data_8FFR
# 
_entry.id   8FFR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.379 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   8FFR         pdb_00008ffr 10.2210/pdb8ffr/pdb 
WWPDB D_1000270634 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'the actual deposition is new re-refinement of 2GTT' 
_pdbx_database_related.db_id          2gtt 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        8FFR 
_pdbx_database_status.recvd_initial_deposition_date   2022-12-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Leyrat, C.'        1 ? 
'Bourhis, J.M.'     2 ? 
'Albertini, A.A.V.' 3 ? 
'Wernimont, A.K.'   4 ? 
'Muziol, T.'        5 ? 
'Ravelli, R.B.G.'   6 ? 
'Weissenhorn, W.'   7 ? 
'Ruigrok, R.W.H.'   8 ? 
'Jamin, M.'         9 ? 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_patent 
_citation.unpublished_flag 
? ? ? ? ? ? ? CH ? ? primary Viruses ?      ?    1999-4915 ? ? 14  ? ?   ?   
'Structure and Dynamics of the Unassembled Nucleoprotein of Rabies Virus in Complex with Its Phosphoprotein Chaperone Module.' 
2022 ? 10.3390/v14122813       36560817 ? ? 
? ? ? ? ? ? ? US ? ? 1       Science SCIEAS 0038 1095-9203 ? ? 313 ? 360 363 
'Crystal structure of the rabies virus nucleoprotein-RNA complex.'                                                             
2006 ? 10.1126/science.1125280 16778023 ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gerard, F.C.A.'  1  0000-0001-9865-2864 
primary 'Bourhis, J.M.'   2  0000-0002-3151-1546 
primary 'Mas, C.'         3  ?                   
primary 'Branchard, A.'   4  ?                   
primary 'Vu, D.D.'        5  ?                   
primary 'Varhoshkova, S.' 6  ?                   
primary 'Leyrat, C.'      7  0000-0003-0189-0562 
primary 'Jamin, M.'       8  0000-0002-8677-2110 
1       'Albertini, A.A.' 9  ?                   
1       'Wernimont, A.K.' 10 ?                   
1       'Muziol, T.'      11 ?                   
1       'Ravelli, R.B.'   12 ?                   
1       'Clapier, C.R.'   13 ?                   
1       'Schoehn, G.'     14 ?                   
1       'Weissenhorn, W.' 15 ?                   
1       'Ruigrok, R.W.'   16 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     8FFR 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     270.430 
_cell.length_a_esd                 ? 
_cell.length_b                     281.000 
_cell.length_b_esd                 ? 
_cell.length_c                     236.900 
_cell.length_c_esd                 ? 
_cell.volume                       18002227.627 
_cell.volume_esd                   ? 
_cell.Z_PDB                        88 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
_cell.pdbx_esd_method              ? 
# 
_symmetry.entry_id                         8FFR 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            'P 2 2ab' 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Nucleoprotein   50641.289 22 ? ? ? ? 
2 polymer     syn 'RNA (99-MER)'  31153.025 1  ? ? ? ? 
3 polymer     syn 'RNA (99-MER)'  30984.857 1  ? ? ? ? 
4 non-polymer syn 'PHOSPHATE ION' 94.971    2  ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MDADKIVFKVNNQVVSLKPEIIVDQHEYKYPAIKDLKKPCITLGKAPDLNKAYKSVLSGMSAAKLDPDDVCSYLAAAMQF
FEGTCPEDWTSYGIVIARKGDKITPGSLVEIKRTDVEGNWALTGGMELTRDPTVPEHASLVGLLLSLYRLSKISGQNTGN
YKTNIADRIEQIFETAPFVKIVEHHTLMTTHKMCANWSTIPNFRFLAGTYDMFFSRIEHLYSAIRVGTVVTAYEDCSGLV
SFTGFIKQINLTAREAILYFFHKNFEEEIRRMFEPGQETAVPHSYFIHFRSLGLSGKSPYSSNAVGHVFNLIHFVGCYMG
QVRSLNATVIAACAPHEMSVLGGYLGEEFFGKGTFERRFFRDEKELQEYEAAELTKTDVALADDGTVNSDDEDYFSGETR
SPEAVYTRIMMNGGRLKRSHIRRYVSVSSNHQARPNSFAEFLNKTYSSDS
;
;MDADKIVFKVNNQVVSLKPEIIVDQHEYKYPAIKDLKKPCITLGKAPDLNKAYKSVLSGMSAAKLDPDDVCSYLAAAMQF
FEGTCPEDWTSYGIVIARKGDKITPGSLVEIKRTDVEGNWALTGGMELTRDPTVPEHASLVGLLLSLYRLSKISGQNTGN
YKTNIADRIEQIFETAPFVKIVEHHTLMTTHKMCANWSTIPNFRFLAGTYDMFFSRIEHLYSAIRVGTVVTAYEDCSGLV
SFTGFIKQINLTAREAILYFFHKNFEEEIRRMFEPGQETAVPHSYFIHFRSLGLSGKSPYSSNAVGHVFNLIHFVGCYMG
QVRSLNATVIAACAPHEMSVLGGYLGEEFFGKGTFERRFFRDEKELQEYEAAELTKTDVALADDGTVNSDDEDYFSGETR
SPEAVYTRIMMNGGRLKRSHIRRYVSVSSNHQARPNSFAEFLNKTYSSDS
;
A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V ? 
2 polyribonucleotide no no 
;CCCCCCCACCCACAAAAACCACAACACCCACAAACCCAAAAAACCCCACAACCCCCCCACACCCCACCAACCCCACAAAC
CCCACACACCCCACAAAAC
;
;CCCCCCCACCCACAAAAACCACAACACCCACAAACCCAAAAAACCCCACAACCCCCCCACACCCCACCAACCCCACAAAC
CCCACACACCCCACAAAAC
;
W                                           ? 
3 polyribonucleotide no no 
;CCACCAACCCCACACACCCCCCCACCCCCACCCACCACACAAAACCCCCAAAACCCCCCCAACCCCCAAACCCCACCAAC
CCCACCAACCCCACAAACC
;
;CCACCAACCCCACACACCCCCCCACCCCCACCCACCACACAAAACCCCCAAAACCCCCCCAACCCCCAAACCCCACCAAC
CCCACCAACCCCACAAACC
;
X                                           ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   ALA n 
1 4   ASP n 
1 5   LYS n 
1 6   ILE n 
1 7   VAL n 
1 8   PHE n 
1 9   LYS n 
1 10  VAL n 
1 11  ASN n 
1 12  ASN n 
1 13  GLN n 
1 14  VAL n 
1 15  VAL n 
1 16  SER n 
1 17  LEU n 
1 18  LYS n 
1 19  PRO n 
1 20  GLU n 
1 21  ILE n 
1 22  ILE n 
1 23  VAL n 
1 24  ASP n 
1 25  GLN n 
1 26  HIS n 
1 27  GLU n 
1 28  TYR n 
1 29  LYS n 
1 30  TYR n 
1 31  PRO n 
1 32  ALA n 
1 33  ILE n 
1 34  LYS n 
1 35  ASP n 
1 36  LEU n 
1 37  LYS n 
1 38  LYS n 
1 39  PRO n 
1 40  CYS n 
1 41  ILE n 
1 42  THR n 
1 43  LEU n 
1 44  GLY n 
1 45  LYS n 
1 46  ALA n 
1 47  PRO n 
1 48  ASP n 
1 49  LEU n 
1 50  ASN n 
1 51  LYS n 
1 52  ALA n 
1 53  TYR n 
1 54  LYS n 
1 55  SER n 
1 56  VAL n 
1 57  LEU n 
1 58  SER n 
1 59  GLY n 
1 60  MET n 
1 61  SER n 
1 62  ALA n 
1 63  ALA n 
1 64  LYS n 
1 65  LEU n 
1 66  ASP n 
1 67  PRO n 
1 68  ASP n 
1 69  ASP n 
1 70  VAL n 
1 71  CYS n 
1 72  SER n 
1 73  TYR n 
1 74  LEU n 
1 75  ALA n 
1 76  ALA n 
1 77  ALA n 
1 78  MET n 
1 79  GLN n 
1 80  PHE n 
1 81  PHE n 
1 82  GLU n 
1 83  GLY n 
1 84  THR n 
1 85  CYS n 
1 86  PRO n 
1 87  GLU n 
1 88  ASP n 
1 89  TRP n 
1 90  THR n 
1 91  SER n 
1 92  TYR n 
1 93  GLY n 
1 94  ILE n 
1 95  VAL n 
1 96  ILE n 
1 97  ALA n 
1 98  ARG n 
1 99  LYS n 
1 100 GLY n 
1 101 ASP n 
1 102 LYS n 
1 103 ILE n 
1 104 THR n 
1 105 PRO n 
1 106 GLY n 
1 107 SER n 
1 108 LEU n 
1 109 VAL n 
1 110 GLU n 
1 111 ILE n 
1 112 LYS n 
1 113 ARG n 
1 114 THR n 
1 115 ASP n 
1 116 VAL n 
1 117 GLU n 
1 118 GLY n 
1 119 ASN n 
1 120 TRP n 
1 121 ALA n 
1 122 LEU n 
1 123 THR n 
1 124 GLY n 
1 125 GLY n 
1 126 MET n 
1 127 GLU n 
1 128 LEU n 
1 129 THR n 
1 130 ARG n 
1 131 ASP n 
1 132 PRO n 
1 133 THR n 
1 134 VAL n 
1 135 PRO n 
1 136 GLU n 
1 137 HIS n 
1 138 ALA n 
1 139 SER n 
1 140 LEU n 
1 141 VAL n 
1 142 GLY n 
1 143 LEU n 
1 144 LEU n 
1 145 LEU n 
1 146 SER n 
1 147 LEU n 
1 148 TYR n 
1 149 ARG n 
1 150 LEU n 
1 151 SER n 
1 152 LYS n 
1 153 ILE n 
1 154 SER n 
1 155 GLY n 
1 156 GLN n 
1 157 ASN n 
1 158 THR n 
1 159 GLY n 
1 160 ASN n 
1 161 TYR n 
1 162 LYS n 
1 163 THR n 
1 164 ASN n 
1 165 ILE n 
1 166 ALA n 
1 167 ASP n 
1 168 ARG n 
1 169 ILE n 
1 170 GLU n 
1 171 GLN n 
1 172 ILE n 
1 173 PHE n 
1 174 GLU n 
1 175 THR n 
1 176 ALA n 
1 177 PRO n 
1 178 PHE n 
1 179 VAL n 
1 180 LYS n 
1 181 ILE n 
1 182 VAL n 
1 183 GLU n 
1 184 HIS n 
1 185 HIS n 
1 186 THR n 
1 187 LEU n 
1 188 MET n 
1 189 THR n 
1 190 THR n 
1 191 HIS n 
1 192 LYS n 
1 193 MET n 
1 194 CYS n 
1 195 ALA n 
1 196 ASN n 
1 197 TRP n 
1 198 SER n 
1 199 THR n 
1 200 ILE n 
1 201 PRO n 
1 202 ASN n 
1 203 PHE n 
1 204 ARG n 
1 205 PHE n 
1 206 LEU n 
1 207 ALA n 
1 208 GLY n 
1 209 THR n 
1 210 TYR n 
1 211 ASP n 
1 212 MET n 
1 213 PHE n 
1 214 PHE n 
1 215 SER n 
1 216 ARG n 
1 217 ILE n 
1 218 GLU n 
1 219 HIS n 
1 220 LEU n 
1 221 TYR n 
1 222 SER n 
1 223 ALA n 
1 224 ILE n 
1 225 ARG n 
1 226 VAL n 
1 227 GLY n 
1 228 THR n 
1 229 VAL n 
1 230 VAL n 
1 231 THR n 
1 232 ALA n 
1 233 TYR n 
1 234 GLU n 
1 235 ASP n 
1 236 CYS n 
1 237 SER n 
1 238 GLY n 
1 239 LEU n 
1 240 VAL n 
1 241 SER n 
1 242 PHE n 
1 243 THR n 
1 244 GLY n 
1 245 PHE n 
1 246 ILE n 
1 247 LYS n 
1 248 GLN n 
1 249 ILE n 
1 250 ASN n 
1 251 LEU n 
1 252 THR n 
1 253 ALA n 
1 254 ARG n 
1 255 GLU n 
1 256 ALA n 
1 257 ILE n 
1 258 LEU n 
1 259 TYR n 
1 260 PHE n 
1 261 PHE n 
1 262 HIS n 
1 263 LYS n 
1 264 ASN n 
1 265 PHE n 
1 266 GLU n 
1 267 GLU n 
1 268 GLU n 
1 269 ILE n 
1 270 ARG n 
1 271 ARG n 
1 272 MET n 
1 273 PHE n 
1 274 GLU n 
1 275 PRO n 
1 276 GLY n 
1 277 GLN n 
1 278 GLU n 
1 279 THR n 
1 280 ALA n 
1 281 VAL n 
1 282 PRO n 
1 283 HIS n 
1 284 SER n 
1 285 TYR n 
1 286 PHE n 
1 287 ILE n 
1 288 HIS n 
1 289 PHE n 
1 290 ARG n 
1 291 SER n 
1 292 LEU n 
1 293 GLY n 
1 294 LEU n 
1 295 SER n 
1 296 GLY n 
1 297 LYS n 
1 298 SER n 
1 299 PRO n 
1 300 TYR n 
1 301 SER n 
1 302 SER n 
1 303 ASN n 
1 304 ALA n 
1 305 VAL n 
1 306 GLY n 
1 307 HIS n 
1 308 VAL n 
1 309 PHE n 
1 310 ASN n 
1 311 LEU n 
1 312 ILE n 
1 313 HIS n 
1 314 PHE n 
1 315 VAL n 
1 316 GLY n 
1 317 CYS n 
1 318 TYR n 
1 319 MET n 
1 320 GLY n 
1 321 GLN n 
1 322 VAL n 
1 323 ARG n 
1 324 SER n 
1 325 LEU n 
1 326 ASN n 
1 327 ALA n 
1 328 THR n 
1 329 VAL n 
1 330 ILE n 
1 331 ALA n 
1 332 ALA n 
1 333 CYS n 
1 334 ALA n 
1 335 PRO n 
1 336 HIS n 
1 337 GLU n 
1 338 MET n 
1 339 SER n 
1 340 VAL n 
1 341 LEU n 
1 342 GLY n 
1 343 GLY n 
1 344 TYR n 
1 345 LEU n 
1 346 GLY n 
1 347 GLU n 
1 348 GLU n 
1 349 PHE n 
1 350 PHE n 
1 351 GLY n 
1 352 LYS n 
1 353 GLY n 
1 354 THR n 
1 355 PHE n 
1 356 GLU n 
1 357 ARG n 
1 358 ARG n 
1 359 PHE n 
1 360 PHE n 
1 361 ARG n 
1 362 ASP n 
1 363 GLU n 
1 364 LYS n 
1 365 GLU n 
1 366 LEU n 
1 367 GLN n 
1 368 GLU n 
1 369 TYR n 
1 370 GLU n 
1 371 ALA n 
1 372 ALA n 
1 373 GLU n 
1 374 LEU n 
1 375 THR n 
1 376 LYS n 
1 377 THR n 
1 378 ASP n 
1 379 VAL n 
1 380 ALA n 
1 381 LEU n 
1 382 ALA n 
1 383 ASP n 
1 384 ASP n 
1 385 GLY n 
1 386 THR n 
1 387 VAL n 
1 388 ASN n 
1 389 SER n 
1 390 ASP n 
1 391 ASP n 
1 392 GLU n 
1 393 ASP n 
1 394 TYR n 
1 395 PHE n 
1 396 SER n 
1 397 GLY n 
1 398 GLU n 
1 399 THR n 
1 400 ARG n 
1 401 SER n 
1 402 PRO n 
1 403 GLU n 
1 404 ALA n 
1 405 VAL n 
1 406 TYR n 
1 407 THR n 
1 408 ARG n 
1 409 ILE n 
1 410 MET n 
1 411 MET n 
1 412 ASN n 
1 413 GLY n 
1 414 GLY n 
1 415 ARG n 
1 416 LEU n 
1 417 LYS n 
1 418 ARG n 
1 419 SER n 
1 420 HIS n 
1 421 ILE n 
1 422 ARG n 
1 423 ARG n 
1 424 TYR n 
1 425 VAL n 
1 426 SER n 
1 427 VAL n 
1 428 SER n 
1 429 SER n 
1 430 ASN n 
1 431 HIS n 
1 432 GLN n 
1 433 ALA n 
1 434 ARG n 
1 435 PRO n 
1 436 ASN n 
1 437 SER n 
1 438 PHE n 
1 439 ALA n 
1 440 GLU n 
1 441 PHE n 
1 442 LEU n 
1 443 ASN n 
1 444 LYS n 
1 445 THR n 
1 446 TYR n 
1 447 SER n 
1 448 SER n 
1 449 ASP n 
1 450 SER n 
2 1   C   n 
2 2   C   n 
2 3   C   n 
2 4   C   n 
2 5   C   n 
2 6   C   n 
2 7   C   n 
2 8   A   n 
2 9   C   n 
2 10  C   n 
2 11  C   n 
2 12  A   n 
2 13  C   n 
2 14  A   n 
2 15  A   n 
2 16  A   n 
2 17  A   n 
2 18  A   n 
2 19  C   n 
2 20  C   n 
2 21  A   n 
2 22  C   n 
2 23  A   n 
2 24  A   n 
2 25  C   n 
2 26  A   n 
2 27  C   n 
2 28  C   n 
2 29  C   n 
2 30  A   n 
2 31  C   n 
2 32  A   n 
2 33  A   n 
2 34  A   n 
2 35  C   n 
2 36  C   n 
2 37  C   n 
2 38  A   n 
2 39  A   n 
2 40  A   n 
2 41  A   n 
2 42  A   n 
2 43  A   n 
2 44  C   n 
2 45  C   n 
2 46  C   n 
2 47  C   n 
2 48  A   n 
2 49  C   n 
2 50  A   n 
2 51  A   n 
2 52  C   n 
2 53  C   n 
2 54  C   n 
2 55  C   n 
2 56  C   n 
2 57  C   n 
2 58  C   n 
2 59  A   n 
2 60  C   n 
2 61  A   n 
2 62  C   n 
2 63  C   n 
2 64  C   n 
2 65  C   n 
2 66  A   n 
2 67  C   n 
2 68  C   n 
2 69  A   n 
2 70  A   n 
2 71  C   n 
2 72  C   n 
2 73  C   n 
2 74  C   n 
2 75  A   n 
2 76  C   n 
2 77  A   n 
2 78  A   n 
2 79  A   n 
2 80  C   n 
2 81  C   n 
2 82  C   n 
2 83  C   n 
2 84  A   n 
2 85  C   n 
2 86  A   n 
2 87  C   n 
2 88  A   n 
2 89  C   n 
2 90  C   n 
2 91  C   n 
2 92  C   n 
2 93  A   n 
2 94  C   n 
2 95  A   n 
2 96  A   n 
2 97  A   n 
2 98  A   n 
2 99  C   n 
3 1   C   n 
3 2   C   n 
3 3   A   n 
3 4   C   n 
3 5   C   n 
3 6   A   n 
3 7   A   n 
3 8   C   n 
3 9   C   n 
3 10  C   n 
3 11  C   n 
3 12  A   n 
3 13  C   n 
3 14  A   n 
3 15  C   n 
3 16  A   n 
3 17  C   n 
3 18  C   n 
3 19  C   n 
3 20  C   n 
3 21  C   n 
3 22  C   n 
3 23  C   n 
3 24  A   n 
3 25  C   n 
3 26  C   n 
3 27  C   n 
3 28  C   n 
3 29  C   n 
3 30  A   n 
3 31  C   n 
3 32  C   n 
3 33  C   n 
3 34  A   n 
3 35  C   n 
3 36  C   n 
3 37  A   n 
3 38  C   n 
3 39  A   n 
3 40  C   n 
3 41  A   n 
3 42  A   n 
3 43  A   n 
3 44  A   n 
3 45  C   n 
3 46  C   n 
3 47  C   n 
3 48  C   n 
3 49  C   n 
3 50  A   n 
3 51  A   n 
3 52  A   n 
3 53  A   n 
3 54  C   n 
3 55  C   n 
3 56  C   n 
3 57  C   n 
3 58  C   n 
3 59  C   n 
3 60  C   n 
3 61  A   n 
3 62  A   n 
3 63  C   n 
3 64  C   n 
3 65  C   n 
3 66  C   n 
3 67  C   n 
3 68  A   n 
3 69  A   n 
3 70  A   n 
3 71  C   n 
3 72  C   n 
3 73  C   n 
3 74  C   n 
3 75  A   n 
3 76  C   n 
3 77  C   n 
3 78  A   n 
3 79  A   n 
3 80  C   n 
3 81  C   n 
3 82  C   n 
3 83  C   n 
3 84  A   n 
3 85  C   n 
3 86  C   n 
3 87  A   n 
3 88  A   n 
3 89  C   n 
3 90  C   n 
3 91  C   n 
3 92  C   n 
3 93  A   n 
3 94  C   n 
3 95  A   n 
3 96  A   n 
3 97  A   n 
3 98  C   n 
3 99  C   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   450 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rabies virus CVS-11' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11294 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 99 'synthetic construct' ? 32630 ? 
3 1 sample 1 99 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP A8VR20_9RHAB A8VR20 ? 1 
;MDADKIVFKVNNQVVSLKPEIIVDQHEYKYPAIKDLKKPCITLGKAPDLNKAYKSVLSGMSAAKLDPDDVCSYLAAAMQF
FEGTCPEDWTSYGIVIARKGDKITPGSLVEIKRTDVEGNWALTGGMELTRDPTVPEHASLVGLLLSLYRLSKISGQNTGN
YKTNIADRIEQIFETAPFVKIVEHHTLMTTHKMCANWSTIPNFRFLAGTYDMFFSRIEHLYSAIRVGTVVTAYEDCSGLV
SFTGFIKQINLTAREAILYFFHKNFEEEIRRMFEPGQETAVPHSYFIHFRSLGLSGKSPYSSNAVGHVFNLIHFVGCYMG
QVRSLNATVIAACAPHEMSVLGGYLGEEFFGKGTFERRFFRDEKELQEYEAAELTKTDVALADDGTVNSDDEDYFSGETR
SPEAVYTRIMMNGGRLKRSHIRRYVSVSSNHQARPNSFAEFLNKTYSSDS
;
1 
2 PDB 8FFR         8FFR   ? 2 ? 1 
3 PDB 8FFR         8FFR   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 8FFR A 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
2  1 8FFR B 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
3  1 8FFR C 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
4  1 8FFR D 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
5  1 8FFR E 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
6  1 8FFR F 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
7  1 8FFR G 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
8  1 8FFR H 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
9  1 8FFR I 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
10 1 8FFR J 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
11 1 8FFR K 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
12 1 8FFR L 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
13 1 8FFR M 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
14 1 8FFR N 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
15 1 8FFR O 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
16 1 8FFR P 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
17 1 8FFR Q 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
18 1 8FFR R 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
19 1 8FFR S 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
20 1 8FFR T 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
21 1 8FFR U 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
22 1 8FFR V 1 ? 450 ? A8VR20 1 ? 450 ? 1 450 
23 2 8FFR W 1 ? 99  ? 8FFR   1 ? 99  ? 1 99  
24 3 8FFR X 1 ? 99  ? 8FFR   1 ? 99  ? 1 99  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PO4 non-polymer         . 'PHOSPHATE ION'              ? 'O4 P -3'         94.971  
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   8FFR 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                       ? 
_exptl_crystal.density_diffrn               ? 
_exptl_crystal.density_Matthews             3.83 
_exptl_crystal.density_method               ? 
_exptl_crystal.density_percent_sol          67.85 
_exptl_crystal.description                  ? 
_exptl_crystal.F_000                        ? 
_exptl_crystal.id                           1 
_exptl_crystal.preparation                  ? 
_exptl_crystal.size_max                     ? 
_exptl_crystal.size_mid                     ? 
_exptl_crystal.size_min                     ? 
_exptl_crystal.size_rad                     ? 
_exptl_crystal.colour_lustre                ? 
_exptl_crystal.colour_modifier              ? 
_exptl_crystal.colour_primary               ? 
_exptl_crystal.density_meas                 ? 
_exptl_crystal.density_meas_esd             ? 
_exptl_crystal.density_meas_gt              ? 
_exptl_crystal.density_meas_lt              ? 
_exptl_crystal.density_meas_temp            ? 
_exptl_crystal.density_meas_temp_esd        ? 
_exptl_crystal.density_meas_temp_gt         ? 
_exptl_crystal.density_meas_temp_lt         ? 
_exptl_crystal.pdbx_crystal_image_url       ? 
_exptl_crystal.pdbx_crystal_image_format    ? 
_exptl_crystal.pdbx_mosaicity               ? 
_exptl_crystal.pdbx_mosaicity_esd           ? 
_exptl_crystal.pdbx_mosaic_method           ? 
_exptl_crystal.pdbx_mosaic_block_size       ? 
_exptl_crystal.pdbx_mosaic_block_size_esd   ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '60% TACSIMATE, 10% L-CYSTEIN, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.temp            293 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 4r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2005-03-25 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'silicon 111' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9394 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9394 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate                          103.61 
_reflns.entry_id                                       8FFR 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              3.49 
_reflns.d_resolution_low                               49.75 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     226498 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           99.9 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                1.0 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          12.15 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                ? 
_reflns.pdbx_Rpim_I_all                                ? 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   ? 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_Rmerge_I_obs                              0.096 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_CC_split_method                           ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    3.49 
_reflns_shell.d_res_low                                     3.63 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           3.36 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             21091 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               ? 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               ? 
_reflns_shell.pdbx_Rpim_I_all                               ? 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  ? 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.percent_possible_all                          ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  ? 
_reflns_shell.pdbx_Rsym_value                               0.457 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               103.10 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 8FFR 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.49 
_refine.ls_d_res_low                             49.75 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     226498 
_refine.ls_number_reflns_R_free                  11055 
_refine.ls_number_reflns_R_work                  215443 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.23 
_refine.ls_percent_reflns_R_free                 4.88 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2253 
_refine.ls_R_factor_R_free                       0.2552 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2237 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.37 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.7461 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4048 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.49 
_refine_hist.d_res_low                        49.75 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               77284 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        73171 
_refine_hist.pdbx_number_atoms_nucleic_acid   4103 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0128  ? 79511  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.3464  ? 108344 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0757  ? 11997  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0116  ? 13191  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.5454 ? 12454  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' d_2  ? ? 1.03713343265  ? ? 1  'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_3  ? ? 1.39191104661  ? ? 2  'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_4  ? ? 1.39793975962  ? ? 3  'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_5  ? ? 1.28656426339  ? ? 4  'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_6  ? ? 1.21525619101  ? ? 5  'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_7  ? ? 1.27465287969  ? ? 6  'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_8  ? ? 1.49754258061  ? ? 7  'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_9  ? ? 1.12927288833  ? ? 8  'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_10 ? ? 1.15027308195  ? ? 9  'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_11 ? ? 1.4290615434   ? ? 10 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_12 ? ? 1.12496771739  ? ? 11 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_13 ? ? 1.57902576876  ? ? 12 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_14 ? ? 0.950556727271 ? ? 13 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_15 ? ? 1.1792334758   ? ? 14 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_16 ? ? 1.08377693245  ? ? 15 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_17 ? ? 1.41981700661  ? ? 16 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_18 ? ? 1.1954308707   ? ? 17 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_19 ? ? 1.43441438373  ? ? 18 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_20 ? ? 1.26886127925  ? ? 19 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_21 ? ? 1.53334912821  ? ? 20 'Torsion NCS' ? A ? ? ? ens_1 
'X-RAY DIFFRACTION' d_22 ? ? 1.18078348888  ? ? 21 'Torsion NCS' ? A ? ? ? ens_1 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       10.81 
_refine_ls_shell.d_res_low                        49.75 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             379 
_refine_ls_shell.number_reflns_R_work             7464 
_refine_ls_shell.percent_reflns_obs               97.60 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2311 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
_refine_ls_shell.R_factor_R_free                  0.2374 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
_struct_ncs_oper.details 
1  given 0.834805138764  -0.549593548816 0.0323621907855   0.549324794746  0.835426105766   0.0174783203189   -0.0366421911134   
0.00318636219164  0.999323369549  135.961416511  -81.1616737224 6.32057229292  ? 
2  given 0.410485806203  -0.910650761794 0.0470807067712   0.909868017995  0.412456503079   0.0449424398333   -0.0603456107484   
0.024388995708    0.997879543909  288.967737643  -75.4946756829 6.44347484973  ? 
3  given -0.102173275882 -0.994246729004 0.0321568586841   0.991562104717  -0.0991982986512 0.0834523219254   -0.0797822924306   
0.040412119589    0.995992794354  409.120194273  0.269264871947 7.73055782386  ? 
4  given -0.610152425638 -0.792176331363 -0.0130643605461  0.787404399361  -0.608139356516  0.100800966877    -0.0877970919542   
0.0512170194777   0.994820831889  477.946820284  136.614280814  8.14847195993  ? 
5  given -0.946821021661 -0.313646046482 -0.071806061484   0.309067358644  -0.948596699735  0.0681297957789   -0.0894836340384   
0.0423138130875   0.995089051523  460.105834209  303.468130264  11.7845258087  ? 
6  given -0.946967656321 0.308509575222  -0.0898559952292  -0.309408470434 -0.950920398577  -0.00409804756346 -0.086710185711    
0.0239214875465   0.995946336972  339.907731793  438.374962097  16.4232236525  ? 
7  given -0.670138674052 0.733328062717  -0.114647764791   -0.74101929754  -0.669851126885  0.0467960306357   -0.042480091951    
0.116316036051    0.992303391884  208.086725752  465.272553401  -13.8673974494 ? 
8  given -0.168042917166 0.980340966304  -0.103407774254   -0.985765156709 -0.16768275412   0.012229055085    -0.00535105670529  
0.103990786883    0.994563865438  58.2279284629  422.224318583  -19.2084059452 ? 
9  given 0.429511446622  0.903017270993  -0.00892891426815 -0.903060076147 0.429472796825   -0.00596788546653 -0.00155437786423  
0.0106266211189   0.999942327753  -59.1303286011 290.841103219  0.643732805975 ? 
10 given 0.82571244095   0.561603855104  -0.0529157329434  -0.563981571947 0.82376145943    -0.0578086884697  0.0111243590932    
0.0775768515106   0.996924310439  -67.6891702393 154.986117979  -19.0237008353 ? 
11 given -0.988128256137 0.151612213716  -0.0248251097901  0.152082036148  0.988199028594   -0.0182683925434  0.0217624379448    
-0.0218269681108  -0.999524877008 376.693848069  -31.8725796776 115.957971177  ? 
12 given -0.790352806585 0.610871868179  -0.0466690667439  0.612651858757  0.788009527138   -0.0608168159461  -0.000375612756889 
-0.0766586316576  -0.997057326891 254.152781322  -80.5736956464 134.439141825  ? 
13 given -0.289415856738 0.957199431621  -0.00277668382998 0.957201298315  0.289407822257   -0.00296427394706 -0.00203380731697  
-0.00351575325106 -0.999991751519 79.6664525892  -59.7677387286 119.278696226  ? 
14 given 0.277563378188  0.960691501326  -0.00551455978869 0.960479280527  -0.27736785757   0.023379975752    0.0209313823721    
-0.0117860454699  -0.999711441549 -35.0864238573 45.7853037851  117.414977086  ? 
15 given 0.767862842762  0.635533002195  0.0805261313278   0.637390162679  -0.770533851014  0.00337119591409  0.0641906163395    
0.0487379478688   -0.996746796941 -80.863841933  209.3589762    93.9804672996  ? 
16 given 0.984293417833  0.161683985429  0.0708855166176   0.160259425058  -0.986748561346  0.0253809645543   0.0740498770459    
-0.013622244211   -0.997161496535 -33.5204766402 343.13363624   106.510861689  ? 
17 given 0.919297218894  -0.382816480178 0.0913464057212   -0.384306818116 -0.923204406826  -0.00137577837815 0.0848580749458    
-0.0338402972922  -0.995818227085 81.0204851564  443.930121867  108.069840501  ? 
18 given 0.0275967869986 -0.997354858076 0.0672436199196   -0.996250711141 -0.032959237457  -0.0799888068193  0.0819935235094    
-0.0647840701006  -0.994525055674 381.525759799  404.806776596  113.390672407  ? 
19 given -0.578845647868 -0.815195837723 -0.0198358791742  -0.81218026009  0.578535062129   -0.0752356764288  0.0728075618635    
-0.0274395343584  -0.996968470359 479.501398118  245.767012883  106.038248253  ? 
20 given -0.89479693904  -0.446371621841 -0.00952959076477 -0.444385149932 0.892470945636   -0.0775722225753  0.0431309216821    
-0.0651765786941  -0.996941190434 472.475112392  115.069250894  120.931266015  ? 
21 given 0.578244118792  -0.809776918611 0.0994740225775   -0.810788366145 -0.583938359558  -0.0404749003761  0.0908623376702    
-0.0572480071383  -0.994216626934 230.010083174  469.394663098  110.939703282  ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
ens_1 d_1  
;chain "A"
;
ens_1 d_2  
;(chain "B" and resid 6 through 448)
;
ens_1 d_3  
;chain "C"
;
ens_1 d_4  
;chain "D"
;
ens_1 d_5  
;chain "E"
;
ens_1 d_6  
;chain "F"
;
ens_1 d_7  
;chain "G"
;
ens_1 d_8  
;chain "H"
;
ens_1 d_9  
;chain "I"
;
ens_1 d_10 
;chain "J"
;
ens_1 d_11 
;(chain "K" and resid 6 through 448)
;
ens_1 d_12 
;(chain "L" and resid 6 through 448)
;
ens_1 d_13 
;(chain "M" and resid 6 through 448)
;
ens_1 d_14 
;chain "N"
;
ens_1 d_15 
;(chain "O" and resid 6 through 448)
;
ens_1 d_16 
;(chain "P" and resid 6 through 448)
;
ens_1 d_17 
;chain "Q"
;
ens_1 d_18 
;chain "R"
;
ens_1 d_19 
;chain "S"
;
ens_1 d_20 
;chain "T"
;
ens_1 d_21 
;chain "U"
;
ens_1 d_22 
;(chain "V" and resid 6 through 448)
;
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_auth_comp_id 
_struct_ncs_dom_lim.end_auth_comp_id 
ens_1 d_1  1 . A ILE 1 . A SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_2  1 . B ILE 2 . B SER 419 ? ? ? ? ? ? ? ? 
ens_1 d_3  1 . C ILE 1 . C SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_4  1 . D ILE 1 . D SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_5  1 . E ILE 1 . E SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_6  1 . F ILE 1 . F SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_7  1 . G ILE 1 . G SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_8  1 . H ILE 1 . H SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_9  1 . I ILE 1 . I SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_10 1 . J ILE 1 . J SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_11 1 . K ILE 3 . K SER 420 ? ? ? ? ? ? ? ? 
ens_1 d_12 1 . L ILE 2 . L SER 419 ? ? ? ? ? ? ? ? 
ens_1 d_13 1 . M ILE 3 . M SER 420 ? ? ? ? ? ? ? ? 
ens_1 d_14 1 . N ILE 1 . N SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_15 1 . O ILE 2 . O SER 419 ? ? ? ? ? ? ? ? 
ens_1 d_16 1 . P ILE 3 . P SER 420 ? ? ? ? ? ? ? ? 
ens_1 d_17 1 . Q ILE 1 . Q SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_18 1 . R ILE 1 . R SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_19 1 . S ILE 1 . S SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_20 1 . T ILE 1 . T SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_21 1 . U ILE 1 . U SER 418 ? ? ? ? ? ? ? ? 
ens_1 d_22 1 . V ILE 2 . V SER 419 ? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        ens_1 
_struct_ncs_ens.details   ? 
# 
loop_
_struct_ncs_ens_gen.ens_id 
_struct_ncs_ens_gen.dom_id_1 
_struct_ncs_ens_gen.dom_id_2 
_struct_ncs_ens_gen.oper_id 
ens_1 d_2  d_1 1  
ens_1 d_3  d_1 2  
ens_1 d_4  d_1 3  
ens_1 d_5  d_1 4  
ens_1 d_6  d_1 5  
ens_1 d_7  d_1 6  
ens_1 d_8  d_1 7  
ens_1 d_9  d_1 8  
ens_1 d_10 d_1 9  
ens_1 d_11 d_1 10 
ens_1 d_12 d_1 11 
ens_1 d_13 d_1 12 
ens_1 d_14 d_1 13 
ens_1 d_15 d_1 14 
ens_1 d_16 d_1 15 
ens_1 d_17 d_1 16 
ens_1 d_18 d_1 17 
ens_1 d_19 d_1 18 
ens_1 d_20 d_1 19 
ens_1 d_21 d_1 20 
ens_1 d_22 d_1 21 
# 
_struct.entry_id                     8FFR 
_struct.title                        'Revised structure of the rabies virus nucleoprotein-RNA complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        8FFR 
_struct_keywords.text            'PROTEIN-RNA COMPLEX, RABIES VIRUS, NUCLEOPROTEIN, VIRAL PROTEIN, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
K N N 1 ? 
L N N 1 ? 
M N N 1 ? 
N N N 1 ? 
O N N 1 ? 
P N N 1 ? 
Q N N 1 ? 
R N N 1 ? 
S N N 1 ? 
T N N 1 ? 
U N N 1 ? 
V N N 1 ? 
W N N 2 ? 
X N N 3 ? 
Y N N 4 ? 
Z N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 ASP A 48  ? ALA A 63  ? ASP A 48  ALA A 63  1 ? 16 
HELX_P HELX_P2   AA2 ASP A 66  ? MET A 78  ? ASP A 66  MET A 78  1 ? 13 
HELX_P HELX_P3   AA3 THR A 104 ? LEU A 108 ? THR A 104 LEU A 108 5 ? 5  
HELX_P HELX_P4   AA4 THR A 133 ? ILE A 153 ? THR A 133 ILE A 153 1 ? 21 
HELX_P HELX_P5   AA5 THR A 158 ? THR A 175 ? THR A 158 THR A 175 1 ? 18 
HELX_P HELX_P6   AA6 HIS A 185 ? CYS A 194 ? HIS A 185 CYS A 194 1 ? 10 
HELX_P HELX_P7   AA7 ASN A 196 ? THR A 199 ? ASN A 196 THR A 199 5 ? 4  
HELX_P HELX_P8   AA8 ILE A 200 ? ILE A 217 ? ILE A 200 ILE A 217 1 ? 18 
HELX_P HELX_P9   AA9 TYR A 221 ? ALA A 223 ? TYR A 221 ALA A 223 5 ? 3  
HELX_P HELX_P10  AB1 ILE A 224 ? VAL A 229 ? ILE A 224 VAL A 229 1 ? 6  
HELX_P HELX_P11  AB2 VAL A 230 ? ALA A 232 ? VAL A 230 ALA A 232 5 ? 3  
HELX_P HELX_P12  AB3 CYS A 236 ? ASN A 250 ? CYS A 236 ASN A 250 1 ? 15 
HELX_P HELX_P13  AB4 THR A 252 ? TYR A 259 ? THR A 252 TYR A 259 1 ? 8  
HELX_P HELX_P14  AB5 ASN A 264 ? PHE A 273 ? ASN A 264 PHE A 273 1 ? 10 
HELX_P HELX_P15  AB6 SER A 284 ? PHE A 289 ? SER A 284 PHE A 289 5 ? 6  
HELX_P HELX_P16  AB7 VAL A 305 ? MET A 319 ? VAL A 305 MET A 319 1 ? 15 
HELX_P HELX_P17  AB8 GLN A 321 ? ASN A 326 ? GLN A 321 ASN A 326 1 ? 6  
HELX_P HELX_P18  AB9 ALA A 334 ? PHE A 350 ? ALA A 334 PHE A 350 1 ? 17 
HELX_P HELX_P19  AC1 ASP A 362 ? ALA A 372 ? ASP A 362 ALA A 372 1 ? 11 
HELX_P HELX_P20  AC2 SER A 401 ? ASN A 412 ? SER A 401 ASN A 412 1 ? 12 
HELX_P HELX_P21  AC3 LYS A 417 ? ASN A 430 ? LYS A 417 ASN A 430 1 ? 14 
HELX_P HELX_P22  AC4 SER A 437 ? TYR A 446 ? SER A 437 TYR A 446 1 ? 10 
HELX_P HELX_P23  AC5 ASP B 48  ? ALA B 63  ? ASP B 48  ALA B 63  1 ? 16 
HELX_P HELX_P24  AC6 ASP B 66  ? MET B 78  ? ASP B 66  MET B 78  1 ? 13 
HELX_P HELX_P25  AC7 THR B 104 ? LEU B 108 ? THR B 104 LEU B 108 5 ? 5  
HELX_P HELX_P26  AC8 THR B 133 ? ILE B 153 ? THR B 133 ILE B 153 1 ? 21 
HELX_P HELX_P27  AC9 THR B 158 ? GLU B 174 ? THR B 158 GLU B 174 1 ? 17 
HELX_P HELX_P28  AD1 HIS B 185 ? CYS B 194 ? HIS B 185 CYS B 194 1 ? 10 
HELX_P HELX_P29  AD2 ASN B 196 ? THR B 199 ? ASN B 196 THR B 199 5 ? 4  
HELX_P HELX_P30  AD3 ILE B 200 ? ILE B 217 ? ILE B 200 ILE B 217 1 ? 18 
HELX_P HELX_P31  AD4 TYR B 221 ? ALA B 223 ? TYR B 221 ALA B 223 5 ? 3  
HELX_P HELX_P32  AD5 ILE B 224 ? VAL B 229 ? ILE B 224 VAL B 229 1 ? 6  
HELX_P HELX_P33  AD6 VAL B 230 ? ALA B 232 ? VAL B 230 ALA B 232 5 ? 3  
HELX_P HELX_P34  AD7 CYS B 236 ? ASN B 250 ? CYS B 236 ASN B 250 1 ? 15 
HELX_P HELX_P35  AD8 THR B 252 ? TYR B 259 ? THR B 252 TYR B 259 1 ? 8  
HELX_P HELX_P36  AD9 ASN B 264 ? PHE B 273 ? ASN B 264 PHE B 273 1 ? 10 
HELX_P HELX_P37  AE1 SER B 284 ? PHE B 289 ? SER B 284 PHE B 289 5 ? 6  
HELX_P HELX_P38  AE2 LEU B 292 ? GLY B 296 ? LEU B 292 GLY B 296 5 ? 5  
HELX_P HELX_P39  AE3 VAL B 305 ? MET B 319 ? VAL B 305 MET B 319 1 ? 15 
HELX_P HELX_P40  AE4 GLN B 321 ? ASN B 326 ? GLN B 321 ASN B 326 1 ? 6  
HELX_P HELX_P41  AE5 ALA B 334 ? PHE B 350 ? ALA B 334 PHE B 350 1 ? 17 
HELX_P HELX_P42  AE6 ASP B 362 ? ALA B 372 ? ASP B 362 ALA B 372 1 ? 11 
HELX_P HELX_P43  AE7 SER B 401 ? ASN B 412 ? SER B 401 ASN B 412 1 ? 12 
HELX_P HELX_P44  AE8 LYS B 417 ? ASN B 430 ? LYS B 417 ASN B 430 1 ? 14 
HELX_P HELX_P45  AE9 SER B 437 ? TYR B 446 ? SER B 437 TYR B 446 1 ? 10 
HELX_P HELX_P46  AF1 LEU C 49  ? ALA C 63  ? LEU C 49  ALA C 63  1 ? 15 
HELX_P HELX_P47  AF2 ASP C 66  ? ALA C 77  ? ASP C 66  ALA C 77  1 ? 12 
HELX_P HELX_P48  AF3 THR C 104 ? GLU C 110 ? THR C 104 GLU C 110 1 ? 7  
HELX_P HELX_P49  AF4 THR C 133 ? ILE C 153 ? THR C 133 ILE C 153 1 ? 21 
HELX_P HELX_P50  AF5 THR C 158 ? GLU C 174 ? THR C 158 GLU C 174 1 ? 17 
HELX_P HELX_P51  AF6 HIS C 185 ? CYS C 194 ? HIS C 185 CYS C 194 1 ? 10 
HELX_P HELX_P52  AF7 ASN C 196 ? THR C 199 ? ASN C 196 THR C 199 5 ? 4  
HELX_P HELX_P53  AF8 ILE C 200 ? ILE C 217 ? ILE C 200 ILE C 217 1 ? 18 
HELX_P HELX_P54  AF9 TYR C 221 ? ALA C 223 ? TYR C 221 ALA C 223 5 ? 3  
HELX_P HELX_P55  AG1 ILE C 224 ? VAL C 229 ? ILE C 224 VAL C 229 1 ? 6  
HELX_P HELX_P56  AG2 VAL C 230 ? ALA C 232 ? VAL C 230 ALA C 232 5 ? 3  
HELX_P HELX_P57  AG3 CYS C 236 ? ASN C 250 ? CYS C 236 ASN C 250 1 ? 15 
HELX_P HELX_P58  AG4 THR C 252 ? TYR C 259 ? THR C 252 TYR C 259 1 ? 8  
HELX_P HELX_P59  AG5 ASN C 264 ? PHE C 273 ? ASN C 264 PHE C 273 1 ? 10 
HELX_P HELX_P60  AG6 TYR C 285 ? PHE C 289 ? TYR C 285 PHE C 289 5 ? 5  
HELX_P HELX_P61  AG7 VAL C 305 ? MET C 319 ? VAL C 305 MET C 319 1 ? 15 
HELX_P HELX_P62  AG8 GLN C 321 ? ASN C 326 ? GLN C 321 ASN C 326 1 ? 6  
HELX_P HELX_P63  AG9 ALA C 334 ? PHE C 350 ? ALA C 334 PHE C 350 1 ? 17 
HELX_P HELX_P64  AH1 ASP C 362 ? TYR C 369 ? ASP C 362 TYR C 369 1 ? 8  
HELX_P HELX_P65  AH2 SER C 401 ? ASN C 412 ? SER C 401 ASN C 412 1 ? 12 
HELX_P HELX_P66  AH3 LYS C 417 ? ASN C 430 ? LYS C 417 ASN C 430 1 ? 14 
HELX_P HELX_P67  AH4 SER C 437 ? TYR C 446 ? SER C 437 TYR C 446 1 ? 10 
HELX_P HELX_P68  AH5 LEU D 49  ? ALA D 62  ? LEU D 49  ALA D 62  1 ? 14 
HELX_P HELX_P69  AH6 ASP D 66  ? ALA D 77  ? ASP D 66  ALA D 77  1 ? 12 
HELX_P HELX_P70  AH7 MET D 78  ? PHE D 81  ? MET D 78  PHE D 81  5 ? 4  
HELX_P HELX_P71  AH8 THR D 104 ? LEU D 108 ? THR D 104 LEU D 108 5 ? 5  
HELX_P HELX_P72  AH9 THR D 133 ? SER D 154 ? THR D 133 SER D 154 1 ? 22 
HELX_P HELX_P73  AI1 THR D 158 ? THR D 175 ? THR D 158 THR D 175 1 ? 18 
HELX_P HELX_P74  AI2 HIS D 185 ? CYS D 194 ? HIS D 185 CYS D 194 1 ? 10 
HELX_P HELX_P75  AI3 ASN D 196 ? THR D 199 ? ASN D 196 THR D 199 5 ? 4  
HELX_P HELX_P76  AI4 ILE D 200 ? ILE D 217 ? ILE D 200 ILE D 217 1 ? 18 
HELX_P HELX_P77  AI5 TYR D 221 ? ALA D 223 ? TYR D 221 ALA D 223 5 ? 3  
HELX_P HELX_P78  AI6 ILE D 224 ? VAL D 229 ? ILE D 224 VAL D 229 1 ? 6  
HELX_P HELX_P79  AI7 VAL D 230 ? ALA D 232 ? VAL D 230 ALA D 232 5 ? 3  
HELX_P HELX_P80  AI8 CYS D 236 ? ASN D 250 ? CYS D 236 ASN D 250 1 ? 15 
HELX_P HELX_P81  AI9 THR D 252 ? TYR D 259 ? THR D 252 TYR D 259 1 ? 8  
HELX_P HELX_P82  AJ1 ASN D 264 ? PHE D 273 ? ASN D 264 PHE D 273 1 ? 10 
HELX_P HELX_P83  AJ2 SER D 284 ? PHE D 289 ? SER D 284 PHE D 289 5 ? 6  
HELX_P HELX_P84  AJ3 VAL D 305 ? MET D 319 ? VAL D 305 MET D 319 1 ? 15 
HELX_P HELX_P85  AJ4 GLN D 321 ? ALA D 327 ? GLN D 321 ALA D 327 1 ? 7  
HELX_P HELX_P86  AJ5 ALA D 334 ? PHE D 350 ? ALA D 334 PHE D 350 1 ? 17 
HELX_P HELX_P87  AJ6 ASP D 362 ? ALA D 372 ? ASP D 362 ALA D 372 1 ? 11 
HELX_P HELX_P88  AJ7 SER D 401 ? ASN D 412 ? SER D 401 ASN D 412 1 ? 12 
HELX_P HELX_P89  AJ8 LYS D 417 ? ASN D 430 ? LYS D 417 ASN D 430 1 ? 14 
HELX_P HELX_P90  AJ9 SER D 437 ? TYR D 446 ? SER D 437 TYR D 446 1 ? 10 
HELX_P HELX_P91  AK1 ASN E 50  ? ALA E 63  ? ASN E 50  ALA E 63  1 ? 14 
HELX_P HELX_P92  AK2 ASP E 66  ? MET E 78  ? ASP E 66  MET E 78  1 ? 13 
HELX_P HELX_P93  AK3 THR E 104 ? VAL E 109 ? THR E 104 VAL E 109 1 ? 6  
HELX_P HELX_P94  AK4 THR E 133 ? ILE E 153 ? THR E 133 ILE E 153 1 ? 21 
HELX_P HELX_P95  AK5 GLY E 159 ? THR E 175 ? GLY E 159 THR E 175 1 ? 17 
HELX_P HELX_P96  AK6 HIS E 185 ? CYS E 194 ? HIS E 185 CYS E 194 1 ? 10 
HELX_P HELX_P97  AK7 ASN E 196 ? THR E 199 ? ASN E 196 THR E 199 5 ? 4  
HELX_P HELX_P98  AK8 ILE E 200 ? ILE E 217 ? ILE E 200 ILE E 217 1 ? 18 
HELX_P HELX_P99  AK9 TYR E 221 ? ALA E 223 ? TYR E 221 ALA E 223 5 ? 3  
HELX_P HELX_P100 AL1 ILE E 224 ? VAL E 229 ? ILE E 224 VAL E 229 1 ? 6  
HELX_P HELX_P101 AL2 VAL E 230 ? ALA E 232 ? VAL E 230 ALA E 232 5 ? 3  
HELX_P HELX_P102 AL3 CYS E 236 ? ASN E 250 ? CYS E 236 ASN E 250 1 ? 15 
HELX_P HELX_P103 AL4 THR E 252 ? PHE E 260 ? THR E 252 PHE E 260 1 ? 9  
HELX_P HELX_P104 AL5 ASN E 264 ? PHE E 273 ? ASN E 264 PHE E 273 1 ? 10 
HELX_P HELX_P105 AL6 SER E 284 ? PHE E 289 ? SER E 284 PHE E 289 5 ? 6  
HELX_P HELX_P106 AL7 VAL E 305 ? MET E 319 ? VAL E 305 MET E 319 1 ? 15 
HELX_P HELX_P107 AL8 GLN E 321 ? ASN E 326 ? GLN E 321 ASN E 326 1 ? 6  
HELX_P HELX_P108 AL9 ALA E 334 ? PHE E 350 ? ALA E 334 PHE E 350 1 ? 17 
HELX_P HELX_P109 AM1 ASP E 362 ? ALA E 371 ? ASP E 362 ALA E 371 1 ? 10 
HELX_P HELX_P110 AM2 SER E 401 ? ASN E 412 ? SER E 401 ASN E 412 1 ? 12 
HELX_P HELX_P111 AM3 LYS E 417 ? ASN E 430 ? LYS E 417 ASN E 430 1 ? 14 
HELX_P HELX_P112 AM4 SER E 437 ? TYR E 446 ? SER E 437 TYR E 446 1 ? 10 
HELX_P HELX_P113 AM5 ASP F 48  ? ALA F 62  ? ASP F 48  ALA F 62  1 ? 15 
HELX_P HELX_P114 AM6 ASP F 66  ? MET F 78  ? ASP F 66  MET F 78  1 ? 13 
HELX_P HELX_P115 AM7 THR F 104 ? LEU F 108 ? THR F 104 LEU F 108 5 ? 5  
HELX_P HELX_P116 AM8 THR F 133 ? SER F 154 ? THR F 133 SER F 154 1 ? 22 
HELX_P HELX_P117 AM9 ASN F 160 ? THR F 175 ? ASN F 160 THR F 175 1 ? 16 
HELX_P HELX_P118 AN1 HIS F 185 ? CYS F 194 ? HIS F 185 CYS F 194 1 ? 10 
HELX_P HELX_P119 AN2 ASN F 196 ? THR F 199 ? ASN F 196 THR F 199 5 ? 4  
HELX_P HELX_P120 AN3 ILE F 200 ? ILE F 217 ? ILE F 200 ILE F 217 1 ? 18 
HELX_P HELX_P121 AN4 TYR F 221 ? ALA F 223 ? TYR F 221 ALA F 223 5 ? 3  
HELX_P HELX_P122 AN5 ILE F 224 ? VAL F 229 ? ILE F 224 VAL F 229 1 ? 6  
HELX_P HELX_P123 AN6 VAL F 230 ? ALA F 232 ? VAL F 230 ALA F 232 5 ? 3  
HELX_P HELX_P124 AN7 CYS F 236 ? ASN F 250 ? CYS F 236 ASN F 250 1 ? 15 
HELX_P HELX_P125 AN8 THR F 252 ? TYR F 259 ? THR F 252 TYR F 259 1 ? 8  
HELX_P HELX_P126 AN9 ASN F 264 ? PHE F 273 ? ASN F 264 PHE F 273 1 ? 10 
HELX_P HELX_P127 AO1 SER F 284 ? ILE F 287 ? SER F 284 ILE F 287 5 ? 4  
HELX_P HELX_P128 AO2 HIS F 288 ? GLY F 293 ? HIS F 288 GLY F 293 1 ? 6  
HELX_P HELX_P129 AO3 VAL F 305 ? MET F 319 ? VAL F 305 MET F 319 1 ? 15 
HELX_P HELX_P130 AO4 GLN F 321 ? ALA F 327 ? GLN F 321 ALA F 327 1 ? 7  
HELX_P HELX_P131 AO5 ALA F 334 ? PHE F 350 ? ALA F 334 PHE F 350 1 ? 17 
HELX_P HELX_P132 AO6 ASP F 362 ? ALA F 371 ? ASP F 362 ALA F 371 1 ? 10 
HELX_P HELX_P133 AO7 SER F 401 ? ASN F 412 ? SER F 401 ASN F 412 1 ? 12 
HELX_P HELX_P134 AO8 LYS F 417 ? ASN F 430 ? LYS F 417 ASN F 430 1 ? 14 
HELX_P HELX_P135 AO9 SER F 437 ? TYR F 446 ? SER F 437 TYR F 446 1 ? 10 
HELX_P HELX_P136 AP1 LEU G 49  ? ALA G 62  ? LEU G 49  ALA G 62  1 ? 14 
HELX_P HELX_P137 AP2 ASP G 66  ? MET G 78  ? ASP G 66  MET G 78  1 ? 13 
HELX_P HELX_P138 AP3 THR G 104 ? VAL G 109 ? THR G 104 VAL G 109 1 ? 6  
HELX_P HELX_P139 AP4 THR G 133 ? ILE G 153 ? THR G 133 ILE G 153 1 ? 21 
HELX_P HELX_P140 AP5 THR G 158 ? THR G 175 ? THR G 158 THR G 175 1 ? 18 
HELX_P HELX_P141 AP6 HIS G 185 ? CYS G 194 ? HIS G 185 CYS G 194 1 ? 10 
HELX_P HELX_P142 AP7 ASN G 196 ? THR G 199 ? ASN G 196 THR G 199 5 ? 4  
HELX_P HELX_P143 AP8 ILE G 200 ? ILE G 217 ? ILE G 200 ILE G 217 1 ? 18 
HELX_P HELX_P144 AP9 HIS G 219 ? ALA G 223 ? HIS G 219 ALA G 223 5 ? 5  
HELX_P HELX_P145 AQ1 ILE G 224 ? VAL G 229 ? ILE G 224 VAL G 229 1 ? 6  
HELX_P HELX_P146 AQ2 VAL G 230 ? ALA G 232 ? VAL G 230 ALA G 232 5 ? 3  
HELX_P HELX_P147 AQ3 CYS G 236 ? ASN G 250 ? CYS G 236 ASN G 250 1 ? 15 
HELX_P HELX_P148 AQ4 ALA G 253 ? TYR G 259 ? ALA G 253 TYR G 259 1 ? 7  
HELX_P HELX_P149 AQ5 ASN G 264 ? PHE G 273 ? ASN G 264 PHE G 273 1 ? 10 
HELX_P HELX_P150 AQ6 SER G 284 ? PHE G 289 ? SER G 284 PHE G 289 5 ? 6  
HELX_P HELX_P151 AQ7 VAL G 305 ? MET G 319 ? VAL G 305 MET G 319 1 ? 15 
HELX_P HELX_P152 AQ8 GLN G 321 ? ALA G 327 ? GLN G 321 ALA G 327 1 ? 7  
HELX_P HELX_P153 AQ9 ALA G 334 ? PHE G 350 ? ALA G 334 PHE G 350 1 ? 17 
HELX_P HELX_P154 AR1 ASP G 362 ? ALA G 372 ? ASP G 362 ALA G 372 1 ? 11 
HELX_P HELX_P155 AR2 SER G 401 ? ASN G 412 ? SER G 401 ASN G 412 1 ? 12 
HELX_P HELX_P156 AR3 LYS G 417 ? ASN G 430 ? LYS G 417 ASN G 430 1 ? 14 
HELX_P HELX_P157 AR4 SER G 437 ? TYR G 446 ? SER G 437 TYR G 446 1 ? 10 
HELX_P HELX_P158 AR5 ASP H 48  ? ALA H 62  ? ASP H 48  ALA H 62  1 ? 15 
HELX_P HELX_P159 AR6 ASP H 66  ? MET H 78  ? ASP H 66  MET H 78  1 ? 13 
HELX_P HELX_P160 AR7 THR H 104 ? VAL H 109 ? THR H 104 VAL H 109 1 ? 6  
HELX_P HELX_P161 AR8 THR H 133 ? SER H 154 ? THR H 133 SER H 154 1 ? 22 
HELX_P HELX_P162 AR9 TYR H 161 ? GLU H 174 ? TYR H 161 GLU H 174 1 ? 14 
HELX_P HELX_P163 AS1 HIS H 185 ? CYS H 194 ? HIS H 185 CYS H 194 1 ? 10 
HELX_P HELX_P164 AS2 ASN H 196 ? THR H 199 ? ASN H 196 THR H 199 5 ? 4  
HELX_P HELX_P165 AS3 ILE H 200 ? ILE H 217 ? ILE H 200 ILE H 217 1 ? 18 
HELX_P HELX_P166 AS4 TYR H 221 ? ALA H 223 ? TYR H 221 ALA H 223 5 ? 3  
HELX_P HELX_P167 AS5 ILE H 224 ? VAL H 229 ? ILE H 224 VAL H 229 1 ? 6  
HELX_P HELX_P168 AS6 VAL H 230 ? ALA H 232 ? VAL H 230 ALA H 232 5 ? 3  
HELX_P HELX_P169 AS7 CYS H 236 ? ASN H 250 ? CYS H 236 ASN H 250 1 ? 15 
HELX_P HELX_P170 AS8 THR H 252 ? TYR H 259 ? THR H 252 TYR H 259 1 ? 8  
HELX_P HELX_P171 AS9 ASN H 264 ? PHE H 273 ? ASN H 264 PHE H 273 1 ? 10 
HELX_P HELX_P172 AT1 SER H 284 ? PHE H 289 ? SER H 284 PHE H 289 5 ? 6  
HELX_P HELX_P173 AT2 VAL H 305 ? MET H 319 ? VAL H 305 MET H 319 1 ? 15 
HELX_P HELX_P174 AT3 GLN H 321 ? ALA H 327 ? GLN H 321 ALA H 327 1 ? 7  
HELX_P HELX_P175 AT4 ALA H 334 ? PHE H 350 ? ALA H 334 PHE H 350 1 ? 17 
HELX_P HELX_P176 AT5 ASP H 362 ? ALA H 372 ? ASP H 362 ALA H 372 1 ? 11 
HELX_P HELX_P177 AT6 SER H 401 ? ASN H 412 ? SER H 401 ASN H 412 1 ? 12 
HELX_P HELX_P178 AT7 LYS H 417 ? HIS H 431 ? LYS H 417 HIS H 431 1 ? 15 
HELX_P HELX_P179 AT8 SER H 437 ? TYR H 446 ? SER H 437 TYR H 446 1 ? 10 
HELX_P HELX_P180 AT9 ASP I 48  ? ALA I 63  ? ASP I 48  ALA I 63  1 ? 16 
HELX_P HELX_P181 AU1 ASP I 66  ? MET I 78  ? ASP I 66  MET I 78  1 ? 13 
HELX_P HELX_P182 AU2 THR I 104 ? VAL I 109 ? THR I 104 VAL I 109 1 ? 6  
HELX_P HELX_P183 AU3 THR I 133 ? ILE I 153 ? THR I 133 ILE I 153 1 ? 21 
HELX_P HELX_P184 AU4 GLY I 159 ? GLU I 174 ? GLY I 159 GLU I 174 1 ? 16 
HELX_P HELX_P185 AU5 HIS I 185 ? CYS I 194 ? HIS I 185 CYS I 194 1 ? 10 
HELX_P HELX_P186 AU6 ASN I 196 ? THR I 199 ? ASN I 196 THR I 199 5 ? 4  
HELX_P HELX_P187 AU7 ILE I 200 ? ILE I 217 ? ILE I 200 ILE I 217 1 ? 18 
HELX_P HELX_P188 AU8 TYR I 221 ? ALA I 223 ? TYR I 221 ALA I 223 5 ? 3  
HELX_P HELX_P189 AU9 ILE I 224 ? VAL I 229 ? ILE I 224 VAL I 229 1 ? 6  
HELX_P HELX_P190 AV1 VAL I 230 ? ALA I 232 ? VAL I 230 ALA I 232 5 ? 3  
HELX_P HELX_P191 AV2 CYS I 236 ? ASN I 250 ? CYS I 236 ASN I 250 1 ? 15 
HELX_P HELX_P192 AV3 THR I 252 ? TYR I 259 ? THR I 252 TYR I 259 1 ? 8  
HELX_P HELX_P193 AV4 ASN I 264 ? PHE I 273 ? ASN I 264 PHE I 273 1 ? 10 
HELX_P HELX_P194 AV5 SER I 284 ? PHE I 289 ? SER I 284 PHE I 289 5 ? 6  
HELX_P HELX_P195 AV6 VAL I 305 ? MET I 319 ? VAL I 305 MET I 319 1 ? 15 
HELX_P HELX_P196 AV7 GLN I 321 ? ASN I 326 ? GLN I 321 ASN I 326 1 ? 6  
HELX_P HELX_P197 AV8 ALA I 334 ? PHE I 350 ? ALA I 334 PHE I 350 1 ? 17 
HELX_P HELX_P198 AV9 ASP I 362 ? TYR I 369 ? ASP I 362 TYR I 369 1 ? 8  
HELX_P HELX_P199 AW1 SER I 401 ? ASN I 412 ? SER I 401 ASN I 412 1 ? 12 
HELX_P HELX_P200 AW2 LYS I 417 ? ASN I 430 ? LYS I 417 ASN I 430 1 ? 14 
HELX_P HELX_P201 AW3 SER I 437 ? TYR I 446 ? SER I 437 TYR I 446 1 ? 10 
HELX_P HELX_P202 AW4 LEU J 49  ? ALA J 62  ? LEU J 49  ALA J 62  1 ? 14 
HELX_P HELX_P203 AW5 ASP J 66  ? MET J 78  ? ASP J 66  MET J 78  1 ? 13 
HELX_P HELX_P204 AW6 GLN J 79  ? PHE J 81  ? GLN J 79  PHE J 81  5 ? 3  
HELX_P HELX_P205 AW7 THR J 104 ? LEU J 108 ? THR J 104 LEU J 108 5 ? 5  
HELX_P HELX_P206 AW8 THR J 133 ? ILE J 153 ? THR J 133 ILE J 153 1 ? 21 
HELX_P HELX_P207 AW9 THR J 158 ? THR J 175 ? THR J 158 THR J 175 1 ? 18 
HELX_P HELX_P208 AX1 HIS J 185 ? CYS J 194 ? HIS J 185 CYS J 194 1 ? 10 
HELX_P HELX_P209 AX2 ASN J 196 ? THR J 199 ? ASN J 196 THR J 199 5 ? 4  
HELX_P HELX_P210 AX3 ILE J 200 ? ILE J 217 ? ILE J 200 ILE J 217 1 ? 18 
HELX_P HELX_P211 AX4 TYR J 221 ? ALA J 223 ? TYR J 221 ALA J 223 5 ? 3  
HELX_P HELX_P212 AX5 ILE J 224 ? VAL J 229 ? ILE J 224 VAL J 229 1 ? 6  
HELX_P HELX_P213 AX6 VAL J 230 ? ALA J 232 ? VAL J 230 ALA J 232 5 ? 3  
HELX_P HELX_P214 AX7 CYS J 236 ? ASN J 250 ? CYS J 236 ASN J 250 1 ? 15 
HELX_P HELX_P215 AX8 THR J 252 ? TYR J 259 ? THR J 252 TYR J 259 1 ? 8  
HELX_P HELX_P216 AX9 ASN J 264 ? PHE J 273 ? ASN J 264 PHE J 273 1 ? 10 
HELX_P HELX_P217 AY1 SER J 284 ? PHE J 289 ? SER J 284 PHE J 289 5 ? 6  
HELX_P HELX_P218 AY2 VAL J 305 ? MET J 319 ? VAL J 305 MET J 319 1 ? 15 
HELX_P HELX_P219 AY3 GLN J 321 ? ASN J 326 ? GLN J 321 ASN J 326 1 ? 6  
HELX_P HELX_P220 AY4 ALA J 334 ? PHE J 350 ? ALA J 334 PHE J 350 1 ? 17 
HELX_P HELX_P221 AY5 ASP J 362 ? ALA J 371 ? ASP J 362 ALA J 371 1 ? 10 
HELX_P HELX_P222 AY6 SER J 401 ? ASN J 412 ? SER J 401 ASN J 412 1 ? 12 
HELX_P HELX_P223 AY7 LYS J 417 ? ASN J 430 ? LYS J 417 ASN J 430 1 ? 14 
HELX_P HELX_P224 AY8 SER J 437 ? TYR J 446 ? SER J 437 TYR J 446 1 ? 10 
