAL C 2 323 ? 57.80330  14.55500  -16.59803 1.000 41.66863  ? 323 VAL C C   1 
ATOM   7777  O  O   . VAL C 2 323 ? 58.81610  14.71444  -17.28852 1.000 42.06883  ? 323 VAL C O   1 
ATOM   7778  C  CB  . VAL C 2 323 ? 57.25112  12.11981  -16.85155 1.000 37.80828  ? 323 VAL C CB  1 
ATOM   7779  C  CG1 . VAL C 2 323 ? 57.53046  11.84767  -15.38576 1.000 36.25549  ? 323 VAL C CG1 1 
ATOM   7780  C  CG2 . VAL C 2 323 ? 56.25519  11.12053  -17.39741 1.000 31.55177  ? 323 VAL C CG2 1 
ATOM   7781  N  N   . PHE C 2 324 ? 57.57196  15.23593  -15.48328 1.000 37.79923  ? 324 PHE C N   1 
ATOM   7782  C  CA  . PHE C 2 324 ? 58.54118  16.16095  -14.92307 1.000 38.34959  ? 324 PHE C CA  1 
ATOM   7783  C  C   . PHE C 2 324 ? 58.89637  15.71533  -13.51294 1.000 41.23119  ? 324 PHE C C   1 
ATOM   7784  O  O   . PHE C 2 324 ? 58.30657  14.78253  -12.96146 1.000 39.22780  ? 324 PHE C O   1 
ATOM   7785  C  CB  . PHE C 2 324 ? 58.00982  17.59808  -14.93684 1.000 40.71596  ? 324 PHE C CB  1 
ATOM   7786  C  CG  . PHE C 2 324 ? 57.59939  18.07157  -16.30308 1.000 44.15365  ? 324 PHE C CG  1 
ATOM   7787  C  CD1 . PHE C 2 324 ? 58.54468  18.26022  -17.29823 1.000 34.95532  ? 324 PHE C CD1 1 
ATOM   7788  C  CD2 . PHE C 2 324 ? 56.26862  18.32102  -16.59376 1.000 40.99130  ? 324 PHE C CD2 1 
ATOM   7789  C  CE1 . PHE C 2 324 ? 58.16976  18.68980  -18.55983 1.000 40.57765  ? 324 PHE C CE1 1 
ATOM   7790  C  CE2 . PHE C 2 324 ? 55.88634  18.75602  -17.85183 1.000 37.31204  ? 324 PHE C CE2 1 
ATOM   7791  C  CZ  . PHE C 2 324 ? 56.83953  18.93812  -18.83764 1.000 43.24902  ? 324 PHE C CZ  1 
ATOM   7792  N  N   . ARG C 2 325 ? 59.86895  16.40383  -12.92559 1.000 47.23825  ? 325 ARG C N   1 
ATOM   7793  C  CA  . ARG C 2 325 ? 60.44147  15.99700  -11.65061 1.000 48.36105  ? 325 ARG C CA  1 
ATOM   7794  C  C   . ARG C 2 325 ? 60.58686  17.23151  -10.77478 1.000 51.24925  ? 325 ARG C C   1 
ATOM   7795  O  O   . ARG C 2 325 ? 61.28453  18.17736  -11.15162 1.000 63.31834  ? 325 ARG C O   1 
ATOM   7796  C  CB  . ARG C 2 325 ? 61.79640  15.31503  -11.87495 1.000 49.32650  ? 325 ARG C CB  1 
ATOM   7797  C  CG  . ARG C 2 325 ? 62.32095  14.50420  -10.70959 1.000 59.75772  ? 325 ARG C CG  1 
ATOM   7798  C  CD  . ARG C 2 325 ? 63.67156  13.87341  -11.04780 1.000 46.59166  ? 325 ARG C CD  1 
ATOM   7799  N  NE  . ARG C 2 325 ? 63.81928  12.55368  -10.44370 1.000 50.02854  ? 325 ARG C NE  1 
ATOM   7800  C  CZ  . ARG C 2 325 ? 63.43167  11.41942  -11.00923 1.000 43.19337  ? 325 ARG C CZ  1 
ATOM   7801  N  NH1 . ARG C 2 325 ? 62.89837  11.39747  -12.21865 1.000 66.97220  ? 325 ARG C NH1 1 
ATOM   7802  N  NH2 . ARG C 2 325 ? 63.58354  10.27699  -10.34468 1.000 53.91282  ? 325 ARG C NH2 1 
ATOM   7803  N  N   . GLY C 2 326 ? 59.91364  17.23646  -9.62436  1.000 39.61784  ? 326 GLY C N   1 
ATOM   7804  C  CA  . GLY C 2 326 ? 60.11161  18.29632  -8.65213  1.000 50.77780  ? 326 GLY C CA  1 
ATOM   7805  C  C   . GLY C 2 326 ? 58.88957  19.14074  -8.35328  1.000 49.51003  ? 326 GLY C C   1 
ATOM   7806  O  O   . GLY C 2 326 ? 58.00975  19.29640  -9.20378  1.000 50.41620  ? 326 GLY C O   1 
ATOM   7807  N  N   . PHE C 2 327 ? 58.83483  19.70475  -7.14309  1.000 47.45925  ? 327 PHE C N   1 
ATOM   7808  C  CA  . PHE C 2 327 ? 57.68960  20.52443  -6.75527  1.000 55.16254  ? 327 PHE C CA  1 
ATOM   7809  C  C   . PHE C 2 327 ? 57.53584  21.73979  -7.65988  1.000 53.66309  ? 327 PHE C C   1 
ATOM   7810  O  O   . PHE C 2 327 ? 56.41156  22.13689  -7.98671  1.000 54.95321  ? 327 PHE C O   1 
ATOM   7811  C  CB  . PHE C 2 327 ? 57.82282  20.96707  -5.29835  1.000 54.86491  ? 327 PHE C CB  1 
ATOM   7812  C  CG  . PHE C 2 327 ? 57.15756  20.04497  -4.32526  1.000 53.64803  ? 327 PHE C CG  1 
ATOM   7813  C  CD1 . PHE C 2 327 ? 55.79362  20.12689  -4.10076  1.000 67.58455  ? 327 PHE C CD1 1 
ATOM   7814  C  CD2 . PHE C 2 327 ? 57.89175  19.09553  -3.63513  1.000 60.85106  ? 327 PHE C CD2 1 
ATOM   7815  C  CE1 . PHE C 2 327 ? 55.16964  19.27594  -3.20727  1.000 66.97700  ? 327 PHE C CE1 1 
ATOM   7816  C  CE2 . PHE C 2 327 ? 57.27624  18.24047  -2.73698  1.000 68.69551  ? 327 PHE C CE2 1 
ATOM   7817  C  CZ  . PHE C 2 327 ? 55.91266  18.33143  -2.52258  1.000 69.20078  ? 327 PHE C CZ  1 
ATOM   7818  N  N   . ASP C 2 328 ? 58.65319  22.34585  -8.07348  1.000 57.80462  ? 328 ASP C N   1 
ATOM   7819  C  CA  . ASP C 2 328 ? 58.57889  23.55007  -8.89655  1.000 70.69850  ? 328 ASP C CA  1 
ATOM   7820  C  C   . ASP C 2 328 ? 57.89893  23.28196  -10.23169 1.000 63.12827  ? 328 ASP C C   1 
ATOM   7821  O  O   . ASP C 2 328 ? 57.29217  24.19001  -10.81254 1.000 66.09207  ? 328 ASP C O   1 
ATOM   7822  C  CB  . ASP C 2 328 ? 59.97904  24.12252  -9.12621  1.000 70.83635  ? 328 ASP C CB  1 
ATOM   7823  C  CG  . ASP C 2 328 ? 60.74224  24.33942  -7.83293  1.000 88.19481  ? 328 ASP C CG  1 
ATOM   7824  O  OD1 . ASP C 2 328 ? 60.09725  24.55876  -6.78442  1.000 87.37150  ? 328 ASP C OD1 1 
ATOM   7825  O  OD2 . ASP C 2 328 ? 61.99062  24.29170  -7.86616  1.000 103.40680 ? 328 ASP C OD2 1 
ATOM   7826  N  N   . ASN C 2 329 ? 57.97989  22.05084  -10.72969 1.000 53.97302  ? 329 ASN C N   1 
ATOM   7827  C  CA  . ASN C 2 329 ? 57.35389  21.70496  -11.99724 1.000 51.30330  ? 329 ASN C CA  1 
ATOM   7828  C  C   . ASN C 2 329 ? 55.86228  21.43509  -11.87324 1.000 47.43401  ? 329 ASN C C   1 
ATOM   7829  O  O   . ASN C 2 329 ? 55.20813  21.19842  -12.89491 1.000 46.58988  ? 329 ASN C O   1 
ATOM   7830  C  CB  . ASN C 2 329 ? 58.06065  20.50040  -12.61651 1.000 52.50497  ? 329 ASN C CB  1 
ATOM   7831  C  CG  . ASN C 2 329 ? 59.45476  20.83868  -13.08699 1.000 54.50569  ? 329 ASN C CG  1 
ATOM   7832  O  OD1 . ASN C 2 329 ? 59.69313  21.93315  -13.59783 1.000 45.91466  ? 329 ASN C OD1 1 
ATOM   7833  N  ND2 . ASN C 2 329 ? 60.38704  19.90581  -12.91751 1.000 58.90017  ? 329 ASN C ND2 1 
ATOM   7834  N  N   . ILE C 2 330 ? 55.30875  21.45021  -10.65919 1.000 43.76387  ? 330 ILE C N   1 
ATOM   7835  C  CA  . ILE C 2 330 ? 53.85793  21.37788  -10.52279 1.000 42.53679  ? 330 ILE C CA  1 
ATOM   7836  C  C   . ILE C 2 330 ? 53.21182  22.57150  -11.21328 1.000 43.03978  ? 330 ILE C C   1 
ATOM   7837  O  O   . ILE C 2 330 ? 52.18749  22.43716  -11.89320 1.000 43.28104  ? 330 ILE C O   1 
ATOM   7838  C  CB  . ILE C 2 330 ? 53.46119  21.28888  -9.03700  1.000 45.10390  ? 330 ILE C CB  1 
ATOM   7839  C  CG1 . ILE C 2 330 ? 53.85638  19.92934  -8.46097  1.000 45.09083  ? 330 ILE C CG1 1 
ATOM   7840  C  CG2 . ILE C 2 330 ? 51.96916  21.52169  -8.85563  1.000 44.30189  ? 330 ILE C CG2 1 
ATOM   7841  C  CD1 . ILE C 2 330 ? 53.45228  19.74576  -7.01703  1.000 40.80624  ? 330 ILE C CD1 1 
ATOM   7842  N  N   . GLU C 2 331 ? 53.81744  23.75272  -11.07217 1.000 45.62179  ? 331 GLU C N   1 
ATOM   7843  C  CA  . GLU C 2 331 ? 53.32370  24.93461  -11.77261 1.000 48.67964  ? 331 GLU C CA  1 
ATOM   7844  C  C   . GLU C 2 331 ? 53.44329  24.77407  -13.28277 1.000 48.93395  ? 331 GLU C C   1 
ATOM   7845  O  O   . GLU C 2 331 ? 52.51191  25.10813  -14.02569 1.000 50.98149  ? 331 GLU C O   1 
ATOM   7846  C  CB  . GLU C 2 331 ? 54.08110  26.17497  -11.29958 1.000 53.57020  ? 331 GLU C CB  1 
ATOM   7847  C  CG  . GLU C 2 331 ? 53.68280  27.45551  -12.01006 1.000 50.17582  ? 331 GLU C CG  1 
ATOM   7848  C  CD  . GLU C 2 331 ? 54.39192  28.67521  -11.45818 1.000 59.77608  ? 331 GLU C CD  1 
ATOM   7849  O  OE1 . GLU C 2 331 ? 55.56650  28.55590  -11.04450 1.000 64.25893  ? 331 GLU C OE1 1 
ATOM   7850  O  OE2 . GLU C 2 331 ? 53.77341  29.75949  -11.44626 1.000 61.25159  ? 331 GLU C OE2 1 
ATOM   7851  N  N   . LYS C 2 332 ? 54.58270  24.26233  -13.75442 1.000 44.47946  ? 332 LYS C N   1 
ATOM   7852  C  CA  A LYS C 2 332 ? 54.76505  24.05777  -15.18794 0.430 45.36729  ? 332 LYS C CA  1 
ATOM   7853  C  CA  B LYS C 2 332 ? 54.76850  24.05307  -15.18706 0.570 45.33548  ? 332 LYS C CA  1 
ATOM   7854  C  C   . LYS C 2 332 ? 53.73196  23.08097  -15.73539 1.000 46.13990  ? 332 LYS C C   1 
ATOM   7855  O  O   . LYS C 2 332 ? 53.11502  23.33098  -16.77863 1.000 47.09741  ? 332 LYS C O   1 
ATOM   7856  C  CB  A LYS C 2 332 ? 56.18576  23.56528  -15.47183 0.430 48.78928  ? 332 LYS C CB  1 
ATOM   7857  C  CB  B LYS C 2 332 ? 56.18687  23.54707  -15.45646 0.570 48.66104  ? 332 LYS C CB  1 
ATOM   7858  C  CG  A LYS C 2 332 ? 56.49984  23.39841  -16.95122 0.430 50.37774  ? 332 LYS C CG  1 
ATOM   7859  C  CG  B LYS C 2 332 ? 56.45971  23.16869  -16.90294 0.570 50.44866  ? 332 LYS C CG  1 
ATOM   7860  C  CD  A LYS C 2 332 ? 57.98544  23.17287  -17.18887 0.430 46.62693  ? 332 LYS C CD  1 
ATOM   7861  C  CD  B LYS C 2 332 ? 57.89643  22.70364  -17.07986 0.570 46.41862  ? 332 LYS C CD  1 
ATOM   7862  C  CE  A LYS C 2 332 ? 58.46372  21.86869  -16.56980 0.430 48.01331  ? 332 LYS C CE  1 
ATOM   7863  C  CE  B LYS C 2 332 ? 58.20029  22.35954  -18.52974 0.570 52.02743  ? 332 LYS C CE  1 
ATOM   7864  N  NZ  A LYS C 2 332 ? 59.92660  21.65748  -16.78554 0.430 42.97065  ? 332 LYS C NZ  1 
ATOM   7865  N  NZ  B LYS C 2 332 ? 59.64001  22.01722  -18.72459 0.570 44.97127  ? 332 LYS C NZ  1 
ATOM   7866  N  N   . ALA C 2 333 ? 53.52213  21.96192  -15.03716 1.000 44.57762  ? 333 ALA C N   1 
ATOM   7867  C  CA  . ALA C 2 333 ? 52.53624  20.98740  -15.48841 1.000 43.09736  ? 333 ALA C CA  1 
ATOM   7868  C  C   . ALA C 2 333 ? 51.12059  21.53555  -15.38294 1.000 46.23069  ? 333 ALA C C   1 
ATOM   7869  O  O   . ALA C 2 333 ? 50.26959  21.20809  -16.21729 1.000 49.52901  ? 333 ALA C O   1 
ATOM   7870  C  CB  . ALA C 2 333 ? 52.66952  19.69088  -14.69141 1.000 33.67929  ? 333 ALA C CB  1 
ATOM   7871  N  N   . PHE C 2 334 ? 50.84695  22.36204  -14.37002 1.000 45.55201  ? 334 PHE C N   1 
ATOM   7872  C  CA  . PHE C 2 334 ? 49.53744  22.99546  -14.27014 1.000 42.47869  ? 334 PHE C CA  1 
ATOM   7873  C  C   . PHE C 2 334 ? 49.30278  23.94452  -15.43641 1.000 46.84623  ? 334 PHE C C   1 
ATOM   7874  O  O   . PHE C 2 334 ? 48.24531  23.91252  -16.07589 1.000 54.19999  ? 334 PHE C O   1 
ATOM   7875  C  CB  . PHE C 2 334 ? 49.40735  23.74042  -12.94295 1.000 41.24261  ? 334 PHE C CB  1 
ATOM   7876  C  CG  . PHE C 2 334 ? 48.07687  24.41188  -12.75922 1.000 46.09267  ? 334 PHE C CG  1 
ATOM   7877  C  CD1 . PHE C 2 334 ? 46.99133  23.70452  -12.27820 1.000 47.82124  ? 334 PHE C CD1 1 
ATOM   7878  C  CD2 . PHE C 2 334 ? 47.91225  25.75299  -13.06774 1.000 51.90448  ? 334 PHE C CD2 1 
ATOM   7879  C  CE1 . PHE C 2 334 ? 45.76454  24.31879  -12.11256 1.000 56.41027  ? 334 PHE C CE1 1 
ATOM   7880  C  CE2 . PHE C 2 334 ? 46.68967  26.37226  -12.90100 1.000 51.55973  ? 334 PHE C CE2 1 
ATOM   7881  C  CZ  . PHE C 2 334 ? 45.61475  25.65536  -12.42199 1.000 56.46751  ? 334 PHE C CZ  1 
ATOM   7882  N  N   . MET C 2 335 ? 50.28133  24.80562  -15.72432 1.000 50.59108  ? 335 MET C N   1 
ATOM   7883  C  CA  . MET C 2 335 ? 50.14046  25.72235  -16.85006 1.000 55.49170  ? 335 MET C CA  1 
ATOM   7884  C  C   . MET C 2 335 ? 50.02202  24.96770  -18.16495 1.000 56.31308  ? 335 MET C C   1 
ATOM   7885  O  O   . MET C 2 335 ? 49.35447  25.43816  -19.09213 1.000 59.00972  ? 335 MET C O   1 
ATOM   7886  C  CB  . MET C 2 335 ? 51.31688  26.69676  -16.88985 1.000 50.56171  ? 335 MET C CB  1 
ATOM   7887  C  CG  . MET C 2 335 ? 51.36676  27.65828  -15.71023 1.000 44.42482  ? 335 MET C CG  1 
ATOM   7888  S  SD  . MET C 2 335 ? 49.82197  28.57413  -15.48384 1.000 60.41680  ? 335 MET C SD  1 
ATOM   7889  C  CE  . MET C 2 335 ? 50.03734  29.89210  -16.67662 1.000 73.40070  ? 335 MET C CE  1 
ATOM   7890  N  N   . LEU C 2 336 ? 50.64292  23.78956  -18.25377 1.000 53.24429  ? 336 LEU C N   1 
ATOM   7891  C  CA  . LEU C 2 336 ? 50.51280  22.96251  -19.44711 1.000 49.46064  ? 336 LEU C CA  1 
ATOM   7892  C  C   . LEU C 2 336 ? 49.06024  22.57325  -19.70094 1.000 53.94458  ? 336 LEU C C   1 
ATOM   7893  O  O   . LEU C 2 336 ? 48.63701  22.47294  -20.85865 1.000 56.34570  ? 336 LEU C O   1 
ATOM   7894  C  CB  . LEU C 2 336 ? 51.40040  21.72646  -19.30184 1.000 54.46785  ? 336 LEU C CB  1 
ATOM   7895  C  CG  . LEU C 2 336 ? 51.98934  21.08067  -20.55335 1.000 49.50347  ? 336 LEU C CG  1 
ATOM   7896  C  CD1 . LEU C 2 336 ? 52.77053  22.10074  -21.35149 1.000 48.54589  ? 336 LEU C CD1 1 
ATOM   7897  C  CD2 . LEU C 2 336 ? 52.89379  19.93144  -20.14837 1.000 44.24417  ? 336 LEU C CD2 1 
ATOM   7898  N  N   . MET C 2 337 ? 48.27754  22.36720  -18.63773 1.000 47.83957  ? 337 MET C N   1 
ATOM   7899  C  CA  . MET C 2 337 ? 46.86238  22.06149  -18.81402 1.000 49.48211  ? 337 MET C CA  1 
ATOM   7900  C  C   . MET C 2 337 ? 46.07489  23.29997  -19.22414 1.000 55.20211  ? 337 MET C C   1 
ATOM   7901  O  O   . MET C 2 337 ? 45.01505  23.17989  -19.84841 1.000 57.29418  ? 337 MET C O   1 
ATOM   7902  C  CB  . MET C 2 337 ? 46.28137  21.46584  -17.53120 1.000 47.51985  ? 337 MET C CB  1 
ATOM   7903  C  CG  . MET C 2 337 ? 46.83961  20.10066  -17.16341 1.000 52.58695  ? 337 MET C CG  1 
ATOM   7904  S  SD  . MET C 2 337 ? 46.45589  18.78846  -18.34120 1.000 51.56196  ? 337 MET C SD  1 
ATOM   7905  C  CE  . MET C 2 337 ? 44.75093  18.44482  -17.93309 1.000 54.32516  ? 337 MET C CE  1 
ATOM   7906  N  N   . LYS C 2 338 ? 46.56086  24.49111  -18.86489 1.000 54.63363  ? 338 LYS C N   1 
ATOM   7907  C  CA  . LYS C 2 338 ? 45.87557  25.72282  -19.24533 1.000 54.22402  ? 338 LYS C CA  1 
ATOM   7908  C  C   . LYS C 2 338 ? 45.99640  25.98206  -20.74322 1.000 69.21849  ? 338 LYS C C   1 
ATOM   7909  O  O   . LYS C 2 338 ? 44.98667  26.16039  -21.43503 1.000 73.48311  ? 338 LYS C O   1 
ATOM   7910  C  CB  . LYS C 2 338 ? 46.43332  26.90275  -18.44727 1.000 67.88604  ? 338 LYS C CB  1 
ATOM   7911  C  CG  . LYS C 2 338 ? 45.67054  28.21061  -18.62866 1.000 61.77260  ? 338 LYS C CG  1 
ATOM   7912  C  CD  . LYS C 2 338 ? 46.37636  29.34916  -17.90334 1.000 72.74680  ? 338 LYS C CD  1 
ATOM   7913  C  CE  . LYS C 2 338 ? 45.62053  30.66438  -18.03120 1.000 75.00181  ? 338 LYS C CE  1 
ATOM   7914  N  NZ  . LYS C 2 338 ? 45.47781  31.10005  -19.44753 1.000 92.09676  ? 338 LYS C NZ  1 
ATOM   7915  N  N   . ASP C 2 339 ? 47.22422  26.01559  -21.26220 1.000 76.96075  ? 339 ASP C N   1 
ATOM   7916  C  CA  A ASP C 2 339 ? 47.44597  26.27094  -22.68613 0.399 74.64906  ? 339 ASP C CA  1 
ATOM   7917  C  CA  B ASP C 2 339 ? 47.46793  26.27308  -22.68033 0.601 74.67590  ? 339 ASP C CA  1 
ATOM   7918  C  C   . ASP C 2 339 ? 47.77012  24.95588  -23.39406 1.000 70.25315  ? 339 ASP C C   1 
ATOM   7919  O  O   . ASP C 2 339 ? 48.89388  24.68515  -23.81238 1.000 90.63124  ? 339 ASP C O   1 
ATOM   7920  C  CB  A ASP C 2 339 ? 48.54016  27.32343  -22.88355 0.399 76.51427  ? 339 ASP C CB  1 
ATOM   7921  C  CB  B ASP C 2 339 ? 48.61188  27.26987  -22.84225 0.601 76.53235  ? 339 ASP C CB  1 
ATOM   7922  C  CG  A ASP C 2 339 ? 49.87433  26.92525  -22.26933 0.399 72.32420  ? 339 ASP C CG  1 
ATOM   7923  C  CG  B ASP C 2 339 ? 48.55047  28.39862  -21.82879 0.601 75.03555  ? 339 ASP C CG  1 
ATOM   7924  O  OD1 A ASP C 2 339 ? 49.95151  25.86975  -21.61328 0.399 71.10579  ? 339 ASP C OD1 1 
ATOM   7925  O  OD1 B ASP C 2 339 ? 47.56106  29.16035  -21.83789 0.601 72.26899  ? 339 ASP C OD1 1 
ATOM   7926  O  OD2 A ASP C 2 339 ? 50.85642  27.67446  -22.45437 0.399 77.93531  ? 339 ASP C OD2 1 
ATOM   7927  O  OD2 B ASP C 2 339 ? 49.48893  28.51316  -21.01247 0.601 71.70105  ? 339 ASP C OD2 1 
ATOM   7928  N  N   . LYS C 2 340 ? 46.72546  24.13385  -23.52866 1.000 56.69428  ? 340 LYS C N   1 
ATOM   7929  C  CA  . LYS C 2 340 ? 46.79357  22.78277  -24.07900 1.000 52.75795  ? 340 LYS C CA  1 
ATOM   7930  C  C   . LYS C 2 340 ? 47.57010  22.72458  -25.38950 1.000 58.27528  ? 340 LYS C C   1 
ATOM   7931  O  O   . LYS C 2 340 ? 47.04689  23.13320  -26.43484 1.000 61.79591  ? 340 LYS C O   1 
ATOM   7932  C  CB  . LYS C 2 340 ? 45.38041  22.25257  -24.32817 1.000 62.10848  ? 340 LYS C CB  1 
ATOM   7933  C  CG  . LYS C 2 340 ? 44.49674  22.12881  -23.10008 1.000 65.04188  ? 340 LYS C CG  1 
ATOM   7934  C  CD  . LYS C 2 340 ? 44.56843  20.74418  -22.47967 1.000 70.14924  ? 340 LYS C CD  1 
ATOM   7935  C  CE  . LYS C 2 340 ? 43.59064  20.62849  -21.31838 1.000 71.27314  ? 340 LYS C CE  1 
ATOM   7936  N  NZ  . LYS C 2 340 ? 43.38574  19.21768  -20.89699 1.000 79.11748  ? 340 LYS C NZ  1 
ATOM   7937  N  N   . PRO C 2 341 ? 48.79263  22.20164  -25.39135 1.000 58.16517  ? 341 PRO C N   1 
ATOM   7938  C  CA  . PRO C 2 341 ? 49.48062  21.94601  -26.65770 1.000 52.97259  ? 341 PRO C CA  1 
ATOM   7939  C  C   . PRO C 2 341 ? 48.91958  20.69928  -27.32621 1.000 51.09674  ? 341 PRO C C   1 
ATOM   7940  O  O   . PRO C 2 341 ? 48.34206  19.82080  -26.68337 1.000 48.10338  ? 341 PRO C O   1 
ATOM   7941  C  CB  . PRO C 2 341 ? 50.94330  21.76062  -26.24050 1.000 48.61420  ? 341 PRO C CB  1 
ATOM   7942  C  CG  . PRO C 2 341 ? 50.87707  21.27284  -24.84230 1.000 54.82873  ? 341 PRO C CG  1 
ATOM   7943  C  CD  . PRO C 2 341 ? 49.60795  21.80929  -24.22697 1.000 54.40577  ? 341 PRO C CD  1 
ATOM   7944  N  N   . LYS C 2 342 ? 49.09482  20.63686  -28.64762 1.000 54.79165  ? 342 LYS C N   1 
ATOM   7945  C  CA  . LYS C 2 342 ? 48.47904  19.56645  -29.42690 1.000 49.22829  ? 342 LYS C CA  1 
ATOM   7946  C  C   . LYS C 2 342 ? 49.05076  18.18649  -29.12952 1.000 50.17641  ? 342 LYS C C   1 
ATOM   7947  O  O   . LYS C 2 342 ? 48.42501  17.18969  -29.50599 1.000 56.71948  ? 342 LYS C O   1 
ATOM   7948  C  CB  . LYS C 2 342 ? 48.60990  19.86007  -30.92395 1.000 52.36919  ? 342 LYS C CB  1 
ATOM   7949  C  CG  . LYS C 2 342 ? 47.87907  21.11980  -31.35219 1.000 66.87286  ? 342 LYS C CG  1 
ATOM   7950  C  CD  . LYS C 2 342 ? 46.38786  20.97912  -31.06941 1.000 75.66831  ? 342 LYS C CD  1 
ATOM   7951  C  CE  . LYS C 2 342 ? 45.57868  22.11472  -31.66875 1.000 70.34921  ? 342 LYS C CE  1 
ATOM   7952  N  NZ  . LYS C 2 342 ? 44.13020  21.94631  -31.36267 1.000 72.41834  ? 342 LYS C NZ  1 
ATOM   7953  N  N   . ASP C 2 343 ? 50.19597  18.09361  -28.45732 1.000 45.92546  ? 343 ASP C N   1 
ATOM   7954  C  CA  . ASP C 2 343 ? 50.80912  16.80781  -28.15207 1.000 51.74995  ? 343 ASP C CA  1 
ATOM   7955  C  C   . ASP C 2 343 ? 50.58970  16.37280  -26.70760 1.000 44.18195  ? 343 ASP C C   1 
ATOM   7956  O  O   . ASP C 2 343 ? 51.14169  15.35167  -26.28883 1.000 40.86895  ? 343 ASP C O   1 
ATOM   7957  C  CB  . ASP C 2 343 ? 52.30360  16.84612  -28.47569 1.000 48.28445  ? 343 ASP C CB  1 
ATOM   7958  C  CG  . ASP C 2 343 ? 53.06642  17.82353  -27.60939 1.000 54.30542  ? 343 ASP C CG  1 
ATOM   7959  O  OD1 . ASP C 2 343 ? 52.44846  18.78147  -27.09975 1.000 56.42497  ? 343 ASP C OD1 1 
ATOM   7960  O  OD2 . ASP C 2 343 ? 54.29278  17.64225  -27.45495 1.000 59.04855  ? 343 ASP C OD2 1 
ATOM   7961  N  N   . LEU C 2 344 ? 49.78862  17.10863  -25.94461 1.000 41.93980  ? 344 LEU C N   1 
ATOM   7962  C  CA  . LEU C 2 344 ? 49.57463  16.82317  -24.53291 1.000 44.36009  ? 344 LEU C CA  1 
ATOM   7963  C  C   . LEU C 2 344 ? 48.31500  15.99418  -24.33200 1.000 45.16463  ? 344 LEU C C   1 
ATOM   7964  O  O   . LEU C 2 344 ? 47.25781  16.31572  -24.88265 1.000 45.26016  ? 344 LEU C O   1 
ATOM   7965  C  CB  . LEU C 2 344 ? 49.45240  18.11956  -23.73394 1.000 41.80117  ? 344 LEU C CB  1 
ATOM   7966  C  CG  . LEU C 2 344 ? 48.93848  17.94640  -22.30606 1.000 39.41692  ? 344 LEU C CG  1 
ATOM   7967  C  CD1 . LEU C 2 344 ? 49.99631  17.27588  -21.44554 1.000 45.06496  ? 344 LEU C CD1 1 
ATOM   7968  C  CD2 . LEU C 2 344 ? 48.51127  19.27590  -21.71190 1.000 45.41347  ? 344 LEU C CD2 1 
ATOM   7969  N  N   . ILE C 2 345 ? 48.42884  14.93229  -23.53833 1.000 39.63402  ? 345 ILE C N   1 
ATOM   7970  C  CA  . ILE C 2 345 ? 47.24422  14.25634  -23.02763 1.000 37.81286  ? 345 ILE C CA  1 
ATOM   7971  C  C   . ILE C 2 345 ? 47.19876  14.49843  -21.52633 1.000 34.52184  ? 345 ILE C C   1 
ATOM   7972  O  O   . ILE C 2 345 ? 46.32006  15.20736  -21.02672 1.000 44.80158  ? 345 ILE C O   1 
ATOM   7973  C  CB  . ILE C 2 345 ? 47.23160  12.75228  -23.35511 1.000 40.89066  ? 345 ILE C CB  1 
ATOM   7974  C  CG1 . ILE C 2 345 ? 47.16115  12.52971  -24.86764 1.000 38.04459  ? 345 ILE C CG1 1 
ATOM   7975  C  CG2 . ILE C 2 345 ? 46.03875  12.08293  -22.68871 1.000 33.72220  ? 345 ILE C CG2 1 
ATOM   7976  C  CD1 . ILE C 2 345 ? 47.17049  11.06764  -25.26919 1.000 31.02553  ? 345 ILE C CD1 1 
ATOM   7977  N  N   . LYS C 2 346 ? 48.16976  13.94978  -20.79804 1.000 36.37240  ? 346 LYS C N   1 
ATOM   7978  C  CA  . LYS C 2 346 ? 48.19209  14.09349  -19.35534 1.000 34.96572  ? 346 LYS C CA  1 
ATOM   7979  C  C   . LYS C 2 346 ? 49.63223  14.22574  -18.87315 1.000 43.66770  ? 346 LYS C C   1 
ATOM   7980  O  O   . LYS C 2 346 ? 50.47884  13.37450  -19.20846 1.000 37.85374  ? 346 LYS C O   1 
ATOM   7981  C  CB  . LYS C 2 346 ? 47.50729  12.89791  -18.68828 1.000 38.59317  ? 346 LYS C CB  1 
ATOM   7982  C  CG  . LYS C 2 346 ? 47.17021  13.09672  -17.22145 1.000 43.28822  ? 346 LYS C CG  1 
ATOM   7983  C  CD  . LYS C 2 346 ? 45.92207  13.93996  -17.01941 1.000 40.09437  ? 346 LYS C CD  1 
ATOM   7984  C  CE  . LYS C 2 346 ? 45.52043  13.94798  -15.54837 1.000 37.80758  ? 346 LYS C CE  1 
ATOM   7985  N  NZ  . LYS C 2 346 ? 44.39073  14.87081  -15.25306 1.000 42.41189  ? 346 LYS C NZ  1 
ATOM   7986  N  N   . PRO C 2 347 ? 49.95119  15.27789  -18.11217 1.000 45.30810  ? 347 PRO C N   1 
ATOM   7987  C  CA  . PRO C 2 347 ? 51.30265  15.40302  -17.55738 1.000 34.92903  ? 347 PRO C CA  1 
ATOM   7988  C  C   . PRO C 2 347 ? 51.38714  14.86502  -16.13885 1.000 38.94263  ? 347 PRO C C   1 
ATOM   7989  O  O   . PRO C 2 347 ? 50.40061  14.88976  -15.39706 1.000 40.64646  ? 347 PRO C O   1 
ATOM   7990  C  CB  . PRO C 2 347 ? 51.55012  16.91317  -17.60054 1.000 37.96894  ? 347 PRO C CB  1 
ATOM   7991  C  CG  . PRO C 2 347 ? 50.18807  17.49215  -17.35452 1.000 43.03535  ? 347 PRO C CG  1 
ATOM   7992  C  CD  . PRO C 2 347 ? 49.17510  16.51886  -17.94145 1.000 40.65238  ? 347 PRO C CD  1 
ATOM   7993  N  N   . VAL C 2 348 ? 52.56145  14.37677  -15.75331 1.000 35.23795  ? 348 VAL C N   1 
ATOM   7994  C  CA  . VAL C 2 348 ? 52.79017  13.80685  -14.43298 1.000 41.15797  ? 348 VAL C CA  1 
ATOM   7995  C  C   . VAL C 2 348 ? 54.03882  14.44165  -13.84306 1.000 37.43064  ? 348 VAL C C   1 
ATOM   7996  O  O   . VAL C 2 348 ? 55.03750  14.63671  -14.54369 1.000 41.58795  ? 348 VAL C O   1 
ATOM   7997  C  CB  . VAL C 2 348 ? 52.93188  12.27051  -14.49768 1.000 33.66977  ? 348 VAL C CB  1 
ATOM   7998  C  CG1 . VAL C 2 348 ? 53.39831  11.70909  -13.16243 1.000 32.32439  ? 348 VAL C CG1 1 
ATOM   7999  C  CG2 . VAL C 2 348 ? 51.61273  11.64426  -14.89916 1.000 38.14964  ? 348 VAL C CG2 1 
ATOM   8000  N  N   . VAL C 2 349 ? 53.97750  14.78206  -12.56003 1.000 39.15649  ? 349 VAL C N   1 
ATOM   8001  C  CA  . VAL C 2 349 ? 55.11643  15.32584  -11.83090 1.000 36.14126  ? 349 VAL C CA  1 
ATOM   8002  C  C   . VAL C 2 349 ? 55.53310  14.28888  -10.80158 1.000 36.19574  ? 349 VAL C C   1 
ATOM   8003  O  O   . VAL C 2 349 ? 54.73787  13.91708  -9.92967  1.000 43.00333  ? 349 VAL C O   1 
ATOM   8004  C  CB  . VAL C 2 349 ? 54.78870  16.67081  -11.16534 1.000 37.14458  ? 349 VAL C CB  1 
ATOM   8005  C  CG1 . VAL C 2 349 ? 55.96598  17.14098  -10.32382 1.000 43.28864  ? 349 VAL C CG1 1 
ATOM   8006  C  CG2 . VAL C 2 349 ? 54.45414  17.71144  -12.21537 1.000 40.03859  ? 349 VAL C CG2 1 
ATOM   8007  N  N   . ILE C 2 350 ? 56.76354  13.80111  -10.92221 1.000 45.72665  ? 350 ILE C N   1 
ATOM   8008  C  CA  . ILE C 2 350 ? 57.32270  12.83267  -9.98556  1.000 43.61681  ? 350 ILE C CA  1 
ATOM   8009  C  C   . ILE C 2 350 ? 58.02846  13.58484  -8.86690  1.000 50.85923  ? 350 ILE C C   1 
ATOM   8010  O  O   . ILE C 2 350 ? 58.89650  14.42743  -9.12197  1.000 51.22633  ? 350 ILE C O   1 
ATOM   8011  C  CB  . ILE C 2 350 ? 58.29146  11.87224  -10.69596 1.000 40.84253  ? 350 ILE C CB  1 
ATOM   8012  C  CG1 . ILE C 2 350 ? 57.56351  11.06021  -11.77107 1.000 50.75680  ? 350 ILE C CG1 1 
ATOM   8013  C  CG2 . ILE C 2 350 ? 58.99243  10.97361  -9.68637  1.000 46.46067  ? 350 ILE C CG2 1 
ATOM   8014  C  CD1 . ILE C 2 350 ? 56.46580  10.15832  -11.23354 1.000 37.43779  ? 350 ILE C CD1 1 
ATOM   8015  N  N   . LEU C 2 351 ? 57.65820  13.28113  -7.62376  1.000 53.92167  ? 351 LEU C N   1 
ATOM   8016  C  CA  . LEU C 2 351 ? 58.24904  13.92040  -6.45610  1.000 54.75715  ? 351 LEU C CA  1 
ATOM   8017  C  C   . LEU C 2 351 ? 59.18068  12.98284  -5.69943  1.000 66.05312  ? 351 LEU C C   1 
ATOM   8018  O  O   . LEU C 2 351 ? 59.51589  13.24632  -4.54050  1.000 88.20334  ? 351 LEU C O   1 
ATOM   8019  C  CB  . LEU C 2 351 ? 57.15000  14.44843  -5.53620  1.000 56.15838  ? 351 LEU C CB  1 
ATOM   8020  C  CG  . LEU C 2 351 ? 56.22562  15.44393  -6.23732  1.000 55.10088  ? 351 LEU C CG  1 
ATOM   8021  C  CD1 . LEU C 2 351 ? 54.93161  15.61721  -5.47258  1.000 59.92733  ? 351 LEU C CD1 1 
ATOM   8022  C  CD2 . LEU C 2 351 ? 56.93236  16.77887  -6.41287  1.000 54.71251  ? 351 LEU C CD2 1 
ATOM   8023  N  N   . ALA C 2 352 ? 59.60347  11.89463  -6.33233  1.000 86.63897  ? 352 ALA C N   1 
ATOM   8024  C  CA  . ALA C 2 352 ? 60.56268  10.98388  -5.72675  1.000 102.62891 ? 352 ALA C CA  1 
ATOM   8025  C  C   . ALA C 2 352 ? 61.95582  11.60217  -5.75052  1.000 111.72832 ? 352 ALA C C   1 
ATOM   8026  O  O   . ALA C 2 352 ? 62.29499  12.35297  -6.66661  1.000 101.98957 ? 352 ALA C O   1 
ATOM   8027  C  CB  . ALA C 2 352 ? 60.55687  9.64473   -6.44858  1.000 104.41762 ? 352 ALA C CB  1 
ATOM   8028  O  OXT . ALA C 2 352 ? 62.77085  11.36977  -4.85694  1.000 119.53718 ? 352 ALA C OXT 1 
HETATM 8029  N  N   . FME D 2 1   ? -17.70620 4.85187   -44.33353 1.000 65.13023  ? 1   FME D N   1 
HETATM 8030  C  CN  . FME D 2 1   ? -18.44820 4.12311   -45.23649 1.000 74.37132  ? 1   FME D CN  1 
HETATM 8031  O  O1  . FME D 2 1   ? -19.57295 3.65152   -45.00704 1.000 80.19430  ? 1   FME D O1  1 
HETATM 8032  C  CA  . FME D 2 1   ? -18.12128 5.17329   -42.99477 1.000 55.50173  ? 1   FME D CA  1 
HETATM 8033  C  CB  . FME D 2 1   ? -17.39036 4.33759   -41.92959 1.000 55.10609  ? 1   FME D CB  1 
HETATM 8034  C  CG  . FME D 2 1   ? -15.91560 4.30393   -42.22813 1.000 48.74759  ? 1   FME D CG  1 
HETATM 8035  S  SD  . FME D 2 1   ? -15.06838 3.86878   -40.73601 1.000 51.24278  ? 1   FME D SD  1 
HETATM 8036  C  CE  . FME D 2 1   ? -13.51053 4.62816   -40.98241 1.000 43.78822  ? 1   FME D CE  1 
HETATM 8037  C  C   . FME D 2 1   ? -17.87762 6.64394   -42.66526 1.000 56.66158  ? 1   FME D C   1 
HETATM 8038  O  O   . FME D 2 1   ? -17.27989 7.40570   -43.41971 1.000 55.87464  ? 1   FME D O   1 
ATOM   8039  N  N   . LYS D 2 2   ? -18.35674 7.05387   -41.49542 1.000 52.73669  ? 2   LYS D N   1 
ATOM   8040  C  CA  . LYS D 2 2   ? -18.12547 8.41386   -41.01858 1.000 50.42350  ? 2   LYS D CA  1 
ATOM   8041  C  C   . LYS D 2 2   ? -16.99223 8.45469   -40.00844 1.000 49.87565  ? 2   LYS D C   1 
ATOM   8042  O  O   . LYS D 2 2   ? -16.75918 7.49096   -39.27681 1.000 49.77240  ? 2   LYS D O   1 
ATOM   8043  C  CB  . LYS D 2 2   ? -19.39217 8.99692   -40.39358 1.000 55.81356  ? 2   LYS D CB  1 
ATOM   8044  C  CG  . LYS D 2 2   ? -20.67501 8.75238   -41.16796 1.000 67.62132  ? 2   LYS D CG  1 
ATOM   8045  C  CD  . LYS D 2 2   ? -21.81817 9.54654   -40.54998 1.000 80.95543  ? 2   LYS D CD  1 
ATOM   8046  C  CE  . LYS D 2 2   ? -23.10851 9.39829   -41.33587 1.000 83.06366  ? 2   LYS D CE  1 
ATOM   8047  N  NZ  . LYS D 2 2   ? -24.23764 10.11729  -40.68264 1.000 76.59111  ? 2   LYS D NZ  1 
ATOM   8048  N  N   . GLY D 2 3   ? -16.29420 9.58561   -39.96597 1.000 54.30528  ? 3   GLY D N   1 
ATOM   8049  C  CA  . GLY D 2 3   ? -15.19639 9.75185   -39.03571 1.000 42.47590  ? 3   GLY D CA  1 
ATOM   8050  C  C   . GLY D 2 3   ? -14.84708 11.20329  -38.78855 1.000 50.74323  ? 3   GLY D C   1 
ATOM   8051  O  O   . GLY D 2 3   ? -14.76051 12.00157  -39.72768 1.000 55.22698  ? 3   GLY D O   1 
ATOM   8052  N  N   . PHE D 2 4   ? -14.66312 11.55763  -37.51952 1.000 40.26314  ? 4   PHE D N   1 
ATOM   8053  C  CA  . PHE D 2 4   ? -14.21591 12.89757  -37.16507 1.000 49.11914  ? 4   PHE D CA  1 
ATOM   8054  C  C   . PHE D 2 4   ? -12.73001 13.01423  -37.46921 1.000 48.76267  ? 4   PHE D C   1 
ATOM   8055  O  O   . PHE D 2 4   ? -11.91029 12.31116  -36.86863 1.000 54.70122  ? 4   PHE D O   1 
ATOM   8056  C  CB  . PHE D 2 4   ? -14.49473 13.16887  -35.69055 1.000 48.44226  ? 4   PHE D CB  1 
ATOM   8057  C  CG  . PHE D 2 4   ? -14.36294 14.61054  -35.29881 1.000 50.14549  ? 4   PHE D CG  1 
ATOM   8058  C  CD1 . PHE D 2 4   ? -15.21688 15.56920  -35.82073 1.000 57.83664  ? 4   PHE D CD1 1 
ATOM   8059  C  CD2 . PHE D 2 4   ? -13.39277 15.00537  -34.39304 1.000 48.64385  ? 4   PHE D CD2 1 
ATOM   8060  C  CE1 . PHE D 2 4   ? -15.09989 16.89706  -35.44955 1.000 46.92419  ? 4   PHE D CE1 1 
ATOM   8061  C  CE2 . PHE D 2 4   ? -13.27067 16.33045  -34.01897 1.000 44.84835  ? 4   PHE D CE2 1 
ATOM   8062  C  CZ  . PHE D 2 4   ? -14.12494 17.27629  -34.54760 1.000 45.29126  ? 4   PHE D CZ  1 
ATOM   8063  N  N   . ALA D 2 5   ? -12.37080 13.90677  -38.38467 1.000 55.47464  ? 5   ALA D N   1 
ATOM   8064  C  CA  . ALA D 2 5   ? -11.02649 13.89995  -38.93209 1.000 48.95308  ? 5   ALA D CA  1 
ATOM   8065  C  C   . ALA D 2 5   ? -10.40820 15.28457  -38.88865 1.000 49.59942  ? 5   ALA D C   1 
ATOM   8066  O  O   . ALA D 2 5   ? -11.09679 16.30099  -38.77445 1.000 49.00206  ? 5   ALA D O   1 
ATOM   8067  C  CB  . ALA D 2 5   ? -11.01892 13.38963  -40.37964 1.000 44.79597  ? 5   ALA D CB  1 
ATOM   8068  N  N   . MET D 2 6   ? -9.08226  15.29679  -38.98689 1.000 53.83423  ? 6   MET D N   1 
ATOM   8069  C  CA  . MET D 2 6   ? -8.31619  16.52564  -39.13360 1.000 54.00380  ? 6   MET D CA  1 
ATOM   8070  C  C   . MET D 2 6   ? -8.28025  16.85880  -40.61852 1.000 54.06239  ? 6   MET D C   1 
ATOM   8071  O  O   . MET D 2 6   ? -7.63792  16.15765  -41.40711 1.000 62.45936  ? 6   MET D O   1 
ATOM   8072  C  CB  . MET D 2 6   ? -6.90883  16.36714  -38.56480 1.000 47.97117  ? 6   MET D CB  1 
ATOM   8073  C  CG  . MET D 2 6   ? -5.99863  17.54512  -38.85843 1.000 57.20209  ? 6   MET D CG  1 
ATOM   8074  S  SD  . MET D 2 6   ? -4.30024  17.25364  -38.33865 1.000 61.59432  ? 6   MET D SD  1 
ATOM   8075  C  CE  . MET D 2 6   ? -3.48034  18.66015  -39.08533 1.000 56.81048  ? 6   MET D CE  1 
ATOM   8076  N  N   . LEU D 2 7   ? -8.99837  17.91080  -41.00200 1.000 60.57723  ? 7   LEU D N   1 
ATOM   8077  C  CA  . LEU D 2 7   ? -9.06943  18.29505  -42.40564 1.000 53.29084  ? 7   LEU D CA  1 
ATOM   8078  C  C   . LEU D 2 7   ? -7.75875  18.90852  -42.87608 1.000 62.30883  ? 7   LEU D C   1 
ATOM   8079  O  O   . LEU D 2 7   ? -7.19835  18.50381  -43.90178 1.000 64.51926  ? 7   LEU D O   1 
ATOM   8080  C  CB  . LEU D 2 7   ? -10.22549 19.26899  -42.59144 1.000 54.58623  ? 7   LEU D CB  1 
ATOM   8081  C  CG  . LEU D 2 7   ? -11.52692 18.81439  -41.93908 1.000 50.66642  ? 7   LEU D CG  1 
ATOM   8082  C  CD1 . LEU D 2 7   ? -12.61735 19.83156  -42.17226 1.000 50.33472  ? 7   LEU D CD1 1 
ATOM   8083  C  CD2 . LEU D 2 7   ? -11.92391 17.46702  -42.49314 1.000 52.41773  ? 7   LEU D CD2 1 
ATOM   8084  N  N   . SER D 2 8   ? -7.27308  19.90356  -42.14574 1.000 65.88018  ? 8   SER D N   1 
ATOM   8085  C  CA  . SER D 2 8   ? -5.98052  20.52791  -42.38316 1.000 65.76320  ? 8   SER D CA  1 
ATOM   8086  C  C   . SER D 2 8   ? -5.55386  21.15534  -41.06589 1.000 67.80052  ? 8   SER D C   1 
ATOM   8087  O  O   . SER D 2 8   ? -6.26488  21.06437  -40.06097 1.000 66.48214  ? 8   SER D O   1 
ATOM   8088  C  CB  . SER D 2 8   ? -6.05103  21.55900  -43.51246 1.000 64.80510  ? 8   SER D CB  1 
ATOM   8089  O  OG  . SER D 2 8   ? -6.88381  22.64885  -43.15729 1.000 69.44305  ? 8   SER D OG  1 
ATOM   8090  N  N   . ILE D 2 9   ? -4.38437  21.79031  -41.06689 1.000 65.84514  ? 9   ILE D N   1 
ATOM   8091  C  CA  . ILE D 2 9   ? -3.93584  22.45860  -39.85286 1.000 67.79566  ? 9   ILE D CA  1 
ATOM   8092  C  C   . ILE D 2 9   ? -4.94929  23.53285  -39.48553 1.000 66.87514  ? 9   ILE D C   1 
ATOM   8093  O  O   . ILE D 2 9   ? -5.17385  24.48504  -40.24464 1.000 77.46296  ? 9   ILE D O   1 
ATOM   8094  C  CB  . ILE D 2 9   ? -2.52867  23.03270  -40.03322 1.000 76.24012  ? 9   ILE D CB  1 
ATOM   8095  C  CG1 . ILE D 2 9   ? -1.52487  21.90099  -40.27226 1.000 79.25906  ? 9   ILE D CG1 1 
ATOM   8096  C  CG2 . ILE D 2 9   ? -2.12943  23.85986  -38.82053 1.000 70.69046  ? 9   ILE D CG2 1 
ATOM   8097  C  CD1 . ILE D 2 9   ? -0.08954  22.36855  -40.40236 1.000 80.25917  ? 9   ILE D CD1 1 
ATOM   8098  N  N   . GLY D 2 10  ? -5.58141  23.37001  -38.32202 1.000 68.00461  ? 10  GLY D N   1 
ATOM   8099  C  CA  . GLY D 2 10  ? -6.55430  24.31525  -37.82100 1.000 66.95003  ? 10  GLY D CA  1 
ATOM   8100  C  C   . GLY D 2 10  ? -8.00575  24.01145  -38.13904 1.000 62.96423  ? 10  GLY D C   1 
ATOM   8101  O  O   . GLY D 2 10  ? -8.88027  24.77452  -37.70727 1.000 67.05050  ? 10  GLY D O   1 
ATOM   8102  N  N   . LYS D 2 11  ? -8.29945  22.93470  -38.87595 1.000 57.98452  ? 11  LYS D N   1 
ATOM   8103  C  CA  . LYS D 2 11  ? -9.67201  22.60937  -39.24696 1.000 55.98590  ? 11  LYS D CA  1 
ATOM   8104  C  C   . LYS D 2 11  ? -9.96912  21.13133  -39.02542 1.000 58.15285  ? 11  LYS D C   1 
ATOM   8105  O  O   . LYS D 2 11  ? -9.15252  20.26330  -39.35190 1.000 66.41712  ? 11  LYS D O   1 
ATOM   8106  C  CB  . LYS D 2 11  ? -9.96894  22.97334  -40.71157 1.000 54.01893  ? 11  LYS D CB  1 
ATOM   8107  C  CG  . LYS D 2 11  ? -9.94563  24.46570  -41.01175 1.000 58.99136  ? 11  LYS D CG  1 
ATOM   8108  C  CD  . LYS D 2 11  ? -10.25150 24.74994  -42.47587 1.000 61.00274  ? 11  LYS D CD  1 
ATOM   8109  C  CE  . LYS D 2 11  ? -10.31455 26.24747  -42.74018 1.000 68.39483  ? 11  LYS D CE  1 
ATOM   8110  N  NZ  . LYS D 2 11  ? -10.52876 26.57802  -44.17612 1.000 66.46613  ? 11  LYS D NZ  1 
ATOM   8111  N  N   . VAL D 2 12  ? -11.15490 20.85315  -38.47381 1.000 52.67078  ? 12  VAL D N   1 
ATOM   8112  C  CA  . VAL D 2 12  ? -11.63551 19.49374  -38.25346 1.000 54.73564  ? 12  VAL D CA  1 
ATOM   8113  C  C   . VAL D 2 12  ? -13.10479 19.42502  -38.65113 1.000 53.23763  ? 12  VAL D C   1 
ATOM   8114  O  O   . VAL D 2 12  ? -13.80659 20.43704  -38.70569 1.000 52.20603  ? 12  VAL D O   1 
ATOM   8115  C  CB  . VAL D 2 12  ? -11.46955 19.02293  -36.78978 1.000 45.88641  ? 12  VAL D CB  1 
ATOM   8116  C  CG1 . VAL D 2 12  ? -10.00327 18.89799  -36.42477 1.000 55.52465  ? 12  VAL D CG1 1 
ATOM   8117  C  CG2 . VAL D 2 12  ? -12.17701 19.97029  -35.84633 1.000 51.95042  ? 12  VAL D CG2 1 
ATOM   8118  N  N   . GLY D 2 13  ? -13.56857 18.21131  -38.92214 1.000 50.32408  ? 13  GLY D N   1 
ATOM   8119  C  CA  . GLY D 2 13  ? -14.95777 18.00739  -39.28949 1.000 49.33185  ? 13  GLY D CA  1 
ATOM   8120  C  C   . GLY D 2 13  ? -15.19691 16.56662  -39.67498 1.000 53.03244  ? 13  GLY D C   1 
ATOM   8121  O  O   . GLY D 2 13  ? -14.26377 15.79351  -39.90883 1.000 53.57862  ? 13  GLY D O   1 
ATOM   8122  N  N   . TRP D 2 14  ? -16.47994 16.21572  -39.76160 1.000 53.87804  ? 14  TRP D N   1 
ATOM   8123  C  CA  . TRP D 2 14  ? -16.85659 14.85814  -40.13390 1.000 53.11909  ? 14  TRP D CA  1 
ATOM   8124  C  C   . TRP D 2 14  ? -16.71982 14.66033  -41.63573 1.000 58.87681  ? 14  TRP D C   1 
ATOM   8125  O  O   . TRP D 2 14  ? -17.15778 15.50010  -42.42850 1.000 55.21745  ? 14  TRP D O   1 
ATOM   8126  C  CB  . TRP D 2 14  ? -18.28591 14.54653  -39.69281 1.000 48.12115  ? 14  TRP D CB  1 
ATOM   8127  C  CG  . TRP D 2 14  ? -18.42812 14.35429  -38.22078 1.000 51.16626  ? 14  TRP D CG  1 
ATOM   8128  C  CD1 . TRP D 2 14  ? -18.72646 15.30533  -37.29128 1.000 58.25303  ? 14  TRP D CD1 1 
ATOM   8129  C  CD2 . TRP D 2 14  ? -18.25474 13.12996  -37.50186 1.000 44.91176  ? 14  TRP D CD2 1 
ATOM   8130  N  NE1 . TRP D 2 14  ? -18.76288 14.74436  -36.03622 1.000 56.36181  ? 14  TRP D NE1 1 
ATOM   8131  C  CE2 . TRP D 2 14  ? -18.47392 13.40957  -36.14037 1.000 51.11354  ? 14  TRP D CE2 1 
ATOM   8132  C  CE3 . TRP D 2 14  ? -17.94071 11.82164  -37.87935 1.000 47.84072  ? 14  TRP D CE3 1 
ATOM   8133  C  CZ2 . TRP D 2 14  ? -18.38722 12.43020  -35.15610 1.000 52.79652  ? 14  TRP D CZ2 1 
ATOM   8134  C  CZ3 . TRP D 2 14  ? -17.85451 10.85270  -36.90227 1.000 46.47026  ? 14  TRP D CZ3 1 
ATOM   8135  C  CH2 . TRP D 2 14  ? -18.07744 11.16045  -35.55682 1.000 48.19277  ? 14  TRP D CH2 1 
ATOM   8136  N  N   . ILE D 2 15  ? -16.12660 13.53474  -42.02009 1.000 54.27759  ? 15  ILE D N   1 
ATOM   8137  C  CA  . ILE D 2 15  ? -15.89697 13.17771  -43.40734 1.000 54.84703  ? 15  ILE D CA  1 
ATOM   8138  C  C   . ILE D 2 15  ? -16.39516 11.75440  -43.62731 1.000 56.66128  ? 15  ILE D C   1 
ATOM   8139  O  O   . ILE D 2 15  ? -16.82625 11.07478  -42.69753 1.000 66.41208  ? 15  ILE D O   1 
ATOM   8140  C  CB  . ILE D 2 15  ? -14.41162 13.29767  -43.80011 1.000 54.20330  ? 15  ILE D CB  1 
ATOM   8141  C  CG1 . ILE D 2 15  ? -13.58926 12.27758  -43.01473 1.000 56.70465  ? 15  ILE D CG1 1 
ATOM   8142  C  CG2 . ILE D 2 15  ? -13.90175 14.70346  -43.55106 1.000 48.34338  ? 15  ILE D CG2 1 
ATOM   8143  C  CD1 . ILE D 2 15  ? -12.18585 12.12126  -43.51207 1.000 61.29439  ? 15  ILE D CD1 1 
ATOM   8144  N  N   . GLU D 2 16  ? -16.30899 11.30195  -44.87273 1.000 57.59654  ? 16  GLU D N   1 
ATOM   8145  C  CA  . GLU D 2 16  ? -16.70754 9.95598   -45.24928 1.000 60.20309  ? 16  GLU D CA  1 
ATOM   8146  C  C   . GLU D 2 16  ? -15.50135 9.25541   -45.84904 1.000 63.76810  ? 16  GLU D C   1 
ATOM   8147  O  O   . GLU D 2 16  ? -14.84948 9.79344   -46.75046 1.000 71.30665  ? 16  GLU D O   1 
ATOM   8148  C  CB  . GLU D 2 16  ? -17.86878 9.97150   -46.24368 1.000 67.86751  ? 16  GLU D CB  1 
ATOM   8149  C  CG  . GLU D 2 16  ? -19.17540 10.46269  -45.65208 1.000 83.10531  ? 16  GLU D CG  1 
ATOM   8150  C  CD  . GLU D 2 16  ? -20.27900 10.53216  -46.68342 1.000 103.67272 ? 16  GLU D CD  1 
ATOM   8151  O  OE1 . GLU D 2 16  ? -20.01598 10.18898  -47.85712 1.000 102.61578 ? 16  GLU D OE1 1 
ATOM   8152  O  OE2 . GLU D 2 16  ? -21.39991 10.95225  -46.33028 1.000 116.26452 ? 16  GLU D OE2 1 
ATOM   8153  N  N   . LYS D 2 17  ? -15.20995 8.05825   -45.35114 1.000 62.30366  ? 17  LYS D N   1 
ATOM   8154  C  CA  . LYS D 2 17  ? -14.07967 7.27849   -45.82438 1.000 68.11583  ? 17  LYS D CA  1 
ATOM   8155  C  C   . LYS D 2 17  ? -14.55469 5.85058   -46.02875 1.000 62.12771  ? 17  LYS D C   1 
ATOM   8156  O  O   . LYS D 2 17  ? -15.70191 5.50603   -45.72989 1.000 62.11305  ? 17  LYS D O   1 
ATOM   8157  C  CB  . LYS D 2 17  ? -12.89992 7.35019   -44.84472 1.000 55.85386  ? 17  LYS D CB  1 
ATOM   8158  C  CG  . LYS D 2 17  ? -12.24733 8.73204   -44.81385 1.000 74.60714  ? 17  LYS D CG  1 
ATOM   8159  C  CD  . LYS D 2 17  ? -10.93664 8.77034   -44.03922 1.000 51.98223  ? 17  LYS D CD  1 
ATOM   8160  C  CE  . LYS D 2 17  ? -9.84926  7.99108   -44.75092 1.000 64.07121  ? 17  LYS D CE  1 
ATOM   8161  N  NZ  . LYS D 2 17  ? -8.52557  8.19594   -44.09548 1.000 73.07424  ? 17  LYS D NZ  1 
ATOM   8162  N  N   . GLU D 2 18  ? -13.66175 5.00909   -46.52534 1.000 65.05927  ? 18  GLU D N   1 
ATOM   8163  C  CA  . GLU D 2 18  ? -13.98564 3.61049   -46.72872 1.000 58.81358  ? 18  GLU D CA  1 
ATOM   8164  C  C   . GLU D 2 18  ? -13.70863 2.83849   -45.45088 1.000 53.31506  ? 18  GLU D C   1 
ATOM   8165  O  O   . GLU D 2 18  ? -12.71348 3.08766   -44.76538 1.000 59.57568  ? 18  GLU D O   1 
ATOM   8166  C  CB  . GLU D 2 18  ? -13.16795 3.03678   -47.88508 1.000 64.09135  ? 18  GLU D CB  1 
ATOM   8167  C  CG  . GLU D 2 18  ? -13.64018 1.68480   -48.38457 1.000 82.45012  ? 18  GLU D CG  1 
ATOM   8168  C  CD  . GLU D 2 18  ? -13.12322 1.37413   -49.77640 1.000 105.07497 ? 18  GLU D CD  1 
ATOM   8169  O  OE1 . GLU D 2 18  ? -13.02157 2.31450   -50.59413 1.000 104.56922 ? 18  GLU D OE1 1 
ATOM   8170  O  OE2 . GLU D 2 18  ? -12.81325 0.19550   -50.05150 1.000 107.65013 ? 18  GLU D OE2 1 
ATOM   8171  N  N   . LYS D 2 19  ? -14.61424 1.92932   -45.11708 1.000 52.01946  ? 19  LYS D N   1 
ATOM   8172  C  CA  . LYS D 2 19  ? -14.43409 1.10678   -43.93228 1.000 50.55057  ? 19  LYS D CA  1 
ATOM   8173  C  C   . LYS D 2 19  ? -13.15208 0.29120   -44.06460 1.000 59.36245  ? 19  LYS D C   1 
ATOM   8174  O  O   . LYS D 2 19  ? -12.96637 -0.39979  -45.07634 1.000 57.87476  ? 19  LYS D O   1 
ATOM   8175  C  CB  . LYS D 2 19  ? -15.62950 0.17748   -43.73792 1.000 48.53986  ? 19  LYS D CB  1 
ATOM   8176  C  CG  . LYS D 2 19  ? -15.49790 -0.75505  -42.54622 1.000 47.66014  ? 19  LYS D CG  1 
ATOM   8177  C  CD  . LYS D 2 19  ? -16.73119 -1.62573  -42.39011 1.000 51.27755  ? 19  LYS D CD  1 
ATOM   8178  C  CE  . LYS D 2 19  ? -16.56417 -2.61803  -41.25096 1.000 60.05020  ? 19  LYS D CE  1 
ATOM   8179  N  NZ  . LYS D 2 19  ? -17.79639 -3.43239  -41.04781 1.000 59.28678  ? 19  LYS D NZ  1 
ATOM   8180  N  N   . PRO D 2 20  ? -12.25059 0.34379   -43.08630 1.000 57.60540  ? 20  PRO D N   1 
ATOM   8181  C  CA  . PRO D 2 20  ? -10.98108 -0.37467  -43.22343 1.000 50.54733  ? 20  PRO D CA  1 
ATOM   8182  C  C   . PRO D 2 20  ? -11.19057 -1.87834  -43.19462 1.000 43.87438  ? 20  PRO D C   1 
ATOM   8183  O  O   . PRO D 2 20  ? -12.09289 -2.39487  -42.53171 1.000 48.57686  ? 20  PRO D O   1 
ATOM   8184  C  CB  . PRO D 2 20  ? -10.17069 0.09819   -42.01116 1.000 45.27338  ? 20  PRO D CB  1 
ATOM   8185  C  CG  . PRO D 2 20  ? -11.20036 0.49108   -41.00758 1.000 44.14007  ? 20  PRO D CG  1 
ATOM   8186  C  CD  . PRO D 2 20  ? -12.34574 1.06073   -41.80228 1.000 55.34191  ? 20  PRO D CD  1 
ATOM   8187  N  N   . ALA D 2 21  ? -10.34515 -2.57805  -43.94063 1.000 49.20627  ? 21  ALA D N   1 
ATOM   8188  C  CA  . ALA D 2 21  ? -10.34818 -4.02887  -44.02288 1.000 48.84006  ? 21  ALA D CA  1 
ATOM   8189  C  C   . ALA D 2 21  ? -9.18473  -4.60001  -43.22699 1.000 45.20035  ? 21  ALA D C   1 
ATOM   8190  O  O   . ALA D 2 21  ? -8.07254  -4.06103  -43.27704 1.000 48.07886  ? 21  ALA D O   1 
ATOM   8191  C  CB  . ALA D 2 21  ? -10.24945 -4.49578  -45.47526 1.000 51.35201  ? 21  ALA D CB  1 
ATOM   8192  N  N   . PRO D 2 22  ? -9.40446  -5.67909  -42.48193 1.000 50.96393  ? 22  PRO D N   1 
ATOM   8193  C  CA  . PRO D 2 22  ? -8.32786  -6.22683  -41.65417 1.000 42.45417  ? 22  PRO D CA  1 
ATOM   8194  C  C   . PRO D 2 22  ? -7.42857  -7.15873  -42.44668 1.000 47.84755  ? 22  PRO D C   1 
ATOM   8195  O  O   . PRO D 2 22  ? -7.88958  -7.95609  -43.26761 1.000 44.80246  ? 22  PRO D O   1 
ATOM   8196  C  CB  . PRO D 2 22  ? -9.08583  -6.99521  -40.56757 1.000 38.76587  ? 22  PRO D CB  1 
ATOM   8197  C  CG  . PRO D 2 22  ? -10.31915 -7.47286  -41.27443 1.000 47.03642  ? 22  PRO D CG  1 
ATOM   8198  C  CD  . PRO D 2 22  ? -10.66489 -6.42531  -42.31532 1.000 42.97143  ? 22  PRO D CD  1 
ATOM   8199  N  N   . GLY D 2 23  ? -6.12518  -7.05424  -42.18883 1.000 48.50896  ? 23  GLY D N   1 
ATOM   8200  C  CA  . GLY D 2 23  ? -5.20582  -8.04114  -42.66818 1.000 41.69773  ? 23  GLY D CA  1 
ATOM   8201  C  C   . GLY D 2 23  ? -5.36930  -9.33913  -41.90196 1.000 45.45423  ? 23  GLY D C   1 
ATOM   8202  O  O   . GLY D 2 23  ? -6.15661  -9.42969  -40.94984 1.000 47.65712  ? 23  GLY D O   1 
ATOM   8203  N  N   . PRO D 2 24  ? -4.61298  -10.36194 -42.30316 1.000 47.13279  ? 24  PRO D N   1 
ATOM   8204  C  CA  . PRO D 2 24  ? -4.74550  -11.66962 -41.63878 1.000 43.14108  ? 24  PRO D CA  1 
ATOM   8205  C  C   . PRO D 2 24  ? -4.48357  -11.62747 -40.14209 1.000 44.37098  ? 24  PRO D C   1 
ATOM   8206  O  O   . PRO D 2 24  ? -4.98945  -12.49417 -39.41863 1.000 47.38135  ? 24  PRO D O   1 
ATOM   8207  C  CB  . PRO D 2 24  ? -3.71926  -12.54688 -42.37225 1.000 50.29694  ? 24  PRO D CB  1 
ATOM   8208  C  CG  . PRO D 2 24  ? -2.84412  -11.59062 -43.14187 1.000 45.63670  ? 24  PRO D CG  1 
ATOM   8209  C  CD  . PRO D 2 24  ? -3.69870  -10.41263 -43.45482 1.000 42.30597  ? 24  PRO D CD  1 
ATOM   8210  N  N   . PHE D 2 25  ? -3.72527  -10.64832 -39.65028 1.000 42.14046  ? 25  PHE D N   1 
ATOM   8211  C  CA  . PHE D 2 25  ? -3.42375  -10.53652 -38.23022 1.000 39.10067  ? 25  PHE D CA  1 
ATOM   8212  C  C   . PHE D 2 25  ? -4.12855  -9.36878  -37.55523 1.000 43.85257  ? 25  PHE D C   1 
ATOM   8213  O  O   . PHE D 2 25  ? -3.91592  -9.14511  -36.35895 1.000 43.24905  ? 25  PHE D O   1 
ATOM   8214  C  CB  . PHE D 2 25  ? -1.91076  -10.40330 -38.02164 1.000 39.24633  ? 25  PHE D CB  1 
ATOM   8215  C  CG  . PHE D 2 25  ? -1.12863  -11.58310 -38.50837 1.000 42.67192  ? 25  PHE D CG  1 