HELX_P HELX_P225 AY9 ASP K 48  ? ALA K 62  ? ASP K 48  ALA K 62  1 ? 15 
HELX_P HELX_P226 AZ1 ASP K 66  ? MET K 78  ? ASP K 66  MET K 78  1 ? 13 
HELX_P HELX_P227 AZ2 THR K 104 ? LEU K 108 ? THR K 104 LEU K 108 5 ? 5  
HELX_P HELX_P228 AZ3 THR K 133 ? ILE K 153 ? THR K 133 ILE K 153 1 ? 21 
HELX_P HELX_P229 AZ4 THR K 158 ? THR K 175 ? THR K 158 THR K 175 1 ? 18 
HELX_P HELX_P230 AZ5 HIS K 185 ? MET K 193 ? HIS K 185 MET K 193 1 ? 9  
HELX_P HELX_P231 AZ6 ILE K 200 ? ILE K 217 ? ILE K 200 ILE K 217 1 ? 18 
HELX_P HELX_P232 AZ7 TYR K 221 ? ALA K 223 ? TYR K 221 ALA K 223 5 ? 3  
HELX_P HELX_P233 AZ8 ILE K 224 ? VAL K 229 ? ILE K 224 VAL K 229 1 ? 6  
HELX_P HELX_P234 AZ9 VAL K 230 ? ALA K 232 ? VAL K 230 ALA K 232 5 ? 3  
HELX_P HELX_P235 BA1 CYS K 236 ? ASN K 250 ? CYS K 236 ASN K 250 1 ? 15 
HELX_P HELX_P236 BA2 THR K 252 ? TYR K 259 ? THR K 252 TYR K 259 1 ? 8  
HELX_P HELX_P237 BA3 ASN K 264 ? PHE K 273 ? ASN K 264 PHE K 273 1 ? 10 
HELX_P HELX_P238 BA4 SER K 284 ? ILE K 287 ? SER K 284 ILE K 287 5 ? 4  
HELX_P HELX_P239 BA5 HIS K 288 ? GLY K 293 ? HIS K 288 GLY K 293 1 ? 6  
HELX_P HELX_P240 BA6 VAL K 305 ? GLY K 320 ? VAL K 305 GLY K 320 1 ? 16 
HELX_P HELX_P241 BA7 GLN K 321 ? ASN K 326 ? GLN K 321 ASN K 326 1 ? 6  
HELX_P HELX_P242 BA8 ALA K 334 ? PHE K 350 ? ALA K 334 PHE K 350 1 ? 17 
HELX_P HELX_P243 BA9 ASP K 362 ? ALA K 371 ? ASP K 362 ALA K 371 1 ? 10 
HELX_P HELX_P244 BB1 SER K 401 ? ASN K 412 ? SER K 401 ASN K 412 1 ? 12 
HELX_P HELX_P245 BB2 LYS K 417 ? ASN K 430 ? LYS K 417 ASN K 430 1 ? 14 
HELX_P HELX_P246 BB3 SER K 437 ? TYR K 446 ? SER K 437 TYR K 446 1 ? 10 
HELX_P HELX_P247 BB4 LEU L 49  ? ALA L 62  ? LEU L 49  ALA L 62  1 ? 14 
HELX_P HELX_P248 BB5 ASP L 66  ? MET L 78  ? ASP L 66  MET L 78  1 ? 13 
HELX_P HELX_P249 BB6 THR L 104 ? LEU L 108 ? THR L 104 LEU L 108 5 ? 5  
HELX_P HELX_P250 BB7 THR L 133 ? SER L 154 ? THR L 133 SER L 154 1 ? 22 
HELX_P HELX_P251 BB8 GLY L 159 ? ILE L 172 ? GLY L 159 ILE L 172 1 ? 14 
HELX_P HELX_P252 BB9 HIS L 185 ? CYS L 194 ? HIS L 185 CYS L 194 1 ? 10 
HELX_P HELX_P253 BC1 ASN L 196 ? THR L 199 ? ASN L 196 THR L 199 5 ? 4  
HELX_P HELX_P254 BC2 ILE L 200 ? ILE L 217 ? ILE L 200 ILE L 217 1 ? 18 
HELX_P HELX_P255 BC3 TYR L 221 ? ALA L 223 ? TYR L 221 ALA L 223 5 ? 3  
HELX_P HELX_P256 BC4 ILE L 224 ? VAL L 229 ? ILE L 224 VAL L 229 1 ? 6  
HELX_P HELX_P257 BC5 VAL L 230 ? ALA L 232 ? VAL L 230 ALA L 232 5 ? 3  
HELX_P HELX_P258 BC6 CYS L 236 ? ASN L 250 ? CYS L 236 ASN L 250 1 ? 15 
HELX_P HELX_P259 BC7 THR L 252 ? LEU L 258 ? THR L 252 LEU L 258 1 ? 7  
HELX_P HELX_P260 BC8 ASN L 264 ? PHE L 273 ? ASN L 264 PHE L 273 1 ? 10 
HELX_P HELX_P261 BC9 SER L 284 ? PHE L 289 ? SER L 284 PHE L 289 5 ? 6  
HELX_P HELX_P262 BD1 VAL L 305 ? MET L 319 ? VAL L 305 MET L 319 1 ? 15 
HELX_P HELX_P263 BD2 GLN L 321 ? ASN L 326 ? GLN L 321 ASN L 326 1 ? 6  
HELX_P HELX_P264 BD3 ALA L 334 ? PHE L 350 ? ALA L 334 PHE L 350 1 ? 17 
HELX_P HELX_P265 BD4 ASP L 362 ? ALA L 371 ? ASP L 362 ALA L 371 1 ? 10 
HELX_P HELX_P266 BD5 SER L 401 ? ASN L 412 ? SER L 401 ASN L 412 1 ? 12 
HELX_P HELX_P267 BD6 LYS L 417 ? ASN L 430 ? LYS L 417 ASN L 430 1 ? 14 
HELX_P HELX_P268 BD7 SER L 437 ? TYR L 446 ? SER L 437 TYR L 446 1 ? 10 
HELX_P HELX_P269 BD8 ASP M 48  ? ALA M 63  ? ASP M 48  ALA M 63  1 ? 16 
HELX_P HELX_P270 BD9 ASP M 66  ? PHE M 81  ? ASP M 66  PHE M 81  1 ? 16 
HELX_P HELX_P271 BE1 THR M 104 ? VAL M 109 ? THR M 104 VAL M 109 1 ? 6  
HELX_P HELX_P272 BE2 THR M 133 ? ILE M 153 ? THR M 133 ILE M 153 1 ? 21 
HELX_P HELX_P273 BE3 THR M 158 ? THR M 175 ? THR M 158 THR M 175 1 ? 18 
HELX_P HELX_P274 BE4 HIS M 185 ? CYS M 194 ? HIS M 185 CYS M 194 1 ? 10 
HELX_P HELX_P275 BE5 ILE M 200 ? ILE M 217 ? ILE M 200 ILE M 217 1 ? 18 
HELX_P HELX_P276 BE6 TYR M 221 ? VAL M 226 ? TYR M 221 VAL M 226 5 ? 6  
HELX_P HELX_P277 BE7 THR M 228 ? ALA M 232 ? THR M 228 ALA M 232 5 ? 5  
HELX_P HELX_P278 BE8 CYS M 236 ? ASN M 250 ? CYS M 236 ASN M 250 1 ? 15 
HELX_P HELX_P279 BE9 THR M 252 ? TYR M 259 ? THR M 252 TYR M 259 1 ? 8  
HELX_P HELX_P280 BF1 ASN M 264 ? PHE M 273 ? ASN M 264 PHE M 273 1 ? 10 
HELX_P HELX_P281 BF2 SER M 284 ? PHE M 289 ? SER M 284 PHE M 289 5 ? 6  
HELX_P HELX_P282 BF3 VAL M 305 ? GLY M 320 ? VAL M 305 GLY M 320 1 ? 16 
HELX_P HELX_P283 BF4 GLN M 321 ? ASN M 326 ? GLN M 321 ASN M 326 1 ? 6  
HELX_P HELX_P284 BF5 ALA M 334 ? PHE M 350 ? ALA M 334 PHE M 350 1 ? 17 
HELX_P HELX_P285 BF6 ASP M 362 ? ALA M 372 ? ASP M 362 ALA M 372 1 ? 11 
HELX_P HELX_P286 BF7 SER M 401 ? ASN M 412 ? SER M 401 ASN M 412 1 ? 12 
HELX_P HELX_P287 BF8 LYS M 417 ? ASN M 430 ? LYS M 417 ASN M 430 1 ? 14 
HELX_P HELX_P288 BF9 SER M 437 ? TYR M 446 ? SER M 437 TYR M 446 1 ? 10 
HELX_P HELX_P289 BG1 ASP N 48  ? ALA N 63  ? ASP N 48  ALA N 63  1 ? 16 
HELX_P HELX_P290 BG2 ASP N 66  ? MET N 78  ? ASP N 66  MET N 78  1 ? 13 
HELX_P HELX_P291 BG3 THR N 104 ? VAL N 109 ? THR N 104 VAL N 109 1 ? 6  
HELX_P HELX_P292 BG4 THR N 133 ? ILE N 153 ? THR N 133 ILE N 153 1 ? 21 
HELX_P HELX_P293 BG5 THR N 158 ? THR N 175 ? THR N 158 THR N 175 1 ? 18 
HELX_P HELX_P294 BG6 HIS N 185 ? CYS N 194 ? HIS N 185 CYS N 194 1 ? 10 
HELX_P HELX_P295 BG7 ASN N 196 ? THR N 199 ? ASN N 196 THR N 199 5 ? 4  
HELX_P HELX_P296 BG8 ILE N 200 ? ILE N 217 ? ILE N 200 ILE N 217 1 ? 18 
HELX_P HELX_P297 BG9 TYR N 221 ? ALA N 223 ? TYR N 221 ALA N 223 5 ? 3  
HELX_P HELX_P298 BH1 ILE N 224 ? VAL N 229 ? ILE N 224 VAL N 229 1 ? 6  
HELX_P HELX_P299 BH2 VAL N 230 ? ALA N 232 ? VAL N 230 ALA N 232 5 ? 3  
HELX_P HELX_P300 BH3 CYS N 236 ? ASN N 250 ? CYS N 236 ASN N 250 1 ? 15 
HELX_P HELX_P301 BH4 THR N 252 ? TYR N 259 ? THR N 252 TYR N 259 1 ? 8  
HELX_P HELX_P302 BH5 ASN N 264 ? PHE N 273 ? ASN N 264 PHE N 273 1 ? 10 
HELX_P HELX_P303 BH6 SER N 284 ? PHE N 289 ? SER N 284 PHE N 289 5 ? 6  
HELX_P HELX_P304 BH7 VAL N 305 ? GLY N 320 ? VAL N 305 GLY N 320 1 ? 16 
HELX_P HELX_P305 BH8 GLN N 321 ? ASN N 326 ? GLN N 321 ASN N 326 1 ? 6  
HELX_P HELX_P306 BH9 ALA N 334 ? PHE N 350 ? ALA N 334 PHE N 350 1 ? 17 
HELX_P HELX_P307 BI1 ASP N 362 ? ALA N 372 ? ASP N 362 ALA N 372 1 ? 11 
HELX_P HELX_P308 BI2 SER N 401 ? ASN N 412 ? SER N 401 ASN N 412 1 ? 12 
HELX_P HELX_P309 BI3 LYS N 417 ? ASN N 430 ? LYS N 417 ASN N 430 1 ? 14 
HELX_P HELX_P310 BI4 SER N 437 ? SER N 447 ? SER N 437 SER N 447 1 ? 11 
HELX_P HELX_P311 BI5 LYS O 51  ? ALA O 63  ? LYS O 51  ALA O 63  1 ? 13 
HELX_P HELX_P312 BI6 ASP O 66  ? MET O 78  ? ASP O 66  MET O 78  1 ? 13 
HELX_P HELX_P313 BI7 GLN O 79  ? PHE O 81  ? GLN O 79  PHE O 81  5 ? 3  
HELX_P HELX_P314 BI8 THR O 104 ? LEU O 108 ? THR O 104 LEU O 108 5 ? 5  
HELX_P HELX_P315 BI9 THR O 133 ? ILE O 153 ? THR O 133 ILE O 153 1 ? 21 
HELX_P HELX_P316 BJ1 THR O 158 ? THR O 175 ? THR O 158 THR O 175 1 ? 18 
HELX_P HELX_P317 BJ2 HIS O 185 ? CYS O 194 ? HIS O 185 CYS O 194 1 ? 10 
HELX_P HELX_P318 BJ3 ASN O 196 ? THR O 199 ? ASN O 196 THR O 199 5 ? 4  
HELX_P HELX_P319 BJ4 ILE O 200 ? ILE O 217 ? ILE O 200 ILE O 217 1 ? 18 
HELX_P HELX_P320 BJ5 TYR O 221 ? ALA O 223 ? TYR O 221 ALA O 223 5 ? 3  
HELX_P HELX_P321 BJ6 ILE O 224 ? VAL O 229 ? ILE O 224 VAL O 229 1 ? 6  
HELX_P HELX_P322 BJ7 VAL O 230 ? ALA O 232 ? VAL O 230 ALA O 232 5 ? 3  
HELX_P HELX_P323 BJ8 CYS O 236 ? ASN O 250 ? CYS O 236 ASN O 250 1 ? 15 
HELX_P HELX_P324 BJ9 ALA O 256 ? PHE O 260 ? ALA O 256 PHE O 260 5 ? 5  
HELX_P HELX_P325 BK1 ASN O 264 ? PHE O 273 ? ASN O 264 PHE O 273 1 ? 10 
HELX_P HELX_P326 BK2 SER O 284 ? PHE O 289 ? SER O 284 PHE O 289 5 ? 6  
HELX_P HELX_P327 BK3 VAL O 305 ? MET O 319 ? VAL O 305 MET O 319 1 ? 15 
HELX_P HELX_P328 BK4 GLN O 321 ? ASN O 326 ? GLN O 321 ASN O 326 1 ? 6  
HELX_P HELX_P329 BK5 ALA O 334 ? PHE O 350 ? ALA O 334 PHE O 350 1 ? 17 
HELX_P HELX_P330 BK6 ASP O 362 ? ALA O 371 ? ASP O 362 ALA O 371 1 ? 10 
HELX_P HELX_P331 BK7 SER O 401 ? ASN O 412 ? SER O 401 ASN O 412 1 ? 12 
HELX_P HELX_P332 BK8 LYS O 417 ? ASN O 430 ? LYS O 417 ASN O 430 1 ? 14 
HELX_P HELX_P333 BK9 SER O 437 ? TYR O 446 ? SER O 437 TYR O 446 1 ? 10 
HELX_P HELX_P334 BL1 ASP P 48  ? ALA P 62  ? ASP P 48  ALA P 62  1 ? 15 
HELX_P HELX_P335 BL2 ASP P 66  ? ALA P 77  ? ASP P 66  ALA P 77  1 ? 12 
HELX_P HELX_P336 BL3 MET P 78  ? PHE P 80  ? MET P 78  PHE P 80  5 ? 3  
HELX_P HELX_P337 BL4 THR P 104 ? VAL P 109 ? THR P 104 VAL P 109 1 ? 6  
HELX_P HELX_P338 BL5 THR P 133 ? ILE P 153 ? THR P 133 ILE P 153 1 ? 21 
HELX_P HELX_P339 BL6 GLY P 159 ? THR P 175 ? GLY P 159 THR P 175 1 ? 17 
HELX_P HELX_P340 BL7 HIS P 185 ? CYS P 194 ? HIS P 185 CYS P 194 1 ? 10 
HELX_P HELX_P341 BL8 ASN P 196 ? THR P 199 ? ASN P 196 THR P 199 5 ? 4  
HELX_P HELX_P342 BL9 ILE P 200 ? ILE P 217 ? ILE P 200 ILE P 217 1 ? 18 
HELX_P HELX_P343 BM1 TYR P 221 ? ALA P 223 ? TYR P 221 ALA P 223 5 ? 3  
HELX_P HELX_P344 BM2 ILE P 224 ? VAL P 229 ? ILE P 224 VAL P 229 1 ? 6  
HELX_P HELX_P345 BM3 VAL P 230 ? ALA P 232 ? VAL P 230 ALA P 232 5 ? 3  
HELX_P HELX_P346 BM4 CYS P 236 ? ASN P 250 ? CYS P 236 ASN P 250 1 ? 15 
HELX_P HELX_P347 BM5 THR P 252 ? TYR P 259 ? THR P 252 TYR P 259 1 ? 8  
HELX_P HELX_P348 BM6 ASN P 264 ? PHE P 273 ? ASN P 264 PHE P 273 1 ? 10 
HELX_P HELX_P349 BM7 SER P 284 ? PHE P 289 ? SER P 284 PHE P 289 5 ? 6  
HELX_P HELX_P350 BM8 VAL P 305 ? GLY P 320 ? VAL P 305 GLY P 320 1 ? 16 
HELX_P HELX_P351 BM9 GLN P 321 ? ASN P 326 ? GLN P 321 ASN P 326 1 ? 6  
HELX_P HELX_P352 BN1 ALA P 334 ? PHE P 350 ? ALA P 334 PHE P 350 1 ? 17 
HELX_P HELX_P353 BN2 ASP P 362 ? ALA P 371 ? ASP P 362 ALA P 371 1 ? 10 
HELX_P HELX_P354 BN3 SER P 401 ? ASN P 412 ? SER P 401 ASN P 412 1 ? 12 
HELX_P HELX_P355 BN4 LYS P 417 ? ASN P 430 ? LYS P 417 ASN P 430 1 ? 14 
HELX_P HELX_P356 BN5 SER P 437 ? TYR P 446 ? SER P 437 TYR P 446 1 ? 10 
HELX_P HELX_P357 BN6 ASP Q 48  ? ALA Q 63  ? ASP Q 48  ALA Q 63  1 ? 16 
HELX_P HELX_P358 BN7 ASP Q 66  ? ALA Q 77  ? ASP Q 66  ALA Q 77  1 ? 12 
HELX_P HELX_P359 BN8 MET Q 78  ? PHE Q 80  ? MET Q 78  PHE Q 80  5 ? 3  
HELX_P HELX_P360 BN9 ILE Q 103 ? VAL Q 109 ? ILE Q 103 VAL Q 109 1 ? 7  
HELX_P HELX_P361 BO1 THR Q 133 ? ILE Q 153 ? THR Q 133 ILE Q 153 1 ? 21 
HELX_P HELX_P362 BO2 THR Q 158 ? THR Q 175 ? THR Q 158 THR Q 175 1 ? 18 
HELX_P HELX_P363 BO3 HIS Q 185 ? CYS Q 194 ? HIS Q 185 CYS Q 194 1 ? 10 
HELX_P HELX_P364 BO4 ASN Q 196 ? THR Q 199 ? ASN Q 196 THR Q 199 5 ? 4  
HELX_P HELX_P365 BO5 ILE Q 200 ? ILE Q 217 ? ILE Q 200 ILE Q 217 1 ? 18 
HELX_P HELX_P366 BO6 TYR Q 221 ? ALA Q 223 ? TYR Q 221 ALA Q 223 5 ? 3  
HELX_P HELX_P367 BO7 ILE Q 224 ? VAL Q 229 ? ILE Q 224 VAL Q 229 1 ? 6  
HELX_P HELX_P368 BO8 VAL Q 230 ? ALA Q 232 ? VAL Q 230 ALA Q 232 5 ? 3  
HELX_P HELX_P369 BO9 CYS Q 236 ? ASN Q 250 ? CYS Q 236 ASN Q 250 1 ? 15 
HELX_P HELX_P370 BP1 THR Q 252 ? TYR Q 259 ? THR Q 252 TYR Q 259 1 ? 8  
HELX_P HELX_P371 BP2 ASN Q 264 ? PHE Q 273 ? ASN Q 264 PHE Q 273 1 ? 10 
HELX_P HELX_P372 BP3 TYR Q 285 ? PHE Q 289 ? TYR Q 285 PHE Q 289 5 ? 5  
HELX_P HELX_P373 BP4 VAL Q 305 ? GLY Q 320 ? VAL Q 305 GLY Q 320 1 ? 16 
HELX_P HELX_P374 BP5 GLN Q 321 ? ASN Q 326 ? GLN Q 321 ASN Q 326 1 ? 6  
HELX_P HELX_P375 BP6 ALA Q 334 ? PHE Q 350 ? ALA Q 334 PHE Q 350 1 ? 17 
HELX_P HELX_P376 BP7 ASP Q 362 ? ALA Q 371 ? ASP Q 362 ALA Q 371 1 ? 10 
HELX_P HELX_P377 BP8 SER Q 401 ? ASN Q 412 ? SER Q 401 ASN Q 412 1 ? 12 
HELX_P HELX_P378 BP9 LYS Q 417 ? ASN Q 430 ? LYS Q 417 ASN Q 430 1 ? 14 
HELX_P HELX_P379 BQ1 SER Q 437 ? TYR Q 446 ? SER Q 437 TYR Q 446 1 ? 10 
HELX_P HELX_P380 BQ2 LEU R 49  ? ALA R 62  ? LEU R 49  ALA R 62  1 ? 14 
HELX_P HELX_P381 BQ3 ASP R 66  ? ALA R 77  ? ASP R 66  ALA R 77  1 ? 12 
HELX_P HELX_P382 BQ4 MET R 78  ? PHE R 81  ? MET R 78  PHE R 81  5 ? 4  
HELX_P HELX_P383 BQ5 THR R 104 ? LEU R 108 ? THR R 104 LEU R 108 5 ? 5  
HELX_P HELX_P384 BQ6 THR R 133 ? ILE R 153 ? THR R 133 ILE R 153 1 ? 21 
HELX_P HELX_P385 BQ7 THR R 158 ? THR R 175 ? THR R 158 THR R 175 1 ? 18 
HELX_P HELX_P386 BQ8 HIS R 185 ? CYS R 194 ? HIS R 185 CYS R 194 1 ? 10 
HELX_P HELX_P387 BQ9 ASN R 196 ? THR R 199 ? ASN R 196 THR R 199 5 ? 4  
HELX_P HELX_P388 BR1 ILE R 200 ? ILE R 217 ? ILE R 200 ILE R 217 1 ? 18 
HELX_P HELX_P389 BR2 TYR R 221 ? ALA R 223 ? TYR R 221 ALA R 223 5 ? 3  
HELX_P HELX_P390 BR3 ILE R 224 ? VAL R 229 ? ILE R 224 VAL R 229 1 ? 6  
HELX_P HELX_P391 BR4 VAL R 230 ? ALA R 232 ? VAL R 230 ALA R 232 5 ? 3  
HELX_P HELX_P392 BR5 CYS R 236 ? ASN R 250 ? CYS R 236 ASN R 250 1 ? 15 
HELX_P HELX_P393 BR6 THR R 252 ? LEU R 258 ? THR R 252 LEU R 258 1 ? 7  
HELX_P HELX_P394 BR7 ASN R 264 ? PHE R 273 ? ASN R 264 PHE R 273 1 ? 10 
HELX_P HELX_P395 BR8 TYR R 285 ? PHE R 289 ? TYR R 285 PHE R 289 5 ? 5  
HELX_P HELX_P396 BR9 VAL R 305 ? MET R 319 ? VAL R 305 MET R 319 1 ? 15 
HELX_P HELX_P397 BS1 GLN R 321 ? ALA R 327 ? GLN R 321 ALA R 327 1 ? 7  
HELX_P HELX_P398 BS2 ALA R 334 ? PHE R 350 ? ALA R 334 PHE R 350 1 ? 17 
HELX_P HELX_P399 BS3 ASP R 362 ? ALA R 371 ? ASP R 362 ALA R 371 1 ? 10 
HELX_P HELX_P400 BS4 SER R 401 ? ASN R 412 ? SER R 401 ASN R 412 1 ? 12 
HELX_P HELX_P401 BS5 LYS R 417 ? ASN R 430 ? LYS R 417 ASN R 430 1 ? 14 
HELX_P HELX_P402 BS6 SER R 437 ? TYR R 446 ? SER R 437 TYR R 446 1 ? 10 
HELX_P HELX_P403 BS7 ASP S 48  ? ALA S 63  ? ASP S 48  ALA S 63  1 ? 16 
HELX_P HELX_P404 BS8 ASP S 66  ? MET S 78  ? ASP S 66  MET S 78  1 ? 13 
HELX_P HELX_P405 BS9 THR S 133 ? SER S 154 ? THR S 133 SER S 154 1 ? 22 
HELX_P HELX_P406 BT1 THR S 158 ? THR S 175 ? THR S 158 THR S 175 1 ? 18 
HELX_P HELX_P407 BT2 HIS S 185 ? CYS S 194 ? HIS S 185 CYS S 194 1 ? 10 
HELX_P HELX_P408 BT3 ASN S 196 ? THR S 199 ? ASN S 196 THR S 199 5 ? 4  
HELX_P HELX_P409 BT4 ILE S 200 ? ILE S 217 ? ILE S 200 ILE S 217 1 ? 18 
HELX_P HELX_P410 BT5 TYR S 221 ? ALA S 223 ? TYR S 221 ALA S 223 5 ? 3  
HELX_P HELX_P411 BT6 ILE S 224 ? VAL S 229 ? ILE S 224 VAL S 229 1 ? 6  
HELX_P HELX_P412 BT7 VAL S 230 ? ALA S 232 ? VAL S 230 ALA S 232 5 ? 3  
HELX_P HELX_P413 BT8 CYS S 236 ? ASN S 250 ? CYS S 236 ASN S 250 1 ? 15 
HELX_P HELX_P414 BT9 THR S 252 ? TYR S 259 ? THR S 252 TYR S 259 1 ? 8  
HELX_P HELX_P415 BU1 ASN S 264 ? PHE S 273 ? ASN S 264 PHE S 273 1 ? 10 
HELX_P HELX_P416 BU2 SER S 284 ? PHE S 289 ? SER S 284 PHE S 289 5 ? 6  
HELX_P HELX_P417 BU3 VAL S 305 ? MET S 319 ? VAL S 305 MET S 319 1 ? 15 
HELX_P HELX_P418 BU4 GLN S 321 ? ASN S 326 ? GLN S 321 ASN S 326 1 ? 6  
HELX_P HELX_P419 BU5 ALA S 334 ? PHE S 350 ? ALA S 334 PHE S 350 1 ? 17 
HELX_P HELX_P420 BU6 ASP S 362 ? ALA S 372 ? ASP S 362 ALA S 372 1 ? 11 
HELX_P HELX_P421 BU7 SER S 401 ? ASN S 412 ? SER S 401 ASN S 412 1 ? 12 
HELX_P HELX_P422 BU8 LYS S 417 ? ASN S 430 ? LYS S 417 ASN S 430 1 ? 14 
HELX_P HELX_P423 BU9 SER S 437 ? TYR S 446 ? SER S 437 TYR S 446 1 ? 10 
HELX_P HELX_P424 BV1 ASP T 48  ? ALA T 63  ? ASP T 48  ALA T 63  1 ? 16 
HELX_P HELX_P425 BV2 ASP T 66  ? MET T 78  ? ASP T 66  MET T 78  1 ? 13 
HELX_P HELX_P426 BV3 GLN T 79  ? PHE T 81  ? GLN T 79  PHE T 81  5 ? 3  
HELX_P HELX_P427 BV4 THR T 104 ? LEU T 108 ? THR T 104 LEU T 108 5 ? 5  
HELX_P HELX_P428 BV5 THR T 133 ? ILE T 153 ? THR T 133 ILE T 153 1 ? 21 
HELX_P HELX_P429 BV6 THR T 158 ? GLU T 174 ? THR T 158 GLU T 174 1 ? 17 
HELX_P HELX_P430 BV7 HIS T 185 ? CYS T 194 ? HIS T 185 CYS T 194 1 ? 10 
HELX_P HELX_P431 BV8 ASN T 196 ? THR T 199 ? ASN T 196 THR T 199 5 ? 4  
HELX_P HELX_P432 BV9 ILE T 200 ? ILE T 217 ? ILE T 200 ILE T 217 1 ? 18 
HELX_P HELX_P433 BW1 TYR T 221 ? ALA T 223 ? TYR T 221 ALA T 223 5 ? 3  
HELX_P HELX_P434 BW2 ILE T 224 ? VAL T 229 ? ILE T 224 VAL T 229 1 ? 6  
HELX_P HELX_P435 BW3 VAL T 230 ? ALA T 232 ? VAL T 230 ALA T 232 5 ? 3  
HELX_P HELX_P436 BW4 CYS T 236 ? ASN T 250 ? CYS T 236 ASN T 250 1 ? 15 
HELX_P HELX_P437 BW5 THR T 252 ? TYR T 259 ? THR T 252 TYR T 259 1 ? 8  
HELX_P HELX_P438 BW6 ASN T 264 ? PHE T 273 ? ASN T 264 PHE T 273 1 ? 10 
HELX_P HELX_P439 BW7 SER T 284 ? PHE T 289 ? SER T 284 PHE T 289 5 ? 6  
HELX_P HELX_P440 BW8 VAL T 305 ? MET T 319 ? VAL T 305 MET T 319 1 ? 15 
HELX_P HELX_P441 BW9 GLN T 321 ? ALA T 327 ? GLN T 321 ALA T 327 1 ? 7  
HELX_P HELX_P442 BX1 ALA T 334 ? PHE T 350 ? ALA T 334 PHE T 350 1 ? 17 
HELX_P HELX_P443 BX2 ASP T 362 ? ALA T 371 ? ASP T 362 ALA T 371 1 ? 10 
HELX_P HELX_P444 BX3 SER T 401 ? ASN T 412 ? SER T 401 ASN T 412 1 ? 12 
HELX_P HELX_P445 BX4 LYS T 417 ? ASN T 430 ? LYS T 417 ASN T 430 1 ? 14 
HELX_P HELX_P446 BX5 SER T 437 ? TYR T 446 ? SER T 437 TYR T 446 1 ? 10 
HELX_P HELX_P447 BX6 ASP U 48  ? ALA U 62  ? ASP U 48  ALA U 62  1 ? 15 
HELX_P HELX_P448 BX7 ASP U 66  ? ALA U 77  ? ASP U 66  ALA U 77  1 ? 12 
HELX_P HELX_P449 BX8 MET U 78  ? PHE U 81  ? MET U 78  PHE U 81  5 ? 4  
HELX_P HELX_P450 BX9 THR U 104 ? VAL U 109 ? THR U 104 VAL U 109 1 ? 6  
HELX_P HELX_P451 BY1 THR U 133 ? ILE U 153 ? THR U 133 ILE U 153 1 ? 21 
HELX_P HELX_P452 BY2 GLY U 159 ? THR U 175 ? GLY U 159 THR U 175 1 ? 17 
HELX_P HELX_P453 BY3 HIS U 185 ? CYS U 194 ? HIS U 185 CYS U 194 1 ? 10 
HELX_P HELX_P454 BY4 ALA U 195 ? THR U 199 ? ALA U 195 THR U 199 5 ? 5  
HELX_P HELX_P455 BY5 ILE U 200 ? ILE U 217 ? ILE U 200 ILE U 217 1 ? 18 
HELX_P HELX_P456 BY6 TYR U 221 ? ALA U 223 ? TYR U 221 ALA U 223 5 ? 3  
HELX_P HELX_P457 BY7 ILE U 224 ? VAL U 229 ? ILE U 224 VAL U 229 1 ? 6  
HELX_P HELX_P458 BY8 VAL U 230 ? ALA U 232 ? VAL U 230 ALA U 232 5 ? 3  
HELX_P HELX_P459 BY9 CYS U 236 ? ASN U 250 ? CYS U 236 ASN U 250 1 ? 15 
HELX_P HELX_P460 BZ1 THR U 252 ? TYR U 259 ? THR U 252 TYR U 259 1 ? 8  
HELX_P HELX_P461 BZ2 ASN U 264 ? PHE U 273 ? ASN U 264 PHE U 273 1 ? 10 
HELX_P HELX_P462 BZ3 SER U 284 ? PHE U 289 ? SER U 284 PHE U 289 5 ? 6  
HELX_P HELX_P463 BZ4 VAL U 305 ? GLY U 320 ? VAL U 305 GLY U 320 1 ? 16 
HELX_P HELX_P464 BZ5 GLN U 321 ? ALA U 327 ? GLN U 321 ALA U 327 1 ? 7  
HELX_P HELX_P465 BZ6 ALA U 334 ? PHE U 350 ? ALA U 334 PHE U 350 1 ? 17 
HELX_P HELX_P466 BZ7 ASP U 362 ? ALA U 372 ? ASP U 362 ALA U 372 1 ? 11 
HELX_P HELX_P467 BZ8 SER U 401 ? ASN U 412 ? SER U 401 ASN U 412 1 ? 12 
HELX_P HELX_P468 BZ9 LYS U 417 ? ASN U 430 ? LYS U 417 ASN U 430 1 ? 14 
HELX_P HELX_P469 CA1 SER U 437 ? TYR U 446 ? SER U 437 TYR U 446 1 ? 10 
HELX_P HELX_P470 CA2 ASP V 48  ? ALA V 62  ? ASP V 48  ALA V 62  1 ? 15 
HELX_P HELX_P471 CA3 ASP V 66  ? MET V 78  ? ASP V 66  MET V 78  1 ? 13 
HELX_P HELX_P472 CA4 THR V 104 ? VAL V 109 ? THR V 104 VAL V 109 1 ? 6  
HELX_P HELX_P473 CA5 THR V 133 ? ILE V 153 ? THR V 133 ILE V 153 1 ? 21 
HELX_P HELX_P474 CA6 THR V 158 ? THR V 175 ? THR V 158 THR V 175 1 ? 18 
HELX_P HELX_P475 CA7 HIS V 185 ? CYS V 194 ? HIS V 185 CYS V 194 1 ? 10 
HELX_P HELX_P476 CA8 ASN V 196 ? THR V 199 ? ASN V 196 THR V 199 5 ? 4  
HELX_P HELX_P477 CA9 ILE V 200 ? ILE V 217 ? ILE V 200 ILE V 217 1 ? 18 
HELX_P HELX_P478 CB1 TYR V 221 ? ALA V 223 ? TYR V 221 ALA V 223 5 ? 3  
HELX_P HELX_P479 CB2 ILE V 224 ? VAL V 229 ? ILE V 224 VAL V 229 1 ? 6  
HELX_P HELX_P480 CB3 VAL V 230 ? ALA V 232 ? VAL V 230 ALA V 232 5 ? 3  
HELX_P HELX_P481 CB4 CYS V 236 ? ASN V 250 ? CYS V 236 ASN V 250 1 ? 15 
HELX_P HELX_P482 CB5 THR V 252 ? PHE V 260 ? THR V 252 PHE V 260 1 ? 9  
HELX_P HELX_P483 CB6 HIS V 262 ? PHE V 273 ? HIS V 262 PHE V 273 1 ? 12 
HELX_P HELX_P484 CB7 SER V 284 ? PHE V 289 ? SER V 284 PHE V 289 5 ? 6  
HELX_P HELX_P485 CB8 VAL V 305 ? MET V 319 ? VAL V 305 MET V 319 1 ? 15 
HELX_P HELX_P486 CB9 GLN V 321 ? ASN V 326 ? GLN V 321 ASN V 326 1 ? 6  
HELX_P HELX_P487 CC1 ALA V 334 ? PHE V 350 ? ALA V 334 PHE V 350 1 ? 17 
HELX_P HELX_P488 CC2 ASP V 362 ? ALA V 372 ? ASP V 362 ALA V 372 1 ? 11 
HELX_P HELX_P489 CC3 SER V 401 ? ASN V 412 ? SER V 401 ASN V 412 1 ? 12 
HELX_P HELX_P490 CC4 LYS V 417 ? ASN V 430 ? LYS V 417 ASN V 430 1 ? 14 
HELX_P HELX_P491 CC5 SER V 437 ? TYR V 446 ? SER V 437 TYR V 446 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 176 A . ? ALA 176 A PRO 177 A ? PRO 177 A 1 9.30  
2  ALA 176 B . ? ALA 176 B PRO 177 B ? PRO 177 B 1 7.45  
3  ALA 176 D . ? ALA 176 D PRO 177 D ? PRO 177 D 1 8.14  
4  ALA 176 F . ? ALA 176 F PRO 177 F ? PRO 177 F 1 15.52 
5  ALA 176 G . ? ALA 176 G PRO 177 G ? PRO 177 G 1 14.58 
6  ALA 176 H . ? ALA 176 H PRO 177 H ? PRO 177 H 1 10.21 
7  ALA 176 I . ? ALA 176 I PRO 177 I ? PRO 177 I 1 14.36 
8  ALA 176 J . ? ALA 176 J PRO 177 J ? PRO 177 J 1 0.84  
9  ALA 176 K . ? ALA 176 K PRO 177 K ? PRO 177 K 1 6.89  
10 ALA 176 L . ? ALA 176 L PRO 177 L ? PRO 177 L 1 12.61 
11 ALA 176 M . ? ALA 176 M PRO 177 M ? PRO 177 M 1 8.72  
12 ALA 176 O . ? ALA 176 O PRO 177 O ? PRO 177 O 1 11.91 
13 ALA 176 P . ? ALA 176 P PRO 177 P ? PRO 177 P 1 19.31 
14 ALA 176 Q . ? ALA 176 Q PRO 177 Q ? PRO 177 Q 1 17.55 
15 ALA 176 R . ? ALA 176 R PRO 177 R ? PRO 177 R 1 12.40 
16 ALA 176 S . ? ALA 176 S PRO 177 S ? PRO 177 S 1 17.11 
17 ALA 176 T . ? ALA 176 T PRO 177 T ? PRO 177 T 1 12.54 
18 ALA 176 U . ? ALA 176 U PRO 177 U ? PRO 177 U 1 9.90  
19 ALA 176 V . ? ALA 176 V PRO 177 V ? PRO 177 V 1 13.75 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 3 ? 
AA6 ? 3 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 3 ? 
AB5 ? 2 ? 
AB6 ? 2 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 2 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 2 ? 
AC7 ? 2 ? 
AC8 ? 2 ? 
AC9 ? 2 ? 
AD1 ? 3 ? 
AD2 ? 2 ? 
AD3 ? 2 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 2 ? 
AE1 ? 2 ? 
AE2 ? 3 ? 
AE3 ? 2 ? 
AE4 ? 2 ? 
AE5 ? 2 ? 
AE6 ? 2 ? 
AE7 ? 2 ? 
AE8 ? 2 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 3 ? 
AF5 ? 2 ? 
AF6 ? 2 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
AF9 ? 3 ? 
AG1 ? 2 ? 
AG2 ? 2 ? 
AG3 ? 2 ? 
AG4 ? 3 ? 
AG5 ? 2 ? 
AG6 ? 2 ? 
AG7 ? 2 ? 
AG8 ? 2 ? 
AG9 ? 2 ? 
AH1 ? 2 ? 
AH2 ? 2 ? 
AH3 ? 3 ? 
AH4 ? 2 ? 
AH5 ? 2 ? 
AH6 ? 2 ? 
AH7 ? 2 ? 
AH8 ? 2 ? 
AH9 ? 2 ? 
AI1 ? 2 ? 
AI2 ? 2 ? 
AI3 ? 2 ? 
AI4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? parallel      
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? parallel      
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? parallel      
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? parallel      
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? parallel      
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? parallel      
AC7 1 2 ? anti-parallel 
AC8 1 2 ? parallel      
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? parallel      
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? parallel      
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? parallel      
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AF1 1 2 ? parallel      
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF4 2 3 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? parallel      
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AG1 1 2 ? parallel      
AG2 1 2 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG4 2 3 ? anti-parallel 
AG5 1 2 ? parallel      
AG6 1 2 ? parallel      
AG7 1 2 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? anti-parallel 
AH2 1 2 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH3 2 3 ? anti-parallel 
AH4 1 2 ? parallel      
AH5 1 2 ? anti-parallel 
AH6 1 2 ? anti-parallel 
AH7 1 2 ? parallel      
AH8 1 2 ? anti-parallel 
AH9 1 2 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI2 1 2 ? parallel      
AI3 1 2 ? anti-parallel 
AI4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 15  ? PRO A 19  ? VAL A 15  PRO A 19  
AA1 2 VAL A 7   ? ASN A 11  ? VAL A 7   ASN A 11  
AA1 3 PHE J 359 ? PHE J 360 ? PHE J 359 PHE J 360 
AA2 1 CYS A 40  ? LEU A 43  ? CYS A 40  LEU A 43  
AA2 2 GLU A 110 ? ARG A 113 ? GLU A 110 ARG A 113 
AA3 1 GLY A 83  ? THR A 84  ? GLY A 83  THR A 84  
AA3 2 LYS A 102 ? ILE A 103 ? LYS A 102 ILE A 103 
AA4 1 TRP A 89  ? THR A 90  ? TRP A 89  THR A 90  
AA4 2 VAL A 95  ? ALA A 97  ? VAL A 95  ALA A 97  
AA5 1 PHE A 359 ? PHE A 360 ? PHE A 359 PHE A 360 
AA5 2 VAL C 7   ? VAL C 10  ? VAL C 7   VAL C 10  
AA5 3 SER C 16  ? PRO C 19  ? SER C 16  PRO C 19  
AA6 1 VAL B 15  ? LYS B 18  ? VAL B 15  LYS B 18  
AA6 2 PHE B 8   ? ASN B 11  ? PHE B 8   ASN B 11  
AA6 3 PHE K 359 ? PHE K 360 ? PHE K 359 PHE K 360 
AA7 1 CYS B 40  ? LEU B 43  ? CYS B 40  LEU B 43  
AA7 2 GLU B 110 ? ARG B 113 ? GLU B 110 ARG B 113 
AA8 1 GLY B 83  ? THR B 84  ? GLY B 83  THR B 84  
AA8 2 LYS B 102 ? ILE B 103 ? LYS B 102 ILE B 103 
AA9 1 TRP B 89  ? THR B 90  ? TRP B 89  THR B 90  
AA9 2 VAL B 95  ? ALA B 97  ? VAL B 95  ALA B 97  
AB1 1 THR C 42  ? LEU C 43  ? THR C 42  LEU C 43  
AB1 2 LYS C 112 ? ARG C 113 ? LYS C 112 ARG C 113 
AB2 1 GLY C 83  ? THR C 84  ? GLY C 83  THR C 84  
AB2 2 LYS C 102 ? ILE C 103 ? LYS C 102 ILE C 103 
AB3 1 GLY C 124 ? MET C 126 ? GLY C 124 MET C 126 
AB3 2 LEU U 122 ? GLY U 125 ? LEU U 122 GLY U 125 
AB4 1 PHE C 359 ? PHE C 360 ? PHE C 359 PHE C 360 
AB4 2 PHE E 8   ? ASN E 11  ? PHE E 8   ASN E 11  
AB4 3 VAL E 15  ? LYS E 18  ? VAL E 15  LYS E 18  
AB5 1 CYS D 40  ? LEU D 43  ? CYS D 40  LEU D 43  
AB5 2 GLU D 110 ? ARG D 113 ? GLU D 110 ARG D 113 
AB6 1 GLY D 83  ? THR D 84  ? GLY D 83  THR D 84  
AB6 2 LYS D 102 ? ILE D 103 ? LYS D 102 ILE D 103 
AB7 1 TRP D 89  ? SER D 91  ? TRP D 89  SER D 91  
AB7 2 ILE D 94  ? ALA D 97  ? ILE D 94  ALA D 97  
AB8 1 PHE D 359 ? PHE D 360 ? PHE D 359 PHE D 360 
AB8 2 LYS F 9   ? ASN F 11  ? LYS F 9   ASN F 11  
AB8 3 VAL F 15  ? LEU F 17  ? VAL F 15  LEU F 17  
AB9 1 CYS E 40  ? LEU E 43  ? CYS E 40  LEU E 43  
AB9 2 GLU E 110 ? ARG E 113 ? GLU E 110 ARG E 113 
AC1 1 GLY E 83  ? THR E 84  ? GLY E 83  THR E 84  
AC1 2 LYS E 102 ? ILE E 103 ? LYS E 102 ILE E 103 
AC2 1 PHE E 359 ? PHE E 360 ? PHE E 359 PHE E 360 
AC2 2 LYS G 9   ? ASN G 11  ? LYS G 9   ASN G 11  
AC2 3 VAL G 15  ? LEU G 17  ? VAL G 15  LEU G 17  
AC3 1 CYS F 40  ? LEU F 43  ? CYS F 40  LEU F 43  
AC3 2 GLU F 110 ? ARG F 113 ? GLU F 110 ARG F 113 
AC4 1 GLY F 83  ? THR F 84  ? GLY F 83  THR F 84  
AC4 2 LYS F 102 ? ILE F 103 ? LYS F 102 ILE F 103 
AC5 1 PHE F 359 ? PHE F 360 ? PHE F 359 PHE F 360 
AC5 2 LYS H 9   ? VAL H 10  ? LYS H 9   VAL H 10  
AC6 1 CYS G 40  ? LEU G 43  ? CYS G 40  LEU G 43  
AC6 2 GLU G 110 ? ARG G 113 ? GLU G 110 ARG G 113 
AC7 1 GLY G 83  ? THR G 84  ? GLY G 83  THR G 84  
AC7 2 LYS G 102 ? ILE G 103 ? LYS G 102 ILE G 103 
AC8 1 CYS H 40  ? LEU H 43  ? CYS H 40  LEU H 43  
AC8 2 GLU H 110 ? ARG H 113 ? GLU H 110 ARG H 113 
AC9 1 GLY H 83  ? THR H 84  ? GLY H 83  THR H 84  
AC9 2 LYS H 102 ? ILE H 103 ? LYS H 102 ILE H 103 
AD1 1 PHE H 359 ? PHE H 360 ? PHE H 359 PHE H 360 
AD1 2 LYS J 9   ? VAL J 10  ? LYS J 9   VAL J 10  
AD1 3 SER J 16  ? LEU J 17  ? SER J 16  LEU J 17  
AD2 1 CYS I 40  ? LEU I 43  ? CYS I 40  LEU I 43  
AD2 2 GLU I 110 ? ARG I 113 ? GLU I 110 ARG I 113 
AD3 1 GLY I 83  ? THR I 84  ? GLY I 83  THR I 84  
AD3 2 LYS I 102 ? ILE I 103 ? LYS I 102 ILE I 103 
AD4 1 TRP I 89  ? SER I 91  ? TRP I 89  SER I 91  
AD4 2 ILE I 94  ? ALA I 97  ? ILE I 94  ALA I 97  
AD5 1 PHE I 359 ? PHE I 360 ? PHE I 359 PHE I 360 
AD5 2 PHE K 8   ? ASN K 11  ? PHE K 8   ASN K 11  
AD5 3 VAL K 15  ? LYS K 18  ? VAL K 15  LYS K 18  
AD6 1 CYS J 40  ? ILE J 41  ? CYS J 40  ILE J 41  
AD6 2 GLU J 110 ? ILE J 111 ? GLU J 110 ILE J 111 
AD7 1 GLY J 83  ? THR J 84  ? GLY J 83  THR J 84  
AD7 2 LYS J 102 ? ILE J 103 ? LYS J 102 ILE J 103 
AD8 1 TRP J 89  ? SER J 91  ? TRP J 89  SER J 91  
AD8 2 ILE J 94  ? ALA J 97  ? ILE J 94  ALA J 97  
AD9 1 GLY K 83  ? THR K 84  ? GLY K 83  THR K 84  
AD9 2 LYS K 102 ? ILE K 103 ? LYS K 102 ILE K 103 
AE1 1 TRP K 89  ? SER K 91  ? TRP K 89  SER K 91  
AE1 2 ILE K 94  ? ALA K 97  ? ILE K 94  ALA K 97  
AE2 1 VAL L 15  ? LYS L 18  ? VAL L 15  LYS L 18  
AE2 2 PHE L 8   ? ASN L 11  ? PHE L 8   ASN L 11  
AE2 3 PHE T 359 ? PHE T 360 ? PHE T 359 PHE T 360 
AE3 1 CYS L 40  ? LEU L 43  ? CYS L 40  LEU L 43  
AE3 2 GLU L 110 ? ARG L 113 ? GLU L 110 ARG L 113 
AE4 1 GLY L 83  ? THR L 84  ? GLY L 83  THR L 84  
AE4 2 LYS L 102 ? ILE L 103 ? LYS L 102 ILE L 103 
AE5 1 TRP L 89  ? SER L 91  ? TRP L 89  SER L 91  
AE5 2 ILE L 94  ? ALA L 97  ? ILE L 94  ALA L 97  
AE6 1 PHE M 8   ? LYS M 9   ? PHE M 8   LYS M 9   
AE6 2 LEU M 17  ? LYS M 18  ? LEU M 17  LYS M 18  
AE7 1 GLY M 83  ? THR M 84  ? GLY M 83  THR M 84  
AE7 2 LYS M 102 ? ILE M 103 ? LYS M 102 ILE M 103 
AE8 1 TRP M 89  ? THR M 90  ? TRP M 89  THR M 90  
AE8 2 VAL M 95  ? ILE M 96  ? VAL M 95  ILE M 96  
AE9 1 PHE N 8   ? ASN N 11  ? PHE N 8   ASN N 11  
AE9 2 VAL N 15  ? LYS N 18  ? VAL N 15  LYS N 18  
AF1 1 CYS N 40  ? ILE N 41  ? CYS N 40  ILE N 41  
AF1 2 GLU N 110 ? ILE N 111 ? GLU N 110 ILE N 111 
AF2 1 GLY N 83  ? THR N 84  ? GLY N 83  THR N 84  
AF2 2 LYS N 102 ? ILE N 103 ? LYS N 102 ILE N 103 
AF3 1 TRP N 89  ? SER N 91  ? TRP N 89  SER N 91  
AF3 2 ILE N 94  ? ALA N 97  ? ILE N 94  ALA N 97  
AF4 1 PHE N 359 ? PHE N 360 ? PHE N 359 PHE N 360 
AF4 2 PHE P 8   ? VAL P 10  ? PHE P 8   VAL P 10  
AF4 3 SER P 16  ? LYS P 18  ? SER P 16  LYS P 18  
AF5 1 PHE O 8   ? ASN O 11  ? PHE O 8   ASN O 11  
AF5 2 VAL O 15  ? LYS O 18  ? VAL O 15  LYS O 18  
AF6 1 CYS O 40  ? LEU O 43  ? CYS O 40  LEU O 43  
AF6 2 GLU O 110 ? ARG O 113 ? GLU O 110 ARG O 113 
AF7 1 GLY O 83  ? THR O 84  ? GLY O 83  THR O 84  
AF7 2 LYS O 102 ? ILE O 103 ? LYS O 102 ILE O 103 
AF8 1 TRP O 89  ? THR O 90  ? TRP O 89  THR O 90  
AF8 2 VAL O 95  ? ALA O 97  ? VAL O 95  ALA O 97  
AF9 1 PHE O 359 ? PHE O 360 ? PHE O 359 PHE O 360 
AF9 2 LYS Q 9   ? VAL Q 10  ? LYS Q 9   VAL Q 10  
AF9 3 SER Q 16  ? LEU Q 17  ? SER Q 16  LEU Q 17  
AG1 1 CYS P 40  ? LEU P 43  ? CYS P 40  LEU P 43  
AG1 2 GLU P 110 ? ARG P 113 ? GLU P 110 ARG P 113 
AG2 1 GLY P 83  ? THR P 84  ? GLY P 83  THR P 84  
AG2 2 LYS P 102 ? ILE P 103 ? LYS P 102 ILE P 103 
AG3 1 TRP P 89  ? THR P 90  ? TRP P 89  THR P 90  
AG3 2 VAL P 95  ? ALA P 97  ? VAL P 95  ALA P 97  
AG4 1 PHE P 359 ? PHE P 360 ? PHE P 359 PHE P 360 
AG4 2 PHE R 8   ? ASN R 11  ? PHE R 8   ASN R 11  
AG4 3 VAL R 15  ? LYS R 18  ? VAL R 15  LYS R 18  
AG5 1 THR Q 42  ? LEU Q 43  ? THR Q 42  LEU Q 43  
AG5 2 LYS Q 112 ? ARG Q 113 ? LYS Q 112 ARG Q 113 
AG6 1 CYS R 40  ? LEU R 43  ? CYS R 40  LEU R 43  
AG6 2 GLU R 110 ? ARG R 113 ? GLU R 110 ARG R 113 
AG7 1 GLY R 83  ? THR R 84  ? GLY R 83  THR R 84  
AG7 2 LYS R 102 ? ILE R 103 ? LYS R 102 ILE R 103 
AG8 1 TRP R 89  ? THR R 90  ? TRP R 89  THR R 90  
AG8 2 VAL R 95  ? ALA R 97  ? VAL R 95  ALA R 97  
AG9 1 VAL S 10  ? ASN S 11  ? VAL S 10  ASN S 11  
AG9 2 VAL S 15  ? SER S 16  ? VAL S 15  SER S 16  
AH1 1 GLY S 83  ? THR S 84  ? GLY S 83  THR S 84  
AH1 2 LYS S 102 ? ILE S 103 ? LYS S 102 ILE S 103 
AH2 1 TRP S 89  ? THR S 90  ? TRP S 89  THR S 90  
AH2 2 VAL S 95  ? ALA S 97  ? VAL S 95  ALA S 97  
AH3 1 SER T 16  ? LEU T 17  ? SER T 16  LEU T 17  
AH3 2 LYS T 9   ? VAL T 10  ? LYS T 9   VAL T 10  
AH3 3 PHE V 359 ? PHE V 360 ? PHE V 359 PHE V 360 
AH4 1 CYS T 40  ? LEU T 43  ? CYS T 40  LEU T 43  
AH4 2 GLU T 110 ? ARG T 113 ? GLU T 110 ARG T 113 
AH5 1 GLY T 83  ? THR T 84  ? GLY T 83  THR T 84  
AH5 2 LYS T 102 ? ILE T 103 ? LYS T 102 ILE T 103 
AH6 1 PHE U 8   ? VAL U 10  ? PHE U 8   VAL U 10  
AH6 2 SER U 16  ? LYS U 18  ? SER U 16  LYS U 18  
AH7 1 CYS U 40  ? LEU U 43  ? CYS U 40  LEU U 43  
AH7 2 GLU U 110 ? ARG U 113 ? GLU U 110 ARG U 113 
AH8 1 GLY U 83  ? THR U 84  ? GLY U 83  THR U 84  
AH8 2 LYS U 102 ? ILE U 103 ? LYS U 102 ILE U 103 
AH9 1 TRP U 89  ? THR U 90  ? TRP U 89  THR U 90  
AH9 2 VAL U 95  ? ALA U 97  ? VAL U 95  ALA U 97  
AI1 1 PHE V 8   ? ASN V 11  ? PHE V 8   ASN V 11  
AI1 2 VAL V 15  ? LYS V 18  ? VAL V 15  LYS V 18  
AI2 1 THR V 42  ? LEU V 43  ? THR V 42  LEU V 43  
AI2 2 LYS V 112 ? ARG V 113 ? LYS V 112 ARG V 113 
AI3 1 GLY V 83  ? THR V 84  ? GLY V 83  THR V 84  
AI3 2 LYS V 102 ? ILE V 103 ? LYS V 102 ILE V 103 
AI4 1 TRP V 89  ? THR V 90  ? TRP V 89  THR V 90  
AI4 2 VAL V 95  ? ALA V 97  ? VAL V 95  ALA V 97  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LYS A 18  ? O LYS A 18  N PHE A 8   ? N PHE A 8   
AA1 2 3 N LYS A 9   ? N LYS A 9   O PHE J 360 ? O PHE J 360 
AA2 1 2 N LEU A 43  ? N LEU A 43  O LYS A 112 ? O LYS A 112 
AA3 1 2 N GLY A 83  ? N GLY A 83  O ILE A 103 ? O ILE A 103 
AA4 1 2 N TRP A 89  ? N TRP A 89  O ALA A 97  ? O ALA A 97  
AA5 1 2 N PHE A 360 ? N PHE A 360 O LYS C 9   ? O LYS C 9   
AA5 2 3 N VAL C 10  ? N VAL C 10  O SER C 16  ? O SER C 16  
AA6 1 2 O SER B 16  ? O SER B 16  N VAL B 10  ? N VAL B 10  
AA6 2 3 N LYS B 9   ? N LYS B 9   O PHE K 360 ? O PHE K 360 
AA7 1 2 N LEU B 43  ? N LEU B 43  O LYS B 112 ? O LYS B 112 
AA8 1 2 N GLY B 83  ? N GLY B 83  O ILE B 103 ? O ILE B 103 
AA9 1 2 N TRP B 89  ? N TRP B 89  O ALA B 97  ? O ALA B 97  
AB1 1 2 N LEU C 43  ? N LEU C 43  O LYS C 112 ? O LYS C 112 
AB2 1 2 N GLY C 83  ? N GLY C 83  O ILE C 103 ? O ILE C 103 
AB3 1 2 N MET C 126 ? N MET C 126 O LEU U 122 ? O LEU U 122 
AB4 1 2 N PHE C 360 ? N PHE C 360 O LYS E 9   ? O LYS E 9   
AB4 2 3 N VAL E 10  ? N VAL E 10  O SER E 16  ? O SER E 16  
AB5 1 2 N LEU D 43  ? N LEU D 43  O LYS D 112 ? O LYS D 112 
AB6 1 2 N GLY D 83  ? N GLY D 83  O ILE D 103 ? O ILE D 103 
AB7 1 2 N SER D 91  ? N SER D 91  O ILE D 94  ? O ILE D 94  
AB8 1 2 N PHE D 360 ? N PHE D 360 O LYS F 9   ? O LYS F 9   
AB8 2 3 N VAL F 10  ? N VAL F 10  O SER F 16  ? O SER F 16  
AB9 1 2 N ILE E 41  ? N ILE E 41  O LYS E 112 ? O LYS E 112 
AC1 1 2 N GLY E 83  ? N GLY E 83  O ILE E 103 ? O ILE E 103 
AC2 1 2 N PHE E 360 ? N PHE E 360 O LYS G 9   ? O LYS G 9   
AC2 2 3 N VAL G 10  ? N VAL G 10  O SER G 16  ? O SER G 16  
AC3 1 2 N LEU F 43  ? N LEU F 43  O LYS F 112 ? O LYS F 112 
AC4 1 2 N GLY F 83  ? N GLY F 83  O ILE F 103 ? O ILE F 103 
AC5 1 2 N PHE F 360 ? N PHE F 360 O LYS H 9   ? O LYS H 9   
AC6 1 2 N LEU G 43  ? N LEU G 43  O LYS G 112 ? O LYS G 112 
AC7 1 2 N GLY G 83  ? N GLY G 83  O ILE G 103 ? O ILE G 103 
AC8 1 2 N LEU H 43  ? N LEU H 43  O LYS H 112 ? O LYS H 112 
AC9 1 2 N GLY H 83  ? N GLY H 83  O ILE H 103 ? O ILE H 103 
AD1 1 2 N PHE H 360 ? N PHE H 360 O LYS J 9   ? O LYS J 9   
AD1 2 3 N VAL J 10  ? N VAL J 10  O SER J 16  ? O SER J 16  
AD2 1 2 N ILE I 41  ? N ILE I 41  O LYS I 112 ? O LYS I 112 
AD3 1 2 N GLY I 83  ? N GLY I 83  O ILE I 103 ? O ILE I 103 
AD4 1 2 N SER I 91  ? N SER I 91  O ILE I 94  ? O ILE I 94  
AD5 1 2 N PHE I 360 ? N PHE I 360 O LYS K 9   ? O LYS K 9   
AD5 2 3 N VAL K 10  ? N VAL K 10  O SER K 16  ? O SER K 16  
AD6 1 2 N ILE J 41  ? N ILE J 41  O GLU J 110 ? O GLU J 110 
AD7 1 2 N GLY J 83  ? N GLY J 83  O ILE J 103 ? O ILE J 103 
AD8 1 2 N SER J 91  ? N SER J 91  O ILE J 94  ? O ILE J 94  
AD9 1 2 N GLY K 83  ? N GLY K 83  O ILE K 103 ? O ILE K 103 
AE1 1 2 N SER K 91  ? N SER K 91  O ILE K 94  ? O ILE K 94  
AE2 1 2 O SER L 16  ? O SER L 16  N VAL L 10  ? N VAL L 10  
AE2 2 3 N LYS L 9   ? N LYS L 9   O PHE T 360 ? O PHE T 360 
AE3 1 2 N LEU L 43  ? N LEU L 43  O LYS L 112 ? O LYS L 112 
AE4 1 2 N GLY L 83  ? N GLY L 83  O ILE L 103 ? O ILE L 103 
AE5 1 2 N TRP L 89  ? N TRP L 89  O ALA L 97  ? O ALA L 97  
AE6 1 2 N PHE M 8   ? N PHE M 8   O LYS M 18  ? O LYS M 18  
AE7 1 2 N GLY M 83  ? N GLY M 83  O ILE M 103 ? O ILE M 103 
AE8 1 2 N TRP M 89  ? N TRP M 89  O ILE M 96  ? O ILE M 96  
AE9 1 2 N VAL N 10  ? N VAL N 10  O SER N 16  ? O SER N 16  
AF1 1 2 N ILE N 41  ? N ILE N 41  O GLU N 110 ? O GLU N 110 
AF2 1 2 N GLY N 83  ? N GLY N 83  O ILE N 103 ? O ILE N 103 
AF3 1 2 N SER N 91  ? N SER N 91  O ILE N 94  ? O ILE N 94  
AF4 1 2 N PHE N 360 ? N PHE N 360 O LYS P 9   ? O LYS P 9   
AF4 2 3 N VAL P 10  ? N VAL P 10  O SER P 16  ? O SER P 16  
AF5 1 2 N VAL O 10  ? N VAL O 10  O SER O 16  ? O SER O 16  
AF6 1 2 N LEU O 43  ? N LEU O 43  O LYS O 112 ? O LYS O 112 
AF7 1 2 N GLY O 83  ? N GLY O 83  O ILE O 103 ? O ILE O 103 
AF8 1 2 N TRP O 89  ? N TRP O 89  O ALA O 97  ? O ALA O 97  
AF9 1 2 N PHE O 360 ? N PHE O 360 O LYS Q 9   ? O LYS Q 9   
AF9 2 3 N VAL Q 10  ? N VAL Q 10  O SER Q 16  ? O SER Q 16  
AG1 1 2 N LEU P 43  ? N LEU P 43  O LYS P 112 ? O LYS P 112 
AG2 1 2 N GLY P 83  ? N GLY P 83  O ILE P 103 ? O ILE P 103 
AG3 1 2 N TRP P 89  ? N TRP P 89  O ALA P 97  ? O ALA P 97  
AG4 1 2 N PHE P 360 ? N PHE P 360 O LYS R 9   ? O LYS R 9   
AG4 2 3 N PHE R 8   ? N PHE R 8   O LYS R 18  ? O LYS R 18  
AG5 1 2 N LEU Q 43  ? N LEU Q 43  O LYS Q 112 ? O LYS Q 112 
AG6 1 2 N LEU R 43  ? N LEU R 43  O LYS R 112 ? O LYS R 112 
AG7 1 2 N GLY R 83  ? N GLY R 83  O ILE R 103 ? O ILE R 103 
AG8 1 2 N TRP R 89  ? N TRP R 89  O ALA R 97  ? O ALA R 97  
AG9 1 2 N VAL S 10  ? N VAL S 10  O SER S 16  ? O SER S 16  
AH1 1 2 N GLY S 83  ? N GLY S 83  O ILE S 103 ? O ILE S 103 
AH2 1 2 N TRP S 89  ? N TRP S 89  O ALA S 97  ? O ALA S 97  
AH3 1 2 O SER T 16  ? O SER T 16  N VAL T 10  ? N VAL T 10  
AH3 2 3 N LYS T 9   ? N LYS T 9   O PHE V 360 ? O PHE V 360 
AH4 1 2 N LEU T 43  ? N LEU T 43  O LYS T 112 ? O LYS T 112 
AH5 1 2 N GLY T 83  ? N GLY T 83  O ILE T 103 ? O ILE T 103 
AH6 1 2 N VAL U 10  ? N VAL U 10  O SER U 16  ? O SER U 16  
AH7 1 2 N LEU U 43  ? N LEU U 43  O LYS U 112 ? O LYS U 112 
AH8 1 2 N GLY U 83  ? N GLY U 83  O ILE U 103 ? O ILE U 103 
AH9 1 2 N TRP U 89  ? N TRP U 89  O ALA U 97  ? O ALA U 97  
AI1 1 2 N VAL V 10  ? N VAL V 10  O SER V 16  ? O SER V 16  
AI2 1 2 N LEU V 43  ? N LEU V 43  O LYS V 112 ? O LYS V 112 
AI3 1 2 N GLY V 83  ? N GLY V 83  O ILE V 103 ? O ILE V 103 
AI4 1 2 N TRP V 89  ? N TRP V 89  O ALA V 97  ? O ALA V 97  
# 
_atom_sites.entry_id                    8FFR 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.003698 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003559 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004221 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C   ? ? 5.96793  ?       ? ? 14.89577 ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N   ? ? 6.96715  ?       ? ? 11.43723 ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O   ? ? 7.96527  ?       ? ? 9.05267  ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O1- ? ? 8.95260  ?       ? ? 12.67477 ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P   ? ? 9.51135  5.44231 ? ? 1.42069  35.72801 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S   ? ? 15.91112 ?       ? ? 10.84690 ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . ILE A 1 6   ? 251.94084 237.07577 120.03549 1.000 100.11640 ?  6   ILE A N     1 
ATOM   2     C CA    . ILE A 1 6   ? 251.89545 236.15162 121.17734 1.000 111.13002 ?  6   ILE A CA    1 
ATOM   3     C C     . ILE A 1 6   ? 252.58825 234.79197 120.86515 1.000 105.89004 ?  6   ILE A C     1 
ATOM   4     O O     . ILE A 1 6   ? 252.42943 234.21206 119.77284 1.000 105.60698 ?  6   ILE A O     1 
ATOM   5     C CB    . ILE A 1 6   ? 250.45395 235.91933 121.64895 1.000 110.13170 ?  6   ILE A CB    1 
ATOM   6     C CG1   . ILE A 1 6   ? 250.43327 235.45550 123.11723 1.000 105.18513 ?  6   ILE A CG1   1 
ATOM   7     C CG2   . ILE A 1 6   ? 249.79040 234.86592 120.77189 1.000 100.51992 ?  6   ILE A CG2   1 
ATOM   8     C CD1   . ILE A 1 6   ? 251.08641 236.43347 124.16320 1.000 85.93476  ?  6   ILE A CD1   1 
ATOM   9     N N     . VAL A 1 7   ? 253.31831 234.26279 121.85598 1.000 104.43985 ?  7   VAL A N     1 
ATOM   10    C CA    . VAL A 1 7   ? 254.15962 233.07518 121.70358 1.000 106.83799 ?  7   VAL A CA    1 
ATOM   11    C C     . VAL A 1 7   ? 253.67155 231.93632 122.60133 1.000 99.49720  ?  7   VAL A C     1 
ATOM   12    O O     . VAL A 1 7   ? 252.85630 232.11946 123.50896 1.000 100.87744 ?  7   VAL A O     1 
ATOM   13    C CB    . VAL A 1 7   ? 255.66012 233.38589 121.98621 1.000 114.89513 ?  7   VAL A CB    1 
ATOM   14    C CG1   . VAL A 1 7   ? 256.23597 234.36002 120.94387 1.000 107.43568 ?  7   VAL A CG1   1 
ATOM   15    C CG2   . VAL A 1 7   ? 255.87635 233.91034 123.42256 1.000 106.50128 ?  7   VAL A CG2   1 
ATOM   16    N N     . PHE A 1 8   ? 254.12125 230.72669 122.27230 1.000 95.59120  ?  8   PHE A N     1 
ATOM   17    C CA    . PHE A 1 8   ? 253.81791 229.53743 123.06366 1.000 96.70644  ?  8   PHE A CA    1 
ATOM   18    C C     . PHE A 1 8   ? 255.11566 228.79692 123.39623 1.000 97.39315  ?  8   PHE A C     1 
ATOM   19    O O     . PHE A 1 8   ? 256.10188 228.86579 122.65526 1.000 97.63965  ?  8   PHE A O     1 
ATOM   20    C CB    . PHE A 1 8   ? 252.84267 228.58235 122.37178 1.000 96.54681  ?  8   PHE A CB    1 
ATOM   21    C CG    . PHE A 1 8   ? 253.52167 227.55934 121.55467 1.000 104.31994 ?  8   PHE A CG    1 
ATOM   22    C CD1   . PHE A 1 8   ? 253.82596 227.80581 120.23090 1.000 106.19939 ?  8   PHE A CD1   1 
ATOM   23    C CD2   . PHE A 1 8   ? 253.91764 226.35527 122.11929 1.000 108.51526 ?  8   PHE A CD2   1 
ATOM   24    C CE1   . PHE A 1 8   ? 254.49521 226.85063 119.47141 1.000 110.85587 ?  8   PHE A CE1   1 
ATOM   25    C CE2   . PHE A 1 8   ? 254.59578 225.41730 121.38304 1.000 113.26215 ?  8   PHE A CE2   1 
ATOM   26    C CZ    . PHE A 1 8   ? 254.87686 225.65063 120.05542 1.000 115.33603 ?  8   PHE A CZ    1 
ATOM   27    N N     . LYS A 1 9   ? 255.08410 228.03770 124.49987 1.000 93.85477  ?  9   LYS A N     1 
ATOM   28    C CA    . LYS A 1 9   ? 256.26362 227.39341 125.06571 1.000 94.86758  ?  9   LYS A CA    1 
ATOM   29    C C     . LYS A 1 9   ? 256.11838 225.87531 125.17170 1.000 95.09291  ?  9   LYS A C     1 
ATOM   30    O O     . LYS A 1 9   ? 255.26593 225.36581 125.90735 1.000 90.60451  ?  9   LYS A O     1 
ATOM   31    C CB    . LYS A 1 9   ? 256.53886 227.98451 126.44267 1.000 97.95630  ?  9   LYS A CB    1 
ATOM   32    C CG    . LYS A 1 9   ? 257.83036 227.52534 127.08017 1.000 107.30599 ?  9   LYS A CG    1 
ATOM   33    C CD    . LYS A 1 9   ? 257.70473 226.25027 127.90725 1.000 116.22335 ?  9   LYS A CD    1 
ATOM   34    C CE    . LYS A 1 9   ? 259.07032 225.75255 128.42788 1.000 121.58187 ?  9   LYS A CE    1 
ATOM   35    N NZ    . LYS A 1 9   ? 259.48042 226.28495 129.76977 1.000 121.27885 ?  9   LYS A NZ    1 
ATOM   36    N N     . VAL A 1 10  ? 257.05481 225.17320 124.54681 1.000 98.40693  ?  10  VAL A N     1 
ATOM   37    C CA    . VAL A 1 10  ? 257.10190 223.72194 124.42342 1.000 94.10597  ?  10  VAL A CA    1 
ATOM   38    C C     . VAL A 1 10  ? 258.40048 223.21952 125.06645 1.000 97.94491  ?  10  VAL A C     1 
ATOM   39    O O     . VAL A 1 10  ? 259.38300 223.96499 125.18283 1.000 101.61525 ?  10  VAL A O     1 
ATOM   40    C CB    . VAL A 1 10  ? 256.93006 223.33029 122.92103 1.000 91.34720  ?  10  VAL A CB    1 
ATOM   41    C CG1   . VAL A 1 10  ? 258.10461 223.75425 122.05651 1.000 85.59880  ?  10  VAL A CG1   1 
ATOM   42    C CG2   . VAL A 1 10  ? 256.70877 221.87342 122.79229 1.000 92.89843  ?  10  VAL A CG2   1 
ATOM   43    N N     . ASN A 1 11  ? 258.36565 222.00685 125.62049 1.000 93.38726  ?  11  ASN A N     1 
ATOM   44    C CA    . ASN A 1 11  ? 259.52104 221.45127 126.33205 1.000 96.09489  ?  11  ASN A CA    1 
ATOM   45    C C     . ASN A 1 11  ? 260.16586 220.25983 125.62066 1.000 106.07453 ?  11  ASN A C     1 
ATOM   46    O O     . ASN A 1 11  ? 259.54250 219.19232 125.52045 1.000 111.88239 ?  11  ASN A O     1 
ATOM   47    C CB    . ASN A 1 11  ? 259.11184 221.01555 127.73484 1.000 107.28756 ?  11  ASN A CB    1 
ATOM   48    C CG    . ASN A 1 11  ? 260.31274 220.75919 128.62639 1.000 118.84375 ?  11  ASN A CG    1 
ATOM   49    O OD1   . ASN A 1 11  ? 261.41211 221.20230 128.29059 1.000 119.27137 ?  11  ASN A OD1   1 
ATOM   50    N ND2   . ASN A 1 11  ? 260.12314 220.05214 129.75075 1.000 114.84043 ?  11  ASN A ND2   1 
ATOM   51    N N     . ASN A 1 12  ? 261.38837 220.44477 125.07294 1.000 107.85148 ?  12  ASN A N     1 
ATOM   52    C CA    . ASN A 1 12  ? 262.20255 219.33449 124.54121 1.000 110.21158 ?  12  ASN A CA    1 
ATOM   53    C C     . ASN A 1 12  ? 263.41837 219.02874 125.43550 1.000 111.07623 ?  12  ASN A C     1 
ATOM   54    O O     . ASN A 1 12  ? 264.52501 218.80322 124.93170 1.000 105.91929 ?  12  ASN A O     1 
ATOM   55    C CB    . ASN A 1 12  ? 262.70188 219.63208 123.12456 1.000 105.21184 ?  12  ASN A CB    1 
ATOM   56    C CG    . ASN A 1 12  ? 263.41051 220.96551 123.03627 1.000 119.88050 ?  12  ASN A CG    1 
ATOM   57    O OD1   . ASN A 1 12  ? 263.68831 221.60412 124.05534 1.000 122.80916 ?  12  ASN A OD1   1 
ATOM   58    N ND2   . ASN A 1 12  ? 263.72160 221.38932 121.81259 1.000 111.64716 ?  12  ASN A ND2   1 
ATOM   59    N N     . GLN A 1 13  ? 263.20660 218.90680 126.75080 1.000 117.61926 ?  13  GLN A N     1 
ATOM   60    C CA    . GLN A 1 13  ? 264.15361 218.78810 127.86483 1.000 113.52004 ?  13  GLN A CA    1 
ATOM   61    C C     . GLN A 1 13  ? 264.83645 220.13967 128.16300 1.000 112.05764 ?  13  GLN A C     1 
ATOM   62    O O     . GLN A 1 13  ? 265.53872 220.26177 129.18473 1.000 98.37542  ?  13  GLN A O     1 
ATOM   63    C CB    . GLN A 1 13  ? 265.20470 217.67260 127.68835 1.000 111.13048 ?  13  GLN A CB    1 
ATOM   64    C CG    . GLN A 1 13  ? 265.80751 217.24233 129.04933 1.000 119.22756 ?  13  GLN A CG    1 
ATOM   65    C CD    . GLN A 1 13  ? 264.73547 216.72406 130.01878 1.000 120.70700 ?  13  GLN A CD    1 
ATOM   66    O OE1   . GLN A 1 13  ? 264.70189 217.10234 131.19649 1.000 102.28523 ?  13  GLN A OE1   1 
ATOM   67    N NE2   . GLN A 1 13  ? 263.82460 215.90144 129.50856 1.000 127.44404 ?  13  GLN A NE2   1 
ATOM   68    N N     . VAL A 1 14  ? 264.65603 221.15542 127.30275 1.000 116.44109 ?  14  VAL A N     1 
ATOM   69    C CA    . VAL A 1 14  ? 265.05768 222.54214 127.51446 1.000 114.64790 ?  14  VAL A CA    1 
ATOM   70    C C     . VAL A 1 14  ? 263.79209 223.39008 127.26678 1.000 108.94375 ?  14  VAL A C     1 
ATOM   71    O O     . VAL A 1 14  ? 262.78964 222.89755 126.73806 1.000 102.28457 ?  14  VAL A O     1 
ATOM   72    C CB    . VAL A 1 14  ? 266.24334 222.92184 126.56822 1.000 111.21306 ?  14  VAL A CB    1 
ATOM   73    C CG1   . VAL A 1 14  ? 266.90538 224.25686 126.96910 1.000 103.66403 ?  14  VAL A CG1   1 
ATOM   74    C CG2   . VAL A 1 14  ? 267.29227 221.77661 126.51322 1.000 109.98208 ?  14  VAL A CG2   1 
ATOM   75    N N     . VAL A 1 15  ? 263.82673 224.67373 127.65324 1.000 101.56428 ?  15  VAL A N     1 
ATOM   76    C CA    . VAL A 1 15  ? 262.68944 225.56874 127.40363 1.000 97.94798  ?  15  VAL A CA    1 
ATOM   77    C C     . VAL A 1 15  ? 262.73578 226.01311 125.94594 1.000 101.89082 ?  15  VAL A C     1 
ATOM   78    O O     . VAL A 1 15  ? 263.78386 226.45849 125.45371 1.000 105.86412 ?  15  VAL A O     1 
ATOM   79    C CB    . VAL A 1 15  ? 262.74167 226.79053 128.34295 1.000 102.69077 ?  15  VAL A CB    1 
ATOM   80    C CG1   . VAL A 1 15  ? 261.67871 227.91139 127.98742 1.000 87.46682  ?  15  VAL A CG1   1 
ATOM   81    C CG2   . VAL A 1 15  ? 262.62655 226.35120 129.79822 1.000 115.32965 ?  15  VAL A CG2   1 
ATOM   82    N N     . SER A 1 16  ? 261.60393 225.91513 125.24378 1.000 100.23260 ?  16  SER A N     1 
ATOM   83    C CA    . SER A 1 16  ? 261.54710 226.30598 123.83479 1.000 100.19242 ?  16  SER A CA    1 
ATOM   84    C C     . SER A 1 16  ? 260.36561 227.23698 123.59435 1.000 100.84114 ?  16  SER A C     1 
ATOM   85    O O     . SER A 1 16  ? 259.26748 226.98487 124.10017 1.000 101.58934 ?  16  SER A O     1 
ATOM   86    C CB    . SER A 1 16  ? 261.46001 225.07860 122.94518 1.000 99.39005  ?  16  SER A CB    1 
ATOM   87    O OG    . SER A 1 16  ? 262.62071 224.31099 123.13191 1.000 98.09101  ?  16  SER A OG    1 
ATOM   88    N N     . LEU A 1 17  ? 260.60507 228.34658 122.89936 1.000 98.31632  ?  17  LEU A N     1 
ATOM   89    C CA    . LEU A 1 17  ? 259.56020 229.31442 122.58175 1.000 106.04789 ?  17  LEU A CA    1 
ATOM   90    C C     . LEU A 1 17  ? 259.41542 229.47824 121.07706 1.000 104.80786 ?  17  LEU A C     1 
ATOM   91    O O     . LEU A 1 17  ? 260.41329 229.68771 120.38101 1.000 104.57398 ?  17  LEU A O     1 
ATOM   92    C CB    . LEU A 1 17  ? 259.85640 230.67248 123.21402 1.000 113.48812 ?  17  LEU A CB    1 
ATOM   93    C CG    . LEU A 1 17  ? 261.10123 231.46213 122.82813 1.000 111.56905 ?  17  LEU A CG    1 
ATOM   94    C CD1   . LEU A 1 17  ? 260.76325 232.49927 121.66925 1.000 86.63867  ?  17  LEU A CD1   1 
ATOM   95    C CD2   . LEU A 1 17  ? 261.79694 232.00234 124.11206 1.000 94.16715  ?  17  LEU A CD2   1 