ATOM   8216  C  CD1 . PHE D 2 25  ? -0.67187  -11.63774 -39.81492 1.000 42.09497  ? 25  PHE D CD1 1 
ATOM   8217  C  CD2 . PHE D 2 25  ? -0.85296  -12.64222 -37.65975 1.000 44.83976  ? 25  PHE D CD2 1 
ATOM   8218  C  CE1 . PHE D 2 25  ? 0.04572   -12.72938 -40.26683 1.000 44.63331  ? 25  PHE D CE1 1 
ATOM   8219  C  CE2 . PHE D 2 25  ? -0.13563  -13.73608 -38.10375 1.000 49.80356  ? 25  PHE D CE2 1 
ATOM   8220  C  CZ  . PHE D 2 25  ? 0.31486   -13.77996 -39.41009 1.000 50.36900  ? 25  PHE D CZ  1 
ATOM   8221  N  N   . ASP D 2 26  ? -4.96913  -8.63327  -38.27517 1.000 40.01064  ? 26  ASP D N   1 
ATOM   8222  C  CA  . ASP D 2 26  ? -5.56629  -7.40678  -37.77430 1.000 38.42044  ? 26  ASP D CA  1 
ATOM   8223  C  C   . ASP D 2 26  ? -7.01120  -7.63798  -37.33876 1.000 39.60612  ? 26  ASP D C   1 
ATOM   8224  O  O   . ASP D 2 26  ? -7.57766  -8.72227  -37.49664 1.000 41.92273  ? 26  ASP D O   1 
ATOM   8225  C  CB  . ASP D 2 26  ? -5.49024  -6.31797  -38.84389 1.000 43.63955  ? 26  ASP D CB  1 
ATOM   8226  C  CG  . ASP D 2 26  ? -4.09476  -6.15183  -39.39979 1.000 43.83545  ? 26  ASP D CG  1 
ATOM   8227  O  OD1 . ASP D 2 26  ? -3.12541  -6.35896  -38.63490 1.000 41.59978  ? 26  ASP D OD1 1 
ATOM   8228  O  OD2 . ASP D 2 26  ? -3.96819  -5.82932  -40.60255 1.000 47.71129  ? 26  ASP D OD2 1 
ATOM   8229  N  N   . ALA D 2 27  ? -7.61559  -6.58774  -36.78678 1.000 35.78898  ? 27  ALA D N   1 
ATOM   8230  C  CA  . ALA D 2 27  ? -9.01180  -6.61358  -36.38291 1.000 34.71266  ? 27  ALA D CA  1 
ATOM   8231  C  C   . ALA D 2 27  ? -9.64419  -5.26512  -36.67936 1.000 38.35395  ? 27  ALA D C   1 
ATOM   8232  O  O   . ALA D 2 27  ? -8.97662  -4.22886  -36.65374 1.000 35.78904  ? 27  ALA D O   1 
ATOM   8233  C  CB  . ALA D 2 27  ? -9.17746  -6.93741  -34.89312 1.000 36.74994  ? 27  ALA D CB  1 
ATOM   8234  N  N   . ILE D 2 28  ? -10.93507 -5.29327  -36.98661 1.000 38.82903  ? 28  ILE D N   1 
ATOM   8235  C  CA  . ILE D 2 28  ? -11.73830 -4.08694  -37.12147 1.000 41.48357  ? 28  ILE D CA  1 
ATOM   8236  C  C   . ILE D 2 28  ? -12.57828 -3.94622  -35.86196 1.000 41.85761  ? 28  ILE D C   1 
ATOM   8237  O  O   . ILE D 2 28  ? -13.25215 -4.89700  -35.44576 1.000 40.54490  ? 28  ILE D O   1 
ATOM   8238  C  CB  . ILE D 2 28  ? -12.61929 -4.13725  -38.38033 1.000 42.80706  ? 28  ILE D CB  1 
ATOM   8239  C  CG1 . ILE D 2 28  ? -11.75019 -4.37588  -39.61337 1.000 42.16146  ? 28  ILE D CG1 1 
ATOM   8240  C  CG2 . ILE D 2 28  ? -13.41254 -2.85057  -38.52925 1.000 42.16868  ? 28  ILE D CG2 1 
ATOM   8241  C  CD1 . ILE D 2 28  ? -10.65830 -3.33944  -39.79418 1.000 43.15476  ? 28  ILE D CD1 1 
ATOM   8242  N  N   . VAL D 2 29  ? -12.52687 -2.77110  -35.24376 1.000 39.26062  ? 29  VAL D N   1 
ATOM   8243  C  CA  . VAL D 2 29  ? -13.19085 -2.52187  -33.97149 1.000 39.68871  ? 29  VAL D CA  1 
ATOM   8244  C  C   . VAL D 2 29  ? -14.17141 -1.37270  -34.14047 1.000 31.30517  ? 29  VAL D C   1 
ATOM   8245  O  O   . VAL D 2 29  ? -13.85749 -0.36657  -34.78549 1.000 45.67120  ? 29  VAL D O   1 
ATOM   8246  C  CB  . VAL D 2 29  ? -12.16988 -2.20968  -32.85617 1.000 32.58348  ? 29  VAL D CB  1 
ATOM   8247  C  CG1 . VAL D 2 29  ? -12.87562 -1.98919  -31.53033 1.000 36.05207  ? 29  VAL D CG1 1 
ATOM   8248  C  CG2 . VAL D 2 29  ? -11.15880 -3.33538  -32.74043 1.000 31.76690  ? 29  VAL D CG2 1 
ATOM   8249  N  N   . ARG D 2 30  ? -15.36937 -1.53899  -33.59031 1.000 38.76447  ? 30  ARG D N   1 
ATOM   8250  C  CA  . ARG D 2 30  ? -16.19701 -0.34530  -33.50809 1.000 40.88752  ? 30  ARG D CA  1 
ATOM   8251  C  C   . ARG D 2 30  ? -16.13853 0.22437   -32.09616 1.000 42.75775  ? 30  ARG D C   1 
ATOM   8252  O  O   . ARG D 2 30  ? -16.14960 -0.53469  -31.12003 1.000 40.28746  ? 30  ARG D O   1 
ATOM   8253  C  CB  . ARG D 2 30  ? -17.65012 -0.64478  -33.88196 1.000 45.85812  ? 30  ARG D CB  1 
ATOM   8254  C  CG  . ARG D 2 30  ? -18.41253 -1.50286  -32.89347 1.000 44.74249  ? 30  ARG D CG  1 
ATOM   8255  C  CD  . ARG D 2 30  ? -19.85519 -1.65903  -33.31960 1.000 42.53311  ? 30  ARG D CD  1 
ATOM   8256  N  NE  . ARG D 2 30  ? -20.67792 -2.23160  -32.26081 1.000 49.76628  ? 30  ARG D NE  1 
ATOM   8257  C  CZ  . ARG D 2 30  ? -21.28672 -1.51993  -31.32179 1.000 51.78515  ? 30  ARG D CZ  1 
ATOM   8258  N  NH1 . ARG D 2 30  ? -21.20574 -0.19901  -31.29393 1.000 43.96470  ? 30  ARG D NH1 1 
ATOM   8259  N  NH2 . ARG D 2 30  ? -21.99715 -2.14833  -30.38944 1.000 57.52960  ? 30  ARG D NH2 1 
ATOM   8260  N  N   . PRO D 2 31  ? -16.04931 1.54267   -31.94102 1.000 42.22709  ? 31  PRO D N   1 
ATOM   8261  C  CA  . PRO D 2 31  ? -15.85227 2.10921   -30.60278 1.000 37.71855  ? 31  PRO D CA  1 
ATOM   8262  C  C   . PRO D 2 31  ? -17.12794 2.09496   -29.77337 1.000 43.62956  ? 31  PRO D C   1 
ATOM   8263  O  O   . PRO D 2 31  ? -18.22124 2.39945   -30.25887 1.000 41.70992  ? 31  PRO D O   1 
ATOM   8264  C  CB  . PRO D 2 31  ? -15.38867 3.54036   -30.89563 1.000 37.16914  ? 31  PRO D CB  1 
ATOM   8265  C  CG  . PRO D 2 31  ? -15.99676 3.86197   -32.21338 1.000 32.92934  ? 31  PRO D CG  1 
ATOM   8266  C  CD  . PRO D 2 31  ? -16.01211 2.57353   -32.99303 1.000 37.52511  ? 31  PRO D CD  1 
ATOM   8267  N  N   . LEU D 2 32  ? -16.97324 1.71969   -28.50309 1.000 41.79634  ? 32  LEU D N   1 
ATOM   8268  C  CA  . LEU D 2 32  ? -18.04580 1.80767   -27.51966 1.000 38.34866  ? 32  LEU D CA  1 
ATOM   8269  C  C   . LEU D 2 32  ? -17.92504 3.04138   -26.63875 1.000 49.08059  ? 32  LEU D C   1 
ATOM   8270  O  O   . LEU D 2 32  ? -18.94475 3.59533   -26.21535 1.000 45.43487  ? 32  LEU D O   1 
ATOM   8271  C  CB  . LEU D 2 32  ? -18.05841 0.55679   -26.63348 1.000 33.70115  ? 32  LEU D CB  1 
ATOM   8272  C  CG  . LEU D 2 32  ? -18.23207 -0.78326  -27.34543 1.000 34.63170  ? 32  LEU D CG  1 
ATOM   8273  C  CD1 . LEU D 2 32  ? -18.08258 -1.93252  -26.36775 1.000 38.68834  ? 32  LEU D CD1 1 
ATOM   8274  C  CD2 . LEU D 2 32  ? -19.58939 -0.83554  -28.01319 1.000 44.65306  ? 32  LEU D CD2 1 
ATOM   8275  N  N   . ALA D 2 33  ? -16.70041 3.47980   -26.36379 1.000 36.05836  ? 33  ALA D N   1 
ATOM   8276  C  CA  . ALA D 2 33  ? -16.44071 4.70042   -25.61866 1.000 40.04851  ? 33  ALA D CA  1 
ATOM   8277  C  C   . ALA D 2 33  ? -15.10833 5.25256   -26.09568 1.000 35.57067  ? 33  ALA D C   1 
ATOM   8278  O  O   . ALA D 2 33  ? -14.16450 4.48946   -26.31357 1.000 40.82523  ? 33  ALA D O   1 
ATOM   8279  C  CB  . ALA D 2 33  ? -16.41281 4.44693   -24.10729 1.000 32.29249  ? 33  ALA D CB  1 
ATOM   8280  N  N   . VAL D 2 34  ? -15.04614 6.57065   -26.29797 1.000 39.72967  ? 34  VAL D N   1 
ATOM   8281  C  CA  . VAL D 2 34  ? -13.82740 7.23035   -26.74680 1.000 34.15168  ? 34  VAL D CA  1 
ATOM   8282  C  C   . VAL D 2 34  ? -13.59143 8.47919   -25.90510 1.000 37.76414  ? 34  VAL D C   1 
ATOM   8283  O  O   . VAL D 2 34  ? -14.49373 8.99364   -25.24108 1.000 40.50253  ? 34  VAL D O   1 
ATOM   8284  C  CB  . VAL D 2 34  ? -13.87121 7.59574   -28.24944 1.000 37.13279  ? 34  VAL D CB  1 
ATOM   8285  C  CG1 . VAL D 2 34  ? -13.99293 6.33818   -29.10484 1.000 34.87486  ? 34  VAL D CG1 1 
ATOM   8286  C  CG2 . VAL D 2 34  ? -15.00889 8.56381   -28.53678 1.000 30.84396  ? 34  VAL D CG2 1 
ATOM   8287  N  N   . ALA D 2 35  ? -12.35281 8.97110   -25.95003 1.000 35.38312  ? 35  ALA D N   1 
ATOM   8288  C  CA  . ALA D 2 35  ? -11.94240 10.15846  -25.21391 1.000 38.86873  ? 35  ALA D CA  1 
ATOM   8289  C  C   . ALA D 2 35  ? -10.95798 10.95834  -26.05398 1.000 47.13541  ? 35  ALA D C   1 
ATOM   8290  O  O   . ALA D 2 35  ? -10.07890 10.37277  -26.70440 1.000 40.18594  ? 35  ALA D O   1 
ATOM   8291  C  CB  . ALA D 2 35  ? -11.29015 9.79942   -23.87211 1.000 36.64756  ? 35  ALA D CB  1 
ATOM   8292  N  N   . PRO D 2 36  ? -11.08716 12.28017  -26.07813 1.000 41.44027  ? 36  PRO D N   1 
ATOM   8293  C  CA  . PRO D 2 36  ? -10.09066 13.10856  -26.75844 1.000 40.26454  ? 36  PRO D CA  1 
ATOM   8294  C  C   . PRO D 2 36  ? -8.87844  13.35344  -25.87442 1.000 41.38566  ? 36  PRO D C   1 
ATOM   8295  O  O   . PRO D 2 36  ? -8.92213  13.21491  -24.65164 1.000 45.54314  ? 36  PRO D O   1 
ATOM   8296  C  CB  . PRO D 2 36  ? -10.84270 14.41413  -27.03001 1.000 34.33958  ? 36  PRO D CB  1 
ATOM   8297  C  CG  . PRO D 2 36  ? -11.82437 14.49188  -25.91826 1.000 42.92719  ? 36  PRO D CG  1 
ATOM   8298  C  CD  . PRO D 2 36  ? -12.22060 13.07678  -25.57914 1.000 40.99181  ? 36  PRO D CD  1 
ATOM   8299  N  N   . CYS D 2 37  ? -7.78354  13.73299  -26.52269 1.000 39.44618  ? 37  CYS D N   1 
ATOM   8300  C  CA  . CYS D 2 37  ? -6.51711  13.95497  -25.84451 1.000 47.17601  ? 37  CYS D CA  1 
ATOM   8301  C  C   . CYS D 2 37  ? -5.95308  15.30965  -26.24192 1.000 43.83506  ? 37  CYS D C   1 
ATOM   8302  O  O   . CYS D 2 37  ? -6.22224  15.81651  -27.33366 1.000 49.27194  ? 37  CYS D O   1 
ATOM   8303  C  CB  . CYS D 2 37  ? -5.49815  12.85858  -26.17331 1.000 49.91139  ? 37  CYS D CB  1 
ATOM   8304  S  SG  . CYS D 2 37  ? -3.92702  13.03820  -25.30357 1.000 56.36230  ? 37  CYS D SG  1 
ATOM   8305  N  N   . THR D 2 38  ? -5.16045  15.89061  -25.33762 1.000 49.53279  ? 38  THR D N   1 
ATOM   8306  C  CA  . THR D 2 38  ? -4.49883  17.15594  -25.63499 1.000 55.14988  ? 38  THR D CA  1 
ATOM   8307  C  C   . THR D 2 38  ? -3.55385  17.02290  -26.82218 1.000 54.40580  ? 38  THR D C   1 
ATOM   8308  O  O   . THR D 2 38  ? -3.29505  18.00692  -27.52450 1.000 55.98863  ? 38  THR D O   1 
ATOM   8309  C  CB  . THR D 2 38  ? -3.74090  17.64660  -24.40059 1.000 60.52605  ? 38  THR D CB  1 
ATOM   8310  O  OG1 . THR D 2 38  ? -4.56098  17.47098  -23.23761 1.000 64.26752  ? 38  THR D OG1 1 
ATOM   8311  C  CG2 . THR D 2 38  ? -3.39034  19.11911  -24.53804 1.000 76.74992  ? 38  THR D CG2 1 
ATOM   8312  N  N   . SER D 2 39  ? -3.04035  15.81401  -27.06359 1.000 46.61744  ? 39  SER D N   1 
ATOM   8313  C  CA  . SER D 2 39  ? -2.12255  15.58977  -28.17563 1.000 53.25141  ? 39  SER D CA  1 
ATOM   8314  C  C   . SER D 2 39  ? -2.79230  15.84166  -29.52071 1.000 47.89335  ? 39  SER D C   1 
ATOM   8315  O  O   . SER D 2 39  ? -2.16625  16.38202  -30.43978 1.000 61.80031  ? 39  SER D O   1 
ATOM   8316  C  CB  . SER D 2 39  ? -1.57705  14.16502  -28.11119 1.000 66.89129  ? 39  SER D CB  1 
ATOM   8317  O  OG  . SER D 2 39  ? -0.92559  13.93445  -26.87289 1.000 82.05494  ? 39  SER D OG  1 
ATOM   8318  N  N   . ASP D 2 40  ? -4.06061  15.45117  -29.66229 1.000 51.08594  ? 40  ASP D N   1 
ATOM   8319  C  CA  . ASP D 2 40  ? -4.77322  15.72775  -30.90629 1.000 47.95752  ? 40  ASP D CA  1 
ATOM   8320  C  C   . ASP D 2 40  ? -4.97171  17.22107  -31.11417 1.000 60.45687  ? 40  ASP D C   1 
ATOM   8321  O  O   . ASP D 2 40  ? -4.95989  17.69533  -32.25634 1.000 61.97457  ? 40  ASP D O   1 
ATOM   8322  C  CB  . ASP D 2 40  ? -6.11813  15.00792  -30.92119 1.000 48.04772  ? 40  ASP D CB  1 
ATOM   8323  C  CG  . ASP D 2 40  ? -5.97953  13.52044  -31.18816 1.000 58.96794  ? 40  ASP D CG  1 
ATOM   8324  O  OD1 . ASP D 2 40  ? -4.85447  13.05913  -31.48711 1.000 60.15767  ? 40  ASP D OD1 1 
ATOM   8325  O  OD2 . ASP D 2 40  ? -7.00398  12.81253  -31.09871 1.000 54.38197  ? 40  ASP D OD2 1 
ATOM   8326  N  N   . ILE D 2 41  ? -5.14903  17.97457  -30.02825 1.000 60.57252  ? 41  ILE D N   1 
ATOM   8327  C  CA  . ILE D 2 41  ? -5.22463  19.42616  -30.14054 1.000 56.60011  ? 41  ILE D CA  1 
ATOM   8328  C  C   . ILE D 2 41  ? -3.91872  19.97145  -30.69776 1.000 55.26139  ? 41  ILE D C   1 
ATOM   8329  O  O   . ILE D 2 41  ? -3.91496  20.83993  -31.57798 1.000 66.46079  ? 41  ILE D O   1 
ATOM   8330  C  CB  . ILE D 2 41  ? -5.56796  20.05039  -28.77549 1.000 57.75128  ? 41  ILE D CB  1 
ATOM   8331  C  CG1 . ILE D 2 41  ? -6.85781  19.44109  -28.22367 1.000 56.04204  ? 41  ILE D CG1 1 
ATOM   8332  C  CG2 . ILE D 2 41  ? -5.68838  21.56234  -28.89136 1.000 64.13898  ? 41  ILE D CG2 1 
ATOM   8333  C  CD1 . ILE D 2 41  ? -8.08238  19.74713  -29.05320 1.000 56.63865  ? 41  ILE D CD1 1 
ATOM   8334  N  N   . HIS D 2 42  ? -2.79008  19.46763  -30.19340 1.000 56.27786  ? 42  HIS D N   1 
ATOM   8335  C  CA  . HIS D 2 42  ? -1.48765  19.89153  -30.69574 1.000 66.49974  ? 42  HIS D CA  1 
ATOM   8336  C  C   . HIS D 2 42  ? -1.32050  19.53503  -32.16852 1.000 63.84627  ? 42  HIS D C   1 
ATOM   8337  O  O   . HIS D 2 42  ? -0.71951  20.29544  -32.93669 1.000 70.22471  ? 42  HIS D O   1 
ATOM   8338  C  CB  . HIS D 2 42  ? -0.38147  19.24466  -29.86250 1.000 74.47129  ? 42  HIS D CB  1 
ATOM   8339  C  CG  . HIS D 2 42  ? -0.33352  19.72233  -28.44415 1.000 81.37558  ? 42  HIS D CG  1 
ATOM   8340  N  ND1 . HIS D 2 42  ? 0.25231   18.99026  -27.43302 1.000 79.31935  ? 42  HIS D ND1 1 
ATOM   8341  C  CD2 . HIS D 2 42  ? -0.79630  20.85713  -27.86753 1.000 83.21978  ? 42  HIS D CD2 1 
ATOM   8342  C  CE1 . HIS D 2 42  ? 0.14624   19.65221  -26.29454 1.000 82.57027  ? 42  HIS D CE1 1 
ATOM   8343  N  NE2 . HIS D 2 42  ? -0.48504  20.78864  -26.53083 1.000 86.71314  ? 42  HIS D NE2 1 
ATOM   8344  N  N   . THR D 2 43  ? -1.84636  18.37919  -32.57982 1.000 60.24610  ? 43  THR D N   1 
ATOM   8345  C  CA  . THR D 2 43  ? -1.71422  17.95323  -33.96977 1.000 58.88333  ? 43  THR D CA  1 
ATOM   8346  C  C   . THR D 2 43  ? -2.51483  18.84886  -34.90721 1.000 65.34132  ? 43  THR D C   1 
ATOM   8347  O  O   . THR D 2 43  ? -2.02759  19.23032  -35.97839 1.000 67.01658  ? 43  THR D O   1 
ATOM   8348  C  CB  . THR D 2 43  ? -2.16607  16.49771  -34.11306 1.000 67.41273  ? 43  THR D CB  1 
ATOM   8349  O  OG1 . THR D 2 43  ? -1.22507  15.63160  -33.46688 1.000 70.86360  ? 43  THR D OG1 1 
ATOM   8350  C  CG2 . THR D 2 43  ? -2.28753  16.10910  -35.57751 1.000 65.74144  ? 43  THR D CG2 1 
ATOM   8351  N  N   . VAL D 2 44  ? -3.73259  19.21736  -34.51122 1.000 68.74505  ? 44  VAL D N   1 
ATOM   8352  C  CA  . VAL D 2 44  ? -4.61110  19.96758  -35.40240 1.000 61.65595  ? 44  VAL D CA  1 
ATOM   8353  C  C   . VAL D 2 44  ? -4.22778  21.44177  -35.43307 1.000 62.13182  ? 44  VAL D C   1 
ATOM   8354  O  O   . VAL D 2 44  ? -4.01417  22.02184  -36.50371 1.000 61.65838  ? 44  VAL D O   1 
ATOM   8355  C  CB  . VAL D 2 44  ? -6.08076  19.77635  -34.98404 1.000 65.04855  ? 44  VAL D CB  1 
ATOM   8356  C  CG1 . VAL D 2 44  ? -6.98056  20.71822  -35.77125 1.000 55.29133  ? 44  VAL D CG1 1 
ATOM   8357  C  CG2 . VAL D 2 44  ? -6.50592  18.32826  -35.18204 1.000 48.77594  ? 44  VAL D CG2 1 
ATOM   8358  N  N   . PHE D 2 45  ? -4.13798  22.07274  -34.26371 1.000 61.47845  ? 45  PHE D N   1 
ATOM   8359  C  CA  . PHE D 2 45  ? -4.02256  23.52190  -34.18853 1.000 65.23426  ? 45  PHE D CA  1 
ATOM   8360  C  C   . PHE D 2 45  ? -2.58983  24.01939  -34.05666 1.000 74.96830  ? 45  PHE D C   1 
ATOM   8361  O  O   . PHE D 2 45  ? -2.34380  25.20767  -34.28732 1.000 74.29432  ? 45  PHE D O   1 
ATOM   8362  C  CB  . PHE D 2 45  ? -4.86638  24.05086  -33.02438 1.000 62.33151  ? 45  PHE D CB  1 
ATOM   8363  C  CG  . PHE D 2 45  ? -6.32031  23.69594  -33.13595 1.000 70.10607  ? 45  PHE D CG  1 
ATOM   8364  C  CD1 . PHE D 2 45  ? -7.16745  24.43658  -33.94556 1.000 69.42851  ? 45  PHE D CD1 1 
ATOM   8365  C  CD2 . PHE D 2 45  ? -6.83688  22.60935  -32.45104 1.000 64.34042  ? 45  PHE D CD2 1 
ATOM   8366  C  CE1 . PHE D 2 45  ? -8.50559  24.10620  -34.05911 1.000 67.59784  ? 45  PHE D CE1 1 
ATOM   8367  C  CE2 . PHE D 2 45  ? -8.17345  22.27433  -32.56108 1.000 65.27529  ? 45  PHE D CE2 1 
ATOM   8368  C  CZ  . PHE D 2 45  ? -9.00877  23.02390  -33.36489 1.000 54.68850  ? 45  PHE D CZ  1 
ATOM   8369  N  N   . GLU D 2 46  ? -1.64430  23.15345  -33.69512 1.000 78.40744  ? 46  GLU D N   1 
ATOM   8370  C  CA  . GLU D 2 46  ? -0.23999  23.52968  -33.63812 1.000 77.60478  ? 46  GLU D CA  1 
ATOM   8371  C  C   . GLU D 2 46  ? 0.59939   22.88603  -34.73075 1.000 71.66928  ? 46  GLU D C   1 
ATOM   8372  O  O   . GLU D 2 46  ? 1.75212   23.29040  -34.91723 1.000 86.22207  ? 46  GLU D O   1 
ATOM   8373  C  CB  . GLU D 2 46  ? 0.36218   23.16457  -32.27263 1.000 88.80050  ? 46  GLU D CB  1 
ATOM   8374  C  CG  . GLU D 2 46  ? -0.14045  23.99505  -31.10653 1.000 95.83368  ? 46  GLU D CG  1 
ATOM   8375  C  CD  . GLU D 2 46  ? 0.46178   23.54833  -29.78484 1.000 119.94833 ? 46  GLU D CD  1 
ATOM   8376  O  OE1 . GLU D 2 46  ? 1.24198   22.56923  -29.78486 1.000 104.22380 ? 46  GLU D OE1 1 
ATOM   8377  O  OE2 . GLU D 2 46  ? 0.15802   24.17567  -28.74770 1.000 127.77382 ? 46  GLU D OE2 1 
ATOM   8378  N  N   . GLY D 2 47  ? 0.05574   21.91799  -35.46180 1.000 71.48644  ? 47  GLY D N   1 
ATOM   8379  C  CA  . GLY D 2 47  ? 0.84016   21.21273  -36.46241 1.000 68.12357  ? 47  GLY D CA  1 
ATOM   8380  C  C   . GLY D 2 47  ? 2.05801   20.53702  -35.87377 1.000 72.07191  ? 47  GLY D C   1 
ATOM   8381  O  O   . GLY D 2 47  ? 3.14714   20.60447  -36.45640 1.000 78.20379  ? 47  GLY D O   1 
ATOM   8382  N  N   . ALA D 2 48  ? 1.89369   19.87155  -34.72732 1.000 73.70124  ? 48  ALA D N   1 
ATOM   8383  C  CA  . ALA D 2 48  ? 3.04540   19.33515  -34.01064 1.000 80.56613  ? 48  ALA D CA  1 
ATOM   8384  C  C   . ALA D 2 48  ? 3.63679   18.10968  -34.69525 1.000 78.03945  ? 48  ALA D C   1 
ATOM   8385  O  O   . ALA D 2 48  ? 4.82758   17.82586  -34.52268 1.000 87.86624  ? 48  ALA D O   1 
ATOM   8386  C  CB  . ALA D 2 48  ? 2.65249   19.00343  -32.57167 1.000 79.61457  ? 48  ALA D CB  1 
ATOM   8387  N  N   . ILE D 2 49  ? 2.84111   17.37696  -35.46922 1.000 72.13240  ? 49  ILE D N   1 
ATOM   8388  C  CA  . ILE D 2 49  ? 3.34589   16.23105  -36.21327 1.000 79.59450  ? 49  ILE D CA  1 
ATOM   8389  C  C   . ILE D 2 49  ? 3.24931   16.46421  -37.71900 1.000 75.20783  ? 49  ILE D C   1 
ATOM   8390  O  O   . ILE D 2 49  ? 3.29832   15.52032  -38.50219 1.000 77.49807  ? 49  ILE D O   1 
ATOM   8391  C  CB  . ILE D 2 49  ? 2.62406   14.93168  -35.80838 1.000 68.74943  ? 49  ILE D CB  1 
ATOM   8392  C  CG1 . ILE D 2 49  ? 1.13656   15.01777  -36.14935 1.000 67.56668  ? 49  ILE D CG1 1 
ATOM   8393  C  CG2 . ILE D 2 49  ? 2.82329   14.65426  -34.32484 1.000 73.18305  ? 49  ILE D CG2 1 
ATOM   8394  C  CD1 . ILE D 2 49  ? 0.40457   13.71333  -35.98129 1.000 60.60604  ? 49  ILE D CD1 1 
ATOM   8395  N  N   . GLY D 2 50  ? 3.10977   17.71816  -38.12948 1.000 70.62942  ? 50  GLY D N   1 
ATOM   8396  C  CA  . GLY D 2 50  ? 2.99067   18.04859  -39.53226 1.000 66.45315  ? 50  GLY D CA  1 
ATOM   8397  C  C   . GLY D 2 50  ? 1.54491   18.12256  -39.96702 1.000 79.68672  ? 50  GLY D C   1 
ATOM   8398  O  O   . GLY D 2 50  ? 0.60325   17.98000  -39.17957 1.000 67.97641  ? 50  GLY D O   1 
ATOM   8399  N  N   . GLU D 2 51  ? 1.36493   18.32526  -41.26701 1.000 76.90731  ? 51  GLU D N   1 
ATOM   8400  C  CA  . GLU D 2 51  ? 0.03376   18.50820  -41.82123 1.000 77.40827  ? 51  GLU D CA  1 
ATOM   8401  C  C   . GLU D 2 51  ? -0.55093  17.17121  -42.25294 1.000 75.86626  ? 51  GLU D C   1 
ATOM   8402  O  O   . GLU D 2 51  ? 0.13671   16.33872  -42.85221 1.000 63.12636  ? 51  GLU D O   1 
ATOM   8403  C  CB  . GLU D 2 51  ? 0.05935   19.47732  -43.00223 1.000 81.38403  ? 51  GLU D CB  1 
ATOM   8404  C  CG  . GLU D 2 51  ? -1.32696  19.85318  -43.49690 1.000 82.06402  ? 51  GLU D CG  1 
ATOM   8405  C  CD  . GLU D 2 51  ? -1.31115  21.08111  -44.38017 1.000 92.31046  ? 51  GLU D CD  1 
ATOM   8406  O  OE1 . GLU D 2 51  ? -0.21389  21.47236  -44.83361 1.000 96.03720  ? 51  GLU D OE1 1 
ATOM   8407  O  OE2 . GLU D 2 51  ? -2.39170  21.67088  -44.59703 1.000 90.59473  ? 51  GLU D OE2 1 
ATOM   8408  N  N   . ARG D 2 52  ? -1.82267  16.96835  -41.92544 1.000 74.08001  ? 52  ARG D N   1 
ATOM   8409  C  CA  . ARG D 2 52  ? -2.57281  15.79600  -42.33803 1.000 69.44241  ? 52  ARG D CA  1 
ATOM   8410  C  C   . ARG D 2 52  ? -3.80636  16.23873  -43.11325 1.000 72.78717  ? 52  ARG D C   1 
ATOM   8411  O  O   . ARG D 2 52  ? -4.26359  17.37948  -42.99660 1.000 70.10906  ? 52  ARG D O   1 
ATOM   8412  C  CB  . ARG D 2 52  ? -2.99638  14.95876  -41.12778 1.000 61.60024  ? 52  ARG D CB  1 
ATOM   8413  C  CG  . ARG D 2 52  ? -1.85233  14.50250  -40.24186 1.000 60.19298  ? 52  ARG D CG  1 
ATOM   8414  C  CD  . ARG D 2 52  ? -0.98023  13.46857  -40.92104 1.000 63.10347  ? 52  ARG D CD  1 
ATOM   8415  N  NE  . ARG D 2 52  ? -0.02537  12.88458  -39.98654 1.000 59.37224  ? 52  ARG D NE  1 
ATOM   8416  C  CZ  . ARG D 2 52  ? 1.14649   13.42380  -39.67851 1.000 72.65390  ? 52  ARG D CZ  1 
ATOM   8417  N  NH1 . ARG D 2 52  ? 1.54460   14.56614  -40.21472 1.000 72.51849  ? 52  ARG D NH1 1 
ATOM   8418  N  NH2 . ARG D 2 52  ? 1.93784   12.80303  -38.80815 1.000 69.26943  ? 52  ARG D NH2 1 
ATOM   8419  N  N   . HIS D 2 53  ? -4.34869  15.31909  -43.90669 1.000 67.36559  ? 53  HIS D N   1 
ATOM   8420  C  CA  . HIS D 2 53  ? -5.52530  15.58563  -44.72896 1.000 68.49335  ? 53  HIS D CA  1 
ATOM   8421  C  C   . HIS D 2 53  ? -6.49676  14.42818  -44.56609 1.000 58.06654  ? 53  HIS D C   1 
ATOM   8422  O  O   . HIS D 2 53  ? -6.19625  13.30022  -44.97105 1.000 62.64432  ? 53  HIS D O   1 
ATOM   8423  C  CB  . HIS D 2 53  ? -5.14620  15.79378  -46.19301 1.000 67.21099  ? 53  HIS D CB  1 
ATOM   8424  C  CG  . HIS D 2 53  ? -4.33511  17.02803  -46.42574 1.000 78.23725  ? 53  HIS D CG  1 
ATOM   8425  N  ND1 . HIS D 2 53  ? -4.87749  18.29354  -46.36627 1.000 80.29816  ? 53  HIS D ND1 1 
ATOM   8426  C  CD2 . HIS D 2 53  ? -3.02007  17.19411  -46.70134 1.000 81.28852  ? 53  HIS D CD2 1 
ATOM   8427  C  CE1 . HIS D 2 53  ? -3.93306  19.18609  -46.60390 1.000 88.71257  ? 53  HIS D CE1 1 
ATOM   8428  N  NE2 . HIS D 2 53  ? -2.79654  18.54515  -46.81013 1.000 84.86218  ? 53  HIS D NE2 1 
ATOM   8429  N  N   . ASN D 2 54  ? -7.65600  14.71406  -43.97363 1.000 57.02097  ? 54  ASN D N   1 
ATOM   8430  C  CA  . ASN D 2 54  ? -8.72182  13.72913  -43.80224 1.000 53.16810  ? 54  ASN D CA  1 
ATOM   8431  C  C   . ASN D 2 54  ? -8.22995  12.51770  -43.01544 1.000 58.20542  ? 54  ASN D C   1 
ATOM   8432  O  O   . ASN D 2 54  ? -8.50017  11.36848  -43.37108 1.000 60.59374  ? 54  ASN D O   1 
ATOM   8433  C  CB  . ASN D 2 54  ? -9.30822  13.30403  -45.14994 1.000 59.87383  ? 54  ASN D CB  1 
ATOM   8434  C  CG  . ASN D 2 54  ? -10.04123 14.43102  -45.84627 1.000 73.52587  ? 54  ASN D CG  1 
ATOM   8435  O  OD1 . ASN D 2 54  ? -10.23498 15.50788  -45.27889 1.000 69.77270  ? 54  ASN D OD1 1 
ATOM   8436  N  ND2 . ASN D 2 54  ? -10.45966 14.18745  -47.08216 1.000 82.57641  ? 54  ASN D ND2 1 
ATOM   8437  N  N   . MET D 2 55  ? -7.50056  12.78175  -41.93430 1.000 55.50940  ? 55  MET D N   1 
ATOM   8438  C  CA  . MET D 2 55  ? -7.02714  11.74626  -41.02630 1.000 55.52805  ? 55  MET D CA  1 
ATOM   8439  C  C   . MET D 2 55  ? -7.93858  11.73664  -39.80783 1.000 50.04407  ? 55  MET D C   1 
ATOM   8440  O  O   . MET D 2 55  ? -8.04163  12.74427  -39.09975 1.000 56.22317  ? 55  MET D O   1 
ATOM   8441  C  CB  . MET D 2 55  ? -5.58050  11.98717  -40.59715 1.000 45.48479  ? 55  MET D CB  1 
ATOM   8442  C  CG  . MET D 2 55  ? -5.09439  10.98531  -39.55358 1.000 41.22601  ? 55  MET D CG  1 
ATOM   8443  S  SD  . MET D 2 55  ? -3.55846  11.47134  -38.74571 1.000 59.25457  ? 55  MET D SD  1 
ATOM   8444  C  CE  . MET D 2 55  ? -4.08345  12.96360  -37.90344 1.000 55.31806  ? 55  MET D CE  1 
ATOM   8445  N  N   . ILE D 2 56  ? -8.60108  10.60503  -39.56815 1.000 48.55133  ? 56  ILE D N   1 
ATOM   8446  C  CA  . ILE D 2 56  ? -9.48535  10.50254  -38.41621 1.000 45.55641  ? 56  ILE D CA  1 
ATOM   8447  C  C   . ILE D 2 56  ? -8.66648  10.62349  -37.13815 1.000 44.64454  ? 56  ILE D C   1 
ATOM   8448  O  O   . ILE D 2 56  ? -7.58052  10.04374  -37.01359 1.000 43.48459  ? 56  ILE D O   1 
ATOM   8449  C  CB  . ILE D 2 56  ? -10.27189 9.18330   -38.47509 1.000 40.84705  ? 56  ILE D CB  1 
ATOM   8450  C  CG1 . ILE D 2 56  ? -11.04825 9.10422   -39.79132 1.000 40.68565  ? 56  ILE D CG1 1 
ATOM   8451  C  CG2 . ILE D 2 56  ? -11.21015 9.06094   -37.29107 1.000 41.89708  ? 56  ILE D CG2 1 
ATOM   8452  C  CD1 . ILE D 2 56  ? -11.92089 7.88192   -39.91785 1.000 42.28053  ? 56  ILE D CD1 1 
ATOM   8453  N  N   . LEU D 2 57  ? -9.17978  11.39865  -36.18502 1.000 44.83576  ? 57  LEU D N   1 
ATOM   8454  C  CA  . LEU D 2 57  ? -8.46113  11.70773  -34.95984 1.000 42.88225  ? 57  LEU D CA  1 
ATOM   8455  C  C   . LEU D 2 57  ? -8.79868  10.69639  -33.86476 1.000 42.98778  ? 57  LEU D C   1 
ATOM   8456  O  O   . LEU D 2 57  ? -9.61981  9.79361   -34.04504 1.000 41.03533  ? 57  LEU D O   1 
ATOM   8457  C  CB  . LEU D 2 57  ? -8.78449  13.13105  -34.50827 1.000 47.21860  ? 57  LEU D CB  1 
ATOM   8458  C  CG  . LEU D 2 57  ? -8.34404  14.26595  -35.43414 1.000 43.76436  ? 57  LEU D CG  1 
ATOM   8459  C  CD1 . LEU D 2 57  ? -9.14820  15.52310  -35.15227 1.000 44.82549  ? 57  LEU D CD1 1 
ATOM   8460  C  CD2 . LEU D 2 57  ? -6.85273  14.53849  -35.28038 1.000 38.30593  ? 57  LEU D CD2 1 
ATOM   8461  N  N   . GLY D 2 58  ? -8.13754  10.83702  -32.71472 1.000 36.05646  ? 58  GLY D N   1 
ATOM   8462  C  CA  . GLY D 2 58  ? -8.45662  10.01838  -31.56076 1.000 41.78793  ? 58  GLY D CA  1 
ATOM   8463  C  C   . GLY D 2 58  ? -7.58335  8.79444   -31.39089 1.000 35.26075  ? 58  GLY D C   1 
ATOM   8464  O  O   . GLY D 2 58  ? -7.32331  8.07343   -32.35786 1.000 41.61317  ? 58  GLY D O   1 
ATOM   8465  N  N   . HIS D 2 59  ? -7.12994  8.53480   -30.16269 1.000 39.01427  ? 59  HIS D N   1 
ATOM   8466  C  CA  . HIS D 2 59  ? -6.35855  7.32432   -29.91082 1.000 40.96818  ? 59  HIS D CA  1 
ATOM   8467  C  C   . HIS D 2 59  ? -6.74341  6.63919   -28.60361 1.000 37.49791  ? 59  HIS D C   1 
ATOM   8468  O  O   . HIS D 2 59  ? -6.02481  5.73167   -28.16542 1.000 38.25861  ? 59  HIS D O   1 
ATOM   8469  C  CB  . HIS D 2 59  ? -4.85015  7.61307   -29.92521 1.000 36.17500  ? 59  HIS D CB  1 
ATOM   8470  C  CG  . HIS D 2 59  ? -4.43653  8.77082   -29.07350 1.000 38.82140  ? 59  HIS D CG  1 
ATOM   8471  N  ND1 . HIS D 2 59  ? -4.10795  10.00216  -29.59918 1.000 53.86536  ? 59  HIS D ND1 1 
ATOM   8472  C  CD2 . HIS D 2 59  ? -4.26844  8.87651   -27.73433 1.000 38.78632  ? 59  HIS D CD2 1 
ATOM   8473  C  CE1 . HIS D 2 59  ? -3.77000  10.82067  -28.61872 1.000 54.56296  ? 59  HIS D CE1 1 
ATOM   8474  N  NE2 . HIS D 2 59  ? -3.86062  10.16240  -27.47733 1.000 45.45332  ? 59  HIS D NE2 1 
ATOM   8475  N  N   . GLU D 2 60  ? -7.83460  7.04689   -27.95854 1.000 36.73335  ? 60  GLU D N   1 
ATOM   8476  C  CA  . GLU D 2 60  ? -8.30151  6.42948   -26.72001 1.000 36.73763  ? 60  GLU D CA  1 
ATOM   8477  C  C   . GLU D 2 60  ? -9.69272  5.85772   -26.96163 1.000 40.61969  ? 60  GLU D C   1 
ATOM   8478  O  O   . GLU D 2 60  ? -10.65560 6.60859   -27.15616 1.000 37.97581  ? 60  GLU D O   1 
ATOM   8479  C  CB  . GLU D 2 60  ? -8.31013  7.44144   -25.57965 1.000 33.69545  ? 60  GLU D CB  1 
ATOM   8480  C  CG  . GLU D 2 60  ? -7.06219  8.29067   -25.54482 1.000 39.22663  ? 60  GLU D CG  1 
ATOM   8481  C  CD  . GLU D 2 60  ? -7.06770  9.28629   -24.41182 1.000 45.22275  ? 60  GLU D CD  1 
ATOM   8482  O  OE1 . GLU D 2 60  ? -7.23394  8.86815   -23.24679 1.000 47.25847  ? 60  GLU D OE1 1 
ATOM   8483  O  OE2 . GLU D 2 60  ? -6.92479  10.49188  -24.68996 1.000 43.82227  ? 60  GLU D OE2 1 
ATOM   8484  N  N   . ALA D 2 61  ? -9.80868  4.53468   -26.93114 1.000 38.46134  ? 61  ALA D N   1 
ATOM   8485  C  CA  . ALA D 2 61  ? -11.07632 3.90941   -27.26160 1.000 31.71399  ? 61  ALA D CA  1 
ATOM   8486  C  C   . ALA D 2 61  ? -11.19386 2.55929   -26.58082 1.000 36.98248  ? 61  ALA D C   1 
ATOM   8487  O  O   . ALA D 2 61  ? -10.22201 1.80449   -26.48921 1.000 41.65879  ? 61  ALA D O   1 
ATOM   8488  C  CB  . ALA D 2 61  ? -11.23887 3.72908   -28.77343 1.000 36.41033  ? 61  ALA D CB  1 
ATOM   8489  N  N   . VAL D 2 62  ? -12.39481 2.28119   -26.09087 1.000 42.66306  ? 62  VAL D N   1 
ATOM   8490  C  CA  . VAL D 2 62  ? -12.83555 0.94018   -25.73818 1.000 36.46113  ? 62  VAL D CA  1 
ATOM   8491  C  C   . VAL D 2 62  ? -13.87950 0.54707   -26.76845 1.000 36.45254  ? 62  VAL D C   1 
ATOM   8492  O  O   . VAL D 2 62  ? -14.80925 1.31720   -27.03626 1.000 45.46899  ? 62  VAL D O   1 
ATOM   8493  C  CB  . VAL D 2 62  ? -13.41250 0.89402   -24.31354 1.000 37.17868  ? 62  VAL D CB  1 
ATOM   8494  C  CG1 . VAL D 2 62  ? -14.08795 -0.43229  -24.06237 1.000 37.03525  ? 62  VAL D CG1 1 
ATOM   8495  C  CG2 . VAL D 2 62  ? -12.31201 1.14457   -23.29276 1.000 44.70538  ? 62  VAL D CG2 1 
ATOM   8496  N  N   . GLY D 2 63  ? -13.72625 -0.63250  -27.36529 1.000 37.61915  ? 63  GLY D N   1 
ATOM   8497  C  CA  . GLY D 2 63  ? -14.57404 -0.99935  -28.47792 1.000 41.29870  ? 63  GLY D CA  1 
ATOM   8498  C  C   . GLY D 2 63  ? -15.02208 -2.44497  -28.43211 1.000 39.34113  ? 63  GLY D C   1 
ATOM   8499  O  O   . GLY D 2 63  ? -14.72748 -3.18775  -27.49370 1.000 41.24943  ? 63  GLY D O   1 
ATOM   8500  N  N   . GLU D 2 64  ? -15.76211 -2.81923  -29.47022 1.000 38.54119  ? 64  GLU D N   1 
ATOM   8501  C  CA  . GLU D 2 64  ? -16.21276 -4.18473  -29.67978 1.000 38.40523  ? 64  GLU D CA  1 
ATOM   8502  C  C   . GLU D 2 64  ? -15.63064 -4.67543  -30.99513 1.000 38.37448  ? 64  GLU D C   1 
ATOM   8503  O  O   . GLU D 2 64  ? -15.73873 -3.99239  -32.01887 1.000 44.63310  ? 64  GLU D O   1 
ATOM   8504  C  CB  . GLU D 2 64  ? -17.74062 -4.26831  -29.70320 1.000 46.79727  ? 64  GLU D CB  1 
ATOM   8505  C  CG  . GLU D 2 64  ? -18.27583 -5.64866  -30.03145 1.000 43.87961  ? 64  GLU D CG  1 
ATOM   8506  C  CD  . GLU D 2 64  ? -19.78499 -5.66804  -30.18831 1.000 65.46441  ? 64  GLU D CD  1 
ATOM   8507  O  OE1 . GLU D 2 64  ? -20.31722 -4.87030  -30.99115 1.000 66.67271  ? 64  GLU D OE1 1 
ATOM   8508  O  OE2 . GLU D 2 64  ? -20.43945 -6.48032  -29.50215 1.000 73.32866  ? 64  GLU D OE2 1 
ATOM   8509  N  N   . VAL D 2 65  ? -14.99985 -5.84580  -30.96503 1.000 36.18188  ? 65  VAL D N   1 
ATOM   8510  C  CA  . VAL D 2 65  ? -14.45731 -6.41886  -32.18698 1.000 37.83186  ? 65  VAL D CA  1 
ATOM   8511  C  C   . VAL D 2 65  ? -15.60520 -6.81385  -33.10112 1.000 39.70833  ? 65  VAL D C   1 
ATOM   8512  O  O   . VAL D 2 65  ? -16.56493 -7.46785  -32.67272 1.000 48.05769  ? 65  VAL D O   1 
ATOM   8513  C  CB  . VAL D 2 65  ? -13.55948 -7.62132  -31.86968 1.000 37.54853  ? 65  VAL D CB  1 
ATOM   8514  C  CG1 . VAL D 2 65  ? -13.04293 -8.23385  -33.15698 1.000 38.70641  ? 65  VAL D CG1 1 
ATOM   8515  C  CG2 . VAL D 2 65  ? -12.40636 -7.19619  -30.97798 1.000 35.98025  ? 65  VAL D CG2 1 
ATOM   8516  N  N   . VAL D 2 66  ? -15.52865 -6.39819  -34.36226 1.000 39.43357  ? 66  VAL D N   1 
ATOM   8517  C  CA  . VAL D 2 66  ? -16.53292 -6.77472  -35.34094 1.000 46.70171  ? 66  VAL D CA  1 
ATOM   8518  C  C   . VAL D 2 66  ? -15.97911 -7.70478  -36.41612 1.000 42.86137  ? 66  VAL D C   1 
ATOM   8519  O  O   . VAL D 2 66  ? -16.74466 -8.48515  -36.99290 1.000 44.30182  ? 66  VAL D O   1 
ATOM   8520  C  CB  . VAL D 2 66  ? -17.18405 -5.52873  -35.98126 1.000 43.43241  ? 66  VAL D CB  1 
ATOM   8521  C  CG1 . VAL D 2 66  ? -17.88583 -4.69027  -34.92465 1.000 40.73267  ? 66  VAL D CG1 1 
ATOM   8522  C  CG2 . VAL D 2 66  ? -16.15295 -4.70287  -36.71768 1.000 44.30639  ? 66  VAL D CG2 1 
ATOM   8523  N  N   . GLU D 2 67  ? -14.67700 -7.66451  -36.68794 1.000 42.18910  ? 67  GLU D N   1 
ATOM   8524  C  CA  . GLU D 2 67  ? -14.08508 -8.49489  -37.72522 1.000 42.87301  ? 67  GLU D CA  1 
ATOM   8525  C  C   . GLU D 2 67  ? -12.62267 -8.73922  -37.38985 1.000 40.70647  ? 67  GLU D C   1 
ATOM   8526  O  O   . GLU D 2 67  ? -11.94695 -7.84903  -36.86908 1.000 46.01149  ? 67  GLU D O   1 
ATOM   8527  C  CB  . GLU D 2 67  ? -14.21515 -7.82350  -39.09585 1.000 42.43113  ? 67  GLU D CB  1 
ATOM   8528  C  CG  . GLU D 2 67  ? -13.80378 -8.68734  -40.27011 1.000 47.29607  ? 67  GLU D CG  1 
ATOM   8529  C  CD  . GLU D 2 67  ? -13.86110 -7.92864  -41.58057 1.000 55.57754  ? 67  GLU D CD  1 
ATOM   8530  O  OE1 . GLU D 2 67  ? -14.38412 -6.79170  -41.58491 1.000 53.80909  ? 67  GLU D OE1 1 
ATOM   8531  O  OE2 . GLU D 2 67  ? -13.38146 -8.46498  -42.60245 1.000 61.21399  ? 67  GLU D OE2 1 
ATOM   8532  N  N   . VAL D 2 68  ? -12.13756 -9.94723  -37.68587 1.000 44.09665  ? 68  VAL D N   1 
ATOM   8533  C  CA  . VAL D 2 68  ? -10.74318 -10.29925 -37.45429 1.000 42.46304  ? 68  VAL D CA  1 
ATOM   8534  C  C   . VAL D 2 68  ? -10.18886 -10.98324 -38.69456 1.000 36.28202  ? 68  VAL D C   1 
ATOM   8535  O  O   . VAL D 2 68  ? -10.92412 -11.55485 -39.50069 1.000 44.21231  ? 68  VAL D O   1 
ATOM   8536  C  CB  . VAL D 2 68  ? -10.55551 -11.21268 -36.22167 1.000 43.47429  ? 68  VAL D CB  1 
ATOM   8537  C  CG1 . VAL D 2 68  ? -10.90086 -10.46940 -34.95113 1.000 40.71075  ? 68  VAL D CG1 1 
ATOM   8538  C  CG2 . VAL D 2 68  ? -11.40015 -12.47190 -36.35655 1.000 38.43256  ? 68  VAL D CG2 1 
ATOM   8539  N  N   . GLY D 2 69  ? -8.86731  -10.92752 -38.82930 1.000 40.04387  ? 69  GLY D N   1 
ATOM   8540  C  CA  . GLY D 2 69  ? -8.19121  -11.64136 -39.89152 1.000 40.13209  ? 69  GLY D CA  1 
ATOM   8541  C  C   . GLY D 2 69  ? -8.17029  -13.14083 -39.65375 1.000 39.71199  ? 69  GLY D C   1 
ATOM   8542  O  O   . GLY D 2 69  ? -8.51327  -13.64827 -38.58451 1.000 45.51217  ? 69  GLY D O   1 
ATOM   8543  N  N   . SER D 2 70  ? -7.73832  -13.86653 -40.68688 1.000 40.86233  ? 70  SER D N   1 
ATOM   8544  C  CA  . SER D 2 70  ? -7.74676  -15.32422 -40.63349 1.000 42.76791  ? 70  SER D CA  1 
ATOM   8545  C  C   . SER D 2 70  ? -6.77635  -15.88793 -39.60380 1.000 46.58282  ? 70  SER D C   1 
ATOM   8546  O  O   . SER D 2 70  ? -6.93163  -17.04501 -39.20192 1.000 49.99606  ? 70  SER D O   1 
ATOM   8547  C  CB  . SER D 2 70  ? -7.41721  -15.90525 -42.00913 1.000 53.44922  ? 70  SER D CB  1 
ATOM   8548  O  OG  . SER D 2 70  ? -6.16042  -15.43875 -42.47071 1.000 50.94174  ? 70  SER D OG  1 
ATOM   8549  N  N   . GLU D 2 71  ? -5.78014  -15.11439 -39.17430 1.000 45.95934  ? 71  GLU D N   1 
ATOM   8550  C  CA  . GLU D 2 71  ? -4.76793  -15.60479 -38.24658 1.000 46.27827  ? 71  GLU D CA  1 
ATOM   8551  C  C   . GLU D 2 71  ? -4.96981  -15.12536 -36.81327 1.000 46.86664  ? 71  GLU D C   1 
ATOM   8552  O  O   . GLU D 2 71  ? -4.19850  -15.51720 -35.93177 1.000 41.30788  ? 71  GLU D O   1 
ATOM   8553  C  CB  . GLU D 2 71  ? -3.37202  -15.19680 -38.72839 1.000 44.41311  ? 71  GLU D CB  1 
ATOM   8554  C  CG  . GLU D 2 71  ? -3.03808  -15.68389 -40.12593 1.000 46.62871  ? 71  GLU D CG  1 
ATOM   8555  C  CD  . GLU D 2 71  ? -3.06944  -17.19456 -40.23768 1.000 62.05206  ? 71  GLU D CD  1 
ATOM   8556  O  OE1 . GLU D 2 71  ? -2.51139  -17.86973 -39.34401 1.000 48.47398  ? 71  GLU D OE1 1 
ATOM   8557  O  OE2 . GLU D 2 71  ? -3.65409  -17.70593 -41.21886 1.000 72.12764  ? 71  GLU D OE2 1 
ATOM   8558  N  N   . VAL D 2 72  ? -5.97925  -14.29489 -36.55438 1.000 45.45236  ? 72  VAL D N   1 
ATOM   8559  C  CA  . VAL D 2 72  ? -6.24234  -13.84139 -35.19359 1.000 42.55185  ? 72  VAL D CA  1 
ATOM   8560  C  C   . VAL D 2 72  ? -6.79858  -14.99987 -34.37745 1.000 43.35520  ? 72  VAL D C   1 
ATOM   8561  O  O   . VAL D 2 72  ? -7.75226  -15.67198 -34.79102 1.000 41.90750  ? 72  VAL D O   1 
ATOM   8562  C  CB  . VAL D 2 72  ? -7.20056  -12.64176 -35.20038 1.000 46.97967  ? 72  VAL D CB  1 
ATOM   8563  C  CG1 . VAL D 2 72  ? -7.58912  -12.26645 -33.78031 1.000 41.74081  ? 72  VAL D CG1 1 
ATOM   8564  C  CG2 . VAL D 2 72  ? -6.55789  -11.45731 -35.91264 1.000 42.67581  ? 72  VAL D CG2 1 
ATOM   8565  N  N   . LYS D 2 73  ? -6.19345  -15.25168 -33.21626 1.000 48.50924  ? 73  LYS D N   1 
ATOM   8566  C  CA  . LYS D 2 73  ? -6.51824  -16.43444 -32.43088 1.000 45.01304  ? 73  LYS D CA  1 
ATOM   8567  C  C   . LYS D 2 73  ? -7.26166  -16.14025 -31.13868 1.000 43.60020  ? 73  LYS D C   1 
ATOM   8568  O  O   . LYS D 2 73  ? -8.09616  -16.94963 -30.73034 1.000 51.59367  ? 73  LYS D O   1 
ATOM   8569  C  CB  . LYS D 2 73  ? -5.23979  -17.21278 -32.09427 1.000 39.46753  ? 73  LYS D CB  1 
ATOM   8570  C  CG  . LYS D 2 73  ? -4.48300  -17.69005 -33.32195 1.000 49.90753  ? 73  LYS D CG  1 
ATOM   8571  C  CD  . LYS D 2 73  ? -5.32522  -18.63265 -34.16902 1.000 64.34263  ? 73  LYS D CD  1 
ATOM   8572  C  CE  . LYS D 2 73  ? -4.55442  -19.11189 -35.39372 1.000 68.60002  ? 73  LYS D CE  1 
ATOM   8573  N  NZ  . LYS D 2 73  ? -5.40230  -19.93778 -36.30061 1.000 77.31898  ? 73  LYS D NZ  1 
ATOM   8574  N  N   . ASP D 2 74  ? -6.99143  -15.01007 -30.48878 1.000 46.76034  ? 74  ASP D N   1 
ATOM   8575  C  CA  . ASP D 2 74  ? -7.52756  -14.72852 -29.16289 1.000 43.48075  ? 74  ASP D CA  1 
ATOM   8576  C  C   . ASP D 2 74  ? -8.69247  -13.74625 -29.15938 1.000 45.54637  ? 74  ASP D C   1 
ATOM   8577  O  O   . ASP D 2 74  ? -9.19111  -13.40795 -28.08005 1.000 40.29188  ? 74  ASP D O   1 
ATOM   8578  C  CB  . ASP D 2 74  ? -6.41564  -14.20484 -28.25195 1.000 42.11119  ? 74  ASP D CB  1 
ATOM   8579  C  CG  . ASP D 2 74  ? -5.36354  -15.25290 -27.96680 1.000 44.46700  ? 74  ASP D CG  1 
ATOM   8580  O  OD1 . ASP D 2 74  ? -5.65892  -16.45314 -28.14665 1.000 46.85940  ? 74  ASP D OD1 1 
ATOM   8581  O  OD2 . ASP D 2 74  ? -4.24554  -14.88018 -27.55558 1.000 51.81175  ? 74  ASP D OD2 1 
ATOM   8582  N  N   . PHE D 2 75  ? -9.12796  -13.26230 -30.31959 1.000 50.11998  ? 75  PHE D N   1 
ATOM   8583  C  CA  . PHE D 2 75  ? -10.21917 -12.30063 -30.36980 1.000 39.94504  ? 75  PHE D CA  1 
ATOM   8584  C  C   . PHE D 2 75  ? -11.14158 -12.63361 -31.53105 1.000 36.97955  ? 75  PHE D C   1 
ATOM   8585  O  O   . PHE D 2 75  ? -10.68029 -12.97675 -32.62381 1.000 42.21820  ? 75  PHE D O   1 
ATOM   8586  C  CB  . PHE D 2 75  ? -9.68453  -10.86774 -30.49189 1.000 39.51294  ? 75  PHE D CB  1 
ATOM   8587  C  CG  . PHE D 2 75  ? -8.86147  -10.43748 -29.31409 1.000 41.30374  ? 75  PHE D CG  1 
ATOM   8588  C  CD1 . PHE D 2 75  ? -9.46743  -9.93097  -28.17527 1.000 39.38796  ? 75  PHE D CD1 1 
ATOM   8589  C  CD2 . PHE D 2 75  ? -7.48475  -10.56810 -29.33165 1.000 40.14399  ? 75  PHE D CD2 1 
ATOM   8590  C  CE1 . PHE D 2 75  ? -8.71174  -9.54963  -27.08105 1.000 36.03684  ? 75  PHE D CE1 1 
ATOM   8591  C  CE2 . PHE D 2 75  ? -6.72348  -10.18713 -28.23869 1.000 44.40129  ? 75  PHE D CE2 1 
ATOM   8592  C  CZ  . PHE D 2 75  ? -7.33826  -9.67931  -27.11331 1.000 34.57920  ? 75  PHE D CZ  1 
ATOM   8593  N  N   . LYS D 2 76  ? -12.44018 -12.53588 -31.28165 1.000 37.66070  ? 76  LYS D N   1 
ATOM   8594  C  CA  . LYS D 2 76  ? -13.49014 -12.85643 -32.23374 1.000 40.88210  ? 76  LYS D CA  1 
ATOM   8595  C  C   . LYS D 2 76  ? -14.51942 -11.73748 -32.24938 1.000 43.71516  ? 76  LYS D C   1 
ATOM   8596  O  O   . LYS D 2 76  ? -14.58629 -10.93241 -31.31260 1.000 39.51863  ? 76  LYS D O   1 
ATOM   8597  C  CB  . LYS D 2 76  ? -14.15592 -14.19653 -31.88056 1.000 39.65345  ? 76  LYS D CB  1 
ATOM   8598  C  CG  . LYS D 2 76  ? -14.70280 -14.26604 -30.47321 1.000 46.84719  ? 76  LYS D CG  1 
ATOM   8599  C  CD  . LYS D 2 76  ? -15.13311 -15.67898 -30.11967 1.000 47.79337  ? 76  LYS D CD  1 
ATOM   8600  C  CE  . LYS D 2 76  ? -15.37580 -15.81403 -28.62295 1.000 61.43832  ? 76  LYS D CE  1 
ATOM   8601  N  NZ  . LYS D 2 76  ? -16.42833 -14.88212 -28.14054 1.000 65.22254  ? 76  LYS D NZ  1 
ATOM   8602  N  N   . PRO D 2 77  ? -15.33964 -11.65757 -33.29841 1.000 45.15776  ? 77  PRO D N   1 
ATOM   8603  C  CA  . PRO D 2 77  ? -16.38160 -10.62187 -33.33948 1.000 45.26168  ? 77  PRO D CA  1 
ATOM   8604  C  C   . PRO D 2 77  ? -17.29051 -10.68491 -32.12075 1.000 46.11655  ? 77  PRO D C   1 
ATOM   8605  O  O   . PRO D 2 77  ? -17.75110 -11.75550 -31.71953 1.000 53.09802  ? 77  PRO D O   1 
ATOM   8606  C  CB  . PRO D 2 77  ? -17.14311 -10.94016 -34.63082 1.000 42.70092  ? 77  PRO D CB  1 
ATOM   8607  C  CG  . PRO D 2 77  ? -16.13185 -11.60460 -35.49790 1.000 40.56031  ? 77  PRO D CG  1 
ATOM   8608  C  CD  . PRO D 2 77  ? -15.26424 -12.40887 -34.56587 1.000 45.72894  ? 77  PRO D CD  1 
ATOM   8609  N  N   . GLY D 2 78  ? -17.52561 -9.51941  -31.51893 1.000 43.57436  ? 78  GLY D N   1 
ATOM   8610  C  CA  . GLY D 2 78  ? -18.34022 -9.40011  -30.33018 1.000 40.93602  ? 78  GLY D CA  1 
ATOM   8611  C  C   . GLY D 2 78  ? -17.56500 -9.19819  -29.04542 1.000 44.13617  ? 78  GLY D C   1 
ATOM   8612  O  O   . GLY D 2 78  ? -18.16965 -8.83230  -28.03011 1.000 50.91464  ? 78  GLY D O   1 
ATOM   8613  N  N   . ASP D 2 79  ? -16.24987 -9.40106  -29.06238 1.000 38.28310  ? 79  ASP D N   1 
ATOM   8614  C  CA  . ASP D 2 79  ? -15.44946 -9.23368  -27.85726 1.000 40.89463  ? 79  ASP D CA  1 
ATOM   8615  C  C   . ASP D 2 79  ? -15.27912 -7.75541  -27.53345 1.000 39.54545  ? 79  ASP D C   1 
ATOM   8616  O  O   . ASP D 2 79  ? -14.84690 -6.97012  -28.38191 1.000 40.09797  ? 79  ASP D O   1 
ATOM   8617  C  CB  . ASP D 2 79  ? -14.07682 -9.88580  -28.03495 1.000 38.58268  ? 79  ASP D CB  1 
ATOM   8618  C  CG  . ASP D 2 79  ? -14.14910 -11.40411 -28.11561 1.000 48.76611  ? 79  ASP D CG  1 
ATOM   8619  O  OD1 . ASP D 2 79  ? -15.18639 -11.98004 -27.72532 1.000 51.21943  ? 79  ASP D OD1 1 
ATOM   8620  O  OD2 . ASP D 2 79  ? -13.16636 -12.02295 -28.57966 1.000 44.56885  ? 79  ASP D OD2 1 
ATOM   8621  N  N   . ARG D 2 80  ? -15.63142 -7.37269  -26.30769 1.000 40.14659  ? 80  ARG D N   1 
ATOM   8622  C  CA  A ARG D 2 80  ? -15.38446 -6.01854  -25.82654 0.459 39.23157  ? 80  ARG D CA  1 
ATOM   8623  C  CA  B ARG D 2 80  ? -15.38268 -6.01733  -25.83500 0.541 39.17107  ? 80  ARG D CA  1 
ATOM   8624  C  C   . ARG D 2 80  ? -13.92960 -5.91373  -25.38639 1.000 37.91880  ? 80  ARG D C   1 
ATOM   8625  O  O   . ARG D 2 80  ? -13.47619 -6.69239  -24.54107 1.000 39.70533  ? 80  ARG D O   1 
ATOM   8626  C  CB  A ARG D 2 80  ? -16.33281 -5.67804  -24.67813 0.459 39.75544  ? 80  ARG D CB  1 
ATOM   8627  C  CB  B ARG D 2 80  ? -16.34545 -5.66503  -24.70356 0.541 39.71981  ? 80  ARG D CB  1 
ATOM   8628  C  CG  A ARG D 2 80  ? -17.79595 -5.61216  -25.09103 0.459 42.09069  ? 80  ARG D CG  1 
ATOM   8629  C  CG  B ARG D 2 80  ? -17.80523 -5.66009  -25.13938 0.541 42.06046  ? 80  ARG D CG  1 
ATOM   8630  C  CD  A ARG D 2 80  ? -18.74085 -5.66838  -23.89353 0.459 50.11397  ? 80  ARG D CD  1 
ATOM   8631  C  CD  B ARG D 2 80  ? -18.75625 -5.74862  -23.95468 0.541 50.19485  ? 80  ARG D CD  1 
ATOM   8632  N  NE  A ARG D 2 80  ? -18.72433 -4.44967  -23.09103 0.459 49.59718  ? 80  ARG D NE  1 
ATOM   8633  N  NE  B ARG D 2 80  ? -18.91396 -4.47518  -23.26179 0.541 50.01821  ? 80  ARG D NE  1 
ATOM   8634  C  CZ  A ARG D 2 80  ? -18.16158 -4.34455  -21.89463 0.459 42.21975  ? 80  ARG D CZ  1 
ATOM   8635  C  CZ  B ARG D 2 80  ? -19.88294 -3.60453  -23.50950 0.541 41.92698  ? 80  ARG D CZ  1 
ATOM   8636  N  NH1 A ARG D 2 80  ? -17.53870 -5.36700  -21.33085 0.459 39.94292  ? 80  ARG D NH1 1 
ATOM   8637  N  NH1 B ARG D 2 80  ? -20.78919 -3.82690  -24.44742 0.541 37.38141  ? 80  ARG D NH1 1 
ATOM   8638  N  NH2 A ARG D 2 80  ? -18.23262 -3.18671  -21.24408 0.459 40.80602  ? 80  ARG D NH2 1 
ATOM   8639  N  NH2 B ARG D 2 80  ? -19.94762 -2.48570  -22.79416 0.541 40.70768  ? 80  ARG D NH2 1 
ATOM   8640  N  N   . VAL D 2 81  ? -13.19378 -4.96305  -25.96065 1.000 35.90761  ? 81  VAL D N   1 
ATOM   8641  C  CA  . VAL D 2 81  ? -11.75263 -4.88523  -25.75940 1.000 32.61418  ? 81  VAL D CA  1 
ATOM   8642  C  C   . VAL D 2 81  ? -11.33001 -3.47133  -25.39392 1.000 31.16589  ? 81  VAL D C   1 
ATOM   8643  O  O   . VAL D 2 81  ? -11.96879 -2.48485  -25.77491 1.000 37.52831  ? 81  VAL D O   1 
ATOM   8644  C  CB  . VAL D 2 81  ? -10.97674 -5.35458  -27.01194 1.000 31.90245  ? 81  VAL D CB  1 
ATOM   8645  C  CG1 . VAL D 2 81  ? -11.20851 -6.83613  -27.26297 1.000 36.87225  ? 81  VAL D CG1 1 
ATOM   8646  C  CG2 . VAL D 2 81  ? -11.38515 -4.52875  -28.22466 1.000 27.70707  ? 81  VAL D CG2 1 
ATOM   8647  N  N   . VAL D 2 82  ? -10.23207 -3.38520  -24.64927 1.000 36.40618  ? 82  VAL D N   1 
ATOM   8648  C  CA  . VAL D 2 82  ? -9.52148  -2.13185  -24.43211 1.000 35.15986  ? 82  VAL D CA  1 
ATOM   8649  C  C   . VAL D 2 82  ? -8.40740  -2.04521  -25.46346 1.000 32.35458  ? 82  VAL D C   1 
ATOM   8650  O  O   . VAL D 2 82  ? -7.60119  -2.97366  -25.59897 1.000 34.49270  ? 82  VAL D O   1 
ATOM   8651  C  CB  . VAL D 2 82  ? -8.95655  -2.05717  -23.00412 1.000 29.72486  ? 82  VAL D CB  1 
ATOM   8652  C  CG1 . VAL D 2 82  ? -8.15624  -0.78307  -22.81660 1.000 26.82300  ? 82  VAL D CG1 1 
ATOM   8653  C  CG2 . VAL D 2 82  ? -10.08185 -2.14835  -21.98459 1.000 32.06512  ? 82  VAL D CG2 1 
ATOM   8654  N  N   . VAL D 2 83  ? -8.36736  -0.94319  -26.19856 1.000 30.84702  ? 83  VAL D N   1 
ATOM   8655  C  CA  . VAL D 2 83  ? -7.41694  -0.74262  -27.28722 1.000 27.26552  ? 83  VAL D CA  1 