ATOM   96    N N     . LYS A 1 18  ? 258.18785 229.36983 120.57160 1.000 103.15934 ?  18  LYS A N     1 
ATOM   97    C CA    . LYS A 1 18  ? 257.93579 229.58250 119.14321 1.000 104.38327 ?  18  LYS A CA    1 
ATOM   98    C C     . LYS A 1 18  ? 256.83672 230.62584 118.93521 1.000 109.49212 ?  18  LYS A C     1 
ATOM   99    O O     . LYS A 1 18  ? 255.86894 230.68514 119.72497 1.000 106.18607 ?  18  LYS A O     1 
ATOM   100   C CB    . LYS A 1 18  ? 257.62334 228.26194 118.41840 1.000 94.91347  ?  18  LYS A CB    1 
ATOM   101   C CG    . LYS A 1 18  ? 258.85911 227.56322 117.83301 1.000 97.00692  ?  18  LYS A CG    1 
ATOM   102   C CD    . LYS A 1 18  ? 258.59582 226.07315 117.66149 1.000 106.12167 ?  18  LYS A CD    1 
ATOM   103   C CE    . LYS A 1 18  ? 258.39278 225.45703 119.05607 1.000 110.15100 ?  18  LYS A CE    1 
ATOM   104   N NZ    . LYS A 1 18  ? 257.95859 224.02673 119.12329 1.000 106.15320 ?  18  LYS A NZ    1 
ATOM   105   N N     . PRO A 1 19  ? 257.04386 231.57103 118.00973 1.000 111.64576 ?  19  PRO A N     1 
ATOM   106   C CA    . PRO A 1 19  ? 255.99333 232.52464 117.62012 1.000 100.15120 ?  19  PRO A CA    1 
ATOM   107   C C     . PRO A 1 19  ? 255.09294 231.98097 116.52161 1.000 102.19727 ?  19  PRO A C     1 
ATOM   108   O O     . PRO A 1 19  ? 255.54660 231.32067 115.58282 1.000 108.39127 ?  19  PRO A O     1 
ATOM   109   C CB    . PRO A 1 19  ? 256.78050 233.72093 117.08301 1.000 103.42791 ?  19  PRO A CB    1 
ATOM   110   C CG    . PRO A 1 19  ? 258.04611 233.11637 116.56306 1.000 112.80412 ?  19  PRO A CG    1 
ATOM   111   C CD    . PRO A 1 19  ? 258.36215 231.94526 117.46300 1.000 116.58999 ?  19  PRO A CD    1 
ATOM   112   N N     . GLU A 1 20  ? 253.80434 232.28038 116.62880 1.000 99.55202  ?  20  GLU A N     1 
ATOM   113   C CA    . GLU A 1 20  ? 252.82028 231.80713 115.66071 1.000 104.67824 ?  20  GLU A CA    1 
ATOM   114   C C     . GLU A 1 20  ? 252.63269 232.79617 114.52201 1.000 103.98918 ?  20  GLU A C     1 
ATOM   115   O O     . GLU A 1 20  ? 252.33745 233.96610 114.77078 1.000 113.06111 ?  20  GLU A O     1 
ATOM   116   C CB    . GLU A 1 20  ? 251.48618 231.56846 116.36102 1.000 108.82853 ?  20  GLU A CB    1 
ATOM   117   C CG    . GLU A 1 20  ? 251.68436 230.54983 117.40317 1.000 105.69955 ?  20  GLU A CG    1 
ATOM   118   C CD    . GLU A 1 20  ? 252.65089 229.52233 116.88436 1.000 106.85325 ?  20  GLU A CD    1 
ATOM   119   O OE1   . GLU A 1 20  ? 252.36296 228.86419 115.85917 1.000 102.81860 ?  20  GLU A OE1   1 
ATOM   120   O OE2   . GLU A 1 20  ? 253.72249 229.39368 117.51143 1.000 108.29534 ?  20  GLU A OE2   1 
ATOM   121   N N     . ILE A 1 21  ? 252.75657 232.33685 113.28123 1.000 101.29966 ?  21  ILE A N     1 
ATOM   122   C CA    . ILE A 1 21  ? 252.67564 233.24097 112.13481 1.000 107.69995 ?  21  ILE A CA    1 
ATOM   123   C C     . ILE A 1 21  ? 251.47242 232.85405 111.25718 1.000 109.09967 ?  21  ILE A C     1 
ATOM   124   O O     . ILE A 1 21  ? 251.36036 231.71259 110.79221 1.000 110.57899 ?  21  ILE A O     1 
ATOM   125   C CB    . ILE A 1 21  ? 254.00735 233.27287 111.34335 1.000 110.18382 ?  21  ILE A CB    1 
ATOM   126   C CG1   . ILE A 1 21  ? 254.55242 231.84829 111.06244 1.000 110.00762 ?  21  ILE A CG1   1 
ATOM   127   C CG2   . ILE A 1 21  ? 255.05067 234.18648 112.04544 1.000 100.39748 ?  21  ILE A CG2   1 
ATOM   128   C CD1   . ILE A 1 21  ? 255.95689 231.76922 110.36022 1.000 102.54354 ?  21  ILE A CD1   1 
ATOM   129   N N     . ILE A 1 22  ? 250.55088 233.79955 111.07025 1.000 107.17882 ?  22  ILE A N     1 
ATOM   130   C CA    . ILE A 1 22  ? 249.37630 233.62159 110.21960 1.000 107.52578 ?  22  ILE A CA    1 
ATOM   131   C C     . ILE A 1 22  ? 249.11866 234.93539 109.47477 1.000 108.77666 ?  22  ILE A C     1 
ATOM   132   O O     . ILE A 1 22  ? 249.45892 236.01789 109.95899 1.000 115.23290 ?  22  ILE A O     1 
ATOM   133   C CB    . ILE A 1 22  ? 248.16131 233.12866 111.05212 1.000 105.83856 ?  22  ILE A CB    1 
ATOM   134   C CG1   . ILE A 1 22  ? 248.03345 233.99678 112.33947 1.000 114.92704 ?  22  ILE A CG1   1 
ATOM   135   C CG2   . ILE A 1 22  ? 248.24275 231.56967 111.22757 1.000 81.09790  ?  22  ILE A CG2   1 
ATOM   136   C CD1   . ILE A 1 22  ? 246.64580 234.14806 113.00312 1.000 112.12872 ?  22  ILE A CD1   1 
ATOM   137   N N     . VAL A 1 23  ? 248.58003 234.85294 108.26462 1.000 98.93097  ?  23  VAL A N     1 
ATOM   138   C CA    . VAL A 1 23  ? 248.43538 236.02724 107.40818 1.000 99.91687  ?  23  VAL A CA    1 
ATOM   139   C C     . VAL A 1 23  ? 246.98831 236.52122 107.38083 1.000 108.27555 ?  23  VAL A C     1 
ATOM   140   O O     . VAL A 1 23  ? 246.06392 235.70647 107.28536 1.000 115.35520 ?  23  VAL A O     1 
ATOM   141   C CB    . VAL A 1 23  ? 249.00106 235.71198 106.00653 1.000 95.74681  ?  23  VAL A CB    1 
ATOM   142   C CG1   . VAL A 1 23  ? 248.39461 234.46904 105.45409 1.000 85.27069  ?  23  VAL A CG1   1 
ATOM   143   C CG2   . VAL A 1 23  ? 248.83211 236.87810 105.04585 1.000 97.16507  ?  23  VAL A CG2   1 
ATOM   144   N N     . ASP A 1 24  ? 246.78420 237.84549 107.55055 1.000 110.12787 ?  24  ASP A N     1 
ATOM   145   C CA    . ASP A 1 24  ? 245.49100 238.47545 107.23866 1.000 116.15656 ?  24  ASP A CA    1 
ATOM   146   C C     . ASP A 1 24  ? 245.70352 239.92738 106.77918 1.000 119.52933 ?  24  ASP A C     1 
ATOM   147   O O     . ASP A 1 24  ? 246.64495 240.58584 107.24185 1.000 121.89775 ?  24  ASP A O     1 
ATOM   148   C CB    . ASP A 1 24  ? 244.51781 238.41604 108.42240 1.000 107.00433 ?  24  ASP A CB    1 
ATOM   149   C CG    . ASP A 1 24  ? 243.08259 238.85173 108.03318 1.000 120.86491 ?  24  ASP A CG    1 
ATOM   150   O OD1   . ASP A 1 24  ? 242.73252 238.84866 106.81391 1.000 118.97738 ?  24  ASP A OD1   1 
ATOM   151   O OD2   . ASP A 1 24  ? 242.28946 239.15628 108.95256 1.000 121.52470 ?  24  ASP A OD2   1 
ATOM   152   N N     . GLN A 1 25  ? 244.84433 240.43293 105.86611 1.000 114.85819 ?  25  GLN A N     1 
ATOM   153   C CA    . GLN A 1 25  ? 244.99834 241.82187 105.40246 1.000 116.96821 ?  25  GLN A CA    1 
ATOM   154   C C     . GLN A 1 25  ? 243.82394 242.26076 104.52127 1.000 127.47564 ?  25  GLN A C     1 
ATOM   155   O O     . GLN A 1 25  ? 243.30563 241.45448 103.73856 1.000 131.72012 ?  25  GLN A O     1 
ATOM   156   C CB    . GLN A 1 25  ? 246.29032 242.03877 104.60129 1.000 117.29967 ?  25  GLN A CB    1 
ATOM   157   C CG    . GLN A 1 25  ? 246.26066 241.60197 103.11537 1.000 127.00688 ?  25  GLN A CG    1 
ATOM   158   C CD    . GLN A 1 25  ? 246.48275 240.12804 102.85539 1.000 124.13744 ?  25  GLN A CD    1 
ATOM   159   O OE1   . GLN A 1 25  ? 246.87895 239.36397 103.74569 1.000 116.09421 ?  25  GLN A OE1   1 
ATOM   160   N NE2   . GLN A 1 25  ? 246.27654 239.72840 101.59510 1.000 115.88725 ?  25  GLN A NE2   1 
ATOM   161   N N     . HIS A 1 26  ? 243.37391 243.51374 104.68484 1.000 125.99015 ?  26  HIS A N     1 
ATOM   162   C CA    . HIS A 1 26  ? 242.29172 244.05923 103.85981 1.000 122.43577 ?  26  HIS A CA    1 
ATOM   163   C C     . HIS A 1 26  ? 242.43153 245.58232 103.76141 1.000 116.22888 ?  26  HIS A C     1 
ATOM   164   O O     . HIS A 1 26  ? 243.17324 246.20179 104.53023 1.000 121.85925 ?  26  HIS A O     1 
ATOM   165   C CB    . HIS A 1 26  ? 240.93397 243.65966 104.44371 1.000 126.32603 ?  26  HIS A CB    1 
ATOM   166   C CG    . HIS A 1 26  ? 240.33570 242.42786 103.82117 1.000 130.40628 ?  26  HIS A CG    1 
ATOM   167   N ND1   . HIS A 1 26  ? 240.10912 242.30423 102.46190 1.000 122.37439 ?  26  HIS A ND1   1 
ATOM   168   C CD2   . HIS A 1 26  ? 239.93275 241.25655 104.37979 1.000 123.10578 ?  26  HIS A CD2   1 
ATOM   169   C CE1   . HIS A 1 26  ? 239.57688 241.11736 102.21448 1.000 119.17802 ?  26  HIS A CE1   1 
ATOM   170   N NE2   . HIS A 1 26  ? 239.46179 240.46320 103.35948 1.000 123.72044 ?  26  HIS A NE2   1 
ATOM   171   N N     . GLU A 1 27  ? 241.72037 246.18655 102.79862 1.000 103.93260 ?  27  GLU A N     1 
ATOM   172   C CA    . GLU A 1 27  ? 241.73818 247.64675 102.63358 1.000 101.03885 ?  27  GLU A CA    1 
ATOM   173   C C     . GLU A 1 27  ? 240.36490 248.27883 102.84404 1.000 102.63373 ?  27  GLU A C     1 
ATOM   174   O O     . GLU A 1 27  ? 240.24175 249.19106 103.66729 1.000 100.67816 ?  27  GLU A O     1 
ATOM   175   C CB    . GLU A 1 27  ? 242.30816 248.00175 101.24615 1.000 106.61650 ?  27  GLU A CB    1 
ATOM   176   C CG    . GLU A 1 27  ? 241.36570 247.74734 100.01146 1.000 114.63497 ?  27  GLU A CG    1 
ATOM   177   C CD    . GLU A 1 27  ? 240.91721 246.28002 99.77551  1.000 105.47487 ?  27  GLU A CD    1 
ATOM   178   O OE1   . GLU A 1 27  ? 241.69460 245.33220 99.98678  1.000 110.02494 ?  27  GLU A OE1   1 
ATOM   179   O OE2   . GLU A 1 27  ? 239.76037 246.07472 99.34774  1.000 87.46879  ?  27  GLU A OE2   1 
ATOM   180   N N     . TYR A 1 28  ? 239.32468 247.78053 102.15832 1.000 105.40714 ?  28  TYR A N     1 
ATOM   181   C CA    . TYR A 1 28  ? 237.94484 248.28717 102.19216 1.000 97.59333  ?  28  TYR A CA    1 
ATOM   182   C C     . TYR A 1 28  ? 237.89311 249.82781 102.17290 1.000 98.92568  ?  28  TYR A C     1 
ATOM   183   O O     . TYR A 1 28  ? 237.55219 250.47392 103.16344 1.000 100.16991 ?  28  TYR A O     1 
ATOM   184   C CB    . TYR A 1 28  ? 237.18065 247.72230 103.40235 1.000 86.58870  ?  28  TYR A CB    1 
ATOM   185   C CG    . TYR A 1 28  ? 236.84658 246.24706 103.31836 1.000 86.62914  ?  28  TYR A CG    1 
ATOM   186   C CD1   . TYR A 1 28  ? 236.27004 245.69814 102.18954 1.000 86.52726  ?  28  TYR A CD1   1 
ATOM   187   C CD2   . TYR A 1 28  ? 237.20459 245.38395 104.34422 1.000 96.08236  ?  28  TYR A CD2   1 
ATOM   188   C CE1   . TYR A 1 28  ? 235.98870 244.33339 102.10432 1.000 85.83824  ?  28  TYR A CE1   1 
ATOM   189   C CE2   . TYR A 1 28  ? 236.94025 244.01447 104.26967 1.000 102.01942 ?  28  TYR A CE2   1 
ATOM   190   C CZ    . TYR A 1 28  ? 236.33165 243.49497 103.14204 1.000 95.72429  ?  28  TYR A CZ    1 
ATOM   191   O OH    . TYR A 1 28  ? 236.06084 242.14424 103.04660 1.000 99.65580  ?  28  TYR A OH    1 
ATOM   192   N N     . LYS A 1 29  ? 238.19118 250.42309 101.01442 1.000 98.62844  ?  29  LYS A N     1 
ATOM   193   C CA    . LYS A 1 29  ? 238.01682 251.86971 100.85771 1.000 92.99479  ?  29  LYS A CA    1 
ATOM   194   C C     . LYS A 1 29  ? 236.52606 252.16973 100.67735 1.000 90.91131  ?  29  LYS A C     1 
ATOM   195   O O     . LYS A 1 29  ? 235.80956 251.41936 100.00581 1.000 93.20377  ?  29  LYS A O     1 
ATOM   196   C CB    . LYS A 1 29  ? 238.81070 252.36571 99.64318  1.000 97.20863  ?  29  LYS A CB    1 
ATOM   197   C CG    . LYS A 1 29  ? 238.63766 251.42117 98.43848  1.000 109.99082 ?  29  LYS A CG    1 
ATOM   198   C CD    . LYS A 1 29  ? 239.87309 251.34828 97.54111  1.000 116.06027 ?  29  LYS A CD    1 
ATOM   199   C CE    . LYS A 1 29  ? 239.79745 250.23279 96.46936  1.000 114.58393 ?  29  LYS A CE    1 
ATOM   200   N NZ    . LYS A 1 29  ? 239.83490 248.81943 96.99975  1.000 105.16043 ?  29  LYS A NZ    1 
ATOM   201   N N     . TYR A 1 30  ? 236.02261 253.33589 101.30124 1.000 87.26413  ?  30  TYR A N     1 
ATOM   202   C CA    . TYR A 1 30  ? 234.58734 253.65956 101.31992 1.000 88.71651  ?  30  TYR A CA    1 
ATOM   203   C C     . TYR A 1 30  ? 234.20405 254.58501 100.15174 1.000 90.80154  ?  30  TYR A C     1 
ATOM   204   O O     . TYR A 1 30  ? 235.06921 255.22547 99.55164  1.000 92.10152  ?  30  TYR A O     1 
ATOM   205   C CB    . TYR A 1 30  ? 234.21126 254.30122 102.66674 1.000 88.38202  ?  30  TYR A CB    1 
ATOM   206   C CG    . TYR A 1 30  ? 234.43538 253.40417 103.91639 1.000 90.77933  ?  30  TYR A CG    1 
ATOM   207   C CD1   . TYR A 1 30  ? 233.51792 252.41984 104.29387 1.000 83.95988  ?  30  TYR A CD1   1 
ATOM   208   C CD2   . TYR A 1 30  ? 235.59841 253.51163 104.67511 1.000 94.36801  ?  30  TYR A CD2   1 
ATOM   209   C CE1   . TYR A 1 30  ? 233.73457 251.62074 105.42643 1.000 86.22751  ?  30  TYR A CE1   1 
ATOM   210   C CE2   . TYR A 1 30  ? 235.82385 252.70896 105.79562 1.000 96.86720  ?  30  TYR A CE2   1 
ATOM   211   C CZ    . TYR A 1 30  ? 234.88787 251.76169 106.16735 1.000 94.88339  ?  30  TYR A CZ    1 
ATOM   212   O OH    . TYR A 1 30  ? 235.10064 250.95320 107.27386 1.000 97.95514  ?  30  TYR A OH    1 
ATOM   213   N N     . PRO A 1 31  ? 232.92563 254.54601 99.69819  1.000 91.59212  ?  31  PRO A N     1 
ATOM   214   C CA    . PRO A 1 31  ? 232.49772 255.29953 98.50597  1.000 86.83012  ?  31  PRO A CA    1 
ATOM   215   C C     . PRO A 1 31  ? 232.01906 256.69210 98.82391  1.000 90.46137  ?  31  PRO A C     1 
ATOM   216   O O     . PRO A 1 31  ? 231.02786 256.85855 99.54195  1.000 97.35476  ?  31  PRO A O     1 
ATOM   217   C CB    . PRO A 1 31  ? 231.32293 254.48446 97.98423  1.000 87.35732  ?  31  PRO A CB    1 
ATOM   218   C CG    . PRO A 1 31  ? 230.75143 253.85922 99.18690  1.000 93.25509  ?  31  PRO A CG    1 
ATOM   219   C CD    . PRO A 1 31  ? 231.81857 253.75295 100.24595 1.000 100.99875 ?  31  PRO A CD    1 
ATOM   220   N N     . ALA A 1 32  ? 232.62105 257.70112 98.23025  1.000 89.03214  ?  32  ALA A N     1 
ATOM   221   C CA    . ALA A 1 32  ? 232.24266 259.05251 98.60795  1.000 96.06402  ?  32  ALA A CA    1 
ATOM   222   C C     . ALA A 1 32  ? 232.90802 259.97926 97.62784  1.000 103.86060 ?  32  ALA A C     1 
ATOM   223   O O     . ALA A 1 32  ? 233.99118 259.67950 97.12546  1.000 114.11291 ?  32  ALA A O     1 
ATOM   224   C CB    . ALA A 1 32  ? 232.67906 259.40234 100.03219 1.000 93.71827  ?  32  ALA A CB    1 
ATOM   225   N N     . ILE A 1 33  ? 232.23770 261.06380 97.30492  1.000 100.76008 ?  33  ILE A N     1 
ATOM   226   C CA    . ILE A 1 33  ? 232.77587 262.01091 96.34508  1.000 103.06791 ?  33  ILE A CA    1 
ATOM   227   C C     . ILE A 1 33  ? 233.28843 263.23250 97.10383  1.000 103.52916 ?  33  ILE A C     1 
ATOM   228   O O     . ILE A 1 33  ? 232.49387 264.04017 97.60388  1.000 100.94263 ?  33  ILE A O     1 
ATOM   229   C CB    . ILE A 1 33  ? 231.74274 262.35613 95.27238  1.000 100.82793 ?  33  ILE A CB    1 
ATOM   230   C CG1   . ILE A 1 33  ? 231.06440 261.06835 94.79112  1.000 95.49164  ?  33  ILE A CG1   1 
ATOM   231   C CG2   . ILE A 1 33  ? 232.40624 262.97194 94.09471  1.000 103.97097 ?  33  ILE A CG2   1 
ATOM   232   C CD1   . ILE A 1 33  ? 230.23247 261.23052 93.52366  1.000 98.70777  ?  33  ILE A CD1   1 
ATOM   233   N N     . LYS A 1 34  ? 234.61414 263.27840 97.34116  1.000 102.22908 ?  34  LYS A N     1 
ATOM   234   C CA    . LYS A 1 34  ? 235.23262 264.51277 97.81896  1.000 106.28604 ?  34  LYS A CA    1 
ATOM   235   C C     . LYS A 1 34  ? 235.64152 265.44483 96.65394  1.000 109.09675 ?  34  LYS A C     1 
ATOM   236   O O     . LYS A 1 34  ? 235.63168 266.67212 96.82904  1.000 108.11412 ?  34  LYS A O     1 
ATOM   237   C CB    . LYS A 1 34  ? 236.43755 264.20972 98.72624  1.000 101.34187 ?  34  LYS A CB    1 
ATOM   238   C CG    . LYS A 1 34  ? 236.68395 265.29373 99.82314  1.000 113.01925 ?  34  LYS A CG    1 
ATOM   239   C CD    . LYS A 1 34  ? 237.62144 266.43989 99.43169  1.000 114.87687 ?  34  LYS A CD    1 
ATOM   240   C CE    . LYS A 1 34  ? 237.73131 267.45458 100.58585 1.000 115.97722 ?  34  LYS A CE    1 
ATOM   241   N NZ    . LYS A 1 34  ? 238.62330 268.62844 100.31543 1.000 116.38166 ?  34  LYS A NZ    1 
ATOM   242   N N     . ASP A 1 35  ? 235.96748 264.89426 95.45427  1.000 105.87347 ?  35  ASP A N     1 
ATOM   243   C CA    . ASP A 1 35  ? 236.37297 265.69363 94.28075  1.000 103.37685 ?  35  ASP A CA    1 
ATOM   244   C C     . ASP A 1 35  ? 235.23893 266.51671 93.68497  1.000 108.99336 ?  35  ASP A C     1 
ATOM   245   O O     . ASP A 1 35  ? 235.49447 267.37854 92.83232  1.000 117.01839 ?  35  ASP A O     1 
ATOM   246   C CB    . ASP A 1 35  ? 236.94182 264.83972 93.12931  1.000 106.59408 ?  35  ASP A CB    1 
ATOM   247   C CG    . ASP A 1 35  ? 236.17711 263.53565 92.88781  1.000 114.29515 ?  35  ASP A CG    1 
ATOM   248   O OD1   . ASP A 1 35  ? 236.26546 262.62277 93.73689  1.000 120.16438 ?  35  ASP A OD1   1 
ATOM   249   O OD2   . ASP A 1 35  ? 235.48454 263.41681 91.84534  1.000 110.97993 ?  35  ASP A OD2   1 
ATOM   250   N N     . LEU A 1 36  ? 233.99513 266.20079 94.03605  1.000 105.61176 ?  36  LEU A N     1 
ATOM   251   C CA    . LEU A 1 36  ? 232.81625 266.89949 93.53436  1.000 105.76027 ?  36  LEU A CA    1 
ATOM   252   C C     . LEU A 1 36  ? 232.65957 266.73373 92.02195  1.000 104.18991 ?  36  LEU A C     1 
ATOM   253   O O     . LEU A 1 36  ? 232.01065 267.54066 91.35985  1.000 103.29020 ?  36  LEU A O     1 
ATOM   254   C CB    . LEU A 1 36  ? 232.87500 268.37495 93.92661  1.000 103.30351 ?  36  LEU A CB    1 
ATOM   255   C CG    . LEU A 1 36  ? 231.99336 268.72913 95.11608  1.000 102.70999 ?  36  LEU A CG    1 
ATOM   256   C CD1   . LEU A 1 36  ? 232.30417 267.80565 96.30951  1.000 102.91524 ?  36  LEU A CD1   1 
ATOM   257   C CD2   . LEU A 1 36  ? 232.20550 270.19407 95.49299  1.000 97.17770  ?  36  LEU A CD2   1 
ATOM   258   N N     . LYS A 1 37  ? 233.20461 265.65666 91.46787  1.000 102.81351 ?  37  LYS A N     1 
ATOM   259   C CA    . LYS A 1 37  ? 233.08179 265.36684 90.04989  1.000 108.83120 ?  37  LYS A CA    1 
ATOM   260   C C     . LYS A 1 37  ? 232.18628 264.14894 89.88064  1.000 108.41935 ?  37  LYS A C     1 
ATOM   261   O O     . LYS A 1 37  ? 232.39127 263.12600 90.54373  1.000 106.38448 ?  37  LYS A O     1 
ATOM   262   C CB    . LYS A 1 37  ? 234.45532 265.15201 89.41066  1.000 112.13703 ?  37  LYS A CB    1 
ATOM   263   C CG    . LYS A 1 37  ? 235.16559 266.45391 89.01680  1.000 116.77465 ?  37  LYS A CG    1 
ATOM   264   C CD    . LYS A 1 37  ? 234.28458 267.32414 88.09925  1.000 112.78417 ?  37  LYS A CD    1 
ATOM   265   C CE    . LYS A 1 37  ? 234.94854 268.65787 87.73164  1.000 108.35372 ?  37  LYS A CE    1 
ATOM   266   N NZ    . LYS A 1 37  ? 234.08650 269.50574 86.84837  1.000 108.39029 ?  37  LYS A NZ    1 
ATOM   267   N N     . LYS A 1 38  ? 231.20592 264.26128 88.98644  1.000 104.34205 ?  38  LYS A N     1 
ATOM   268   C CA    . LYS A 1 38  ? 230.27383 263.16733 88.75595  1.000 105.33752 ?  38  LYS A CA    1 
ATOM   269   C C     . LYS A 1 38  ? 231.00682 261.94096 88.19980  1.000 102.28067 ?  38  LYS A C     1 
ATOM   270   O O     . LYS A 1 38  ? 232.11285 262.07126 87.66781  1.000 101.49631 ?  38  LYS A O     1 
ATOM   271   C CB    . LYS A 1 38  ? 229.15434 263.60761 87.81034  1.000 106.51724 ?  38  LYS A CB    1 
ATOM   272   C CG    . LYS A 1 38  ? 228.35655 264.80666 88.31295  1.000 110.56964 ?  38  LYS A CG    1 
ATOM   273   C CD    . LYS A 1 38  ? 227.34760 265.29886 87.27588  1.000 107.96488 ?  38  LYS A CD    1 
ATOM   274   C CE    . LYS A 1 38  ? 228.01839 265.84023 86.02044  1.000 115.81575 ?  38  LYS A CE    1 
ATOM   275   N NZ    . LYS A 1 38  ? 228.89855 267.02830 86.25980  1.000 118.44023 ?  38  LYS A NZ    1 
ATOM   276   N N     . PRO A 1 39  ? 230.45079 260.73448 88.39219  1.000 101.13091 ?  39  PRO A N     1 
ATOM   277   C CA    . PRO A 1 39  ? 231.11453 259.49948 87.91881  1.000 102.18259 ?  39  PRO A CA    1 
ATOM   278   C C     . PRO A 1 39  ? 231.40194 259.53076 86.42275  1.000 108.01195 ?  39  PRO A C     1 
ATOM   279   O O     . PRO A 1 39  ? 230.52272 259.84840 85.62556  1.000 108.24680 ?  39  PRO A O     1 
ATOM   280   C CB    . PRO A 1 39  ? 230.07615 258.41454 88.22312  1.000 97.78563  ?  39  PRO A CB    1 
ATOM   281   C CG    . PRO A 1 39  ? 229.38912 258.88048 89.41650  1.000 101.94724 ?  39  PRO A CG    1 
ATOM   282   C CD    . PRO A 1 39  ? 229.34660 260.41953 89.32123  1.000 100.56525 ?  39  PRO A CD    1 
ATOM   283   N N     . CYS A 1 40  ? 232.58677 259.04499 86.02555  1.000 109.88847 ?  40  CYS A N     1 
ATOM   284   C CA    . CYS A 1 40  ? 233.05795 259.20311 84.65221  1.000 113.92339 ?  40  CYS A CA    1 
ATOM   285   C C     . CYS A 1 40  ? 233.55958 257.89856 84.01460  1.000 110.68571 ?  40  CYS A C     1 
ATOM   286   O O     . CYS A 1 40  ? 234.19285 257.07477 84.68302  1.000 111.20384 ?  40  CYS A O     1 
ATOM   287   C CB    . CYS A 1 40  ? 234.16439 260.29119 84.67788  1.000 107.01660 ?  40  CYS A CB    1 
ATOM   288   S SG    . CYS A 1 40  ? 235.28159 260.42299 83.28651  1.000 127.65668 ?  40  CYS A SG    1 
ATOM   289   N N     . ILE A 1 41  ? 233.24365 257.69379 82.72167  1.000 98.57419  ?  41  ILE A N     1 
ATOM   290   C CA    . ILE A 1 41  ? 233.81520 256.60851 81.91482  1.000 104.30961 ?  41  ILE A CA    1 
ATOM   291   C C     . ILE A 1 41  ? 234.24273 257.20896 80.58821  1.000 110.27161 ?  41  ILE A C     1 
ATOM   292   O O     . ILE A 1 41  ? 233.83887 258.31244 80.22388  1.000 109.25538 ?  41  ILE A O     1 
ATOM   293   C CB    . ILE A 1 41  ? 232.88504 255.41158 81.59731  1.000 105.51998 ?  41  ILE A CB    1 
ATOM   294   C CG1   . ILE A 1 41  ? 231.54719 255.86567 81.01544  1.000 103.75050 ?  41  ILE A CG1   1 
ATOM   295   C CG2   . ILE A 1 41  ? 232.69908 254.53477 82.82965  1.000 106.38304 ?  41  ILE A CG2   1 
ATOM   296   C CD1   . ILE A 1 41  ? 230.82156 254.75507 80.27597  1.000 94.50266  ?  41  ILE A CD1   1 
ATOM   297   N N     . THR A 1 42  ? 235.13035 256.49835 79.90615  1.000 114.76168 ?  42  THR A N     1 
ATOM   298   C CA    . THR A 1 42  ? 235.59394 256.86832 78.57811  1.000 113.11690 ?  42  THR A CA    1 
ATOM   299   C C     . THR A 1 42  ? 235.00477 255.92395 77.53895  1.000 113.82243 ?  42  THR A C     1 
ATOM   300   O O     . THR A 1 42  ? 235.02536 254.70523 77.72395  1.000 115.48371 ?  42  THR A O     1 
ATOM   301   C CB    . THR A 1 42  ? 237.10865 256.86203 78.54503  1.000 114.19694 ?  42  THR A CB    1 
ATOM   302   O OG1   . THR A 1 42  ? 237.58285 257.52979 79.72414  1.000 123.46089 ?  42  THR A OG1   1 
ATOM   303   C CG2   . THR A 1 42  ? 237.60460 257.59057 77.32113  1.000 104.39609 ?  42  THR A CG2   1 
ATOM   304   N N     . LEU A 1 43  ? 234.48526 256.47243 76.44768  1.000 111.97560 ?  43  LEU A N     1 
ATOM   305   C CA    . LEU A 1 43  ? 233.85141 255.64886 75.42260  1.000 115.22267 ?  43  LEU A CA    1 
ATOM   306   C C     . LEU A 1 43  ? 234.33190 256.12372 74.05308  1.000 115.07605 ?  43  LEU A C     1 
ATOM   307   O O     . LEU A 1 43  ? 235.06380 257.11248 73.93774  1.000 109.64682 ?  43  LEU A O     1 
ATOM   308   C CB    . LEU A 1 43  ? 232.31389 255.69391 75.52095  1.000 113.56050 ?  43  LEU A CB    1 
ATOM   309   C CG    . LEU A 1 43  ? 231.61792 254.76606 76.52128  1.000 110.39850 ?  43  LEU A CG    1 
ATOM   310   C CD1   . LEU A 1 43  ? 230.11985 254.82531 76.33470  1.000 101.91369 ?  43  LEU A CD1   1 
ATOM   311   C CD2   . LEU A 1 43  ? 232.12638 253.36642 76.29783  1.000 105.35840 ?  43  LEU A CD2   1 
ATOM   312   N N     . GLY A 1 44  ? 233.88308 255.43336 72.99709  1.000 115.00067 ?  44  GLY A N     1 
ATOM   313   C CA    . GLY A 1 44  ? 234.33352 255.73077 71.65109  1.000 111.33562 ?  44  GLY A CA    1 
ATOM   314   C C     . GLY A 1 44  ? 233.57826 256.89976 71.02945  1.000 116.34162 ?  44  GLY A C     1 
ATOM   315   O O     . GLY A 1 44  ? 232.74456 257.55016 71.66013  1.000 115.42523 ?  44  GLY A O     1 
ATOM   316   N N     . LYS A 1 45  ? 233.88931 257.16732 69.75925  1.000 120.64805 ?  45  LYS A N     1 
ATOM   317   C CA    . LYS A 1 45  ? 233.31827 258.32818 69.07551  1.000 120.07932 ?  45  LYS A CA    1 
ATOM   318   C C     . LYS A 1 45  ? 231.81683 258.16334 68.89262  1.000 117.80039 ?  45  LYS A C     1 
ATOM   319   O O     . LYS A 1 45  ? 231.32605 257.06432 68.60167  1.000 115.06213 ?  45  LYS A O     1 
ATOM   320   C CB    . LYS A 1 45  ? 233.97852 258.51396 67.70156  1.000 119.47063 ?  45  LYS A CB    1 
ATOM   321   C CG    . LYS A 1 45  ? 233.47681 259.70462 66.92253  1.000 121.09761 ?  45  LYS A CG    1 
ATOM   322   C CD    . LYS A 1 45  ? 233.59588 259.50636 65.41990  1.000 116.70667 ?  45  LYS A CD    1 
ATOM   323   C CE    . LYS A 1 45  ? 235.03225 259.32367 64.99068  1.000 115.44959 ?  45  LYS A CE    1 
ATOM   324   N NZ    . LYS A 1 45  ? 235.12154 259.13403 63.51091  1.000 113.03747 ?  45  LYS A NZ    1 
ATOM   325   N N     . ALA A 1 46  ? 231.09374 259.28437 68.98387  1.000 115.08003 ?  46  ALA A N     1 
ATOM   326   C CA    . ALA A 1 46  ? 229.63922 259.21697 68.94672  1.000 113.75163 ?  46  ALA A CA    1 
ATOM   327   C C     . ALA A 1 46  ? 229.21522 258.52710 67.65469  1.000 114.75747 ?  46  ALA A C     1 
ATOM   328   O O     . ALA A 1 46  ? 229.62099 258.96633 66.56849  1.000 116.20697 ?  46  ALA A O     1 
ATOM   329   C CB    . ALA A 1 46  ? 229.05006 260.63207 69.01840  1.000 104.28506 ?  46  ALA A CB    1 
ATOM   330   N N     . PRO A 1 47  ? 228.42965 257.44892 67.71772  1.000 112.99360 ?  47  PRO A N     1 
ATOM   331   C CA    . PRO A 1 47  ? 228.01969 256.76739 66.48780  1.000 115.27004 ?  47  PRO A CA    1 
ATOM   332   C C     . PRO A 1 47  ? 226.75094 257.37843 65.90345  1.000 120.07219 ?  47  PRO A C     1 
ATOM   333   O O     . PRO A 1 47  ? 226.02705 258.13828 66.55674  1.000 113.04455 ?  47  PRO A O     1 
ATOM   334   C CB    . PRO A 1 47  ? 227.78282 255.31835 66.94823  1.000 105.13135 ?  47  PRO A CB    1 
ATOM   335   C CG    . PRO A 1 47  ? 227.32338 255.45082 68.31482  1.000 109.21742 ?  47  PRO A CG    1 
ATOM   336   C CD    . PRO A 1 47  ? 228.02200 256.68245 68.90757  1.000 110.16443 ?  47  PRO A CD    1 
ATOM   337   N N     . ASP A 1 48  ? 226.50616 257.06548 64.63113  1.000 117.47098 ?  48  ASP A N     1 
ATOM   338   C CA    . ASP A 1 48  ? 225.22186 257.41878 64.04984  1.000 114.78299 ?  48  ASP A CA    1 
ATOM   339   C C     . ASP A 1 48  ? 224.17728 256.50942 64.69413  1.000 115.22606 ?  48  ASP A C     1 
ATOM   340   O O     . ASP A 1 48  ? 224.30184 255.27716 64.64170  1.000 110.77814 ?  48  ASP A O     1 
ATOM   341   C CB    . ASP A 1 48  ? 225.25467 257.27590 62.53079  1.000 112.78963 ?  48  ASP A CB    1 
ATOM   342   C CG    . ASP A 1 48  ? 223.94000 257.67823 61.87597  1.000 117.61632 ?  48  ASP A CG    1 
ATOM   343   O OD1   . ASP A 1 48  ? 223.19865 258.47430 62.49681  1.000 122.10400 ?  48  ASP A OD1   1 
ATOM   344   O OD2   . ASP A 1 48  ? 223.66942 257.25370 60.73073  1.000 115.64306 ?  48  ASP A OD2   1 
ATOM   345   N N     . LEU A 1 49  ? 223.19087 257.12067 65.35780  1.000 114.40891 ?  49  LEU A N     1 
ATOM   346   C CA    . LEU A 1 49  ? 222.19033 256.37587 66.12354  1.000 111.52509 ?  49  LEU A CA    1 
ATOM   347   C C     . LEU A 1 49  ? 221.58219 255.25450 65.28714  1.000 113.16604 ?  49  LEU A C     1 
ATOM   348   O O     . LEU A 1 49  ? 221.50841 254.09637 65.72185  1.000 104.48921 ?  49  LEU A O     1 
ATOM   349   C CB    . LEU A 1 49  ? 221.10660 257.33547 66.62719  1.000 107.13441 ?  49  LEU A CB    1 
ATOM   350   C CG    . LEU A 1 49  ? 221.66591 258.65778 67.18742  1.000 112.86883 ?  49  LEU A CG    1 
ATOM   351   C CD1   . LEU A 1 49  ? 220.67737 259.81947 67.07692  1.000 121.38594 ?  49  LEU A CD1   1 
ATOM   352   C CD2   . LEU A 1 49  ? 222.11436 258.50137 68.62304  1.000 99.72568  ?  49  LEU A CD2   1 
ATOM   353   N N     . ASN A 1 50  ? 221.09046 255.61385 64.09637  1.000 115.93446 ?  50  ASN A N     1 
ATOM   354   C CA    . ASN A 1 50  ? 220.42492 254.66781 63.20572  1.000 115.12316 ?  50  ASN A CA    1 
ATOM   355   C C     . ASN A 1 50  ? 221.33534 253.50888 62.80696  1.000 112.53516 ?  50  ASN A C     1 
ATOM   356   O O     . ASN A 1 50  ? 220.93165 252.34164 62.86898  1.000 105.94862 ?  50  ASN A O     1 
ATOM   357   C CB    . ASN A 1 50  ? 219.92975 255.41291 61.95951  1.000 113.22571 ?  50  ASN A CB    1 
ATOM   358   C CG    . ASN A 1 50  ? 219.58292 256.88730 62.23749  1.000 113.35908 ?  50  ASN A CG    1 
ATOM   359   O OD1   . ASN A 1 50  ? 218.67047 257.19514 63.00759  1.000 113.87833 ?  50  ASN A OD1   1 
ATOM   360   N ND2   . ASN A 1 50  ? 220.30227 257.79787 61.58374  1.000 119.42434 ?  50  ASN A ND2   1 
ATOM   361   N N     . LYS A 1 51  ? 222.57780 253.81189 62.40396  1.000 112.50413 ?  51  LYS A N     1 
ATOM   362   C CA    . LYS A 1 51  ? 223.47864 252.74726 61.96586  1.000 110.19667 ?  51  LYS A CA    1 
ATOM   363   C C     . LYS A 1 51  ? 223.87945 251.87874 63.14890  1.000 107.92954 ?  51  LYS A C     1 
ATOM   364   O O     . LYS A 1 51  ? 223.79421 250.64288 63.08797  1.000 95.14127  ?  51  LYS A O     1 
ATOM   365   C CB    . LYS A 1 51  ? 224.71619 253.36185 61.28893  1.000 111.30952 ?  51  LYS A CB    1 
ATOM   366   C CG    . LYS A 1 51  ? 224.49651 254.01694 59.88910  1.000 113.46660 ?  51  LYS A CG    1 
ATOM   367   C CD    . LYS A 1 51  ? 225.80742 254.63595 59.33876  1.000 112.40904 ?  51  LYS A CD    1 
ATOM   368   C CE    . LYS A 1 51  ? 225.63834 255.35613 58.00273  1.000 102.01927 ?  51  LYS A CE    1 
ATOM   369   N NZ    . LYS A 1 51  ? 226.91877 255.97320 57.52839  1.000 103.35320 ?  51  LYS A NZ    1 
ATOM   370   N N     . ALA A 1 52  ? 224.17370 252.51831 64.28147  1.000 114.29397 ?  52  ALA A N     1 
ATOM   371   C CA    . ALA A 1 52  ? 224.52690 251.74953 65.46057  1.000 113.27412 ?  52  ALA A CA    1 
ATOM   372   C C     . ALA A 1 52  ? 223.36483 250.84930 65.85590  1.000 110.57078 ?  52  ALA A C     1 
ATOM   373   O O     . ALA A 1 52  ? 223.57549 249.67763 66.18731  1.000 106.29722 ?  52  ALA A O     1 
ATOM   374   C CB    . ALA A 1 52  ? 224.93554 252.69455 66.59291  1.000 98.74528  ?  52  ALA A CB    1 
ATOM   375   N N     . TYR A 1 53  ? 222.12755 251.36569 65.72259  1.000 105.41848 ?  53  TYR A N     1 
ATOM   376   C CA    . TYR A 1 53  ? 220.91961 250.61252 66.06988  1.000 104.29558 ?  53  TYR A CA    1 
ATOM   377   C C     . TYR A 1 53  ? 220.82439 249.35281 65.20842  1.000 104.95377 ?  53  TYR A C     1 
ATOM   378   O O     . TYR A 1 53  ? 220.37745 248.27959 65.66198  1.000 92.96643  ?  53  TYR A O     1 
ATOM   379   C CB    . TYR A 1 53  ? 219.66525 251.48342 65.82302  1.000 101.77637 ?  53  TYR A CB    1 
ATOM   380   C CG    . TYR A 1 53  ? 218.35611 250.70762 65.99783  1.000 108.86414 ?  53  TYR A CG    1 
ATOM   381   C CD1   . TYR A 1 53  ? 217.86045 249.89863 64.97938  1.000 105.95921 ?  53  TYR A CD1   1 
ATOM   382   C CD2   . TYR A 1 53  ? 217.53728 250.91408 67.11274  1.000 106.09402 ?  53  TYR A CD2   1 
ATOM   383   C CE1   . TYR A 1 53  ? 216.70187 249.19697 65.11817  1.000 104.83355 ?  53  TYR A CE1   1 
ATOM   384   C CE2   . TYR A 1 53  ? 216.32585 250.22293 67.25162  1.000 109.22316 ?  53  TYR A CE2   1 
ATOM   385   C CZ    . TYR A 1 53  ? 215.91703 249.35939 66.23266  1.000 109.99730 ?  53  TYR A CZ    1 
ATOM   386   O OH    . TYR A 1 53  ? 214.73731 248.63659 66.28187  1.000 111.63837 ?  53  TYR A OH    1 
ATOM   387   N N     . LYS A 1 54  ? 221.15437 249.51475 63.92377  1.000 109.57788 ?  54  LYS A N     1 
ATOM   388   C CA    . LYS A 1 54  ? 221.08977 248.42151 62.96549  1.000 111.33837 ?  54  LYS A CA    1 
ATOM   389   C C     . LYS A 1 54  ? 222.11757 247.34004 63.28375  1.000 110.06016 ?  54  LYS A C     1 
ATOM   390   O O     . LYS A 1 54  ? 221.79763 246.14125 63.31120  1.000 103.23646 ?  54  LYS A O     1 
ATOM   391   C CB    . LYS A 1 54  ? 221.27624 248.96936 61.53456  1.000 106.39338 ?  54  LYS A CB    1 
ATOM   392   C CG    . LYS A 1 54  ? 220.20967 250.01357 61.10234  1.000 104.72610 ?  54  LYS A CG    1 
ATOM   393   C CD    . LYS A 1 54  ? 220.40197 250.55208 59.66171  1.000 111.65816 ?  54  LYS A CD    1 
ATOM   394   C CE    . LYS A 1 54  ? 219.22107 251.42564 59.18928  1.000 108.93375 ?  54  LYS A CE    1 
ATOM   395   N NZ    . LYS A 1 54  ? 219.39009 251.84187 57.77720  1.000 105.70009 ?  54  LYS A NZ    1 
ATOM   396   N N     . SER A 1 55  ? 223.34953 247.75575 63.58760  1.000 109.62535 ?  55  SER A N     1 
ATOM   397   C CA    . SER A 1 55  ? 224.41886 246.78556 63.76227  1.000 106.80122 ?  55  SER A CA    1 
ATOM   398   C C     . SER A 1 55  ? 224.14652 245.89486 64.96843  1.000 106.69209 ?  55  SER A C     1 
ATOM   399   O O     . SER A 1 55  ? 224.15722 244.66041 64.85639  1.000 103.09520 ?  55  SER A O     1 
ATOM   400   C CB    . SER A 1 55  ? 225.74488 247.53855 63.87822  1.000 102.09607 ?  55  SER A CB    1 
ATOM   401   O OG    . SER A 1 55  ? 226.80502 246.70246 64.29004  1.000 105.76372 ?  55  SER A OG    1 
ATOM   402   N N     . VAL A 1 56  ? 223.78526 246.52051 66.10138  1.000 103.91114 ?  56  VAL A N     1 
ATOM   403   C CA    . VAL A 1 56  ? 223.57694 245.81555 67.36574  1.000 102.24994 ?  56  VAL A CA    1 
ATOM   404   C C     . VAL A 1 56  ? 222.33653 244.91846 67.28831  1.000 103.55485 ?  56  VAL A C     1 
ATOM   405   O O     . VAL A 1 56  ? 222.34007 243.77965 67.79215  1.000 95.63605  ?  56  VAL A O     1 
ATOM   406   C CB    . VAL A 1 56  ? 223.51265 246.83463 68.53358  1.000 105.72415 ?  56  VAL A CB    1 
ATOM   407   C CG1   . VAL A 1 56  ? 224.88229 247.40866 68.83166  1.000 107.47809 ?  56  VAL A CG1   1 
ATOM   408   C CG2   . VAL A 1 56  ? 222.58826 247.98481 68.24675  1.000 107.59695 ?  56  VAL A CG2   1 
ATOM   409   N N     . LEU A 1 57  ? 221.28913 245.39045 66.59031  1.000 103.40885 ?  57  LEU A N     1 
ATOM   410   C CA    . LEU A 1 57  ? 220.06175 244.60953 66.39006  1.000 107.45301 ?  57  LEU A CA    1 
ATOM   411   C C     . LEU A 1 57  ? 220.31066 243.29908 65.64038  1.000 102.01078 ?  57  LEU A C     1 
ATOM   412   O O     . LEU A 1 57  ? 219.71457 242.25980 65.96252  1.000 91.96099  ?  57  LEU A O     1 
ATOM   413   C CB    . LEU A 1 57  ? 219.02244 245.48989 65.66952  1.000 104.08508 ?  57  LEU A CB    1 
ATOM   414   C CG    . LEU A 1 57  ? 217.58338 244.94087 65.66759  1.000 103.06530 ?  57  LEU A CG    1 
ATOM   415   C CD1   . LEU A 1 57  ? 217.00920 244.71481 67.02486  1.000 102.01582 ?  57  LEU A CD1   1 
ATOM   416   C CD2   . LEU A 1 57  ? 216.65143 245.90725 64.93532  1.000 101.57017 ?  57  LEU A CD2   1 
ATOM   417   N N     . SER A 1 58  ? 221.11628 243.36323 64.58439  1.000 105.31368 ?  58  SER A N     1 
ATOM   418   C CA    . SER A 1 58  ? 221.57055 242.17112 63.88394  1.000 109.42157 ?  58  SER A CA    1 
ATOM   419   C C     . SER A 1 58  ? 222.46515 241.32587 64.76257  1.000 103.88525 ?  58  SER A C     1 
ATOM   420   O O     . SER A 1 58  ? 222.35707 240.08958 64.77599  1.000 100.67649 ?  58  SER A O     1 
ATOM   421   C CB    . SER A 1 58  ? 222.31901 242.59603 62.64570  1.000 114.85664 ?  58  SER A CB    1 
ATOM   422   O OG    . SER A 1 58  ? 223.60848 243.08360 63.01010  1.000 110.14950 ?  58  SER A OG    1 
ATOM   423   N N     . GLY A 1 59  ? 223.36175 241.98935 65.49921  1.000 104.00139 ?  59  GLY A N     1 
ATOM   424   C CA    . GLY A 1 59  ? 224.22719 241.27733 66.41244  1.000 105.93694 ?  59  GLY A CA    1 
ATOM   425   C C     . GLY A 1 59  ? 223.43346 240.51026 67.44957  1.000 106.72096 ?  59  GLY A C     1 
ATOM   426   O O     . GLY A 1 59  ? 223.84606 239.43224 67.88745  1.000 104.78422 ?  59  GLY A O     1 
ATOM   427   N N     . MET A 1 60  ? 222.31345 241.08892 67.89808  1.000 100.14706 ?  60  MET A N     1 
ATOM   428   C CA    . MET A 1 60  ? 221.44320 240.41826 68.86176  1.000 104.43338 ?  60  MET A CA    1 
ATOM   429   C C     . MET A 1 60  ? 220.89773 239.10483 68.33843  1.000 103.63643 ?  60  MET A C     1 
ATOM   430   O O     . MET A 1 60  ? 220.86762 238.09352 69.05765  1.000 102.55265 ?  60  MET A O     1 
ATOM   431   C CB    . MET A 1 60  ? 220.30011 241.33707 69.28064  1.000 103.39701 ?  60  MET A CB    1 
ATOM   432   C CG    . MET A 1 60  ? 219.75269 240.96129 70.63155  1.000 99.15001  ?  60  MET A CG    1 
ATOM   433   S SD    . MET A 1 60  ? 220.95916 241.48391 71.83356  1.000 126.76341 ?  60  MET A SD    1 
ATOM   434   C CE    . MET A 1 60  ? 219.86626 242.15906 73.06945  1.000 118.49659 ?  60  MET A CE    1 
ATOM   435   N N     . SER A 1 61  ? 220.33193 239.14737 67.12029  1.000 102.45353 ?  61  SER A N     1 
ATOM   436   C CA    . SER A 1 61  ? 219.75118 237.96675 66.50232  1.000 101.12545 ?  61  SER A CA    1 
ATOM   437   C C     . SER A 1 61  ? 220.81693 236.97119 66.09037  1.000 101.93995 ?  61  SER A C     1 
ATOM   438   O O     . SER A 1 61  ? 220.54471 235.76153 66.07743  1.000 100.41840 ?  61  SER A O     1 
ATOM   439   C CB    . SER A 1 61  ? 218.83396 238.37890 65.33260  1.000 94.81934  ?  61  SER A CB    1 
ATOM   440   O OG    . SER A 1 61  ? 219.48845 239.38050 64.49179  1.000 107.29841 ?  61  SER A OG    1 
ATOM   441   N N     . ALA A 1 62  ? 222.00897 237.46278 65.72737  1.000 104.17618 ?  62  ALA A N     1 
ATOM   442   C CA    . ALA A 1 62  ? 223.12679 236.64182 65.29179  1.000 112.28274 ?  62  ALA A CA    1 
ATOM   443   C C     . ALA A 1 62  ? 224.01162 236.16036 66.44908  1.000 110.70610 ?  62  ALA A C     1 
ATOM   444   O O     . ALA A 1 62  ? 224.90765 235.33315 66.23343  1.000 104.87340 ?  62  ALA A O     1 
ATOM   445   C CB    . ALA A 1 62  ? 223.98738 237.42321 64.28699  1.000 114.51084 ?  62  ALA A CB    1 
ATOM   446   N N     . ALA A 1 63  ? 223.71398 236.62554 67.68189  1.000 110.83575 ?  63  ALA A N     1 
ATOM   447   C CA    . ALA A 1 63  ? 224.42693 236.32968 68.91882  1.000 108.16203 ?  63  ALA A CA    1 
ATOM   448   C C     . ALA A 1 63  ? 225.86466 236.83649 68.91483  1.000 107.13362 ?  63  ALA A C     1 
ATOM   449   O O     . ALA A 1 63  ? 226.70320 236.32062 69.66631  1.000 111.97319 ?  63  ALA A O     1 
ATOM   450   C CB    . ALA A 1 63  ? 224.38631 234.83428 69.26679  1.000 101.73370 ?  63  ALA A CB    1 
ATOM   451   N N     . LYS A 1 64  ? 226.18350 237.82884 68.07821  1.000 100.57164 ?  64  LYS A N     1 
ATOM   452   C CA    . LYS A 1 64  ? 227.51672 238.41865 68.06575  1.000 102.76202 ?  64  LYS A CA    1 
ATOM   453   C C     . LYS A 1 64  ? 227.44046 239.90902 68.39061  1.000 99.74371  ?  64  LYS A C     1 
ATOM   454   O O     . LYS A 1 64  ? 226.91220 240.69399 67.59301  1.000 102.45919 ?  64  LYS A O     1 
ATOM   455   C CB    . LYS A 1 64  ? 228.18749 238.16920 66.71040  1.000 104.16322 ?  64  LYS A CB    1 
ATOM   456   C CG    . LYS A 1 64  ? 229.63538 238.64765 66.59774  1.000 104.52187 ?  64  LYS A CG    1 
ATOM   457   C CD    . LYS A 1 64  ? 230.26954 238.19041 65.27638  1.000 108.00767 ?  64  LYS A CD    1 
ATOM   458   C CE    . LYS A 1 64  ? 231.74173 238.59772 65.15354  1.000 104.75510 ?  64  LYS A CE    1 
ATOM   459   N NZ    . LYS A 1 64  ? 232.34494 238.06954 63.88384  1.000 102.48805 ?  64  LYS A NZ    1 
ATOM   460   N N     . LEU A 1 65  ? 228.04840 240.31005 69.51771  1.000 97.87381  ?  65  LEU A N     1 
ATOM   461   C CA    . LEU A 1 65  ? 227.98540 241.68373 70.01460  1.000 103.66710 ?  65  LEU A CA    1 
ATOM   462   C C     . LEU A 1 65  ? 229.36935 242.22115 70.34192  1.000 98.62859  ?  65  LEU A C     1 
ATOM   463   O O     . LEU A 1 65  ? 230.18929 241.52185 70.94713  1.000 98.11114  ?  65  LEU A O     1 
ATOM   464   C CB    . LEU A 1 65  ? 227.09969 241.77807 71.26830  1.000 104.06315 ?  65  LEU A CB    1 
ATOM   465   C CG    . LEU A 1 65  ? 225.59831 241.75131 70.98060  1.000 104.54739 ?  65  LEU A CG    1 
ATOM   466   C CD1   . LEU A 1 65  ? 224.75138 241.68389 72.23733  1.000 92.55199  ?  65  LEU A CD1   1 
ATOM   467   C CD2   . LEU A 1 65  ? 225.23397 243.00259 70.16500  1.000 110.41658 ?  65  LEU A CD2   1 
ATOM   468   N N     . ASP A 1 66  ? 229.59750 243.49104 69.99838  1.000 87.38628  ?  66  ASP A N     1 
ATOM   469   C CA    . ASP A 1 66  ? 230.85535 244.12940 70.31962  1.000 94.33959  ?  66  ASP A CA    1 
ATOM   470   C C     . ASP A 1 66  ? 230.63946 245.00690 71.53812  1.000 100.74295 ?  66  ASP A C     1 
ATOM   471   O O     . ASP A 1 66  ? 229.83450 245.95601 71.46867  1.000 100.85645 ?  66  ASP A O     1 
ATOM   472   C CB    . ASP A 1 66  ? 231.36193 244.96057 69.14670  1.000 104.14473 ?  66  ASP A CB    1 
ATOM   473   C CG    . ASP A 1 66  ? 232.75064 245.58224 69.39427  1.000 113.17534 ?  66  ASP A CG    1 
ATOM   474   O OD1   . ASP A 1 66  ? 232.83730 246.68273 69.99135  1.000 108.41434 ?  66  ASP A OD1   1 
ATOM   475   O OD2   . ASP A 1 66  ? 233.76611 244.98437 68.95883  1.000 113.68753 ?  66  ASP A OD2   1 
ATOM   476   N N     . PRO A 1 67  ? 231.33227 244.74839 72.65609  1.000 102.11524 ?  67  PRO A N     1 
ATOM   477   C CA    . PRO A 1 67  ? 231.01341 245.48875 73.88976  1.000 96.70855  ?  67  PRO A CA    1 
ATOM   478   C C     . PRO A 1 67  ? 231.17603 246.99268 73.76700  1.000 99.97929  ?  67  PRO A C     1 
ATOM   479   O O     . PRO A 1 67  ? 230.24265 247.72664 74.10838  1.000 104.39957 ?  67  PRO A O     1 
ATOM   480   C CB    . PRO A 1 67  ? 231.98799 244.87835 74.90973  1.000 91.82451  ?  67  PRO A CB    1 
ATOM   481   C CG    . PRO A 1 67  ? 232.31296 243.52245 74.36107  1.000 90.91356  ?  67  PRO A CG    1 
ATOM   482   C CD    . PRO A 1 67  ? 232.34493 243.70004 72.88735  1.000 102.31957 ?  67  PRO A CD    1 
ATOM   483   N N     . ASP A 1 68  ? 232.29512 247.47584 73.22326  1.000 98.34167  ?  68  ASP A N     1 
ATOM   484   C CA    . ASP A 1 68  ? 232.50852 248.92112 73.13881  1.000 103.34707 ?  68  ASP A CA    1 
ATOM   485   C C     . ASP A 1 68  ? 231.45588 249.59800 72.26984  1.000 101.40754 ?  68  ASP A C     1 
ATOM   486   O O     . ASP A 1 68  ? 231.06920 250.75362 72.52093  1.000 90.44264  ?  68  ASP A O     1 
ATOM   487   C CB    . ASP A 1 68  ? 233.91241 249.22535 72.62811  1.000 111.14670 ?  68  ASP A CB    1 
ATOM   488   C CG    . ASP A 1 68  ? 234.34691 250.65874 72.92082  1.000 118.93023 ?  68  ASP A CG    1 
ATOM   489   O OD1   . ASP A 1 68  ? 233.69321 251.39711 73.71018  1.000 119.60178 ?  68  ASP A OD1   1 
ATOM   490   O OD2   . ASP A 1 68  ? 235.36646 251.05064 72.32572  1.000 128.16329 ?  68  ASP A OD2   1 
ATOM   491   N N     . ASP A 1 69  ? 231.04294 248.92882 71.19566  1.000 104.96371 ?  69  ASP A N     1 
ATOM   492   C CA    . ASP A 1 69  ? 230.01978 249.51756 70.35022  1.000 111.46964 ?  69  ASP A CA    1 
ATOM   493   C C     . ASP A 1 69  ? 228.71420 249.65050 71.12882  1.000 104.76437 ?  69  ASP A C     1 
ATOM   494   O O     . ASP A 1 69  ? 228.14348 250.75090 71.21944  1.000 101.87830 ?  69  ASP A O     1 
ATOM   495   C CB    . ASP A 1 69  ? 229.83738 248.65163 69.09634  1.000 110.62755 ?  69  ASP A CB    1 
ATOM   496   C CG    . ASP A 1 69  ? 231.06808 248.65787 68.17724  1.000 106.32731 ?  69  ASP A CG    1 
ATOM   497   O OD1   . ASP A 1 69  ? 232.07825 249.34526 68.48138  1.000 106.25661 ?  69  ASP A OD1   1 
ATOM   498   O OD2   . ASP A 1 69  ? 231.02088 247.93734 67.15513  1.000 99.95560  ?  69  ASP A OD2   1 
ATOM   499   N N     . VAL A 1 70  ? 228.32738 248.58360 71.83748  1.000 95.56940  ?  70  VAL A N     1 
ATOM   500   C CA    . VAL A 1 70  ? 227.06562 248.60854 72.56918  1.000 96.50016  ?  70  VAL A CA    1 
ATOM   501   C C     . VAL A 1 70  ? 227.06826 249.75161 73.60338  1.000 97.91778  ?  70  VAL A C     1 
ATOM   502   O O     . VAL A 1 70  ? 226.06733 250.46274 73.75842  1.000 99.01434  ?  70  VAL A O     1 
ATOM   503   C CB    . VAL A 1 70  ? 226.76808 247.20814 73.16560  1.000 96.26643  ?  70  VAL A CB    1 
ATOM   504   C CG1   . VAL A 1 70  ? 225.73879 247.29315 74.25567  1.000 95.35350  ?  70  VAL A CG1   1 
ATOM   505   C CG2   . VAL A 1 70  ? 226.30162 246.17579 72.05162  1.000 86.68589  ?  70  VAL A CG2   1 
ATOM   506   N N     . CYS A 1 71  ? 228.19502 249.97419 74.29166  1.000 99.02707  ?  71  CYS A N     1 
ATOM   507   C CA    . CYS A 1 71  ? 228.28006 251.05900 75.27862  1.000 100.89106 ?  71  CYS A CA    1 
ATOM   508   C C     . CYS A 1 71  ? 228.21700 252.44794 74.65052  1.000 99.98596  ?  71  CYS A C     1 
ATOM   509   O O     . CYS A 1 71  ? 227.74424 253.40308 75.28359  1.000 94.09552  ?  71  CYS A O     1 
ATOM   510   C CB    . CYS A 1 71  ? 229.53431 250.90918 76.12558  1.000 104.81943 ?  71  CYS A CB    1 
ATOM   511   S SG    . CYS A 1 71  ? 229.46375 249.37329 77.09950  1.000 119.65860 ?  71  CYS A SG    1 
ATOM   512   N N     . SER A 1 72  ? 228.84010 252.61763 73.48902  1.000 100.70553 ?  72  SER A N     1 
ATOM   513   C CA    . SER A 1 72  ? 228.77467 253.90091 72.80238  1.000 103.95353 ?  72  SER A CA    1 
ATOM   514   C C     . SER A 1 72  ? 227.34525 254.22789 72.39330  1.000 101.09530 ?  72  SER A C     1 
ATOM   515   O O     . SER A 1 72  ? 226.94469 255.40422 72.40175  1.000 98.10809  ?  72  SER A O     1 
ATOM   516   C CB    . SER A 1 72  ? 229.71356 253.87115 71.60858  1.000 105.45034 ?  72  SER A CB    1 
ATOM   517   O OG    . SER A 1 72  ? 229.21236 252.96454 70.64492  1.000 103.12885 ?  72  SER A OG    1 
ATOM   518   N N     . TYR A 1 73  ? 226.58571 253.19826 71.96381  1.000 95.49521  ?  73  TYR A N     1 
ATOM   519   C CA    . TYR A 1 73  ? 225.17896 253.38736 71.58923  1.000 98.08728  ?  73  TYR A CA    1 
ATOM   520   C C     . TYR A 1 73  ? 224.31609 253.79366 72.78380  1.000 103.04577 ?  73  TYR A C     1 
ATOM   521   O O     . TYR A 1 73  ? 223.49607 254.72117 72.68630  1.000 99.62816  ?  73  TYR A O     1 
ATOM   522   C CB    . TYR A 1 73  ? 224.63820 252.12955 70.87302  1.000 100.92703 ?  73  TYR A CB    1 
ATOM   523   C CG    . TYR A 1 73  ? 223.11746 252.03917 70.83499  1.000 107.12338 ?  73  TYR A CG    1 
ATOM   524   C CD1   . TYR A 1 73  ? 222.37964 252.86722 69.99723  1.000 108.68770 ?  73  TYR A CD1   1 
ATOM   525   C CD2   . TYR A 1 73  ? 222.43890 251.00905 71.47797  1.000 109.40410 ?  73  TYR A CD2   1 
ATOM   526   C CE1   . TYR A 1 73  ? 221.00218 252.79504 69.94038  1.000 104.52401 ?  73  TYR A CE1   1 
ATOM   527   C CE2   . TYR A 1 73  ? 221.05617 250.90548 71.40733  1.000 110.17689 ?  73  TYR A CE2   1 
ATOM   528   C CZ    . TYR A 1 73  ? 220.34451 251.79688 70.63060  1.000 109.67979 ?  73  TYR A CZ    1 
ATOM   529   O OH    . TYR A 1 73  ? 218.97610 251.67949 70.55478  1.000 110.11781 ?  73  TYR A OH    1 
ATOM   530   N N     . LEU A 1 74  ? 224.51067 253.12285 73.92206  1.000 103.80576 ?  74  LEU A N     1 
ATOM   531   C CA    . LEU A 1 74  ? 223.76660 253.41861 75.14053  1.000 97.05316  ?  74  LEU A CA    1 
ATOM   532   C C     . LEU A 1 74  ? 224.08059 254.82672 75.62881  1.000 98.21452  ?  74  LEU A C     1 
ATOM   533   O O     . LEU A 1 74  ? 223.19951 255.53151 76.14058  1.000 103.01782 ?  74  LEU A O     1 
ATOM   534   C CB    . LEU A 1 74  ? 224.11836 252.36076 76.19082  1.000 89.02162  ?  74  LEU A CB    1 
ATOM   535   C CG    . LEU A 1 74  ? 223.68264 250.90345 75.89608  1.000 92.35780  ?  74  LEU A CG    1 
ATOM   536   C CD1   . LEU A 1 74  ? 224.27234 249.88660 76.88062  1.000 87.19002  ?  74  LEU A CD1   1 
ATOM   537   C CD2   . LEU A 1 74  ? 222.16289 250.71896 75.85237  1.000 89.04835  ?  74  LEU A CD2   1 
ATOM   538   N N     . ALA A 1 75  ? 225.34804 255.23607 75.52887  1.000 96.51668  ?  75  ALA A N     1 
ATOM   539   C CA    . ALA A 1 75  ? 225.69484 256.59432 75.92219  1.000 103.47569 ?  75  ALA A CA    1 
ATOM   540   C C     . ALA A 1 75  ? 225.02887 257.60511 74.99628  1.000 104.35854 ?  75  ALA A C     1 
ATOM   541   O O     . ALA A 1 75  ? 224.52476 258.64021 75.45403  1.000 104.31910 ?  75  ALA A O     1 
ATOM   542   C CB    . ALA A 1 75  ? 227.21175 256.77437 75.94105  1.000 98.31941  ?  75  ALA A CB    1 
ATOM   543   N N     . ALA A 1 76  ? 224.99343 257.30968 73.68989  1.000 97.44423  ?  76  ALA A N     1 
ATOM   544   C CA    . ALA A 1 76  ? 224.34199 258.21126 72.74210  1.000 101.13373 ?  76  ALA A CA    1 
ATOM   545   C C     . ALA A 1 76  ? 222.83443 258.27200 72.97697  1.000 109.02260 ?  76  ALA A C     1 
ATOM   546   O O     . ALA A 1 76  ? 222.22649 259.34891 72.90017  1.000 111.77832 ?  76  ALA A O     1 
ATOM   547   C CB    . ALA A 1 76  ? 224.64960 257.77617 71.31218  1.000 99.52795  ?  76  ALA A CB    1 
ATOM   548   N N     . ALA A 1 77  ? 222.22056 257.13301 73.30857  1.000 104.56943 ?  77  ALA A N     1 
ATOM   549   C CA    . ALA A 1 77  ? 220.77407 257.06699 73.49732  1.000 105.71176 ?  77  ALA A CA    1 
ATOM   550   C C     . ALA A 1 77  ? 220.28574 257.83578 74.72391  1.000 110.51742 ?  77  ALA A C     1 
ATOM   551   O O     . ALA A 1 77  ? 219.07652 258.05692 74.86742  1.000 111.09416 ?  77  ALA A O     1 
ATOM   552   C CB    . ALA A 1 77  ? 220.34298 255.59659 73.56766  1.000 99.52249  ?  77  ALA A CB    1 
ATOM   553   N N     . MET A 1 78  ? 221.18707 258.25063 75.62114  1.000 110.49238 ?  78  MET A N     1 
ATOM   554   C CA    . MET A 1 78  ? 220.78604 258.90456 76.86693  1.000 111.84942 ?  78  MET A CA    1 
ATOM   555   C C     . MET A 1 78  ? 220.01950 260.20116 76.64494  1.000 111.50661 ?  78  MET A C     1 
ATOM   556   O O     . MET A 1 78  ? 219.18313 260.58858 77.48113  1.000 109.52074 ?  78  MET A O     1 
ATOM   557   C CB    . MET A 1 78  ? 222.02305 259.17580 77.70826  1.000 113.10113 ?  78  MET A CB    1 
ATOM   558   C CG    . MET A 1 78  ? 222.49604 258.00300 78.52051  1.000 105.56632 ?  78  MET A CG    1 
ATOM   559   S SD    . MET A 1 78  ? 223.83918 258.63106 79.48752  1.000 114.27043 ?  78  MET A SD    1 
ATOM   560   C CE    . MET A 1 78  ? 224.49538 257.05633 80.01090  1.000 104.87152 ?  78  MET A CE    1 
ATOM   561   N N     . GLN A 1 79  ? 220.29380 260.90887 75.54621  1.000 112.13584 ?  79  GLN A N     1 
ATOM   562   C CA    . GLN A 1 79  ? 219.58081 262.15410 75.27325  1.000 112.89420 ?  79  GLN A CA    1 
ATOM   563   C C     . GLN A 1 79  ? 218.10560 261.89589 75.02732  1.000 111.13752 ?  79  GLN A C     1 
ATOM   564   O O     . GLN A 1 79  ? 217.25633 262.74611 75.32521  1.000 107.27859 ?  79  GLN A O     1 
ATOM   565   C CB    . GLN A 1 79  ? 220.19971 262.84806 74.06825  1.000 112.13951 ?  79  GLN A CB    1 
ATOM   566   C CG    . GLN A 1 79  ? 219.37385 263.97904 73.54357  1.000 111.49820 ?  79  GLN A CG    1 
ATOM   567   C CD    . GLN A 1 79  ? 218.54578 263.54387 72.37296  1.000 114.64508 ?  79  GLN A CD    1 
ATOM   568   O OE1   . GLN A 1 79  ? 218.62272 262.38378 71.95046  1.000 116.88783 ?  79  GLN A OE1   1 
ATOM   569   N NE2   . GLN A 1 79  ? 217.73414 264.44875 71.85387  1.000 113.39207 ?  79  GLN A NE2   1 
ATOM   570   N N     . PHE A 1 80  ? 217.77455 260.70298 74.46265  1.000 110.68285 ?  80  PHE A N     1 
ATOM   571   C CA    . PHE A 1 80  ? 216.39159 260.35196 74.12823  1.000 111.80648 ?  80  PHE A CA    1 
ATOM   572   C C     . PHE A 1 80  ? 215.48979 260.35246 75.37593  1.000 113.61553 ?  80  PHE A C     1 
ATOM   573   O O     . PHE A 1 80  ? 214.31098 260.74507 75.31340  1.000 111.92690 ?  80  PHE A O     1 
ATOM   574   C CB    . PHE A 1 80  ? 216.35935 258.97452 73.43682  1.000 105.45751 ?  80  PHE A CB    1 
ATOM   575   C CG    . PHE A 1 80  ? 216.90783 258.93944 71.98500  1.000 108.08046 ?  80  PHE A CG    1 
ATOM   576   C CD1   . PHE A 1 80  ? 218.24357 259.18829 71.71163  1.000 109.26935 ?  80  PHE A CD1   1 
ATOM   577   C CD2   . PHE A 1 80  ? 216.09579 258.50277 70.92143  1.000 111.17319 ?  80  PHE A CD2   1 
ATOM   578   C CE1   . PHE A 1 80  ? 218.74285 259.12503 70.39087  1.000 115.05438 ?  80  PHE A CE1   1 
ATOM   579   C CE2   . PHE A 1 80  ? 216.59558 258.41935 69.61019  1.000 109.93557 ?  80  PHE A CE2   1 
ATOM   580   C CZ    . PHE A 1 80  ? 217.91666 258.73258 69.34963  1.000 109.44679 ?  80  PHE A CZ    1 
ATOM   581   N N     . PHE A 1 81  ? 216.00968 259.86598 76.50695  1.000 109.60924 ?  81  PHE A N     1 
ATOM   582   C CA    . PHE A 1 81  ? 215.23374 259.75734 77.74157  1.000 107.44256 ?  81  PHE A CA    1 
ATOM   583   C C     . PHE A 1 81  ? 215.41935 261.01133 78.59867  1.000 108.48265 ?  81  PHE A C     1 
ATOM   584   O O     . PHE A 1 81  ? 216.46398 261.19297 79.23509  1.000 103.42556 ?  81  PHE A O     1 
ATOM   585   C CB    . PHE A 1 81  ? 215.65882 258.52380 78.51661  1.000 95.10503  ?  81  PHE A CB    1 
ATOM   586   C CG    . PHE A 1 81  ? 215.72967 257.30542 77.70040  1.000 89.88646  ?  81  PHE A CG    1 
ATOM   587   C CD1   . PHE A 1 81  ? 214.58220 256.58387 77.42575  1.000 94.98489  ?  81  PHE A CD1   1 
ATOM   588   C CD2   . PHE A 1 81  ? 216.94217 256.86682 77.19509  1.000 94.83195  ?  81  PHE A CD2   1 
ATOM   589   C CE1   . PHE A 1 81  ? 214.63790 255.42186 76.68214  1.000 101.21777 ?  81  PHE A CE1   1 
ATOM   590   C CE2   . PHE A 1 81  ? 217.01014 255.70808 76.44266  1.000 103.62066 ?  81  PHE A CE2   1 
ATOM   591   C CZ    . PHE A 1 81  ? 215.85306 254.98439 76.18545  1.000 104.80308 ?  81  PHE A CZ    1 
ATOM   592   N N     . GLU A 1 82  ? 214.37888 261.83014 78.69141  1.000 107.99856 ?  82  GLU A N     1 
ATOM   593   C CA    . GLU A 1 82  ? 214.42935 263.05448 79.47631  1.000 108.99141 ?  82  GLU A CA    1 
ATOM   594   C C     . GLU A 1 82  ? 213.11175 263.26081 80.19473  1.000 108.85803 ?  82  GLU A C     1 
ATOM   595   O O     . GLU A 1 82  ? 212.05171 262.85312 79.71093  1.000 108.19180 ?  82  GLU A O     1 
ATOM   596   C CB    . GLU A 1 82  ? 214.67282 264.32888 78.66624  1.000 114.85772 ?  82  GLU A CB    1 
ATOM   597   C CG    . GLU A 1 82  ? 213.66127 264.54330 77.55224  1.000 114.29650 ?  82  GLU A CG    1 
ATOM   598   C CD    . GLU A 1 82  ? 213.52674 266.00380 77.13044  1.000 109.32285 ?  82  GLU A CD    1 
ATOM   599   O OE1   . GLU A 1 82  ? 214.12180 266.91053 77.76542  1.000 106.24895 ?  82  GLU A OE1   1 
ATOM   600   O OE2   . GLU A 1 82  ? 212.87880 266.22989 76.09463  1.000 110.17323 ?  82  GLU A OE2   1 
ATOM   601   N N     . GLY A 1 83  ? 213.18793 263.86511 81.36348  1.000 109.70623 ?  83  GLY A N     1 
ATOM   602   C CA    . GLY A 1 83  ? 211.98503 264.16714 82.10743  1.000 110.20599 ?  83  GLY A CA    1 
ATOM   603   C C     . GLY A 1 83  ? 212.25838 265.27600 83.09074  1.000 115.56333 ?  83  GLY A C     1 
ATOM   604   O O     . GLY A 1 83  ? 213.40967 265.64531 83.33322  1.000 118.15302 ?  83  GLY A O     1 
ATOM   605   N N     . THR A 1 84  ? 211.17873 265.83648 83.61753  1.000 114.32319 ?  84  THR A N     1 
ATOM   606   C CA    . THR A 1 84  ? 211.27571 266.83935 84.67231  1.000 117.70232 ?  84  THR A CA    1 
ATOM   607   C C     . THR A 1 84  ? 211.62046 266.23372 86.04617  1.000 118.18671 ?  84  THR A C     1 
ATOM   608   O O     . THR A 1 84  ? 211.08908 265.18465 86.43284  1.000 113.47319 ?  84  THR A O     1 
ATOM   609   C CB    . THR A 1 84  ? 209.94912 267.58047 84.72579  1.000 121.62561 ?  84  THR A CB    1 
ATOM   610   O OG1   . THR A 1 84  ? 209.47510 267.75852 83.37861  1.000 122.94566 ?  84  THR A OG1   1 
ATOM   611   C CG2   . THR A 1 84  ? 210.09415 268.91592 85.43289  1.000 113.09588 ?  84  THR A CG2   1 
ATOM   612   N N     . CYS A 1 85  ? 212.48733 266.93974 86.81066  1.000 119.96667 ?  85  CYS A N     1 
ATOM   613   C CA    . CYS A 1 85  ? 212.92621 266.49516 88.14390  1.000 118.20106 ?  85  CYS A CA    1 
ATOM   614   C C     . CYS A 1 85  ? 211.96397 266.92258 89.24660  1.000 122.80553 ?  85  CYS A C     1 
ATOM   615   O O     . CYS A 1 85  ? 211.81765 268.13605 89.48607  1.000 123.33294 ?  85  CYS A O     1 
ATOM   616   C CB    . CYS A 1 85  ? 214.29012 267.06036 88.48103  1.000 117.46285 ?  85  CYS A CB    1 
ATOM   617   S SG    . CYS A 1 85  ? 214.92438 266.25381 89.93709  1.000 129.30470 ?  85  CYS A SG    1 
ATOM   618   N N     . PRO A 1 86  ? 211.41411 265.98541 90.03546  1.000 122.33816 ?  86  PRO A N     1 
ATOM   619   C CA    . PRO A 1 86  ? 210.38804 266.38984 91.01814  1.000 122.26731 ?  86  PRO A CA    1 
ATOM   620   C C     . PRO A 1 86  ? 210.91245 267.31585 92.10753  1.000 119.17112 ?  86  PRO A C     1 
ATOM   621   O O     . PRO A 1 86  ? 210.25935 268.31744 92.43345  1.000 116.19455 ?  86  PRO A O     1 
ATOM   622   C CB    . PRO A 1 86  ? 209.90008 265.04476 91.58649  1.000 117.63602 ?  86  PRO A CB    1 
ATOM   623   C CG    . PRO A 1 86  ? 210.30026 264.01138 90.54377  1.000 113.00485 ?  86  PRO A CG    1 
ATOM   624   C CD    . PRO A 1 86  ? 211.59107 264.52212 89.98066  1.000 113.38850 ?  86  PRO A CD    1 
ATOM   625   N N     . GLU A 1 87  ? 212.09769 267.04140 92.65170  1.000 119.66253 ?  87  GLU A N     1 
ATOM   626   C CA    . GLU A 1 87  ? 212.65025 267.80691 93.76309  1.000 122.27897 ?  87  GLU A CA    1 
ATOM   627   C C     . GLU A 1 87  ? 214.13085 268.03734 93.49585  1.000 122.30003 ?  87  GLU A C     1 
ATOM   628   O O     . GLU A 1 87  ? 214.71488 267.43434 92.59620  1.000 116.63324 ?  87  GLU A O     1 
ATOM   629   C CB    . GLU A 1 87  ? 212.45242 267.08431 95.10625  1.000 112.87008 ?  87  GLU A CB    1 
ATOM   630   C CG    . GLU A 1 87  ? 211.08914 267.33995 95.75050  1.000 120.68189 ?  87  GLU A CG    1 
ATOM   631   C CD    . GLU A 1 87  ? 210.00458 266.33152 95.32479  1.000 125.36420 ?  87  GLU A CD    1 
ATOM   632   O OE1   . GLU A 1 87  ? 210.34559 265.18231 94.95996  1.000 118.96830 ?  87  GLU A OE1   1 
ATOM   633   O OE2   . GLU A 1 87  ? 208.80685 266.69252 95.33968  1.000 126.38062 ?  87  GLU A OE2   1 
ATOM   634   N N     . ASP A 1 88  ? 214.72202 268.96507 94.24089  1.000 123.91942 ?  88  ASP A N     1 
ATOM   635   C CA    . ASP A 1 88  ? 216.15483 269.20812 94.12058  1.000 122.90702 ?  88  ASP A CA    1 
ATOM   636   C C     . ASP A 1 88  ? 216.95461 267.95160 94.46328  1.000 123.59479 ?  88  ASP A C     1 
ATOM   637   O O     . ASP A 1 88  ? 216.61774 267.20978 95.39598  1.000 123.18618 ?  88  ASP A O     1 
ATOM   638   C CB    . ASP A 1 88  ? 216.55589 270.37628 95.01147  1.000 125.59622 ?  88  ASP A CB    1 
ATOM   639   C CG    . ASP A 1 88  ? 215.64372 271.58250 94.83143  1.000 130.38612 ?  88  ASP A CG    1 
ATOM   640   O OD1   . ASP A 1 88  ? 214.89856 271.65714 93.82462  1.000 126.56714 ?  88  ASP A OD1   1 
ATOM   641   O OD2   . ASP A 1 88  ? 215.64641 272.44284 95.73196  1.000 131.04087 ?  88  ASP A OD2   1 
ATOM   642   N N     . TRP A 1 89  ? 217.99055 267.68609 93.65472  1.000 120.57148 ?  89  TRP A N     1 
ATOM   643   C CA    . TRP A 1 89  ? 218.80859 266.47456 93.74649  1.000 115.61538 ?  89  TRP A CA    1 
ATOM   644   C C     . TRP A 1 89  ? 220.21557 266.79997 94.25313  1.000 113.24759 ?  89  TRP A C     1 
ATOM   645   O O     . TRP A 1 89  ? 221.05317 267.28198 93.47868  1.000 108.90031 ?  89  TRP A O     1 
ATOM   646   C CB    . TRP A 1 89  ? 218.90691 265.78861 92.38846  1.000 107.08365 ?  89  TRP A CB    1 
ATOM   647   C CG    . TRP A 1 89  ? 218.85618 264.33082 92.51818  1.000 104.56469 ?  89  TRP A CG    1 
ATOM   648   C CD1   . TRP A 1 89  ? 218.81598 263.63167 93.67550  1.000 108.10277 ?  89  TRP A CD1   1 
ATOM   649   C CD2   . TRP A 1 89  ? 218.87753 263.36520 91.46208  1.000 104.34930 ?  89  TRP A CD2   1 
ATOM   650   N NE1   . TRP A 1 89  ? 218.78005 262.28620 93.41712  1.000 105.08244 ?  89  TRP A NE1   1 
ATOM   651   C CE2   . TRP A 1 89  ? 218.82438 262.09452 92.06467  1.000 101.41041 ?  89  TRP A CE2   1 
ATOM   652   C CE3   . TRP A 1 89  ? 218.92412 263.44947 90.06678  1.000 105.36222 ?  89  TRP A CE3   1 
ATOM   653   C CZ2   . TRP A 1 89  ? 218.81938 260.91394 91.32705  1.000 102.74816 ?  89  TRP A CZ2   1 
ATOM   654   C CZ3   . TRP A 1 89  ? 218.91816 262.27696 89.33302  1.000 105.57246 ?  89  TRP A CZ3   1 
ATOM   655   C CH2   . TRP A 1 89  ? 218.86601 261.02457 89.96559  1.000 106.06714 ?  89  TRP A CH2   1 
ATOM   656   N N     . THR A 1 90  ? 220.47543 266.51006 95.53786  1.000 111.31227 ?  90  THR A N     1 
ATOM   657   C CA    . THR A 1 90  ? 221.77659 266.67914 96.20160  1.000 112.40729 ?  90  THR A CA    1 
ATOM   658   C C     . THR A 1 90  ? 222.35585 265.31894 96.57326  1.000 110.69227 ?  90  THR A C     1 
ATOM   659   O O     . THR A 1 90  ? 221.70727 264.54125 97.28075  1.000 109.81527 ?  90  THR A O     1 
ATOM   660   C CB    . THR A 1 90  ? 221.67776 267.55213 97.46939  1.000 114.66658 ?  90  THR A CB    1 
ATOM   661   O OG1   . THR A 1 90  ? 221.06873 268.81772 97.16988  1.000 120.61492 ?  90  THR A OG1   1 
ATOM   662   C CG2   . THR A 1 90  ? 223.04166 267.74001 98.18050  1.000 101.80353 ?  90  THR A CG2   1 
ATOM   663   N N     . SER A 1 91  ? 223.55021 265.01520 96.04735  1.000 106.33002 ?  91  SER A N     1 
ATOM   664   C CA    . SER A 1 91  ? 224.31855 263.80758 96.36174  1.000 102.19668 ?  91  SER A CA    1 
ATOM   665   C C     . SER A 1 91  ? 225.56929 264.19541 97.14181  1.000 105.83277 ?  91  SER A C     1 
ATOM   666   O O     . SER A 1 91  ? 225.57895 265.22242 97.83028  1.000 106.98676 ?  91  SER A O     1 
ATOM   667   C CB    . SER A 1 91  ? 224.77045 263.06443 95.12555  1.000 102.85431 ?  91  SER A CB    1 
ATOM   668   O OG    . SER A 1 91  ? 225.56579 263.94586 94.35745  1.000 116.74417 ?  91  SER A OG    1 
ATOM   669   N N     . TYR A 1 92  ? 226.63794 263.39061 97.01943  1.000 105.64757 ?  92  TYR A N     1 
ATOM   670   C CA    . TYR A 1 92  ? 227.89103 263.61154 97.74836  1.000 106.09894 ?  92  TYR A CA    1 
ATOM   671   C C     . TYR A 1 92  ? 228.48204 264.98637 97.42348  1.000 114.48625 ?  92  TYR A C     1 
ATOM   672   O O     . TYR A 1 92  ? 229.64736 265.08216 97.02578  1.000 118.05726 ?  92  TYR A O     1 
ATOM   673   C CB    . TYR A 1 92  ? 228.92713 262.51732 97.40136  1.000 102.05368 ?  92  TYR A CB    1 
ATOM   674   C CG    . TYR A 1 92  ? 228.61947 261.14004 97.98861  1.000 95.55469  ?  92  TYR A CG    1 
ATOM   675   C CD1   . TYR A 1 92  ? 228.83336 260.86550 99.32264  1.000 93.99906  ?  92  TYR A CD1   1 
ATOM   676   C CD2   . TYR A 1 92  ? 228.10187 260.11527 97.19409  1.000 97.40722  ?  92  TYR A CD2   1 
ATOM   677   C CE1   . TYR A 1 92  ? 228.52409 259.63447 99.86231  1.000 97.58983  ?  92  TYR A CE1   1 
ATOM   678   C CE2   . TYR A 1 92  ? 227.78932 258.87078 97.72212  1.000 93.08586  ?  92  TYR A CE2   1 
ATOM   679   C CZ    . TYR A 1 92  ? 228.00652 258.63875 99.06761  1.000 100.84039 ?  92  TYR A CZ    1 
ATOM   680   O OH    . TYR A 1 92  ? 227.72045 257.42814 99.66190  1.000 104.04346 ?  92  TYR A OH    1 
ATOM   681   N N     . GLY A 1 93  ? 227.73850 266.06755 97.67668  1.000 115.63754 ?  93  GLY A N     1 
ATOM   682   C CA    . GLY A 1 93  ? 228.21763 267.41208 97.41132  1.000 114.35988 ?  93  GLY A CA    1 
ATOM   683   C C     . GLY A 1 93  ? 228.00513 267.89711 95.99897  1.000 112.92989 ?  93  GLY A C     1 
ATOM   684   O O     . GLY A 1 93  ? 228.34701 269.05628 95.69142  1.000 110.70269 ?  93  GLY A O     1 
ATOM   685   N N     . ILE A 1 94  ? 227.46903 267.05886 95.11156  1.000 107.94617 ?  94  ILE A N     1 
ATOM   686   C CA    . ILE A 1 94  ? 227.18460 267.47153 93.75257  1.000 112.70040 ?  94  ILE A CA    1 
ATOM   687   C C     . ILE A 1 94  ? 225.68055 267.62008 93.63423  1.000 115.27683 ?  94  ILE A C     1 
ATOM   688   O O     . ILE A 1 94  ? 224.91137 266.70922 93.99168  1.000 115.66576 ?  94  ILE A O     1 
ATOM   689   C CB    . ILE A 1 94  ? 227.76457 266.49280 92.70692  1.000 112.11802 ?  94  ILE A CB    1 
ATOM   690   C CG1   . ILE A 1 94  ? 229.18512 266.03841 93.07811  1.000 109.51333 ?  94  ILE A CG1   1 
ATOM   691   C CG2   . ILE A 1 94  ? 227.81884 267.08084 91.30980  1.000 106.52626 ?  94  ILE A CG2   1 
ATOM   692   C CD1   . ILE A 1 94  ? 229.73147 265.03101 92.12418  1.000 102.49459 ?  94  ILE A CD1   1 
ATOM   693   N N     . VAL A 1 95  ? 225.26712 268.79863 93.14056  1.000 115.11881 ?  95  VAL A N     1 
ATOM   694   C CA    . VAL A 1 95  ? 223.87651 269.08125 92.82211  1.000 111.62945 ?  95  VAL A CA    1 
ATOM   695   C C     . VAL A 1 95  ? 223.74387 268.98952 91.30482  1.000 109.81937 ?  95  VAL A C     1 
ATOM   696   O O     . VAL A 1 95  ? 224.43138 269.70578 90.55346  1.000 111.52160 ?  95  VAL A O     1 
ATOM   697   C CB    . VAL A 1 95  ? 223.39353 270.44892 93.34747  1.000 114.74617 ?  95  VAL A CB    1 
ATOM   698   C CG1   . VAL A 1 95  ? 224.39897 271.68793 92.94040  1.000 94.69595  ?  95  VAL A CG1   1 
ATOM   699   C CG2   . VAL A 1 95  ? 221.87068 270.69609 92.84206  1.000 112.83075 ?  95  VAL A CG2   1 
ATOM   700   N N     . ILE A 1 96  ? 222.95448 268.03212 90.83240  1.000 103.00037 ?  96  ILE A N     1 
ATOM   701   C CA    . ILE A 1 96  ? 222.79352 267.84960 89.39950  1.000 112.34747 ?  96  ILE A CA    1 
ATOM   702   C C     . ILE A 1 96  ? 221.43211 268.29714 88.89424  1.000 118.99719 ?  96  ILE A C     1 
ATOM   703   O O     . ILE A 1 96  ? 221.30073 268.55631 87.68251  1.000 123.79098 ?  96  ILE A O     1 
ATOM   704   C CB    . ILE A 1 96  ? 223.11070 266.39791 88.96523  1.000 119.79775 ?  96  ILE A CB    1 
ATOM   705   C CG1   . ILE A 1 96  ? 223.28424 266.35335 87.44033  1.000 115.38514 ?  96  ILE A CG1   1 
ATOM   706   C CG2   . ILE A 1 96  ? 222.04921 265.43936 89.54122  1.000 113.33396 ?  96  ILE A CG2   1 
ATOM   707   C CD1   . ILE A 1 96  ? 224.25955 267.45421 86.83490  1.000 109.63071 ?  96  ILE A CD1   1 
ATOM   708   N N     . ALA A 1 97  ? 220.42377 268.44367 89.75911  1.000 118.91199 ?  97  ALA A N     1 
ATOM   709   C CA    . ALA A 1 97  ? 219.10427 268.82281 89.28409  1.000 122.97129 ?  97  ALA A CA    1 
ATOM   710   C C     . ALA A 1 97  ? 218.40564 269.75197 90.27092  1.000 125.73184 ?  97  ALA A C     1 
ATOM   711   O O     . ALA A 1 97  ? 218.76511 269.84736 91.44727  1.000 118.82015 ?  97  ALA A O     1 
ATOM   712   C CB    . ALA A 1 97  ? 218.20705 267.60112 89.01624  1.000 109.14925 ?  97  ALA A CB    1 
ATOM   713   N N     . ARG A 1 98  ? 217.41049 270.47052 89.74241  1.000 125.74898 ?  98  ARG A N     1 
ATOM   714   C CA    . ARG A 1 98  ? 216.60610 271.43708 90.47175  1.000 121.73094 ?  98  ARG A CA    1 
ATOM   715   C C     . ARG A 1 98  ? 215.14083 271.18145 90.15353  1.000 123.34362 ?  98  ARG A C     1 
ATOM   716   O O     . ARG A 1 98  ? 214.81444 270.62304 89.10159  1.000 119.07146 ?  98  ARG A O     1 
ATOM   717   C CB    . ARG A 1 98  ? 217.03290 272.86615 90.08176  1.000 117.27800 ?  98  ARG A CB    1 
ATOM   718   C CG    . ARG A 1 98  ? 216.53266 273.98740 90.95513  1.000 123.64506 ?  98  ARG A CG    1 
ATOM   719   C CD    . ARG A 1 98  ? 216.99808 273.79194 92.37594  1.000 120.33166 ?  98  ARG A CD    1 
ATOM   720   N NE    . ARG A 1 98  ? 216.86037 275.00761 93.16244  1.000 130.87551 ?  98  ARG A NE    1 
ATOM   721   C CZ    . ARG A 1 98  ? 215.74539 275.37200 93.77880  1.000 138.73865 ?  98  ARG A CZ    1 
ATOM   722   N NH1   . ARG A 1 98  ? 214.65186 274.62556 93.72089  1.000 131.25907 ?  98  ARG A NH1   1 
ATOM   723   N NH2   . ARG A 1 98  ? 215.72369 276.51859 94.46147  1.000 141.93533 ?  98  ARG A NH2   1 
ATOM   724   N N     . LYS A 1 99  ? 214.25869 271.56240 91.07936  1.000 124.48178 ?  99  LYS A N     1 
ATOM   725   C CA    . LYS A 1 99  ? 212.83132 271.34472 90.87203  1.000 124.49585 ?  99  LYS A CA    1 
ATOM   726   C C     . LYS A 1 99  ? 212.37815 272.02927 89.57927  1.000 127.24508 ?  99  LYS A C     1 
ATOM   727   O O     . LYS A 1 99  ? 212.68363 273.20390 89.34803  1.000 123.13122 ?  99  LYS A O     1 
ATOM   728   C CB    . LYS A 1 99  ? 212.05732 271.89033 92.08261  1.000 116.75663 ?  99  LYS A CB    1 
ATOM   729   C CG    . LYS A 1 99  ? 210.63788 272.32783 91.79298  1.000 122.18964 ?  99  LYS A CG    1 
ATOM   730   C CD    . LYS A 1 99  ? 209.69831 271.17444 91.55516  1.000 120.57410 ?  99  LYS A CD    1 
ATOM   731   C CE    . LYS A 1 99  ? 208.29443 271.64688 91.15050  1.000 119.84207 ?  99  LYS A CE    1 
ATOM   732   N NZ    . LYS A 1 99  ? 208.24796 272.47294 89.90105  1.000 112.64636 ?  99  LYS A NZ    1 
ATOM   733   N N     . GLY A 1 100 ? 211.63061 271.29471 88.74798  1.000 122.34389 ?  100 GLY A N     1 
ATOM   734   C CA    . GLY A 1 100 ? 211.12078 271.79622 87.48452  1.000 119.78774 ?  100 GLY A CA    1 
ATOM   735   C C     . GLY A 1 100 ? 212.10165 271.76916 86.34369  1.000 122.76319 ?  100 GLY A C     1 
ATOM   736   O O     . GLY A 1 100 ? 211.79710 272.31402 85.26880  1.000 123.28348 ?  100 GLY A O     1 
ATOM   737   N N     . ASP A 1 101 ? 213.26905 271.13003 86.51301  1.000 120.01869 ?  101 ASP A N     1 
ATOM   738   C CA    . ASP A 1 101 ? 214.27798 271.03818 85.46223  1.000 119.40935 ?  101 ASP A CA    1 
ATOM   739   C C     . ASP A 1 101 ? 214.21649 269.69943 84.75517  1.000 117.09583 ?  101 ASP A C     1 
ATOM   740   O O     . ASP A 1 101 ? 214.24604 268.65539 85.41274  1.000 116.44567 ?  101 ASP A O     1 
ATOM   741   C CB    . ASP A 1 101 ? 215.69112 271.22728 86.01513  1.000 115.99651 ?  101 ASP A CB    1 
ATOM   742   C CG    . ASP A 1 101 ? 215.91277 272.56690 86.60669  1.000 124.63316 ?  101 ASP A CG    1 
ATOM   743   O OD1   . ASP A 1 101 ? 214.92630 273.31819 86.69235  1.000 125.03734 ?  101 ASP A OD1   1 
ATOM   744   O OD2   . ASP A 1 101 ? 217.06503 272.85087 86.98037  1.000 132.78022 ?  101 ASP A OD2   1 
ATOM   745   N N     . LYS A 1 102 ? 214.11227 269.73186 83.40581  1.000 112.49158 ?  102 LYS A N     1 
ATOM   746   C CA    . LYS A 1 102 ? 214.22456 268.49368 82.61892  1.000 113.62368 ?  102 LYS A CA    1 
ATOM   747   C C     . LYS A 1 102 ? 215.65893 268.00900 82.62159  1.000 117.11128 ?  102 LYS A C     1 
ATOM   748   O O     . LYS A 1 102 ? 216.59495 268.81657 82.52038  1.000 116.38644 ?  102 LYS A O     1 
ATOM   749   C CB    . LYS A 1 102 ? 213.71844 268.66907 81.16465  1.000 117.14908 ?  102 LYS A CB    1 
ATOM   750   C CG    . LYS A 1 102 ? 212.11490 268.48625 80.99989  1.000 109.94450 ?  102 LYS A CG    1 
ATOM   751   C CD    . LYS A 1 102 ? 211.65787 267.65448 79.71670  1.000 93.22560  ?  102 LYS A CD    1 
ATOM   752   C CE    . LYS A 1 102 ? 210.12155 267.37746 79.93119  1.000 89.43258  ?  102 LYS A CE    1 
ATOM   753   N NZ    . LYS A 1 102 ? 209.41813 266.48932 78.88834  1.000 93.91313  ?  102 LYS A NZ    1 
ATOM   754   N N     . ILE A 1 103 ? 215.84241 266.67920 82.75320  1.000 117.71998 ?  103 ILE A N     1 
ATOM   755   C CA    . ILE A 1 103 ? 217.17749 266.09780 82.83944  1.000 113.32166 ?  103 ILE A CA    1 
ATOM   756   C C     . ILE A 1 103 ? 217.19634 264.79264 82.06202  1.000 107.73091 ?  103 ILE A C     1 
ATOM   757   O O     . ILE A 1 103 ? 216.15435 264.23270 81.70095  1.000 101.27624 ?  103 ILE A O     1 
ATOM   758   C CB    . ILE A 1 103 ? 217.67378 265.85332 84.27130  1.000 108.76672 ?  103 ILE A CB    1 
ATOM   759   C CG1   . ILE A 1 103 ? 216.68216 264.98323 85.04560  1.000 107.63361 ?  103 ILE A CG1   1 
ATOM   760   C CG2   . ILE A 1 103 ? 217.95687 267.16542 84.98712  1.000 114.35514 ?  103 ILE A CG2   1 
ATOM   761   C CD1   . ILE A 1 103 ? 217.10414 264.71018 86.47001  1.000 115.62163 ?  103 ILE A CD1   1 
ATOM   762   N N     . THR A 1 104 ? 218.41221 264.33621 81.76451  1.000 109.40779 ?  104 THR A N     1 
ATOM   763   C CA    . THR A 1 104 ? 218.69519 263.07124 81.10227  1.000 111.30296 ?  104 THR A CA    1 
ATOM   764   C C     . THR A 1 104 ? 219.61565 262.20741 81.94928  1.000 109.70334 ?  104 THR A C     1 
ATOM   765   O O     . THR A 1 104 ? 220.14743 262.66446 82.97321  1.000 98.36850  ?  104 THR A O     1 
ATOM   766   C CB    . THR A 1 104 ? 219.30646 263.36834 79.71846  1.000 111.34043 ?  104 THR A CB    1 
ATOM   767   O OG1   . THR A 1 104 ? 220.51951 264.12221 79.84300  1.000 114.86696 ?  104 THR A OG1   1 
ATOM   768   C CG2   . THR A 1 104 ? 218.33033 264.15599 78.87491  1.000 109.87203 ?  104 THR A CG2   1 
ATOM   769   N N     . PRO A 1 105 ? 219.77288 260.92593 81.58073  1.000 104.31001 ?  105 PRO A N     1 
ATOM   770   C CA    . PRO A 1 105 ? 220.85725 260.13246 82.17357  1.000 100.82207 ?  105 PRO A CA    1 
ATOM   771   C C     . PRO A 1 105 ? 222.19947 260.77919 81.93996  1.000 108.09996 ?  105 PRO A C     1 
ATOM   772   O O     . PRO A 1 105 ? 223.05962 260.73054 82.83353  1.000 106.51793 ?  105 PRO A O     1 
ATOM   773   C CB    . PRO A 1 105 ? 220.74039 258.80705 81.42038  1.000 95.84438  ?  105 PRO A CB    1 
ATOM   774   C CG    . PRO A 1 105 ? 219.28262 258.74573 81.05972  1.000 96.43419  ?  105 PRO A CG    1 
ATOM   775   C CD    . PRO A 1 105 ? 218.89236 260.12811 80.73580  1.000 99.49673  ?  105 PRO A CD    1 
ATOM   776   N N     . GLY A 1 106 ? 222.39162 261.41657 80.77603  1.000 112.88790 ?  106 GLY A N     1 
ATOM   777   C CA    . GLY A 1 106 ? 223.62155 262.13027 80.46800  1.000 113.31794 ?  106 GLY A CA    1 
ATOM   778   C C     . GLY A 1 106 ? 223.96147 263.22646 81.46067  1.000 115.62596 ?  106 GLY A C     1 
ATOM   779   O O     . GLY A 1 106 ? 225.09295 263.73046 81.48276  1.000 120.12482 ?  106 GLY A O     1 
ATOM   780   N N     . SER A 1 107 ? 222.94083 263.73657 82.18624  1.000 105.67459 ?  107 SER A N     1 
ATOM   781   C CA    . SER A 1 107 ? 223.18466 264.77404 83.18997  1.000 110.49221 ?  107 SER A CA    1 
ATOM   782   C C     . SER A 1 107 ? 223.77152 264.22314 84.48977  1.000 109.95388 ?  107 SER A C     1 
ATOM   783   O O     . SER A 1 107 ? 224.40067 264.97399 85.25108  1.000 105.29398 ?  107 SER A O     1 
ATOM   784   C CB    . SER A 1 107 ? 221.88881 265.52555 83.53597  1.000 114.36376 ?  107 SER A CB    1 
ATOM   785   O OG    . SER A 1 107 ? 221.17357 265.96933 82.41280  1.000 120.17537 ?  107 SER A OG    1 
ATOM   786   N N     . LEU A 1 108 ? 223.56351 262.93717 84.77568  1.000 112.33638 ?  108 LEU A N     1 
ATOM   787   C CA    . LEU A 1 108 ? 223.98389 262.36188 86.06578  1.000 110.38732 ?  108 LEU A CA    1 
ATOM   788   C C     . LEU A 1 108 ? 225.47650 262.03454 86.10548  1.000 108.63201 ?  108 LEU A C     1 
ATOM   789   O O     . LEU A 1 108 ? 226.08857 262.08250 87.17732  1.000 97.14916  ?  108 LEU A O     1 
ATOM   790   C CB    . LEU A 1 108 ? 223.17783 261.08863 86.32353  1.000 105.90367 ?  108 LEU A CB    1 
ATOM   791   C CG    . LEU A 1 108 ? 221.81321 261.16114 87.00072  1.000 109.70243 ?  108 LEU A CG    1 
ATOM   792   C CD1   . LEU A 1 108 ? 220.83086 261.81773 86.06086  1.000 116.05494 ?  108 LEU A CD1   1 
ATOM   793   C CD2   . LEU A 1 108 ? 221.35918 259.73715 87.28495  1.000 101.71821 ?  108 LEU A CD2   1 
ATOM   794   N N     . VAL A 1 109 ? 226.06266 261.65221 84.96353  1.000 111.91246 ?  109 VAL A N     1 
ATOM   795   C CA    . VAL A 1 109 ? 227.45653 261.23198 84.85721  1.000 108.35341 ?  109 VAL A CA    1 
ATOM   796   C C     . VAL A 1 109 ? 228.16551 262.10347 83.80425  1.000 112.55841 ?  109 VAL A C     1 
ATOM   797   O O     . VAL A 1 109 ? 227.52899 262.88464 83.09617  1.000 114.20433 ?  109 VAL A O     1 
ATOM   798   C CB    . VAL A 1 109 ? 227.54877 259.73060 84.51502  1.000 100.66259 ?  109 VAL A CB    1 
ATOM   799   C CG1   . VAL A 1 109 ? 227.06245 258.89606 85.66653  1.000 96.84584  ?  109 VAL A CG1   1 
ATOM   800   C CG2   . VAL A 1 109 ? 226.67656 259.40641 83.28354  1.000 96.50194  ?  109 VAL A CG2   1 
ATOM   801   N N     . GLU A 1 110 ? 229.50108 261.96502 83.71203  1.000 113.18263 ?  110 GLU A N     1 
ATOM   802   C CA    . GLU A 1 110 ? 230.31907 262.61822 82.67861  1.000 113.30435 ?  110 GLU A CA    1 
ATOM   803   C C     . GLU A 1 110 ? 230.83455 261.54913 81.71918  1.000 118.91502 ?  110 GLU A C     1 
ATOM   804   O O     . GLU A 1 110 ? 231.53076 260.62385 82.15500  1.000 117.22607 ?  110 GLU A O     1 
ATOM   805   C CB    . GLU A 1 110 ? 231.50014 263.37852 83.28928  1.000 104.86943 ?  110 GLU A CB    1 
ATOM   806   C CG    . GLU A 1 110 ? 231.08597 264.54173 84.17869  1.000 118.71440 ?  110 GLU A CG    1 
ATOM   807   C CD    . GLU A 1 110 ? 232.26330 265.30065 84.78271  1.000 133.45578 ?  110 GLU A CD    1 
ATOM   808   O OE1   . GLU A 1 110 ? 233.42171 264.90330 84.52748  1.000 133.38121 ?  110 GLU A OE1   1 
ATOM   809   O OE2   . GLU A 1 110 ? 232.01903 266.23657 85.58780  1.000 132.89351 ?  110 GLU A OE2   1 
ATOM   810   N N     . ILE A 1 111 ? 230.52733 261.67137 80.42626  1.000 119.30539 ?  111 ILE A N     1 
ATOM   811   C CA    . ILE A 1 111 ? 231.04367 260.73533 79.42289  1.000 113.95453 ?  111 ILE A CA    1 
ATOM   812   C C     . ILE A 1 111 ? 232.13005 261.47353 78.63207  1.000 109.82148 ?  111 ILE A C     1 
ATOM   813   O O     . ILE A 1 111 ? 231.94962 262.64456 78.26925  1.000 106.57156 ?  111 ILE A O     1 
ATOM   814   C CB    . ILE A 1 111 ? 229.93010 260.16794 78.51279  1.000 113.51697 ?  111 ILE A CB    1 
ATOM   815   C CG1   . ILE A 1 111 ? 228.71070 259.71988 79.32536  1.000 108.86305 ?  111 ILE A CG1   1 
ATOM   816   C CG2   . ILE A 1 111 ? 230.40730 258.88688 77.75664  1.000 104.14836 ?  111 ILE A CG2   1 
ATOM   817   C CD1   . ILE A 1 111 ? 228.88700 258.39723 80.04725  1.000 99.40259  ?  111 ILE A CD1   1 
ATOM   818   N N     . LYS A 1 112 ? 233.30963 260.84907 78.52115  1.000 108.03028 ?  112 LYS A N     1 
ATOM   819   C CA    . LYS A 1 112 ? 234.41576 261.34035 77.70630  1.000 107.95176 ?  112 LYS A CA    1 
ATOM   820   C C     . LYS A 1 112 ? 234.46445 260.46703 76.45596  1.000 113.06771 ?  112 LYS A C     1 
ATOM   821   O O     . LYS A 1 112 ? 234.55626 259.23782 76.57324  1.000 110.20477 ?  112 LYS A O     1 
ATOM   822   C CB    . LYS A 1 112 ? 235.74658 261.29289 78.46049  1.000 101.52023 ?  112 LYS A CB    1 
ATOM   823   C CG    . LYS A 1 112 ? 235.69443 261.89842 79.84017  1.000 100.24251 ?  112 LYS A CG    1 
ATOM   824   C CD    . LYS A 1 112 ? 235.21834 263.35559 79.79757  1.000 104.00332 ?  112 LYS A CD    1 
ATOM   825   C CE    . LYS A 1 112 ? 234.97389 263.87297 81.21631  1.000 111.07276 ?  112 LYS A CE    1 
ATOM   826   N NZ    . LYS A 1 112 ? 234.41242 265.25229 81.33224  1.000 118.27621 ?  112 LYS A NZ    1 
ATOM   827   N N     . ARG A 1 113 ? 234.33200 261.07311 75.26851  1.000 110.52569 ?  113 ARG A N     1 
ATOM   828   C CA    . ARG A 1 113 ? 234.34068 260.30165 74.02460  1.000 107.21241 ?  113 ARG A CA    1 
ATOM   829   C C     . ARG A 1 113 ? 235.70918 260.45730 73.36363  1.000 106.69732 ?  113 ARG A C     1 
ATOM   830   O O     . ARG A 1 113 ? 236.27097 261.56303 73.34249  1.000 104.38313 ?  113 ARG A O     1 
ATOM   831   C CB    . ARG A 1 113 ? 233.24558 260.72534 73.01893  1.000 108.23993 ?  113 ARG A CB    1 
ATOM   832   C CG    . ARG A 1 113 ? 231.78109 260.64382 73.49264  1.000 99.95179  ?  113 ARG A CG    1 
ATOM   833   C CD    . ARG A 1 113 ? 231.27071 259.24053 73.90886  1.000 102.40888 ?  113 ARG A CD    1 
ATOM   834   N NE    . ARG A 1 113 ? 229.83509 258.98191 73.72722  1.000 102.64782 ?  113 ARG A NE    1 
ATOM   835   C CZ    . ARG A 1 113 ? 229.26568 258.12073 72.88133  1.000 101.15867 ?  113 ARG A CZ    1 
ATOM   836   N NH1   . ARG A 1 113 ? 229.97734 257.27221 72.14772  1.000 94.95354  ?  113 ARG A NH1   1 
ATOM   837   N NH2   . ARG A 1 113 ? 227.93683 258.07258 72.80850  1.000 99.21769  ?  113 ARG A NH2   1 
ATOM   838   N N     . THR A 1 114 ? 236.26239 259.34181 72.87733  1.000 107.55654 ?  114 THR A N     1 
ATOM   839   C CA    . THR A 1 114 ? 237.51462 259.35981 72.13119  1.000 112.75044 ?  114 THR A CA    1 
ATOM   840   C C     . THR A 1 114 ? 237.18351 259.41432 70.64064  1.000 117.88452 ?  114 THR A C     1 
ATOM   841   O O     . THR A 1 114 ? 236.14776 258.90372 70.20335  1.000 117.38610 ?  114 THR A O     1 
ATOM   842   C CB    . THR A 1 114 ? 238.37640 258.11797 72.40201  1.000 115.01656 ?  114 THR A CB    1 
ATOM   843   O OG1   . THR A 1 114 ? 237.63729 256.92776 72.09043  1.000 120.99987 ?  114 THR A OG1   1 
ATOM   844   C CG2   . THR A 1 114 ? 238.79981 258.05833 73.85491  1.000 108.82062 ?  114 THR A CG2   1 
ATOM   845   N N     . ASP A 1 115 ? 238.02750 260.10395 69.87015  1.000 118.24677 ?  115 ASP A N     1 
ATOM   846   C CA    . ASP A 1 115 ? 237.84043 260.21228 68.42114  1.000 115.44536 ?  115 ASP A CA    1 
ATOM   847   C C     . ASP A 1 115 ? 238.18600 258.91137 67.68713  1.000 114.32764 ?  115 ASP A C     1 
ATOM   848   O O     . ASP A 1 115 ? 239.07754 258.86003 66.84400  1.000 115.16542 ?  115 ASP A O     1 
ATOM   849   C CB    . ASP A 1 115 ? 238.64030 261.39674 67.89901  1.000 110.86257 ?  115 ASP A CB    1 
ATOM   850   C CG    . ASP A 1 115 ? 238.25821 262.67974 68.59798  1.000 116.52814 ?  115 ASP A CG    1 
ATOM   851   O OD1   . ASP A 1 115 ? 237.22132 262.65280 69.30178  1.000 120.82367 ?  115 ASP A OD1   1 
ATOM   852   O OD2   . ASP A 1 115 ? 238.95217 263.70695 68.44184  1.000 118.36770 ?  115 ASP A OD2   1 
ATOM   853   N N     . VAL A 1 116 ? 237.46046 257.84358 68.02167  1.000 113.27647 ?  116 VAL A N     1 
ATOM   854   C CA    . VAL A 1 116 ? 237.69745 256.52815 67.43807  1.000 109.80519 ?  116 VAL A CA    1 
ATOM   855   C C     . VAL A 1 116 ? 236.37949 255.99815 66.89091  1.000 107.90867 ?  116 VAL A C     1 
ATOM   856   O O     . VAL A 1 116 ? 235.36721 255.97448 67.60038  1.000 109.64405 ?  116 VAL A O     1 
ATOM   857   C CB    . VAL A 1 116 ? 238.28494 255.53335 68.45937  1.000 104.18860 ?  116 VAL A CB    1 
ATOM   858   C CG1   . VAL A 1 116 ? 238.46060 254.11031 67.80880  1.000 84.78720  ?  116 VAL A CG1   1 
ATOM   859   C CG2   . VAL A 1 116 ? 239.56083 256.10726 69.12819  1.000 98.69569  ?  116 VAL A CG2   1 
ATOM   860   N N     . GLU A 1 117 ? 236.40479 255.51571 65.65403  1.000 108.92242 ?  117 GLU A N     1 
ATOM   861   C CA    . GLU A 1 117 ? 235.18905 255.01624 65.04723  1.000 108.43955 ?  117 GLU A CA    1 
ATOM   862   C C     . GLU A 1 117 ? 235.02325 253.56038 65.45735  1.000 102.19392 ?  117 GLU A C     1 
ATOM   863   O O     . GLU A 1 117 ? 235.99958 252.81868 65.61912  1.000 102.02883 ?  117 GLU A O     1 
ATOM   864   C CB    . GLU A 1 117 ? 235.23812 255.17272 63.51574  1.000 113.32060 ?  117 GLU A CB    1 
ATOM   865   C CG    . GLU A 1 117 ? 236.49183 254.58491 62.80253  1.000 118.56852 ?  117 GLU A CG    1 
ATOM   866   C CD    . GLU A 1 117 ? 237.69943 255.53823 62.70590  1.000 127.50346 ?  117 GLU A CD    1 
ATOM   867   O OE1   . GLU A 1 117 ? 237.54955 256.75397 62.96766  1.000 125.70197 ?  117 GLU A OE1   1 
ATOM   868   O OE2   . GLU A 1 117 ? 238.80980 255.06600 62.35672  1.000 132.91907 ?  117 GLU A OE2   1 
ATOM   869   N N     . GLY A 1 118 ? 233.79811 253.16904 65.64386  1.000 98.15089  ?  118 GLY A N     1 
ATOM   870   C CA    . GLY A 1 118 ? 233.49739 251.81525 66.03443  1.000 101.38520 ?  118 GLY A CA    1 
ATOM   871   C C     . GLY A 1 118 ? 233.28991 250.94995 64.83198  1.000 100.10237 ?  118 GLY A C     1 
ATOM   872   O O     . GLY A 1 118 ? 233.07425 251.46214 63.73867  1.000 105.99603 ?  118 GLY A O     1 
ATOM   873   N N     . ASN A 1 119 ? 233.35184 249.63340 65.04367  1.000 100.42449 ?  119 ASN A N     1 
ATOM   874   C CA    . ASN A 1 119 ? 233.19224 248.70411 63.92402  1.000 109.86498 ?  119 ASN A CA    1 
ATOM   875   C C     . ASN A 1 119 ? 231.80018 248.79801 63.31749  1.000 110.20575 ?  119 ASN A C     1 
ATOM   876   O O     . ASN A 1 119 ? 231.62986 248.54901 62.11514  1.000 106.54599 ?  119 ASN A O     1 
ATOM   877   C CB    . ASN A 1 119 ? 233.38636 247.24925 64.37188  1.000 107.94575 ?  119 ASN A CB    1 
ATOM   878   C CG    . ASN A 1 119 ? 234.74396 246.97916 64.91219  1.000 115.18498 ?  119 ASN A CG    1 
ATOM   879   O OD1   . ASN A 1 119 ? 235.63390 247.82592 64.81603  1.000 118.70633 ?  119 ASN A OD1   1 
ATOM   880   N ND2   . ASN A 1 119 ? 234.94483 245.76764 65.43984  1.000 116.27775 ?  119 ASN A ND2   1 
ATOM   881   N N     . TRP A 1 120 ? 230.80116 249.16598 64.13237  1.000 106.69210 ?  120 TRP A N     1 
ATOM   882   C CA    . TRP A 1 120 ? 229.39499 249.30055 63.74815  1.000 104.71261 ?  120 TRP A CA    1 
ATOM   883   C C     . TRP A 1 120 ? 229.09965 248.52306 62.46467  1.000 101.62134 ?  120 TRP A C     1 
ATOM   884   O O     . TRP A 1 120 ? 228.63792 249.10111 61.47444  1.000 101.58391 ?  120 TRP A O     1 
ATOM   885   C CB    . TRP A 1 120 ? 229.08777 250.80610 63.58583  1.000 101.80608 ?  120 TRP A CB    1 
ATOM   886   C CG    . TRP A 1 120 ? 229.45347 251.65502 64.80206  1.000 104.91403 ?  120 TRP A CG    1 
ATOM   887   C CD1   . TRP A 1 120 ? 229.29545 251.32490 66.12638  1.000 105.68513 ?  120 TRP A CD1   1 
ATOM   888   C CD2   . TRP A 1 120 ? 230.10464 252.93896 64.78515  1.000 109.29239 ?  120 TRP A CD2   1 
ATOM   889   N NE1   . TRP A 1 120 ? 229.77095 252.34591 66.92832  1.000 108.23625 ?  120 TRP A NE1   1 
ATOM   890   C CE2   . TRP A 1 120 ? 230.28347 253.34123 66.13402  1.000 113.40087 ?  120 TRP A CE2   1 
ATOM   891   C CE3   . TRP A 1 120 ? 230.53832 253.79514 63.75984  1.000 107.98610 ?  120 TRP A CE3   1 
ATOM   892   C CZ2   . TRP A 1 120 ? 230.89037 254.56197 66.48219  1.000 112.53842 ?  120 TRP A CZ2   1 
ATOM   893   C CZ3   . TRP A 1 120 ? 231.13386 255.00666 64.10689  1.000 112.63136 ?  120 TRP A CZ3   1 
ATOM   894   C CH2   . TRP A 1 120 ? 231.30272 255.37755 65.45660  1.000 112.90538 ?  120 TRP A CH2   1 
ATOM   895   N N     . ALA A 1 121 ? 229.38560 247.22639 62.44633  1.000 99.77673  ?  121 ALA A N     1 
ATOM   896   C CA    . ALA A 1 121 ? 229.18683 246.43207 61.24055  1.000 105.62673 ?  121 ALA A CA    1 
ATOM   897   C C     . ALA A 1 121 ? 228.03055 245.45626 61.39866  1.000 106.22229 ?  121 ALA A C     1 
ATOM   898   O O     . ALA A 1 121 ? 227.85826 244.84655 62.45577  1.000 104.98416 ?  121 ALA A O     1 
ATOM   899   C CB    . ALA A 1 121 ? 230.46296 245.67414 60.85715  1.000 114.12130 ?  121 ALA A CB    1 
ATOM   900   N N     . LEU A 1 122 ? 227.32691 245.21491 60.30083  1.000 101.70016 ?  122 LEU A N     1 
ATOM   901   C CA    . LEU A 1 122 ? 226.12177 244.39896 60.33930  1.000 103.16937 ?  122 LEU A CA    1 
ATOM   902   C C     . LEU A 1 122 ? 226.49334 242.92367 60.29547  1.000 101.38141 ?  122 LEU A C     1 
ATOM   903   O O     . LEU A 1 122 ? 227.10256 242.48191 59.32658  1.000 105.55674 ?  122 LEU A O     1 
ATOM   904   C CB    . LEU A 1 122 ? 225.24151 244.74201 59.14644  1.000 107.66862 ?  122 LEU A CB    1 
ATOM   905   C CG    . LEU A 1 122 ? 223.92459 243.96933 59.03496  1.000 110.12636 ?  122 LEU A CG    1 
ATOM   906   C CD1   . LEU A 1 122 ? 222.98385 244.28686 60.16650  1.000 110.09392 ?  122 LEU A CD1   1 
ATOM   907   C CD2   . LEU A 1 122 ? 223.26531 244.24422 57.73594  1.000 110.71439 ?  122 LEU A CD2   1 
ATOM   908   N N     . THR A 1 123 ? 226.14058 242.15103 61.31886  1.000 102.81018 ?  123 THR A N     1 
ATOM   909   C CA    . THR A 1 123 ? 226.53316 240.73904 61.28971  1.000 110.58788 ?  123 THR A CA    1 
ATOM   910   C C     . THR A 1 123 ? 225.45444 239.83786 60.71154  1.000 114.88827 ?  123 THR A C     1 
ATOM   911   O O     . THR A 1 123 ? 225.71468 239.08073 59.76915  1.000 113.98671 ?  123 THR A O     1 
ATOM   912   C CB    . THR A 1 123 ? 226.87353 240.22337 62.70283  1.000 111.31440 ?  123 THR A CB    1 
ATOM   913   O OG1   . THR A 1 123 ? 227.93370 241.00485 63.27611  1.000 112.55847 ?  123 THR A OG1   1 
ATOM   914   C CG2   . THR A 1 123 ? 227.26963 238.73046 62.67106  1.000 111.01654 ?  123 THR A CG2   1 
ATOM   915   N N     . GLY A 1 124 ? 224.22933 239.97749 61.17854  1.000 119.64533 ?  124 GLY A N     1 
ATOM   916   C CA    . GLY A 1 124 ? 223.15986 239.12107 60.73770  1.000 120.10463 ?  124 GLY A CA    1 
ATOM   917   C C     . GLY A 1 124 ? 222.13989 239.94072 59.97936  1.000 129.81271 ?  124 GLY A C     1 
ATOM   918   O O     . GLY A 1 124 ? 222.22306 241.16907 59.89338  1.000 120.45154 ?  124 GLY A O     1 
ATOM   919   N N     . GLY A 1 125 ? 221.13696 239.24312 59.45418  1.000 141.91359 ?  125 GLY A N     1 
ATOM   920   C CA    . GLY A 1 125 ? 220.11875 239.92316 58.66827  1.000 138.04438 ?  125 GLY A CA    1 
ATOM   921   C C     . GLY A 1 125 ? 219.28441 240.82856 59.55507  1.000 133.24245 ?  125 GLY A C     1 
ATOM   922   O O     . GLY A 1 125 ? 218.80815 240.41240 60.61892  1.000 114.63558 ?  125 GLY A O     1 
ATOM   923   N N     . MET A 1 126 ? 219.18910 242.10074 59.17425  1.000 131.86872 ?  126 MET A N     1 
ATOM   924   C CA    . MET A 1 126 ? 218.30245 243.03394 59.84842  1.000 124.46385 ?  126 MET A CA    1 
ATOM   925   C C     . MET A 1 126 ? 217.19607 243.40774 58.86129  1.000 128.89393 ?  126 MET A C     1 
ATOM   926   O O     . MET A 1 126 ? 217.48863 243.86400 57.74496  1.000 125.90029 ?  126 MET A O     1 
ATOM   927   C CB    . MET A 1 126 ? 219.04406 244.27993 60.34264  1.000 110.00947 ?  126 MET A CB    1 
ATOM   928   C CG    . MET A 1 126 ? 218.11601 245.47150 60.32185  1.000 116.07551 ?  126 MET A CG    1 
ATOM   929   S SD    . MET A 1 126 ? 218.83709 246.99185 60.85924  1.000 121.04859 ?  126 MET A SD    1 
ATOM   930   C CE    . MET A 1 126 ? 218.17467 248.10525 59.64500  1.000 109.53104 ?  126 MET A CE    1 
ATOM   931   N N     . GLU A 1 127 ? 215.92843 243.23951 59.28250  1.000 128.03750 ?  127 GLU A N     1 
ATOM   932   C CA    . GLU A 1 127 ? 214.77654 243.42390 58.39774  1.000 124.55717 ?  127 GLU A CA    1 
ATOM   933   C C     . GLU A 1 127 ? 214.42774 244.89023 58.14606  1.000 127.28820 ?  127 GLU A C     1 
ATOM   934   O O     . GLU A 1 127 ? 213.99025 245.21782 57.03383  1.000 123.95170 ?  127 GLU A O     1 
ATOM   935   C CB    . GLU A 1 127 ? 213.53108 242.70648 58.96429  1.000 120.75647 ?  127 GLU A CB    1 
ATOM   936   C CG    . GLU A 1 127 ? 213.62261 241.19030 59.04839  1.000 120.44744 ?  127 GLU A CG    1 
ATOM   937   C CD    . GLU A 1 127 ? 214.32999 240.71706 60.29476  1.000 130.66752 ?  127 GLU A CD    1 
ATOM   938   O OE1   . GLU A 1 127 ? 214.41490 241.50905 61.26046  1.000 134.05671 ?  127 GLU A OE1   1 
ATOM   939   O OE2   . GLU A 1 127 ? 214.83136 239.57161 60.29541  1.000 130.25897 ?  127 GLU A OE2   1 
ATOM   940   N N     . LEU A 1 128 ? 214.68592 245.78462 59.10558  1.000 126.30918 ?  128 LEU A N     1 
ATOM   941   C CA    . LEU A 1 128 ? 214.28092 247.18040 58.97002  1.000 119.61567 ?  128 LEU A CA    1 
ATOM   942   C C     . LEU A 1 128 ? 215.11987 247.85765 57.89463  1.000 118.16133 ?  128 LEU A C     1 
ATOM   943   O O     . LEU A 1 128 ? 216.28929 247.52439 57.70862  1.000 114.38095 ?  128 LEU A O     1 
ATOM   944   C CB    . LEU A 1 128 ? 214.41663 247.91939 60.30951  1.000 111.58941 ?  128 LEU A CB    1 
ATOM   945   C CG    . LEU A 1 128 ? 213.76542 247.22900 61.52289  1.000 115.35062 ?  128 LEU A CG    1 
ATOM   946   C CD1   . LEU A 1 128 ? 214.00394 247.96283 62.85443  1.000 108.74837 ?  128 LEU A CD1   1 
ATOM   947   C CD2   . LEU A 1 128 ? 212.27513 246.98955 61.28701  1.000 111.43567 ?  128 LEU A CD2   1 
ATOM   948   N N     . THR A 1 129 ? 214.45607 248.66892 57.06494  1.000 120.88640 ?  129 THR A N     1 
ATOM   949   C CA    . THR A 1 129 ? 215.09474 249.44626 56.00824  1.000 121.83487 ?  129 THR A CA    1 
ATOM   950   C C     . THR A 1 129 ? 215.11867 250.95264 56.27230  1.000 116.56895 ?  129 THR A C     1 
ATOM   951   O O     . THR A 1 129 ? 215.79485 251.68684 55.54299  1.000 109.80390 ?  129 THR A O     1 
ATOM   952   C CB    . THR A 1 129 ? 214.38626 249.16987 54.66667  1.000 119.68874 ?  129 THR A CB    1 
ATOM   953   O OG1   . THR A 1 129 ? 212.98707 249.48497 54.77051  1.000 120.86052 ?  129 THR A OG1   1 
ATOM   954   C CG2   . THR A 1 129 ? 214.52021 247.70174 54.25321  1.000 113.14995 ?  129 THR A CG2   1 
ATOM   955   N N     . ARG A 1 130 ? 214.40042 251.43094 57.27703  1.000 117.17975 ?  130 ARG A N     1 
ATOM   956   C CA    . ARG A 1 130 ? 214.27347 252.84896 57.55444  1.000 115.15665 ?  130 ARG A CA    1 
ATOM   957   C C     . ARG A 1 130 ? 214.83535 253.16870 58.93170  1.000 113.43224 ?  130 ARG A C     1 
ATOM   958   O O     . ARG A 1 130 ? 215.25457 252.27974 59.68229  1.000 111.58447 ?  130 ARG A O     1 
ATOM   959   C CB    . ARG A 1 130 ? 212.81495 253.30891 57.41758  1.000 115.85420 ?  130 ARG A CB    1 
ATOM   960   C CG    . ARG A 1 130 ? 211.77561 252.25955 57.76406  1.000 119.43410 ?  130 ARG A CG    1 
ATOM   961   C CD    . ARG A 1 130 ? 211.80882 251.90978 59.24757  1.000 121.27335 ?  130 ARG A CD    1 
ATOM   962   N NE    . ARG A 1 130 ? 210.84669 250.86717 59.58072  1.000 125.78725 ?  130 ARG A NE    1 
ATOM   963   C CZ    . ARG A 1 130 ? 210.65934 250.40134 60.80694  1.000 120.62800 ?  130 ARG A CZ    1 
ATOM   964   N NH1   . ARG A 1 130 ? 211.37072 250.85104 61.82695  1.000 120.28596 ?  130 ARG A NH1   1 
ATOM   965   N NH2   . ARG A 1 130 ? 209.73657 249.46234 61.01460  1.000 115.40514 ?  130 ARG A NH2   1 
ATOM   966   N N     . ASP A 1 131 ? 214.87259 254.47172 59.20948  1.000 112.00214 ?  131 ASP A N     1 
ATOM   967   C CA    . ASP A 1 131 ? 215.31863 255.01790 60.48801  1.000 117.19084 ?  131 ASP A CA    1 
ATOM   968   C C     . ASP A 1 131 ? 214.42709 254.58630 61.65078  1.000 120.42614 ?  131 ASP A C     1 
ATOM   969   O O     . ASP A 1 131 ? 213.20248 254.49882 61.49817  1.000 121.41077 ?  131 ASP A O     1 
ATOM   970   C CB    . ASP A 1 131 ? 215.33351 256.53684 60.40356  1.000 112.36305 ?  131 ASP A CB    1 
ATOM   971   C CG    . ASP A 1 131 ? 216.57493 257.03302 59.73528  1.000 115.51025 ?  131 ASP A CG    1 
ATOM   972   O OD1   . ASP A 1 131 ? 217.06674 256.30602 58.83433  1.000 113.47535 ?  131 ASP A OD1   1 
ATOM   973   O OD2   . ASP A 1 131 ? 217.06812 258.11839 60.10173  1.000 115.22951 ?  131 ASP A OD2   1 
ATOM   974   N N     . PRO A 1 132 ? 215.02116 254.25042 62.80353  1.000 122.84615 ?  132 PRO A N     1 
ATOM   975   C CA    . PRO A 1 132 ? 214.23118 253.78274 63.95438  1.000 119.63017 ?  132 PRO A CA    1 
ATOM   976   C C     . PRO A 1 132 ? 213.58450 254.94117 64.71494  1.000 112.05866 ?  132 PRO A C     1 
ATOM   977   O O     . PRO A 1 132 ? 214.12684 256.05438 64.78080  1.000 105.24903 ?  132 PRO A O     1 
ATOM   978   C CB    . PRO A 1 132 ? 215.26756 253.06459 64.83194  1.000 115.23075 ?  132 PRO A CB    1 
ATOM   979   C CG    . PRO A 1 132 ? 216.57362 253.73942 64.49888  1.000 116.63957 ?  132 PRO A CG    1 
ATOM   980   C CD    . PRO A 1 132 ? 216.45201 254.38865 63.13336  1.000 118.27162 ?  132 PRO A CD    1 
ATOM   981   N N     . THR A 1 133 ? 212.41385 254.65640 65.30540  1.000 110.31373 ?  133 THR A N     1 
ATOM   982   C CA    . THR A 1 133 ? 211.72264 255.59990 66.18420  1.000 113.10879 ?  133 THR A CA    1 
ATOM   983   C C     . THR A 1 133 ? 212.26098 255.49072 67.61003  1.000 109.85226 ?  133 THR A C     1 
ATOM   984   O O     . THR A 1 133 ? 212.84098 254.47081 68.00864  1.000 109.78014 ?  133 THR A O     1 
ATOM   985   C CB    . THR A 1 133 ? 210.20858 255.31512 66.21937  1.000 111.09391 ?  133 THR A CB    1 
ATOM   986   O OG1   . THR A 1 133 ? 209.57240 256.23385 67.12899  1.000 114.05401 ?  133 THR A OG1   1 
ATOM   987   C CG2   . THR A 1 133 ? 209.91741 253.87572 66.70335  1.000 103.16550 ?  133 THR A CG2   1 
ATOM   988   N N     . VAL A 1 134 ? 211.99326 256.51005 68.41586  1.000 100.88622 ?  134 VAL A N     1 
ATOM   989   C CA    . VAL A 1 134 ? 212.45251 256.47257 69.79968  1.000 100.64204 ?  134 VAL A CA    1 
ATOM   990   C C     . VAL A 1 134 ? 212.02564 255.18500 70.51419  1.000 100.96254 ?  134 VAL A C     1 
ATOM   991   O O     . VAL A 1 134 ? 212.85219 254.61026 71.23903  1.000 100.15513 ?  134 VAL A O     1 
ATOM   992   C CB    . VAL A 1 134 ? 212.03763 257.74861 70.53582  1.000 98.65707  ?  134 VAL A CB    1 
ATOM   993   C CG1   . VAL A 1 134 ? 212.36492 257.66000 72.01222  1.000 97.78613  ?  134 VAL A CG1   1 
ATOM   994   C CG2   . VAL A 1 134 ? 212.77157 258.96754 69.93581  1.000 97.10994  ?  134 VAL A CG2   1 
ATOM   995   N N     . PRO A 1 135 ? 210.76393 254.74275 70.45006  1.000 101.54283 ?  135 PRO A N     1 
ATOM   996   C CA    . PRO A 1 135 ? 210.42894 253.41927 71.06511  1.000 103.01497 ?  135 PRO A CA    1 
ATOM   997   C C     . PRO A 1 135 ? 211.27611 252.25318 70.60025  1.000 103.28682 ?  135 PRO A C     1 
ATOM   998   O O     . PRO A 1 135 ? 211.55115 251.33715 71.37998  1.000 106.80855 ?  135 PRO A O     1 
ATOM   999   C CB    . PRO A 1 135 ? 208.92324 253.22182 70.74590  1.000 109.45389 ?  135 PRO A CB    1 
ATOM   1000  C CG    . PRO A 1 135 ? 208.32726 254.76697 70.77008  1.000 108.54988 ?  135 PRO A CG    1 
ATOM   1001  C CD    . PRO A 1 135 ? 209.58133 255.59879 70.18527  1.000 107.22656 ?  135 PRO A CD    1 
ATOM   1002  N N     . GLU A 1 136 ? 211.57264 252.16374 69.31139  1.000 102.90166 ?  136 GLU A N     1 
ATOM   1003  C CA    . GLU A 1 136 ? 212.49298 251.14339 68.83735  1.000 108.10088 ?  136 GLU A CA    1 