ATOM   8656  C  C   . VAL D 2 83  ? -6.34900  0.23312   -26.81006 1.000 29.41902  ? 83  VAL D C   1 
ATOM   8657  O  O   . VAL D 2 83  ? -6.66750  1.39275   -26.52052 1.000 32.34282  ? 83  VAL D O   1 
ATOM   8658  C  CB  . VAL D 2 83  ? -8.10688  -0.21574  -28.55263 1.000 28.61848  ? 83  VAL D CB  1 
ATOM   8659  C  CG1 . VAL D 2 83  ? -7.11374  -0.16319  -29.70123 1.000 34.87138  ? 83  VAL D CG1 1 
ATOM   8660  C  CG2 . VAL D 2 83  ? -9.29336  -1.08353  -28.89922 1.000 27.37508  ? 83  VAL D CG2 1 
ATOM   8661  N  N   . PRO D 2 84  ? -5.08510  -0.17155  -26.73549 1.000 30.91535  ? 84  PRO D N   1 
ATOM   8662  C  CA  . PRO D 2 84  ? -4.03991  0.76270   -26.31323 1.000 28.02301  ? 84  PRO D CA  1 
ATOM   8663  C  C   . PRO D 2 84  ? -3.84617  1.87533   -27.32891 1.000 29.84421  ? 84  PRO D C   1 
ATOM   8664  O  O   . PRO D 2 84  ? -4.02542  1.68659   -28.53365 1.000 35.43772  ? 84  PRO D O   1 
ATOM   8665  C  CB  . PRO D 2 84  ? -2.79218  -0.12283  -26.22187 1.000 31.80983  ? 84  PRO D CB  1 
ATOM   8666  C  CG  . PRO D 2 84  ? -3.06598  -1.25148  -27.16767 1.000 29.56504  ? 84  PRO D CG  1 
ATOM   8667  C  CD  . PRO D 2 84  ? -4.54541  -1.50353  -27.04448 1.000 22.76944  ? 84  PRO D CD  1 
ATOM   8668  N  N   . ALA D 2 85  ? -3.49675  3.06125   -26.82138 1.000 27.08571  ? 85  ALA D N   1 
ATOM   8669  C  CA  . ALA D 2 85  ? -3.17807  4.17000   -27.71362 1.000 28.20057  ? 85  ALA D CA  1 
ATOM   8670  C  C   . ALA D 2 85  ? -1.95570  3.85385   -28.56396 1.000 30.55864  ? 85  ALA D C   1 
ATOM   8671  O  O   . ALA D 2 85  ? -1.86681  4.29472   -29.71590 1.000 38.18815  ? 85  ALA D O   1 
ATOM   8672  C  CB  . ALA D 2 85  ? -2.96129  5.45443   -26.91295 1.000 29.45321  ? 85  ALA D CB  1 
ATOM   8673  N  N   . ALA D 2 86  ? -1.01048  3.09284   -28.01997 1.000 36.08297  ? 86  ALA D N   1 
ATOM   8674  C  CA  . ALA D 2 86  ? 0.15504   2.63165   -28.76129 1.000 33.13495  ? 86  ALA D CA  1 
ATOM   8675  C  C   . ALA D 2 86  ? -0.09238  1.19598   -29.20945 1.000 34.43093  ? 86  ALA D C   1 
ATOM   8676  O  O   . ALA D 2 86  ? -0.23506  0.29620   -28.37310 1.000 39.24105  ? 86  ALA D O   1 
ATOM   8677  C  CB  . ALA D 2 86  ? 1.42282   2.72366   -27.90932 1.000 24.46098  ? 86  ALA D CB  1 
ATOM   8678  N  N   . THR D 2 87  ? -0.15259  0.98688   -30.52798 1.000 33.61568  ? 87  THR D N   1 
ATOM   8679  C  CA  . THR D 2 87  ? -0.35469  -0.32839  -31.13470 1.000 37.16440  ? 87  THR D CA  1 
ATOM   8680  C  C   . THR D 2 87  ? 0.81754   -0.58344  -32.07470 1.000 38.38074  ? 87  THR D C   1 
ATOM   8681  O  O   . THR D 2 87  ? 0.68115   -0.47763  -33.30382 1.000 34.66511  ? 87  THR D O   1 
ATOM   8682  C  CB  . THR D 2 87  ? -1.68373  -0.40653  -31.88400 1.000 29.79834  ? 87  THR D CB  1 
ATOM   8683  O  OG1 . THR D 2 87  ? -1.72447  0.61841   -32.88614 1.000 35.20029  ? 87  THR D OG1 1 
ATOM   8684  C  CG2 . THR D 2 87  ? -2.85414  -0.22643  -30.92959 1.000 29.76864  ? 87  THR D CG2 1 
ATOM   8685  N  N   . PRO D 2 88  ? 1.98282   -0.92155  -31.54095 1.000 39.71605  ? 88  PRO D N   1 
ATOM   8686  C  CA  . PRO D 2 88  ? 3.18473   -0.98591  -32.37249 1.000 40.97996  ? 88  PRO D CA  1 
ATOM   8687  C  C   . PRO D 2 88  ? 3.23249   -2.24698  -33.22246 1.000 34.03725  ? 88  PRO D C   1 
ATOM   8688  O  O   . PRO D 2 88  ? 2.47973   -3.20335  -33.03019 1.000 40.65919  ? 88  PRO D O   1 
ATOM   8689  C  CB  . PRO D 2 88  ? 4.31860   -0.98017  -31.34340 1.000 43.59516  ? 88  PRO D CB  1 
ATOM   8690  C  CG  . PRO D 2 88  ? 3.72506   -1.65107  -30.15562 1.000 38.71980  ? 88  PRO D CG  1 
ATOM   8691  C  CD  . PRO D 2 88  ? 2.27117   -1.23423  -30.12940 1.000 35.67296  ? 88  PRO D CD  1 
ATOM   8692  N  N   . ASP D 2 89  ? 4.12604   -2.20652  -34.20573 1.000 43.78621  ? 89  ASP D N   1 
ATOM   8693  C  CA  A ASP D 2 89  ? 4.52069   -3.40193  -34.93710 0.495 44.42845  ? 89  ASP D CA  1 
ATOM   8694  C  CA  B ASP D 2 89  ? 4.51594   -3.40457  -34.93417 0.505 44.43172  ? 89  ASP D CA  1 
ATOM   8695  C  C   . ASP D 2 89  ? 5.45773   -4.20905  -34.04808 1.000 44.92615  ? 89  ASP D C   1 
ATOM   8696  O  O   . ASP D 2 89  ? 6.51936   -3.71598  -33.65193 1.000 51.39219  ? 89  ASP D O   1 
ATOM   8697  C  CB  A ASP D 2 89  ? 5.20067   -3.01907  -36.25043 0.495 45.48268  ? 89  ASP D CB  1 
ATOM   8698  C  CB  B ASP D 2 89  ? 5.18719   -3.03773  -36.25593 0.505 45.48198  ? 89  ASP D CB  1 
ATOM   8699  C  CG  A ASP D 2 89  ? 5.58020   -4.22294  -37.09098 0.495 43.77670  ? 89  ASP D CG  1 
ATOM   8700  C  CG  B ASP D 2 89  ? 4.31251   -2.15958  -37.13183 0.505 48.10320  ? 89  ASP D CG  1 
ATOM   8701  O  OD1 A ASP D 2 89  ? 5.11069   -5.34206  -36.79349 0.495 47.21732  ? 89  ASP D OD1 1 
ATOM   8702  O  OD1 B ASP D 2 89  ? 3.11532   -2.48014  -37.29818 0.505 42.43622  ? 89  ASP D OD1 1 
ATOM   8703  O  OD2 A ASP D 2 89  ? 6.35399   -4.04582  -38.05439 0.495 48.47313  ? 89  ASP D OD2 1 
ATOM   8704  O  OD2 B ASP D 2 89  ? 4.82445   -1.14380  -37.64960 0.505 52.90489  ? 89  ASP D OD2 1 
ATOM   8705  N  N   . TRP D 2 90  ? 5.06886   -5.43554  -33.72006 1.000 42.63970  ? 90  TRP D N   1 
ATOM   8706  C  CA  . TRP D 2 90  ? 5.82597   -6.22348  -32.75741 1.000 43.01687  ? 90  TRP D CA  1 
ATOM   8707  C  C   . TRP D 2 90  ? 6.94189   -7.04109  -33.38279 1.000 45.49786  ? 90  TRP D C   1 
ATOM   8708  O  O   . TRP D 2 90  ? 7.52021   -7.89519  -32.70303 1.000 49.32907  ? 90  TRP D O   1 
ATOM   8709  C  CB  . TRP D 2 90  ? 4.87708   -7.12373  -31.97055 1.000 43.87712  ? 90  TRP D CB  1 
ATOM   8710  C  CG  . TRP D 2 90  ? 4.11529   -6.33216  -30.97204 1.000 41.13969  ? 90  TRP D CG  1 
ATOM   8711  C  CD1 . TRP D 2 90  ? 2.86071   -5.81549  -31.11253 1.000 41.12114  ? 90  TRP D CD1 1 
ATOM   8712  C  CD2 . TRP D 2 90  ? 4.57362   -5.93415  -29.67748 1.000 45.26186  ? 90  TRP D CD2 1 
ATOM   8713  N  NE1 . TRP D 2 90  ? 2.50462   -5.12586  -29.97771 1.000 40.12818  ? 90  TRP D NE1 1 
ATOM   8714  C  CE2 . TRP D 2 90  ? 3.53926   -5.18636  -29.08029 1.000 41.95870  ? 90  TRP D CE2 1 
ATOM   8715  C  CE3 . TRP D 2 90  ? 5.75601   -6.14705  -28.96016 1.000 39.35020  ? 90  TRP D CE3 1 
ATOM   8716  C  CZ2 . TRP D 2 90  ? 3.65222   -4.64862  -27.80178 1.000 40.18434  ? 90  TRP D CZ2 1 
ATOM   8717  C  CZ3 . TRP D 2 90  ? 5.86621   -5.61456  -27.69240 1.000 38.80431  ? 90  TRP D CZ3 1 
ATOM   8718  C  CH2 . TRP D 2 90  ? 4.82135   -4.87284  -27.12527 1.000 40.35615  ? 90  TRP D CH2 1 
ATOM   8719  N  N   . ARG D 2 91  ? 7.28347   -6.78413  -34.64183 1.000 45.96638  ? 91  ARG D N   1 
ATOM   8720  C  CA  . ARG D 2 91  ? 8.31968   -7.53843  -35.33541 1.000 39.98340  ? 91  ARG D CA  1 
ATOM   8721  C  C   . ARG D 2 91  ? 9.33420   -6.55825  -35.93235 1.000 43.41875  ? 91  ARG D C   1 
ATOM   8722  O  O   . ARG D 2 91  ? 9.46946   -6.42800  -37.15064 1.000 53.65220  ? 91  ARG D O   1 
ATOM   8723  C  CB  . ARG D 2 91  ? 7.70880   -8.44971  -36.39042 1.000 41.92797  ? 91  ARG D CB  1 
ATOM   8724  C  CG  . ARG D 2 91  ? 6.89621   -9.59019  -35.79387 1.000 48.76412  ? 91  ARG D CG  1 
ATOM   8725  C  CD  . ARG D 2 91  ? 6.26317   -10.46367 -36.86580 1.000 48.95609  ? 91  ARG D CD  1 
ATOM   8726  N  NE  . ARG D 2 91  ? 7.24263   -10.93688 -37.83566 1.000 49.98351  ? 91  ARG D NE  1 
ATOM   8727  C  CZ  . ARG D 2 91  ? 7.42875   -10.39406 -39.03140 1.000 57.98400  ? 91  ARG D CZ  1 
ATOM   8728  N  NH1 . ARG D 2 91  ? 6.70844   -9.36047  -39.43963 1.000 55.16745  ? 91  ARG D NH1 1 
ATOM   8729  N  NH2 . ARG D 2 91  ? 8.36280   -10.89671 -39.83477 1.000 41.97395  ? 91  ARG D NH2 1 
ATOM   8730  N  N   . THR D 2 92  ? 10.05758  -5.86962  -35.05051 1.000 47.81121  ? 92  THR D N   1 
ATOM   8731  C  CA  . THR D 2 92  ? 11.11500  -4.94810  -35.43909 1.000 52.43290  ? 92  THR D CA  1 
ATOM   8732  C  C   . THR D 2 92  ? 12.30304  -5.13932  -34.50616 1.000 59.01144  ? 92  THR D C   1 
ATOM   8733  O  O   . THR D 2 92  ? 12.22711  -5.85076  -33.49990 1.000 51.99743  ? 92  THR D O   1 
ATOM   8734  C  CB  . THR D 2 92  ? 10.65382  -3.48375  -35.39382 1.000 55.12711  ? 92  THR D CB  1 
ATOM   8735  O  OG1 . THR D 2 92  ? 10.24625  -3.15354  -34.05948 1.000 57.64429  ? 92  THR D OG1 1 
ATOM   8736  C  CG2 . THR D 2 92  ? 9.49446   -3.23999  -36.35685 1.000 46.08072  ? 92  THR D CG2 1 
ATOM   8737  N  N   . SER D 2 93  ? 13.40563  -4.46384  -34.83722 1.000 57.06223  ? 93  SER D N   1 
ATOM   8738  C  CA  . SER D 2 93  ? 14.60116  -4.54650  -34.00549 1.000 60.56334  ? 93  SER D CA  1 
ATOM   8739  C  C   . SER D 2 93  ? 14.42253  -3.82073  -32.67701 1.000 57.92964  ? 93  SER D C   1 
ATOM   8740  O  O   . SER D 2 93  ? 15.01510  -4.22464  -31.66988 1.000 56.83746  ? 93  SER D O   1 
ATOM   8741  C  CB  . SER D 2 93  ? 15.80120  -3.97602  -34.76129 1.000 62.90576  ? 93  SER D CB  1 
ATOM   8742  O  OG  . SER D 2 93  ? 15.59813  -2.60780  -35.07475 1.000 72.47803  ? 93  SER D OG  1 
ATOM   8743  N  N   . GLU D 2 94  ? 13.61736  -2.75541  -32.65034 1.000 47.73073  ? 94  GLU D N   1 
ATOM   8744  C  CA  . GLU D 2 94  ? 13.42819  -2.00726  -31.41233 1.000 48.79982  ? 94  GLU D CA  1 
ATOM   8745  C  C   . GLU D 2 94  ? 12.64317  -2.81106  -30.38433 1.000 57.00395  ? 94  GLU D C   1 
ATOM   8746  O  O   . GLU D 2 94  ? 12.77361  -2.56947  -29.17667 1.000 53.37778  ? 94  GLU D O   1 
ATOM   8747  C  CB  . GLU D 2 94  ? 12.72729  -0.67712  -31.69691 1.000 52.68571  ? 94  GLU D CB  1 
ATOM   8748  C  CG  . GLU D 2 94  ? 13.55486  0.30522   -32.52380 1.000 67.15771  ? 94  GLU D CG  1 
ATOM   8749  C  CD  . GLU D 2 94  ? 13.35715  0.13654   -34.02443 1.000 62.63061  ? 94  GLU D CD  1 
ATOM   8750  O  OE1 . GLU D 2 94  ? 12.60869  -0.77654  -34.43308 1.000 62.85764  ? 94  GLU D OE1 1 
ATOM   8751  O  OE2 . GLU D 2 94  ? 13.94629  0.92318   -34.79639 1.000 66.37025  ? 94  GLU D OE2 1 
ATOM   8752  N  N   . VAL D 2 95  ? 11.82566  -3.76276  -30.83696 1.000 54.85007  ? 95  VAL D N   1 
ATOM   8753  C  CA  . VAL D 2 95  ? 11.12533  -4.63270  -29.89980 1.000 55.61702  ? 95  VAL D CA  1 
ATOM   8754  C  C   . VAL D 2 95  ? 12.10800  -5.57849  -29.21798 1.000 54.51431  ? 95  VAL D C   1 
ATOM   8755  O  O   . VAL D 2 95  ? 12.00066  -5.84097  -28.01316 1.000 50.80603  ? 95  VAL D O   1 
ATOM   8756  C  CB  . VAL D 2 95  ? 9.99660   -5.39186  -30.62165 1.000 47.00519  ? 95  VAL D CB  1 
ATOM   8757  C  CG1 . VAL D 2 95  ? 9.43002   -6.49305  -29.73715 1.000 46.71113  ? 95  VAL D CG1 1 
ATOM   8758  C  CG2 . VAL D 2 95  ? 8.90351   -4.42587  -31.02814 1.000 47.26427  ? 95  VAL D CG2 1 
ATOM   8759  N  N   . GLN D 2 96  ? 13.10010  -6.08123  -29.96375 1.000 48.70672  ? 96  GLN D N   1 
ATOM   8760  C  CA  . GLN D 2 96  ? 14.11574  -6.93492  -29.35540 1.000 48.70218  ? 96  GLN D CA  1 
ATOM   8761  C  C   . GLN D 2 96  ? 15.00330  -6.17245  -28.37387 1.000 47.69496  ? 96  GLN D C   1 
ATOM   8762  O  O   . GLN D 2 96  ? 15.61232  -6.79894  -27.49980 1.000 57.55689  ? 96  GLN D O   1 
ATOM   8763  C  CB  . GLN D 2 96  ? 14.97132  -7.60735  -30.43939 1.000 43.32897  ? 96  GLN D CB  1 
ATOM   8764  C  CG  . GLN D 2 96  ? 14.16777  -8.43768  -31.44425 1.000 48.12073  ? 96  GLN D CG  1 
ATOM   8765  C  CD  . GLN D 2 96  ? 15.02807  -9.36993  -32.29680 1.000 50.98548  ? 96  GLN D CD  1 
ATOM   8766  O  OE1 . GLN D 2 96  ? 16.12900  -9.75651  -31.90579 1.000 55.25907  ? 96  GLN D OE1 1 
ATOM   8767  N  NE2 . GLN D 2 96  ? 14.51520  -9.74486  -33.46420 1.000 40.90311  ? 96  GLN D NE2 1 
ATOM   8768  N  N   . ARG D 2 97  ? 15.08356  -4.84105  -28.48704 1.000 54.53717  ? 97  ARG D N   1 
ATOM   8769  C  CA  . ARG D 2 97  ? 15.79386  -4.02560  -27.50483 1.000 56.00827  ? 97  ARG D CA  1 
ATOM   8770  C  C   . ARG D 2 97  ? 14.93720  -3.67430  -26.29599 1.000 52.12111  ? 97  ARG D C   1 
ATOM   8771  O  O   . ARG D 2 97  ? 15.46728  -3.13860  -25.31669 1.000 50.48913  ? 97  ARG D O   1 
ATOM   8772  C  CB  . ARG D 2 97  ? 16.30769  -2.72715  -28.14018 1.000 44.34282  ? 97  ARG D CB  1 
ATOM   8773  C  CG  . ARG D 2 97  ? 17.53673  -2.89538  -29.01528 1.000 47.21744  ? 97  ARG D CG  1 
ATOM   8774  C  CD  . ARG D 2 97  ? 18.25435  -1.57307  -29.29703 1.000 54.08676  ? 97  ARG D CD  1 
ATOM   8775  N  NE  . ARG D 2 97  ? 17.42282  -0.61444  -30.01738 1.000 44.70450  ? 97  ARG D NE  1 
ATOM   8776  C  CZ  . ARG D 2 97  ? 16.98517  0.53067   -29.50825 1.000 49.13854  ? 97  ARG D CZ  1 
ATOM   8777  N  NH1 . ARG D 2 97  ? 17.29144  0.90292   -28.27425 1.000 40.84792  ? 97  ARG D NH1 1 
ATOM   8778  N  NH2 . ARG D 2 97  ? 16.22041  1.32278   -30.25513 1.000 45.19987  ? 97  ARG D NH2 1 
ATOM   8779  N  N   . GLY D 2 98  ? 13.63707  -3.94336  -26.34348 1.000 48.77592  ? 98  GLY D N   1 
ATOM   8780  C  CA  . GLY D 2 98  ? 12.76610  -3.64611  -25.22696 1.000 50.73476  ? 98  GLY D CA  1 
ATOM   8781  C  C   . GLY D 2 98  ? 12.09130  -2.29635  -25.28060 1.000 53.69737  ? 98  GLY D C   1 
ATOM   8782  O  O   . GLY D 2 98  ? 11.66461  -1.79313  -24.23439 1.000 50.49112  ? 98  GLY D O   1 
ATOM   8783  N  N   . TYR D 2 99  ? 11.98026  -1.68688  -26.46398 1.000 49.55773  ? 99  TYR D N   1 
ATOM   8784  C  CA  . TYR D 2 99  ? 11.35185  -0.37809  -26.62046 1.000 49.29984  ? 99  TYR D CA  1 
ATOM   8785  C  C   . TYR D 2 99  ? 10.33351  -0.46639  -27.76063 1.000 47.05938  ? 99  TYR D C   1 
ATOM   8786  O  O   . TYR D 2 99  ? 10.55329  0.04567   -28.86026 1.000 45.80926  ? 99  TYR D O   1 
ATOM   8787  C  CB  . TYR D 2 99  ? 12.40345  0.70838   -26.87517 1.000 43.20333  ? 99  TYR D CB  1 
ATOM   8788  C  CG  . TYR D 2 99  ? 13.26048  0.99916   -25.66534 1.000 41.23061  ? 99  TYR D CG  1 
ATOM   8789  C  CD1 . TYR D 2 99  ? 12.81918  1.86187   -24.66582 1.000 39.42148  ? 99  TYR D CD1 1 
ATOM   8790  C  CD2 . TYR D 2 99  ? 14.50714  0.40145   -25.51410 1.000 47.35245  ? 99  TYR D CD2 1 
ATOM   8791  C  CE1 . TYR D 2 99  ? 13.59896  2.12280   -23.54836 1.000 44.46919  ? 99  TYR D CE1 1 
ATOM   8792  C  CE2 . TYR D 2 99  ? 15.29509  0.65772   -24.40233 1.000 44.39684  ? 99  TYR D CE2 1 
ATOM   8793  C  CZ  . TYR D 2 99  ? 14.83595  1.51699   -23.42302 1.000 43.47224  ? 99  TYR D CZ  1 
ATOM   8794  O  OH  . TYR D 2 99  ? 15.62063  1.77155   -22.31945 1.000 58.91783  ? 99  TYR D OH  1 
ATOM   8795  N  N   . HIS D 2 100 ? 9.19884   -1.11339  -27.48074 1.000 44.23865  ? 100 HIS D N   1 
ATOM   8796  C  CA  . HIS D 2 100 ? 8.16207   -1.25031  -28.49736 1.000 43.49103  ? 100 HIS D CA  1 
ATOM   8797  C  C   . HIS D 2 100 ? 7.55443   0.09631   -28.86923 1.000 44.13662  ? 100 HIS D C   1 
ATOM   8798  O  O   . HIS D 2 100 ? 7.05348   0.25613   -29.98877 1.000 47.73292  ? 100 HIS D O   1 
ATOM   8799  C  CB  . HIS D 2 100 ? 7.07150   -2.21024  -28.02059 1.000 38.79313  ? 100 HIS D CB  1 
ATOM   8800  C  CG  . HIS D 2 100 ? 6.31943   -1.72725  -26.81870 1.000 42.68907  ? 100 HIS D CG  1 
ATOM   8801  N  ND1 . HIS D 2 100 ? 6.58422   -2.17942  -25.54373 1.000 41.55219  ? 100 HIS D ND1 1 
ATOM   8802  C  CD2 . HIS D 2 100 ? 5.31440   -0.82684  -26.69710 1.000 36.68662  ? 100 HIS D CD2 1 
ATOM   8803  C  CE1 . HIS D 2 100 ? 5.77181   -1.58285  -24.68906 1.000 38.85257  ? 100 HIS D CE1 1 
ATOM   8804  N  NE2 . HIS D 2 100 ? 4.99338   -0.75545  -25.36310 1.000 38.01828  ? 100 HIS D NE2 1 
ATOM   8805  N  N   . GLN D 2 101 ? 7.59977   1.07578   -27.95796 1.000 44.70198  ? 101 GLN D N   1 
ATOM   8806  C  CA  . GLN D 2 101 ? 7.08172   2.40681   -28.26096 1.000 46.66851  ? 101 GLN D CA  1 
ATOM   8807  C  C   . GLN D 2 101 ? 7.75854   3.02258   -29.47775 1.000 49.68028  ? 101 GLN D C   1 
ATOM   8808  O  O   . GLN D 2 101 ? 7.17358   3.89589   -30.12996 1.000 44.22310  ? 101 GLN D O   1 
ATOM   8809  C  CB  . GLN D 2 101 ? 7.26187   3.33983   -27.05775 1.000 41.02426  ? 101 GLN D CB  1 
ATOM   8810  C  CG  . GLN D 2 101 ? 6.56393   2.88775   -25.78502 1.000 37.53886  ? 101 GLN D CG  1 
ATOM   8811  C  CD  . GLN D 2 101 ? 7.48959   2.15850   -24.82601 1.000 38.60365  ? 101 GLN D CD  1 
ATOM   8812  O  OE1 . GLN D 2 101 ? 8.27343   1.30067   -25.22800 1.000 36.47028  ? 101 GLN D OE1 1 
ATOM   8813  N  NE2 . GLN D 2 101 ? 7.39763   2.49775   -23.54637 1.000 40.33606  ? 101 GLN D NE2 1 
ATOM   8814  N  N   . HIS D 2 102 ? 8.97123   2.58173   -29.79970 1.000 46.80029  ? 102 HIS D N   1 
ATOM   8815  C  CA  . HIS D 2 102 ? 9.73361   3.10810   -30.92113 1.000 48.94488  ? 102 HIS D CA  1 
ATOM   8816  C  C   . HIS D 2 102 ? 9.96620   2.03492   -31.97662 1.000 44.32397  ? 102 HIS D C   1 
ATOM   8817  O  O   . HIS D 2 102 ? 10.95625  2.07111   -32.70823 1.000 42.60173  ? 102 HIS D O   1 
ATOM   8818  C  CB  . HIS D 2 102 ? 11.04780  3.69983   -30.41826 1.000 39.89960  ? 102 HIS D CB  1 
ATOM   8819  C  CG  . HIS D 2 102 ? 10.86443  4.60321   -29.24047 1.000 46.13075  ? 102 HIS D CG  1 
ATOM   8820  N  ND1 . HIS D 2 102 ? 10.28962  5.85173   -29.34560 1.000 41.15463  ? 102 HIS D ND1 1 
ATOM   8821  C  CD2 . HIS D 2 102 ? 11.11869  4.41538   -27.92359 1.000 44.39244  ? 102 HIS D CD2 1 
ATOM   8822  C  CE1 . HIS D 2 102 ? 10.22555  6.40647   -28.14837 1.000 43.37479  ? 102 HIS D CE1 1 
ATOM   8823  N  NE2 . HIS D 2 102 ? 10.72321  5.55620   -27.26820 1.000 40.72328  ? 102 HIS D NE2 1 
ATOM   8824  N  N   . SER D 2 103 ? 9.04425   1.08027   -32.06364 1.000 47.32412  ? 103 SER D N   1 
ATOM   8825  C  CA  . SER D 2 103 ? 9.13725   -0.00807  -33.02982 1.000 52.29591  ? 103 SER D CA  1 
ATOM   8826  C  C   . SER D 2 103 ? 8.98776   0.54816   -34.44253 1.000 55.77841  ? 103 SER D C   1 
ATOM   8827  O  O   . SER D 2 103 ? 7.89015   0.93906   -34.85352 1.000 54.80327  ? 103 SER D O   1 
ATOM   8828  C  CB  . SER D 2 103 ? 8.06607   -1.05254  -32.73094 1.000 45.54883  ? 103 SER D CB  1 
ATOM   8829  O  OG  . SER D 2 103 ? 8.10654   -2.11441  -33.66649 1.000 48.39205  ? 103 SER D OG  1 
ATOM   8830  N  N   . GLY D 2 104 ? 10.08940  0.59133   -35.18631 1.000 48.91475  ? 104 GLY D N   1 
ATOM   8831  C  CA  . GLY D 2 104 ? 10.07755  1.12417   -36.53157 1.000 50.28125  ? 104 GLY D CA  1 
ATOM   8832  C  C   . GLY D 2 104 ? 10.42351  2.59153   -36.64933 1.000 56.73168  ? 104 GLY D C   1 
ATOM   8833  O  O   . GLY D 2 104 ? 10.24556  3.16647   -37.73041 1.000 59.47679  ? 104 GLY D O   1 
ATOM   8834  N  N   . GLY D 2 105 ? 10.91158  3.21516   -35.57893 1.000 50.88206  ? 105 GLY D N   1 
ATOM   8835  C  CA  . GLY D 2 105 ? 11.25386  4.62534   -35.59513 1.000 46.12103  ? 105 GLY D CA  1 
ATOM   8836  C  C   . GLY D 2 105 ? 10.83617  5.31613   -34.31429 1.000 46.60150  ? 105 GLY D C   1 
ATOM   8837  O  O   . GLY D 2 105 ? 10.06448  4.75377   -33.53275 1.000 49.43688  ? 105 GLY D O   1 
ATOM   8838  N  N   . MET D 2 106 ? 11.32347  6.53432   -34.08969 1.000 47.11160  ? 106 MET D N   1 
ATOM   8839  C  CA  . MET D 2 106 ? 10.99474  7.25467   -32.86519 1.000 47.17753  ? 106 MET D CA  1 
ATOM   8840  C  C   . MET D 2 106 ? 9.49472   7.50985   -32.77646 1.000 42.63444  ? 106 MET D C   1 
ATOM   8841  O  O   . MET D 2 106 ? 8.89132   8.07077   -33.69744 1.000 45.83402  ? 106 MET D O   1 
ATOM   8842  C  CB  . MET D 2 106 ? 11.76075  8.57713   -32.80586 1.000 51.56558  ? 106 MET D CB  1 
ATOM   8843  C  CG  . MET D 2 106 ? 11.75309  9.24269   -31.43561 1.000 37.06562  ? 106 MET D CG  1 
ATOM   8844  S  SD  . MET D 2 106 ? 12.86352  10.66012  -31.36646 1.000 56.93674  ? 106 MET D SD  1 
ATOM   8845  C  CE  . MET D 2 106 ? 14.32183  9.99383   -32.15767 1.000 60.10107  ? 106 MET D CE  1 
ATOM   8846  N  N   . LEU D 2 107 ? 8.89689   7.07745   -31.66278 1.000 45.57457  ? 107 LEU D N   1 
ATOM   8847  C  CA  . LEU D 2 107 ? 7.46858   7.22227   -31.37860 1.000 44.65085  ? 107 LEU D CA  1 
ATOM   8848  C  C   . LEU D 2 107 ? 6.58551   6.45723   -32.36385 1.000 48.56829  ? 107 LEU D C   1 
ATOM   8849  O  O   . LEU D 2 107 ? 5.37132   6.68655   -32.41805 1.000 43.73303  ? 107 LEU D O   1 
ATOM   8850  C  CB  . LEU D 2 107 ? 7.05798   8.70005   -31.34006 1.000 47.94571  ? 107 LEU D CB  1 
ATOM   8851  C  CG  . LEU D 2 107 ? 7.90087   9.61471   -30.45072 1.000 49.81269  ? 107 LEU D CG  1 
ATOM   8852  C  CD1 . LEU D 2 107 ? 7.39810   11.04510  -30.53651 1.000 57.09496  ? 107 LEU D CD1 1 
ATOM   8853  C  CD2 . LEU D 2 107 ? 7.86918   9.12173   -29.01431 1.000 49.81325  ? 107 LEU D CD2 1 
ATOM   8854  N  N   . ALA D 2 108 ? 7.16056   5.52205   -33.12521 1.000 46.62606  ? 108 ALA D N   1 
ATOM   8855  C  CA  . ALA D 2 108 ? 6.40770   4.81580   -34.15647 1.000 40.45699  ? 108 ALA D CA  1 
ATOM   8856  C  C   . ALA D 2 108 ? 5.39409   3.83169   -33.58582 1.000 45.38663  ? 108 ALA D C   1 
ATOM   8857  O  O   . ALA D 2 108 ? 4.56980   3.30962   -34.34452 1.000 50.51823  ? 108 ALA D O   1 
ATOM   8858  C  CB  . ALA D 2 108 ? 7.36303   4.08702   -35.10087 1.000 40.41293  ? 108 ALA D CB  1 
ATOM   8859  N  N   . GLY D 2 109 ? 5.43835   3.55231   -32.28242 1.000 42.87553  ? 109 GLY D N   1 
ATOM   8860  C  CA  . GLY D 2 109 ? 4.38282   2.76517   -31.67268 1.000 38.47145  ? 109 GLY D CA  1 
ATOM   8861  C  C   . GLY D 2 109 ? 3.05783   3.49325   -31.60230 1.000 42.11126  ? 109 GLY D C   1 
ATOM   8862  O  O   . GLY D 2 109 ? 2.01149   2.84951   -31.47047 1.000 42.44856  ? 109 GLY D O   1 
ATOM   8863  N  N   . TRP D 2 110 ? 3.08325   4.82206   -31.68257 1.000 41.41463  ? 110 TRP D N   1 
ATOM   8864  C  CA  . TRP D 2 110 ? 1.87828   5.64767   -31.69055 1.000 46.14785  ? 110 TRP D CA  1 
ATOM   8865  C  C   . TRP D 2 110 ? 1.42019   5.78330   -33.14024 1.000 38.05473  ? 110 TRP D C   1 
ATOM   8866  O  O   . TRP D 2 110 ? 1.98075   6.56829   -33.90882 1.000 40.88265  ? 110 TRP D O   1 
ATOM   8867  C  CB  . TRP D 2 110 ? 2.17387   7.00308   -31.05179 1.000 44.81106  ? 110 TRP D CB  1 
ATOM   8868  C  CG  . TRP D 2 110 ? 1.08595   8.04134   -31.18922 1.000 58.76026  ? 110 TRP D CG  1 
ATOM   8869  C  CD1 . TRP D 2 110 ? -0.25912  7.82012   -31.28106 1.000 58.89275  ? 110 TRP D CD1 1 
ATOM   8870  C  CD2 . TRP D 2 110 ? 1.26190   9.46459   -31.25903 1.000 62.58714  ? 110 TRP D CD2 1 
ATOM   8871  N  NE1 . TRP D 2 110 ? -0.93006  9.01493   -31.39737 1.000 62.33503  ? 110 TRP D NE1 1 
ATOM   8872  C  CE2 . TRP D 2 110 ? -0.01984  10.03910  -31.38852 1.000 62.10153  ? 110 TRP D CE2 1 
ATOM   8873  C  CE3 . TRP D 2 110 ? 2.37848   10.30778  -31.22259 1.000 65.21337  ? 110 TRP D CE3 1 
ATOM   8874  C  CZ2 . TRP D 2 110 ? -0.21594  11.41816  -31.48217 1.000 72.18878  ? 110 TRP D CZ2 1 
ATOM   8875  C  CZ3 . TRP D 2 110 ? 2.18195   11.67766  -31.31534 1.000 69.98128  ? 110 TRP D CZ3 1 
ATOM   8876  C  CH2 . TRP D 2 110 ? 0.89455   12.21838  -31.44384 1.000 71.49731  ? 110 TRP D CH2 1 
ATOM   8877  N  N   . LYS D 2 111 ? 0.39714   5.01398   -33.52005 1.000 36.90869  ? 111 LYS D N   1 
ATOM   8878  C  CA  . LYS D 2 111 ? -0.11460  5.01124   -34.88852 1.000 39.41977  ? 111 LYS D CA  1 
ATOM   8879  C  C   . LYS D 2 111 ? -1.42070  5.78242   -35.04336 1.000 40.72896  ? 111 LYS D C   1 
ATOM   8880  O  O   . LYS D 2 111 ? -1.56321  6.55271   -35.99828 1.000 43.21777  ? 111 LYS D O   1 
ATOM   8881  C  CB  . LYS D 2 111 ? -0.31519  3.57410   -35.38299 1.000 35.28538  ? 111 LYS D CB  1 
ATOM   8882  C  CG  . LYS D 2 111 ? 0.97267   2.77450   -35.54840 1.000 37.59212  ? 111 LYS D CG  1 
ATOM   8883  C  CD  . LYS D 2 111 ? 0.68121   1.35732   -36.01877 1.000 33.42539  ? 111 LYS D CD  1 
ATOM   8884  C  CE  . LYS D 2 111 ? 1.95603   0.55759   -36.21767 1.000 40.27050  ? 111 LYS D CE  1 
ATOM   8885  N  NZ  . LYS D 2 111 ? 2.81882   1.13208   -37.28721 1.000 47.53868  ? 111 LYS D NZ  1 
ATOM   8886  N  N   . PHE D 2 112 ? -2.36970  5.59638   -34.12224 1.000 38.04234  ? 112 PHE D N   1 
ATOM   8887  C  CA  . PHE D 2 112 ? -3.66975  6.25881   -34.20175 1.000 40.67036  ? 112 PHE D CA  1 
ATOM   8888  C  C   . PHE D 2 112 ? -3.52404  7.77884   -34.24081 1.000 36.69002  ? 112 PHE D C   1 
ATOM   8889  O  O   . PHE D 2 112 ? -2.85721  8.37388   -33.38965 1.000 44.03802  ? 112 PHE D O   1 
ATOM   8890  C  CB  . PHE D 2 112 ? -4.53123  5.85610   -33.00240 1.000 38.71320  ? 112 PHE D CB  1 
ATOM   8891  C  CG  . PHE D 2 112 ? -5.08383  4.45818   -33.07318 1.000 38.46098  ? 112 PHE D CG  1 
ATOM   8892  C  CD1 . PHE D 2 112 ? -5.52712  3.92572   -34.27339 1.000 36.26123  ? 112 PHE D CD1 1 
ATOM   8893  C  CD2 . PHE D 2 112 ? -5.16570  3.67801   -31.92820 1.000 31.70206  ? 112 PHE D CD2 1 
ATOM   8894  C  CE1 . PHE D 2 112 ? -6.04921  2.64245   -34.32766 1.000 37.75997  ? 112 PHE D CE1 1 
ATOM   8895  C  CE2 . PHE D 2 112 ? -5.67944  2.39639   -31.97581 1.000 33.30953  ? 112 PHE D CE2 1 
ATOM   8896  C  CZ  . PHE D 2 112 ? -6.12476  1.87668   -33.17665 1.000 35.56943  ? 112 PHE D CZ  1 
ATOM   8897  N  N   . SER D 2 113 ? -4.17757  8.40424   -35.22370 1.000 43.08948  ? 113 SER D N   1 
ATOM   8898  C  CA  . SER D 2 113 ? -4.15810  9.86051   -35.41310 1.000 47.57846  ? 113 SER D CA  1 
ATOM   8899  C  C   . SER D 2 113 ? -2.72788  10.38820  -35.52130 1.000 51.95896  ? 113 SER D C   1 
ATOM   8900  O  O   . SER D 2 113 ? -2.40755  11.48767  -35.06187 1.000 52.59034  ? 113 SER D O   1 
ATOM   8901  C  CB  . SER D 2 113 ? -4.92866  10.58854  -34.30486 1.000 41.01969  ? 113 SER D CB  1 
ATOM   8902  O  OG  . SER D 2 113 ? -4.22727  10.57246  -33.07370 1.000 53.57890  ? 113 SER D OG  1 
ATOM   8903  N  N   . ASN D 2 114 ? -1.85830  9.59032   -36.14232 1.000 54.95517  ? 114 ASN D N   1 
ATOM   8904  C  CA  . ASN D 2 114 ? -0.48414  10.00045  -36.40644 1.000 49.23731  ? 114 ASN D CA  1 
ATOM   8905  C  C   . ASN D 2 114 ? -0.08556  9.57396   -37.81378 1.000 47.34389  ? 114 ASN D C   1 
ATOM   8906  O  O   . ASN D 2 114 ? 0.17323   10.41816  -38.67687 1.000 58.09261  ? 114 ASN D O   1 
ATOM   8907  C  CB  . ASN D 2 114 ? 0.47012   9.40357   -35.36913 1.000 51.50587  ? 114 ASN D CB  1 
ATOM   8908  C  CG  . ASN D 2 114 ? 1.90205   9.87625   -35.55179 1.000 57.92351  ? 114 ASN D CG  1 
ATOM   8909  O  OD1 . ASN D 2 114 ? 2.16146   10.84811  -36.25857 1.000 56.00890  ? 114 ASN D OD1 1 
ATOM   8910  N  ND2 . ASN D 2 114 ? 2.83946   9.18805   -34.91104 1.000 57.91434  ? 114 ASN D ND2 1 
ATOM   8911  N  N   . VAL D 2 115 ? -0.05894  8.26580   -38.05987 1.000 44.74236  ? 115 VAL D N   1 
ATOM   8912  C  CA  . VAL D 2 115 ? 0.24119   7.72971   -39.38243 1.000 47.39974  ? 115 VAL D CA  1 
ATOM   8913  C  C   . VAL D 2 115 ? -0.89019  6.79478   -39.78029 1.000 44.47089  ? 115 VAL D C   1 
ATOM   8914  O  O   . VAL D 2 115 ? -0.76982  6.00906   -40.72779 1.000 52.20680  ? 115 VAL D O   1 
ATOM   8915  C  CB  . VAL D 2 115 ? 1.59875   7.00364   -39.40287 1.000 49.69800  ? 115 VAL D CB  1 
ATOM   8916  C  CG1 . VAL D 2 115 ? 2.71439   7.95579   -39.00433 1.000 51.36505  ? 115 VAL D CG1 1 
ATOM   8917  C  CG2 . VAL D 2 115 ? 1.56674   5.79664   -38.47891 1.000 47.31757  ? 115 VAL D CG2 1 
ATOM   8918  N  N   . LYS D 2 116 ? -1.99716  6.87584   -39.05219 1.000 44.62351  ? 116 LYS D N   1 
ATOM   8919  C  CA  . LYS D 2 116 ? -3.09843  5.94436   -39.22344 1.000 46.09727  ? 116 LYS D CA  1 
ATOM   8920  C  C   . LYS D 2 116 ? -4.37421  6.61866   -38.74187 1.000 46.05446  ? 116 LYS D C   1 
ATOM   8921  O  O   . LYS D 2 116 ? -4.34022  7.44140   -37.82206 1.000 42.92626  ? 116 LYS D O   1 
ATOM   8922  C  CB  . LYS D 2 116 ? -2.82032  4.65602   -38.44588 1.000 44.14824  ? 116 LYS D CB  1 
ATOM   8923  C  CG  . LYS D 2 116 ? -3.86170  3.57965   -38.55911 1.000 42.42578  ? 116 LYS D CG  1 
ATOM   8924  C  CD  . LYS D 2 116 ? -3.48814  2.42432   -37.64857 1.000 36.28423  ? 116 LYS D CD  1 
ATOM   8925  C  CE  . LYS D 2 116 ? -4.26766  1.17831   -38.00025 1.000 39.55248  ? 116 LYS D CE  1 
ATOM   8926  N  NZ  . LYS D 2 116 ? -3.81743  0.00989   -37.19917 1.000 40.45784  ? 116 LYS D NZ  1 
ATOM   8927  N  N   . ASP D 2 117 ? -5.49413  6.27742   -39.37872 1.000 44.09087  ? 117 ASP D N   1 
ATOM   8928  C  CA  . ASP D 2 117 ? -6.77483  6.84005   -38.96821 1.000 41.81570  ? 117 ASP D CA  1 
ATOM   8929  C  C   . ASP D 2 117 ? -7.08069  6.45950   -37.52524 1.000 39.08395  ? 117 ASP D C   1 
ATOM   8930  O  O   . ASP D 2 117 ? -6.95026  5.29670   -37.13440 1.000 38.76917  ? 117 ASP D O   1 
ATOM   8931  C  CB  . ASP D 2 117 ? -7.89664  6.36588   -39.89294 1.000 47.76490  ? 117 ASP D CB  1 
ATOM   8932  C  CG  . ASP D 2 117 ? -7.95324  7.14528   -41.19601 1.000 55.34089  ? 117 ASP D CG  1 
ATOM   8933  O  OD1 . ASP D 2 117 ? -7.59170  8.34535   -41.19669 1.000 45.02550  ? 117 ASP D OD1 1 
ATOM   8934  O  OD2 . ASP D 2 117 ? -8.37361  6.56041   -42.21825 1.000 54.45572  ? 117 ASP D OD2 1 
ATOM   8935  N  N   . GLY D 2 118 ? -7.47162  7.45224   -36.73066 1.000 41.46090  ? 118 GLY D N   1 
ATOM   8936  C  CA  . GLY D 2 118 ? -7.71324  7.25386   -35.31533 1.000 34.24052  ? 118 GLY D CA  1 
ATOM   8937  C  C   . GLY D 2 118 ? -9.00556  6.52556   -35.00375 1.000 41.04071  ? 118 GLY D C   1 
ATOM   8938  O  O   . GLY D 2 118 ? -9.58327  5.86330   -35.87137 1.000 37.17886  ? 118 GLY D O   1 
ATOM   8939  N  N   . VAL D 2 119 ? -9.48597  6.65750   -33.76522 1.000 37.47504  ? 119 VAL D N   1 
ATOM   8940  C  CA  . VAL D 2 119 ? -10.62741 5.87830   -33.30125 1.000 40.51695  ? 119 VAL D CA  1 
ATOM   8941  C  C   . VAL D 2 119 ? -11.94126 6.64768   -33.36904 1.000 39.14659  ? 119 VAL D C   1 
ATOM   8942  O  O   . VAL D 2 119 ? -12.99916 6.06398   -33.09200 1.000 37.73775  ? 119 VAL D O   1 
ATOM   8943  C  CB  . VAL D 2 119 ? -10.38362 5.35853   -31.86745 1.000 37.18302  ? 119 VAL D CB  1 
ATOM   8944  C  CG1 . VAL D 2 119 ? -9.14540  4.48210   -31.82283 1.000 26.89246  ? 119 VAL D CG1 1 
ATOM   8945  C  CG2 . VAL D 2 119 ? -10.23451 6.51671   -30.89780 1.000 29.95490  ? 119 VAL D CG2 1 
ATOM   8946  N  N   . PHE D 2 120 ? -11.91634 7.92512   -33.76133 1.000 36.60865  ? 120 PHE D N   1 
ATOM   8947  C  CA  . PHE D 2 120 ? -13.12716 8.74653   -33.83738 1.000 37.23928  ? 120 PHE D CA  1 
ATOM   8948  C  C   . PHE D 2 120 ? -13.88789 8.47139   -35.13777 1.000 41.74273  ? 120 PHE D C   1 
ATOM   8949  O  O   . PHE D 2 120 ? -14.16571 9.36498   -35.93489 1.000 41.01228  ? 120 PHE D O   1 
ATOM   8950  C  CB  . PHE D 2 120 ? -12.77894 10.22589  -33.73843 1.000 38.02011  ? 120 PHE D CB  1 
ATOM   8951  C  CG  . PHE D 2 120 ? -12.26822 10.65425  -32.39478 1.000 34.66299  ? 120 PHE D CG  1 
ATOM   8952  C  CD1 . PHE D 2 120 ? -12.39258 9.83252   -31.28861 1.000 37.42803  ? 120 PHE D CD1 1 
ATOM   8953  C  CD2 . PHE D 2 120 ? -11.66570 11.89422  -32.24235 1.000 38.39163  ? 120 PHE D CD2 1 
ATOM   8954  C  CE1 . PHE D 2 120 ? -11.92286 10.23796  -30.05444 1.000 36.23693  ? 120 PHE D CE1 1 
ATOM   8955  C  CE2 . PHE D 2 120 ? -11.19352 12.30895  -31.01340 1.000 37.79757  ? 120 PHE D CE2 1 
ATOM   8956  C  CZ  . PHE D 2 120 ? -11.32130 11.47811  -29.91538 1.000 43.36188  ? 120 PHE D CZ  1 
ATOM   8957  N  N   . GLY D 2 121 ? -14.24137 7.20375   -35.33781 1.000 36.83392  ? 121 GLY D N   1 
ATOM   8958  C  CA  . GLY D 2 121 ? -14.98756 6.81476   -36.51646 1.000 35.57959  ? 121 GLY D CA  1 
ATOM   8959  C  C   . GLY D 2 121 ? -15.87106 5.63001   -36.20227 1.000 41.50019  ? 121 GLY D C   1 
ATOM   8960  O  O   . GLY D 2 121 ? -15.73842 4.99053   -35.15720 1.000 41.82928  ? 121 GLY D O   1 
ATOM   8961  N  N   . GLU D 2 122 ? -16.78524 5.34074   -37.13195 1.000 46.59585  ? 122 GLU D N   1 
ATOM   8962  C  CA  . GLU D 2 122 ? -17.71400 4.23432   -36.92709 1.000 41.09526  ? 122 GLU D CA  1 
ATOM   8963  C  C   . GLU D 2 122 ? -16.98367 2.90862   -36.78746 1.000 43.65542  ? 122 GLU D C   1 
ATOM   8964  O  O   . GLU D 2 122 ? -17.48483 1.99103   -36.12732 1.000 40.02498  ? 122 GLU D O   1 
ATOM   8965  C  CB  . GLU D 2 122 ? -18.71236 4.16778   -38.08015 1.000 41.17152  ? 122 GLU D CB  1 
ATOM   8966  C  CG  . GLU D 2 122 ? -19.68829 5.32819   -38.12170 1.000 53.57926  ? 122 GLU D CG  1 
ATOM   8967  C  CD  . GLU D 2 122 ? -20.65053 5.23010   -39.28834 1.000 60.91823  ? 122 GLU D CD  1 
ATOM   8968  O  OE1 . GLU D 2 122 ? -20.22992 5.50603   -40.43301 1.000 55.16856  ? 122 GLU D OE1 1 
ATOM   8969  O  OE2 . GLU D 2 122 ? -21.82274 4.86276   -39.06141 1.000 66.62266  ? 122 GLU D OE2 1 
ATOM   8970  N  N   . PHE D 2 123 ? -15.80959 2.78910   -37.40364 1.000 40.18059  ? 123 PHE D N   1 
ATOM   8971  C  CA  . PHE D 2 123 ? -14.94512 1.63046   -37.24330 1.000 37.46167  ? 123 PHE D CA  1 
ATOM   8972  C  C   . PHE D 2 123 ? -13.50498 2.11173   -37.29159 1.000 41.59168  ? 123 PHE D C   1 
ATOM   8973  O  O   . PHE D 2 123 ? -13.20950 3.17980   -37.83422 1.000 44.22942  ? 123 PHE D O   1 
ATOM   8974  C  CB  . PHE D 2 123 ? -15.17543 0.58096   -38.33690 1.000 41.49756  ? 123 PHE D CB  1 
ATOM   8975  C  CG  . PHE D 2 123 ? -16.59051 0.08932   -38.42736 1.000 44.47596  ? 123 PHE D CG  1 
ATOM   8976  C  CD1 . PHE D 2 123 ? -17.03125 -0.94715  -37.62449 1.000 44.53634  ? 123 PHE D CD1 1 
ATOM   8977  C  CD2 . PHE D 2 123 ? -17.47743 0.66136   -39.32359 1.000 41.98767  ? 123 PHE D CD2 1 
ATOM   8978  C  CE1 . PHE D 2 123 ? -18.33174 -1.40255  -37.71172 1.000 48.87869  ? 123 PHE D CE1 1 
ATOM   8979  C  CE2 . PHE D 2 123 ? -18.77686 0.21330   -39.41454 1.000 39.31211  ? 123 PHE D CE2 1 
ATOM   8980  C  CZ  . PHE D 2 123 ? -19.20545 -0.82041  -38.60813 1.000 47.27728  ? 123 PHE D CZ  1 
ATOM   8981  N  N   . PHE D 2 124 ? -12.60426 1.31499   -36.72282 1.000 39.08057  ? 124 PHE D N   1 
ATOM   8982  C  CA  . PHE D 2 124 ? -11.18775 1.60152   -36.88061 1.000 37.69513  ? 124 PHE D CA  1 
ATOM   8983  C  C   . PHE D 2 124 ? -10.41844 0.29195   -36.94152 1.000 39.71954  ? 124 PHE D C   1 
ATOM   8984  O  O   . PHE D 2 124 ? -10.93262 -0.77832  -36.60184 1.000 35.92800  ? 124 PHE D O   1 
ATOM   8985  C  CB  . PHE D 2 124 ? -10.63477 2.52303   -35.77595 1.000 41.59323  ? 124 PHE D CB  1 
ATOM   8986  C  CG  . PHE D 2 124 ? -10.84075 2.01891   -34.37253 1.000 37.75237  ? 124 PHE D CG  1 
ATOM   8987  C  CD1 . PHE D 2 124 ? -9.92654  1.15700   -33.78909 1.000 34.86180  ? 124 PHE D CD1 1 
ATOM   8988  C  CD2 . PHE D 2 124 ? -11.92059 2.44727   -33.62012 1.000 34.62701  ? 124 PHE D CD2 1 
ATOM   8989  C  CE1 . PHE D 2 124 ? -10.10691 0.70661   -32.49259 1.000 36.86667  ? 124 PHE D CE1 1 
ATOM   8990  C  CE2 . PHE D 2 124 ? -12.10511 1.99961   -32.32431 1.000 36.99910  ? 124 PHE D CE2 1 
ATOM   8991  C  CZ  . PHE D 2 124 ? -11.19791 1.12981   -31.76043 1.000 32.10633  ? 124 PHE D CZ  1 
ATOM   8992  N  N   . HIS D 2 125 ? -9.18074  0.40049   -37.41272 1.000 36.57580  ? 125 HIS D N   1 
ATOM   8993  C  CA  . HIS D 2 125 ? -8.31269  -0.73463  -37.68838 1.000 30.84466  ? 125 HIS D CA  1 
ATOM   8994  C  C   . HIS D 2 125 ? -7.28097  -0.87711  -36.57611 1.000 35.23020  ? 125 HIS D C   1 
ATOM   8995  O  O   . HIS D 2 125 ? -6.62752  0.10229   -36.20187 1.000 38.81859  ? 125 HIS D O   1 
ATOM   8996  C  CB  . HIS D 2 125 ? -7.62254  -0.53242  -39.03957 1.000 35.69946  ? 125 HIS D CB  1 
ATOM   8997  C  CG  . HIS D 2 125 ? -6.70945  -1.64724  -39.44163 1.000 32.47122  ? 125 HIS D CG  1 
ATOM   8998  N  ND1 . HIS D 2 125 ? -5.38760  -1.70051  -39.05449 1.000 35.86569  ? 125 HIS D ND1 1 
ATOM   8999  C  CD2 . HIS D 2 125 ? -6.91009  -2.72138  -40.24083 1.000 40.50625  ? 125 HIS D CD2 1 
ATOM   9000  C  CE1 . HIS D 2 125 ? -4.82136  -2.77556  -39.57318 1.000 37.32773  ? 125 HIS D CE1 1 
ATOM   9001  N  NE2 . HIS D 2 125 ? -5.72274  -3.41135  -40.29980 1.000 36.98426  ? 125 HIS D NE2 1 
ATOM   9002  N  N   . VAL D 2 126 ? -7.13802  -2.09021  -36.04977 1.000 32.89958  ? 126 VAL D N   1 
ATOM   9003  C  CA  . VAL D 2 126 ? -6.13108  -2.40254  -35.04022 1.000 39.83605  ? 126 VAL D CA  1 
ATOM   9004  C  C   . VAL D 2 126 ? -5.18477  -3.44171  -35.62290 1.000 35.62407  ? 126 VAL D C   1 
ATOM   9005  O  O   . VAL D 2 126 ? -5.59960  -4.56935  -35.92070 1.000 34.19874  ? 126 VAL D O   1 
ATOM   9006  C  CB  . VAL D 2 126 ? -6.75349  -2.90952  -33.73220 1.000 32.28976  ? 126 VAL D CB  1 
ATOM   9007  C  CG1 . VAL D 2 126 ? -5.65369  -3.32966  -32.77108 1.000 32.93711  ? 126 VAL D CG1 1 
ATOM   9008  C  CG2 . VAL D 2 126 ? -7.61501  -1.83053  -33.10764 1.000 33.24918  ? 126 VAL D CG2 1 
ATOM   9009  N  N   . ASN D 2 127 ? -3.91908  -3.06472  -35.78474 1.000 33.99433  ? 127 ASN D N   1 
ATOM   9010  C  CA  . ASN D 2 127 ? -2.91920  -3.97830  -36.31634 1.000 32.73955  ? 127 ASN D CA  1 
ATOM   9011  C  C   . ASN D 2 127 ? -2.47754  -4.97507  -35.25178 1.000 37.19481  ? 127 ASN D C   1 
ATOM   9012  O  O   . ASN D 2 127 ? -2.29487  -4.61603  -34.08469 1.000 39.52631  ? 127 ASN D O   1 
ATOM   9013  C  CB  . ASN D 2 127 ? -1.70981  -3.19806  -36.83174 1.000 35.68835  ? 127 ASN D CB  1 
ATOM   9014  C  CG  . ASN D 2 127 ? -1.08362  -2.32034  -35.76437 1.000 35.88780  ? 127 ASN D CG  1 
ATOM   9015  O  OD1 . ASN D 2 127 ? -1.69091  -1.35085  -35.30416 1.000 35.49272  ? 127 ASN D OD1 1 
ATOM   9016  N  ND2 . ASN D 2 127 ? 0.13943   -2.65387  -35.36666 1.000 32.96576  ? 127 ASN D ND2 1 
ATOM   9017  N  N   . ASP D 2 128 ? -2.30859  -6.23292  -35.66478 1.000 39.11538  ? 128 ASP D N   1 
ATOM   9018  C  CA  . ASP D 2 128 ? -1.83602  -7.31441  -34.79687 1.000 33.55299  ? 128 ASP D CA  1 
ATOM   9019  C  C   . ASP D 2 128 ? -2.69330  -7.42411  -33.53054 1.000 40.98497  ? 128 ASP D C   1 
ATOM   9020  O  O   . ASP D 2 128 ? -2.26908  -7.10359  -32.41826 1.000 38.38987  ? 128 ASP D O   1 
ATOM   9021  C  CB  . ASP D 2 128 ? -0.35767  -7.10942  -34.45662 1.000 41.08375  ? 128 ASP D CB  1 
ATOM   9022  C  CG  . ASP D 2 128 ? 0.34518   -8.40399  -34.12565 1.000 52.47780  ? 128 ASP D CG  1 
ATOM   9023  O  OD1 . ASP D 2 128 ? -0.34929  -9.36221  -33.72056 1.000 50.16491  ? 128 ASP D OD1 1 
ATOM   9024  O  OD2 . ASP D 2 128 ? 1.58743   -8.46120  -34.26462 1.000 56.82014  ? 128 ASP D OD2 1 
ATOM   9025  N  N   . ALA D 2 129 ? -3.92116  -7.90776  -33.74406 1.000 34.78994  ? 129 ALA D N   1 
ATOM   9026  C  CA  . ALA D 2 129 ? -4.92576  -7.93347  -32.68130 1.000 39.71328  ? 129 ALA D CA  1 
ATOM   9027  C  C   . ALA D 2 129 ? -4.46172  -8.73875  -31.47080 1.000 39.58981  ? 129 ALA D C   1 
ATOM   9028  O  O   . ALA D 2 129 ? -4.62111  -8.29968  -30.32455 1.000 38.08947  ? 129 ALA D O   1 
ATOM   9029  C  CB  . ALA D 2 129 ? -6.24062  -8.49323  -33.22205 1.000 39.05932  ? 129 ALA D CB  1 
ATOM   9030  N  N   . ASP D 2 130 ? -3.89651  -9.92863  -31.70158 1.000 35.53097  ? 130 ASP D N   1 
ATOM   9031  C  CA  . ASP D 2 130 ? -3.48273  -10.77882 -30.58849 1.000 35.27315  ? 130 ASP D CA  1 
ATOM   9032  C  C   . ASP D 2 130 ? -2.40340  -10.13665 -29.72932 1.000 37.19196  ? 130 ASP D C   1 
ATOM   9033  O  O   . ASP D 2 130 ? -2.23291  -10.53528 -28.57241 1.000 43.59559  ? 130 ASP D O   1 
ATOM   9034  C  CB  . ASP D 2 130 ? -2.98941  -12.13564 -31.09572 1.000 38.06400  ? 130 ASP D CB  1 
ATOM   9035  C  CG  . ASP D 2 130 ? -4.11819  -13.02772 -31.56605 1.000 45.74053  ? 130 ASP D CG  1 
ATOM   9036  O  OD1 . ASP D 2 130 ? -5.26945  -12.80059 -31.13688 1.000 44.40393  ? 130 ASP D OD1 1 
ATOM   9037  O  OD2 . ASP D 2 130 ? -3.85510  -13.96273 -32.35341 1.000 47.46773  ? 130 ASP D OD2 1 
ATOM   9038  N  N   . MET D 2 131 ? -1.67124  -9.16049  -30.26047 1.000 37.16639  ? 131 MET D N   1 
ATOM   9039  C  CA  . MET D 2 131 ? -0.62287  -8.49068  -29.50508 1.000 35.27664  ? 131 MET D CA  1 
ATOM   9040  C  C   . MET D 2 131 ? -1.02408  -7.10283  -29.02996 1.000 34.32630  ? 131 MET D C   1 
ATOM   9041  O  O   . MET D 2 131 ? -0.34944  -6.54943  -28.15643 1.000 34.80857  ? 131 MET D O   1 
ATOM   9042  C  CB  . MET D 2 131 ? 0.65112   -8.37416  -30.35228 1.000 36.73427  ? 131 MET D CB  1 
ATOM   9043  C  CG  . MET D 2 131 ? 1.28882   -9.70282  -30.72437 1.000 39.33145  ? 131 MET D CG  1 
ATOM   9044  S  SD  . MET D 2 131 ? 2.13175   -10.49822 -29.34366 1.000 45.23491  ? 131 MET D SD  1 
ATOM   9045  C  CE  . MET D 2 131 ? 3.61205   -9.49802  -29.21330 1.000 44.90327  ? 131 MET D CE  1 
ATOM   9046  N  N   . ASN D 2 132 ? -2.10645  -6.53370  -29.56995 1.000 34.23991  ? 132 ASN D N   1 
ATOM   9047  C  CA  . ASN D 2 132 ? -2.45243  -5.13995  -29.31664 1.000 34.49638  ? 132 ASN D CA  1 
ATOM   9048  C  C   . ASN D 2 132 ? -3.88895  -4.95605  -28.83985 1.000 35.62964  ? 132 ASN D C   1 
ATOM   9049  O  O   . ASN D 2 132 ? -4.42099  -3.84837  -28.93123 1.000 44.52240  ? 132 ASN D O   1 
ATOM   9050  C  CB  . ASN D 2 132 ? -2.21634  -4.29651  -30.57185 1.000 32.26711  ? 132 ASN D CB  1 
ATOM   9051  C  CG  . ASN D 2 132 ? -0.75530  -3.99948  -30.80183 1.000 35.97549  ? 132 ASN D CG  1 
ATOM   9052  O  OD1 . ASN D 2 132 ? -0.00738  -3.75440  -29.85447 1.000 42.11403  ? 132 ASN D OD1 1 
ATOM   9053  N  ND2 . ASN D 2 132 ? -0.33359  -4.02620  -32.06323 1.000 32.42502  ? 132 ASN D ND2 1 
ATOM   9054  N  N   . LEU D 2 133 ? -4.53570  -6.00463  -28.34400 1.000 39.70299  ? 133 LEU D N   1 
ATOM   9055  C  CA  . LEU D 2 133 ? -5.86395  -5.88225  -27.76377 1.000 28.71222  ? 133 LEU D CA  1 
ATOM   9056  C  C   . LEU D 2 133 ? -5.89004  -6.62407  -26.43877 1.000 30.84523  ? 133 LEU D C   1 
ATOM   9057  O  O   . LEU D 2 133 ? -5.14893  -7.58594  -26.23812 1.000 35.13969  ? 133 LEU D O   1 
ATOM   9058  C  CB  . LEU D 2 133 ? -6.96405  -6.44500  -28.68362 1.000 31.32078  ? 133 LEU D CB  1 
ATOM   9059  C  CG  . LEU D 2 133 ? -7.31565  -5.69905  -29.96775 1.000 31.14520  ? 133 LEU D CG  1 
ATOM   9060  C  CD1 . LEU D 2 133 ? -8.40938  -6.43951  -30.71050 1.000 35.33748  ? 133 LEU D CD1 1 
ATOM   9061  C  CD2 . LEU D 2 133 ? -7.74717  -4.27640  -29.66779 1.000 25.44218  ? 133 LEU D CD2 1 
ATOM   9062  N  N   . ALA D 2 134 ? -6.74581  -6.16587  -25.53332 1.000 32.94929  ? 134 ALA D N   1 
ATOM   9063  C  CA  . ALA D 2 134 ? -6.96256  -6.83611  -24.26076 1.000 31.84626  ? 134 ALA D CA  1 
ATOM   9064  C  C   . ALA D 2 134 ? -8.45674  -6.91426  -23.99879 1.000 34.06338  ? 134 ALA D C   1 
ATOM   9065  O  O   . ALA D 2 134 ? -9.18683  -5.95494  -24.25925 1.000 40.56639  ? 134 ALA D O   1 
ATOM   9066  C  CB  . ALA D 2 134 ? -6.25943  -6.10827  -23.11056 1.000 33.82050  ? 134 ALA D CB  1 
ATOM   9067  N  N   . HIS D 2 135 ? -8.90753  -8.06026  -23.49622 1.000 33.16030  ? 135 HIS D N   1 
ATOM   9068  C  CA  . HIS D 2 135 ? -10.31949 -8.24460  -23.18640 1.000 34.32030  ? 135 HIS D CA  1 
ATOM   9069  C  C   . HIS D 2 135 ? -10.74668 -7.33935  -22.03620 1.000 38.07312  ? 135 HIS D C   1 
ATOM   9070  O  O   . HIS D 2 135 ? -10.00266 -7.13692  -21.07232 1.000 38.20486  ? 135 HIS D O   1 
ATOM   9071  C  CB  . HIS D 2 135 ? -10.59910 -9.70495  -22.83241 1.000 36.81821  ? 135 HIS D CB  1 
ATOM   9072  C  CG  . HIS D 2 135 ? -10.45411 -10.64453 -23.98774 1.000 38.57410  ? 135 HIS D CG  1 
ATOM   9073  N  ND1 . HIS D 2 135 ? -11.45839 -10.85179 -24.90862 1.000 40.40759  ? 135 HIS D ND1 1 
ATOM   9074  C  CD2 . HIS D 2 135 ? -9.42339  -11.43552 -24.37001 1.000 44.36324  ? 135 HIS D CD2 1 
ATOM   9075  C  CE1 . HIS D 2 135 ? -11.05191 -11.72760 -25.81056 1.000 38.38052  ? 135 HIS D CE1 1 
ATOM   9076  N  NE2 . HIS D 2 135 ? -9.82006  -12.09717 -25.50711 1.000 42.56248  ? 135 HIS D NE2 1 
ATOM   9077  N  N   . LEU D 2 136 ? -11.95774 -6.78953  -22.14437 1.000 33.50116  ? 136 LEU D N   1 
ATOM   9078  C  CA  . LEU D 2 136 ? -12.49166 -5.90367  -21.12125 1.000 41.18081  ? 136 LEU D CA  1 
ATOM   9079  C  C   . LEU D 2 136 ? -13.42683 -6.67285  -20.20399 1.000 37.68844  ? 136 LEU D C   1 
ATOM   9080  O  O   . LEU D 2 136 ? -14.43819 -7.21663  -20.67742 1.000 46.56409  ? 136 LEU D O   1 
ATOM   9081  C  CB  . LEU D 2 136 ? -13.23070 -4.73170  -21.75623 1.000 43.76023  ? 136 LEU D CB  1 
ATOM   9082  C  CG  . LEU D 2 136 ? -13.95924 -3.82480  -20.76246 1.000 41.03488  ? 136 LEU D CG  1 
ATOM   9083  C  CD1 . LEU D 2 136 ? -12.97446 -3.15282  -19.82272 1.000 32.84974  ? 136 LEU D CD1 1 
ATOM   9084  C  CD2 . LEU D 2 136 ? -14.81042 -2.79697  -21.48512 1.000 48.86717  ? 136 LEU D CD2 1 
ATOM   9085  N  N   . PRO D 2 137 ? -13.13622 -6.76008  -18.91044 1.000 36.54114  ? 137 PRO D N   1 
ATOM   9086  C  CA  . PRO D 2 137 ? -14.06925 -7.41537  -17.98969 1.000 33.41805  ? 137 PRO D CA  1 
ATOM   9087  C  C   . PRO D 2 137 ? -15.35762 -6.62209  -17.84186 1.000 47.00956  ? 137 PRO D C   1 
ATOM   9088  O  O   . PRO D 2 137 ? -15.37010 -5.38878  -17.88654 1.000 42.85617  ? 137 PRO D O   1 
ATOM   9089  C  CB  . PRO D 2 137 ? -13.29569 -7.45894  -16.66508 1.000 43.75371  ? 137 PRO D CB  1 
ATOM   9090  C  CG  . PRO D 2 137 ? -11.85718 -7.22364  -17.03810 1.000 37.40226  ? 137 PRO D CG  1 
ATOM   9091  C  CD  . PRO D 2 137 ? -11.89735 -6.33542  -18.24027 1.000 38.95855  ? 137 PRO D CD  1 
ATOM   9092  N  N   . LYS D 2 138 ? -16.45494 -7.35670  -17.65338 1.000 44.38905  ? 138 LYS D N   1 
ATOM   9093  C  CA  . LYS D 2 138 ? -17.75578 -6.73422  -17.44060 1.000 46.13051  ? 138 LYS D CA  1 
ATOM   9094  C  C   . LYS D 2 138 ? -17.79010 -5.87588  -16.18273 1.000 45.40158  ? 138 LYS D C   1 
ATOM   9095  O  O   . LYS D 2 138 ? -18.61334 -4.95874  -16.09511 1.000 50.52123  ? 138 LYS D O   1 
ATOM   9096  C  CB  . LYS D 2 138 ? -18.82982 -7.81973  -17.36783 1.000 42.38105  ? 138 LYS D CB  1 