ATOM   1004  C C     . GLU A 1 136 ? 213.84113 251.26813 69.55039  1.000 106.35428 ?  136 GLU A C     1 
ATOM   1005  O O     . GLU A 1 136 ? 214.43845 250.26867 69.99279  1.000 104.02876 ?  136 GLU A O     1 
ATOM   1006  C CB    . GLU A 1 136 ? 212.61782 251.26654 67.31662  1.000 109.97447 ?  136 GLU A CB    1 
ATOM   1007  C CG    . GLU A 1 136 ? 211.42294 250.66451 66.59573  1.000 111.30182 ?  136 GLU A CG    1 
ATOM   1008  C CD    . GLU A 1 136 ? 211.57674 250.80140 65.12385  1.000 108.57881 ?  136 GLU A CD    1 
ATOM   1009  O OE1   . GLU A 1 136 ? 211.63191 251.97042 64.69271  1.000 104.51681 ?  136 GLU A OE1   1 
ATOM   1010  O OE2   . GLU A 1 136 ? 211.65167 249.76736 64.42325  1.000 100.74980 ?  136 GLU A OE2   1 
ATOM   1011  N N     . HIS A 1 137 ? 214.35194 252.51575 69.64179  1.000 104.24015 ?  137 HIS A N     1 
ATOM   1012  C CA    . HIS A 1 137 ? 215.58574 252.81421 70.37917  1.000 104.99584 ?  137 HIS A CA    1 
ATOM   1013  C C     . HIS A 1 137 ? 215.46813 252.37990 71.84823  1.000 111.61748 ?  137 HIS A C     1 
ATOM   1014  O O     . HIS A 1 137 ? 216.37661 251.73697 72.39166  1.000 109.98980 ?  137 HIS A O     1 
ATOM   1015  C CB    . HIS A 1 137 ? 215.89911 254.31706 70.29311  1.000 102.96996 ?  137 HIS A CB    1 
ATOM   1016  C CG    . HIS A 1 137 ? 216.79939 254.70492 69.15377  1.000 109.41420 ?  137 HIS A CG    1 
ATOM   1017  N ND1   . HIS A 1 137 ? 218.16371 254.49959 69.14892  1.000 113.55764 ?  137 HIS A ND1   1 
ATOM   1018  C CD2   . HIS A 1 137 ? 216.51618 255.32187 67.98083  1.000 114.68220 ?  137 HIS A CD2   1 
ATOM   1019  C CE1   . HIS A 1 137 ? 218.68041 254.96688 68.02478  1.000 116.96493 ?  137 HIS A CE1   1 
ATOM   1020  N NE2   . HIS A 1 137 ? 217.70009 255.46600 67.29480  1.000 119.02298 ?  137 HIS A NE2   1 
ATOM   1021  N N     . ALA A 1 138 ? 214.35927 252.72632 72.51529  1.000 111.09499 ?  138 ALA A N     1 
ATOM   1022  C CA    . ALA A 1 138 ? 214.19895 252.34100 73.91531  1.000 103.94480 ?  138 ALA A CA    1 
ATOM   1023  C C     . ALA A 1 138 ? 214.10973 250.82787 74.04838  1.000 99.42783  ?  138 ALA A C     1 
ATOM   1024  O O     . ALA A 1 138 ? 214.66393 250.25611 74.99257  1.000 103.82142 ?  138 ALA A O     1 
ATOM   1025  C CB    . ALA A 1 138 ? 212.97660 253.02517 74.53091  1.000 100.92573 ?  138 ALA A CB    1 
ATOM   1026  N N     . SER A 1 139 ? 213.41526 250.16492 73.11125  1.000 95.33856  ?  139 SER A N     1 
ATOM   1027  C CA    . SER A 1 139 ? 213.28156 248.70745 73.14946  1.000 102.05258 ?  139 SER A CA    1 
ATOM   1028  C C     . SER A 1 139 ? 214.64297 248.03353 73.07287  1.000 103.29570 ?  139 SER A C     1 
ATOM   1029  O O     . SER A 1 139 ? 214.90380 247.03074 73.75167  1.000 100.50259 ?  139 SER A O     1 
ATOM   1030  C CB    . SER A 1 139 ? 212.40542 248.20754 71.99468  1.000 105.97394 ?  139 SER A CB    1 
ATOM   1031  O OG    . SER A 1 139 ? 211.12090 248.80144 71.95545  1.000 103.40312 ?  139 SER A OG    1 
ATOM   1032  N N     . LEU A 1 140 ? 215.49342 248.52153 72.17519  1.000 103.49638 ?  140 LEU A N     1 
ATOM   1033  C CA    . LEU A 1 140 ? 216.82760 247.95982 72.05823  1.000 104.08119 ?  140 LEU A CA    1 
ATOM   1034  C C     . LEU A 1 140 ? 217.64740 248.28620 73.30847  1.000 102.66124 ?  140 LEU A C     1 
ATOM   1035  O O     . LEU A 1 140 ? 218.26943 247.39086 73.90598  1.000 97.35786  ?  140 LEU A O     1 
ATOM   1036  C CB    . LEU A 1 140 ? 217.50378 248.54279 70.82222  1.000 101.86312 ?  140 LEU A CB    1 
ATOM   1037  C CG    . LEU A 1 140 ? 218.90554 248.06923 70.48612  1.000 95.99878  ?  140 LEU A CG    1 
ATOM   1038  C CD1   . LEU A 1 140 ? 218.89455 246.51794 70.23737  1.000 89.87882  ?  140 LEU A CD1   1 
ATOM   1039  C CD2   . LEU A 1 140 ? 219.50855 248.91161 69.39945  1.000 96.53836  ?  140 LEU A CD2   1 
ATOM   1040  N N     . VAL A 1 141 ? 217.57159 249.55462 73.76903  1.000 96.34356  ?  141 VAL A N     1 
ATOM   1041  C CA    . VAL A 1 141 ? 218.35150 249.99508 74.92578  1.000 94.20967  ?  141 VAL A CA    1 
ATOM   1042  C C     . VAL A 1 141 ? 218.07254 249.07588 76.09624  1.000 94.20425  ?  141 VAL A C     1 
ATOM   1043  O O     . VAL A 1 141 ? 218.99621 248.50848 76.69274  1.000 96.67244  ?  141 VAL A O     1 
ATOM   1044  C CB    . VAL A 1 141 ? 218.02064 251.46499 75.29008  1.000 97.52255  ?  141 VAL A CB    1 
ATOM   1045  C CG1   . VAL A 1 141 ? 218.40998 251.78141 76.72057  1.000 96.58138  ?  141 VAL A CG1   1 
ATOM   1046  C CG2   . VAL A 1 141 ? 218.74774 252.47296 74.39999  1.000 95.88896  ?  141 VAL A CG2   1 
ATOM   1047  N N     . GLY A 1 142 ? 216.78757 248.81903 76.34966  1.000 94.32857  ?  142 GLY A N     1 
ATOM   1048  C CA    . GLY A 1 142 ? 216.40167 247.92716 77.42951  1.000 94.70745  ?  142 GLY A CA    1 
ATOM   1049  C C     . GLY A 1 142 ? 216.85444 246.49522 77.21492  1.000 90.15115  ?  142 GLY A C     1 
ATOM   1050  O O     . GLY A 1 142 ? 217.25147 245.81120 78.15994  1.000 90.85769  ?  142 GLY A O     1 
ATOM   1051  N N     . LEU A 1 143 ? 216.75235 246.00572 75.98265  1.000 92.32434  ?  143 LEU A N     1 
ATOM   1052  C CA    . LEU A 1 143 ? 217.19956 244.64758 75.68086  1.000 98.81273  ?  143 LEU A CA    1 
ATOM   1053  C C     . LEU A 1 143 ? 218.69981 244.50260 75.89477  1.000 99.88659  ?  143 LEU A C     1 
ATOM   1054  O O     . LEU A 1 143 ? 219.17067 243.47539 76.41231  1.000 94.18325  ?  143 LEU A O     1 
ATOM   1055  C CB    . LEU A 1 143 ? 216.80560 244.30883 74.25288  1.000 96.86517  ?  143 LEU A CB    1 
ATOM   1056  C CG    . LEU A 1 143 ? 215.33022 243.99190 74.15748  1.000 87.30911  ?  143 LEU A CG    1 
ATOM   1057  C CD1   . LEU A 1 143 ? 214.95993 244.03274 72.71240  1.000 86.14195  ?  143 LEU A CD1   1 
ATOM   1058  C CD2   . LEU A 1 143 ? 215.15279 242.58678 74.72229  1.000 86.76670  ?  143 LEU A CD2   1 
ATOM   1059  N N     . LEU A 1 144 ? 219.46765 245.52345 75.48862  1.000 97.33476  ?  144 LEU A N     1 
ATOM   1060  C CA    . LEU A 1 144 ? 220.91016 245.49048 75.69705  1.000 100.14147 ?  144 LEU A CA    1 
ATOM   1061  C C     . LEU A 1 144 ? 221.24197 245.49886 77.18513  1.000 104.10412 ?  144 LEU A C     1 
ATOM   1062  O O     . LEU A 1 144 ? 222.00792 244.64863 77.66115  1.000 104.19222 ?  144 LEU A O     1 
ATOM   1063  C CB    . LEU A 1 144 ? 221.57559 246.67446 74.98637  1.000 95.62299  ?  144 LEU A CB    1 
ATOM   1064  C CG    . LEU A 1 144 ? 221.61842 246.58579 73.45829  1.000 101.70861 ?  144 LEU A CG    1 
ATOM   1065  C CD1   . LEU A 1 144 ? 222.24013 247.84992 72.87614  1.000 96.77638  ?  144 LEU A CD1   1 
ATOM   1066  C CD2   . LEU A 1 144 ? 222.33544 245.32510 72.96555  1.000 106.83274 ?  144 LEU A CD2   1 
ATOM   1067  N N     . LEU A 1 145 ? 220.60294 246.39289 77.95249  1.000 100.63717 ?  145 LEU A N     1 
ATOM   1068  C CA    . LEU A 1 145 ? 220.87543 246.44959 79.38376  1.000 89.54149  ?  145 LEU A CA    1 
ATOM   1069  C C     . LEU A 1 145 ? 220.48099 245.15745 80.09260  1.000 89.24070  ?  145 LEU A C     1 
ATOM   1070  O O     . LEU A 1 145 ? 221.20452 244.72001 80.99102  1.000 92.08774  ?  145 LEU A O     1 
ATOM   1071  C CB    . LEU A 1 145 ? 220.16981 247.65285 80.00479  1.000 77.64507  ?  145 LEU A CB    1 
ATOM   1072  C CG    . LEU A 1 145 ? 220.76594 248.97583 79.55223  1.000 83.50174  ?  145 LEU A CG    1 
ATOM   1073  C CD1   . LEU A 1 145 ? 219.99147 250.17092 80.12188  1.000 86.76028  ?  145 LEU A CD1   1 
ATOM   1074  C CD2   . LEU A 1 145 ? 222.21841 249.00625 79.96326  1.000 87.85552  ?  145 LEU A CD2   1 
ATOM   1075  N N     . SER A 1 146 ? 219.40187 244.49952 79.65232  1.000 87.20785  ?  146 SER A N     1 
ATOM   1076  C CA    . SER A 1 146 ? 218.93802 243.26102 80.27879  1.000 89.79881  ?  146 SER A CA    1 
ATOM   1077  C C     . SER A 1 146 ? 219.96711 242.14292 80.20339  1.000 95.10109  ?  146 SER A C     1 
ATOM   1078  O O     . SER A 1 146 ? 219.77726 241.09224 80.83972  1.000 91.69204  ?  146 SER A O     1 
ATOM   1079  C CB    . SER A 1 146 ? 217.62570 242.77668 79.66177  1.000 98.16515  ?  146 SER A CB    1 
ATOM   1080  O OG    . SER A 1 146 ? 217.84905 242.04984 78.46100  1.000 105.94792 ?  146 SER A OG    1 
ATOM   1081  N N     . LEU A 1 147 ? 220.95186 242.25966 79.31085  1.000 96.32913  ?  147 LEU A N     1 
ATOM   1082  C CA    . LEU A 1 147 ? 222.00886 241.25774 79.29955  1.000 98.68295  ?  147 LEU A CA    1 
ATOM   1083  C C     . LEU A 1 147 ? 222.76749 241.26328 80.61467  1.000 98.29569  ?  147 LEU A C     1 
ATOM   1084  O O     . LEU A 1 147 ? 223.16317 240.19439 81.10266  1.000 99.03324  ?  147 LEU A O     1 
ATOM   1085  C CB    . LEU A 1 147 ? 222.94477 241.49161 78.10877  1.000 101.95795 ?  147 LEU A CB    1 
ATOM   1086  C CG    . LEU A 1 147 ? 222.39289 241.12847 76.72576  1.000 101.27502 ?  147 LEU A CG    1 
ATOM   1087  C CD1   . LEU A 1 147 ? 223.35819 241.59256 75.67838  1.000 98.54520  ?  147 LEU A CD1   1 
ATOM   1088  C CD2   . LEU A 1 147 ? 222.17930 239.62936 76.59235  1.000 97.60069  ?  147 LEU A CD2   1 
ATOM   1089  N N     . TYR A 1 148 ? 222.90929 242.44961 81.23008  1.000 99.73317  ?  148 TYR A N     1 
ATOM   1090  C CA    . TYR A 1 148 ? 223.66492 242.56898 82.47610  1.000 96.73266  ?  148 TYR A CA    1 
ATOM   1091  C C     . TYR A 1 148 ? 223.03022 241.71121 83.56652  1.000 90.94191  ?  148 TYR A C     1 
ATOM   1092  O O     . TYR A 1 148 ? 223.68864 240.83306 84.13868  1.000 91.40108  ?  148 TYR A O     1 
ATOM   1093  C CB    . TYR A 1 148 ? 223.73816 244.04225 82.92740  1.000 90.11415  ?  148 TYR A CB    1 
ATOM   1094  C CG    . TYR A 1 148 ? 224.50088 244.22276 84.21965  1.000 89.21357  ?  148 TYR A CG    1 
ATOM   1095  C CD1   . TYR A 1 148 ? 225.88747 244.30420 84.21638  1.000 93.37551  ?  148 TYR A CD1   1 
ATOM   1096  C CD2   . TYR A 1 148 ? 223.85420 244.19959 85.45015  1.000 90.83043  ?  148 TYR A CD2   1 
ATOM   1097  C CE1   . TYR A 1 148 ? 226.60619 244.42632 85.39279  1.000 97.63486  ?  148 TYR A CE1   1 
ATOM   1098  C CE2   . TYR A 1 148 ? 224.56719 244.30899 86.64346  1.000 94.99723  ?  148 TYR A CE2   1 
ATOM   1099  C CZ    . TYR A 1 148 ? 225.94401 244.42307 86.60749  1.000 98.67790  ?  148 TYR A CZ    1 
ATOM   1100  O OH    . TYR A 1 148 ? 226.67008 244.52550 87.77410  1.000 98.96038  ?  148 TYR A OH    1 
ATOM   1101  N N     . ARG A 1 149 ? 221.71556 241.86463 83.76658  1.000 81.91606  ?  149 ARG A N     1 
ATOM   1102  C CA    . ARG A 1 149 ? 221.01373 241.05958 84.75525  1.000 84.22728  ?  149 ARG A CA    1 
ATOM   1103  C C     . ARG A 1 149 ? 221.15909 239.57163 84.47107  1.000 86.33332  ?  149 ARG A C     1 
ATOM   1104  O O     . ARG A 1 149 ? 221.40107 238.77593 85.38480  1.000 85.65291  ?  149 ARG A O     1 
ATOM   1105  C CB    . ARG A 1 149 ? 219.54402 241.48062 84.82264  1.000 80.96915  ?  149 ARG A CB    1 
ATOM   1106  C CG    . ARG A 1 149 ? 218.76137 240.71524 85.88955  1.000 91.08444  ?  149 ARG A CG    1 
ATOM   1107  C CD    . ARG A 1 149 ? 217.34388 241.22078 86.06156  1.000 85.07824  ?  149 ARG A CD    1 
ATOM   1108  N NE    . ARG A 1 149 ? 216.63303 240.42243 87.05436  1.000 86.37368  ?  149 ARG A NE    1 
ATOM   1109  C CZ    . ARG A 1 149 ? 215.38867 240.65846 87.42681  1.000 85.02833  ?  149 ARG A CZ    1 
ATOM   1110  N NH1   . ARG A 1 149 ? 214.72187 241.70160 86.95866  1.000 82.12783  ?  149 ARG A NH1   1 
ATOM   1111  N NH2   . ARG A 1 149 ? 214.79820 239.82349 88.27634  1.000 87.30254  ?  149 ARG A NH2   1 
ATOM   1112  N N     . LEU A 1 150 ? 221.05622 239.17983 83.21135  1.000 93.32692  ?  150 LEU A N     1 
ATOM   1113  C CA    . LEU A 1 150 ? 221.22062 237.77286 82.89228  1.000 101.28094 ?  150 LEU A CA    1 
ATOM   1114  C C     . LEU A 1 150 ? 222.62291 237.29557 83.23985  1.000 99.38151  ?  150 LEU A C     1 
ATOM   1115  O O     . LEU A 1 150 ? 222.79099 236.23263 83.85010  1.000 98.36990  ?  150 LEU A O     1 
ATOM   1116  C CB    . LEU A 1 150 ? 220.91681 237.58208 81.41483  1.000 101.40031 ?  150 LEU A CB    1 
ATOM   1117  C CG    . LEU A 1 150 ? 219.43375 237.74712 81.15103  1.000 96.72573  ?  150 LEU A CG    1 
ATOM   1118  C CD1   . LEU A 1 150 ? 219.30845 238.16546 79.72511  1.000 93.75644  ?  150 LEU A CD1   1 
ATOM   1119  C CD2   . LEU A 1 150 ? 218.76679 236.38076 81.40539  1.000 92.08188  ?  150 LEU A CD2   1 
ATOM   1120  N N     . SER A 1 151 ? 223.63599 238.11532 82.94192  1.000 95.96418  ?  151 SER A N     1 
ATOM   1121  C CA    . SER A 1 151 ? 225.01300 237.70873 83.21028  1.000 100.59799 ?  151 SER A CA    1 
ATOM   1122  C C     . SER A 1 151 ? 225.24740 237.49812 84.69876  1.000 96.45679  ?  151 SER A C     1 
ATOM   1123  O O     . SER A 1 151 ? 225.91535 236.53436 85.10247  1.000 91.55832  ?  151 SER A O     1 
ATOM   1124  C CB    . SER A 1 151 ? 225.98223 238.75136 82.65468  1.000 103.25902 ?  151 SER A CB    1 
ATOM   1125  O OG    . SER A 1 151 ? 227.32619 238.37020 82.90587  1.000 106.47620 ?  151 SER A OG    1 
ATOM   1126  N N     . LYS A 1 152 ? 224.69055 238.39304 85.52193  1.000 96.27631  ?  152 LYS A N     1 
ATOM   1127  C CA    . LYS A 1 152 ? 224.81121 238.29161 86.97113  1.000 96.31759  ?  152 LYS A CA    1 
ATOM   1128  C C     . LYS A 1 152 ? 224.10977 237.03783 87.49270  1.000 99.82075  ?  152 LYS A C     1 
ATOM   1129  O O     . LYS A 1 152 ? 224.56299 236.43130 88.47011  1.000 101.63808 ?  152 LYS A O     1 
ATOM   1130  C CB    . LYS A 1 152 ? 224.23808 239.55211 87.63531  1.000 89.08159  ?  152 LYS A CB    1 
ATOM   1131  C CG    . LYS A 1 152 ? 224.60905 239.78269 89.11411  1.000 89.71397  ?  152 LYS A CG    1 
ATOM   1132  C CD    . LYS A 1 152 ? 223.98533 241.07530 89.67044  1.000 93.95445  ?  152 LYS A CD    1 
ATOM   1133  C CE    . LYS A 1 152 ? 224.39016 241.35995 91.11375  1.000 90.04039  ?  152 LYS A CE    1 
ATOM   1134  N NZ    . LYS A 1 152 ? 225.86205 241.62687 91.22078  1.000 96.96808  ?  152 LYS A NZ    1 
ATOM   1135  N N     . ILE A 1 153 ? 222.96734 236.65754 86.90537  1.000 99.34075  ?  153 ILE A N     1 
ATOM   1136  C CA    . ILE A 1 153 ? 222.26298 235.49376 87.44413  1.000 99.06920  ?  153 ILE A CA    1 
ATOM   1137  C C     . ILE A 1 153 ? 222.85590 234.18012 86.97276  1.000 103.00363 ?  153 ILE A C     1 
ATOM   1138  O O     . ILE A 1 153 ? 222.20122 233.12837 87.11817  1.000 100.36164 ?  153 ILE A O     1 
ATOM   1139  C CB    . ILE A 1 153 ? 220.77541 235.40512 87.06076  1.000 93.34667  ?  153 ILE A CB    1 
ATOM   1140  C CG1   . ILE A 1 153 ? 220.68938 234.99788 85.61019  1.000 95.52828  ?  153 ILE A CG1   1 
ATOM   1141  C CG2   . ILE A 1 153 ? 219.99293 236.71444 87.31915  1.000 95.92574  ?  153 ILE A CG2   1 
ATOM   1142  C CD1   . ILE A 1 153 ? 219.34711 234.97015 85.15748  1.000 101.57497 ?  153 ILE A CD1   1 
ATOM   1143  N N     . SER A 1 154 ? 224.07068 234.20917 86.40495  1.000 106.79590 ?  154 SER A N     1 
ATOM   1144  C CA    . SER A 1 154 ? 224.74553 232.98109 85.99573  1.000 111.53945 ?  154 SER A CA    1 
ATOM   1145  C C     . SER A 1 154 ? 225.33098 232.31043 87.22552  1.000 110.36786 ?  154 SER A C     1 
ATOM   1146  O O     . SER A 1 154 ? 225.78809 232.95658 88.17355  1.000 104.74673 ?  154 SER A O     1 
ATOM   1147  C CB    . SER A 1 154 ? 225.83969 233.22334 84.92471  1.000 106.74887 ?  154 SER A CB    1 
ATOM   1148  O OG    . SER A 1 154 ? 225.31701 233.86173 83.77021  1.000 100.76018 ?  154 SER A OG    1 
ATOM   1149  N N     . GLY A 1 155 ? 225.26730 230.99520 87.22192  1.000 106.84421 ?  155 GLY A N     1 
ATOM   1150  C CA    . GLY A 1 155 ? 225.72363 230.26978 88.38602  1.000 100.44489 ?  155 GLY A CA    1 
ATOM   1151  C C     . GLY A 1 155 ? 225.31800 228.82008 88.23244  1.000 108.45561 ?  155 GLY A C     1 
ATOM   1152  O O     . GLY A 1 155 ? 224.72346 228.42456 87.23151  1.000 111.11968 ?  155 GLY A O     1 
ATOM   1153  N N     . GLN A 1 156 ? 225.60899 228.03150 89.26442  1.000 113.47379 ?  156 GLN A N     1 
ATOM   1154  C CA    . GLN A 1 156 ? 225.24050 226.62360 89.21548  1.000 116.87498 ?  156 GLN A CA    1 
ATOM   1155  C C     . GLN A 1 156 ? 223.72292 226.50953 89.28695  1.000 118.49941 ?  156 GLN A C     1 
ATOM   1156  O O     . GLN A 1 156 ? 223.04416 227.31057 89.93224  1.000 119.93562 ?  156 GLN A O     1 
ATOM   1157  C CB    . GLN A 1 156 ? 225.85697 225.85295 90.39455  1.000 119.16509 ?  156 GLN A CB    1 
ATOM   1158  C CG    . GLN A 1 156 ? 225.44525 226.36261 91.79471  1.000 121.40514 ?  156 GLN A CG    1 
ATOM   1159  C CD    . GLN A 1 156 ? 226.30184 225.75696 92.91012  1.000 127.90879 ?  156 GLN A CD    1 
ATOM   1160  O OE1   . GLN A 1 156 ? 226.40057 224.52959 93.05646  1.000 129.21462 ?  156 GLN A OE1   1 
ATOM   1161  N NE2   . GLN A 1 156 ? 226.89929 226.62559 93.72204  1.000 127.35076 ?  156 GLN A NE2   1 
ATOM   1162  N N     . ASN A 1 157 ? 223.20035 225.44432 88.67026  1.000 115.47891 ?  157 ASN A N     1 
ATOM   1163  C CA    . ASN A 1 157 ? 221.74650 225.28419 88.53583  1.000 112.49339 ?  157 ASN A CA    1 
ATOM   1164  C C     . ASN A 1 157 ? 221.17741 226.52406 87.84108  1.000 112.07822 ?  157 ASN A C     1 
ATOM   1165  O O     . ASN A 1 157 ? 221.70125 226.88719 86.76664  1.000 119.23439 ?  157 ASN A O     1 
ATOM   1166  C CB    . ASN A 1 157 ? 221.16930 224.95303 89.90029  1.000 105.35508 ?  157 ASN A CB    1 
ATOM   1167  C CG    . ASN A 1 157 ? 219.70541 224.31468 89.77081  1.000 109.11893 ?  157 ASN A CG    1 
ATOM   1168  O OD1   . ASN A 1 157 ? 218.69232 225.04798 89.19890  1.000 94.76943  ?  157 ASN A OD1   1 
ATOM   1169  N ND2   . ASN A 1 157 ? 219.51397 223.00511 90.36623  1.000 105.02902 ?  157 ASN A ND2   1 
ATOM   1170  N N     . THR A 1 158 ? 220.27205 227.27196 88.49798  1.000 105.05905 ?  158 THR A N     1 
ATOM   1171  C CA    . THR A 1 158 ? 219.59242 228.45806 87.97965  1.000 114.04140 ?  158 THR A CA    1 
ATOM   1172  C C     . THR A 1 158 ? 219.19553 228.38338 86.50160  1.000 115.33509 ?  158 THR A C     1 
ATOM   1173  O O     . THR A 1 158 ? 218.94553 229.43539 85.89740  1.000 110.91350 ?  158 THR A O     1 
ATOM   1174  C CB    . THR A 1 158 ? 220.51064 229.67842 88.14700  1.000 119.37895 ?  158 THR A CB    1 
ATOM   1175  O OG1   . THR A 1 158 ? 221.63161 229.57335 87.24953  1.000 113.00512 ?  158 THR A OG1   1 
ATOM   1176  C CG2   . THR A 1 158 ? 221.03043 229.73742 89.56484  1.000 115.82014 ?  158 THR A CG2   1 
ATOM   1177  N N     . GLY A 1 159 ? 219.05527 227.17644 85.93345  1.000 118.26416 ?  159 GLY A N     1 
ATOM   1178  C CA    . GLY A 1 159 ? 218.82838 227.04193 84.48441  1.000 114.27653 ?  159 GLY A CA    1 
ATOM   1179  C C     . GLY A 1 159 ? 217.50245 227.62106 84.04594  1.000 111.55225 ?  159 GLY A C     1 
ATOM   1180  O O     . GLY A 1 159 ? 217.44212 228.59343 83.27861  1.000 107.58076 ?  159 GLY A O     1 
ATOM   1181  N N     . ASN A 1 160 ? 216.44148 227.02689 84.60695  1.000 112.79539 ?  160 ASN A N     1 
ATOM   1182  C CA    . ASN A 1 160 ? 215.07468 227.46565 84.36497  1.000 111.15950 ?  160 ASN A CA    1 
ATOM   1183  C C     . ASN A 1 160 ? 214.87261 228.92394 84.74010  1.000 111.12748 ?  160 ASN A C     1 
ATOM   1184  O O     . ASN A 1 160 ? 214.10154 229.62721 84.07775  1.000 108.94105 ?  160 ASN A O     1 
ATOM   1185  C CB    . ASN A 1 160 ? 214.09752 226.60632 85.17823  1.000 109.43472 ?  160 ASN A CB    1 
ATOM   1186  C CG    . ASN A 1 160 ? 214.38996 226.62570 86.71453  1.000 123.55231 ?  160 ASN A CG    1 
ATOM   1187  O OD1   . ASN A 1 160 ? 215.52868 226.84247 87.16783  1.000 123.41948 ?  160 ASN A OD1   1 
ATOM   1188  N ND2   . ASN A 1 160 ? 213.33059 226.44837 87.50974  1.000 121.27871 ?  160 ASN A ND2   1 
ATOM   1189  N N     . TYR A 1 161 ? 215.59231 229.40417 85.76611  1.000 111.80295 ?  161 TYR A N     1 
ATOM   1190  C CA    . TYR A 1 161 ? 215.37875 230.76906 86.24870  1.000 108.64895 ?  161 TYR A CA    1 
ATOM   1191  C C     . TYR A 1 161 ? 215.81663 231.79182 85.19257  1.000 103.79309 ?  161 TYR A C     1 
ATOM   1192  O O     . TYR A 1 161 ? 215.08925 232.75794 84.92509  1.000 97.97706  ?  161 TYR A O     1 
ATOM   1193  C CB    . TYR A 1 161 ? 216.07930 230.97447 87.62326  1.000 103.93256 ?  161 TYR A CB    1 
ATOM   1194  C CG    . TYR A 1 161 ? 216.13558 232.42823 88.17119  1.000 103.18456 ?  161 TYR A CG    1 
ATOM   1195  C CD1   . TYR A 1 161 ? 215.03034 233.03584 88.78467  1.000 101.76838 ?  161 TYR A CD1   1 
ATOM   1196  C CD2   . TYR A 1 161 ? 217.29945 233.18943 88.06489  1.000 100.80974 ?  161 TYR A CD2   1 
ATOM   1197  C CE1   . TYR A 1 161 ? 215.09855 234.36011 89.26945  1.000 101.20974 ?  161 TYR A CE1   1 
ATOM   1198  C CE2   . TYR A 1 161 ? 217.36588 234.50304 88.53350  1.000 99.06381  ?  161 TYR A CE2   1 
ATOM   1199  C CZ    . TYR A 1 161 ? 216.26902 235.08578 89.13747  1.000 101.36653 ?  161 TYR A CZ    1 
ATOM   1200  O OH    . TYR A 1 161 ? 216.33045 236.38920 89.60539  1.000 100.98992 ?  161 TYR A OH    1 
ATOM   1201  N N     . LYS A 1 162 ? 216.94713 231.54054 84.51088  1.000 100.66588 ?  162 LYS A N     1 
ATOM   1202  C CA    . LYS A 1 162 ? 217.44432 232.47331 83.49618  1.000 99.55883  ?  162 LYS A CA    1 
ATOM   1203  C C     . LYS A 1 162 ? 216.43634 232.64031 82.37390  1.000 108.86766 ?  162 LYS A C     1 
ATOM   1204  O O     . LYS A 1 162 ? 216.17047 233.75726 81.90645  1.000 110.26493 ?  162 LYS A O     1 
ATOM   1205  C CB    . LYS A 1 162 ? 218.76511 231.96444 82.91713  1.000 95.89054  ?  162 LYS A CB    1 
ATOM   1206  C CG    . LYS A 1 162 ? 219.80953 231.59102 83.94992  1.000 98.60794  ?  162 LYS A CG    1 
ATOM   1207  C CD    . LYS A 1 162 ? 221.03621 230.91083 83.36929  1.000 96.17200  ?  162 LYS A CD    1 
ATOM   1208  C CE    . LYS A 1 162 ? 221.80576 231.85541 82.45275  1.000 93.56069  ?  162 LYS A CE    1 
ATOM   1209  N NZ    . LYS A 1 162 ? 222.36849 233.05206 83.12365  1.000 96.43135  ?  162 LYS A NZ    1 
ATOM   1210  N N     . THR A 1 163 ? 215.88223 231.51546 81.91923  1.000 111.34997 ?  163 THR A N     1 
ATOM   1211  C CA    . THR A 1 163 ? 214.88894 231.52670 80.85725  1.000 112.18482 ?  163 THR A CA    1 
ATOM   1212  C C     . THR A 1 163 ? 213.61920 232.26370 81.29116  1.000 106.84294 ?  163 THR A C     1 
ATOM   1213  O O     . THR A 1 163 ? 213.09547 233.09655 80.53932  1.000 103.80287 ?  163 THR A O     1 
ATOM   1214  C CB    . THR A 1 163 ? 214.61716 230.07437 80.42362  1.000 113.61115 ?  163 THR A CB    1 
ATOM   1215  O OG1   . THR A 1 163 ? 213.84846 229.39015 81.42625  1.000 110.30455 ?  163 THR A OG1   1 
ATOM   1216  C CG2   . THR A 1 163 ? 215.93635 229.31153 80.16281  1.000 104.99486 ?  163 THR A CG2   1 
ATOM   1217  N N     . ASN A 1 164 ? 213.16753 232.04846 82.53426  1.000 99.59312  ?  164 ASN A N     1 
ATOM   1218  C CA    . ASN A 1 164 ? 211.92667 232.67398 82.99404  1.000 97.09160  ?  164 ASN A CA    1 
ATOM   1219  C C     . ASN A 1 164 ? 212.03467 234.19310 83.01331  1.000 98.01406  ?  164 ASN A C     1 
ATOM   1220  O O     . ASN A 1 164 ? 211.07720 234.89597 82.65581  1.000 93.39533  ?  164 ASN A O     1 
ATOM   1221  C CB    . ASN A 1 164 ? 211.55304 232.15122 84.38021  1.000 101.30456 ?  164 ASN A CB    1 
ATOM   1222  C CG    . ASN A 1 164 ? 211.23900 230.65009 84.37981  1.000 113.78214 ?  164 ASN A CG    1 
ATOM   1223  O OD1   . ASN A 1 164 ? 210.76697 230.09761 83.38318  1.000 110.91774 ?  164 ASN A OD1   1 
ATOM   1224  N ND2   . ASN A 1 164 ? 211.53447 229.98087 85.49019  1.000 119.94945 ?  164 ASN A ND2   1 
ATOM   1225  N N     . ILE A 1 165 ? 213.16186 234.72420 83.51506  1.000 100.25151 ?  165 ILE A N     1 
ATOM   1226  C CA    . ILE A 1 165 ? 213.30120 236.18161 83.55407  1.000 101.73002 ?  165 ILE A CA    1 
ATOM   1227  C C     . ILE A 1 165 ? 213.48246 236.73387 82.14570  1.000 97.27630  ?  165 ILE A C     1 
ATOM   1228  O O     . ILE A 1 165 ? 212.98149 237.82288 81.81485  1.000 93.64930  ?  165 ILE A O     1 
ATOM   1229  C CB    . ILE A 1 165 ? 214.42332 236.66412 84.50842  1.000 106.82037 ?  165 ILE A CB    1 
ATOM   1230  C CG1   . ILE A 1 165 ? 215.82117 236.52540 83.91159  1.000 105.26086 ?  165 ILE A CG1   1 
ATOM   1231  C CG2   . ILE A 1 165 ? 214.35334 235.97576 85.89123  1.000 102.39899 ?  165 ILE A CG2   1 
ATOM   1232  C CD1   . ILE A 1 165 ? 216.81807 237.35496 84.70243  1.000 99.15991  ?  165 ILE A CD1   1 
ATOM   1233  N N     . ALA A 1 166 ? 214.22311 236.00736 81.30231  1.000 99.20036  ?  166 ALA A N     1 
ATOM   1234  C CA    . ALA A 1 166 ? 214.43324 236.48133 79.94301  1.000 102.84038 ?  166 ALA A CA    1 
ATOM   1235  C C     . ALA A 1 166 ? 213.10084 236.59510 79.22178  1.000 100.48067 ?  166 ALA A C     1 
ATOM   1236  O O     . ALA A 1 166 ? 212.81295 237.62819 78.60480  1.000 93.78014  ?  166 ALA A O     1 
ATOM   1237  C CB    . ALA A 1 166 ? 215.38158 235.54520 79.20458  1.000 104.11026 ?  166 ALA A CB    1 
ATOM   1238  N N     . ASP A 1 167 ? 212.22405 235.59594 79.41469  1.000 101.26643 ?  167 ASP A N     1 
ATOM   1239  C CA    . ASP A 1 167 ? 210.88950 235.63456 78.82055  1.000 103.29829 ?  167 ASP A CA    1 
ATOM   1240  C C     . ASP A 1 167 ? 210.10546 236.84520 79.30144  1.000 101.69891 ?  167 ASP A C     1 
ATOM   1241  O O     . ASP A 1 167 ? 209.43579 237.50748 78.50012  1.000 104.67013 ?  167 ASP A O     1 
ATOM   1242  C CB    . ASP A 1 167 ? 210.10061 234.35554 79.14541  1.000 99.02475  ?  167 ASP A CB    1 
ATOM   1243  C CG    . ASP A 1 167 ? 210.71030 233.09328 78.53426  1.000 101.73988 ?  167 ASP A CG    1 
ATOM   1244  O OD1   . ASP A 1 167 ? 211.59137 233.20158 77.64769  1.000 115.34730 ?  167 ASP A OD1   1 
ATOM   1245  O OD2   . ASP A 1 167 ? 210.27825 231.98326 78.92173  1.000 93.18781  ?  167 ASP A OD2   1 
ATOM   1246  N N     . ARG A 1 168 ? 210.18041 237.14603 80.60381  1.000 99.30445  ?  168 ARG A N     1 
ATOM   1247  C CA    . ARG A 1 168 ? 209.51738 238.32607 81.15900  1.000 102.15168 ?  168 ARG A CA    1 
ATOM   1248  C C     . ARG A 1 168 ? 210.06837 239.60062 80.53502  1.000 100.25767 ?  168 ARG A C     1 
ATOM   1249  O O     . ARG A 1 168 ? 209.32149 240.55840 80.28376  1.000 97.02508  ?  168 ARG A O     1 
ATOM   1250  C CB    . ARG A 1 168 ? 209.71112 238.37020 82.67946  1.000 104.85804 ?  168 ARG A CB    1 
ATOM   1251  C CG    . ARG A 1 168 ? 209.17971 239.63916 83.42620  1.000 103.02903 ?  168 ARG A CG    1 
ATOM   1252  C CD    . ARG A 1 168 ? 209.87300 239.89558 84.80584  1.000 98.00784  ?  168 ARG A CD    1 
ATOM   1253  N NE    . ARG A 1 168 ? 209.96185 238.67689 85.62074  1.000 100.38820 ?  168 ARG A NE    1 
ATOM   1254  C CZ    . ARG A 1 168 ? 210.56504 238.55314 86.80070  1.000 97.14217  ?  168 ARG A CZ    1 
ATOM   1255  N NH1   . ARG A 1 168 ? 211.10339 239.58979 87.42646  1.000 97.95560  ?  168 ARG A NH1   1 
ATOM   1256  N NH2   . ARG A 1 168 ? 210.68708 237.34504 87.33412  1.000 91.89798  ?  168 ARG A NH2   1 
ATOM   1257  N N     . ILE A 1 169 ? 211.39316 239.65423 80.34788  1.000 94.27603  ?  169 ILE A N     1 
ATOM   1258  C CA    . ILE A 1 169 ? 212.01177 240.83921 79.76449  1.000 95.93725  ?  169 ILE A CA    1 
ATOM   1259  C C     . ILE A 1 169 ? 211.51200 241.01827 78.34478  1.000 103.63692 ?  169 ILE A C     1 
ATOM   1260  O O     . ILE A 1 169 ? 211.27767 242.14536 77.88109  1.000 106.16072 ?  169 ILE A O     1 
ATOM   1261  C CB    . ILE A 1 169 ? 213.54103 240.71867 79.78557  1.000 96.99262  ?  169 ILE A CB    1 
ATOM   1262  C CG1   . ILE A 1 169 ? 214.07656 240.75664 81.20432  1.000 96.65284  ?  169 ILE A CG1   1 
ATOM   1263  C CG2   . ILE A 1 169 ? 214.15818 241.93258 79.10512  1.000 92.86978  ?  169 ILE A CG2   1 
ATOM   1264  C CD1   . ILE A 1 169 ? 215.51152 240.32414 81.25555  1.000 93.52593  ?  169 ILE A CD1   1 
ATOM   1265  N N     . GLU A 1 170 ? 211.38545 239.89919 77.61613  1.000 107.55594 ?  170 GLU A N     1 
ATOM   1266  C CA    . GLU A 1 170 ? 210.92743 239.96339 76.23367  1.000 108.36859 ?  170 GLU A CA    1 
ATOM   1267  C C     . GLU A 1 170 ? 209.52151 240.55604 76.17263  1.000 103.25955 ?  170 GLU A C     1 
ATOM   1268  O O     . GLU A 1 170 ? 209.29843 241.55815 75.47784  1.000 99.45874  ?  170 GLU A O     1 
ATOM   1269  C CB    . GLU A 1 170 ? 210.95075 238.55054 75.62133  1.000 106.55385 ?  170 GLU A CB    1 
ATOM   1270  C CG    . GLU A 1 170 ? 212.36013 238.00227 75.31192  1.000 113.60303 ?  170 GLU A CG    1 
ATOM   1271  C CD    . GLU A 1 170 ? 212.72098 237.93956 73.83704  1.000 117.00884 ?  170 GLU A CD    1 
ATOM   1272  O OE1   . GLU A 1 170 ? 211.99780 238.53267 73.01058  1.000 120.82694 ?  170 GLU A OE1   1 
ATOM   1273  O OE2   . GLU A 1 170 ? 213.73568 237.27787 73.51337  1.000 112.64552 ?  170 GLU A OE2   1 
ATOM   1274  N N     . GLN A 1 171 ? 208.61093 240.06024 77.02814  1.000 100.19771 ?  171 GLN A N     1 
ATOM   1275  C CA    . GLN A 1 171 ? 207.24272 240.56558 77.02688  1.000 98.24373  ?  171 GLN A CA    1 
ATOM   1276  C C     . GLN A 1 171 ? 207.21263 242.04707 77.34470  1.000 99.61217  ?  171 GLN A C     1 
ATOM   1277  O O     . GLN A 1 171 ? 206.43116 242.79415 76.75078  1.000 103.24045 ?  171 GLN A O     1 
ATOM   1278  C CB    . GLN A 1 171 ? 206.35733 239.80213 78.01967  1.000 104.12208 ?  171 GLN A CB    1 
ATOM   1279  C CG    . GLN A 1 171 ? 205.51987 238.68584 77.38832  1.000 104.30112 ?  171 GLN A CG    1 
ATOM   1280  C CD    . GLN A 1 171 ? 206.26795 237.37339 77.25027  1.000 112.91459 ?  171 GLN A CD    1 
ATOM   1281  O OE1   . GLN A 1 171 ? 206.86848 236.86631 78.20066  1.000 106.41418 ?  171 GLN A OE1   1 
ATOM   1282  N NE2   . GLN A 1 171 ? 206.29152 236.84953 76.02479  1.000 113.78106 ?  171 GLN A NE2   1 
ATOM   1283  N N     . ILE A 1 172 ? 208.06641 242.49707 78.26158  1.000 98.21718  ?  172 ILE A N     1 
ATOM   1284  C CA    . ILE A 1 172 ? 208.08497 243.91199 78.63300  1.000 97.75849  ?  172 ILE A CA    1 
ATOM   1285  C C     . ILE A 1 172 ? 208.41568 244.77210 77.41916  1.000 99.48544  ?  172 ILE A C     1 
ATOM   1286  O O     . ILE A 1 172 ? 207.77101 245.79705 77.16939  1.000 101.73390 ?  172 ILE A O     1 
ATOM   1287  C CB    . ILE A 1 172 ? 209.05632 244.16635 79.80206  1.000 98.56482  ?  172 ILE A CB    1 
ATOM   1288  C CG1   . ILE A 1 172 ? 208.64846 243.33092 81.01116  1.000 100.19131 ?  172 ILE A CG1   1 
ATOM   1289  C CG2   . ILE A 1 172 ? 209.02323 245.61207 80.20508  1.000 95.90044  ?  172 ILE A CG2   1 
ATOM   1290  C CD1   . ILE A 1 172 ? 207.21418 243.55317 81.41989  1.000 105.13313 ?  172 ILE A CD1   1 
ATOM   1291  N N     . PHE A 1 173 ? 209.47837 244.40805 76.69359  1.000 101.41411 ?  173 PHE A N     1 
ATOM   1292  C CA    . PHE A 1 173 ? 209.98009 245.18824 75.56191  1.000 104.83255 ?  173 PHE A CA    1 
ATOM   1293  C C     . PHE A 1 173 ? 209.29030 244.93103 74.21023  1.000 106.00373 ?  173 PHE A C     1 
ATOM   1294  O O     . PHE A 1 173 ? 209.60692 245.64554 73.24829  1.000 98.38544  ?  173 PHE A O     1 
ATOM   1295  C CB    . PHE A 1 173 ? 211.49642 244.98658 75.46197  1.000 106.00655 ?  173 PHE A CB    1 
ATOM   1296  C CG    . PHE A 1 173 ? 212.25011 245.52246 76.66697  1.000 102.81835 ?  173 PHE A CG    1 
ATOM   1297  C CD1   . PHE A 1 173 ? 212.14063 246.85561 77.02422  1.000 101.59987 ?  173 PHE A CD1   1 
ATOM   1298  C CD2   . PHE A 1 173 ? 213.05837 244.69588 77.43534  1.000 95.77181  ?  173 PHE A CD2   1 
ATOM   1299  C CE1   . PHE A 1 173 ? 212.82212 247.35312 78.11588  1.000 97.17305  ?  173 PHE A CE1   1 
ATOM   1300  C CE2   . PHE A 1 173 ? 213.73548 245.19206 78.51908  1.000 92.24543  ?  173 PHE A CE2   1 
ATOM   1301  C CZ    . PHE A 1 173 ? 213.61462 246.52203 78.86110  1.000 94.16149  ?  173 PHE A CZ    1 
ATOM   1302  N N     . GLU A 1 174 ? 208.40610 243.92387 74.08071  1.000 107.28712 ?  174 GLU A N     1 
ATOM   1303  C CA    . GLU A 1 174 ? 207.57347 243.79412 72.87741  1.000 100.08722 ?  174 GLU A CA    1 
ATOM   1304  C C     . GLU A 1 174 ? 206.17577 244.37964 73.04663  1.000 102.56741 ?  174 GLU A C     1 
ATOM   1305  O O     . GLU A 1 174 ? 205.45713 244.50659 72.05256  1.000 107.47540 ?  174 GLU A O     1 
ATOM   1306  C CB    . GLU A 1 174 ? 207.41802 242.34084 72.40231  1.000 88.63309  ?  174 GLU A CB    1 
ATOM   1307  C CG    . GLU A 1 174 ? 206.42511 241.52780 73.23244  1.000 98.34111  ?  174 GLU A CG    1 
ATOM   1308  C CD    . GLU A 1 174 ? 206.55468 240.02278 73.01978  1.000 109.58710 ?  174 GLU A CD    1 
ATOM   1309  O OE1   . GLU A 1 174 ? 207.56808 239.59276 72.42241  1.000 102.42414 ?  174 GLU A OE1   1 
ATOM   1310  O OE2   . GLU A 1 174 ? 205.68853 239.27104 73.53527  1.000 115.38416 ?  174 GLU A OE2   1 
ATOM   1311  N N     . THR A 1 175 ? 205.77251 244.75850 74.25681  1.000 99.69309  ?  175 THR A N     1 
ATOM   1312  C CA    . THR A 1 175 ? 204.44862 245.33355 74.46316  1.000 94.75411  ?  175 THR A CA    1 
ATOM   1313  C C     . THR A 1 175 ? 204.60675 246.82739 74.69959  1.000 94.06519  ?  175 THR A C     1 
ATOM   1314  O O     . THR A 1 175 ? 205.68050 247.30786 75.06079  1.000 95.08997  ?  175 THR A O     1 
ATOM   1315  C CB    . THR A 1 175 ? 203.70412 244.67055 75.63407  1.000 99.09288  ?  175 THR A CB    1 
ATOM   1316  O OG1   . THR A 1 175 ? 203.88721 243.24385 75.59503  1.000 101.12412 ?  175 THR A OG1   1 
ATOM   1317  C CG2   . THR A 1 175 ? 202.19835 245.04265 75.66353  1.000 102.93062 ?  175 THR A CG2   1 
ATOM   1318  N N     . ALA A 1 176 ? 203.51955 247.55979 74.49005  1.000 95.59798  ?  176 ALA A N     1 
ATOM   1319  C CA    . ALA A 1 176 ? 203.59379 249.01409 74.51712  1.000 94.96696  ?  176 ALA A CA    1 
ATOM   1320  C C     . ALA A 1 176 ? 204.08330 249.48666 75.88278  1.000 93.89611  ?  176 ALA A C     1 
ATOM   1321  O O     . ALA A 1 176 ? 203.77683 248.84591 76.89537  1.000 96.85549  ?  176 ALA A O     1 
ATOM   1322  C CB    . ALA A 1 176 ? 202.22351 249.61173 74.18989  1.000 97.50426  ?  176 ALA A CB    1 
ATOM   1323  N N     . PRO A 1 177 ? 204.88680 250.58094 75.95520  1.000 97.14418  ?  177 PRO A N     1 
ATOM   1324  C CA    . PRO A 1 177 ? 205.26242 251.56311 74.91011  1.000 101.63145 ?  177 PRO A CA    1 
ATOM   1325  C C     . PRO A 1 177 ? 206.43417 251.11563 74.02150  1.000 104.57628 ?  177 PRO A C     1 
ATOM   1326  O O     . PRO A 1 177 ? 206.93586 251.85069 73.14566  1.000 100.84762 ?  177 PRO A O     1 
ATOM   1327  C CB    . PRO A 1 177 ? 205.63390 252.80393 75.73705  1.000 95.79289  ?  177 PRO A CB    1 
ATOM   1328  C CG    . PRO A 1 177 ? 206.23713 252.23912 76.97628  1.000 100.02959 ?  177 PRO A CG    1 
ATOM   1329  C CD    . PRO A 1 177 ? 205.47187 250.94860 77.26156  1.000 102.98791 ?  177 PRO A CD    1 
ATOM   1330  N N     . PHE A 1 178 ? 206.90046 249.89425 74.26131  1.000 109.48359 ?  178 PHE A N     1 
ATOM   1331  C CA    . PHE A 1 178 ? 208.01200 249.34846 73.50070  1.000 113.13345 ?  178 PHE A CA    1 
ATOM   1332  C C     . PHE A 1 178 ? 207.48181 248.53912 72.31891  1.000 108.80663 ?  178 PHE A C     1 
ATOM   1333  O O     . PHE A 1 178 ? 206.37428 247.99592 72.35226  1.000 105.34756 ?  178 PHE A O     1 
ATOM   1334  C CB    . PHE A 1 178 ? 208.90104 248.48199 74.40316  1.000 106.85130 ?  178 PHE A CB    1 
ATOM   1335  C CG    . PHE A 1 178 ? 209.39487 249.20889 75.61901  1.000 99.51109  ?  178 PHE A CG    1 
ATOM   1336  C CD1   . PHE A 1 178 ? 210.47822 250.06033 75.53323  1.000 96.44038  ?  178 PHE A CD1   1 
ATOM   1337  C CD2   . PHE A 1 178 ? 208.82260 248.98356 76.85494  1.000 98.05049  ?  178 PHE A CD2   1 
ATOM   1338  C CE1   . PHE A 1 178 ? 210.94006 250.73964 76.64626  1.000 100.10821 ?  178 PHE A CE1   1 
ATOM   1339  C CE2   . PHE A 1 178 ? 209.28973 249.64766 77.98672  1.000 104.51252 ?  178 PHE A CE2   1 
ATOM   1340  C CZ    . PHE A 1 178 ? 210.35098 250.52867 77.88215  1.000 104.33899 ?  178 PHE A CZ    1 
ATOM   1341  N N     . VAL A 1 179 ? 208.29505 248.44388 71.27790  1.000 106.69942 ?  179 VAL A N     1 
ATOM   1342  C CA    . VAL A 1 179 ? 207.87700 247.74717 70.07093  1.000 106.05124 ?  179 VAL A CA    1 
ATOM   1343  C C     . VAL A 1 179 ? 208.76105 246.52723 69.84547  1.000 101.87812 ?  179 VAL A C     1 
ATOM   1344  O O     . VAL A 1 179 ? 209.97187 246.56009 70.09317  1.000 105.38857 ?  179 VAL A O     1 
ATOM   1345  C CB    . VAL A 1 179 ? 207.93149 248.73741 68.90198  1.000 104.08238 ?  179 VAL A CB    1 
ATOM   1346  C CG1   . VAL A 1 179 ? 206.98358 249.88741 69.19770  1.000 100.76763 ?  179 VAL A CG1   1 
ATOM   1347  C CG2   . VAL A 1 179 ? 209.31574 249.28867 68.80055  1.000 102.05969 ?  179 VAL A CG2   1 
ATOM   1348  N N     . LYS A 1 180 ? 208.15274 245.45214 69.34150  1.000 92.23407  ?  180 LYS A N     1 
ATOM   1349  C CA    . LYS A 1 180 ? 208.88494 244.20810 69.14529  1.000 92.99277  ?  180 LYS A CA    1 
ATOM   1350  C C     . LYS A 1 180 ? 209.90187 244.39900 68.04020  1.000 96.16510  ?  180 LYS A C     1 
ATOM   1351  O O     . LYS A 1 180 ? 209.52949 244.68546 66.89862  1.000 104.83484 ?  180 LYS A O     1 
ATOM   1352  C CB    . LYS A 1 180 ? 207.94865 243.05851 68.77975  1.000 87.38746  ?  180 LYS A CB    1 
ATOM   1353  C CG    . LYS A 1 180 ? 208.62828 241.68957 68.67535  1.000 77.19893  ?  180 LYS A CG    1 
ATOM   1354  C CD    . LYS A 1 180 ? 207.61951 240.57436 68.40247  1.000 85.12503  ?  180 LYS A CD    1 
ATOM   1355  C CE    . LYS A 1 180 ? 208.29795 239.20277 68.34124  1.000 99.05396  ?  180 LYS A CE    1 
ATOM   1356  N NZ    . LYS A 1 180 ? 207.38506 238.04697 68.05210  1.000 104.89539 ?  180 LYS A NZ    1 
ATOM   1357  N N     . ILE A 1 181 ? 211.18349 244.28285 68.37582  1.000 94.19291  ?  181 ILE A N     1 
ATOM   1358  C CA    . ILE A 1 181 ? 212.23365 244.39584 67.37493  1.000 93.58152  ?  181 ILE A CA    1 
ATOM   1359  C C     . ILE A 1 181 ? 213.02833 243.10336 67.22488  1.000 93.24535  ?  181 ILE A C     1 
ATOM   1360  O O     . ILE A 1 181 ? 213.84005 242.99240 66.29197  1.000 101.87478 ?  181 ILE A O     1 
ATOM   1361  C CB    . ILE A 1 181 ? 213.16623 245.59482 67.64804  1.000 93.68782  ?  181 ILE A CB    1 
ATOM   1362  C CG1   . ILE A 1 181 ? 213.78903 245.50347 69.01954  1.000 96.94105  ?  181 ILE A CG1   1 
ATOM   1363  C CG2   . ILE A 1 181 ? 212.37061 246.91459 67.62296  1.000 94.82562  ?  181 ILE A CG2   1 
ATOM   1364  C CD1   . ILE A 1 181 ? 214.65009 246.70380 69.29053  1.000 100.42676 ?  181 ILE A CD1   1 
ATOM   1365  N N     . VAL A 1 182 ? 212.90802 242.16041 68.15148  1.000 91.75828  ?  182 VAL A N     1 
ATOM   1366  C CA    . VAL A 1 182 ? 213.57237 240.86517 68.04246  1.000 95.17455  ?  182 VAL A CA    1 
ATOM   1367  C C     . VAL A 1 182 ? 212.54391 239.74555 68.16256  1.000 93.58052  ?  182 VAL A C     1 
ATOM   1368  O O     . VAL A 1 182 ? 211.43102 239.95146 68.65522  1.000 97.86254  ?  182 VAL A O     1 
ATOM   1369  C CB    . VAL A 1 182 ? 214.69267 240.70311 69.09394  1.000 101.55073 ?  182 VAL A CB    1 
ATOM   1370  C CG1   . VAL A 1 182 ? 215.84347 241.65322 68.76899  1.000 101.01700 ?  182 VAL A CG1   1 
ATOM   1371  C CG2   . VAL A 1 182 ? 214.14692 240.94806 70.49854  1.000 96.34849  ?  182 VAL A CG2   1 
ATOM   1372  N N     . GLU A 1 183 ? 212.91108 238.56141 67.68287  1.000 92.68960  ?  183 GLU A N     1 
ATOM   1373  C CA    . GLU A 1 183 ? 212.02832 237.41533 67.83534  1.000 98.76445  ?  183 GLU A CA    1 
ATOM   1374  C C     . GLU A 1 183 ? 212.30469 236.76590 69.18560  1.000 100.75018 ?  183 GLU A C     1 
ATOM   1375  O O     . GLU A 1 183 ? 213.39051 236.92292 69.74980  1.000 99.30155  ?  183 GLU A O     1 
ATOM   1376  C CB    . GLU A 1 183 ? 212.22806 236.40084 66.69339  1.000 109.44149 ?  183 GLU A CB    1 
ATOM   1377  C CG    . GLU A 1 183 ? 211.17513 235.26255 66.57425  1.000 118.92717 ?  183 GLU A CG    1 
ATOM   1378  C CD    . GLU A 1 183 ? 209.72311 235.72755 66.47590  1.000 121.74891 ?  183 GLU A CD    1 
ATOM   1379  O OE1   . GLU A 1 183 ? 209.42568 236.63084 65.66522  1.000 119.35627 ?  183 GLU A OE1   1 
ATOM   1380  O OE2   . GLU A 1 183 ? 208.87685 235.18609 67.22997  1.000 112.73806 ?  183 GLU A OE2   1 
ATOM   1381  N N     . HIS A 1 184 ? 211.29456 236.06850 69.72326  1.000 106.57263 ?  184 HIS A N     1 
ATOM   1382  C CA    . HIS A 1 184 ? 211.44343 235.41698 71.02131  1.000 110.31180 ?  184 HIS A CA    1 
ATOM   1383  C C     . HIS A 1 184 ? 212.65432 234.49815 70.98233  1.000 107.59102 ?  184 HIS A C     1 
ATOM   1384  O O     . HIS A 1 184 ? 213.05346 234.01705 69.92184  1.000 104.55991 ?  184 HIS A O     1 
ATOM   1385  C CB    . HIS A 1 184 ? 210.17307 234.62511 71.37106  1.000 110.69824 ?  184 HIS A CB    1 
ATOM   1386  C CG    . HIS A 1 184 ? 209.00059 235.49832 71.70743  1.000 118.15948 ?  184 HIS A CG    1 
ATOM   1387  N ND1   . HIS A 1 184 ? 208.11951 235.96498 70.75175  1.000 118.33538 ?  184 HIS A ND1   1 
ATOM   1388  C CD2   . HIS A 1 184 ? 208.57900 236.00910 72.88930  1.000 119.03020 ?  184 HIS A CD2   1 
ATOM   1389  C CE1   . HIS A 1 184 ? 207.19819 236.71185 71.33367  1.000 115.39769 ?  184 HIS A CE1   1 
ATOM   1390  N NE2   . HIS A 1 184 ? 207.45408 236.75602 72.62987  1.000 118.55837 ?  184 HIS A NE2   1 
ATOM   1391  N N     . HIS A 1 185 ? 213.23559 234.25315 72.15542  1.000 105.03892 ?  185 HIS A N     1 
ATOM   1392  C CA    . HIS A 1 185 ? 214.38000 233.37651 72.37339  1.000 103.57704 ?  185 HIS A CA    1 
ATOM   1393  C C     . HIS A 1 185 ? 215.67422 233.86453 71.70619  1.000 103.22620 ?  185 HIS A C     1 
ATOM   1394  O O     . HIS A 1 185 ? 216.67464 233.12676 71.75645  1.000 102.71792 ?  185 HIS A O     1 
ATOM   1395  C CB    . HIS A 1 185 ? 214.06142 231.94097 71.91893  1.000 96.75724  ?  185 HIS A CB    1 
ATOM   1396  C CG    . HIS A 1 185 ? 212.80513 231.39806 72.52561  1.000 104.84441 ?  185 HIS A CG    1 
ATOM   1397  N ND1   . HIS A 1 185 ? 211.61611 231.32099 71.82589  1.000 102.67986 ?  185 HIS A ND1   1 
ATOM   1398  C CD2   . HIS A 1 185 ? 212.54711 230.92051 73.76760  1.000 116.97261 ?  185 HIS A CD2   1 
ATOM   1399  C CE1   . HIS A 1 185 ? 210.67893 230.82599 72.61478  1.000 110.45014 ?  185 HIS A CE1   1 
ATOM   1400  N NE2   . HIS A 1 185 ? 211.21905 230.57033 73.79511  1.000 121.40488 ?  185 HIS A NE2   1 
ATOM   1401  N N     . THR A 1 186 ? 215.67363 235.02259 71.01097  1.000 99.69391  ?  186 THR A N     1 
ATOM   1402  C CA    . THR A 1 186 ? 216.92976 235.61173 70.52550  1.000 101.91391 ?  186 THR A CA    1 
ATOM   1403  C C     . THR A 1 186 ? 217.77174 236.18591 71.67709  1.000 109.54826 ?  186 THR A C     1 
ATOM   1404  O O     . THR A 1 186 ? 219.00907 236.18996 71.59594  1.000 112.10011 ?  186 THR A O     1 
ATOM   1405  C CB    . THR A 1 186 ? 216.69662 236.68290 69.43704  1.000 103.89602 ?  186 THR A CB    1 
ATOM   1406  O OG1   . THR A 1 186 ? 215.78470 237.69168 69.89150  1.000 98.28071  ?  186 THR A OG1   1 
ATOM   1407  C CG2   . THR A 1 186 ? 216.18527 236.05340 68.10351  1.000 111.25419 ?  186 THR A CG2   1 
ATOM   1408  N N     . LEU A 1 187 ? 217.11987 236.76151 72.71121  1.000 110.29267 ?  187 LEU A N     1 
ATOM   1409  C CA    . LEU A 1 187 ? 217.83708 237.34277 73.85595  1.000 101.20776 ?  187 LEU A CA    1 
ATOM   1410  C C     . LEU A 1 187 ? 218.57873 236.26778 74.65388  1.000 102.95966 ?  187 LEU A C     1 
ATOM   1411  O O     . LEU A 1 187 ? 219.75267 236.44102 74.99899  1.000 99.72307  ?  187 LEU A O     1 
ATOM   1412  C CB    . LEU A 1 187 ? 216.86507 238.11597 74.75823  1.000 101.47053 ?  187 LEU A CB    1 
ATOM   1413  C CG    . LEU A 1 187 ? 217.37523 238.85807 76.01399  1.000 108.36699 ?  187 LEU A CG    1 
ATOM   1414  C CD1   . LEU A 1 187 ? 218.33501 240.03426 75.71748  1.000 98.23637  ?  187 LEU A CD1   1 
ATOM   1415  C CD2   . LEU A 1 187 ? 216.22997 239.30171 76.92356  1.000 104.69044 ?  187 LEU A CD2   1 
ATOM   1416  N N     . MET A 1 188 ? 217.92344 235.12751 74.91607  1.000 103.08560 ?  188 MET A N     1 
ATOM   1417  C CA    . MET A 1 188 ? 218.58428 234.03607 75.63461  1.000 104.56738 ?  188 MET A CA    1 
ATOM   1418  C C     . MET A 1 188 ? 219.81630 233.54687 74.88282  1.000 109.42169 ?  188 MET A C     1 
ATOM   1419  O O     . MET A 1 188 ? 220.84680 233.24037 75.49696  1.000 104.57478 ?  188 MET A O     1 
ATOM   1420  C CB    . MET A 1 188 ? 217.61407 232.86480 75.82397  1.000 101.88919 ?  188 MET A CB    1 
ATOM   1421  C CG    . MET A 1 188 ? 217.13236 232.51296 77.24293  1.000 115.32007 ?  188 MET A CG    1 
ATOM   1422  S SD    . MET A 1 188 ? 218.45285 232.01823 78.37051  1.000 120.86715 ?  188 MET A SD    1 
ATOM   1423  C CE    . MET A 1 188 ? 219.06731 230.54208 77.54394  1.000 101.93158 ?  188 MET A CE    1 
ATOM   1424  N N     . THR A 1 189 ? 219.69885 233.41479 73.55317  1.000 112.89106 ?  189 THR A N     1 
ATOM   1425  C CA    . THR A 1 189 ? 220.79224 232.91284 72.72323  1.000 112.23818 ?  189 THR A CA    1 
ATOM   1426  C C     . THR A 1 189 ? 221.93616 233.92700 72.60898  1.000 106.54183 ?  189 THR A C     1 
ATOM   1427  O O     . THR A 1 189 ? 223.10881 233.54479 72.70037  1.000 111.08858 ?  189 THR A O     1 
ATOM   1428  C CB    . THR A 1 189 ? 220.26970 232.49518 71.34082  1.000 112.80797 ?  189 THR A CB    1 
ATOM   1429  O OG1   . THR A 1 189 ? 219.48972 233.55312 70.76623  1.000 119.03694 ?  189 THR A OG1   1 
ATOM   1430  C CG2   . THR A 1 189 ? 219.37831 231.24886 71.47112  1.000 96.65878  ?  189 THR A CG2   1 
ATOM   1431  N N     . THR A 1 190 ? 221.63172 235.21886 72.42880  1.000 100.23833 ?  190 THR A N     1 
ATOM   1432  C CA    . THR A 1 190 ? 222.71529 236.19819 72.45832  1.000 103.92167 ?  190 THR A CA    1 
ATOM   1433  C C     . THR A 1 190 ? 223.41772 236.21839 73.80942  1.000 110.81296 ?  190 THR A C     1 
ATOM   1434  O O     . THR A 1 190 ? 224.61915 236.50421 73.87324  1.000 108.90760 ?  190 THR A O     1 
ATOM   1435  C CB    . THR A 1 190 ? 222.22945 237.60929 72.08438  1.000 102.44973 ?  190 THR A CB    1 
ATOM   1436  O OG1   . THR A 1 190 ? 223.33466 238.53273 72.15974  1.000 96.97843  ?  190 THR A OG1   1 
ATOM   1437  C CG2   . THR A 1 190 ? 221.06892 238.08121 72.92851  1.000 101.26864 ?  190 THR A CG2   1 
ATOM   1438  N N     . HIS A 1 191 ? 222.68585 235.94969 74.89271  1.000 111.89825 ?  191 HIS A N     1 
ATOM   1439  C CA    . HIS A 1 191 ? 223.28997 235.94206 76.22291  1.000 109.19076 ?  191 HIS A CA    1 
ATOM   1440  C C     . HIS A 1 191 ? 224.33880 234.83913 76.38360  1.000 109.71907 ?  191 HIS A C     1 
ATOM   1441  O O     . HIS A 1 191 ? 225.33301 235.03043 77.09171  1.000 113.25200 ?  191 HIS A O     1 
ATOM   1442  C CB    . HIS A 1 191 ? 222.20665 235.81180 77.28853  1.000 108.16018 ?  191 HIS A CB    1 
ATOM   1443  C CG    . HIS A 1 191 ? 222.74118 235.44410 78.63410  1.000 109.72725 ?  191 HIS A CG    1 
ATOM   1444  N ND1   . HIS A 1 191 ? 223.62653 236.24226 79.32891  1.000 103.43216 ?  191 HIS A ND1   1 
ATOM   1445  C CD2   . HIS A 1 191 ? 222.54152 234.34212 79.39615  1.000 106.89248 ?  191 HIS A CD2   1 
ATOM   1446  C CE1   . HIS A 1 191 ? 223.93747 235.65038 80.46965  1.000 105.07889 ?  191 HIS A CE1   1 
ATOM   1447  N NE2   . HIS A 1 191 ? 223.29210 234.49682 80.53419  1.000 105.68515 ?  191 HIS A NE2   1 
ATOM   1448  N N     . LYS A 1 192 ? 224.12018 233.66913 75.76923  1.000 102.56322 ?  192 LYS A N     1 
ATOM   1449  C CA    . LYS A 1 192 ? 225.06504 232.56222 75.90519  1.000 100.41236 ?  192 LYS A CA    1 
ATOM   1450  C C     . LYS A 1 192 ? 226.45651 232.96744 75.43464  1.000 102.09618 ?  192 LYS A C     1 
ATOM   1451  O O     . LYS A 1 192 ? 227.46831 232.51449 75.98791  1.000 101.11545 ?  192 LYS A O     1 
ATOM   1452  C CB    . LYS A 1 192 ? 224.55397 231.36147 75.12427  1.000 96.71854  ?  192 LYS A CB    1 
ATOM   1453  C CG    . LYS A 1 192 ? 223.10399 231.06492 75.41641  1.000 100.88874 ?  192 LYS A CG    1 
ATOM   1454  C CD    . LYS A 1 192 ? 222.87504 230.63441 76.84175  1.000 107.83026 ?  192 LYS A CD    1 
ATOM   1455  C CE    . LYS A 1 192 ? 223.00053 229.10278 76.99666  1.000 107.81807 ?  192 LYS A CE    1 
ATOM   1456  N NZ    . LYS A 1 192 ? 222.17133 228.25769 76.06124  1.000 108.25421 ?  192 LYS A NZ    1 
ATOM   1457  N N     . MET A 1 193 ? 226.52743 233.77973 74.37881  1.000 100.84763 ?  193 MET A N     1 