ATOM   9097  C  CG  . LYS D 2 138 ? -18.53606 -8.87301  -16.30956 1.000 60.86387  ? 138 LYS D CG  1 
ATOM   9098  C  CD  . LYS D 2 138 ? -19.48823 -10.05906 -16.39377 1.000 68.37366  ? 138 LYS D CD  1 
ATOM   9099  C  CE  . LYS D 2 138 ? -19.09585 -11.14717 -15.40164 1.000 54.12946  ? 138 LYS D CE  1 
ATOM   9100  N  NZ  . LYS D 2 138 ? -19.98596 -12.33694 -15.49933 1.000 72.45162  ? 138 LYS D NZ  1 
ATOM   9101  N  N   . GLU D 2 139 ? -16.91458 -6.14676  -15.21145 1.000 49.54274  ? 139 GLU D N   1 
ATOM   9102  C  CA  . GLU D 2 139 ? -16.91572 -5.41031  -13.95201 1.000 48.01989  ? 139 GLU D CA  1 
ATOM   9103  C  C   . GLU D 2 139 ? -16.38605 -3.98870  -14.08836 1.000 49.55074  ? 139 GLU D C   1 
ATOM   9104  O  O   . GLU D 2 139 ? -16.56303 -3.19246  -13.15921 1.000 49.95335  ? 139 GLU D O   1 
ATOM   9105  C  CB  . GLU D 2 139 ? -16.09144 -6.15421  -12.89131 1.000 47.16314  ? 139 GLU D CB  1 
ATOM   9106  C  CG  . GLU D 2 139 ? -16.69009 -7.46875  -12.38834 1.000 57.14670  ? 139 GLU D CG  1 
ATOM   9107  C  CD  . GLU D 2 139 ? -16.39896 -8.65938  -13.29147 1.000 64.51282  ? 139 GLU D CD  1 
ATOM   9108  O  OE1 . GLU D 2 139 ? -15.82648 -8.46879  -14.38683 1.000 57.89765  ? 139 GLU D OE1 1 
ATOM   9109  O  OE2 . GLU D 2 139 ? -16.73814 -9.79547  -12.89413 1.000 69.65713  ? 139 GLU D OE2 1 
ATOM   9110  N  N   . ILE D 2 140 ? -15.73314 -3.65120  -15.19319 1.000 47.29958  ? 140 ILE D N   1 
ATOM   9111  C  CA  . ILE D 2 140 ? -15.14395 -2.33005  -15.38411 1.000 41.99686  ? 140 ILE D CA  1 
ATOM   9112  C  C   . ILE D 2 140 ? -16.07024 -1.52819  -16.29740 1.000 42.04877  ? 140 ILE D C   1 
ATOM   9113  O  O   . ILE D 2 140 ? -16.27101 -1.92744  -17.45378 1.000 43.73726  ? 140 ILE D O   1 
ATOM   9114  C  CB  . ILE D 2 140 ? -13.73308 -2.42212  -15.97898 1.000 41.07648  ? 140 ILE D CB  1 
ATOM   9115  C  CG1 . ILE D 2 140 ? -12.83715 -3.28345  -15.08726 1.000 36.29656  ? 140 ILE D CG1 1 
ATOM   9116  C  CG2 . ILE D 2 140 ? -13.13651 -1.02911  -16.14020 1.000 37.88525  ? 140 ILE D CG2 1 
ATOM   9117  C  CD1 . ILE D 2 140 ? -11.40019 -3.36549  -15.56918 1.000 35.75804  ? 140 ILE D CD1 1 
ATOM   9118  N  N   . PRO D 2 141 ? -16.63231 -0.41429  -15.83622 1.000 44.71598  ? 141 PRO D N   1 
ATOM   9119  C  CA  . PRO D 2 141 ? -17.50069 0.38580   -16.70809 1.000 42.41104  ? 141 PRO D CA  1 
ATOM   9120  C  C   . PRO D 2 141 ? -16.70150 1.09944   -17.78933 1.000 37.69677  ? 141 PRO D C   1 
ATOM   9121  O  O   . PRO D 2 141 ? -15.48371 1.26724   -17.70063 1.000 42.90810  ? 141 PRO D O   1 
ATOM   9122  C  CB  . PRO D 2 141 ? -18.16638 1.37604   -15.74387 1.000 44.45546  ? 141 PRO D CB  1 
ATOM   9123  C  CG  . PRO D 2 141 ? -17.24418 1.45326   -14.57198 1.000 37.13971  ? 141 PRO D CG  1 
ATOM   9124  C  CD  . PRO D 2 141 ? -16.57930 0.10973   -14.45915 1.000 39.06384  ? 141 PRO D CD  1 
ATOM   9125  N  N   . LEU D 2 142 ? -17.42363 1.52599   -18.82860 1.000 35.84908  ? 142 LEU D N   1 
ATOM   9126  C  CA  . LEU D 2 142 ? -16.78137 2.09399   -20.01222 1.000 38.32691  ? 142 LEU D CA  1 
ATOM   9127  C  C   . LEU D 2 142 ? -16.02458 3.37878   -19.69457 1.000 42.43956  ? 142 LEU D C   1 
ATOM   9128  O  O   . LEU D 2 142 ? -14.93254 3.60630   -20.22618 1.000 37.90262  ? 142 LEU D O   1 
ATOM   9129  C  CB  . LEU D 2 142 ? -17.83212 2.34474   -21.09265 1.000 38.94892  ? 142 LEU D CB  1 
ATOM   9130  C  CG  . LEU D 2 142 ? -18.43003 1.07649   -21.70026 1.000 37.31682  ? 142 LEU D CG  1 
ATOM   9131  C  CD1 . LEU D 2 142 ? -19.54103 1.40784   -22.67934 1.000 29.46509  ? 142 LEU D CD1 1 
ATOM   9132  C  CD2 . LEU D 2 142 ? -17.33764 0.27194   -22.38327 1.000 32.26077  ? 142 LEU D CD2 1 
ATOM   9133  N  N   . GLU D 2 143 ? -16.59216 4.23714   -18.84285 1.000 43.68660  ? 143 GLU D N   1 
ATOM   9134  C  CA  . GLU D 2 143 ? -15.94395 5.50851   -18.52922 1.000 47.59456  ? 143 GLU D CA  1 
ATOM   9135  C  C   . GLU D 2 143 ? -14.57959 5.29449   -17.88912 1.000 38.97435  ? 143 GLU D C   1 
ATOM   9136  O  O   . GLU D 2 143 ? -13.62448 6.02318   -18.18447 1.000 39.57362  ? 143 GLU D O   1 
ATOM   9137  C  CB  . GLU D 2 143 ? -16.82937 6.34503   -17.60375 1.000 42.19903  ? 143 GLU D CB  1 
ATOM   9138  C  CG  . GLU D 2 143 ? -18.14043 6.80317   -18.21706 1.000 50.51959  ? 143 GLU D CG  1 
ATOM   9139  C  CD  . GLU D 2 143 ? -19.22015 5.73868   -18.14447 1.000 62.21605  ? 143 GLU D CD  1 
ATOM   9140  O  OE1 . GLU D 2 143 ? -18.94459 4.65244   -17.58694 1.000 52.45974  ? 143 GLU D OE1 1 
ATOM   9141  O  OE2 . GLU D 2 143 ? -20.34236 5.98932   -18.63946 1.000 71.77447  ? 143 GLU D OE2 1 
ATOM   9142  N  N   . ALA D 2 144 ? -14.46752 4.29879   -17.00992 1.000 35.75412  ? 144 ALA D N   1 
ATOM   9143  C  CA  . ALA D 2 144 ? -13.19513 4.03476   -16.35324 1.000 39.04979  ? 144 ALA D CA  1 
ATOM   9144  C  C   . ALA D 2 144 ? -12.20255 3.36214   -17.29416 1.000 35.48696  ? 144 ALA D C   1 
ATOM   9145  O  O   . ALA D 2 144 ? -11.01426 3.69949   -17.28960 1.000 37.32149  ? 144 ALA D O   1 
ATOM   9146  C  CB  . ALA D 2 144 ? -13.42329 3.17343   -15.11185 1.000 36.53550  ? 144 ALA D CB  1 
ATOM   9147  N  N   . ALA D 2 145 ? -12.67273 2.42285   -18.11657 1.000 32.25138  ? 145 ALA D N   1 
ATOM   9148  C  CA  . ALA D 2 145 ? -11.76645 1.65355   -18.96218 1.000 27.61198  ? 145 ALA D CA  1 
ATOM   9149  C  C   . ALA D 2 145 ? -11.09214 2.51768   -20.01823 1.000 35.08731  ? 145 ALA D C   1 
ATOM   9150  O  O   . ALA D 2 145 ? -9.93505  2.26872   -20.36840 1.000 34.97612  ? 145 ALA D O   1 
ATOM   9151  C  CB  . ALA D 2 145 ? -12.51894 0.50386   -19.63005 1.000 31.95513  ? 145 ALA D CB  1 
ATOM   9152  N  N   . VAL D 2 146 ? -11.77995 3.53852   -20.52834 1.000 34.94952  ? 146 VAL D N   1 
ATOM   9153  C  CA  . VAL D 2 146 ? -11.23798 4.35855   -21.60812 1.000 30.96504  ? 146 VAL D CA  1 
ATOM   9154  C  C   . VAL D 2 146 ? -10.15736 5.30283   -21.07918 1.000 37.13737  ? 146 VAL D C   1 
ATOM   9155  O  O   . VAL D 2 146 ? -9.51907  6.02404   -21.85177 1.000 38.29254  ? 146 VAL D O   1 
ATOM   9156  C  CB  . VAL D 2 146 ? -12.36947 5.11325   -22.33663 1.000 40.33855  ? 146 VAL D CB  1 
ATOM   9157  C  CG1 . VAL D 2 146 ? -12.89531 6.26080   -21.49240 1.000 39.77102  ? 146 VAL D CG1 1 
ATOM   9158  C  CG2 . VAL D 2 146 ? -11.90769 5.59024   -23.70802 1.000 34.13883  ? 146 VAL D CG2 1 
ATOM   9159  N  N   . MET D 2 147 ? -9.93223  5.30457   -19.76296 1.000 28.41532  ? 147 MET D N   1 
ATOM   9160  C  CA  . MET D 2 147 ? -8.78573  6.01715   -19.21372 1.000 32.92102  ? 147 MET D CA  1 
ATOM   9161  C  C   . MET D 2 147 ? -7.50684  5.19219   -19.27437 1.000 32.83510  ? 147 MET D C   1 
ATOM   9162  O  O   . MET D 2 147 ? -6.41387  5.75116   -19.13878 1.000 33.31132  ? 147 MET D O   1 
ATOM   9163  C  CB  . MET D 2 147 ? -9.05088  6.43170   -17.76228 1.000 33.35557  ? 147 MET D CB  1 
ATOM   9164  C  CG  . MET D 2 147 ? -10.20475 7.39581   -17.56057 1.000 30.62825  ? 147 MET D CG  1 
ATOM   9165  S  SD  . MET D 2 147 ? -9.95482  8.99477   -18.36430 1.000 40.32355  ? 147 MET D SD  1 
ATOM   9166  C  CE  . MET D 2 147 ? -10.96530 8.79274   -19.83561 1.000 38.71093  ? 147 MET D CE  1 
ATOM   9167  N  N   . ILE D 2 148 ? -7.62159  3.88789   -19.49667 1.000 33.16502  ? 148 ILE D N   1 
ATOM   9168  C  CA  . ILE D 2 148 ? -6.48852  2.96493   -19.53205 1.000 35.69386  ? 148 ILE D CA  1 
ATOM   9169  C  C   . ILE D 2 148 ? -5.63746  3.09976   -20.79560 1.000 37.14584  ? 148 ILE D C   1 
ATOM   9170  O  O   . ILE D 2 148 ? -4.40312  3.07446   -20.68801 1.000 36.64682  ? 148 ILE D O   1 
ATOM   9171  C  CB  . ILE D 2 148 ? -6.98289  1.52193   -19.35982 1.000 32.92062  ? 148 ILE D CB  1 
ATOM   9172  C  CG1 . ILE D 2 148 ? -7.77183  1.40903   -18.05321 1.000 28.66020  ? 148 ILE D CG1 1 
ATOM   9173  C  CG2 . ILE D 2 148 ? -5.81419  0.54486   -19.39596 1.000 32.71908  ? 148 ILE D CG2 1 
ATOM   9174  C  CD1 . ILE D 2 148 ? -8.37840  0.05310   -17.82047 1.000 34.48429  ? 148 ILE D CD1 1 
ATOM   9175  N  N   . PRO D 2 149 ? -6.21621  3.20917   -22.00294 1.000 36.40417  ? 149 PRO D N   1 
ATOM   9176  C  CA  . PRO D 2 149 ? -5.37484  3.21647   -23.21510 1.000 30.26649  ? 149 PRO D CA  1 
ATOM   9177  C  C   . PRO D 2 149 ? -4.26173  4.25066   -23.22839 1.000 31.83071  ? 149 PRO D C   1 
ATOM   9178  O  O   . PRO D 2 149 ? -3.22510  4.01823   -23.86451 1.000 31.66864  ? 149 PRO D O   1 
ATOM   9179  C  CB  . PRO D 2 149 ? -6.39352  3.48985   -24.32740 1.000 33.17671  ? 149 PRO D CB  1 
ATOM   9180  C  CG  . PRO D 2 149 ? -7.63011  2.87361   -23.82815 1.000 31.65830  ? 149 PRO D CG  1 
ATOM   9181  C  CD  . PRO D 2 149 ? -7.64777  3.16917   -22.36057 1.000 34.11344  ? 149 PRO D CD  1 
ATOM   9182  N  N   . ASP D 2 150 ? -4.43914  5.39175   -22.56727 1.000 30.32229  ? 150 ASP D N   1 
ATOM   9183  C  CA  . ASP D 2 150 ? -3.46856  6.47174   -22.68050 1.000 31.14258  ? 150 ASP D CA  1 
ATOM   9184  C  C   . ASP D 2 150 ? -3.14495  7.09508   -21.32779 1.000 37.36974  ? 150 ASP D C   1 
ATOM   9185  O  O   . ASP D 2 150 ? -1.97694  7.15454   -20.93334 1.000 34.34015  ? 150 ASP D O   1 
ATOM   9186  C  CB  . ASP D 2 150 ? -3.98119  7.54134   -23.64532 1.000 32.99220  ? 150 ASP D CB  1 
ATOM   9187  C  CG  . ASP D 2 150 ? -2.92444  8.56309   -23.99588 1.000 40.60904  ? 150 ASP D CG  1 
ATOM   9188  O  OD1 . ASP D 2 150 ? -1.76076  8.38524   -23.58553 1.000 45.48829  ? 150 ASP D OD1 1 
ATOM   9189  O  OD2 . ASP D 2 150 ? -3.25982  9.54951   -24.67952 1.000 45.33532  ? 150 ASP D OD2 1 
ATOM   9190  N  N   . MET D 2 151 ? -4.16647  7.57754   -20.61902 1.000 36.15639  ? 151 MET D N   1 
ATOM   9191  C  CA  . MET D 2 151 ? -3.92219  8.33026   -19.39281 1.000 35.40603  ? 151 MET D CA  1 
ATOM   9192  C  C   . MET D 2 151 ? -3.22482  7.47613   -18.34260 1.000 33.39381  ? 151 MET D C   1 
ATOM   9193  O  O   . MET D 2 151 ? -2.20333  7.88172   -17.77614 1.000 34.20800  ? 151 MET D O   1 
ATOM   9194  C  CB  . MET D 2 151 ? -5.23990  8.88001   -18.84879 1.000 39.88830  ? 151 MET D CB  1 
ATOM   9195  C  CG  . MET D 2 151 ? -5.99029  9.77997   -19.81714 1.000 33.50899  ? 151 MET D CG  1 
ATOM   9196  S  SD  . MET D 2 151 ? -5.10018  11.30658  -20.17652 1.000 42.80447  ? 151 MET D SD  1 
ATOM   9197  C  CE  . MET D 2 151 ? -4.34637  10.93078  -21.76050 1.000 36.97565  ? 151 MET D CE  1 
ATOM   9198  N  N   . MET D 2 152 ? -3.75749  6.28519   -18.07155 1.000 35.08698  ? 152 MET D N   1 
ATOM   9199  C  CA  . MET D 2 152 ? -3.19073  5.45750   -17.01222 1.000 33.35456  ? 152 MET D CA  1 
ATOM   9200  C  C   . MET D 2 152 ? -1.80684  4.93722   -17.38867 1.000 38.49407  ? 152 MET D C   1 
ATOM   9201  O  O   . MET D 2 152 ? -0.86800  5.00626   -16.58424 1.000 31.05966  ? 152 MET D O   1 
ATOM   9202  C  CB  . MET D 2 152 ? -4.13315  4.30576   -16.68709 1.000 33.83054  ? 152 MET D CB  1 
ATOM   9203  C  CG  . MET D 2 152 ? -3.67201  3.48244   -15.51149 1.000 36.07188  ? 152 MET D CG  1 
ATOM   9204  S  SD  . MET D 2 152 ? -4.87132  2.22596   -15.05573 1.000 43.57230  ? 152 MET D SD  1 
ATOM   9205  C  CE  . MET D 2 152 ? -6.29926  3.25140   -14.80585 1.000 37.78154  ? 152 MET D CE  1 
ATOM   9206  N  N   . THR D 2 153 ? -1.65311  4.42415   -18.61434 1.000 32.61003  ? 153 THR D N   1 
ATOM   9207  C  CA  . THR D 2 153 ? -0.36074  3.87289   -19.01022 1.000 31.85085  ? 153 THR D CA  1 
ATOM   9208  C  C   . THR D 2 153 ? 0.71351   4.95133   -19.08971 1.000 27.97974  ? 153 THR D C   1 
ATOM   9209  O  O   . THR D 2 153 ? 1.87806   4.67486   -18.78972 1.000 31.76643  ? 153 THR D O   1 
ATOM   9210  C  CB  . THR D 2 153 ? -0.47704  3.12758   -20.34491 1.000 30.93374  ? 153 THR D CB  1 
ATOM   9211  O  OG1 . THR D 2 153 ? 0.81013   2.62238   -20.72613 1.000 32.79089  ? 153 THR D OG1 1 
ATOM   9212  C  CG2 . THR D 2 153 ? -1.00155  4.04366   -21.44160 1.000 32.25020  ? 153 THR D CG2 1 
ATOM   9213  N  N   . THR D 2 154 ? 0.34953   6.18171   -19.46400 1.000 30.63353  ? 154 THR D N   1 
ATOM   9214  C  CA  . THR D 2 154 ? 1.32865   7.26627   -19.48171 1.000 33.92084  ? 154 THR D CA  1 
ATOM   9215  C  C   . THR D 2 154 ? 1.69217   7.69637   -18.06784 1.000 32.67746  ? 154 THR D C   1 
ATOM   9216  O  O   . THR D 2 154 ? 2.87459   7.79370   -17.72176 1.000 30.66959  ? 154 THR D O   1 
ATOM   9217  C  CB  . THR D 2 154 ? 0.79819   8.46739   -20.26201 1.000 35.18753  ? 154 THR D CB  1 
ATOM   9218  O  OG1 . THR D 2 154 ? 0.41869   8.06045   -21.57849 1.000 38.19985  ? 154 THR D OG1 1 
ATOM   9219  C  CG2 . THR D 2 154 ? 1.86516   9.54148   -20.35799 1.000 41.74770  ? 154 THR D CG2 1 
ATOM   9220  N  N   . GLY D 2 155 ? 0.68401   7.98730   -17.24353 1.000 35.72365  ? 155 GLY D N   1 
ATOM   9221  C  CA  . GLY D 2 155 ? 0.96294   8.41743   -15.88477 1.000 32.19058  ? 155 GLY D CA  1 
ATOM   9222  C  C   . GLY D 2 155 ? 1.73178   7.37446   -15.09867 1.000 30.89582  ? 155 GLY D C   1 
ATOM   9223  O  O   . GLY D 2 155 ? 2.70575   7.69445   -14.41343 1.000 32.56990  ? 155 GLY D O   1 
ATOM   9224  N  N   . PHE D 2 156 ? 1.32731   6.10790   -15.21448 1.000 30.79564  ? 156 PHE D N   1 
ATOM   9225  C  CA  . PHE D 2 156 ? 2.05349   5.04088   -14.53475 1.000 29.49413  ? 156 PHE D CA  1 
ATOM   9226  C  C   . PHE D 2 156 ? 3.46120   4.88621   -15.08667 1.000 30.02175  ? 156 PHE D C   1 
ATOM   9227  O  O   . PHE D 2 156 ? 4.37857   4.51322   -14.34677 1.000 35.77557  ? 156 PHE D O   1 
ATOM   9228  C  CB  . PHE D 2 156 ? 1.29232   3.71959   -14.64349 1.000 26.70918  ? 156 PHE D CB  1 
ATOM   9229  C  CG  . PHE D 2 156 ? 0.04951   3.65695   -13.79193 1.000 31.48600  ? 156 PHE D CG  1 
ATOM   9230  C  CD1 . PHE D 2 156 ? -0.42025  4.78049   -13.13070 1.000 32.31336  ? 156 PHE D CD1 1 
ATOM   9231  C  CD2 . PHE D 2 156 ? -0.63499  2.46622   -13.63970 1.000 29.79145  ? 156 PHE D CD2 1 
ATOM   9232  C  CE1 . PHE D 2 156 ? -1.55568  4.71877   -12.34644 1.000 38.31426  ? 156 PHE D CE1 1 
ATOM   9233  C  CE2 . PHE D 2 156 ? -1.77253  2.39624   -12.85682 1.000 39.01902  ? 156 PHE D CE2 1 
ATOM   9234  C  CZ  . PHE D 2 156 ? -2.23383  3.52644   -12.20885 1.000 38.32568  ? 156 PHE D CZ  1 
ATOM   9235  N  N   . HIS D 2 157 ? 3.65732   5.17177   -16.37427 1.000 31.80604  ? 157 HIS D N   1 
ATOM   9236  C  CA  . HIS D 2 157 ? 4.99876   5.09161   -16.93750 1.000 29.48639  ? 157 HIS D CA  1 
ATOM   9237  C  C   . HIS D 2 157 ? 5.91303   6.13658   -16.31723 1.000 28.65667  ? 157 HIS D C   1 
ATOM   9238  O  O   . HIS D 2 157 ? 7.09801   5.87482   -16.08935 1.000 31.48449  ? 157 HIS D O   1 
ATOM   9239  C  CB  . HIS D 2 157 ? 4.94958   5.26221   -18.44940 1.000 25.92333  ? 157 HIS D CB  1 
ATOM   9240  C  CG  . HIS D 2 157 ? 6.22156   4.88276   -19.13594 1.000 27.80831  ? 157 HIS D CG  1 
ATOM   9241  N  ND1 . HIS D 2 157 ? 6.89499   3.71303   -18.85647 1.000 31.70465  ? 157 HIS D ND1 1 
ATOM   9242  C  CD2 . HIS D 2 157 ? 6.94528   5.51657   -20.08784 1.000 24.82562  ? 157 HIS D CD2 1 
ATOM   9243  C  CE1 . HIS D 2 157 ? 7.97632   3.63857   -19.61288 1.000 23.58531  ? 157 HIS D CE1 1 
ATOM   9244  N  NE2 . HIS D 2 157 ? 8.03139   4.72197   -20.36616 1.000 34.02901  ? 157 HIS D NE2 1 
ATOM   9245  N  N   . GLY D 2 158 ? 5.38419   7.32884   -16.04584 1.000 30.33919  ? 158 GLY D N   1 
ATOM   9246  C  CA  . GLY D 2 158 ? 6.17284   8.32027   -15.33830 1.000 30.40658  ? 158 GLY D CA  1 
ATOM   9247  C  C   . GLY D 2 158 ? 6.62894   7.82296   -13.98136 1.000 26.21671  ? 158 GLY D C   1 
ATOM   9248  O  O   . GLY D 2 158 ? 7.77583   8.03440   -13.58543 1.000 30.47251  ? 158 GLY D O   1 
ATOM   9249  N  N   . ALA D 2 159 ? 5.73802   7.14900   -13.25227 1.000 30.40438  ? 159 ALA D N   1 
ATOM   9250  C  CA  . ALA D 2 159 ? 6.12435   6.57880   -11.96582 1.000 33.56156  ? 159 ALA D CA  1 
ATOM   9251  C  C   . ALA D 2 159 ? 7.13300   5.44739   -12.13745 1.000 32.23530  ? 159 ALA D C   1 
ATOM   9252  O  O   . ALA D 2 159 ? 8.05900   5.31093   -11.32876 1.000 35.54581  ? 159 ALA D O   1 
ATOM   9253  C  CB  . ALA D 2 159 ? 4.88730   6.08995   -11.21880 1.000 28.08190  ? 159 ALA D CB  1 
ATOM   9254  N  N   . GLU D 2 160 ? 6.97093   4.62372   -13.18045 1.000 29.96584  ? 160 GLU D N   1 
ATOM   9255  C  CA  . GLU D 2 160 ? 7.93921   3.55955   -13.43919 1.000 27.41415  ? 160 GLU D CA  1 
ATOM   9256  C  C   . GLU D 2 160 ? 9.30452   4.13220   -13.78261 1.000 28.74416  ? 160 GLU D C   1 
ATOM   9257  O  O   . GLU D 2 160 ? 10.33085  3.66344   -13.27602 1.000 32.81154  ? 160 GLU D O   1 
ATOM   9258  C  CB  . GLU D 2 160 ? 7.45589   2.66262   -14.57732 1.000 27.58787  ? 160 GLU D CB  1 
ATOM   9259  C  CG  . GLU D 2 160 ? 6.22614   1.84036   -14.26884 1.000 40.29471  ? 160 GLU D CG  1 
ATOM   9260  C  CD  . GLU D 2 160 ? 5.64923   1.19296   -15.51456 1.000 39.33863  ? 160 GLU D CD  1 
ATOM   9261  O  OE1 . GLU D 2 160 ? 5.75653   1.79964   -16.60638 1.000 39.70970  ? 160 GLU D OE1 1 
ATOM   9262  O  OE2 . GLU D 2 160 ? 5.10455   0.07395   -15.40600 1.000 46.09873  ? 160 GLU D OE2 1 
ATOM   9263  N  N   . LEU D 2 161 ? 9.33730   5.15089   -14.64342 1.000 28.65194  ? 161 LEU D N   1 
ATOM   9264  C  CA  . LEU D 2 161 ? 10.60798  5.75033   -15.03004 1.000 23.79861  ? 161 LEU D CA  1 
ATOM   9265  C  C   . LEU D 2 161 ? 11.30419  6.39817   -13.84508 1.000 25.99404  ? 161 LEU D C   1 
ATOM   9266  O  O   . LEU D 2 161 ? 12.53283  6.50381   -13.83186 1.000 32.85502  ? 161 LEU D O   1 
ATOM   9267  C  CB  . LEU D 2 161 ? 10.38605  6.78719   -16.13239 1.000 29.61848  ? 161 LEU D CB  1 
ATOM   9268  C  CG  . LEU D 2 161 ? 9.95581   6.29590   -17.51567 1.000 35.05817  ? 161 LEU D CG  1 
ATOM   9269  C  CD1 . LEU D 2 161 ? 9.61373   7.47971   -18.40255 1.000 32.06969  ? 161 LEU D CD1 1 
ATOM   9270  C  CD2 . LEU D 2 161 ? 11.06035  5.46650   -18.13917 1.000 32.27411  ? 161 LEU D CD2 1 
ATOM   9271  N  N   . ALA D 2 162 ? 10.54207  6.81630   -12.83477 1.000 30.55648  ? 162 ALA D N   1 
ATOM   9272  C  CA  . ALA D 2 162 ? 11.09692  7.57932   -11.72502 1.000 31.87863  ? 162 ALA D CA  1 
ATOM   9273  C  C   . ALA D 2 162 ? 12.01175  6.76393   -10.81895 1.000 31.09763  ? 162 ALA D C   1 
ATOM   9274  O  O   . ALA D 2 162 ? 12.74917  7.36431   -10.03045 1.000 38.95854  ? 162 ALA D O   1 
ATOM   9275  C  CB  . ALA D 2 162 ? 9.96022   8.18701   -10.89988 1.000 27.74161  ? 162 ALA D CB  1 
ATOM   9276  N  N   . ASP D 2 163 ? 11.98987  5.43395   -10.90431 1.000 35.39207  ? 163 ASP D N   1 
ATOM   9277  C  CA  . ASP D 2 163 ? 12.82145  4.57529   -10.05728 1.000 38.72295  ? 163 ASP D CA  1 
ATOM   9278  C  C   . ASP D 2 163 ? 12.60607  4.90267   -8.57998  1.000 43.44104  ? 163 ASP D C   1 
ATOM   9279  O  O   . ASP D 2 163 ? 13.53140  5.24527   -7.84115  1.000 42.39660  ? 163 ASP D O   1 
ATOM   9280  C  CB  . ASP D 2 163 ? 14.30164  4.69391   -10.42856 1.000 39.07145  ? 163 ASP D CB  1 
ATOM   9281  C  CG  . ASP D 2 163 ? 14.61453  4.08024   -11.76869 1.000 53.94810  ? 163 ASP D CG  1 
ATOM   9282  O  OD1 . ASP D 2 163 ? 13.87294  3.16260   -12.18511 1.000 64.17803  ? 163 ASP D OD1 1 
ATOM   9283  O  OD2 . ASP D 2 163 ? 15.60087  4.51627   -12.40368 1.000 57.75479  ? 163 ASP D OD2 1 
ATOM   9284  N  N   . ILE D 2 164 ? 11.35185  4.78969   -8.16617  1.000 36.90162  ? 164 ILE D N   1 
ATOM   9285  C  CA  . ILE D 2 164 ? 10.93955  5.14978   -6.81549  1.000 32.72939  ? 164 ILE D CA  1 
ATOM   9286  C  C   . ILE D 2 164 ? 11.28881  4.01813   -5.86127  1.000 40.13981  ? 164 ILE D C   1 
ATOM   9287  O  O   . ILE D 2 164 ? 10.89336  2.86506   -6.07185  1.000 45.21758  ? 164 ILE D O   1 
ATOM   9288  C  CB  . ILE D 2 164 ? 9.43370   5.45334   -6.78144  1.000 36.04407  ? 164 ILE D CB  1 
ATOM   9289  C  CG1 . ILE D 2 164 ? 9.11907   6.64780   -7.68072  1.000 35.94697  ? 164 ILE D CG1 1 
ATOM   9290  C  CG2 . ILE D 2 164 ? 8.94921   5.67150   -5.35624  1.000 36.36883  ? 164 ILE D CG2 1 
ATOM   9291  C  CD1 . ILE D 2 164 ? 7.64680   6.85565   -7.91638  1.000 32.84786  ? 164 ILE D CD1 1 
ATOM   9292  N  N   . GLU D 2 165 ? 12.02936  4.34506   -4.81025  1.000 36.91749  ? 165 GLU D N   1 
ATOM   9293  C  CA  . GLU D 2 165 ? 12.27129  3.42163   -3.71506  1.000 38.19540  ? 165 GLU D CA  1 
ATOM   9294  C  C   . GLU D 2 165 ? 11.18413  3.57741   -2.65392  1.000 38.98655  ? 165 GLU D C   1 
ATOM   9295  O  O   . GLU D 2 165 ? 10.52017  4.61207   -2.56054  1.000 43.83976  ? 165 GLU D O   1 
ATOM   9296  C  CB  . GLU D 2 165 ? 13.65446  3.66483   -3.11496  1.000 43.81184  ? 165 GLU D CB  1 
ATOM   9297  C  CG  . GLU D 2 165 ? 14.77919  3.51895   -4.12727  1.000 53.29811  ? 165 GLU D CG  1 
ATOM   9298  C  CD  . GLU D 2 165 ? 16.09379  4.08093   -3.62921  1.000 80.93157  ? 165 GLU D CD  1 
ATOM   9299  O  OE1 . GLU D 2 165 ? 16.08825  4.77411   -2.58873  1.000 82.63022  ? 165 GLU D OE1 1 
ATOM   9300  O  OE2 . GLU D 2 165 ? 17.13231  3.83093   -4.27968  1.000 87.82665  ? 165 GLU D OE2 1 
ATOM   9301  N  N   . LEU D 2 166 ? 11.00022  2.52473   -1.85705  1.000 43.43561  ? 166 LEU D N   1 
ATOM   9302  C  CA  . LEU D 2 166 ? 9.93531   2.51474   -0.85809  1.000 42.26803  ? 166 LEU D CA  1 
ATOM   9303  C  C   . LEU D 2 166 ? 10.08772  3.67159   0.11920   1.000 43.10029  ? 166 LEU D C   1 
ATOM   9304  O  O   . LEU D 2 166 ? 11.14083  3.84506   0.73922   1.000 41.12035  ? 166 LEU D O   1 
ATOM   9305  C  CB  . LEU D 2 166 ? 9.93051   1.19053   -0.09540  1.000 44.36234  ? 166 LEU D CB  1 
ATOM   9306  C  CG  . LEU D 2 166 ? 9.40385   -0.02809  -0.84673  1.000 41.26769  ? 166 LEU D CG  1 
ATOM   9307  C  CD1 . LEU D 2 166 ? 9.38700   -1.24617  0.06216   1.000 39.54178  ? 166 LEU D CD1 1 
ATOM   9308  C  CD2 . LEU D 2 166 ? 8.02038   0.25735   -1.40114  1.000 39.75781  ? 166 LEU D CD2 1 
ATOM   9309  N  N   . GLY D 2 167 ? 9.02586   4.46332   0.25414   1.000 42.99712  ? 167 GLY D N   1 
ATOM   9310  C  CA  . GLY D 2 167 ? 9.02832   5.59586   1.15060   1.000 36.22867  ? 167 GLY D CA  1 
ATOM   9311  C  C   . GLY D 2 167 ? 9.60912   6.86901   0.57937   1.000 41.16889  ? 167 GLY D C   1 
ATOM   9312  O  O   . GLY D 2 167 ? 9.67279   7.87383   1.29753   1.000 42.99433  ? 167 GLY D O   1 
ATOM   9313  N  N   . ALA D 2 168 ? 10.02324  6.86927   -0.68471  1.000 40.26501  ? 168 ALA D N   1 
ATOM   9314  C  CA  . ALA D 2 168 ? 10.66006  8.04277   -1.25918  1.000 35.42598  ? 168 ALA D CA  1 
ATOM   9315  C  C   . ALA D 2 168 ? 9.66523   9.18855   -1.42197  1.000 28.59988  ? 168 ALA D C   1 
ATOM   9316  O  O   . ALA D 2 168 ? 8.45047   8.99395   -1.50131  1.000 33.63886  ? 168 ALA D O   1 