ATOM   1458  C CA    . MET A 1 193 ? 227.81047 234.30738 73.92714  1.000 106.27142 ?  193 MET A CA    1 
ATOM   1459  C C     . MET A 1 193 ? 228.31040 235.47623 74.76686  1.000 111.52251 ?  193 MET A C     1 
ATOM   1460  O O     . MET A 1 193 ? 229.50909 235.76803 74.72617  1.000 118.06864 ?  193 MET A O     1 
ATOM   1461  C CB    . MET A 1 193 ? 227.73453 234.71092 72.44618  1.000 110.82610 ?  193 MET A CB    1 
ATOM   1462  C CG    . MET A 1 193 ? 228.03514 233.54146 71.47625  1.000 112.42088 ?  193 MET A CG    1 
ATOM   1463  S SD    . MET A 1 193 ? 226.94188 232.08677 71.65450  1.000 119.17062 ?  193 MET A SD    1 
ATOM   1464  C CE    . MET A 1 193 ? 228.02781 230.78120 72.21390  1.000 93.16315  ?  193 MET A CE    1 
ATOM   1465  N N     . CYS A 1 194 ? 227.42080 236.16908 75.48926  1.000 111.65452 ?  194 CYS A N     1 
ATOM   1466  C CA    . CYS A 1 194 ? 227.77510 237.32912 76.30836  1.000 110.59457 ?  194 CYS A CA    1 
ATOM   1467  C C     . CYS A 1 194 ? 227.47271 237.08323 77.80210  1.000 112.14400 ?  194 CYS A C     1 
ATOM   1468  O O     . CYS A 1 194 ? 226.88481 237.93743 78.48043  1.000 113.55543 ?  194 CYS A O     1 
ATOM   1469  C CB    . CYS A 1 194 ? 227.04230 238.55723 75.75293  1.000 112.03756 ?  194 CYS A CB    1 
ATOM   1470  S SG    . CYS A 1 194 ? 227.09103 238.66941 73.91226  1.000 127.52351 ?  194 CYS A SG    1 
ATOM   1471  N N     . ALA A 1 195 ? 227.86396 235.89782 78.30868  1.000 111.78948 ?  195 ALA A N     1 
ATOM   1472  C CA    . ALA A 1 195 ? 227.51314 235.45160 79.66297  1.000 107.33842 ?  195 ALA A CA    1 
ATOM   1473  C C     . ALA A 1 195 ? 228.27674 236.18124 80.76345  1.000 106.86647 ?  195 ALA A C     1 
ATOM   1474  O O     . ALA A 1 195 ? 227.78561 236.26597 81.90032  1.000 106.91915 ?  195 ALA A O     1 
ATOM   1475  C CB    . ALA A 1 195 ? 227.76288 233.95008 79.80177  1.000 103.39989 ?  195 ALA A CB    1 
ATOM   1476  N N     . ASN A 1 196 ? 229.49298 236.64491 80.48715  1.000 102.49641 ?  196 ASN A N     1 
ATOM   1477  C CA    . ASN A 1 196 ? 230.27209 237.34435 81.49601  1.000 101.42328 ?  196 ASN A CA    1 
ATOM   1478  C C     . ASN A 1 196 ? 230.31495 238.84288 81.23254  1.000 98.78563  ?  196 ASN A C     1 
ATOM   1479  O O     . ASN A 1 196 ? 231.26023 239.51798 81.65763  1.000 101.65504 ?  196 ASN A O     1 
ATOM   1480  C CB    . ASN A 1 196 ? 231.67701 236.74607 81.59221  1.000 103.10271 ?  196 ASN A CB    1 
ATOM   1481  C CG    . ASN A 1 196 ? 231.66668 235.25541 81.96358  1.000 103.69438 ?  196 ASN A CG    1 
ATOM   1482  O OD1   . ASN A 1 196 ? 230.61813 234.68712 82.30463  1.000 100.13635 ?  196 ASN A OD1   1 
ATOM   1483  N ND2   . ASN A 1 196 ? 232.82971 234.62049 81.88757  1.000 102.38808 ?  196 ASN A ND2   1 
ATOM   1484  N N     . TRP A 1 197 ? 229.29358 239.38397 80.55361  1.000 95.55786  ?  197 TRP A N     1 
ATOM   1485  C CA    . TRP A 1 197 ? 229.29807 240.81586 80.23943  1.000 99.43349  ?  197 TRP A CA    1 
ATOM   1486  C C     . TRP A 1 197 ? 229.17866 241.69954 81.46446  1.000 96.88659  ?  197 TRP A C     1 
ATOM   1487  O O     . TRP A 1 197 ? 229.56467 242.87420 81.39873  1.000 90.87542  ?  197 TRP A O     1 
ATOM   1488  C CB    . TRP A 1 197 ? 228.18462 241.16265 79.25347  1.000 102.13542 ?  197 TRP A CB    1 
ATOM   1489  C CG    . TRP A 1 197 ? 228.67368 241.05776 77.87091  1.000 104.01926 ?  197 TRP A CG    1 
ATOM   1490  C CD1   . TRP A 1 197 ? 229.50446 240.10538 77.36902  1.000 102.65281 ?  197 TRP A CD1   1 
ATOM   1491  C CD2   . TRP A 1 197 ? 228.44890 241.99522 76.81816  1.000 101.93040 ?  197 TRP A CD2   1 
ATOM   1492  N NE1   . TRP A 1 197 ? 229.77570 240.37018 76.05560  1.000 105.08352 ?  197 TRP A NE1   1 
ATOM   1493  C CE2   . TRP A 1 197 ? 229.14096 241.52833 75.69298  1.000 103.72133 ?  197 TRP A CE2   1 
ATOM   1494  C CE3   . TRP A 1 197 ? 227.71124 243.17962 76.71563  1.000 100.61982 ?  197 TRP A CE3   1 
ATOM   1495  C CZ2   . TRP A 1 197 ? 229.12034 242.20005 74.47428  1.000 104.29871 ?  197 TRP A CZ2   1 
ATOM   1496  C CZ3   . TRP A 1 197 ? 227.69166 243.84778 75.51244  1.000 98.88821  ?  197 TRP A CZ3   1 
ATOM   1497  C CH2   . TRP A 1 197 ? 228.39047 243.35438 74.40518  1.000 102.37921 ?  197 TRP A CH2   1 
ATOM   1498  N N     . SER A 1 198 ? 228.70774 241.14158 82.58581  1.000 97.36368  ?  198 SER A N     1 
ATOM   1499  C CA    . SER A 1 198 ? 228.66184 241.88233 83.83995  1.000 93.63748  ?  198 SER A CA    1 
ATOM   1500  C C     . SER A 1 198 ? 230.05027 242.33869 84.25500  1.000 92.59343  ?  198 SER A C     1 
ATOM   1501  O O     . SER A 1 198 ? 230.18688 243.37386 84.90983  1.000 96.99273  ?  198 SER A O     1 
ATOM   1502  C CB    . SER A 1 198 ? 228.05397 241.01727 84.92981  1.000 92.32864  ?  198 SER A CB    1 
ATOM   1503  O OG    . SER A 1 198 ? 228.57894 239.71202 84.83598  1.000 93.40152  ?  198 SER A OG    1 
ATOM   1504  N N     . THR A 1 199 ? 231.08340 241.55789 83.92140  1.000 86.00742  ?  199 THR A N     1 
ATOM   1505  C CA    . THR A 1 199 ? 232.44573 241.94809 84.27697  1.000 89.44075  ?  199 THR A CA    1 
ATOM   1506  C C     . THR A 1 199 ? 232.87688 243.22241 83.55304  1.000 87.91514  ?  199 THR A C     1 
ATOM   1507  O O     . THR A 1 199 ? 233.73220 243.95706 84.05566  1.000 87.90565  ?  199 THR A O     1 
ATOM   1508  C CB    . THR A 1 199 ? 233.41717 240.79775 84.00503  1.000 91.65557  ?  199 THR A CB    1 
ATOM   1509  O OG1   . THR A 1 199 ? 232.93570 239.62940 84.67839  1.000 92.27733  ?  199 THR A OG1   1 
ATOM   1510  C CG2   . THR A 1 199 ? 234.80999 241.11330 84.59574  1.000 87.73056  ?  199 THR A CG2   1 
ATOM   1511  N N     . ILE A 1 200 ? 232.34081 243.48431 82.36755  1.000 87.05768  ?  200 ILE A N     1 
ATOM   1512  C CA    . ILE A 1 200 ? 232.74013 244.67717 81.62456  1.000 91.47513  ?  200 ILE A CA    1 
ATOM   1513  C C     . ILE A 1 200 ? 232.42038 245.93953 82.42623  1.000 87.53402  ?  200 ILE A C     1 
ATOM   1514  O O     . ILE A 1 200 ? 231.25793 246.14582 82.79804  1.000 85.77487  ?  200 ILE A O     1 
ATOM   1515  C CB    . ILE A 1 200 ? 232.03471 244.73303 80.26889  1.000 91.32463  ?  200 ILE A CB    1 
ATOM   1516  C CG1   . ILE A 1 200 ? 232.31687 243.42353 79.52454  1.000 90.93437  ?  200 ILE A CG1   1 
ATOM   1517  C CG2   . ILE A 1 200 ? 232.54335 245.98686 79.54057  1.000 82.49893  ?  200 ILE A CG2   1 
ATOM   1518  C CD1   . ILE A 1 200 ? 231.43402 243.13565 78.35293  1.000 93.76208  ?  200 ILE A CD1   1 
ATOM   1519  N N     . PRO A 1 201 ? 233.39943 246.81019 82.70246  1.000 85.57721  ?  201 PRO A N     1 
ATOM   1520  C CA    . PRO A 1 201 ? 233.13147 247.96973 83.57240  1.000 90.27223  ?  201 PRO A CA    1 
ATOM   1521  C C     . PRO A 1 201 ? 232.22681 249.02520 82.97714  1.000 94.21453  ?  201 PRO A C     1 
ATOM   1522  O O     . PRO A 1 201 ? 231.37724 249.57156 83.69170  1.000 97.60327  ?  201 PRO A O     1 
ATOM   1523  C CB    . PRO A 1 201 ? 234.53114 248.54246 83.82935  1.000 89.47110  ?  201 PRO A CB    1 
ATOM   1524  C CG    . PRO A 1 201 ? 235.42546 247.42248 83.61931  1.000 93.97660  ?  201 PRO A CG    1 
ATOM   1525  C CD    . PRO A 1 201 ? 234.83621 246.66192 82.46499  1.000 93.99388  ?  201 PRO A CD    1 
ATOM   1526  N N     . ASN A 1 202 ? 232.43797 249.41802 81.72656  1.000 91.33332  ?  202 ASN A N     1 
ATOM   1527  C CA    . ASN A 1 202 ? 231.59314 250.47313 81.17838  1.000 96.27387  ?  202 ASN A CA    1 
ATOM   1528  C C     . ASN A 1 202 ? 230.16029 249.99567 81.00654  1.000 96.91250  ?  202 ASN A C     1 
ATOM   1529  O O     . ASN A 1 202 ? 229.21773 250.77633 81.18200  1.000 99.01777  ?  202 ASN A O     1 
ATOM   1530  C CB    . ASN A 1 202 ? 232.18046 250.97365 79.87666  1.000 104.92923 ?  202 ASN A CB    1 
ATOM   1531  C CG    . ASN A 1 202 ? 233.46839 251.63570 80.09455  1.000 105.44082 ?  202 ASN A CG    1 
ATOM   1532  O OD1   . ASN A 1 202 ? 233.86826 251.82091 81.24284  1.000 97.94602  ?  202 ASN A OD1   1 
ATOM   1533  N ND2   . ASN A 1 202 ? 234.18384 251.92139 79.02348  1.000 112.81309 ?  202 ASN A ND2   1 
ATOM   1534  N N     . PHE A 1 203 ? 229.97531 248.72688 80.63237  1.000 92.22826  ?  203 PHE A N     1 
ATOM   1535  C CA    . PHE A 1 203 ? 228.61990 248.21478 80.50729  1.000 88.48477  ?  203 PHE A CA    1 
ATOM   1536  C C     . PHE A 1 203 ? 227.90545 248.26706 81.85434  1.000 93.86882  ?  203 PHE A C     1 
ATOM   1537  O O     . PHE A 1 203 ? 226.79885 248.81054 81.94351  1.000 104.27662 ?  203 PHE A O     1 
ATOM   1538  C CB    . PHE A 1 203 ? 228.64631 246.79987 79.92403  1.000 88.27771  ?  203 PHE A CB    1 
ATOM   1539  C CG    . PHE A 1 203 ? 227.28018 246.19988 79.69821  1.000 89.01030  ?  203 PHE A CG    1 
ATOM   1540  C CD1   . PHE A 1 203 ? 226.24653 246.94295 79.13169  1.000 85.09271  ?  203 PHE A CD1   1 
ATOM   1541  C CD2   . PHE A 1 203 ? 227.03355 244.87473 80.04814  1.000 90.91597  ?  203 PHE A CD2   1 
ATOM   1542  C CE1   . PHE A 1 203 ? 224.97719 246.37091 78.95154  1.000 87.67054  ?  203 PHE A CE1   1 
ATOM   1543  C CE2   . PHE A 1 203 ? 225.76584 244.29371 79.85824  1.000 87.47755  ?  203 PHE A CE2   1 
ATOM   1544  C CZ    . PHE A 1 203 ? 224.74397 245.03947 79.31689  1.000 87.25044  ?  203 PHE A CZ    1 
ATOM   1545  N N     . ARG A 1 204 ? 228.56283 247.81102 82.93231  1.000 93.31402  ?  204 ARG A N     1 
ATOM   1546  C CA    . ARG A 1 204 ? 227.96573 247.91355 84.26885  1.000 94.32920  ?  204 ARG A CA    1 
ATOM   1547  C C     . ARG A 1 204 ? 227.71211 249.36939 84.64803  1.000 91.42685  ?  204 ARG A C     1 
ATOM   1548  O O     . ARG A 1 204 ? 226.66394 249.69719 85.21590  1.000 95.48916  ?  204 ARG A O     1 
ATOM   1549  C CB    . ARG A 1 204 ? 228.86785 247.25688 85.31183  1.000 93.51273  ?  204 ARG A CB    1 
ATOM   1550  C CG    . ARG A 1 204 ? 228.26368 247.07263 86.68938  1.000 90.02182  ?  204 ARG A CG    1 
ATOM   1551  C CD    . ARG A 1 204 ? 229.39002 246.77514 87.65713  1.000 94.91478  ?  204 ARG A CD    1 
ATOM   1552  N NE    . ARG A 1 204 ? 229.07280 245.71381 88.60999  1.000 106.33453 ?  204 ARG A NE    1 
ATOM   1553  C CZ    . ARG A 1 204 ? 229.41058 245.73019 89.89422  1.000 100.14095 ?  204 ARG A CZ    1 
ATOM   1554  N NH1   . ARG A 1 204 ? 230.06688 246.75230 90.41978  1.000 95.23965  ?  204 ARG A NH1   1 
ATOM   1555  N NH2   . ARG A 1 204 ? 229.11507 244.67929 90.66087  1.000 91.76202  ?  204 ARG A NH2   1 
ATOM   1556  N N     . PHE A 1 205 ? 228.65822 250.25771 84.33663  1.000 85.32921  ?  205 PHE A N     1 
ATOM   1557  C CA    . PHE A 1 205 ? 228.47877 251.66950 84.65644  1.000 85.86357  ?  205 PHE A CA    1 
ATOM   1558  C C     . PHE A 1 205 ? 227.22668 252.21487 83.98460  1.000 87.56461  ?  205 PHE A C     1 
ATOM   1559  O O     . PHE A 1 205 ? 226.43164 252.92551 84.60789  1.000 87.32841  ?  205 PHE A O     1 
ATOM   1560  C CB    . PHE A 1 205 ? 229.70205 252.46960 84.21013  1.000 85.27719  ?  205 PHE A CB    1 
ATOM   1561  C CG    . PHE A 1 205 ? 229.61286 253.93214 84.49808  1.000 83.84710  ?  205 PHE A CG    1 
ATOM   1562  C CD1   . PHE A 1 205 ? 229.02101 254.80112 83.60001  1.000 84.09555  ?  205 PHE A CD1   1 
ATOM   1563  C CD2   . PHE A 1 205 ? 230.19566 254.45449 85.64040  1.000 89.77124  ?  205 PHE A CD2   1 
ATOM   1564  C CE1   . PHE A 1 205 ? 228.95663 256.16814 83.87092  1.000 85.37230  ?  205 PHE A CE1   1 
ATOM   1565  C CE2   . PHE A 1 205 ? 230.14447 255.81550 85.90901  1.000 98.66581  ?  205 PHE A CE2   1 
ATOM   1566  C CZ    . PHE A 1 205 ? 229.52491 256.67545 85.01058  1.000 87.87327  ?  205 PHE A CZ    1 
ATOM   1567  N N     . LEU A 1 206 ? 227.03097 251.89331 82.70422  1.000 95.40550  ?  206 LEU A N     1 
ATOM   1568  C CA    . LEU A 1 206 ? 225.85977 252.41125 82.00342  1.000 95.53920  ?  206 LEU A CA    1 
ATOM   1569  C C     . LEU A 1 206 ? 224.56846 251.84305 82.58211  1.000 93.16071  ?  206 LEU A C     1 
ATOM   1570  O O     . LEU A 1 206 ? 223.60146 252.58723 82.77651  1.000 94.87516  ?  206 LEU A O     1 
ATOM   1571  C CB    . LEU A 1 206 ? 225.98371 252.13809 80.50594  1.000 89.69544  ?  206 LEU A CB    1 
ATOM   1572  C CG    . LEU A 1 206 ? 227.17104 252.89513 79.89196  1.000 90.46009  ?  206 LEU A CG    1 
ATOM   1573  C CD1   . LEU A 1 206 ? 227.48783 252.31536 78.54533  1.000 98.68282  ?  206 LEU A CD1   1 
ATOM   1574  C CD2   . LEU A 1 206 ? 226.96815 254.42234 79.79729  1.000 91.41126  ?  206 LEU A CD2   1 
ATOM   1575  N N     . ALA A 1 207 ? 224.55422 250.55084 82.92732  1.000 90.51098  ?  207 ALA A N     1 
ATOM   1576  C CA    . ALA A 1 207 ? 223.36583 249.97217 83.55149  1.000 91.20197  ?  207 ALA A CA    1 
ATOM   1577  C C     . ALA A 1 207 ? 223.04676 250.68714 84.85612  1.000 88.25994  ?  207 ALA A C     1 
ATOM   1578  O O     . ALA A 1 207 ? 221.87922 250.96712 85.16715  1.000 88.22937  ?  207 ALA A O     1 
ATOM   1579  C CB    . ALA A 1 207 ? 223.56823 248.48218 83.82558  1.000 87.44224  ?  207 ALA A CB    1 
ATOM   1580  N N     . GLY A 1 208 ? 224.07458 250.96987 85.64301  1.000 88.11984  ?  208 GLY A N     1 
ATOM   1581  C CA    . GLY A 1 208 ? 223.85971 251.71118 86.86468  1.000 92.60198  ?  208 GLY A CA    1 
ATOM   1582  C C     . GLY A 1 208 ? 223.35729 253.11224 86.59402  1.000 92.91113  ?  208 GLY A C     1 
ATOM   1583  O O     . GLY A 1 208 ? 222.46959 253.60577 87.29217  1.000 95.40017  ?  208 GLY A O     1 
ATOM   1584  N N     . THR A 1 209 ? 223.90983 253.77514 85.57223  1.000 88.66174  ?  209 THR A N     1 
ATOM   1585  C CA    . THR A 1 209 ? 223.46542 255.13670 85.29802  1.000 89.64152  ?  209 THR A CA    1 
ATOM   1586  C C     . THR A 1 209 ? 221.99332 255.12672 84.90662  1.000 87.72938  ?  209 THR A C     1 
ATOM   1587  O O     . THR A 1 209 ? 221.22251 256.00703 85.31449  1.000 86.54988  ?  209 THR A O     1 
ATOM   1588  C CB    . THR A 1 209 ? 224.31085 255.81842 84.21773  1.000 87.09566  ?  209 THR A CB    1 
ATOM   1589  O OG1   . THR A 1 209 ? 225.70025 255.63813 84.50543  1.000 88.45940  ?  209 THR A OG1   1 
ATOM   1590  C CG2   . THR A 1 209 ? 224.06820 257.34724 84.32295  1.000 84.02354  ?  209 THR A CG2   1 
ATOM   1591  N N     . TYR A 1 210 ? 221.59024 254.14772 84.08494  1.000 87.06460  ?  210 TYR A N     1 
ATOM   1592  C CA    . TYR A 1 210 ? 220.19078 254.08320 83.67337  1.000 93.03389  ?  210 TYR A CA    1 
ATOM   1593  C C     . TYR A 1 210 ? 219.29294 253.80998 84.87312  1.000 91.63101  ?  210 TYR A C     1 
ATOM   1594  O O     . TYR A 1 210 ? 218.27617 254.48978 85.06503  1.000 93.53284  ?  210 TYR A O     1 
ATOM   1595  C CB    . TYR A 1 210 ? 219.98854 253.04054 82.54803  1.000 99.95058  ?  210 TYR A CB    1 
ATOM   1596  C CG    . TYR A 1 210 ? 220.14721 253.68397 81.17154  1.000 99.44584  ?  210 TYR A CG    1 
ATOM   1597  C CD1   . TYR A 1 210 ? 219.16098 254.51520 80.64682  1.000 99.17220  ?  210 TYR A CD1   1 
ATOM   1598  C CD2   . TYR A 1 210 ? 221.28873 253.46846 80.41332  1.000 99.12832  ?  210 TYR A CD2   1 
ATOM   1599  C CE1   . TYR A 1 210 ? 219.33034 255.14199 79.42785  1.000 102.77777 ?  210 TYR A CE1   1 
ATOM   1600  C CE2   . TYR A 1 210 ? 221.45320 254.07677 79.18680  1.000 104.27874 ?  210 TYR A CE2   1 
ATOM   1601  C CZ    . TYR A 1 210 ? 220.47719 254.90664 78.69919  1.000 103.55119 ?  210 TYR A CZ    1 
ATOM   1602  O OH    . TYR A 1 210 ? 220.66199 255.49331 77.47344  1.000 101.87926 ?  210 TYR A OH    1 
ATOM   1603  N N     . ASP A 1 211 ? 219.69996 252.87719 85.73525  1.000 90.71870  ?  211 ASP A N     1 
ATOM   1604  C CA    . ASP A 1 211 ? 218.89315 252.53320 86.90068  1.000 91.57731  ?  211 ASP A CA    1 
ATOM   1605  C C     . ASP A 1 211 ? 218.73058 253.70217 87.86623  1.000 89.07926  ?  211 ASP A C     1 
ATOM   1606  O O     . ASP A 1 211 ? 217.64940 253.89750 88.43541  1.000 89.67296  ?  211 ASP A O     1 
ATOM   1607  C CB    . ASP A 1 211 ? 219.50549 251.34906 87.61471  1.000 88.01419  ?  211 ASP A CB    1 
ATOM   1608  C CG    . ASP A 1 211 ? 218.50114 250.63301 88.40588  1.000 88.86461  ?  211 ASP A CG    1 
ATOM   1609  O OD1   . ASP A 1 211 ? 217.52022 250.21626 87.76298  1.000 90.44296  ?  211 ASP A OD1   1 
ATOM   1610  O OD2   . ASP A 1 211 ? 218.68090 250.49289 89.63529  1.000 89.65208  ?  211 ASP A OD2   1 
ATOM   1611  N N     . MET A 1 212 ? 219.80629 254.44011 88.12476  1.000 83.27763  ?  212 MET A N     1 
ATOM   1612  C CA    . MET A 1 212 ? 219.68098 255.62056 88.96637  1.000 88.86449  ?  212 MET A CA    1 
ATOM   1613  C C     . MET A 1 212 ? 218.76357 256.65353 88.33711  1.000 90.73625  ?  212 MET A C     1 
ATOM   1614  O O     . MET A 1 212 ? 217.96020 257.27911 89.03740  1.000 94.86208  ?  212 MET A O     1 
ATOM   1615  C CB    . MET A 1 212 ? 221.04688 256.23164 89.26037  1.000 90.87070  ?  212 MET A CB    1 
ATOM   1616  C CG    . MET A 1 212 ? 221.01375 257.32469 90.31324  1.000 88.51312  ?  212 MET A CG    1 
ATOM   1617  S SD    . MET A 1 212 ? 222.68771 257.83958 90.68535  1.000 91.04923  ?  212 MET A SD    1 
ATOM   1618  C CE    . MET A 1 212 ? 222.36910 259.43307 91.41452  1.000 94.41087  ?  212 MET A CE    1 
ATOM   1619  N N     . PHE A 1 213 ? 218.89272 256.88231 87.03048  1.000 91.61952  ?  213 PHE A N     1 
ATOM   1620  C CA    . PHE A 1 213 ? 218.03203 257.87571 86.39310  1.000 99.12262  ?  213 PHE A CA    1 
ATOM   1621  C C     . PHE A 1 213 ? 216.57004 257.48027 86.53020  1.000 98.47420  ?  213 PHE A C     1 
ATOM   1622  O O     . PHE A 1 213 ? 215.75023 258.26060 87.02234  1.000 100.85777 ?  213 PHE A O     1 
ATOM   1623  C CB    . PHE A 1 213 ? 218.40379 258.04776 84.90424  1.000 105.96366 ?  213 PHE A CB    1 
ATOM   1624  C CG    . PHE A 1 213 ? 217.42748 258.92459 84.08870  1.000 106.52024 ?  213 PHE A CG    1 
ATOM   1625  C CD1   . PHE A 1 213 ? 217.48048 260.31762 84.13024  1.000 102.90524 ?  213 PHE A CD1   1 
ATOM   1626  C CD2   . PHE A 1 213 ? 216.45959 258.32693 83.26925  1.000 106.64857 ?  213 PHE A CD2   1 
ATOM   1627  C CE1   . PHE A 1 213 ? 216.57664 261.09877 83.36836  1.000 108.05346 ?  213 PHE A CE1   1 
ATOM   1628  C CE2   . PHE A 1 213 ? 215.56558 259.09408 82.51662  1.000 108.45234 ?  213 PHE A CE2   1 
ATOM   1629  C CZ    . PHE A 1 213 ? 215.62361 260.47919 82.56504  1.000 112.80911 ?  213 PHE A CZ    1 
ATOM   1630  N N     . PHE A 1 214 ? 216.23398 256.24657 86.16597  1.000 95.92977  ?  214 PHE A N     1 
ATOM   1631  C CA    . PHE A 1 214 ? 214.83177 255.86491 86.21616  1.000 99.62661  ?  214 PHE A CA    1 
ATOM   1632  C C     . PHE A 1 214 ? 214.31377 255.76999 87.64457  1.000 104.52358 ?  214 PHE A C     1 
ATOM   1633  O O     . PHE A 1 214 ? 213.09811 255.82613 87.85232  1.000 109.23956 ?  214 PHE A O     1 
ATOM   1634  C CB    . PHE A 1 214 ? 214.59126 254.59086 85.42078  1.000 93.86881  ?  214 PHE A CB    1 
ATOM   1635  C CG    . PHE A 1 214 ? 214.65423 254.82248 83.95601  1.000 102.54607 ?  214 PHE A CG    1 
ATOM   1636  C CD1   . PHE A 1 214 ? 213.89943 255.83426 83.38784  1.000 103.81684 ?  214 PHE A CD1   1 
ATOM   1637  C CD2   . PHE A 1 214 ? 215.43910 254.03431 83.13208  1.000 107.77401 ?  214 PHE A CD2   1 
ATOM   1638  C CE1   . PHE A 1 214 ? 213.94664 256.08016 82.03747  1.000 104.19658 ?  214 PHE A CE1   1 
ATOM   1639  C CE2   . PHE A 1 214 ? 215.48415 254.26448 81.76766  1.000 103.18385 ?  214 PHE A CE2   1 
ATOM   1640  C CZ    . PHE A 1 214 ? 214.73406 255.28952 81.22223  1.000 104.74923 ?  214 PHE A CZ    1 
ATOM   1641  N N     . SER A 1 215 ? 215.20164 255.58442 88.62139  1.000 101.81592 ?  215 SER A N     1 
ATOM   1642  C CA    . SER A 1 215 ? 214.77229 255.51840 90.01186  1.000 102.96857 ?  215 SER A CA    1 
ATOM   1643  C C     . SER A 1 215 ? 214.16630 256.84313 90.47144  1.000 105.60016 ?  215 SER A C     1 
ATOM   1644  O O     . SER A 1 215 ? 213.08984 256.86502 91.07852  1.000 107.38335 ?  215 SER A O     1 
ATOM   1645  C CB    . SER A 1 215 ? 215.96911 255.14224 90.87060  1.000 105.16049 ?  215 SER A CB    1 
ATOM   1646  O OG    . SER A 1 215 ? 216.46123 253.89966 90.41216  1.000 106.66724 ?  215 SER A OG    1 
ATOM   1647  N N     . ARG A 1 216 ? 214.85629 257.96525 90.19920  1.000 106.33720 ?  216 ARG A N     1 
ATOM   1648  C CA    . ARG A 1 216 ? 214.34317 259.29212 90.55990  1.000 104.38353 ?  216 ARG A CA    1 
ATOM   1649  C C     . ARG A 1 216 ? 213.28296 259.81714 89.61342  1.000 105.30637 ?  216 ARG A C     1 
ATOM   1650  O O     . ARG A 1 216 ? 212.29032 260.39598 90.07015  1.000 110.01286 ?  216 ARG A O     1 
ATOM   1651  C CB    . ARG A 1 216 ? 215.44405 260.34590 90.64730  1.000 99.01924  ?  216 ARG A CB    1 
ATOM   1652  C CG    . ARG A 1 216 ? 214.92226 261.64449 91.34017  1.000 100.60742 ?  216 ARG A CG    1 
ATOM   1653  C CD    . ARG A 1 216 ? 214.08116 261.31965 92.63019  1.000 108.32612 ?  216 ARG A CD    1 
ATOM   1654  N NE    . ARG A 1 216 ? 213.68302 262.45230 93.47752  1.000 115.84567 ?  216 ARG A NE    1 
ATOM   1655  C CZ    . ARG A 1 216 ? 212.70190 262.44644 94.38296  1.000 111.54382 ?  216 ARG A CZ    1 
ATOM   1656  N NH1   . ARG A 1 216 ? 211.93013 261.38500 94.57214  1.000 112.65712 ?  216 ARG A NH1   1 
ATOM   1657  N NH2   . ARG A 1 216 ? 212.53656 263.51001 95.16847  1.000 101.25134 ?  216 ARG A NH2   1 
ATOM   1658  N N     . ILE A 1 217 ? 213.47408 259.66231 88.30687  1.000 101.70541 ?  217 ILE A N     1 
ATOM   1659  C CA    . ILE A 1 217 ? 212.61460 260.30739 87.32065  1.000 103.24446 ?  217 ILE A CA    1 
ATOM   1660  C C     . ILE A 1 217 ? 211.68557 259.25684 86.75587  1.000 109.79669 ?  217 ILE A C     1 
ATOM   1661  O O     . ILE A 1 217 ? 212.13619 258.24585 86.19894  1.000 110.92570 ?  217 ILE A O     1 
ATOM   1662  C CB    . ILE A 1 217 ? 213.42294 260.95485 86.18426  1.000 102.48410 ?  217 ILE A CB    1 
ATOM   1663  C CG1   . ILE A 1 217 ? 214.51931 261.86850 86.73940  1.000 108.91699 ?  217 ILE A CG1   1 
ATOM   1664  C CG2   . ILE A 1 217 ? 212.48250 261.65435 85.19325  1.000 95.79678  ?  217 ILE A CG2   1 
ATOM   1665  C CD1   . ILE A 1 217 ? 214.01965 262.96750 87.62638  1.000 114.11751 ?  217 ILE A CD1   1 
ATOM   1666  N N     . GLU A 1 218 ? 210.39054 259.48189 86.91468  1.000 109.28044 ?  218 GLU A N     1 
ATOM   1667  C CA    . GLU A 1 218 ? 209.43592 258.60692 86.26661  1.000 113.13680 ?  218 GLU A CA    1 
ATOM   1668  C C     . GLU A 1 218 ? 209.44409 258.96608 84.78344  1.000 108.87380 ?  218 GLU A C     1 
ATOM   1669  O O     . GLU A 1 218 ? 209.59484 260.13735 84.41653  1.000 100.86434 ?  218 GLU A O     1 
ATOM   1670  C CB    . GLU A 1 218 ? 208.04754 258.72930 86.90613  1.000 115.01669 ?  218 GLU A CB    1 
ATOM   1671  C CG    . GLU A 1 218 ? 206.96023 257.87002 86.23836  1.000 119.13130 ?  218 GLU A CG    1 
ATOM   1672  C CD    . GLU A 1 218 ? 207.35361 256.38522 86.10332  1.000 115.63952 ?  218 GLU A CD    1 
ATOM   1673  O OE1   . GLU A 1 218 ? 207.84595 255.80349 87.09776  1.000 121.87820 ?  218 GLU A OE1   1 
ATOM   1674  O OE2   . GLU A 1 218 ? 207.16047 255.79497 85.01297  1.000 98.90246  ?  218 GLU A OE2   1 
ATOM   1675  N N     . HIS A 1 219 ? 209.43319 257.94346 83.94059  1.000 109.02387 ?  219 HIS A N     1 
ATOM   1676  C CA    . HIS A 1 219 ? 209.49631 258.13620 82.50641  1.000 109.41891 ?  219 HIS A CA    1 
ATOM   1677  C C     . HIS A 1 219 ? 208.57813 257.10378 81.86716  1.000 106.01185 ?  219 HIS A C     1 
ATOM   1678  O O     . HIS A 1 219 ? 208.17515 256.12132 82.49949  1.000 105.70284 ?  219 HIS A O     1 
ATOM   1679  C CB    . HIS A 1 219 ? 210.93726 258.00337 81.98905  1.000 112.55631 ?  219 HIS A CB    1 
ATOM   1680  C CG    . HIS A 1 219 ? 211.16991 258.57390 80.62023  1.000 110.65100 ?  219 HIS A CG    1 
ATOM   1681  N ND1   . HIS A 1 219 ? 211.07121 257.81130 79.47086  1.000 105.02127 ?  219 HIS A ND1   1 
ATOM   1682  C CD2   . HIS A 1 219 ? 211.59891 259.79896 80.22702  1.000 107.97247 ?  219 HIS A CD2   1 
ATOM   1683  C CE1   . HIS A 1 219 ? 211.37562 258.55927 78.42596  1.000 107.11611 ?  219 HIS A CE1   1 
ATOM   1684  N NE2   . HIS A 1 219 ? 211.70152 259.76745 78.85699  1.000 111.05271 ?  219 HIS A NE2   1 
ATOM   1685  N N     . LEU A 1 220 ? 208.22607 257.35116 80.60883  1.000 102.19401 ?  220 LEU A N     1 
ATOM   1686  C CA    . LEU A 1 220 ? 207.40948 256.39188 79.88285  1.000 104.09904 ?  220 LEU A CA    1 
ATOM   1687  C C     . LEU A 1 220 ? 208.11478 255.05778 79.77603  1.000 104.39636 ?  220 LEU A C     1 
ATOM   1688  O O     . LEU A 1 220 ? 207.49029 253.99112 79.88321  1.000 99.89300  ?  220 LEU A O     1 
ATOM   1689  C CB    . LEU A 1 220 ? 207.09161 256.94976 78.50220  1.000 106.59632 ?  220 LEU A CB    1 
ATOM   1690  C CG    . LEU A 1 220 ? 206.14342 256.08143 77.69780  1.000 109.93074 ?  220 LEU A CG    1 
ATOM   1691  C CD1   . LEU A 1 220 ? 204.80538 256.00722 78.41706  1.000 113.84404 ?  220 LEU A CD1   1 
ATOM   1692  C CD2   . LEU A 1 220 ? 205.99036 256.68517 76.31615  1.000 105.86352 ?  220 LEU A CD2   1 
ATOM   1693  N N     . TYR A 1 221 ? 209.43371 255.11469 79.62758  1.000 105.86326 ?  221 TYR A N     1 
ATOM   1694  C CA    . TYR A 1 221 ? 210.28468 253.95016 79.46248  1.000 108.40330 ?  221 TYR A CA    1 
ATOM   1695  C C     . TYR A 1 221 ? 210.95682 253.54337 80.77739  1.000 105.06491 ?  221 TYR A C     1 
ATOM   1696  O O     . TYR A 1 221 ? 212.06168 252.98923 80.77383  1.000 103.10149 ?  221 TYR A O     1 
ATOM   1697  C CB    . TYR A 1 221 ? 211.30697 254.26926 78.36172  1.000 110.94164 ?  221 TYR A CB    1 
ATOM   1698  C CG    . TYR A 1 221 ? 210.66520 254.65688 77.02202  1.000 106.40509 ?  221 TYR A CG    1 
ATOM   1699  C CD1   . TYR A 1 221 ? 209.80382 253.77557 76.36583  1.000 104.96797 ?  221 TYR A CD1   1 
ATOM   1700  C CD2   . TYR A 1 221 ? 210.85338 255.92227 76.46370  1.000 99.73876  ?  221 TYR A CD2   1 
ATOM   1701  C CE1   . TYR A 1 221 ? 209.20070 254.11523 75.15662  1.000 104.53686 ?  221 TYR A CE1   1 
ATOM   1702  C CE2   . TYR A 1 221 ? 210.24451 256.27522 75.25692  1.000 99.66309  ?  221 TYR A CE2   1 
ATOM   1703  C CZ    . TYR A 1 221 ? 209.41708 255.35934 74.60602  1.000 105.80839 ?  221 TYR A CZ    1 
ATOM   1704  O OH    . TYR A 1 221 ? 208.79696 255.67967 73.42067  1.000 100.38427 ?  221 TYR A OH    1 
ATOM   1705  N N     . SER A 1 222 ? 210.30221 253.79541 81.91417  1.000 106.03938 ?  222 SER A N     1 
ATOM   1706  C CA    . SER A 1 222 ? 210.89146 253.38485 83.17870  1.000 103.50776 ?  222 SER A CA    1 
ATOM   1707  C C     . SER A 1 222 ? 210.99922 251.87061 83.26540  1.000 100.45992 ?  222 SER A C     1 
ATOM   1708  O O     . SER A 1 222 ? 211.71740 251.37395 84.13105  1.000 103.30681 ?  222 SER A O     1 
ATOM   1709  C CB    . SER A 1 222 ? 210.09561 253.93804 84.37574  1.000 102.78821 ?  222 SER A CB    1 
ATOM   1710  O OG    . SER A 1 222 ? 208.72891 253.54157 84.34221  1.000 99.46916  ?  222 SER A OG    1 
ATOM   1711  N N     . ALA A 1 223 ? 210.30434 251.12650 82.39193  1.000 94.95231  ?  223 ALA A N     1 
ATOM   1712  C CA    . ALA A 1 223 ? 210.34983 249.66462 82.40589  1.000 87.45993  ?  223 ALA A CA    1 
ATOM   1713  C C     . ALA A 1 223 ? 211.72100 249.10026 82.04188  1.000 88.01642  ?  223 ALA A C     1 
ATOM   1714  O O     . ALA A 1 223 ? 211.95568 247.90446 82.26782  1.000 81.74103  ?  223 ALA A O     1 
ATOM   1715  C CB    . ALA A 1 223 ? 209.27633 249.10453 81.47825  1.000 84.41139  ?  223 ALA A CB    1 
ATOM   1716  N N     . ILE A 1 224 ? 212.62510 249.93577 81.51228  1.000 93.83478  ?  224 ILE A N     1 
ATOM   1717  C CA    . ILE A 1 224 ? 213.99877 249.53768 81.21033  1.000 93.53238  ?  224 ILE A CA    1 
ATOM   1718  C C     . ILE A 1 224 ? 214.71277 249.04657 82.45100  1.000 93.12154  ?  224 ILE A C     1 
ATOM   1719  O O     . ILE A 1 224 ? 215.58171 248.16754 82.36009  1.000 92.65973  ?  224 ILE A O     1 
ATOM   1720  C CB    . ILE A 1 224 ? 214.73459 250.73796 80.55083  1.000 90.98690  ?  224 ILE A CB    1 
ATOM   1721  C CG1   . ILE A 1 224 ? 214.15303 250.96941 79.14055  1.000 97.20588  ?  224 ILE A CG1   1 
ATOM   1722  C CG2   . ILE A 1 224 ? 216.26946 250.61520 80.64784  1.000 83.77957  ?  224 ILE A CG2   1 
ATOM   1723  C CD1   . ILE A 1 224 ? 214.80209 252.06652 78.30557  1.000 101.37659 ?  224 ILE A CD1   1 
ATOM   1724  N N     . ARG A 1 225 ? 214.25947 249.48900 83.62885  1.000 94.35946  ?  225 ARG A N     1 
ATOM   1725  C CA    . ARG A 1 225 ? 214.90131 249.12486 84.88603  1.000 86.95847  ?  225 ARG A CA    1 
ATOM   1726  C C     . ARG A 1 225 ? 214.90889 247.62273 85.11527  1.000 83.44512  ?  225 ARG A C     1 
ATOM   1727  O O     . ARG A 1 225 ? 215.71952 247.14866 85.90270  1.000 85.12029  ?  225 ARG A O     1 
ATOM   1728  C CB    . ARG A 1 225 ? 214.18860 249.81795 86.04840  1.000 88.27275  ?  225 ARG A CB    1 
ATOM   1729  C CG    . ARG A 1 225 ? 214.62862 251.25976 86.28995  1.000 93.56908  ?  225 ARG A CG    1 
ATOM   1730  C CD    . ARG A 1 225 ? 214.19869 251.74047 87.65793  1.000 98.88102  ?  225 ARG A CD    1 
ATOM   1731  N NE    . ARG A 1 225 ? 214.86159 250.94119 88.68225  1.000 99.84836  ?  225 ARG A NE    1 
ATOM   1732  C CZ    . ARG A 1 225 ? 214.67093 251.09757 89.97993  1.000 98.62483  ?  225 ARG A CZ    1 
ATOM   1733  N NH1   . ARG A 1 225 ? 213.85875 252.03551 90.44339  1.000 101.43437 ?  225 ARG A NH1   1 
ATOM   1734  N NH2   . ARG A 1 225 ? 215.27884 250.27227 90.82727  1.000 96.11066  ?  225 ARG A NH2   1 
ATOM   1735  N N     . VAL A 1 226 ? 214.04667 246.85867 84.43800  1.000 82.05886  ?  226 VAL A N     1 
ATOM   1736  C CA    . VAL A 1 226 ? 214.00009 245.41376 84.66715  1.000 82.01839  ?  226 VAL A CA    1 
ATOM   1737  C C     . VAL A 1 226 ? 215.35814 244.77948 84.37909  1.000 84.19631  ?  226 VAL A C     1 
ATOM   1738  O O     . VAL A 1 226 ? 215.73396 243.75882 84.98642  1.000 74.46877  ?  226 VAL A O     1 
ATOM   1739  C CB    . VAL A 1 226 ? 212.88348 244.78810 83.80833  1.000 81.89876  ?  226 VAL A CB    1 
ATOM   1740  C CG1   . VAL A 1 226 ? 213.15017 245.08033 82.39540  1.000 84.69790  ?  226 VAL A CG1   1 
ATOM   1741  C CG2   . VAL A 1 226 ? 212.79077 243.26545 83.99860  1.000 80.56200  ?  226 VAL A CG2   1 
ATOM   1742  N N     . GLY A 1 227 ? 216.09490 245.33894 83.41316  1.000 89.80733  ?  227 GLY A N     1 
ATOM   1743  C CA    . GLY A 1 227 ? 217.46602 244.90700 83.21092  1.000 91.41350  ?  227 GLY A CA    1 
ATOM   1744  C C     . GLY A 1 227 ? 218.41562 245.38401 84.29843  1.000 85.04371  ?  227 GLY A C     1 
ATOM   1745  O O     . GLY A 1 227 ? 219.24258 244.60899 84.79078  1.000 89.74750  ?  227 GLY A O     1 
ATOM   1746  N N     . THR A 1 228 ? 218.28352 246.65017 84.71481  1.000 72.89420  ?  228 THR A N     1 
ATOM   1747  C CA    . THR A 1 228 ? 219.25832 247.31034 85.58091  1.000 80.96057  ?  228 THR A CA    1 
ATOM   1748  C C     . THR A 1 228 ? 218.90503 247.33837 87.05968  1.000 87.53557  ?  228 THR A C     1 
ATOM   1749  O O     . THR A 1 228 ? 219.65479 247.93030 87.84504  1.000 86.36524  ?  228 THR A O     1 
ATOM   1750  C CB    . THR A 1 228 ? 219.48086 248.74681 85.13607  1.000 86.13992  ?  228 THR A CB    1 
ATOM   1751  O OG1   . THR A 1 228 ? 218.28124 249.50636 85.34753  1.000 86.79980  ?  228 THR A OG1   1 
ATOM   1752  C CG2   . THR A 1 228 ? 219.80674 248.74776 83.69067  1.000 89.30909  ?  228 THR A CG2   1 
ATOM   1753  N N     . VAL A 1 229 ? 217.78612 246.74904 87.46367  1.000 89.16280  ?  229 VAL A N     1 
ATOM   1754  C CA    . VAL A 1 229 ? 217.38897 246.86910 88.85487  1.000 79.74424  ?  229 VAL A CA    1 
ATOM   1755  C C     . VAL A 1 229 ? 218.46686 246.30934 89.75590  1.000 82.64249  ?  229 VAL A C     1 
ATOM   1756  O O     . VAL A 1 229 ? 218.70270 246.84860 90.84317  1.000 85.73172  ?  229 VAL A O     1 
ATOM   1757  C CB    . VAL A 1 229 ? 216.02745 246.18316 89.04985  1.000 78.29030  ?  229 VAL A CB    1 
ATOM   1758  C CG1   . VAL A 1 229 ? 216.14792 244.65801 88.92604  1.000 84.92786  ?  229 VAL A CG1   1 
ATOM   1759  C CG2   . VAL A 1 229 ? 215.42605 246.58538 90.33008  1.000 88.69940  ?  229 VAL A CG2   1 
ATOM   1760  N N     . VAL A 1 230 ? 219.21464 245.30018 89.27750  1.000 82.91813  ?  230 VAL A N     1 
ATOM   1761  C CA    . VAL A 1 230 ? 220.21545 244.61345 90.10195  1.000 85.81524  ?  230 VAL A CA    1 
ATOM   1762  C C     . VAL A 1 230 ? 221.32930 245.54972 90.55666  1.000 84.21084  ?  230 VAL A C     1 
ATOM   1763  O O     . VAL A 1 230 ? 221.94670 245.31929 91.60030  1.000 87.98250  ?  230 VAL A O     1 
ATOM   1764  C CB    . VAL A 1 230 ? 220.80149 243.39206 89.35926  1.000 85.59674  ?  230 VAL A CB    1 
ATOM   1765  C CG1   . VAL A 1 230 ? 219.86428 242.18719 89.42320  1.000 84.61926  ?  230 VAL A CG1   1 
ATOM   1766  C CG2   . VAL A 1 230 ? 221.18040 243.75717 87.95385  1.000 84.61346  ?  230 VAL A CG2   1 
ATOM   1767  N N     . THR A 1 231 ? 221.64724 246.57140 89.77388  1.000 77.27880  ?  231 THR A N     1 
ATOM   1768  C CA    . THR A 1 231 ? 222.70508 247.48450 90.18251  1.000 82.34778  ?  231 THR A CA    1 
ATOM   1769  C C     . THR A 1 231 ? 222.37911 248.19714 91.49189  1.000 83.87878  ?  231 THR A C     1 
ATOM   1770  O O     . THR A 1 231 ? 223.28927 248.71170 92.15809  1.000 82.39132  ?  231 THR A O     1 
ATOM   1771  C CB    . THR A 1 231 ? 222.96624 248.49293 89.09204  1.000 88.77850  ?  231 THR A CB    1 
ATOM   1772  O OG1   . THR A 1 231 ? 221.82165 249.34682 88.99161  1.000 93.03934  ?  231 THR A OG1   1 
ATOM   1773  C CG2   . THR A 1 231 ? 223.17002 247.74948 87.80916  1.000 90.33773  ?  231 THR A CG2   1 
ATOM   1774  N N     . ALA A 1 232 ? 221.09459 248.34520 91.81263  1.000 84.10607  ?  232 ALA A N     1 
ATOM   1775  C CA    . ALA A 1 232 ? 220.71546 248.99246 93.06311  1.000 84.68780  ?  232 ALA A CA    1 
ATOM   1776  C C     . ALA A 1 232 ? 221.18189 248.16007 94.26255  1.000 85.38741  ?  232 ALA A C     1 
ATOM   1777  O O     . ALA A 1 232 ? 220.92969 246.94938 94.33077  1.000 86.35329  ?  232 ALA A O     1 
ATOM   1778  C CB    . ALA A 1 232 ? 219.20134 249.18872 93.10148  1.000 86.17825  ?  232 ALA A CB    1 
ATOM   1779  N N     . TYR A 1 233 ? 221.87059 248.82835 95.20398  1.000 82.28724  ?  233 TYR A N     1 
ATOM   1780  C CA    . TYR A 1 233 ? 222.49513 248.21227 96.40069  1.000 82.37989  ?  233 TYR A CA    1 
ATOM   1781  C C     . TYR A 1 233 ? 223.32740 246.98495 96.00901  1.000 84.03219  ?  233 TYR A C     1 
ATOM   1782  O O     . TYR A 1 233 ? 223.35164 245.96518 96.70024  1.000 81.70137  ?  233 TYR A O     1 
ATOM   1783  C CB    . TYR A 1 233 ? 221.47575 247.88110 97.51312  1.000 83.16797  ?  233 TYR A CB    1 
ATOM   1784  C CG    . TYR A 1 233 ? 220.76722 249.11405 98.08595  1.000 81.24124  ?  233 TYR A CG    1 
ATOM   1785  C CD1   . TYR A 1 233 ? 221.41288 249.98537 98.96319  1.000 80.47809  ?  233 TYR A CD1   1 
ATOM   1786  C CD2   . TYR A 1 233 ? 219.44332 249.39735 97.75156  1.000 78.83783  ?  233 TYR A CD2   1 
ATOM   1787  C CE1   . TYR A 1 233 ? 220.77402 251.11762 99.46035  1.000 76.24757  ?  233 TYR A CE1   1 
ATOM   1788  C CE2   . TYR A 1 233 ? 218.79930 250.51338 98.24032  1.000 75.75353  ?  233 TYR A CE2   1 
ATOM   1789  C CZ    . TYR A 1 233 ? 219.47489 251.37189 99.09495  1.000 82.19117  ?  233 TYR A CZ    1 
ATOM   1790  O OH    . TYR A 1 233 ? 218.87698 252.49845 99.60325  1.000 91.15918  ?  233 TYR A OH    1 
ATOM   1791  N N     . GLU A 1 234 ? 224.03275 247.10358 94.88464  1.000 87.18160  ?  234 GLU A N     1 
ATOM   1792  C CA    . GLU A 1 234 ? 224.85090 246.01503 94.37274  1.000 84.99518  ?  234 GLU A CA    1 
ATOM   1793  C C     . GLU A 1 234 ? 226.07039 245.76135 95.24991  1.000 83.40979  ?  234 GLU A C     1 
ATOM   1794  O O     . GLU A 1 234 ? 226.84309 246.67711 95.53874  1.000 79.93237  ?  234 GLU A O     1 
ATOM   1795  C CB    . GLU A 1 234 ? 225.28916 246.34423 92.95262  1.000 89.09093  ?  234 GLU A CB    1 
ATOM   1796  C CG    . GLU A 1 234 ? 225.98398 245.21115 92.26717  1.000 95.83381  ?  234 GLU A CG    1 
ATOM   1797  C CD    . GLU A 1 234 ? 225.79080 245.24108 90.78268  1.000 98.21289  ?  234 GLU A CD    1 
ATOM   1798  O OE1   . GLU A 1 234 ? 226.38637 246.12402 90.13164  1.000 99.09051  ?  234 GLU A OE1   1 
ATOM   1799  O OE2   . GLU A 1 234 ? 225.10609 244.33605 90.26139  1.000 95.42689  ?  234 GLU A OE2   1 
ATOM   1800  N N     . ASP A 1 235 ? 226.29943 244.47848 95.57036  1.000 86.53495  ?  235 ASP A N     1 
ATOM   1801  C CA    . ASP A 1 235 ? 227.42038 244.01905 96.41617  1.000 87.17489  ?  235 ASP A CA    1 
ATOM   1802  C C     . ASP A 1 235 ? 227.33708 244.54971 97.84630  1.000 82.56386  ?  235 ASP A C     1 
ATOM   1803  O O     . ASP A 1 235 ? 228.35418 244.74436 98.52102  1.000 81.31522  ?  235 ASP A O     1 
ATOM   1804  C CB    . ASP A 1 235 ? 228.78409 244.37714 95.81134  1.000 89.85978  ?  235 ASP A CB    1 
ATOM   1805  C CG    . ASP A 1 235 ? 228.92404 243.96056 94.35211  1.000 94.58529  ?  235 ASP A CG    1 
ATOM   1806  O OD1   . ASP A 1 235 ? 228.09969 243.15401 93.86197  1.000 102.93064 ?  235 ASP A OD1   1 
ATOM   1807  O OD2   . ASP A 1 235 ? 229.88907 244.41755 93.70178  1.000 91.53735  ?  235 ASP A OD2   1 
ATOM   1808  N N     . CYS A 1 236 ? 226.12848 244.79167 98.31611  1.000 82.02275  ?  236 CYS A N     1 
ATOM   1809  C CA    . CYS A 1 236 ? 225.91579 245.29437 99.65943  1.000 77.97285  ?  236 CYS A CA    1 
ATOM   1810  C C     . CYS A 1 236 ? 224.90878 244.41838 100.40723 1.000 74.78286  ?  236 CYS A C     1 
ATOM   1811  O O     . CYS A 1 236 ? 224.16073 244.90374 101.25572 1.000 74.50512  ?  236 CYS A O     1 
ATOM   1812  C CB    . CYS A 1 236 ? 225.47373 246.75606 99.57874  1.000 75.92584  ?  236 CYS A CB    1 
ATOM   1813  S SG    . CYS A 1 236 ? 226.64819 247.78309 98.61503  1.000 77.79787  ?  236 CYS A SG    1 
ATOM   1814  N N     . SER A 1 237 ? 224.86554 243.12242 100.07751 1.000 78.10956  ?  237 SER A N     1 
ATOM   1815  C CA    . SER A 1 237 ? 223.88285 242.23769 100.68950 1.000 77.63640  ?  237 SER A CA    1 
ATOM   1816  C C     . SER A 1 237 ? 224.02590 242.24776 102.18737 1.000 79.13539  ?  237 SER A C     1 
ATOM   1817  O O     . SER A 1 237 ? 223.03835 242.02718 102.89309 1.000 83.66687  ?  237 SER A O     1 
ATOM   1818  C CB    . SER A 1 237 ? 223.99031 240.79395 100.18489 1.000 81.70564  ?  237 SER A CB    1 
ATOM   1819  O OG    . SER A 1 237 ? 224.09847 240.68842 98.77735  1.000 82.53915  ?  237 SER A OG    1 
ATOM   1820  N N     . GLY A 1 238 ? 225.24614 242.46777 102.69354 1.000 79.14654  ?  238 GLY A N     1 
ATOM   1821  C CA    . GLY A 1 238 ? 225.43023 242.49677 104.13797 1.000 77.53206  ?  238 GLY A CA    1 
ATOM   1822  C C     . GLY A 1 238 ? 224.65420 243.62009 104.79496 1.000 73.94899  ?  238 GLY A C     1 
ATOM   1823  O O     . GLY A 1 238 ? 223.77645 243.37676 105.62165 1.000 77.25187  ?  238 GLY A O     1 
ATOM   1824  N N     . LEU A 1 239 ? 224.85364 244.84377 104.31472 1.000 72.35696  ?  239 LEU A N     1 
ATOM   1825  C CA    . LEU A 1 239 ? 224.10887 245.97961 104.83275 1.000 72.46604  ?  239 LEU A CA    1 
ATOM   1826  C C     . LEU A 1 239 ? 222.60366 245.82175 104.63372 1.000 78.06688  ?  239 LEU A C     1 
ATOM   1827  O O     . LEU A 1 239 ? 221.81201 246.22471 105.49597 1.000 74.51425  ?  239 LEU A O     1 
ATOM   1828  C CB    . LEU A 1 239 ? 224.62083 247.23016 104.16163 1.000 72.39896  ?  239 LEU A CB    1 
ATOM   1829  C CG    . LEU A 1 239 ? 223.76179 248.43740 104.38629 1.000 72.48355  ?  239 LEU A CG    1 
ATOM   1830  C CD1   . LEU A 1 239 ? 223.66543 248.75194 105.85000 1.000 82.47047  ?  239 LEU A CD1   1 
ATOM   1831  C CD2   . LEU A 1 239 ? 224.53097 249.48578 103.66173 1.000 73.48279  ?  239 LEU A CD2   1 
ATOM   1832  N N     . VAL A 1 240 ? 222.18534 245.31368 103.47540 1.000 80.35182  ?  240 VAL A N     1 
ATOM   1833  C CA    . VAL A 1 240 ? 220.75899 245.13032 103.23798 1.000 74.68959  ?  240 VAL A CA    1 
ATOM   1834  C C     . VAL A 1 240 ? 220.19939 244.04943 104.15581 1.000 78.86005  ?  240 VAL A C     1 
ATOM   1835  O O     . VAL A 1 240 ? 219.08503 244.17531 104.67603 1.000 87.36816  ?  240 VAL A O     1 
ATOM   1836  C CB    . VAL A 1 240 ? 220.48054 244.78736 101.76562 1.000 72.21567  ?  240 VAL A CB    1 
ATOM   1837  C CG1   . VAL A 1 240 ? 218.96623 244.57625 101.54887 1.000 72.25854  ?  240 VAL A CG1   1 
ATOM   1838  C CG2   . VAL A 1 240 ? 221.08961 245.80381 100.82856 1.000 73.64607  ?  240 VAL A CG2   1 
ATOM   1839  N N     . SER A 1 241 ? 220.93272 242.94524 104.33445 1.000 77.98599  ?  241 SER A N     1 
ATOM   1840  C CA    . SER A 1 241 ? 220.40829 241.88977 105.19917 1.000 78.98949  ?  241 SER A CA    1 
ATOM   1841  C C     . SER A 1 241 ? 220.19279 242.41748 106.59541 1.000 79.99952  ?  241 SER A C     1 
ATOM   1842  O O     . SER A 1 241 ? 219.22673 242.03759 107.26883 1.000 79.37798  ?  241 SER A O     1 
ATOM   1843  C CB    . SER A 1 241 ? 221.33452 240.66445 105.25439 1.000 79.37744  ?  241 SER A CB    1 
ATOM   1844  O OG    . SER A 1 241 ? 221.47183 240.01100 104.00418 1.000 85.65246  ?  241 SER A OG    1 
ATOM   1845  N N     . PHE A 1 242 ? 221.10015 243.28423 107.04768 1.000 85.49149  ?  242 PHE A N     1 
ATOM   1846  C CA    . PHE A 1 242 ? 220.99338 243.84927 108.38155 1.000 78.81213  ?  242 PHE A CA    1 
ATOM   1847  C C     . PHE A 1 242 ? 219.75428 244.72311 108.51322 1.000 76.71463  ?  242 PHE A C     1 
ATOM   1848  O O     . PHE A 1 242 ? 219.02364 244.61362 109.50151 1.000 80.15046  ?  242 PHE A O     1 
ATOM   1849  C CB    . PHE A 1 242 ? 222.25567 244.64842 108.70638 1.000 78.13975  ?  242 PHE A CB    1 
ATOM   1850  C CG    . PHE A 1 242 ? 222.24714 245.23258 110.07030 1.000 75.98892  ?  242 PHE A CG    1 
ATOM   1851  C CD1   . PHE A 1 242 ? 222.47118 244.42826 111.17177 1.000 81.62759  ?  242 PHE A CD1   1 
ATOM   1852  C CD2   . PHE A 1 242 ? 221.92185 246.55485 110.27470 1.000 73.18369  ?  242 PHE A CD2   1 
ATOM   1853  C CE1   . PHE A 1 242 ? 222.43054 244.94808 112.44449 1.000 75.11601  ?  242 PHE A CE1   1 
ATOM   1854  C CE2   . PHE A 1 242 ? 221.88865 247.07542 111.53326 1.000 73.35220  ?  242 PHE A CE2   1 
ATOM   1855  C CZ    . PHE A 1 242 ? 222.12369 246.26946 112.62257 1.000 81.90980  ?  242 PHE A CZ    1 
ATOM   1856  N N     . THR A 1 243 ? 219.49192 245.59649 107.53502 1.000 74.58273  ?  243 THR A N     1 
ATOM   1857  C CA    . THR A 1 243 ? 218.28777 246.41851 107.62663 1.000 76.19015  ?  243 THR A CA    1 
ATOM   1858  C C     . THR A 1 243 ? 217.03920 245.55325 107.57913 1.000 80.31831  ?  243 THR A C     1 
ATOM   1859  O O     . THR A 1 243 ? 216.03839 245.85967 108.23137 1.000 85.81219  ?  243 THR A O     1 
ATOM   1860  C CB    . THR A 1 243 ? 218.22535 247.47275 106.52926 1.000 72.95899  ?  243 THR A CB    1 
ATOM   1861  O OG1   . THR A 1 243 ? 218.00823 246.82124 105.28270 1.000 89.23560  ?  243 THR A OG1   1 
ATOM   1862  C CG2   . THR A 1 243 ? 219.50872 248.26894 106.45991 1.000 72.92210  ?  243 THR A CG2   1 
ATOM   1863  N N     . GLY A 1 244 ? 217.04177 244.52018 106.74442 1.000 78.93948  ?  244 GLY A N     1 
ATOM   1864  C CA    . GLY A 1 244 ? 215.91257 243.61762 106.74265 1.000 78.47183  ?  244 GLY A CA    1 
ATOM   1865  C C     . GLY A 1 244 ? 215.76275 242.91104 108.07387 1.000 79.85655  ?  244 GLY A C     1 
ATOM   1866  O O     . GLY A 1 244 ? 214.65856 242.80579 108.61400 1.000 80.71039  ?  244 GLY A O     1 
ATOM   1867  N N     . PHE A 1 245 ? 216.88964 242.48831 108.65490 1.000 81.20999  ?  245 PHE A N     1 
ATOM   1868  C CA    . PHE A 1 245 ? 216.88013 241.78751 109.93899 1.000 83.21509  ?  245 PHE A CA    1 
ATOM   1869  C C     . PHE A 1 245 ? 216.23462 242.63670 111.02400 1.000 81.05227  ?  245 PHE A C     1 
ATOM   1870  O O     . PHE A 1 245 ? 215.43425 242.14804 111.82763 1.000 78.67081  ?  245 PHE A O     1 
ATOM   1871  C CB    . PHE A 1 245 ? 218.32120 241.42246 110.30917 1.000 84.02947  ?  245 PHE A CB    1 
ATOM   1872  C CG    . PHE A 1 245 ? 218.46601 240.81860 111.65277 1.000 73.29932  ?  245 PHE A CG    1 
ATOM   1873  C CD1   . PHE A 1 245 ? 217.90713 239.58823 111.93348 1.000 73.30441  ?  245 PHE A CD1   1 
ATOM   1874  C CD2   . PHE A 1 245 ? 219.17186 241.47234 112.63457 1.000 73.40933  ?  245 PHE A CD2   1 
ATOM   1875  C CE1   . PHE A 1 245 ? 218.04405 239.03645 113.17770 1.000 74.66189  ?  245 PHE A CE1   1 
ATOM   1876  C CE2   . PHE A 1 245 ? 219.32050 240.93622 113.87277 1.000 73.52486  ?  245 PHE A CE2   1 
ATOM   1877  C CZ    . PHE A 1 245 ? 218.75305 239.71045 114.15275 1.000 74.62613  ?  245 PHE A CZ    1 
ATOM   1878  N N     . ILE A 1 246 ? 216.56480 243.91931 111.03305 1.000 82.25667  ?  246 ILE A N     1 
ATOM   1879  C CA    . ILE A 1 246 ? 215.99818 244.86901 111.97436 1.000 73.58912  ?  246 ILE A CA    1 
ATOM   1880  C C     . ILE A 1 246 ? 214.49074 244.95089 111.80050 1.000 79.41099  ?  246 ILE A C     1 
ATOM   1881  O O     . ILE A 1 246 ? 213.73584 244.92969 112.77692 1.000 81.48063  ?  246 ILE A O     1 
ATOM   1882  C CB    . ILE A 1 246 ? 216.64602 246.23246 111.73991 1.000 73.58773  ?  246 ILE A CB    1 
ATOM   1883  C CG1   . ILE A 1 246 ? 217.97697 246.29209 112.43586 1.000 73.61350  ?  246 ILE A CG1   1 
ATOM   1884  C CG2   . ILE A 1 246 ? 215.70237 247.34127 112.07538 1.000 74.32440  ?  246 ILE A CG2   1 
ATOM   1885  C CD1   . ILE A 1 246 ? 218.77051 247.30588 111.78766 1.000 85.22467  ?  246 ILE A CD1   1 
ATOM   1886  N N     . LYS A 1 247 ? 214.02699 245.09423 110.54886 1.000 86.69859  ?  247 LYS A N     1 
ATOM   1887  C CA    . LYS A 1 247 ? 212.58999 245.23839 110.31657 1.000 83.12688  ?  247 LYS A CA    1 
ATOM   1888  C C     . LYS A 1 247 ? 211.86312 243.94413 110.63273 1.000 84.50073  ?  247 LYS A C     1 
ATOM   1889  O O     . LYS A 1 247 ? 210.82986 243.95165 111.31397 1.000 84.33760  ?  247 LYS A O     1 
ATOM   1890  C CB    . LYS A 1 247 ? 212.30578 245.68676 108.88272 1.000 73.43425  ?  247 LYS A CB    1 
ATOM   1891  C CG    . LYS A 1 247 ? 212.91833 247.03491 108.55381 1.000 81.77420  ?  247 LYS A CG    1 
ATOM   1892  C CD    . LYS A 1 247 ? 212.23572 247.75021 107.39308 1.000 92.28445  ?  247 LYS A CD    1 
ATOM   1893  C CE    . LYS A 1 247 ? 212.81846 247.28397 106.06137 1.000 110.93901 ?  247 LYS A CE    1 
ATOM   1894  N NZ    . LYS A 1 247 ? 212.04727 247.71922 104.85896 1.000 113.72979 ?  247 LYS A NZ    1 
ATOM   1895  N N     . GLN A 1 248 ? 212.42040 242.81601 110.20521 1.000 87.80545  ?  248 GLN A N     1 
ATOM   1896  C CA    . GLN A 1 248 ? 211.74764 241.55692 110.47411 1.000 87.82673  ?  248 GLN A CA    1 
ATOM   1897  C C     . GLN A 1 248 ? 211.65826 241.30700 111.97445 1.000 86.08596  ?  248 GLN A C     1 
ATOM   1898  O O     . GLN A 1 248 ? 210.57643 241.01198 112.49093 1.000 87.68949  ?  248 GLN A O     1 
ATOM   1899  C CB    . GLN A 1 248 ? 212.48700 240.42131 109.75234 1.000 84.33424  ?  248 GLN A CB    1 
ATOM   1900  C CG    . GLN A 1 248 ? 212.20245 240.36988 108.26281 1.000 88.55492  ?  248 GLN A CG    1 
ATOM   1901  C CD    . GLN A 1 248 ? 210.92461 239.59246 107.98865 1.000 103.85073 ?  248 GLN A CD    1 
ATOM   1902  O OE1   . GLN A 1 248 ? 210.15615 239.30320 108.91277 1.000 107.38915 ?  248 GLN A OE1   1 
ATOM   1903  N NE2   . GLN A 1 248 ? 210.67610 239.26614 106.72092 1.000 104.84208 ?  248 GLN A NE2   1 
ATOM   1904  N N     . ILE A 1 249 ? 212.75628 241.54919 112.69737 1.000 81.79252  ?  249 ILE A N     1 
ATOM   1905  C CA    . ILE A 1 249 ? 212.83351 241.29128 114.13750 1.000 82.37065  ?  249 ILE A CA    1 
ATOM   1906  C C     . ILE A 1 249 ? 212.11370 242.35631 114.95099 1.000 86.15142  ?  249 ILE A C     1 
ATOM   1907  O O     . ILE A 1 249 ? 211.93689 242.19122 116.17007 1.000 89.41954  ?  249 ILE A O     1 
ATOM   1908  C CB    . ILE A 1 249 ? 214.31895 241.17805 114.55683 1.000 85.00512  ?  249 ILE A CB    1 
ATOM   1909  C CG1   . ILE A 1 249 ? 214.51352 240.15531 115.65343 1.000 82.05259  ?  249 ILE A CG1   1 
ATOM   1910  C CG2   . ILE A 1 249 ? 214.87883 242.48023 115.08067 1.000 87.57822  ?  249 ILE A CG2   1 
ATOM   1911  C CD1   . ILE A 1 249 ? 214.42109 238.79917 115.07745 1.000 80.95192  ?  249 ILE A CD1   1 