ATOM   9317  C  CB  . ALA D 2 168 ? 11.28673  7.70657   -2.61129  1.000 40.38292  ? 168 ALA D CB  1 
ATOM   9318  N  N   . THR D 2 169 ? 10.20853  10.40144  -1.47685  1.000 34.45110  ? 169 THR D N   1 
ATOM   9319  C  CA  . THR D 2 169 ? 9.42103   11.61076  -1.68065  1.000 38.04851  ? 169 THR D CA  1 
ATOM   9320  C  C   . THR D 2 169 ? 9.40224   11.93433  -3.16958  1.000 33.98204  ? 169 THR D C   1 
ATOM   9321  O  O   . THR D 2 169 ? 10.45990  12.05512  -3.79579  1.000 37.88756  ? 169 THR D O   1 
ATOM   9322  C  CB  . THR D 2 169 ? 10.00585  12.77181  -0.87656  1.000 38.15454  ? 169 THR D CB  1 
ATOM   9323  O  OG1 . THR D 2 169 ? 9.90138   12.48038  0.52330   1.000 44.23124  ? 169 THR D OG1 1 
ATOM   9324  C  CG2 . THR D 2 169 ? 9.26564   14.07064  -1.18031  1.000 44.36282  ? 169 THR D CG2 1 
ATOM   9325  N  N   . VAL D 2 170 ? 8.20515   12.06007  -3.73644  1.000 35.56728  ? 170 VAL D N   1 
ATOM   9326  C  CA  . VAL D 2 170 ? 8.02690   12.22838  -5.17323  1.000 32.56087  ? 170 VAL D CA  1 
ATOM   9327  C  C   . VAL D 2 170 ? 7.26755   13.52054  -5.42439  1.000 41.19782  ? 170 VAL D C   1 
ATOM   9328  O  O   . VAL D 2 170 ? 6.24546   13.78123  -4.77952  1.000 37.34413  ? 170 VAL D O   1 
ATOM   9329  C  CB  . VAL D 2 170 ? 7.27915   11.03556  -5.79553  1.000 34.42255  ? 170 VAL D CB  1 
ATOM   9330  C  CG1 . VAL D 2 170 ? 7.06158   11.26482  -7.28075  1.000 36.69708  ? 170 VAL D CG1 1 
ATOM   9331  C  CG2 . VAL D 2 170 ? 8.04481   9.75026   -5.56058  1.000 30.96090  ? 170 VAL D CG2 1 
ATOM   9332  N  N   . ALA D 2 171 ? 7.75739   14.31937  -6.36753  1.000 35.37340  ? 171 ALA D N   1 
ATOM   9333  C  CA  . ALA D 2 171 ? 7.04139   15.49242  -6.84133  1.000 39.67097  ? 171 ALA D CA  1 
ATOM   9334  C  C   . ALA D 2 171 ? 6.46649   15.19167  -8.21642  1.000 36.75882  ? 171 ALA D C   1 
ATOM   9335  O  O   . ALA D 2 171 ? 7.13149   14.57417  -9.05403  1.000 36.22912  ? 171 ALA D O   1 
ATOM   9336  C  CB  . ALA D 2 171 ? 7.95301   16.71867  -6.90620  1.000 29.67586  ? 171 ALA D CB  1 
ATOM   9337  N  N   . VAL D 2 172 ? 5.22010   15.59946  -8.43526  1.000 38.43299  ? 172 VAL D N   1 
ATOM   9338  C  CA  . VAL D 2 172 ? 4.55015   15.43210  -9.72087  1.000 35.30835  ? 172 VAL D CA  1 
ATOM   9339  C  C   . VAL D 2 172 ? 4.24661   16.82384  -10.25592 1.000 30.70971  ? 172 VAL D C   1 
ATOM   9340  O  O   . VAL D 2 172 ? 3.40404   17.54234  -9.70228  1.000 38.20771  ? 172 VAL D O   1 
ATOM   9341  C  CB  . VAL D 2 172 ? 3.27775   14.58570  -9.60672  1.000 34.45217  ? 172 VAL D CB  1 
ATOM   9342  C  CG1 . VAL D 2 172 ? 2.61760   14.43989  -10.96831 1.000 33.11199  ? 172 VAL D CG1 1 
ATOM   9343  C  CG2 . VAL D 2 172 ? 3.60959   13.21870  -9.02460  1.000 31.43119  ? 172 VAL D CG2 1 
ATOM   9344  N  N   . LEU D 2 173 ? 4.93801   17.20819  -11.32643 1.000 39.14383  ? 173 LEU D N   1 
ATOM   9345  C  CA  . LEU D 2 173 ? 4.81694   18.54550  -11.90079 1.000 36.41850  ? 173 LEU D CA  1 
ATOM   9346  C  C   . LEU D 2 173 ? 3.72312   18.50874  -12.95835 1.000 39.73018  ? 173 LEU D C   1 
ATOM   9347  O  O   . LEU D 2 173 ? 3.92395   17.99914  -14.06438 1.000 42.95114  ? 173 LEU D O   1 
ATOM   9348  C  CB  . LEU D 2 173 ? 6.15134   19.00400  -12.47744 1.000 34.80211  ? 173 LEU D CB  1 
ATOM   9349  C  CG  . LEU D 2 173 ? 7.33868   18.93435  -11.51614 1.000 32.24767  ? 173 LEU D CG  1 
ATOM   9350  C  CD1 . LEU D 2 173 ? 8.60771   19.39570  -12.19745 1.000 35.24277  ? 173 LEU D CD1 1 
ATOM   9351  C  CD2 . LEU D 2 173 ? 7.06545   19.78350  -10.28578 1.000 38.21291  ? 173 LEU D CD2 1 
ATOM   9352  N  N   . GLY D 2 174 ? 2.56311   19.06027  -12.61589 1.000 45.42237  ? 174 GLY D N   1 
ATOM   9353  C  CA  . GLY D 2 174 ? 1.41009   19.03118  -13.48907 1.000 44.19417  ? 174 GLY D CA  1 
ATOM   9354  C  C   . GLY D 2 174 ? 0.42392   17.96117  -13.07823 1.000 43.74942  ? 174 GLY D C   1 
ATOM   9355  O  O   . GLY D 2 174 ? 0.78031   16.78171  -12.99153 1.000 43.27180  ? 174 GLY D O   1 
ATOM   9356  N  N   . ILE D 2 175 ? -0.82128  18.35310  -12.81572 1.000 45.90322  ? 175 ILE D N   1 
ATOM   9357  C  CA  . ILE D 2 175 ? -1.82729  17.38721  -12.39066 1.000 48.97608  ? 175 ILE D CA  1 
ATOM   9358  C  C   . ILE D 2 175 ? -3.03260  17.43632  -13.31963 1.000 47.15505  ? 175 ILE D C   1 
ATOM   9359  O  O   . ILE D 2 175 ? -4.18243  17.48325  -12.86607 1.000 44.84570  ? 175 ILE D O   1 
ATOM   9360  C  CB  . ILE D 2 175 ? -2.24336  17.60273  -10.92313 1.000 46.73835  ? 175 ILE D CB  1 
ATOM   9361  C  CG1 . ILE D 2 175 ? -2.53748  19.07482  -10.64506 1.000 47.90935  ? 175 ILE D CG1 1 
ATOM   9362  C  CG2 . ILE D 2 175 ? -1.17235  17.07436  -9.98795  1.000 47.37884  ? 175 ILE D CG2 1 
ATOM   9363  C  CD1 . ILE D 2 175 ? -3.07343  19.31713  -9.25683  1.000 46.12797  ? 175 ILE D CD1 1 
ATOM   9364  N  N   . GLY D 2 176 ? -2.77627  17.43044  -14.62664 1.000 46.48917  ? 176 GLY D N   1 
ATOM   9365  C  CA  . GLY D 2 176 ? -3.79063  17.08085  -15.59089 1.000 37.47585  ? 176 GLY D CA  1 
ATOM   9366  C  C   . GLY D 2 176 ? -4.06308  15.59471  -15.48000 1.000 41.26019  ? 176 GLY D C   1 
ATOM   9367  O  O   . GLY D 2 176 ? -3.55192  14.92462  -14.57675 1.000 39.89489  ? 176 GLY D O   1 
ATOM   9368  N  N   . PRO D 2 177 ? -4.86139  15.04029  -16.39530 1.000 45.57800  ? 177 PRO D N   1 
ATOM   9369  C  CA  . PRO D 2 177 ? -5.16431  13.60103  -16.30932 1.000 35.43180  ? 177 PRO D CA  1 
ATOM   9370  C  C   . PRO D 2 177 ? -3.92557  12.71617  -16.24140 1.000 32.79287  ? 177 PRO D C   1 
ATOM   9371  O  O   . PRO D 2 177 ? -3.89088  11.77289  -15.44135 1.000 37.87719  ? 177 PRO D O   1 
ATOM   9372  C  CB  . PRO D 2 177 ? -5.97696  13.34111  -17.58501 1.000 34.83575  ? 177 PRO D CB  1 
ATOM   9373  C  CG  . PRO D 2 177 ? -6.50707  14.65680  -17.99140 1.000 52.88220  ? 177 PRO D CG  1 
ATOM   9374  C  CD  . PRO D 2 177 ? -5.52092  15.68553  -17.54277 1.000 42.55038  ? 177 PRO D CD  1 
ATOM   9375  N  N   . VAL D 2 178 ? -2.89146  13.01631  -17.02982 1.000 33.44659  ? 178 VAL D N   1 
ATOM   9376  C  CA  . VAL D 2 178 ? -1.66093  12.23153  -16.96954 1.000 39.75610  ? 178 VAL D CA  1 
ATOM   9377  C  C   . VAL D 2 178 ? -0.97918  12.41222  -15.62026 1.000 38.89004  ? 178 VAL D C   1 
ATOM   9378  O  O   . VAL D 2 178 ? -0.52240  11.44135  -15.00355 1.000 35.20862  ? 178 VAL D O   1 
ATOM   9379  C  CB  . VAL D 2 178 ? -0.72564  12.61124  -18.13113 1.000 36.97473  ? 178 VAL D CB  1 
ATOM   9380  C  CG1 . VAL D 2 178 ? 0.65374   11.99933  -17.92248 1.000 35.65247  ? 178 VAL D CG1 1 
ATOM   9381  C  CG2 . VAL D 2 178 ? -1.31473  12.15262  -19.45250 1.000 32.46748  ? 178 VAL D CG2 1 
ATOM   9382  N  N   . GLY D 2 179 ? -0.90018  13.65370  -15.13964 1.000 37.62186  ? 179 GLY D N   1 
ATOM   9383  C  CA  . GLY D 2 179 ? -0.27494  13.89513  -13.85117 1.000 35.49062  ? 179 GLY D CA  1 
ATOM   9384  C  C   . GLY D 2 179 ? -1.02378  13.24569  -12.70513 1.000 36.92484  ? 179 GLY D C   1 
ATOM   9385  O  O   . GLY D 2 179 ? -0.41366  12.77333  -11.74216 1.000 38.57509  ? 179 GLY D O   1 
ATOM   9386  N  N   . LEU D 2 180 ? -2.35625  13.21511  -12.78944 1.000 38.26472  ? 180 LEU D N   1 
ATOM   9387  C  CA  . LEU D 2 180 ? -3.14147  12.55661  -11.75198 1.000 34.62432  ? 180 LEU D CA  1 
ATOM   9388  C  C   . LEU D 2 180 ? -2.85781  11.06109  -11.71549 1.000 35.81576  ? 180 LEU D C   1 
ATOM   9389  O  O   . LEU D 2 180 ? -2.85258  10.44915  -10.64140 1.000 36.38181  ? 180 LEU D O   1 
ATOM   9390  C  CB  . LEU D 2 180 ? -4.63092  12.82526  -11.96446 1.000 32.16548  ? 180 LEU D CB  1 
ATOM   9391  C  CG  . LEU D 2 180 ? -5.04583  14.28606  -11.78579 1.000 47.37180  ? 180 LEU D CG  1 
ATOM   9392  C  CD1 . LEU D 2 180 ? -6.50516  14.50110  -12.15902 1.000 39.24718  ? 180 LEU D CD1 1 
ATOM   9393  C  CD2 . LEU D 2 180 ? -4.78072  14.73959  -10.35923 1.000 36.81270  ? 180 LEU D CD2 1 
ATOM   9394  N  N   . MET D 2 181 ? -2.63572  10.44799  -12.87884 1.000 38.36098  ? 181 MET D N   1 
ATOM   9395  C  CA  . MET D 2 181 ? -2.24206  9.04440   -12.89505 1.000 37.17600  ? 181 MET D CA  1 
ATOM   9396  C  C   . MET D 2 181 ? -0.78813  8.85396   -12.47976 1.000 39.98677  ? 181 MET D C   1 
ATOM   9397  O  O   . MET D 2 181 ? -0.42495  7.77830   -11.98915 1.000 34.05856  ? 181 MET D O   1 
ATOM   9398  C  CB  . MET D 2 181 ? -2.49898  8.43965   -14.27486 1.000 35.14778  ? 181 MET D CB  1 
ATOM   9399  C  CG  . MET D 2 181 ? -3.98016  8.23276   -14.58015 1.000 35.43827  ? 181 MET D CG  1 
ATOM   9400  S  SD  . MET D 2 181 ? -4.75434  6.98534   -13.52350 1.000 38.92349  ? 181 MET D SD  1 
ATOM   9401  C  CE  . MET D 2 181 ? -5.50699  7.98215   -12.24444 1.000 34.49546  ? 181 MET D CE  1 
ATOM   9402  N  N   . ALA D 2 182 ? 0.05715   9.86995   -12.67127 1.000 31.57862  ? 182 ALA D N   1 
ATOM   9403  C  CA  . ALA D 2 182 ? 1.41020   9.79587   -12.13270 1.000 31.18891  ? 182 ALA D CA  1 
ATOM   9404  C  C   . ALA D 2 182 ? 1.38403   9.81089   -10.61002 1.000 39.37719  ? 182 ALA D C   1 
ATOM   9405  O  O   . ALA D 2 182 ? 2.17934   9.11988   -9.96169  1.000 35.41042  ? 182 ALA D O   1 
ATOM   9406  C  CB  . ALA D 2 182 ? 2.25966   10.94813  -12.67096 1.000 24.31738  ? 182 ALA D CB  1 
ATOM   9407  N  N   . VAL D 2 183 ? 0.46623   10.58642  -10.02463 1.000 40.70902  ? 183 VAL D N   1 
ATOM   9408  C  CA  . VAL D 2 183 ? 0.28689   10.57718  -8.57514  1.000 29.93048  ? 183 VAL D CA  1 
ATOM   9409  C  C   . VAL D 2 183 ? -0.14510  9.19418   -8.10977  1.000 34.47095  ? 183 VAL D C   1 
ATOM   9410  O  O   . VAL D 2 183 ? 0.40729   8.64239   -7.15033  1.000 37.42045  ? 183 VAL D O   1 
ATOM   9411  C  CB  . VAL D 2 183 ? -0.72368  11.65984  -8.15044  1.000 38.64863  ? 183 VAL D CB  1 
ATOM   9412  C  CG1 . VAL D 2 183 ? -1.10553  11.49327  -6.68590  1.000 36.49513  ? 183 VAL D CG1 1 
ATOM   9413  C  CG2 . VAL D 2 183 ? -0.14897  13.04587  -8.39252  1.000 35.97721  ? 183 VAL D CG2 1 
ATOM   9414  N  N   . ALA D 2 184 ? -1.13663  8.60809   -8.79000  1.000 34.71044  ? 184 ALA D N   1 
ATOM   9415  C  CA  . ALA D 2 184 ? -1.56294  7.25651   -8.44685  1.000 33.59745  ? 184 ALA D CA  1 
ATOM   9416  C  C   . ALA D 2 184 ? -0.44258  6.25565   -8.68349  1.000 34.28595  ? 184 ALA D C   1 
ATOM   9417  O  O   . ALA D 2 184 ? -0.24906  5.32908   -7.88904  1.000 34.87918  ? 184 ALA D O   1 
ATOM   9418  C  CB  . ALA D 2 184 ? -2.80264  6.86915   -9.25336  1.000 32.75773  ? 184 ALA D CB  1 
ATOM   9419  N  N   . GLY D 2 185 ? 0.31714   6.43432   -9.76364  1.000 32.42887  ? 185 GLY D N   1 
ATOM   9420  C  CA  . GLY D 2 185 ? 1.43366   5.54193   -10.01618 1.000 35.98231  ? 185 GLY D CA  1 
ATOM   9421  C  C   . GLY D 2 185 ? 2.50072   5.62786   -8.94197  1.000 36.31787  ? 185 GLY D C   1 
ATOM   9422  O  O   . GLY D 2 185 ? 3.06620   4.61044   -8.53115  1.000 36.24450  ? 185 GLY D O   1 
ATOM   9423  N  N   . ALA D 2 186 ? 2.78885   6.84234   -8.46745  1.000 33.86375  ? 186 ALA D N   1 
ATOM   9424  C  CA  . ALA D 2 186 ? 3.78128   6.99514   -7.40876  1.000 36.23817  ? 186 ALA D CA  1 
ATOM   9425  C  C   . ALA D 2 186 ? 3.34564   6.27328   -6.14071  1.000 35.12163  ? 186 ALA D C   1 
ATOM   9426  O  O   . ALA D 2 186 ? 4.16666   5.64446   -5.46215  1.000 40.86175  ? 186 ALA D O   1 
ATOM   9427  C  CB  . ALA D 2 186 ? 4.03078   8.47651   -7.13155  1.000 39.93144  ? 186 ALA D CB  1 
ATOM   9428  N  N   . LYS D 2 187 ? 2.05807   6.36168   -5.79913  1.000 37.14096  ? 187 LYS D N   1 
ATOM   9429  C  CA  . LYS D 2 187 ? 1.53408   5.59003   -4.67766  1.000 36.72671  ? 187 LYS D CA  1 
ATOM   9430  C  C   . LYS D 2 187 ? 1.65809   4.09453   -4.94033  1.000 43.98142  ? 187 LYS D C   1 
ATOM   9431  O  O   . LYS D 2 187 ? 1.91062   3.31064   -4.01757  1.000 37.26755  ? 187 LYS D O   1 
ATOM   9432  C  CB  . LYS D 2 187 ? 0.07823   5.97473   -4.41310  1.000 36.27707  ? 187 LYS D CB  1 
ATOM   9433  C  CG  . LYS D 2 187 ? -0.53965  5.29896   -3.20131  1.000 37.69427  ? 187 LYS D CG  1 
ATOM   9434  C  CD  . LYS D 2 187 ? -2.00789  5.66001   -3.05326  1.000 47.13073  ? 187 LYS D CD  1 
ATOM   9435  C  CE  . LYS D 2 187 ? -2.61936  4.97347   -1.84155  1.000 56.75221  ? 187 LYS D CE  1 
ATOM   9436  N  NZ  . LYS D 2 187 ? -2.54721  3.48964   -1.95033  1.000 69.70140  ? 187 LYS D NZ  1 
ATOM   9437  N  N   . LEU D 2 188 ? 1.48528   3.67913   -6.19761  1.000 43.66246  ? 188 LEU D N   1 
ATOM   9438  C  CA  . LEU D 2 188 ? 1.61389   2.27045   -6.54502  1.000 42.42080  ? 188 LEU D CA  1 
ATOM   9439  C  C   . LEU D 2 188 ? 3.05611   1.78292   -6.53627  1.000 42.93589  ? 188 LEU D C   1 
ATOM   9440  O  O   . LEU D 2 188 ? 3.27787   0.58359   -6.70935  1.000 50.21556  ? 188 LEU D O   1 
ATOM   9441  C  CB  . LEU D 2 188 ? 0.99235   1.99943   -7.91754  1.000 38.80134  ? 188 LEU D CB  1 
ATOM   9442  C  CG  . LEU D 2 188 ? -0.53462  2.05192   -7.99849  1.000 34.48933  ? 188 LEU D CG  1 
ATOM   9443  C  CD1 . LEU D 2 188 ? -0.98650  1.85742   -9.42953  1.000 37.50457  ? 188 LEU D CD1 1 
ATOM   9444  C  CD2 . LEU D 2 188 ? -1.16577  1.00686   -7.10002  1.000 30.11203  ? 188 LEU D CD2 1 
ATOM   9445  N  N   . ARG D 2 189 ? 4.04132   2.66446   -6.36627  1.000 41.51722  ? 189 ARG D N   1 
ATOM   9446  C  CA  A ARG D 2 189 ? 5.43258   2.24465   -6.24419  0.462 40.03605  ? 189 ARG D CA  1 
ATOM   9447  C  CA  B ARG D 2 189 ? 5.43692   2.26150   -6.24978  0.538 39.96498  ? 189 ARG D CA  1 
ATOM   9448  C  C   . ARG D 2 189 ? 5.97885   2.48331   -4.84241  1.000 36.61922  ? 189 ARG D C   1 
ATOM   9449  O  O   . ARG D 2 189 ? 7.19581   2.56877   -4.65773  1.000 38.48268  ? 189 ARG D O   1 
ATOM   9450  C  CB  A ARG D 2 189 ? 6.30124   2.94511   -7.28794  0.462 40.41136  ? 189 ARG D CB  1 
ATOM   9451  C  CB  B ARG D 2 189 ? 6.29482   3.00284   -7.27478  0.538 38.68733  ? 189 ARG D CB  1 
ATOM   9452  C  CG  A ARG D 2 189 ? 5.93401   2.58264   -8.71584  0.462 37.64714  ? 189 ARG D CG  1 
ATOM   9453  C  CG  B ARG D 2 189 ? 5.86628   2.78648   -8.71913  0.538 37.58895  ? 189 ARG D CG  1 
ATOM   9454  C  CD  A ARG D 2 189 ? 7.05871   1.85767   -9.44187  0.462 39.31122  ? 189 ARG D CD  1 
ATOM   9455  C  CD  B ARG D 2 189 ? 6.71560   1.73893   -9.42912  0.538 38.86041  ? 189 ARG D CD  1 
ATOM   9456  N  NE  A ARG D 2 189 ? 7.33724   0.52881   -8.90871  0.462 41.98243  ? 189 ARG D NE  1 
ATOM   9457  N  NE  B ARG D 2 189 ? 6.37464   0.36987   -9.05884  0.538 39.92365  ? 189 ARG D NE  1 
ATOM   9458  C  CZ  A ARG D 2 189 ? 8.50287   0.15323   -8.39931  0.462 38.58032  ? 189 ARG D CZ  1 
ATOM   9459  C  CZ  B ARG D 2 189 ? 6.77195   -0.70574  -9.72831  0.538 38.16931  ? 189 ARG D CZ  1 
ATOM   9460  N  NH1 A ARG D 2 189 ? 9.52247   0.99083   -8.31507  0.462 39.48923  ? 189 ARG D NH1 1 
ATOM   9461  N  NH1 B ARG D 2 189 ? 7.51378   -0.60628  -10.82033 0.538 31.11076  ? 189 ARG D NH1 1 
ATOM   9462  N  NH2 A ARG D 2 189 ? 8.65243   -1.09749  -7.97403  0.462 37.55783  ? 189 ARG D NH2 1 
ATOM   9463  N  NH2 B ARG D 2 189 ? 6.40987   -1.91080  -9.29627  0.538 28.20553  ? 189 ARG D NH2 1 
ATOM   9464  N  N   . GLY D 2 190 ? 5.09584   2.58743   -3.85141  1.000 41.83666  ? 190 GLY D N   1 
ATOM   9465  C  CA  . GLY D 2 190 ? 5.51100   2.73731   -2.47337  1.000 39.73020  ? 190 GLY D CA  1 
ATOM   9466  C  C   . GLY D 2 190 ? 6.02030   4.10353   -2.08488  1.000 43.24224  ? 190 GLY D C   1 
ATOM   9467  O  O   . GLY D 2 190 ? 6.74125   4.21699   -1.08718  1.000 43.93752  ? 190 GLY D O   1 
ATOM   9468  N  N   . ALA D 2 191 ? 5.67377   5.15001   -2.83069  1.000 36.99656  ? 191 ALA D N   1 
ATOM   9469  C  CA  . ALA D 2 191 ? 6.09930   6.48609   -2.44067  1.000 35.99925  ? 191 ALA D CA  1 
ATOM   9470  C  C   . ALA D 2 191 ? 5.43177   6.87920   -1.13346  1.000 37.48860  ? 191 ALA D C   1 
ATOM   9471  O  O   . ALA D 2 191 ? 4.27274   6.54196   -0.88328  1.000 40.10670  ? 191 ALA D O   1 
ATOM   9472  C  CB  . ALA D 2 191 ? 5.76108   7.50610   -3.52568  1.000 32.14960  ? 191 ALA D CB  1 
ATOM   9473  N  N   . GLY D 2 192 ? 6.17171   7.58954   -0.29227  1.000 38.72380  ? 192 GLY D N   1 
ATOM   9474  C  CA  . GLY D 2 192 ? 5.58278   8.12813   0.91244   1.000 39.23191  ? 192 GLY D CA  1 
ATOM   9475  C  C   . GLY D 2 192 ? 4.95729   9.47648   0.63939   1.000 30.39026  ? 192 GLY D C   1 
ATOM   9476  O  O   . GLY D 2 192 ? 3.78968   9.56265   0.24713   1.000 37.85866  ? 192 GLY D O   1 
ATOM   9477  N  N   . ARG D 2 193 ? 5.74141   10.53445  0.81300   1.000 35.08145  ? 193 ARG D N   1 
ATOM   9478  C  CA  . ARG D 2 193 ? 5.26459   11.87884  0.52868   1.000 34.38576  ? 193 ARG D CA  1 
ATOM   9479  C  C   . ARG D 2 193 ? 5.17971   12.08397  -0.97779  1.000 39.55847  ? 193 ARG D C   1 
ATOM   9480  O  O   . ARG D 2 193 ? 6.13299   11.79642  -1.70962  1.000 35.77659  ? 193 ARG D O   1 
ATOM   9481  C  CB  . ARG D 2 193 ? 6.20461   12.90791  1.15417   1.000 34.46731  ? 193 ARG D CB  1 
ATOM   9482  C  CG  . ARG D 2 193 ? 5.66326   14.32735  1.19121   1.000 38.30070  ? 193 ARG D CG  1 
ATOM   9483  C  CD  . ARG D 2 193 ? 6.62329   15.25301  1.93469   1.000 40.99006  ? 193 ARG D CD  1 
ATOM   9484  N  NE  . ARG D 2 193 ? 6.01095   16.53374  2.26645   1.000 40.63340  ? 193 ARG D NE  1 
ATOM   9485  C  CZ  . ARG D 2 193 ? 6.62213   17.50757  2.92704   1.000 49.91194  ? 193 ARG D CZ  1 
ATOM   9486  N  NH1 . ARG D 2 193 ? 7.87137   17.38206  3.34282   1.000 42.19522  ? 193 ARG D NH1 1 
ATOM   9487  N  NH2 . ARG D 2 193 ? 5.96424   18.63757  3.17381   1.000 49.80353  ? 193 ARG D NH2 1 
ATOM   9488  N  N   . ILE D 2 194 ? 4.02947   12.56079  -1.44438  1.000 37.22756  ? 194 ILE D N   1 
ATOM   9489  C  CA  . ILE D 2 194 ? 3.81894   12.87894  -2.85112  1.000 33.14740  ? 194 ILE D CA  1 
ATOM   9490  C  C   . ILE D 2 194 ? 3.36326   14.32696  -2.93830  1.000 28.18333  ? 194 ILE D C   1 
ATOM   9491  O  O   . ILE D 2 194 ? 2.28446   14.67334  -2.44217  1.000 45.59316  ? 194 ILE D O   1 
ATOM   9492  C  CB  . ILE D 2 194 ? 2.79761   11.94038  -3.50686  1.000 32.96225  ? 194 ILE D CB  1 
ATOM   9493  C  CG1 . ILE D 2 194 ? 3.25590   10.48599  -3.38223  1.000 35.37743  ? 194 ILE D CG1 1 
ATOM   9494  C  CG2 . ILE D 2 194 ? 2.62790   12.30302  -4.97579  1.000 34.30985  ? 194 ILE D CG2 1 
ATOM   9495  C  CD1 . ILE D 2 194 ? 2.27176   9.49330   -3.96452  1.000 30.46060  ? 194 ILE D CD1 1 
ATOM   9496  N  N   . ILE D 2 195 ? 4.18270   15.16775  -3.56247  1.000 35.89540  ? 195 ILE D N   1 
ATOM   9497  C  CA  . ILE D 2 195 ? 3.90892   16.59231  -3.70649  1.000 33.54307  ? 195 ILE D CA  1 
ATOM   9498  C  C   . ILE D 2 195 ? 3.40103   16.83873  -5.12109  1.000 35.15464  ? 195 ILE D C   1 
ATOM   9499  O  O   . ILE D 2 195 ? 4.13273   16.63071  -6.09526  1.000 40.49763  ? 195 ILE D O   1 
ATOM   9500  C  CB  . ILE D 2 195 ? 5.16514   17.42611  -3.41562  1.000 35.42345  ? 195 ILE D CB  1 
ATOM   9501  C  CG1 . ILE D 2 195 ? 5.72179   17.07314  -2.03521  1.000 33.84901  ? 195 ILE D CG1 1 
ATOM   9502  C  CG2 . ILE D 2 195 ? 4.86404   18.91163  -3.51444  1.000 33.73708  ? 195 ILE D CG2 1 
ATOM   9503  C  CD1 . ILE D 2 195 ? 7.00832   17.77356  -1.70537  1.000 35.38770  ? 195 ILE D CD1 1 
ATOM   9504  N  N   . ALA D 2 196 ? 2.15328   17.28546  -5.24122  1.000 44.44455  ? 196 ALA D N   1 
ATOM   9505  C  CA  . ALA D 2 196 ? 1.53316   17.53551  -6.53697  1.000 39.18227  ? 196 ALA D CA  1 
ATOM   9506  C  C   . ALA D 2 196 ? 1.47886   19.03604  -6.79792  1.000 42.34258  ? 196 ALA D C   1 
ATOM   9507  O  O   . ALA D 2 196 ? 1.09649   19.81176  -5.91571  1.000 44.61293  ? 196 ALA D O   1 
ATOM   9508  C  CB  . ALA D 2 196 ? 0.13246   16.92682  -6.59591  1.000 42.37690  ? 196 ALA D CB  1 
ATOM   9509  N  N   . VAL D 2 197 ? 1.85430   19.43800  -8.00922  1.000 44.44787  ? 197 VAL D N   1 
ATOM   9510  C  CA  . VAL D 2 197 ? 1.93347   20.84291  -8.39469  1.000 39.29761  ? 197 VAL D CA  1 
ATOM   9511  C  C   . VAL D 2 197 ? 0.82163   21.12647  -9.39877  1.000 41.91483  ? 197 VAL D C   1 
ATOM   9512  O  O   . VAL D 2 197 ? 0.82534   20.58972  -10.51342 1.000 43.98171  ? 197 VAL D O   1 
ATOM   9513  C  CB  . VAL D 2 197 ? 3.30968   21.19036  -8.97628  1.000 44.90504  ? 197 VAL D CB  1 
ATOM   9514  C  CG1 . VAL D 2 197 ? 3.35448   22.64820  -9.40404  1.000 41.93512  ? 197 VAL D CG1 1 
ATOM   9515  C  CG2 . VAL D 2 197 ? 4.40891   20.87933  -7.96557  1.000 39.92126  ? 197 VAL D CG2 1 
ATOM   9516  N  N   . GLY D 2 198 ? -0.12649  21.97211  -9.00679  1.000 40.21598  ? 198 GLY D N   1 
ATOM   9517  C  CA  . GLY D 2 198 ? -1.24038  22.34517  -9.86447  1.000 42.95753  ? 198 GLY D CA  1 
ATOM   9518  C  C   . GLY D 2 198 ? -2.05544  23.42650  -9.19392  1.000 41.06153  ? 198 GLY D C   1 
ATOM   9519  O  O   . GLY D 2 198 ? -1.86230  23.73333  -8.01525  1.000 54.93315  ? 198 GLY D O   1 
ATOM   9520  N  N   . SER D 2 199 ? -2.98971  23.99696  -9.95730  1.000 47.56184  ? 199 SER D N   1 
ATOM   9521  C  CA  . SER D 2 199 ? -3.75971  25.12962  -9.45060  1.000 47.65320  ? 199 SER D CA  1 
ATOM   9522  C  C   . SER D 2 199 ? -5.26441  24.91541  -9.55588  1.000 54.87808  ? 199 SER D C   1 
ATOM   9523  O  O   . SER D 2 199 ? -6.02055  25.40669  -8.71008  1.000 59.40579  ? 199 SER D O   1 
ATOM   9524  C  CB  . SER D 2 199 ? -3.37435  26.41559  -10.18875 1.000 53.98746  ? 199 SER D CB  1 
ATOM   9525  O  OG  . SER D 2 199 ? -3.54315  26.27329  -11.58881 1.000 69.51070  ? 199 SER D OG  1 
ATOM   9526  N  N   . ARG D 2 200 ? -5.71130  24.22485  -10.59511 1.000 43.81669  ? 200 ARG D N   1 
ATOM   9527  C  CA  . ARG D 2 200 ? -7.14376  24.07822  -10.81818 1.000 49.11013  ? 200 ARG D CA  1 
ATOM   9528  C  C   . ARG D 2 200 ? -7.76697  23.26468  -9.68919  1.000 50.26543  ? 200 ARG D C   1 
ATOM   9529  O  O   . ARG D 2 200 ? -7.29880  22.15824  -9.39733  1.000 47.55779  ? 200 ARG D O   1 
ATOM   9530  C  CB  . ARG D 2 200 ? -7.41846  23.41659  -12.16537 1.000 51.95151  ? 200 ARG D CB  1 
ATOM   9531  C  CG  . ARG D 2 200 ? -7.29035  24.36921  -13.34368 1.000 53.86236  ? 200 ARG D CG  1 
ATOM   9532  C  CD  . ARG D 2 200 ? -7.78913  23.72872  -14.61938 1.000 59.97370  ? 200 ARG D CD  1 
ATOM   9533  N  NE  . ARG D 2 200 ? -6.97756  22.58456  -15.01354 1.000 70.25026  ? 200 ARG D NE  1 
ATOM   9534  C  CZ  . ARG D 2 200 ? -7.33901  21.69855  -15.93095 1.000 77.80580  ? 200 ARG D CZ  1 
ATOM   9535  N  NH1 . ARG D 2 200 ? -8.50022  21.79274  -16.56068 1.000 71.83418  ? 200 ARG D NH1 1 
ATOM   9536  N  NH2 . ARG D 2 200 ? -6.51774  20.69116  -16.22055 1.0