ATOM   1912  N N     . ASN A 1 250 ? 211.72628 243.46296 114.31516 1.000 84.92209  ?  250 ASN A N     1 
ATOM   1913  C CA    . ASN A 1 250 ? 211.00401 244.54143 114.98441 1.000 84.35464  ?  250 ASN A CA    1 
ATOM   1914  C C     . ASN A 1 250 ? 211.83976 245.17678 116.09740 1.000 82.83912  ?  250 ASN A C     1 
ATOM   1915  O O     . ASN A 1 250 ? 211.39423 245.33474 117.23486 1.000 87.77350  ?  250 ASN A O     1 
ATOM   1916  C CB    . ASN A 1 250 ? 209.65120 244.05747 115.49320 1.000 84.16146  ?  250 ASN A CB    1 
ATOM   1917  C CG    . ASN A 1 250 ? 208.71098 245.19106 115.73642 1.000 90.03472  ?  250 ASN A CG    1 
ATOM   1918  O OD1   . ASN A 1 250 ? 208.30577 245.88192 114.80689 1.000 91.04420  ?  250 ASN A OD1   1 
ATOM   1919  N ND2   . ASN A 1 250 ? 208.34823 245.39476 116.99281 1.000 95.95407  ?  250 ASN A ND2   1 
ATOM   1920  N N     . LEU A 1 251 ? 213.09334 245.47192 115.78323 1.000 83.12733  ?  251 LEU A N     1 
ATOM   1921  C CA    . LEU A 1 251 ? 213.99817 246.13049 116.71300 1.000 82.82383  ?  251 LEU A CA    1 
ATOM   1922  C C     . LEU A 1 251 ? 214.58404 247.41401 116.13452 1.000 78.64039  ?  251 LEU A C     1 
ATOM   1923  O O     . LEU A 1 251 ? 214.56994 247.65359 114.93343 1.000 75.48654  ?  251 LEU A O     1 
ATOM   1924  C CB    . LEU A 1 251 ? 215.14122 245.18868 117.10572 1.000 80.95190  ?  251 LEU A CB    1 
ATOM   1925  C CG    . LEU A 1 251 ? 214.95127 244.48062 118.42470 1.000 87.38208  ?  251 LEU A CG    1 
ATOM   1926  C CD1   . LEU A 1 251 ? 216.16191 243.59950 118.57758 1.000 89.81570  ?  251 LEU A CD1   1 
ATOM   1927  C CD2   . LEU A 1 251 ? 214.81463 245.51370 119.55014 1.000 93.10889  ?  251 LEU A CD2   1 
ATOM   1928  N N     . THR A 1 252 ? 215.10335 248.24578 117.02143 1.000 87.35507  ?  252 THR A N     1 
ATOM   1929  C CA    . THR A 1 252 ? 215.82436 249.42649 116.58077 1.000 90.00628  ?  252 THR A CA    1 
ATOM   1930  C C     . THR A 1 252 ? 217.22779 249.03866 116.18261 1.000 86.22502  ?  252 THR A C     1 
ATOM   1931  O O     . THR A 1 252 ? 217.86526 248.21446 116.83915 1.000 91.99577  ?  252 THR A O     1 
ATOM   1932  C CB    . THR A 1 252 ? 215.96497 250.47487 117.68374 1.000 98.55863  ?  252 THR A CB    1 
ATOM   1933  O OG1   . THR A 1 252 ? 214.72295 250.65544 118.36623 1.000 112.28363 ?  252 THR A OG1   1 
ATOM   1934  C CG2   . THR A 1 252 ? 216.45638 251.82192 117.12429 1.000 86.37615  ?  252 THR A CG2   1 
ATOM   1935  N N     . ALA A 1 253 ? 217.70422 249.64693 115.10038 1.000 84.20651  ?  253 ALA A N     1 
ATOM   1936  C CA    . ALA A 1 253 ? 219.05639 249.38851 114.62958 1.000 80.42708  ?  253 ALA A CA    1 
ATOM   1937  C C     . ALA A 1 253 ? 220.06181 249.33071 115.77972 1.000 84.04183  ?  253 ALA A C     1 
ATOM   1938  O O     . ALA A 1 253 ? 220.86645 248.39906 115.85041 1.000 77.78388  ?  253 ALA A O     1 
ATOM   1939  C CB    . ALA A 1 253 ? 219.43981 250.42789 113.59121 1.000 80.47585  ?  253 ALA A CB    1 
ATOM   1940  N N     . ARG A 1 254 ? 220.02424 250.30557 116.70369 1.000 84.26488  ?  254 ARG A N     1 
ATOM   1941  C CA    . ARG A 1 254 ? 220.93923 250.25765 117.84409 1.000 83.73879  ?  254 ARG A CA    1 
ATOM   1942  C C     . ARG A 1 254 ? 220.62582 249.06427 118.72870 1.000 85.90771  ?  254 ARG A C     1 
ATOM   1943  O O     . ARG A 1 254 ? 221.53328 248.36026 119.18441 1.000 85.38176  ?  254 ARG A O     1 
ATOM   1944  C CB    . ARG A 1 254 ? 220.91234 251.54309 118.66092 1.000 88.49584  ?  254 ARG A CB    1 
ATOM   1945  C CG    . ARG A 1 254 ? 221.52172 251.40702 120.07763 1.000 94.54116  ?  254 ARG A CG    1 
ATOM   1946  C CD    . ARG A 1 254 ? 221.54186 252.77581 120.76700 1.000 96.92645  ?  254 ARG A CD    1 
ATOM   1947  N NE    . ARG A 1 254 ? 221.19824 252.66690 122.17221 1.000 93.70352  ?  254 ARG A NE    1 
ATOM   1948  C CZ    . ARG A 1 254 ? 219.96371 252.82386 122.62029 1.000 93.86449  ?  254 ARG A CZ    1 
ATOM   1949  N NH1   . ARG A 1 254 ? 218.96482 253.09829 121.79682 1.000 87.53192  ?  254 ARG A NH1   1 
ATOM   1950  N NH2   . ARG A 1 254 ? 219.71918 252.65636 123.91575 1.000 97.15674  ?  254 ARG A NH2   1 
ATOM   1951  N N     . GLU A 1 255 ? 219.34453 248.88957 119.06697 1.000 86.09526  ?  255 GLU A N     1 
ATOM   1952  C CA    . GLU A 1 255 ? 218.93847 247.79381 119.94323 1.000 85.67085  ?  255 GLU A CA    1 
ATOM   1953  C C     . GLU A 1 255 ? 219.38595 246.42672 119.44140 1.000 88.51821  ?  255 GLU A C     1 
ATOM   1954  O O     . GLU A 1 255 ? 219.79499 245.57791 120.24150 1.000 89.78010  ?  255 GLU A O     1 
ATOM   1955  C CB    . GLU A 1 255 ? 217.42536 247.83178 120.15577 1.000 84.62181  ?  255 GLU A CB    1 
ATOM   1956  C CG    . GLU A 1 255 ? 217.02590 249.08237 120.86861 1.000 95.86040  ?  255 GLU A CG    1 
ATOM   1957  C CD    . GLU A 1 255 ? 217.45226 249.09312 122.34803 1.000 117.14033 ?  255 GLU A CD    1 
ATOM   1958  O OE1   . GLU A 1 255 ? 217.58812 248.01263 122.97207 1.000 117.49492 ?  255 GLU A OE1   1 
ATOM   1959  O OE2   . GLU A 1 255 ? 217.69273 250.19903 122.87843 1.000 113.35680 ?  255 GLU A OE2   1 
ATOM   1960  N N     . ALA A 1 256 ? 219.30213 246.18039 118.13310 1.000 87.16682  ?  256 ALA A N     1 
ATOM   1961  C CA    . ALA A 1 256 ? 219.67564 244.86567 117.62831 1.000 74.75605  ?  256 ALA A CA    1 
ATOM   1962  C C     . ALA A 1 256 ? 221.16184 244.59845 117.82129 1.000 74.92194  ?  256 ALA A C     1 
ATOM   1963  O O     . ALA A 1 256 ? 221.53525 243.51583 118.28264 1.000 81.45795  ?  256 ALA A O     1 
ATOM   1964  C CB    . ALA A 1 256 ? 219.26201 244.72203 116.17025 1.000 80.80985  ?  256 ALA A CB    1 
ATOM   1965  N N     . ILE A 1 257 ? 222.02169 245.59174 117.56414 1.000 74.05427  ?  257 ILE A N     1 
ATOM   1966  C CA    . ILE A 1 257 ? 223.46045 245.34877 117.70699 1.000 77.28831  ?  257 ILE A CA    1 
ATOM   1967  C C     . ILE A 1 257 ? 223.84493 244.96585 119.14266 1.000 79.54445  ?  257 ILE A C     1 
ATOM   1968  O O     . ILE A 1 257 ? 224.83373 244.25099 119.35631 1.000 78.11252  ?  257 ILE A O     1 
ATOM   1969  C CB    . ILE A 1 257 ? 224.28838 246.53600 117.15803 1.000 76.66538  ?  257 ILE A CB    1 
ATOM   1970  C CG1   . ILE A 1 257 ? 223.71411 247.03495 115.83495 1.000 79.59243  ?  257 ILE A CG1   1 
ATOM   1971  C CG2   . ILE A 1 257 ? 225.73372 246.18042 116.99101 1.000 82.12630  ?  257 ILE A CG2   1 
ATOM   1972  C CD1   . ILE A 1 257 ? 224.41453 248.27446 115.28612 1.000 79.70858  ?  257 ILE A CD1   1 
ATOM   1973  N N     . LEU A 1 258 ? 223.06753 245.39327 120.13703 1.000 81.81346  ?  258 LEU A N     1 
ATOM   1974  C CA    . LEU A 1 258 ? 223.33538 244.99504 121.51782 1.000 83.19807  ?  258 LEU A CA    1 
ATOM   1975  C C     . LEU A 1 258 ? 223.31966 243.47592 121.69352 1.000 81.82286  ?  258 LEU A C     1 
ATOM   1976  O O     . LEU A 1 258 ? 223.96597 242.94496 122.60614 1.000 83.73963  ?  258 LEU A O     1 
ATOM   1977  C CB    . LEU A 1 258 ? 222.31061 245.63349 122.43494 1.000 78.13510  ?  258 LEU A CB    1 
ATOM   1978  C CG    . LEU A 1 258 ? 222.28322 247.13821 122.33683 1.000 78.70538  ?  258 LEU A CG    1 
ATOM   1979  C CD1   . LEU A 1 258 ? 221.21178 247.57157 123.26618 1.000 87.24988  ?  258 LEU A CD1   1 
ATOM   1980  C CD2   . LEU A 1 258 ? 223.61587 247.70857 122.76106 1.000 84.46082  ?  258 LEU A CD2   1 
ATOM   1981  N N     . TYR A 1 259 ? 222.48442 242.77740 120.92173 1.000 74.33801  ?  259 TYR A N     1 
ATOM   1982  C CA    . TYR A 1 259 ? 222.38777 241.33074 121.00127 1.000 74.29739  ?  259 TYR A CA    1 
ATOM   1983  C C     . TYR A 1 259 ? 223.59149 240.61598 120.40354 1.000 74.70369  ?  259 TYR A C     1 
ATOM   1984  O O     . TYR A 1 259 ? 223.71597 239.40372 120.59282 1.000 75.66273  ?  259 TYR A O     1 
ATOM   1985  C CB    . TYR A 1 259 ? 221.10679 240.84194 120.32643 1.000 74.23390  ?  259 TYR A CB    1 
ATOM   1986  C CG    . TYR A 1 259 ? 219.87769 241.14086 121.13435 1.000 76.00266  ?  259 TYR A CG    1 
ATOM   1987  C CD1   . TYR A 1 259 ? 219.21275 242.34865 120.98535 1.000 78.99252  ?  259 TYR A CD1   1 
ATOM   1988  C CD2   . TYR A 1 259 ? 219.41642 240.25364 122.08997 1.000 75.47569  ?  259 TYR A CD2   1 
ATOM   1989  C CE1   . TYR A 1 259 ? 218.10505 242.64731 121.74156 1.000 85.80660  ?  259 TYR A CE1   1 
ATOM   1990  C CE2   . TYR A 1 259 ? 218.30622 240.54250 122.85188 1.000 83.60070  ?  259 TYR A CE2   1 
ATOM   1991  C CZ    . TYR A 1 259 ? 217.65278 241.74532 122.67768 1.000 89.70792  ?  259 TYR A CZ    1 
ATOM   1992  O OH    . TYR A 1 259 ? 216.54548 242.05151 123.44235 1.000 96.78705  ?  259 TYR A OH    1 
ATOM   1993  N N     . PHE A 1 260 ? 224.46915 241.30526 119.68275 1.000 74.51791  ?  260 PHE A N     1 
ATOM   1994  C CA    . PHE A 1 260 ? 225.64464 240.67465 119.07733 1.000 73.94707  ?  260 PHE A CA    1 
ATOM   1995  C C     . PHE A 1 260 ? 226.72069 240.46254 120.13803 1.000 76.58129  ?  260 PHE A C     1 
ATOM   1996  O O     . PHE A 1 260 ? 227.60982 241.29834 120.31730 1.000 83.57670  ?  260 PHE A O     1 
ATOM   1997  C CB    . PHE A 1 260 ? 226.20288 241.54704 117.95893 1.000 73.81689  ?  260 PHE A CB    1 
ATOM   1998  C CG    . PHE A 1 260 ? 225.32163 241.69018 116.73918 1.000 74.35280  ?  260 PHE A CG    1 
ATOM   1999  C CD1   . PHE A 1 260 ? 224.01786 241.21401 116.70521 1.000 75.33332  ?  260 PHE A CD1   1 
ATOM   2000  C CD2   . PHE A 1 260 ? 225.78287 242.44668 115.65675 1.000 76.64654  ?  260 PHE A CD2   1 
ATOM   2001  C CE1   . PHE A 1 260 ? 223.23575 241.38893 115.56716 1.000 74.67273  ?  260 PHE A CE1   1 
ATOM   2002  C CE2   . PHE A 1 260 ? 225.00676 242.65321 114.54017 1.000 79.34744  ?  260 PHE A CE2   1 
ATOM   2003  C CZ    . PHE A 1 260 ? 223.72739 242.12130 114.49330 1.000 74.87426  ?  260 PHE A CZ    1 
ATOM   2004  N N     . PHE A 1 261 ? 226.70381 239.30501 120.80625 1.000 74.33090  ?  261 PHE A N     1 
ATOM   2005  C CA    . PHE A 1 261 ? 227.63581 239.07307 121.91454 1.000 81.49638  ?  261 PHE A CA    1 
ATOM   2006  C C     . PHE A 1 261 ? 228.92900 238.40874 121.43276 1.000 76.74644  ?  261 PHE A C     1 
ATOM   2007  O O     . PHE A 1 261 ? 229.27502 237.29732 121.82926 1.000 78.90790  ?  261 PHE A O     1 
ATOM   2008  C CB    . PHE A 1 261 ? 226.97267 238.21625 122.98986 1.000 81.89668  ?  261 PHE A CB    1 
ATOM   2009  C CG    . PHE A 1 261 ? 225.62064 238.69382 123.42062 1.000 79.53814  ?  261 PHE A CG    1 
ATOM   2010  C CD1   . PHE A 1 261 ? 225.42287 240.00728 123.82826 1.000 80.88318  ?  261 PHE A CD1   1 
ATOM   2011  C CD2   . PHE A 1 261 ? 224.55197 237.82476 123.44309 1.000 75.35452  ?  261 PHE A CD2   1 
ATOM   2012  C CE1   . PHE A 1 261 ? 224.16582 240.44050 124.24689 1.000 78.80925  ?  261 PHE A CE1   1 
ATOM   2013  C CE2   . PHE A 1 261 ? 223.30951 238.24075 123.85262 1.000 75.72890  ?  261 PHE A CE2   1 
ATOM   2014  C CZ    . PHE A 1 261 ? 223.10743 239.54849 124.25289 1.000 80.22405  ?  261 PHE A CZ    1 
ATOM   2015  N N     . HIS A 1 262 ? 229.67085 239.12209 120.59241 1.000 74.03417  ?  262 HIS A N     1 
ATOM   2016  C CA    . HIS A 1 262 ? 230.96972 238.58286 120.23249 1.000 78.30913  ?  262 HIS A CA    1 
ATOM   2017  C C     . HIS A 1 262 ? 231.91840 239.65922 119.77779 1.000 77.87560  ?  262 HIS A C     1 
ATOM   2018  O O     . HIS A 1 262 ? 231.53921 240.58042 119.05659 1.000 74.82931  ?  262 HIS A O     1 
ATOM   2019  C CB    . HIS A 1 262 ? 230.87480 237.52881 119.13122 1.000 86.79802  ?  262 HIS A CB    1 
ATOM   2020  C CG    . HIS A 1 262 ? 232.00262 236.54437 119.14683 1.000 88.00272  ?  262 HIS A CG    1 
ATOM   2021  N ND1   . HIS A 1 262 ? 233.14584 236.71729 118.39398 1.000 86.42800  ?  262 HIS A ND1   1 
ATOM   2022  C CD2   . HIS A 1 262 ? 232.16945 235.38731 119.82825 1.000 90.54323  ?  262 HIS A CD2   1 
ATOM   2023  C CE1   . HIS A 1 262 ? 233.96999 235.71054 118.61586 1.000 92.11325  ?  262 HIS A CE1   1 
ATOM   2024  N NE2   . HIS A 1 262 ? 233.39900 234.88678 119.47638 1.000 98.83058  ?  262 HIS A NE2   1 
ATOM   2025  N N     . LYS A 1 263 ? 233.19062 239.41186 120.07375 1.000 81.24301  ?  263 LYS A N     1 
ATOM   2026  C CA    . LYS A 1 263 ? 234.23037 240.35675 119.71859 1.000 83.83575  ?  263 LYS A CA    1 
ATOM   2027  C C     . LYS A 1 263 ? 234.29393 240.57455 118.21512 1.000 81.87287  ?  263 LYS A C     1 
ATOM   2028  O O     . LYS A 1 263 ? 234.48588 241.70561 117.74991 1.000 77.02685  ?  263 LYS A O     1 
ATOM   2029  C CB    . LYS A 1 263 ? 235.56937 239.84622 120.24347 1.000 88.49793  ?  263 LYS A CB    1 
ATOM   2030  C CG    . LYS A 1 263 ? 236.60560 240.94605 120.35479 1.000 99.43111  ?  263 LYS A CG    1 
ATOM   2031  C CD    . LYS A 1 263 ? 238.01626 240.43026 120.66406 1.000 105.35844 ?  263 LYS A CD    1 
ATOM   2032  C CE    . LYS A 1 263 ? 239.08252 241.55491 120.59218 1.000 110.36028 ?  263 LYS A CE    1 
ATOM   2033  N NZ    . LYS A 1 263 ? 239.33807 242.10255 119.21148 1.000 111.38621 ?  263 LYS A NZ    1 
ATOM   2034  N N     . ASN A 1 264 ? 234.05175 239.51932 117.44468 1.000 84.90956  ?  264 ASN A N     1 
ATOM   2035  C CA    . ASN A 1 264 ? 234.23797 239.57879 116.00240 1.000 81.42732  ?  264 ASN A CA    1 
ATOM   2036  C C     . ASN A 1 264 ? 233.37267 240.64703 115.38123 1.000 78.78820  ?  264 ASN A C     1 
ATOM   2037  O O     . ASN A 1 264 ? 233.81385 241.34317 114.46944 1.000 82.51069  ?  264 ASN A O     1 
ATOM   2038  C CB    . ASN A 1 264 ? 233.91851 238.21273 115.43720 1.000 78.63758  ?  264 ASN A CB    1 
ATOM   2039  C CG    . ASN A 1 264 ? 234.82677 237.17795 115.99211 1.000 82.82073  ?  264 ASN A CG    1 
ATOM   2040  O OD1   . ASN A 1 264 ? 234.57143 235.98543 115.88526 1.000 85.29587  ?  264 ASN A OD1   1 
ATOM   2041  N ND2   . ASN A 1 264 ? 235.91986 237.63136 116.61159 1.000 84.52307  ?  264 ASN A ND2   1 
ATOM   2042  N N     . PHE A 1 265 ? 232.18246 240.85671 115.92416 1.000 75.72076  ?  265 PHE A N     1 
ATOM   2043  C CA    . PHE A 1 265 ? 231.27461 241.82901 115.34636 1.000 74.38576  ?  265 PHE A CA    1 
ATOM   2044  C C     . PHE A 1 265 ? 231.86815 243.22320 115.35182 1.000 78.60662  ?  265 PHE A C     1 
ATOM   2045  O O     . PHE A 1 265 ? 231.41557 244.06913 114.57501 1.000 78.97557  ?  265 PHE A O     1 
ATOM   2046  C CB    . PHE A 1 265 ? 229.95970 241.81446 116.09778 1.000 80.24560  ?  265 PHE A CB    1 
ATOM   2047  C CG    . PHE A 1 265 ? 229.23547 240.52625 115.97359 1.000 78.76677  ?  265 PHE A CG    1 
ATOM   2048  C CD1   . PHE A 1 265 ? 228.93370 240.00887 114.74068 1.000 73.36327  ?  265 PHE A CD1   1 
ATOM   2049  C CD2   . PHE A 1 265 ? 228.90179 239.81013 117.10189 1.000 84.59403  ?  265 PHE A CD2   1 
ATOM   2050  C CE1   . PHE A 1 265 ? 228.29513 238.80066 114.63017 1.000 76.01244  ?  265 PHE A CE1   1 
ATOM   2051  C CE2   . PHE A 1 265 ? 228.24726 238.60721 117.00039 1.000 85.24855  ?  265 PHE A CE2   1 
ATOM   2052  C CZ    . PHE A 1 265 ? 227.94590 238.09598 115.76567 1.000 74.99996  ?  265 PHE A CZ    1 
ATOM   2053  N N     . GLU A 1 266 ? 232.84139 243.49454 116.23320 1.000 79.51835  ?  266 GLU A N     1 
ATOM   2054  C CA    . GLU A 1 266 ? 233.31534 244.86395 116.41439 1.000 78.28209  ?  266 GLU A CA    1 
ATOM   2055  C C     . GLU A 1 266 ? 233.83088 245.43912 115.10004 1.000 80.54853  ?  266 GLU A C     1 
ATOM   2056  O O     . GLU A 1 266 ? 233.37307 246.49667 114.65366 1.000 83.27908  ?  266 GLU A O     1 
ATOM   2057  C CB    . GLU A 1 266 ? 234.40580 244.90100 117.48059 1.000 81.20145  ?  266 GLU A CB    1 
ATOM   2058  C CG    . GLU A 1 266 ? 233.88858 244.61293 118.89191 1.000 95.68571  ?  266 GLU A CG    1 
ATOM   2059  C CD    . GLU A 1 266 ? 234.93640 244.83582 119.97503 1.000 106.25479 ?  266 GLU A CD    1 
ATOM   2060  O OE1   . GLU A 1 266 ? 236.11011 244.50239 119.72762 1.000 107.08047 ?  266 GLU A OE1   1 
ATOM   2061  O OE2   . GLU A 1 266 ? 234.57454 245.19696 121.11562 1.000 100.25213 ?  266 GLU A OE2   1 
ATOM   2062  N N     . GLU A 1 267 ? 234.73464 244.72383 114.42446 1.000 79.39649  ?  267 GLU A N     1 
ATOM   2063  C CA    . GLU A 1 267 ? 235.25042 245.25209 113.16573 1.000 81.68996  ?  267 GLU A CA    1 
ATOM   2064  C C     . GLU A 1 267 ? 234.11959 245.44394 112.16561 1.000 78.75936  ?  267 GLU A C     1 
ATOM   2065  O O     . GLU A 1 267 ? 233.97760 246.52171 111.57819 1.000 73.38488  ?  267 GLU A O     1 
ATOM   2066  C CB    . GLU A 1 267 ? 236.30854 244.32147 112.57537 1.000 91.90400  ?  267 GLU A CB    1 
ATOM   2067  C CG    . GLU A 1 267 ? 237.55542 244.20606 113.41073 1.000 104.85847 ?  267 GLU A CG    1 
ATOM   2068  C CD    . GLU A 1 267 ? 238.79522 243.97069 112.57667 1.000 119.31240 ?  267 GLU A CD    1 
ATOM   2069  O OE1   . GLU A 1 267 ? 238.65454 243.72688 111.35532 1.000 113.43165 ?  267 GLU A OE1   1 
ATOM   2070  O OE2   . GLU A 1 267 ? 239.90736 243.99223 113.15180 1.000 118.09322 ?  267 GLU A OE2   1 
ATOM   2071  N N     . GLU A 1 268 ? 233.22846 244.45302 112.05978 1.000 78.44603  ?  268 GLU A N     1 
ATOM   2072  C CA    . GLU A 1 268 ? 232.19669 244.50195 111.03329 1.000 75.05787  ?  268 GLU A CA    1 
ATOM   2073  C C     . GLU A 1 268 ? 231.24977 245.65561 111.27102 1.000 76.24692  ?  268 GLU A C     1 
ATOM   2074  O O     . GLU A 1 268 ? 230.97039 246.43516 110.35366 1.000 76.12925  ?  268 GLU A O     1 
ATOM   2075  C CB    . GLU A 1 268 ? 231.42037 243.18876 111.01335 1.000 72.91738  ?  268 GLU A CB    1 
ATOM   2076  C CG    . GLU A 1 268 ? 232.33640 242.04875 110.67150 1.000 76.55020  ?  268 GLU A CG    1 
ATOM   2077  C CD    . GLU A 1 268 ? 231.66261 240.69710 110.50797 1.000 79.82539  ?  268 GLU A CD    1 
ATOM   2078  O OE1   . GLU A 1 268 ? 230.41967 240.58118 110.62752 1.000 74.75989  ?  268 GLU A OE1   1 
ATOM   2079  O OE2   . GLU A 1 268 ? 232.41548 239.72781 110.27369 1.000 80.89222  ?  268 GLU A OE2   1 
ATOM   2080  N N     . ILE A 1 269 ? 230.81638 245.82522 112.51858 1.000 77.60561  ?  269 ILE A N     1 
ATOM   2081  C CA    . ILE A 1 269 ? 229.88016 246.88810 112.84487 1.000 73.68895  ?  269 ILE A CA    1 
ATOM   2082  C C     . ILE A 1 269 ? 230.50600 248.23909 112.55387 1.000 76.77149  ?  269 ILE A C     1 
ATOM   2083  O O     . ILE A 1 269 ? 229.84201 249.16660 112.07232 1.000 81.07980  ?  269 ILE A O     1 
ATOM   2084  C CB    . ILE A 1 269 ? 229.45561 246.77716 114.30511 1.000 73.43702  ?  269 ILE A CB    1 
ATOM   2085  C CG1   . ILE A 1 269 ? 228.57604 245.56010 114.54463 1.000 73.46837  ?  269 ILE A CG1   1 
ATOM   2086  C CG2   . ILE A 1 269 ? 228.56727 247.90642 114.56213 1.000 77.55922  ?  269 ILE A CG2   1 
ATOM   2087  C CD1   . ILE A 1 269 ? 227.25456 245.59109 113.78951 1.000 73.40976  ?  269 ILE A CD1   1 
ATOM   2088  N N     . ARG A 1 270 ? 231.78568 248.38493 112.89235 1.000 82.04063  ?  270 ARG A N     1 
ATOM   2089  C CA    . ARG A 1 270 ? 232.52564 249.59575 112.55459 1.000 82.31363  ?  270 ARG A CA    1 
ATOM   2090  C C     . ARG A 1 270 ? 232.64227 249.75819 111.04041 1.000 84.29362  ?  270 ARG A C     1 
ATOM   2091  O O     . ARG A 1 270 ? 232.57105 250.87484 110.50772 1.000 83.52100  ?  270 ARG A O     1 
ATOM   2092  C CB    . ARG A 1 270 ? 233.89534 249.53424 113.22836 1.000 81.81754  ?  270 ARG A CB    1 
ATOM   2093  C CG    . ARG A 1 270 ? 234.78626 250.71722 113.00446 1.000 87.03725  ?  270 ARG A CG    1 
ATOM   2094  C CD    . ARG A 1 270 ? 235.94940 250.74643 114.00963 1.000 99.68517  ?  270 ARG A CD    1 
ATOM   2095  N NE    . ARG A 1 270 ? 237.20138 251.19503 113.40714 1.000 109.62211 ?  270 ARG A NE    1 
ATOM   2096  C CZ    . ARG A 1 270 ? 237.92556 252.20857 113.86686 1.000 118.43762 ?  270 ARG A CZ    1 
ATOM   2097  N NH1   . ARG A 1 270 ? 237.54115 252.90589 114.92388 1.000 119.21898 ?  270 ARG A NH1   1 
ATOM   2098  N NH2   . ARG A 1 270 ? 239.04749 252.55162 113.23260 1.000 115.18380 ?  270 ARG A NH2   1 
ATOM   2099  N N     . ARG A 1 271 ? 232.83202 248.64663 110.33476 1.000 80.43579  ?  271 ARG A N     1 
ATOM   2100  C CA    . ARG A 1 271 ? 233.05599 248.70523 108.90093 1.000 78.59957  ?  271 ARG A CA    1 
ATOM   2101  C C     . ARG A 1 271 ? 231.82114 249.17004 108.14431 1.000 78.41690  ?  271 ARG A C     1 
ATOM   2102  O O     . ARG A 1 271 ? 231.90286 250.08792 107.32165 1.000 82.76955  ?  271 ARG A O     1 
ATOM   2103  C CB    . ARG A 1 271 ? 233.50549 247.33661 108.41168 1.000 82.20395  ?  271 ARG A CB    1 
ATOM   2104  C CG    . ARG A 1 271 ? 233.80175 247.30595 106.95089 1.000 83.96080  ?  271 ARG A CG    1 
ATOM   2105  C CD    . ARG A 1 271 ? 234.44100 245.99854 106.59599 1.000 77.19170  ?  271 ARG A CD    1 
ATOM   2106  N NE    . ARG A 1 271 ? 235.65130 245.77068 107.37480 1.000 75.13824  ?  271 ARG A NE    1 
ATOM   2107  C CZ    . ARG A 1 271 ? 235.98821 244.60325 107.90229 1.000 85.77328  ?  271 ARG A CZ    1 
ATOM   2108  N NH1   . ARG A 1 271 ? 235.22451 243.53220 107.75224 1.000 88.95143  ?  271 ARG A NH1   1 
ATOM   2109  N NH2   . ARG A 1 271 ? 237.11404 244.50858 108.60455 1.000 92.82931  ?  271 ARG A NH2   1 
ATOM   2110  N N     . MET A 1 272 ? 230.65947 248.56690 108.41903 1.000 74.60573  ?  272 MET A N     1 
ATOM   2111  C CA    . MET A 1 272 ? 229.47786 248.86852 107.61487 1.000 74.03884  ?  272 MET A CA    1 
ATOM   2112  C C     . MET A 1 272 ? 228.77251 250.15666 108.02791 1.000 82.69703  ?  272 MET A C     1 
ATOM   2113  O O     . MET A 1 272 ? 227.95074 250.66899 107.26484 1.000 83.31073  ?  272 MET A O     1 
ATOM   2114  C CB    . MET A 1 272 ? 228.48805 247.71253 107.63929 1.000 72.68143  ?  272 MET A CB    1 
ATOM   2115  C CG    . MET A 1 272 ? 227.93935 247.38986 108.98415 1.000 75.28548  ?  272 MET A CG    1 
ATOM   2116  S SD    . MET A 1 272 ? 227.01005 245.83936 108.99080 1.000 82.79035  ?  272 MET A SD    1 
ATOM   2117  C CE    . MET A 1 272 ? 225.64596 246.26743 107.92024 1.000 74.71133  ?  272 MET A CE    1 
ATOM   2118  N N     . PHE A 1 273 ? 229.03892 250.68849 109.21457 1.000 80.43233  ?  273 PHE A N     1 
ATOM   2119  C CA    . PHE A 1 273 ? 228.36926 251.89826 109.67488 1.000 77.78581  ?  273 PHE A CA    1 
ATOM   2120  C C     . PHE A 1 273 ? 229.26632 253.11291 109.67466 1.000 86.54768  ?  273 PHE A C     1 
ATOM   2121  O O     . PHE A 1 273 ? 229.03222 254.06075 110.42828 1.000 89.43828  ?  273 PHE A O     1 
ATOM   2122  C CB    . PHE A 1 273 ? 227.77580 251.69145 111.05112 1.000 75.05425  ?  273 PHE A CB    1 
ATOM   2123  C CG    . PHE A 1 273 ? 226.70572 250.68650 111.06806 1.000 77.77900  ?  273 PHE A CG    1 
ATOM   2124  C CD1   . PHE A 1 273 ? 225.60391 250.84805 110.24233 1.000 77.92703  ?  273 PHE A CD1   1 
ATOM   2125  C CD2   . PHE A 1 273 ? 226.83008 249.53696 111.80780 1.000 83.34893  ?  273 PHE A CD2   1 
ATOM   2126  C CE1   . PHE A 1 273 ? 224.60231 249.92099 110.23695 1.000 80.85033  ?  273 PHE A CE1   1 
ATOM   2127  C CE2   . PHE A 1 273 ? 225.84379 248.59428 111.79401 1.000 79.18292  ?  273 PHE A CE2   1 
ATOM   2128  C CZ    . PHE A 1 273 ? 224.72203 248.78525 111.00260 1.000 76.61962  ?  273 PHE A CZ    1 
ATOM   2129  N N     . GLU A 1 274 ? 230.25525 253.11706 108.80144 1.000 94.99157  ?  274 GLU A N     1 
ATOM   2130  C CA    . GLU A 1 274 ? 231.12599 254.27100 108.69396 1.000 96.66632  ?  274 GLU A CA    1 
ATOM   2131  C C     . GLU A 1 274 ? 230.27288 255.48817 108.30103 1.000 98.18165  ?  274 GLU A C     1 
ATOM   2132  O O     . GLU A 1 274 ? 229.42490 255.38594 107.38591 1.000 101.14816 ?  274 GLU A O     1 
ATOM   2133  C CB    . GLU A 1 274 ? 232.21221 253.95367 107.65228 1.000 98.10726  ?  274 GLU A CB    1 
ATOM   2134  C CG    . GLU A 1 274 ? 233.17277 255.05956 107.30185 1.000 97.96389  ?  274 GLU A CG    1 
ATOM   2135  C CD    . GLU A 1 274 ? 234.06694 255.45669 108.46462 1.000 105.22584 ?  274 GLU A CD    1 
ATOM   2136  O OE1   . GLU A 1 274 ? 234.34231 254.61325 109.35651 1.000 95.00192  ?  274 GLU A OE1   1 
ATOM   2137  O OE2   . GLU A 1 274 ? 234.45962 256.63904 108.49837 1.000 111.53218 ?  274 GLU A OE2   1 
ATOM   2138  N N     . PRO A 1 275 ? 230.38847 256.61081 109.01075 1.000 91.38333  ?  275 PRO A N     1 
ATOM   2139  C CA    . PRO A 1 275 ? 229.58043 257.79083 108.68621 1.000 95.55683  ?  275 PRO A CA    1 
ATOM   2140  C C     . PRO A 1 275 ? 230.12563 258.52728 107.46798 1.000 98.57392  ?  275 PRO A C     1 
ATOM   2141  O O     . PRO A 1 275 ? 231.28452 258.37960 107.08558 1.000 99.46188  ?  275 PRO A O     1 
ATOM   2142  C CB    . PRO A 1 275 ? 229.68577 258.64290 109.95290 1.000 95.03198  ?  275 PRO A CB    1 
ATOM   2143  C CG    . PRO A 1 275 ? 231.02570 258.30993 110.47952 1.000 101.83262 ?  275 PRO A CG    1 
ATOM   2144  C CD    . PRO A 1 275 ? 231.21725 256.83397 110.20208 1.000 99.42612  ?  275 PRO A CD    1 
ATOM   2145  N N     . GLY A 1 276 ? 229.27761 259.38612 106.90898 1.000 94.08585  ?  276 GLY A N     1 
ATOM   2146  C CA    . GLY A 1 276 ? 229.60050 260.15186 105.73033 1.000 91.11024  ?  276 GLY A CA    1 
ATOM   2147  C C     . GLY A 1 276 ? 229.18571 259.51492 104.42200 1.000 95.66062  ?  276 GLY A C     1 
ATOM   2148  O O     . GLY A 1 276 ? 229.09622 260.22307 103.41598 1.000 94.25774  ?  276 GLY A O     1 
ATOM   2149  N N     . GLN A 1 277 ? 228.86401 258.22735 104.40924 1.000 97.33759  ?  277 GLN A N     1 
ATOM   2150  C CA    . GLN A 1 277 ? 228.25001 257.62075 103.24285 1.000 95.22725  ?  277 GLN A CA    1 
ATOM   2151  C C     . GLN A 1 277 ? 226.75821 257.86276 103.35734 1.000 98.27576  ?  277 GLN A C     1 
ATOM   2152  O O     . GLN A 1 277 ? 226.17461 257.69475 104.43994 1.000 110.38982 ?  277 GLN A O     1 
ATOM   2153  C CB    . GLN A 1 277 ? 228.52298 256.12355 103.11620 1.000 90.43472  ?  277 GLN A CB    1 
ATOM   2154  C CG    . GLN A 1 277 ? 229.82121 255.71197 102.47556 1.000 91.48736  ?  277 GLN A CG    1 
ATOM   2155  C CD    . GLN A 1 277 ? 230.97227 256.54367 102.90134 1.000 90.05212  ?  277 GLN A CD    1 
ATOM   2156  O OE1   . GLN A 1 277 ? 231.26365 256.62601 104.07045 1.000 96.01622  ?  277 GLN A OE1   1 
ATOM   2157  N NE2   . GLN A 1 277 ? 231.66788 257.13417 101.95070 1.000 93.97034  ?  277 GLN A NE2   1 
ATOM   2158  N N     . GLU A 1 278 ? 226.16240 258.34734 102.27477 1.000 86.80093  ?  278 GLU A N     1 
ATOM   2159  C CA    . GLU A 1 278 ? 224.74321 258.68816 102.27977 1.000 91.04498  ?  278 GLU A CA    1 
ATOM   2160  C C     . GLU A 1 278 ? 223.89154 257.41304 102.28657 1.000 94.75913  ?  278 GLU A C     1 
ATOM   2161  O O     . GLU A 1 278 ? 223.03906 257.19462 101.43237 1.000 96.60363  ?  278 GLU A O     1 
ATOM   2162  C CB    . GLU A 1 278 ? 224.41662 259.55685 101.07800 1.000 91.77056  ?  278 GLU A CB    1 
ATOM   2163  C CG    . GLU A 1 278 ? 225.09413 260.89123 101.16027 1.000 93.08549  ?  278 GLU A CG    1 
ATOM   2164  C CD    . GLU A 1 278 ? 225.01867 261.68824 99.87337  1.000 101.54128 ?  278 GLU A CD    1 
ATOM   2165  O OE1   . GLU A 1 278 ? 224.84650 261.09345 98.77969  1.000 101.73344 ?  278 GLU A OE1   1 
ATOM   2166  O OE2   . GLU A 1 278 ? 225.15831 262.92524 99.96366  1.000 101.41619 ?  278 GLU A OE2   1 
ATOM   2167  N N     . THR A 1 279 ? 224.12850 256.58656 103.30878 1.000 92.34482  ?  279 THR A N     1 
ATOM   2168  C CA    . THR A 1 279 ? 223.38901 255.34282 103.47574 1.000 85.10832  ?  279 THR A CA    1 
ATOM   2169  C C     . THR A 1 279 ? 221.90133 255.60453 103.61997 1.000 94.76436  ?  279 THR A C     1 
ATOM   2170  O O     . THR A 1 279 ? 221.07118 254.84845 103.10149 1.000 94.25237  ?  279 THR A O     1 
ATOM   2171  C CB    . THR A 1 279 ? 223.88511 254.63100 104.72413 1.000 86.05028  ?  279 THR A CB    1 
ATOM   2172  O OG1   . THR A 1 279 ? 225.29648 254.40545 104.63792 1.000 84.59059  ?  279 THR A OG1   1 
ATOM   2173  C CG2   . THR A 1 279 ? 223.18425 253.34294 104.90189 1.000 87.73251  ?  279 THR A CG2   1 
ATOM   2174  N N     . ALA A 1 280 ? 221.55140 256.66239 104.35683 1.000 101.16140 ?  280 ALA A N     1 
ATOM   2175  C CA    . ALA A 1 280 ? 220.16813 257.05073 104.60124 1.000 102.81308 ?  280 ALA A CA    1 
ATOM   2176  C C     . ALA A 1 280 ? 219.52033 257.84157 103.45334 1.000 103.67840 ?  280 ALA A C     1 
ATOM   2177  O O     . ALA A 1 280 ? 218.28901 257.80565 103.32133 1.000 107.06067 ?  280 ALA A O     1 
ATOM   2178  C CB    . ALA A 1 280 ? 220.09195 257.85479 105.90623 1.000 104.67053 ?  280 ALA A CB    1 
ATOM   2179  N N     . VAL A 1 281 ? 220.30023 258.53683 102.62777 1.000 99.08287  ?  281 VAL A N     1 
ATOM   2180  C CA    . VAL A 1 281 ? 219.73138 259.45267 101.62582 1.000 99.71408  ?  281 VAL A CA    1 
ATOM   2181  C C     . VAL A 1 281 ? 218.93078 258.65160 100.60193 1.000 102.62657 ?  281 VAL A C     1 
ATOM   2182  O O     . VAL A 1 281 ? 219.35161 257.54226 100.22369 1.000 103.49705 ?  281 VAL A O     1 
ATOM   2183  C CB    . VAL A 1 281 ? 220.83801 260.25380 100.95406 1.000 97.65788  ?  281 VAL A CB    1 
ATOM   2184  C CG1   . VAL A 1 281 ? 220.26235 261.09022 99.78805  1.000 105.45878 ?  281 VAL A CG1   1 
ATOM   2185  C CG2   . VAL A 1 281 ? 221.52786 261.10762 101.97099 1.000 92.26510  ?  281 VAL A CG2   1 
ATOM   2186  N N     . PRO A 1 282 ? 217.73452 259.11037 100.21469 1.000 101.24667 ?  282 PRO A N     1 
ATOM   2187  C CA    . PRO A 1 282 ? 216.89630 258.29787 99.31729  1.000 104.29023 ?  282 PRO A CA    1 
ATOM   2188  C C     . PRO A 1 282 ? 217.45499 258.10413 97.90914  1.000 109.31470 ?  282 PRO A C     1 
ATOM   2189  O O     . PRO A 1 282 ? 217.42528 256.97730 97.39904  1.000 109.47991 ?  282 PRO A O     1 
ATOM   2190  C CB    . PRO A 1 282 ? 215.57212 259.07051 99.29890  1.000 104.43454 ?  282 PRO A CB    1 
ATOM   2191  C CG    . PRO A 1 282 ? 215.54163 259.78765 100.59316 1.000 108.77765 ?  282 PRO A CG    1 
ATOM   2192  C CD    . PRO A 1 282 ? 216.96957 260.19793 100.84094 1.000 102.54263 ?  282 PRO A CD    1 
ATOM   2193  N N     . HIS A 1 283 ? 217.89647 259.14777 97.21895  1.000 105.68616 ?  283 HIS A N     1 
ATOM   2194  C CA    . HIS A 1 283 ? 218.38845 258.82974 95.88441  1.000 102.41024 ?  283 HIS A CA    1 
ATOM   2195  C C     . HIS A 1 283 ? 219.81592 259.29868 95.72037  1.000 104.16510 ?  283 HIS A C     1 
ATOM   2196  O O     . HIS A 1 283 ? 220.11328 260.06405 94.80003  1.000 102.78759 ?  283 HIS A O     1 
ATOM   2197  C CB    . HIS A 1 283 ? 217.52005 259.43643 94.79007  1.000 100.99564 ?  283 HIS A CB    1 
ATOM   2198  C CG    . HIS A 1 283 ? 216.12175 258.91140 94.73975  1.000 106.47450 ?  283 HIS A CG    1 
ATOM   2199  N ND1   . HIS A 1 283 ? 215.06651 259.51142 95.38837  1.000 105.89989 ?  283 HIS A ND1   1 
ATOM   2200  C CD2   . HIS A 1 283 ? 215.59272 257.87724 94.04393  1.000 109.09732 ?  283 HIS A CD2   1 
ATOM   2201  C CE1   . HIS A 1 283 ? 213.95346 258.84810 95.12555  1.000 106.61355 ?  283 HIS A CE1   1 
ATOM   2202  N NE2   . HIS A 1 283 ? 214.24519 257.85479 94.30762  1.000 106.64021 ?  283 HIS A NE2   1 
ATOM   2203  N N     . SER A 1 284 ? 220.72056 258.76329 96.51772  1.000 104.97760 ?  284 SER A N     1 
ATOM   2204  C CA    . SER A 1 284 ? 222.08481 259.25483 96.48901  1.000 104.11775 ?  284 SER A CA    1 
ATOM   2205  C C     . SER A 1 284 ? 222.92620 258.36486 95.60269  1.000 97.30704  ?  284 SER A C     1 
ATOM   2206  O O     . SER A 1 284 ? 222.47681 257.34236 95.08308  1.000 90.63578  ?  284 SER A O     1 
ATOM   2207  C CB    . SER A 1 284 ? 222.70784 259.26420 97.86966  1.000 99.96391  ?  284 SER A CB    1 
ATOM   2208  O OG    . SER A 1 284 ? 222.88053 257.93181 98.30196  1.000 101.65030 ?  284 SER A OG    1 
ATOM   2209  N N     . TYR A 1 285 ? 224.15874 258.79123 95.38829  1.000 98.59282  ?  285 TYR A N     1 
ATOM   2210  C CA    . TYR A 1 285 ? 225.01142 257.92693 94.60080  1.000 99.41080  ?  285 TYR A CA    1 
ATOM   2211  C C     . TYR A 1 285 ? 225.22844 256.57933 95.28815  1.000 94.28721  ?  285 TYR A C     1 
ATOM   2212  O O     . TYR A 1 285 ? 225.45051 255.56778 94.60722  1.000 88.73369  ?  285 TYR A O     1 
ATOM   2213  C CB    . TYR A 1 285 ? 226.33606 258.63474 94.32377  1.000 98.92057  ?  285 TYR A CB    1 
ATOM   2214  C CG    . TYR A 1 285 ? 226.28972 259.57419 93.13464  1.000 97.93148  ?  285 TYR A CG    1 
ATOM   2215  C CD1   . TYR A 1 285 ? 225.89314 259.13451 91.86258  1.000 92.89764  ?  285 TYR A CD1   1 
ATOM   2216  C CD2   . TYR A 1 285 ? 226.70879 260.88897 93.26841  1.000 100.05061 ?  285 TYR A CD2   1 
ATOM   2217  C CE1   . TYR A 1 285 ? 225.88615 260.01825 90.76615  1.000 93.88380  ?  285 TYR A CE1   1 
ATOM   2218  C CE2   . TYR A 1 285 ? 226.71354 261.77539 92.17993  1.000 97.73518  ?  285 TYR A CE2   1 
ATOM   2219  C CZ    . TYR A 1 285 ? 226.30520 261.34243 90.94263  1.000 96.69308  ?  285 TYR A CZ    1 
ATOM   2220  O OH    . TYR A 1 285 ? 226.33311 262.25888 89.91705  1.000 101.18139 ?  285 TYR A OH    1 
ATOM   2221  N N     . PHE A 1 286 ? 225.05841 256.52438 96.60703  1.000 92.14175  ?  286 PHE A N     1 
ATOM   2222  C CA    . PHE A 1 286 ? 225.34375 255.29142 97.31986  1.000 91.19516  ?  286 PHE A CA    1 
ATOM   2223  C C     . PHE A 1 286 ? 224.56742 254.11384 96.75151  1.000 90.38029  ?  286 PHE A C     1 
ATOM   2224  O O     . PHE A 1 286 ? 225.15078 253.05247 96.48826  1.000 86.63888  ?  286 PHE A O     1 
ATOM   2225  C CB    . PHE A 1 286 ? 224.99539 255.47044 98.78638  1.000 88.42049  ?  286 PHE A CB    1 
ATOM   2226  C CG    . PHE A 1 286 ? 225.31227 254.29370 99.60380  1.000 87.55382  ?  286 PHE A CG    1 
ATOM   2227  C CD1   . PHE A 1 286 ? 226.61914 254.04439 99.98671  1.000 89.67643  ?  286 PHE A CD1   1 
ATOM   2228  C CD2   . PHE A 1 286 ? 224.31825 253.39432 99.93942  1.000 81.46913  ?  286 PHE A CD2   1 
ATOM   2229  C CE1   . PHE A 1 286 ? 226.91919 252.92803 100.73845 1.000 91.67079  ?  286 PHE A CE1   1 
ATOM   2230  C CE2   . PHE A 1 286 ? 224.60734 252.28346 100.68236 1.000 86.43893  ?  286 PHE A CE2   1 
ATOM   2231  C CZ    . PHE A 1 286 ? 225.91372 252.04616 101.08826 1.000 87.39251  ?  286 PHE A CZ    1 
ATOM   2232  N N     . ILE A 1 287 ? 223.28875 254.32966 96.42126  1.000 91.00994  ?  287 ILE A N     1 
ATOM   2233  C CA    . ILE A 1 287 ? 222.40215 253.22789 96.02996  1.000 89.11972  ?  287 ILE A CA    1 
ATOM   2234  C C     . ILE A 1 287 ? 222.97050 252.46479 94.84417  1.000 86.34938  ?  287 ILE A C     1 
ATOM   2235  O O     . ILE A 1 287 ? 222.70396 251.26557 94.69617  1.000 82.14121  ?  287 ILE A O     1 
ATOM   2236  C CB    . ILE A 1 287 ? 220.96489 253.74860 95.78102  1.000 87.43796  ?  287 ILE A CB    1 
ATOM   2237  C CG1   . ILE A 1 287 ? 220.92915 254.75954 94.60180  1.000 100.20626 ?  287 ILE A CG1   1 
ATOM   2238  C CG2   . ILE A 1 287 ? 220.39099 254.28509 97.14114  1.000 81.79286  ?  287 ILE A CG2   1 
ATOM   2239  C CD1   . ILE A 1 287 ? 219.51603 255.20213 94.02198  1.000 99.08125  ?  287 ILE A CD1   1 
ATOM   2240  N N     . HIS A 1 288 ? 223.75637 253.14247 93.99360  1.000 88.58679  ?  288 HIS A N     1 
ATOM   2241  C CA    . HIS A 1 288 ? 224.41835 252.52294 92.85213  1.000 89.43801  ?  288 HIS A CA    1 
ATOM   2242  C C     . HIS A 1 288 ? 225.93814 252.64450 92.87283  1.000 92.62546  ?  288 HIS A C     1 
ATOM   2243  O O     . HIS A 1 288 ? 226.56008 252.48141 91.82209  1.000 90.94606  ?  288 HIS A O     1 
ATOM   2244  C CB    . HIS A 1 288 ? 223.86499 253.15398 91.58812  1.000 87.73704  ?  288 HIS A CB    1 
ATOM   2245  C CG    . HIS A 1 288 ? 222.41185 252.89119 91.42380  1.000 90.59739  ?  288 HIS A CG    1 
ATOM   2246  N ND1   . HIS A 1 288 ? 221.45394 253.86880 91.60905  1.000 90.52031  ?  288 HIS A ND1   1 
ATOM   2247  C CD2   . HIS A 1 288 ? 221.74468 251.73786 91.17048  1.000 90.31445  ?  288 HIS A CD2   1 
ATOM   2248  C CE1   . HIS A 1 288 ? 220.25794 253.32880 91.44091  1.000 93.54008  ?  288 HIS A CE1   1 
ATOM   2249  N NE2   . HIS A 1 288 ? 220.40607 252.04035 91.17230  1.000 91.15790  ?  288 HIS A NE2   1 
ATOM   2250  N N     . PHE A 1 289 ? 226.56891 252.86634 94.03619  1.000 94.40755  ?  289 PHE A N     1 
ATOM   2251  C CA    . PHE A 1 289 ? 227.99512 253.21553 94.02779  1.000 90.49256  ?  289 PHE A CA    1 
ATOM   2252  C C     . PHE A 1 289 ? 228.83892 252.10606 93.41969  1.000 91.61539  ?  289 PHE A C     1 
ATOM   2253  O O     . PHE A 1 289 ? 229.82891 252.38788 92.73832  1.000 95.97530  ?  289 PHE A O     1 
ATOM   2254  C CB    . PHE A 1 289 ? 228.50577 253.59706 95.42860  1.000 89.00311  ?  289 PHE A CB    1 
ATOM   2255  C CG    . PHE A 1 289 ? 228.91279 252.43004 96.32184  1.000 89.84361  ?  289 PHE A CG    1 
ATOM   2256  C CD1   . PHE A 1 289 ? 230.22756 251.96757 96.35355  1.000 89.65217  ?  289 PHE A CD1   1 
ATOM   2257  C CD2   . PHE A 1 289 ? 227.98973 251.83385 97.16184  1.000 87.04647  ?  289 PHE A CD2   1 
ATOM   2258  C CE1   . PHE A 1 289 ? 230.60481 250.93757 97.19058  1.000 87.15814  ?  289 PHE A CE1   1 
ATOM   2259  C CE2   . PHE A 1 289 ? 228.35973 250.78800 97.98758  1.000 82.59608  ?  289 PHE A CE2   1 
ATOM   2260  C CZ    . PHE A 1 289 ? 229.66851 250.34191 98.00409  1.000 82.07980  ?  289 PHE A CZ    1 
ATOM   2261  N N     . ARG A 1 290 ? 228.49205 250.84299 93.67190  1.000 90.86509  ?  290 ARG A N     1 
ATOM   2262  C CA    . ARG A 1 290 ? 229.30217 249.77145 93.11423  1.000 91.96239  ?  290 ARG A CA    1 
ATOM   2263  C C     . ARG A 1 290 ? 229.20483 249.74832 91.59079  1.000 95.96517  ?  290 ARG A C     1 
ATOM   2264  O O     . ARG A 1 290 ? 230.21560 249.56773 90.89831  1.000 96.25718  ?  290 ARG A O     1 
ATOM   2265  C CB    . ARG A 1 290 ? 228.90861 248.42275 93.70105  1.000 93.58555  ?  290 ARG A CB    1 
ATOM   2266  C CG    . ARG A 1 290 ? 229.72203 248.01999 94.91037  1.000 90.36860  ?  290 ARG A CG    1 
ATOM   2267  C CD    . ARG A 1 290 ? 231.22076 248.16986 94.72772  1.000 91.53320  ?  290 ARG A CD    1 
ATOM   2268  N NE    . ARG A 1 290 ? 231.68885 247.50255 93.52651  1.000 93.30598  ?  290 ARG A NE    1 
ATOM   2269  C CZ    . ARG A 1 290 ? 232.48877 246.45079 93.52710  1.000 93.96737  ?  290 ARG A CZ    1 
ATOM   2270  N NH1   . ARG A 1 290 ? 232.88651 245.89295 94.65982  1.000 93.96170  ?  290 ARG A NH1   1 
ATOM   2271  N NH2   . ARG A 1 290 ? 232.89785 245.94818 92.36550  1.000 91.67101  ?  290 ARG A NH2   1 
ATOM   2272  N N     . SER A 1 291 ? 228.00189 249.94459 91.04374  1.000 98.00495  ?  291 SER A N     1 
ATOM   2273  C CA    . SER A 1 291 ? 227.86278 249.92410 89.59198  1.000 97.01902  ?  291 SER A CA    1 
ATOM   2274  C C     . SER A 1 291 ? 228.67901 251.04287 88.95407  1.000 90.45268  ?  291 SER A C     1 
ATOM   2275  O O     . SER A 1 291 ? 229.43870 250.80026 88.01406  1.000 91.31980  ?  291 SER A O     1 
ATOM   2276  C CB    . SER A 1 291 ? 226.38688 249.99085 89.20826  1.000 96.45801  ?  291 SER A CB    1 
ATOM   2277  O OG    . SER A 1 291 ? 225.79847 251.16451 89.73464  1.000 100.31108 ?  291 SER A OG    1 
ATOM   2278  N N     . LEU A 1 292 ? 228.55073 252.27078 89.46146  1.000 86.59319  ?  292 LEU A N     1 
ATOM   2279  C CA    . LEU A 1 292 ? 229.31856 253.40400 88.95211  1.000 87.21826  ?  292 LEU A CA    1 
ATOM   2280  C C     . LEU A 1 292 ? 230.75729 253.29231 89.46084  1.000 91.45616  ?  292 LEU A C     1 
ATOM   2281  O O     . LEU A 1 292 ? 231.19274 252.22876 89.91102  1.000 85.59860  ?  292 LEU A O     1 
ATOM   2282  C CB    . LEU A 1 292 ? 228.69055 254.70862 89.41458  1.000 85.74315  ?  292 LEU A CB    1 
ATOM   2283  C CG    . LEU A 1 292 ? 227.19321 254.62996 89.13545  1.000 88.00066  ?  292 LEU A CG    1 
ATOM   2284  C CD1   . LEU A 1 292 ? 226.50938 255.83562 89.74367  1.000 89.07330  ?  292 LEU A CD1   1 
ATOM   2285  C CD2   . LEU A 1 292 ? 226.85419 254.45896 87.66776  1.000 89.45595  ?  292 LEU A CD2   1 
ATOM   2286  N N     . GLY A 1 293 ? 231.50727 254.40295 89.43837  1.000 93.63624  ?  293 GLY A N     1 
ATOM   2287  C CA    . GLY A 1 293 ? 232.86211 254.42042 89.97584  1.000 94.78368  ?  293 GLY A CA    1 
ATOM   2288  C C     . GLY A 1 293 ? 232.98030 254.47820 91.49320  1.000 95.77933  ?  293 GLY A C     1 
ATOM   2289  O O     . GLY A 1 293 ? 232.13428 253.93386 92.19966  1.000 93.47227  ?  293 GLY A O     1 
ATOM   2290  N N     . LEU A 1 294 ? 233.92493 255.29420 91.99555  1.000 101.25974 ?  294 LEU A N     1 
ATOM   2291  C CA    . LEU A 1 294 ? 234.20918 255.48231 93.42612  1.000 101.00436 ?  294 LEU A CA    1 
ATOM   2292  C C     . LEU A 1 294 ? 233.87455 254.31369 94.36421  1.000 97.73947  ?  294 LEU A C     1 
ATOM   2293  O O     . LEU A 1 294 ? 233.44358 254.54122 95.49904  1.000 103.89752 ?  294 LEU A O     1 
ATOM   2294  C CB    . LEU A 1 294 ? 233.45427 256.74777 93.91948  1.000 99.30847  ?  294 LEU A CB    1 
ATOM   2295  C CG    . LEU A 1 294 ? 231.92715 256.69496 93.98915  1.000 96.98878  ?  294 LEU A CG    1 
ATOM   2296  C CD1   . LEU A 1 294 ? 231.51106 257.70745 95.03286  1.000 100.52234 ?  294 LEU A CD1   1 
ATOM   2297  C CD2   . LEU A 1 294 ? 231.23408 256.97450 92.64704  1.000 80.24339  ?  294 LEU A CD2   1 
ATOM   2298  N N     . SER A 1 295 ? 234.07470 253.07648 93.93893  1.000 96.27583  ?  295 SER A N     1 
ATOM   2299  C CA    . SER A 1 295 ? 233.63594 251.93784 94.73302  1.000 102.66675 ?  295 SER A CA    1 
ATOM   2300  C C     . SER A 1 295 ? 234.77201 251.10147 95.30692  1.000 102.18338 ?  295 SER A C     1 
ATOM   2301  O O     . SER A 1 295 ? 234.83543 250.90189 96.52472  1.000 102.96359 ?  295 SER A O     1 
ATOM   2302  C CB    . SER A 1 295 ? 232.71346 251.02353 93.89741  1.000 102.86288 ?  295 SER A CB    1 
ATOM   2303  O OG    . SER A 1 295 ? 233.27355 250.67486 92.62777  1.000 110.39219 ?  295 SER A OG    1 
ATOM   2304  N N     . GLY A 1 296 ? 235.63540 250.55438 94.45047  1.000 100.07464 ?  296 GLY A N     1 
ATOM   2305  C CA    . GLY A 1 296 ? 236.61930 249.58833 94.90409  1.000 104.46342 ?  296 GLY A CA    1 
ATOM   2306  C C     . GLY A 1 296 ? 235.88616 248.31139 95.27294  1.000 101.03212 ?  296 GLY A C     1 
ATOM   2307  O O     . GLY A 1 296 ? 234.84450 247.98327 94.68924  1.000 96.03832  ?  296 GLY A O     1 
ATOM   2308  N N     . LYS A 1 297 ? 236.38452 247.61443 96.29744  1.000 96.32834  ?  297 LYS A N     1 
ATOM   2309  C CA    . LYS A 1 297 ? 235.66021 246.48001 96.86197  1.000 88.77207  ?  297 LYS A CA    1 
ATOM   2310  C C     . LYS A 1 297 ? 234.69721 247.05884 97.88839  1.000 91.86304  ?  297 LYS A C     1 
ATOM   2311  O O     . LYS A 1 297 ? 235.07471 247.95399 98.65981  1.000 94.02565  ?  297 LYS A O     1 
ATOM   2312  C CB    . LYS A 1 297 ? 236.59945 245.45638 97.51091  1.000 88.50705  ?  297 LYS A CB    1 
ATOM   2313  C CG    . LYS A 1 297 ? 235.88188 244.29869 98.23568  1.000 87.98376  ?  297 LYS A CG    1 
ATOM   2314  C CD    . LYS A 1 297 ? 236.71139 243.00787 98.16270  1.000 92.85217  ?  297 LYS A CD    1 
ATOM   2315  C CE    . LYS A 1 297 ? 238.09046 243.16321 98.82963  1.000 101.06516 ?  297 LYS A CE    1 
ATOM   2316  N NZ    . LYS A 1 297 ? 239.05487 242.01030 98.68795  1.000 92.74556  ?  297 LYS A NZ    1 
ATOM   2317  N N     . SER A 1 298 ? 233.48233 246.55450 97.90947  1.000 88.47708  ?  298 SER A N     1 
ATOM   2318  C CA    . SER A 1 298 ? 232.50123 247.16105 98.79104  1.000 85.24968  ?  298 SER A CA    1 
ATOM   2319  C C     . SER A 1 298 ? 232.69418 246.64705 100.20849 1.000 83.36119  ?  298 SER A C     1 
ATOM   2320  O O     . SER A 1 298 ? 232.79695 245.42451 100.41686 1.000 84.92869  ?  298 SER A O     1 
ATOM   2321  C CB    . SER A 1 298 ? 231.07765 246.85951 98.34566  1.000 84.41513  ?  298 SER A CB    1 
ATOM   2322  O OG    . SER A 1 298 ? 230.13747 247.30245 99.32009  1.000 78.47346  ?  298 SER A OG    1 
ATOM   2323  N N     . PRO A 1 299 ? 232.75717 247.54133 101.19657 1.000 76.37597  ?  299 PRO A N     1 
ATOM   2324  C CA    . PRO A 1 299 ? 232.79714 247.12432 102.59922 1.000 76.29677  ?  299 PRO A CA    1 
ATOM   2325  C C     . PRO A 1 299 ? 231.45043 246.66659 103.13737 1.000 74.69194  ?  299 PRO A C     1 
ATOM   2326  O O     . PRO A 1 299 ? 231.35505 246.38668 104.33253 1.000 80.91410  ?  299 PRO A O     1 
ATOM   2327  C CB    . PRO A 1 299 ? 233.26542 248.39042 103.30894 1.000 81.82100  ?  299 PRO A CB    1 
ATOM   2328  C CG    . PRO A 1 299 ? 232.68513 249.48689 102.48380 1.000 81.79138  ?  299 PRO A CG    1 
ATOM   2329  C CD    . PRO A 1 299 ? 232.69260 249.00082 101.05459 1.000 77.06856  ?  299 PRO A CD    1 
ATOM   2330  N N     . TYR A 1 300 ? 230.39550 246.66239 102.32627 1.000 75.08291  ?  300 TYR A N     1 
ATOM   2331  C CA    . TYR A 1 300 ? 229.06786 246.25230 102.75437 1.000 73.09657  ?  300 TYR A CA    1 
ATOM   2332  C C     . TYR A 1 300 ? 228.67217 244.86808 102.24155 1.000 73.31725  ?  300 TYR A C     1 
ATOM   2333  O O     . TYR A 1 300 ? 227.53716 244.43265 102.47070 1.000 72.05132  ?  300 TYR A O     1 
ATOM   2334  C CB    . TYR A 1 300 ? 228.05727 247.28392 102.28088 1.000 74.40695  ?  300 TYR A CB    1 
ATOM   2335  C CG    . TYR A 1 300 ? 228.37373 248.70529 102.69048 1.000 72.14511  ?  300 TYR A CG    1 
ATOM   2336  C CD1   . TYR A 1 300 ? 228.16792 249.17073 103.97921 1.000 75.93465  ?  300 TYR A CD1   1 
ATOM   2337  C CD2   . TYR A 1 300 ? 228.96094 249.56711 101.78032 1.000 80.91741  ?  300 TYR A CD2   1 
ATOM   2338  C CE1   . TYR A 1 300 ? 228.48449 250.50777 104.32992 1.000 89.45351  ?  300 TYR A CE1   1 
ATOM   2339  C CE2   . TYR A 1 300 ? 229.28918 250.86971 102.11499 1.000 78.69348  ?  300 TYR A CE2   1 
ATOM   2340  C CZ    . TYR A 1 300 ? 229.05451 251.34439 103.38637 1.000 79.60661  ?  300 TYR A CZ    1 
ATOM   2341  O OH    . TYR A 1 300 ? 229.39737 252.65182 103.69083 1.000 80.27572  ?  300 TYR A OH    1 
ATOM   2342  N N     . SER A 1 301 ? 229.57608 244.17017 101.56316 1.000 76.28994  ?  301 SER A N     1 
ATOM   2343  C CA    . SER A 1 301 ? 229.26194 242.86838 100.99813 1.000 81.67343  ?  301 SER A CA    1 
ATOM   2344  C C     . SER A 1 301 ? 229.07134 241.82917 102.09177 1.000 76.17544  ?  301 SER A C     1 
ATOM   2345  O O     . SER A 1 301 ? 229.54100 241.98734 103.20874 1.000 80.44774  ?  301 SER A O     1 
ATOM   2346  C CB    . SER A 1 301 ? 230.35475 242.43053 100.01001 1.000 81.53553  ?  301 SER A CB    1 
ATOM   2347  O OG    . SER A 1 301 ? 231.64181 242.30698 100.57424 1.000 76.47415  ?  301 SER A OG    1 
ATOM   2348  N N     . SER A 1 302 ? 228.37739 240.74343 101.75130 1.000 74.56687  ?  302 SER A N     1 
ATOM   2349  C CA    . SER A 1 302 ? 228.12261 239.70694 102.74377 1.000 78.33616  ?  302 SER A CA    1 
ATOM   2350  C C     . SER A 1 302 ? 229.42322 239.14982 103.28806 1.000 80.04531  ?  302 SER A C     1 
ATOM   2351  O O     . SER A 1 302 ? 229.41877 238.49617 104.32925 1.000 79.60376  ?  302 SER A O     1 
ATOM   2352  C CB    . SER A 1 302 ? 227.30816 238.57159 102.16666 1.000 81.74017  ?  302 SER A CB    1 
ATOM   2353  O OG    . SER A 1 302 ? 227.78810 238.26063 100.87231 1.000 90.84122  ?  302 SER A OG    1 
ATOM   2354  N N     . ASN A 1 303 ? 230.49424 239.18904 102.49038 1.000 82.45367  ?  303 ASN A N     1 
ATOM   2355  C CA    . ASN A 1 303 ? 231.79066 238.75219 103.00903 1.000 82.14034  ?  303 ASN A CA    1 
ATOM   2356  C C     . ASN A 1 303 ? 232.41500 239.80025 103.91106 1.000 83.58673  ?  303 ASN A C     1 
ATOM   2357  O O     . ASN A 1 303 ? 233.03875 239.46338 104.92161 1.000 94.06420  ?  303 ASN A O     1 
ATOM   2358  C CB    . ASN A 1 303 ? 232.73315 238.42712 101.87406 1.000 83.63284  ?  303 ASN A CB    1 
ATOM   2359  C CG    . ASN A 1 303 ? 232.07545 237.60405 100.84697 1.000 91.04723  ?  303 ASN A CG    1 
ATOM   2360  O OD1   . ASN A 1 303 ? 231.26173 238.11044 100.06530 1.000 94.23805  ?  303 ASN A OD1   1 
ATOM   2361  N ND2   . ASN A 1 303 ? 232.33034 236.29883 100.89133 1.000 86.81697  ?  303 ASN A ND2   1 
ATOM   2362  N N     . ALA A 1 304 ? 232.28749 241.07626 103.54224 1.000 78.05409  ?  304 ALA A N     1 
ATOM   2363  C CA    . ALA A 1 304 ? 232.91009 242.13575 104.31600 1.000 75.88492  ?  304 ALA A CA    1 
ATOM   2364  C C     . ALA A 1 304 ? 232.36220 242.14682 105.73422 1.000 80.51922  ?  304 ALA A C     1 
ATOM   2365  O O     . ALA A 1 304 ? 233.07972 242.49912 106.67495 1.000 83.33002  ?  304 ALA A O     1 
ATOM   2366  C CB    . ALA A 1 304 ? 232.72100 243.48171 103.61418 1.000 79.12620  ?  304 ALA A CB    1 
ATOM   2367  N N     . VAL A 1 305 ? 231.10596 241.78596 105.91477 1.000 74.82529  ?  305 VAL A N     1 
ATOM   2368  C CA    . VAL A 1 305 ? 230.51731 241.74536 107.23962 1.000 72.47521  ?  305 VAL A CA    1 
ATOM   2369  C C     . VAL A 1 305 ? 230.08043 240.31055 107.52937 1.000 73.31063  ?  305 VAL A C     1 
ATOM   2370  O O     . VAL A 1 305 ? 228.95445 240.07018 107.97158 1.000 72.58627  ?  305 VAL A O     1 
ATOM   2371  C CB    . VAL A 1 305 ? 229.37438 242.75833 107.33250 1.000 72.52900  ?  305 VAL A CB    1 
ATOM   2372  C CG1   . VAL A 1 305 ? 229.92565 244.14147 107.16446 1.000 72.51586  ?  305 VAL A CG1   1 
ATOM   2373  C CG2   . VAL A 1 305 ? 228.38003 242.50865 106.24972 1.000 74.80185  ?  305 VAL A CG2   1 
ATOM   2374  N N     . GLY A 1 306 ? 230.96610 239.34472 107.26826 1.000 73.62504  ?  306 GLY A N     1 
ATOM   2375  C CA    . GLY A 1 306 ? 230.56177 237.94024 107.27298 1.000 74.53587  ?  306 GLY A CA    1 
ATOM   2376  C C     . GLY A 1 306 ? 229.90853 237.46751 108.56348 1.000 73.76202  ?  306 GLY A C     1 
ATOM   2377  O O     . GLY A 1 306 ? 228.90009 236.76150 108.52874 1.000 72.61881  ?  306 GLY A O     1 
ATOM   2378  N N     . HIS A 1 307 ? 230.48848 237.82024 109.72354 1.000 78.17880  ?  307 HIS A N     1 
ATOM   2379  C CA    . HIS A 1 307 ? 229.92368 237.36371 111.00011 1.000 75.78471  ?  307 HIS A CA    1 
ATOM   2380  C C     . HIS A 1 307 ? 228.51262 237.89905 111.20510 1.000 74.79754  ?  307 HIS A C     1 
ATOM   2381  O O     . HIS A 1 307 ? 227.60947 237.16494 111.63305 1.000 75.16838  ?  307 HIS A O     1 
ATOM   2382  C CB    . HIS A 1 307 ? 230.79359 237.78627 112.18589 1.000 73.01081  ?  307 HIS A CB    1 
ATOM   2383  C CG    . HIS A 1 307 ? 232.15718 237.17685 112.19935 1.000 72.98923  ?  307 HIS A CG    1 
ATOM   2384  N ND1   . HIS A 1 307 ? 233.26255 237.79167 111.65012 1.000 72.91415  ?  307 HIS A ND1   1 
ATOM   2385  C CD2   . HIS A 1 307 ? 232.58598 235.98720 112.67921 1.000 73.03330  ?  307 HIS A CD2   1 
ATOM   2386  C CE1   . HIS A 1 307 ? 234.31859 237.01573 111.81317 1.000 73.43316  ?  307 HIS A CE1   1 
ATOM   2387  N NE2   . HIS A 1 307 ? 233.93306 235.91174 112.42724 1.000 72.99219  ?  307 HIS A NE2   1 
ATOM   2388  N N     . VAL A 1 308 ? 228.31422 239.18354 110.92075 1.000 72.91607  ?  308 VAL A N     1 
ATOM   2389  C CA    . VAL A 1 308 ? 226.99735 239.78902 111.04742 1.000 72.96291  ?  308 VAL A CA    1 
ATOM   2390  C C     . VAL A 1 308 ? 226.02100 239.12578 110.08196 1.000 77.01026  ?  308 VAL A C     1 
ATOM   2391  O O     . VAL A 1 308 ? 224.85072 238.88015 110.41370 1.000 74.70608  ?  308 VAL A O     1 
ATOM   2392  C CB    . VAL A 1 308 ? 227.10664 241.30036 110.79430 1.000 72.95580  ?  308 VAL A CB    1 
ATOM   2393  C CG1   . VAL A 1 308 ? 225.72548 241.91454 110.67109 1.000 75.45037  ?  308 VAL A CG1   1 
ATOM   2394  C CG2   . VAL A 1 308 ? 227.91154 241.96147 111.88226 1.000 76.86603  ?  308 VAL A CG2   1 
ATOM   2395  N N     . PHE A 1 309 ? 226.48157 238.85831 108.85704 1.000 74.41285  ?  309 PHE A N     1 
ATOM   2396  C CA    . PHE A 1 309 ? 225.64419 238.19758 107.86597 1.000 75.75881  ?  309 PHE A CA    1 
ATOM   2397  C C     . PHE A 1 309 ? 225.25063 236.81613 108.37769 1.000 75.16414  ?  309 PHE A C     1 
ATOM   2398  O O     . PHE A 1 309 ? 224.06022 236.50677 108.51422 1.000 76.22140  ?  309 PHE A O     1 
ATOM   2399  C CB    . PHE A 1 309 ? 226.42231 238.13203 106.54675 1.000 78.42257  ?  309 PHE A CB    1 
ATOM   2400  C CG    . PHE A 1 309 ? 225.63740 237.66566 105.34249 1.000 79.33981  ?  309 PHE A CG    1 
ATOM   2401  C CD1   . PHE A 1 309 ? 224.92559 238.57584 104.56879 1.000 80.45835  ?  309 PHE A CD1   1 
ATOM   2402  C CD2   . PHE A 1 309 ? 225.66285 236.34633 104.94826 1.000 79.40277  ?  309 PHE A CD2   1 
ATOM   2403  C CE1   . PHE A 1 309 ? 224.23930 238.17559 103.44026 1.000 78.33179  ?  309 PHE A CE1   1 
ATOM   2404  C CE2   . PHE A 1 309 ? 224.97659 235.93570 103.82342 1.000 80.36097  ?  309 PHE A CE2   1 
ATOM   2405  C CZ    . PHE A 1 309 ? 224.26633 236.85010 103.06552 1.000 79.58170  ?  309 PHE A CZ    1 
ATOM   2406  N N     . ASN A 1 310 ? 226.23815 236.04542 108.84740 1.000 75.79136  ?  310 ASN A N     1 
ATOM   2407  C CA    . ASN A 1 310 ? 225.93787 234.70444 109.33404 1.000 76.01669  ?  310 ASN A CA    1 
ATOM   2408  C C     . ASN A 1 310 ? 224.94961 234.72539 110.48237 1.000 78.68839  ?  310 ASN A C     1 
ATOM   2409  O O     . ASN A 1 310 ? 223.97079 233.96755 110.47358 1.000 81.14971  ?  310 ASN A O     1 
ATOM   2410  C CB    . ASN A 1 310 ? 227.21072 234.00874 109.78770 1.000 78.33733  ?  310 ASN A CB    1 
ATOM   2411  C CG    . ASN A 1 310 ? 228.05971 233.60444 108.66162 1.000 75.05564  ?  310 ASN A CG    1 
ATOM   2412  O OD1   . ASN A 1 310 ? 227.64494 233.69676 107.52348 1.000 80.67505  ?  310 ASN A OD1   1 
ATOM   2413  N ND2   . ASN A 1 310 ? 229.27481 233.16704 108.95496 1.000 82.43185  ?  310 ASN A ND2   1 
ATOM   2414  N N     . LEU A 1 311 ? 225.15813 235.60535 111.45901 1.000 77.15391  ?  311 LEU A N     1 
ATOM   2415  C CA    . LEU A 1 311 ? 224.22767 235.65070 112.57589 1.000 78.76735  ?  311 LEU A CA    1 
ATOM   2416  C C     . LEU A 1 311 ? 222.82911 235.98311 112.08902 1.000 78.90184  ?  311 LEU A C     1 
ATOM   2417  O O     . LEU A 1 311 ? 221.85151 235.33557 112.49649 1.000 77.21657  ?  311 LEU A O     1 
ATOM   2418  C CB    . LEU A 1 311 ? 224.68395 236.66719 113.62163 1.000 73.26738  ?  311 LEU A CB    1 
ATOM   2419  C CG    . LEU A 1 311 ? 223.81525 236.74699 114.87570 1.000 73.43101  ?  311 LEU A CG    1 
ATOM   2420  C CD1   . LEU A 1 311 ? 223.89914 235.48584 115.67890 1.000 73.50412  ?  311 LEU A CD1   1 
ATOM   2421  C CD2   . LEU A 1 311 ? 224.19030 237.93224 115.73594 1.000 73.53862  ?  311 LEU A CD2   1 
ATOM   2422  N N     . ILE A 1 312 ? 222.71884 236.94891 111.17182 1.000 74.59610  ?  312 ILE A N     1 
ATOM   2423  C CA    . ILE A 1 312 ? 221.40145 237.39392 110.73931 1.000 73.01610  ?  312 ILE A CA    1 
ATOM   2424  C C     . ILE A 1 312 ? 220.61969 236.23999 110.14195 1.000 78.02621  ?  312 ILE A C     1 
ATOM   2425  O O     . ILE A 1 312 ? 219.44637 236.01976 110.46984 1.000 80.86534  ?  312 ILE A O     1 
ATOM   2426  C CB    . ILE A 1 312 ? 221.52642 238.53607 109.73716 1.000 72.91095  ?  312 ILE A CB    1 
ATOM   2427  C CG1   . ILE A 1 312 ? 221.84606 239.80857 110.48028 1.000 73.01362  ?  312 ILE A CG1   1 
ATOM   2428  C CG2   . ILE A 1 312 ? 220.22562 238.71774 109.05774 1.000 76.83409  ?  312 ILE A CG2   1 
ATOM   2429  C CD1   . ILE A 1 312 ? 222.43506 240.85011 109.63456 1.000 72.92190  ?  312 ILE A CD1   1 
ATOM   2430  N N     . HIS A 1 313 ? 221.25531 235.49058 109.24451 1.000 73.43428  ?  313 HIS A N     1 
ATOM   2431  C CA    . HIS A 1 313 ? 220.54065 234.43406 108.54981 1.000 74.47045  ?  313 HIS A CA    1 
ATOM   2432  C C     . HIS A 1 313 ? 220.37156 233.17825 109.38565 1.000 76.65722  ?  313 HIS A C     1 
ATOM   2433  O O     . HIS A 1 313 ? 219.34044 232.50039 109.26711 1.000 80.50235  ?  313 HIS A O     1 
ATOM   2434  C CB    . HIS A 1 313 ? 221.21311 234.19998 107.22349 1.000 72.58745  ?  313 HIS A CB    1 
ATOM   2435  C CG    . HIS A 1 313 ? 221.09255 235.40110 106.36829 1.000 72.51909  ?  313 HIS A CG    1 
ATOM   2436  N ND1   . HIS A 1 313 ? 219.87567 235.84210 105.89747 1.000 72.50815  ?  313 HIS A ND1   1 
ATOM   2437  C CD2   . HIS A 1 313 ? 222.00727 236.31610 105.97516 1.000 74.20565  ?  313 HIS A CD2   1 
ATOM   2438  C CE1   . HIS A 1 313 ? 220.05144 236.96936 105.22795 1.000 77.54726  ?  313 HIS A CE1   1 
ATOM   2439  N NE2   . HIS A 1 313 ? 221.33765 237.27251 105.24815 1.000 76.91009  ?  313 HIS A NE2   1 
ATOM   2440  N N     . PHE A 1 314 ? 221.32002 232.87224 110.26550 1.000 74.02197  ?  314 PHE A N     1 
ATOM   2441  C CA    . PHE A 1 314 ? 221.08144 231.76251 111.17008 1.000 72.99705  ?  314 PHE A CA    1 
ATOM   2442  C C     . PHE A 1 314 ? 219.84685 232.04484 111.99214 1.000 73.10886  ?  314 PHE A C     1 
ATOM   2443  O O     . PHE A 1 314 ? 218.99336 231.16971 112.15751 1.000 73.13545  ?  314 PHE A O     1 
ATOM   2444  C CB    . PHE A 1 314 ? 222.29653 231.55260 112.06278 1.000 73.07954  ?  314 PHE A CB    1 
ATOM   2445  C CG    . PHE A 1 314 ? 223.28726 230.60448 111.51006 1.000 73.00702  ?  314 PHE A CG    1 
ATOM   2446  C CD1   . PHE A 1 314 ? 222.90023 229.34294 111.10289 1.000 75.25646  ?  314 PHE A CD1   1 
ATOM   2447  C CD2   . PHE A 1 314 ? 224.59604 231.00166 111.30931 1.000 72.97077  ?  314 PHE A CD2   1 
ATOM   2448  C CE1   . PHE A 1 314 ? 223.82729 228.46517 110.56134 1.000 73.99594  ?  314 PHE A CE1   1 
ATOM   2449  C CE2   . PHE A 1 314 ? 225.52192 230.14047 110.76571 1.000 72.90606  ?  314 PHE A CE2   1 
ATOM   2450  C CZ    . PHE A 1 314 ? 225.13972 228.87127 110.39132 1.000 72.87793  ?  314 PHE A CZ    1 
ATOM   2451  N N     . VAL A 1 315 ? 219.68283 233.29160 112.43976 1.000 73.17506  ?  315 VAL A N     1 
ATOM   2452  C CA    . VAL A 1 315 ? 218.45640 233.62117 113.15476 1.000 73.29372  ?  315 VAL A CA    1 
ATOM   2453  C C     . VAL A 1 315 ? 217.27241 233.50983 112.21471 1.000 76.45734  ?  315 VAL A C     1 
ATOM   2454  O O     . VAL A 1 315 ? 216.20024 233.02066 112.59595 1.000 77.87326  ?  315 VAL A O     1 
ATOM   2455  C CB    . VAL A 1 315 ? 218.53186 235.01020 113.80149 1.000 73.39000  ?  315 VAL A CB    1 
ATOM   2456  C CG1   . VAL A 1 315 ? 217.16927 235.39272 114.35585 1.000 73.50280  ?  315 VAL A CG1   1 
ATOM   2457  C CG2   . VAL A 1 315 ? 219.58704 235.03657 114.84960 1.000 73.47455  ?  315 VAL A CG2   1 
ATOM   2458  N N     . GLY A 1 316 ? 217.44160 233.96933 110.97305 1.000 73.09340  ?  316 GLY A N     1 
ATOM   2459  C CA    . GLY A 1 316 ? 216.38295 233.79145 109.99645 1.000 82.50642  ?  316 GLY A CA    1 
ATOM   2460  C C     . GLY A 1 316 ? 216.05347 232.32668 109.77278 1.000 80.71084  ?  316 GLY A C     1 
ATOM   2461  O O     . GLY A 1 316 ? 214.88779 231.93635 109.81778 1.000 83.91268  ?  316 GLY A O     1 
ATOM   2462  N N     . CYS A 1 317 ? 217.06918 231.47824 109.64908 1.000 75.41779  ?  317 CYS A N     1 
ATOM   2463  C CA    . CYS A 1 317 ? 216.76458 230.05910 109.53972 1.000 72.91408  ?  317 CYS A CA    1 
ATOM   2464  C C     . CYS A 1 317 ? 216.00602 229.56774 110.75674 1.000 73.27559  ?  317 CYS A C     1 
ATOM   2465  O O     . CYS A 1 317 ? 215.06482 228.78306 110.62576 1.000 75.52050  ?  317 CYS A O     1 
ATOM   2466  C CB    . CYS A 1 317 ? 218.02580 229.23187 109.38155 1.000 72.87180  ?  317 CYS A CB    1 
ATOM   2467  S SG    . CYS A 1 317 ? 218.83522 229.51712 107.82538 1.000 73.12346  ?  317 CYS A SG    1 
ATOM   2468  N N     . TYR A 1 318 ? 216.37969 230.02607 111.95159 1.000 73.19800  ?  318 TYR A N     1 
ATOM   2469  C CA    . TYR A 1 318 ? 215.66458 229.56925 113.13345 1.000 73.34679  ?  318 TYR A CA    1 
ATOM   2470  C C     . TYR A 1 318 ? 214.18751 229.91712 113.05947 1.000 77.12211  ?  318 TYR A C     1 
ATOM   2471  O O     . TYR A 1 318 ? 213.34248 229.10844 113.44876 1.000 81.49019  ?  318 TYR A O     1 
ATOM   2472  C CB    . TYR A 1 318 ? 216.32969 230.14546 114.37222 1.000 74.48747  ?  318 TYR A CB    1 
ATOM   2473  C CG    . TYR A 1 318 ? 215.96980 229.48600 115.69855 1.000 79.47995  ?  318 TYR A CG    1 
ATOM   2474  C CD1   . TYR A 1 318 ? 214.79440 229.81715 116.36895 1.000 80.00301  ?  318 TYR A CD1   1 
ATOM   2475  C CD2   . TYR A 1 318 ? 216.80392 228.53233 116.28055 1.000 79.61390  ?  318 TYR A CD2   1 
ATOM   2476  C CE1   . TYR A 1 318 ? 214.48100 229.24156 117.58938 1.000 79.08049  ?  318 TYR A CE1   1 
ATOM   2477  C CE2   . TYR A 1 318 ? 216.48440 227.94639 117.49982 1.000 75.09343  ?  318 TYR A CE2   1 
ATOM   2478  C CZ    . TYR A 1 318 ? 215.31971 228.30550 118.14346 1.000 76.84551  ?  318 TYR A CZ    1 
ATOM   2479  O OH    . TYR A 1 318 ? 214.97232 227.74392 119.35263 1.000 83.42629  ?  318 TYR A OH    1 
ATOM   2480  N N     . MET A 1 319 ? 213.85442 231.05604 112.47858 1.000 79.17309  ?  319 MET A N     1 
ATOM   2481  C CA    . MET A 1 319 ? 212.46845 231.48941 112.35862 1.000 84.58235  ?  319 MET A CA    1 
ATOM   2482  C C     . MET A 1 319 ? 211.79748 231.05151 111.06964 1.000 85.72351  ?  319 MET A C     1 
ATOM   2483  O O     . MET A 1 319 ? 210.67285 231.48513 110.78866 1.000 87.86963  ?  319 MET A O     1 
ATOM   2484  C CB    . MET A 1 319 ? 212.41600 232.99199 112.51952 1.000 85.95913  ?  319 MET A CB    1 
ATOM   2485  C CG    . MET A 1 319 ? 213.04820 233.35963 113.82713 1.000 85.89824  ?  319 MET A CG    1 
ATOM   2486  S SD    . MET A 1 319 ? 212.85963 235.07424 114.05360 1.000 84.58646  ?  319 MET A SD    1 
ATOM   2487  C CE    . MET A 1 319 ? 213.37195 235.56948 112.40378 1.000 78.20719  ?  319 MET A CE    1 
ATOM   2488  N N     . GLY A 1 320 ? 212.47296 230.24039 110.26916 1.000 84.70517  ?  320 GLY A N     1 
ATOM   2489  C CA    . GLY A 1 320 ? 211.89413 229.72018 109.04656 1.000 87.59945  ?  320 GLY A CA    1 
ATOM   2490  C C     . GLY A 1 320 ? 211.88802 230.67483 107.87928 1.000 87.71622  ?  320 GLY A C     1 
ATOM   2491  O O     . GLY A 1 320 ? 211.14363 230.45914 106.92657 1.000 90.94746  ?  320 GLY A O     1 
ATOM   2492  N N     . GLN A 1 321 ? 212.73086 231.69586 107.88339 1.000 86.97601  ?  321 GLN A N     1 
ATOM   2493  C CA    . GLN A 1 321 ? 212.74087 232.61974 106.75554 1.000 91.32951  ?  321 GLN A CA    1 
ATOM   2494  C C     . GLN A 1 321 ? 213.31647 231.92282 105.53138 1.000 85.69799  ?  321 GLN A C     1 
ATOM   2495  O O     . GLN A 1 321 ? 214.45602 231.45933 105.55084 1.000 83.51485  ?  321 GLN A O     1 
ATOM   2496  C CB    . GLN A 1 321 ? 213.55862 233.87291 107.08741 1.000 93.36452  ?  321 GLN A CB    1 
ATOM   2497  C CG    . GLN A 1 321 ? 212.97614 234.70692 108.21730 1.000 98.69739  ?  321 GLN A CG    1 
ATOM   2498  C CD    . GLN A 1 321 ? 211.60024 235.25001 107.88711 1.000 101.75749 ?  321 GLN A CD    1 
ATOM   2499  O OE1   . GLN A 1 321 ? 210.57628 234.69279 108.30494 1.000 104.50059 ?  321 GLN A OE1   1 
ATOM   2500  N NE2   . GLN A 1 321 ? 211.56608 236.33999 107.13462 1.000 98.28940  ?  321 GLN A NE2   1 
ATOM   2501  N N     . VAL A 1 322 ? 212.53371 231.84521 104.45825 1.000 84.79693  ?  322 VAL A N     1 
ATOM   2502  C CA    . VAL A 1 322 ? 213.04636 231.14518 103.28875 1.000 82.42445  ?  322 VAL A CA    1 
ATOM   2503  C C     . VAL A 1 322 ? 214.26133 231.84227 102.70622 1.000 76.65160  ?  322 VAL A C     1 
ATOM   2504  O O     . VAL A 1 322 ? 215.21297 231.17508 102.28915 1.000 81.74803  ?  322 VAL A O     1 
ATOM   2505  C CB    . VAL A 1 322 ? 211.94130 230.93895 102.24600 1.000 79.84111  ?  322 VAL A CB    1 
ATOM   2506  C CG1   . VAL A 1 322 ? 212.44107 229.97804 101.21342 1.000 86.07778  ?  322 VAL A CG1   1 
ATOM   2507  C CG2   . VAL A 1 322 ? 210.70716 230.32014 102.94343 1.000 80.41817  ?  322 VAL A CG2   1 
ATOM   2508  N N     . ARG A 1 323 ? 214.28291 233.17092 102.71555 1.000 74.78865  ?  323 ARG A N     1 
ATOM   2509  C CA    . ARG A 1 323 ? 215.43014 233.90130 102.17861 1.000 75.38441  ?  323 ARG A CA    1 
ATOM   2510  C C     . ARG A 1 323 ? 216.73393 233.48763 102.84959 1.000 78.35267  ?  323 ARG A C     1 
ATOM   2511  O O     . ARG A 1 323 ? 217.78863 233.39363 102.20542 1.000 78.94581  ?  323 ARG A O     1 
ATOM   2512  C CB    . ARG A 1 323 ? 215.20994 235.39508 102.38252 1.000 73.71242  ?  323 ARG A CB    1 
ATOM   2513  C CG    . ARG A 1 323 ? 216.26001 236.26673 101.79469 1.000 72.15840  ?  323 ARG A CG    1 
ATOM   2514  C CD    . ARG A 1 323 ? 217.37897 236.48796 102.76512 1.000 76.92327  ?  323 ARG A CD    1 
ATOM   2515  N NE    . ARG A 1 323 ? 218.56893 236.87466 102.03737 1.000 77.56024  ?  323 ARG A NE    1 
ATOM   2516  C CZ    . ARG A 1 323 ? 219.00095 238.12103 102.03439 1.000 82.09022  ?  323 ARG A CZ    1 
ATOM   2517  N NH1   . ARG A 1 323 ? 218.37706 239.06300 102.73350 1.000 80.87464  ?  323 ARG A NH1   1 
ATOM   2518  N NH2   . ARG A 1 323 ? 220.05562 238.43732 101.29007 1.000 86.09756  ?  323 ARG A NH2   1 
ATOM   2519  N N     . SER A 1 324 ? 216.69237 233.36483 104.17402 1.000 82.02985  ?  324 SER A N     1 
ATOM   2520  C CA    . SER A 1 324 ? 217.85716 232.97678 104.95456 1.000 83.20847  ?  324 SER A CA    1 
ATOM   2521  C C     . SER A 1 324 ? 218.23797 231.52362 104.69407 1.000 83.83461  ?  324 SER A C     1 
ATOM   2522  O O     . SER A 1 324 ? 219.42650 231.19335 104.60246 1.000 83.91352  ?  324 SER A O     1 
ATOM   2523  C CB    . SER A 1 324 ? 217.54573 233.22134 106.42855 1.000 77.02317  ?  324 SER A CB    1 
ATOM   2524  O OG    . SER A 1 324 ? 217.08383 234.54365 106.57221 1.000 75.03744  ?  324 SER A OG    1 
ATOM   2525  N N     . LEU A 1 325 ? 217.24017 230.64888 104.55535 1.000 78.44013  ?  325 LEU A N     1 
ATOM   2526  C CA    . LEU A 1 325 ? 217.53287 229.25645 104.29587 1.000 73.37850  ?  325 LEU A CA    1 
ATOM   2527  C C     . LEU A 1 325 ? 218.35952 229.12551 103.02717 1.000 81.03921  ?  325 LEU A C     1 
ATOM   2528  O O     . LEU A 1 325 ? 219.27068 228.29169 102.94986 1.000 87.83141  ?  325 LEU A O     1 
ATOM   2529  C CB    . LEU A 1 325 ? 216.23877 228.45951 104.15973 1.000 74.83922  ?  325 LEU A CB    1 
ATOM   2530  C CG    . LEU A 1 325 ? 215.50486 227.78725 105.32480 1.000 72.46715  ?  325 LEU A CG    1 
ATOM   2531  C CD1   . LEU A 1 325 ? 216.30009 226.65331 105.91897 1.000 72.52349  ?  325 LEU A CD1   1 
ATOM   2532  C CD2   . LEU A 1 325 ? 215.15916 228.76525 106.38785 1.000 82.33922  ?  325 LEU A CD2   1 
ATOM   2533  N N     . ASN A 1 326 ? 218.06588 229.95758 102.02216 1.000 82.63518  ?  326 ASN A N     1 
ATOM   2534  C CA    . ASN A 1 326 ? 218.69390 229.88513 100.70270 1.000 84.90924  ?  326 ASN A CA    1 
ATOM   2535  C C     . ASN A 1 326 ? 219.87231 230.83610 100.50592 1.000 87.29076  ?  326 ASN A C     1 
ATOM   2536  O O     . ASN A 1 326 ? 220.38615 230.91492 99.37752  1.000 85.30284  ?  326 ASN A O     1 
ATOM   2537  C CB    . ASN A 1 326 ? 217.65614 230.13287 99.60971  1.000 86.38842  ?  326 ASN A CB    1 
ATOM   2538  C CG    . ASN A 1 326 ? 216.49415 229.14579 99.67469  1.000 88.57653  ?  326 ASN A CG    1 
ATOM   2539  O OD1   . ASN A 1 326 ? 216.67295 227.95364 99.92524  1.000 88.05629  ?  326 ASN A OD1   1 
ATOM   2540  N ND2   . ASN A 1 326 ? 215.28696 229.65332 99.44868  1.000 88.14924  ?  326 ASN A ND2   1 
ATOM   2541  N N     . ALA A 1 327 ? 220.20362 231.67120 101.50039 1.000 88.92041  ?  327 ALA A N     1 
ATOM   2542  C CA    . ALA A 1 327 ? 221.38522 232.52350 101.38704 1.000 85.61852  ?  327 ALA A CA    1 
ATOM   2543  C C     . ALA A 1 327 ? 222.62715 231.66234 101.51940 1.000 81.18055  ?  327 ALA A C     1 
ATOM   2544  O O     . ALA A 1 327 ? 222.59692 230.60650 102.14668 1.000 85.97790  ?  327 ALA A O     1 
ATOM   2545  C CB    . ALA A 1 327 ? 221.38438 233.61376 102.45036 1.000 79.28554  ?  327 ALA A CB    1 
ATOM   2546  N N     . THR A 1 328 ? 223.70764 232.06488 100.87289 1.000 76.06468  ?  328 THR A N     1 
ATOM   2547  C CA    . THR A 1 328 ? 224.92473 231.26756 100.94665 1.000 82.30623  ?  328 THR A CA    1 
ATOM   2548  C C     . THR A 1 328 ? 225.76716 231.73216 102.13120 1.000 86.45464  ?  328 THR A C     1 
ATOM   2549  O O     . THR A 1 328 ? 226.06359 232.92701 102.26917 1.000 84.73353  ?  328 THR A O     1 
ATOM   2550  C CB    . THR A 1 328 ? 225.70508 231.32055 99.64350  1.000 85.73308  ?  328 THR A CB    1 
ATOM   2551  O OG1   . THR A 1 328 ? 226.50645 232.50429 99.62174  1.000 90.73713  ?  328 THR A OG1   1 
ATOM   2552  C CG2   . THR A 1 328 ? 224.72679 231.31137 98.47115  1.000 88.58737  ?  328 THR A CG2   1 
ATOM   2553  N N     . VAL A 1 329 ? 226.12722 230.78101 102.99873 1.000 89.79175  ?  329 VAL A N     1 
ATOM   2554  C CA    . VAL A 1 329 ? 226.84784 231.10196 104.22116 1.000 84.05018  ?  329 VAL A CA    1 
ATOM   2555  C C     . VAL A 1 329 ? 228.28607 231.46054 103.88345 1.000 84.66648  ?  329 VAL A C     1 
ATOM   2556  O O     . VAL A 1 329 ? 228.89367 230.89028 102.96414 1.000 82.76328  ?  329 VAL A O     1 
ATOM   2557  C CB    . VAL A 1 329 ? 226.76944 229.92962 105.21256 1.000 72.30173  ?  329 VAL A CB    1 
ATOM   2558  C CG1   . VAL A 1 329 ? 227.40495 228.70675 104.64338 1.000 77.54117  ?  329 VAL A CG1   1 
ATOM   2559  C CG2   . VAL A 1 329 ? 227.49565 230.28592 106.43773 1.000 85.49926  ?  329 VAL A CG2   1 
ATOM   2560  N N     . ILE A 1 330 ? 228.82944 232.43223 104.61642 1.000 83.10953  ?  330 ILE A N     1 
ATOM   2561  C CA    . ILE A 1 330 ? 230.23407 232.81391 104.49133 1.000 84.57259  ?  330 ILE A CA    1 
ATOM   2562  C C     . ILE A 1 330 ? 231.01419 231.85676 105.38241 1.000 87.61518  ?  330 ILE A C     1 
ATOM   2563  O O     . ILE A 1 330 ? 231.09599 232.06362 106.59271 1.000 92.30974  ?  330 ILE A O     1 
ATOM   2564  C CB    . ILE A 1 330 ? 230.48214 234.26402 104.90627 1.000 81.45117  ?  330 ILE A CB    1 
ATOM   2565  C CG1   . ILE A 1 330 ? 229.54415 235.24579 104.19282 1.000 74.71116  ?  330 ILE A CG1   1 
ATOM   2566  C CG2   . ILE A 1 330 ? 231.93978 234.58602 104.67973 1.000 85.26054  ?  330 ILE A CG2   1 
ATOM   2567  C CD1   . ILE A 1 330 ? 229.58609 235.15595 102.72864 1.000 83.70030  ?  330 ILE A CD1   1 
ATOM   2568  N N     . ALA A 1 331 ? 231.64238 230.84317 104.78550 1.000 91.27492  ?  331 ALA A N     1 
ATOM   2569  C CA    . ALA A 1 331 ? 232.25351 229.78906 105.59343 1.000 90.62748  ?  331 ALA A CA    1 
ATOM   2570  C C     . ALA A 1 331 ? 233.40574 230.30953 106.42619 1.000 89.17902  ?  331 ALA A C     1 
ATOM   2571  O O     . ALA A 1 331 ? 233.67154 229.77925 107.51339 1.000 84.44888  ?  331 ALA A O     1 
ATOM   2572  C CB    . ALA A 1 331 ? 232.73277 228.63700 104.72083 1.000 92.58656  ?  331 ALA A CB    1 
ATOM   2573  N N     . ALA A 1 332 ? 234.10330 231.33078 105.93584 1.000 88.64797  ?  332 ALA A N     1 
ATOM   2574  C CA    . ALA A 1 332 ? 235.27240 231.79802 106.66274 1.000 91.28397  ?  332 ALA A CA    1 
ATOM   2575  C C     . ALA A 1 332 ? 234.89183 232.35682 108.02761 1.000 90.51320  ?  332 ALA A C     1 
ATOM   2576  O O     . ALA A 1 332 ? 235.54471 232.04304 109.02761 1.000 95.40815  ?  332 ALA A O     1 
ATOM   2577  C CB    . ALA A 1 332 ? 236.00860 232.84825 105.83437 1.000 93.63820  ?  332 ALA A CB    1 
ATOM   2578  N N     . CYS A 1 333 ? 233.79310 233.10602 108.10626 1.000 89.16194  ?  333 CYS A N     1 
ATOM   2579  C CA    . CYS A 1 333 ? 233.46307 233.86789 109.31397 1.000 83.50495  ?  333 CYS A CA    1 
ATOM   2580  C C     . CYS A 1 333 ? 232.67689 233.02361 110.32472 1.000 79.56237  ?  333 CYS A C     1 
ATOM   2581  O O     . CYS A 1 333 ? 231.47492 233.16581 110.51494 1.000 79.89052  ?  333 CYS A O     1 
ATOM   2582  C CB    . CYS A 1 333 ? 232.75881 235.17235 108.94910 1.000 81.26717  ?  333 CYS A CB    1 
ATOM   2583  S SG    . CYS A 1 333 ? 233.81747 236.33702 107.99033 1.000 82.74656  ?  333 CYS A SG    1 
ATOM   2584  N N     . ALA A 1 334 ? 233.40784 232.07305 110.90869 1.000 80.90149  ?  334 ALA A N     1 
ATOM   2585  C CA    . ALA A 1 334 ? 233.04412 231.30733 112.09769 1.000 78.79115  ?  334 ALA A CA    1 
ATOM   2586  C C     . ALA A 1 334 ? 231.55149 230.97331 112.14962 1.000 82.07904  ?  334 ALA A C     1 
ATOM   2587  O O     . ALA A 1 334 ? 230.85302 231.36649 113.08945 1.000 80.47047  ?  334 ALA A O     1 
ATOM   2588  C CB    . ALA A 1 334 ? 233.48655 232.04206 113.35536 1.000 77.58737  ?  334 ALA A CB    1 
ATOM   2589  N N     . PRO A 1 335 ? 231.04654 230.22520 111.17225 1.000 80.64389  ?  335 PRO A N     1 
ATOM   2590  C CA    . PRO A 1 335 ? 229.60445 229.97086 111.10608 1.000 75.23468  ?  335 PRO A CA    1 
ATOM   2591  C C     . PRO A 1 335 ? 229.11295 229.17073 112.27962 1.000 79.63884  ?  335 PRO A C     1 
ATOM   2592  O O     . PRO A 1 335 ? 227.95334 229.32535 112.68012 1.000 81.36800  ?  335 PRO A O     1 
ATOM   2593  C CB    . PRO A 1 335 ? 229.43324 229.19064 109.80830 1.000 74.48027  ?  335 PRO A CB    1 
ATOM   2594  C CG    . PRO A 1 335 ? 230.78117 229.23229 109.13443 1.000 86.09992  ?  335 PRO A CG    1 
ATOM   2595  C CD    . PRO A 1 335 ? 231.79019 229.44312 110.17996 1.000 83.13357  ?  335 PRO A CD    1 
ATOM   2596  N N     . HIS A 1 336 ? 229.94075 228.26905 112.82033 1.000 78.58545  ?  336 HIS A N     1 
ATOM   2597  C CA    . HIS A 1 336 ? 229.45907 227.44284 113.91953 1.000 81.08769  ?  336 HIS A CA    1 
ATOM   2598  C C     . HIS A 1 336 ? 229.17134 228.29805 115.13881 1.000 82.40801  ?  336 HIS A C     1 
ATOM   2599  O O     . HIS A 1 336 ? 228.09596 228.19458 115.74035 1.000 81.54808  ?  336 HIS A O     1 
ATOM   2600  C CB    . HIS A 1 336 ? 230.46330 226.36100 114.28402 1.000 85.98830  ?  336 HIS A CB    1 
ATOM   2601  C CG    . HIS A 1 336 ? 230.72481 225.38497 113.18900 1.000 87.51304  ?  336 HIS A CG    1 
ATOM   2602  N ND1   . HIS A 1 336 ? 230.06782 224.17332 113.09542 1.000 84.89496  ?  336 HIS A ND1   1 
ATOM   2603  C CD2   . HIS A 1 336 ? 231.63674 225.39820 112.19035 1.000 90.58846  ?  336 HIS A CD2   1 
ATOM   2604  C CE1   . HIS A 1 336 ? 230.52650 223.50481 112.05413 1.000 81.79511  ?  336 HIS A CE1   1 
ATOM   2605  N NE2   . HIS A 1 336 ? 231.48472 224.22116 111.49293 1.000 89.80918  ?  336 HIS A NE2   1 
ATOM   2606  N N     . GLU A 1 337 ? 230.12141 229.15594 115.52424 1.000 83.14033  ?  337 GLU A N     1 
ATOM   2607  C CA    . GLU A 1 337 ? 229.85610 230.01658 116.66522 1.000 80.96203  ?  337 GLU A CA    1 
ATOM   2608  C C     . GLU A 1 337 ? 228.67738 230.92231 116.36154 1.000 78.18159  ?  337 GLU A C     1 
ATOM   2609  O O     . GLU A 1 337 ? 227.74725 231.01831 117.16653 1.000 83.37591  ?  337 GLU A O     1 
ATOM   2610  C CB    . GLU A 1 337 ? 231.10325 230.82158 117.04087 1.000 83.78408  ?  337 GLU A CB    1 
ATOM   2611  C CG    . GLU A 1 337 ? 232.16574 229.98321 117.78451 1.000 91.02158  ?  337 GLU A CG    1 
ATOM   2612  C CD    . GLU A 1 337 ? 232.89972 230.79426 118.85851 1.000 96.47528  ?  337 GLU A CD    1 
ATOM   2613  O OE1   . GLU A 1 337 ? 232.59868 232.00456 119.00153 1.000 94.88412  ?  337 GLU A OE1   1 
ATOM   2614  O OE2   . GLU A 1 337 ? 233.72791 230.21474 119.60089 1.000 92.54627  ?  337 GLU A OE2   1 
ATOM   2615  N N     . MET A 1 338 ? 228.62465 231.45460 115.13581 1.000 75.12684  ?  338 MET A N     1 
ATOM   2616  C CA    . MET A 1 338 ? 227.49879 232.28913 114.72513 1.000 74.84722  ?  338 MET A CA    1 
ATOM   2617  C C     . MET A 1 338 ? 226.16855 231.53268 114.79757 1.000 79.32826  ?  338 MET A C     1 
ATOM   2618  O O     . MET A 1 338 ? 225.15903 232.08161 115.25153 1.000 80.06716  ?  338 MET A O     1 
ATOM   2619  C CB    . MET A 1 338 ? 227.75338 232.83316 113.32239 1.000 73.15554  ?  338 MET A CB    1 
ATOM   2620  C CG    . MET A 1 338 ? 228.98584 233.71493 113.24337 1.000 73.13832  ?  338 MET A CG    1 
ATOM   2621  S SD    . MET A 1 338 ? 228.92216 235.09606 114.36558 1.000 76.05734  ?  338 MET A SD    1 
ATOM   2622  C CE    . MET A 1 338 ? 230.14513 234.67815 115.60263 1.000 82.39011  ?  338 MET A CE    1 
ATOM   2623  N N     . SER A 1 339 ? 226.15175 230.25722 114.42428 1.000 79.22846  ?  339 SER A N     1 
ATOM   2624  C CA    . SER A 1 339 ? 224.91206 229.49470 114.52195 1.000 73.32380  ?  339 SER A CA    1 
ATOM   2625  C C     . SER A 1 339 ? 224.46008 229.33993 115.97517 1.000 74.29175  ?  339 SER A C     1 
ATOM   2626  O O     . SER A 1 339 ? 223.25877 229.36950 116.25767 1.000 75.41311  ?  339 SER A O     1 
ATOM   2627  C CB    . SER A 1 339 ? 225.10984 228.14685 113.85584 1.000 73.25935  ?  339 SER A CB    1 
ATOM   2628  O OG    . SER A 1 339 ? 226.09047 227.46459 114.57832 1.000 81.66132  ?  339 SER A OG    1 
ATOM   2629  N N     . VAL A 1 340 ? 225.40674 229.18337 116.90816 1.000 73.59300  ?  340 VAL A N     1 
ATOM   2630  C CA    . VAL A 1 340 ? 225.07578 229.03476 118.33017 1.000 75.25482  ?  340 VAL A CA    1 
ATOM   2631  C C     . VAL A 1 340 ? 224.39128 230.28122 118.87496 1.000 75.18081  ?  340 VAL A C     1 
ATOM   2632  O O     . VAL A 1 340 ? 223.41475 230.19779 119.63526 1.000 73.95415  ?  340 VAL A O     1 
ATOM   2633  C CB    . VAL A 1 340 ? 226.33921 228.71440 119.14243 1.000 75.25157  ?  340 VAL A CB    1 
ATOM   2634  C CG1   . VAL A 1 340 ? 225.98465 228.58009 120.57665 1.000 74.43430  ?  340 VAL A CG1   1 
ATOM   2635  C CG2   . VAL A 1 340 ? 226.92417 227.43676 118.66382 1.000 83.88852  ?  340 VAL A CG2   1 
ATOM   2636  N N     . LEU A 1 341 ? 224.97979 231.44697 118.60385 1.000 76.66493  ?  341 LEU A N     1 
ATOM   2637  C CA    . LEU A 1 341 ? 224.36209 232.70425 119.00347 1.000 76.48649  ?  341 LEU A CA    1 
ATOM   2638  C C     . LEU A 1 341 ? 223.03925 232.90878 118.30433 1.000 76.66649  ?  341 LEU A C     1 
ATOM   2639  O O     . LEU A 1 341 ? 222.12151 233.52065 118.86554 1.000 78.33261  ?  341 LEU A O     1 
ATOM   2640  C CB    . LEU A 1 341 ? 225.29089 233.87201 118.71321 1.000 73.81548  ?  341 LEU A CB    1 
ATOM   2641  C CG    . LEU A 1 341 ? 224.72465 235.22945 119.08398 1.000 73.87745  ?  341 LEU A CG    1 
ATOM   2642  C CD1   . LEU A 1 341 ? 224.45238 235.34856 120.52129 1.000 74.05465  ?  341 LEU A CD1   1 
ATOM   2643  C CD2   . LEU A 1 341 ? 225.77916 236.20845 118.74566 1.000 79.24953  ?  341 LEU A CD2   1 
ATOM   2644  N N     . GLY A 1 342 ? 222.96318 232.49360 117.04141 1.000 76.95433  ?  342 GLY A N     1 
ATOM   2645  C CA    . GLY A 1 342 ? 221.72775 232.64729 116.30415 1.000 73.98587  ?  342 GLY A CA    1 
ATOM   2646  C C     . GLY A 1 342 ? 220.61029 231.79194 116.85091 1.000 73.66917  ?  342 GLY A C     1 
ATOM   2647  O O     . GLY A 1 342 ? 219.44707 232.19530 116.84553 1.000 73.70115  ?  342 GLY A O     1 
ATOM   2648  N N     . GLY A 1 343 ? 220.95315 230.59545 117.32201 1.000 79.71456  ?  343 GLY A N     1 
ATOM   2649  C CA    . GLY A 1 343 ? 219.96930 229.74646 117.97142 1.000 80.66453  ?  343 GLY A CA    1 
ATOM   2650  C C     . GLY A 1 343 ? 219.39324 230.37531 119.22437 1.000 76.56935  ?  343 GLY A C     1 
ATOM   2651  O O     . GLY A 1 343 ? 218.20237 230.23047 119.51171 1.000 75.05298  ?  343 GLY A O     1 
ATOM   2652  N N     . TYR A 1 344 ? 220.25150 231.00056 120.03277 1.000 77.65960  ?  344 TYR A N     1 
ATOM   2653  C CA    . TYR A 1 344 ? 219.75768 231.70315 121.20308 1.000 76.86351  ?  344 TYR A CA    1 
ATOM   2654  C C     . TYR A 1 344 ? 218.93820 232.91052 120.80304 1.000 77.58173  ?  344 TYR A C     1 
ATOM   2655  O O     . TYR A 1 344 ? 217.86627 233.14216 121.36675 1.000 82.41875  ?  344 TYR A O     1 
ATOM   2656  C CB    . TYR A 1 344 ? 220.89915 232.14606 122.09765 1.000 79.08126  ?  344 TYR A CB    1 
ATOM   2657  C CG    . TYR A 1 344 ? 221.30381 231.08296 123.06275 1.000 78.15672  ?  344 TYR A CG    1 
ATOM   2658  C CD1   . TYR A 1 344 ? 220.62484 230.90049 124.26275 1.000 77.37172  ?  344 TYR A CD1   1 
ATOM   2659  C CD2   . TYR A 1 344 ? 222.37310 230.26058 122.76968 1.000 76.94373  ?  344 TYR A CD2   1 
ATOM   2660  C CE1   . TYR A 1 344 ? 221.00197 229.89894 125.12508 1.000 79.82490  ?  344 TYR A CE1   1 
ATOM   2661  C CE2   . TYR A 1 344 ? 222.75601 229.28093 123.62033 1.000 74.74753  ?  344 TYR A CE2   1 
ATOM   2662  C CZ    . TYR A 1 344 ? 222.07937 229.09838 124.78837 1.000 76.29184  ?  344 TYR A CZ    1 
ATOM   2663  O OH    . TYR A 1 344 ? 222.51866 228.09180 125.59433 1.000 80.87687  ?  344 TYR A OH    1 
ATOM   2664  N N     . LEU A 1 345 ? 219.43615 233.70464 119.85114 1.000 75.59443  ?  345 LEU A N     1 
ATOM   2665  C CA    . LEU A 1 345 ? 218.69809 234.89223 119.42699 1.000 74.71627  ?  345 LEU A CA    1 
ATOM   2666  C C     . LEU A 1 345 ? 217.37340 234.51898 118.77990 1.000 77.04527  ?  345 LEU A C     1 
ATOM   2667  O O     . LEU A 1 345 ? 216.35092 235.15577 119.04238 1.000 77.87639  ?  345 LEU A O     1 
ATOM   2668  C CB    . LEU A 1 345 ? 219.53545 235.72938 118.46592 1.000 73.93852  ?  345 LEU A CB    1 
ATOM   2669  C CG    . LEU A 1 345 ? 220.18136 236.97365 119.04015 1.000 74.01119  ?  345 LEU A CG    1 
ATOM   2670  C CD1   . LEU A 1 345 ? 220.81356 236.63411 120.34345 1.000 76.08604  ?  345 LEU A CD1   1 
ATOM   2671  C CD2   . LEU A 1 345 ? 221.23142 237.47671 118.11269 1.000 74.16154  ?  345 LEU A CD2   1 
ATOM   2672  N N     . GLY A 1 346 ? 217.38300 233.50277 117.91821 1.000 76.21133  ?  346 GLY A N     1 
ATOM   2673  C CA    . GLY A 1 346 ? 216.14224 233.02252 117.34228 1.000 78.81214  ?  346 GLY A CA    1 
ATOM   2674  C C     . GLY A 1 346 ? 215.19866 232.45938 118.38781 1.000 80.59881  ?  346 GLY A C     1 
ATOM   2675  O O     . GLY A 1 346 ? 213.98223 232.62616 118.29655 1.000 83.78387  ?  346 GLY A O     1 
ATOM   2676  N N     . GLU A 1 347 ? 215.74271 231.77609 119.39295 1.000 84.11123  ?  347 GLU A N     1 
ATOM   2677  C CA    . GLU A 1 347 ? 214.88283 231.30353 120.46820 1.000 87.55413  ?  347 GLU A CA    1 
ATOM   2678  C C     . GLU A 1 347 ? 214.15063 232.47182 121.09920 1.000 87.91330  ?  347 GLU A C     1 
ATOM   2679  O O     . GLU A 1 347 ? 212.94828 232.38313 121.36816 1.000 92.59108  ?  347 GLU A O     1 
ATOM   2680  C CB    . GLU A 1 347 ? 215.69809 230.53957 121.51995 1.000 82.25128  ?  347 GLU A CB    1 
ATOM   2681  C CG    . GLU A 1 347 ? 214.93117 230.06035 122.77163 1.000 82.42994  ?  347 GLU A CG    1 
ATOM   2682  C CD    . GLU A 1 347 ? 215.85656 229.82415 123.97973 1.000 96.02610  ?  347 GLU A CD    1 
ATOM   2683  O OE1   . GLU A 1 347 ? 216.75573 230.66996 124.21408 1.000 95.28597  ?  347 GLU A OE1   1 
ATOM   2684  O OE2   . GLU A 1 347 ? 215.70656 228.78048 124.67203 1.000 91.60719  ?  347 GLU A OE2   1 
ATOM   2685  N N     . GLU A 1 348 ? 214.86025 233.58348 121.32294 1.000 85.19679  ?  348 GLU A N     1 
ATOM   2686  C CA    . GLU A 1 348 ? 214.25031 234.75333 121.94493 1.000 84.71859  ?  348 GLU A CA    1 
ATOM   2687  C C     . GLU A 1 348 ? 213.16808 235.36701 121.07226 1.000 84.13751  ?  348 GLU A C     1 
ATOM   2688  O O     . GLU A 1 348 ? 212.13295 235.81021 121.57984 1.000 89.60451  ?  348 GLU A O     1 
ATOM   2689  C CB    . GLU A 1 348 ? 215.31066 235.80117 122.25319 1.000 84.66319  ?  348 GLU A CB    1 
ATOM   2690  C CG    . GLU A 1 348 ? 214.75498 237.12065 122.77217 1.000 91.16940  ?  348 GLU A CG    1 
ATOM   2691  C CD    . GLU A 1 348 ? 213.83450 236.95061 123.98215 1.000 96.82218  ?  348 GLU A CD    1 
ATOM   2692  O OE1   . GLU A 1 348 ? 214.23762 236.29332 124.96329 1.000 89.97892  ?  348 GLU A OE1   1 
ATOM   2693  O OE2   . GLU A 1 348 ? 212.72594 237.52448 123.97491 1.000 100.50919 ?  348 GLU A OE2   1 
ATOM   2694  N N     . PHE A 1 349 ? 213.39367 235.43021 119.76364 1.000 87.35124  ?  349 PHE A N     1 
ATOM   2695  C CA    . PHE A 1 349 ? 212.49571 236.14847 118.86825 1.000 88.86092  ?  349 PHE A CA    1 
ATOM   2696  C C     . PHE A 1 349 ? 211.45921 235.28174 118.17634 1.000 91.90323  ?  349 PHE A C     1 
ATOM   2697  O O     . PHE A 1 349 ? 210.54208 235.83506 117.56804 1.000 93.71283  ?  349 PHE A O     1 
ATOM   2698  C CB    . PHE A 1 349 ? 213.29854 236.86827 117.79470 1.000 83.36568  ?  349 PHE A CB    1 
ATOM   2699  C CG    . PHE A 1 349 ? 214.09542 238.00595 118.30720 1.000 82.37129  ?  349 PHE A CG    1 
ATOM   2700  C CD1   . PHE A 1 349 ? 213.47035 239.10986 118.83901 1.000 83.47862  ?  349 PHE A CD1   1 
ATOM   2701  C CD2   . PHE A 1 349 ? 215.47472 237.97457 118.24623 1.000 78.74214  ?  349 PHE A CD2   1 
ATOM   2702  C CE1   . PHE A 1 349 ? 214.20593 240.17098 119.30469 1.000 88.29713  ?  349 PHE A CE1   1 
ATOM   2703  C CE2   . PHE A 1 349 ? 216.21267 239.02365 118.70091 1.000 80.91404  ?  349 PHE A CE2   1 
ATOM   2704  C CZ    . PHE A 1 349 ? 215.58311 240.12531 119.23862 1.000 88.78664  ?  349 PHE A CZ    1 
ATOM   2705  N N     . PHE A 1 350 ? 211.54052 233.95893 118.27358 1.000 96.22782  ?  350 PHE A N     1 
ATOM   2706  C CA    . PHE A 1 350 ? 210.61531 233.09072 117.55127 1.000 92.91031  ?  350 PHE A CA    1 
ATOM   2707  C C     . PHE A 1 350 ? 209.36964 232.83873 118.38175 1.000 95.22353  ?  350 PHE A C     1 
ATOM   2708  O O     . PHE A 1 350 ? 209.44453 232.25866 119.47061 1.000 93.48514  ?  350 PHE A O     1 
ATOM   2709  C CB    . PHE A 1 350 ? 211.27051 231.75866 117.19798 1.000 90.30081  ?  350 PHE A CB    1 
ATOM   2710  C CG    . PHE A 1 350 ? 210.33619 230.76348 116.55227 1.000 87.75694  ?  350 PHE A CG    1 
ATOM   2711  C CD1   . PHE A 1 350 ? 210.12400 230.77946 115.19119 1.000 93.72823  ?  350 PHE A CD1   1 
ATOM   2712  C CD2   . PHE A 1 350 ? 209.72865 229.76976 117.29945 1.000 84.35008  ?  350 PHE A CD2   1 
ATOM   2713  C CE1   . PHE A 1 350 ? 209.27852 229.86138 114.59349 1.000 93.06910  ?  350 PHE A CE1   1 
ATOM   2714  C CE2   . PHE A 1 350 ? 208.89721 228.84761 116.70997 1.000 87.86106  ?  350 PHE A CE2   1 
ATOM   2715  C CZ    . PHE A 1 350 ? 208.66880 228.89173 115.35796 1.000 90.80589  ?  350 PHE A CZ    1 
ATOM   2716  N N     . GLY A 1 351 ? 208.22153 233.21307 117.83571 1.000 92.18190  ?  351 GLY A N     1 
ATOM   2717  C CA    . GLY A 1 351 ? 206.99339 232.97804 118.55278 1.000 98.90826  ?  351 GLY A CA    1 
ATOM   2718  C C     . GLY A 1 351 ? 206.70758 233.95460 119.67116 1.000 94.64893  ?  351 GLY A C     1 
ATOM   2719  O O     . GLY A 1 351 ? 205.84383 233.67957 120.51233 1.000 94.06864  ?  351 GLY A O     1 
ATOM   2720  N N     . LYS A 1 352 ? 207.41802 235.06634 119.73558 1.000 91.14133  ?  352 LYS A N     1 
ATOM   2721  C CA    . LYS A 1 352 ? 207.24930 236.01259 120.82198 1.000 91.37366  ?  352 LYS A CA    1 
ATOM   2722  C C     . LYS A 1 352 ? 207.12959 237.42250 120.27258 1.000 91.46323  ?  352 LYS A C     1 
ATOM   2723  O O     . LYS A 1 352 ? 207.80539 237.79616 119.30073 1.000 93.33031  ?  352 LYS A O     1 
ATOM   2724  C CB    . LYS A 1 352 ? 208.42491 235.93077 121.81102 1.000 97.34359  ?  352 LYS A CB    1 
ATOM   2725  C CG    . LYS A 1 352 ? 208.26696 236.73068 123.10850 1.000 94.18607  ?  352 LYS A CG    1 
ATOM   2726  C CD    . LYS A 1 352 ? 209.57232 236.71379 123.90775 1.000 91.70457  ?  352 LYS A CD    1 
ATOM   2727  C CE    . LYS A 1 352 ? 209.42529 237.34879 125.27780 1.000 99.00864  ?  352 LYS A CE    1 
ATOM   2728  N NZ    . LYS A 1 352 ? 210.55326 236.98641 126.18324 1.000 100.04314 ?  352 LYS A NZ    1 
ATOM   2729  N N     . GLY A 1 353 ? 206.30141 238.21363 120.92131 1.000 87.75337  ?  353 GLY A N     1 
ATOM   2730  C CA    . GLY A 1 353 ? 206.13506 239.59169 120.52130 1.000 92.65424  ?  353 GLY A CA    1 
ATOM   2731  C C     . GLY A 1 353 ? 206.04056 240.48628 121.73359 1.000 92.74588  ?  353 GLY A C     1 
ATOM   2732  O O     . GLY A 1 353 ? 205.65664 240.06906 122.82746 1.000 92.23018  ?  353 GLY A O     1 
ATOM   2733  N N     . THR A 1 354 ? 206.42036 241.71760 121.52187 1.000 91.29717  ?  354 THR A N     1 
ATOM   2734  C CA    . THR A 1 354 ? 206.31531 242.75984 122.51464 1.000 88.06450  ?  354 THR A CA    1 
ATOM   2735  C C     . THR A 1 354 ? 205.02114 243.49694 122.21125 1.000 92.47340  ?  354 THR A C     1 
ATOM   2736  O O     . THR A 1 354 ? 204.94484 244.26197 121.24538 1.000 97.55970  ?  354 THR A O     1 
ATOM   2737  C CB    . THR A 1 354 ? 207.54811 243.63425 122.41106 1.000 98.16415  ?  354 THR A CB    1 
ATOM   2738  O OG1   . THR A 1 354 ? 207.76462 243.95592 121.02531 1.000 101.58362 ?  354 THR A OG1   1 
ATOM   2739  C CG2   . THR A 1 354 ? 208.75513 242.87162 122.94891 1.000 104.38704 ?  354 THR A CG2   1 
ATOM   2740  N N     . PHE A 1 355 ? 203.98891 243.25887 123.02604 1.000 91.12214  ?  355 PHE A N     1 
ATOM   2741  C CA    . PHE A 1 355 ? 202.66049 243.80785 122.75417 1.000 93.33256  ?  355 PHE A CA    1 
ATOM   2742  C C     . PHE A 1 355 ? 202.23763 244.79660 123.82546 1.000 89.69962  ?  355 PHE A C     1 
ATOM   2743  O O     . PHE A 1 355 ? 202.45659 244.56851 125.01698 1.000 90.71901  ?  355 PHE A O     1 
ATOM   2744  C CB    . PHE A 1 355 ? 201.59087 242.71424 122.60907 1.000 89.74392  ?  355 PHE A CB    1 
ATOM   2745  C CG    . PHE A 1 355 ? 201.94967 241.68893 121.60291 1.000 89.23892  ?  355 PHE A CG    1 
ATOM   2746  C CD1   . PHE A 1 355 ? 201.97445 242.02693 120.25345 1.000 86.91066  ?  355 PHE A CD1   1 
ATOM   2747  C CD2   . PHE A 1 355 ? 202.21838 240.39066 121.97714 1.000 87.97088  ?  355 PHE A CD2   1 
ATOM   2748  C CE1   . PHE A 1 355 ? 202.30324 241.10707 119.31399 1.000 82.82472  ?  355 PHE A CE1   1 
ATOM   2749  C CE2   . PHE A 1 355 ? 202.54379 239.44538 121.01448 1.000 89.74997  ?  355 PHE A CE2   1 
ATOM   2750  C CZ    . PHE A 1 355 ? 202.57910 239.81322 119.68261 1.000 82.82572  ?  355 PHE A CZ    1 
ATOM   2751  N N     . GLU A 1 356 ? 201.64313 245.90168 123.37989 1.000 85.81564  ?  356 GLU A N     1 
ATOM   2752  C CA    . GLU A 1 356 ? 201.13782 246.93516 124.26736 1.000 91.84672  ?  356 GLU A CA    1 
ATOM   2753  C C     . GLU A 1 356 ? 199.85120 247.54138 123.72433 1.000 93.66268  ?  356 GLU A C     1 
ATOM   2754  O O     . GLU A 1 356 ? 199.67901 247.69589 122.51368 1.000 96.18452  ?  356 GLU A O     1 
ATOM   2755  C CB    . GLU A 1 356 ? 202.15280 248.04740 124.46387 1.000 92.97234  ?  356 GLU A CB    1 
ATOM   2756  C CG    . GLU A 1 356 ? 202.57731 248.70676 123.18001 1.000 95.12365  ?  356 GLU A CG    1 
ATOM   2757  C CD    . GLU A 1 356 ? 203.54897 249.82519 123.42819 1.000 102.24819 ?  356 GLU A CD    1 
ATOM   2758  O OE1   . GLU A 1 356 ? 203.41749 250.50262 124.47140 1.000 112.38448 ?  356 GLU A OE1   1 
ATOM   2759  O OE2   . GLU A 1 356 ? 204.47610 249.99141 122.61180 1.000 104.68226 ?  356 GLU A OE2   1 
ATOM   2760  N N     . ARG A 1 357 ? 198.95851 247.90867 124.64075 1.000 92.98154  ?  357 ARG A N     1 
ATOM   2761  C CA    . ARG A 1 357 ? 197.73091 248.58920 124.25372 1.000 91.70116  ?  357 ARG A CA    1 
ATOM   2762  C C     . ARG A 1 357 ? 198.06683 249.98436 123.74656 1.000 87.01704  ?  357 ARG A C     1 
ATOM   2763  O O     . ARG A 1 357 ? 198.87739 250.69175 124.34223 1.000 85.90400  ?  357 ARG A O     1 
ATOM   2764  C CB    . ARG A 1 357 ? 196.75196 248.65566 125.42878 1.000 93.11372  ?  357 ARG A CB    1 
ATOM   2765  C CG    . ARG A 1 357 ? 196.24020 247.28910 125.85718 1.000 94.65780  ?  357 ARG A CG    1 
ATOM   2766  C CD    . ARG A 1 357 ? 194.93631 247.34998 126.64301 1.000 94.35043  ?  357 ARG A CD    1 
ATOM   2767  N NE    . ARG A 1 357 ? 193.89378 248.01720 125.87624 1.000 97.18229  ?  357 ARG A NE    1 
ATOM   2768  C CZ    . ARG A 1 357 ? 192.75042 248.44250 126.39061 1.000 100.44329 ?  357 ARG A CZ    1 
ATOM   2769  N NH1   . ARG A 1 357 ? 192.46475 248.26370 127.66754 1.000 102.95457 ?  357 ARG A NH1   1 
ATOM   2770  N NH2   . ARG A 1 357 ? 191.89009 249.09717 125.61476 1.000 100.73784 ?  357 ARG A NH2   1 
ATOM   2771  N N     . ARG A 1 358 ? 197.56228 250.32548 122.57571 1.000 86.62183  ?  358 ARG A N     1 
ATOM   2772  C CA    . ARG A 1 358 ? 197.78458 251.64999 122.03265 1.000 89.52925  ?  358 ARG A CA    1 
ATOM   2773  C C     . ARG A 1 358 ? 196.51951 252.37435 121.63624 1.000 92.30133  ?  358 ARG A C     1 
ATOM   2774  O O     . ARG A 1 358 ? 196.56111 253.59600 121.44732 1.000 96.13336  ?  358 ARG A O     1 
ATOM   2775  C CB    . ARG A 1 358 ? 198.69863 251.56141 120.81378 1.000 87.26523  ?  358 ARG A CB    1 
ATOM   2776  C CG    . ARG A 1 358 ? 200.13742 251.37426 121.15013 1.000 89.03026  ?  358 ARG A CG    1 
ATOM   2777  C CD    . ARG A 1 358 ? 200.72690 252.67143 121.53064 1.000 95.81833  ?  358 ARG A CD    1 
ATOM   2778  N NE    . ARG A 1 358 ? 202.08414 252.51135 122.01936 1.000 100.22200 ?  358 ARG A NE    1 
ATOM   2779  C CZ    . ARG A 1 358 ? 203.00795 253.46016 121.93766 1.000 102.97262 ?  358 ARG A CZ    1 
ATOM   2780  N NH1   . ARG A 1 358 ? 202.74506 254.62715 121.37990 1.000 108.03906 ?  358 ARG A NH1   1 
ATOM   2781  N NH2   . ARG A 1 358 ? 204.23012 253.22696 122.41143 1.000 98.43476  ?  358 ARG A NH2   1 
ATOM   2782  N N     . PHE A 1 359 ? 195.40669 251.66647 121.49877 1.000 90.73207  ?  359 PHE A N     1 
ATOM   2783  C CA    . PHE A 1 359 ? 194.15578 252.25548 121.05201 1.000 94.11032  ?  359 PHE A CA    1 
ATOM   2784  C C     . PHE A 1 359 ? 193.09389 252.06578 122.11306 1.000 91.10679  ?  359 PHE A C     1 
ATOM   2785  O O     . PHE A 1 359 ? 192.86764 250.94218 122.58765 1.000 82.39175  ?  359 PHE A O     1 
ATOM   2786  C CB    . PHE A 1 359 ? 193.65992 251.63940 119.75958 1.000 94.69257  ?  359 PHE A CB    1 
ATOM   2787  C CG    . PHE A 1 359 ? 194.62874 251.71845 118.64492 1.000 89.55672  ?  359 PHE A CG    1 
ATOM   2788  C CD1   . PHE A 1 359 ? 194.66552 252.81604 117.80809 1.000 91.73020  ?  359 PHE A CD1   1 
ATOM   2789  C CD2   . PHE A 1 359 ? 195.51299 250.68641 118.43672 1.000 87.18688  ?  359 PHE A CD2   1 
ATOM   2790  C CE1   . PHE A 1 359 ? 195.56706 252.85870 116.75068 1.000 92.73097  ?  359 PHE A CE1   1 
ATOM   2791  C CE2   . PHE A 1 359 ? 196.39977 250.72277 117.41156 1.000 89.56961  ?  359 PHE A CE2   1 
ATOM   2792  C CZ    . PHE A 1 359 ? 196.43460 251.81174 116.55767 1.000 89.70250  ?  359 PHE A CZ    1 
ATOM   2793  N N     . PHE A 1 360 ? 192.42143 253.16600 122.43795 1.000 97.65496  ?  360 PHE A N     1 
ATOM   2794  C CA    . PHE A 1 360 ? 191.44527 253.19473 123.50931 1.000 100.14501 ?  360 PHE A CA    1 
ATOM   2795  C C     . PHE A 1 360 ? 190.23332 254.00586 123.06006 1.000 101.78146 ?  360 PHE A C     1 
ATOM   2796  O O     . PHE A 1 360 ? 190.32891 254.83313 122.14601 1.000 100.13499 ?  360 PHE A O     1 
ATOM   2797  C CB    . PHE A 1 360 ? 192.06041 253.80481 124.74933 1.000 97.34867  ?  360 PHE A CB    1 
ATOM   2798  C CG    . PHE A 1 360 ? 193.35347 253.16982 125.12483 1.000 97.24503  ?  360 PHE A CG    1 
ATOM   2799  C CD1   . PHE A 1 360 ? 193.37456 252.07887 125.96439 1.000 98.49405  ?  360 PHE A CD1   1 
ATOM   2800  C CD2   . PHE A 1 360 ? 194.56212 253.73416 124.71655 1.000 93.18114  ?  360 PHE A CD2   1 
ATOM   2801  C CE1   . PHE A 1 360 ? 194.56758 251.49366 126.32148 1.000 100.59846 ?  360 PHE A CE1   1 
ATOM   2802  C CE2   . PHE A 1 360 ? 195.75733 253.17816 125.08233 1.000 92.67200  ?  360 PHE A CE2   1 
ATOM   2803  C CZ    . PHE A 1 360 ? 195.76446 252.05075 125.88889 1.000 100.40391 ?  360 PHE A CZ    1 
ATOM   2804  N N     . ARG A 1 361 ? 189.08275 253.73792 123.69548 1.000 99.59102  ?  361 ARG A N     1 
ATOM   2805  C CA    . ARG A 1 361 ? 187.83807 254.43044 123.35182 1.000 100.77442 ?  361 ARG A CA    1 
ATOM   2806  C C     . ARG A 1 361 ? 187.87238 255.90459 123.74908 1.000 105.90898 ?  361 ARG A C     1 
ATOM   2807  O O     . ARG A 1 361 ? 187.29272 256.74932 123.05573 1.000 103.41995 ?  361 ARG A O     1 
ATOM   2808  C CB    . ARG A 1 361 ? 186.64446 253.74570 124.01466 1.000 99.59855  ?  361 ARG A CB    1 
ATOM   2809  C CG    . ARG A 1 361 ? 186.50610 252.27834 123.74048 1.000 100.25602 ?  361 ARG A CG    1 
ATOM   2810  C CD    . ARG A 1 361 ? 185.39703 251.69739 124.58065 1.000 103.50142 ?  361 ARG A CD    1 
ATOM   2811  N NE    . ARG A 1 361 ? 185.25034 250.26648 124.35586 1.000 105.69350 ?  361 ARG A NE    1 
ATOM   2812  C CZ    . ARG A 1 361 ? 185.87829 249.32443 125.04458 1.000 104.71527 ?  361 ARG A CZ    1 
ATOM   2813  N NH1   . ARG A 1 361 ? 186.72189 249.63045 126.01600 1.000 103.45642 ?  361 ARG A NH1   1 
ATOM   2814  N NH2   . ARG A 1 361 ? 185.65618 248.04393 124.74585 1.000 100.12746 ?  361 ARG A NH2   1 
ATOM   2815  N N     . ASP A 1 362 ? 188.41778 256.20910 124.93169 1.000 113.57493 ?  362 ASP A N     1 
ATOM   2816  C CA    . ASP A 1 362 ? 188.46513 257.56371 125.47783 1.000 112.18740 ?  362 ASP A CA    1 
ATOM   2817  C C     . ASP A 1 362 ? 189.82768 257.81089 126.12306 1.000 116.57802 ?  362 ASP A C     1 
ATOM   2818  O O     . ASP A 1 362 ? 190.51042 256.87451 126.55418 1.000 113.22227 ?  362 ASP A O     1 
ATOM   2819  C CB    . ASP A 1 362 ? 187.34483 257.77487 126.50887 1.000 117.88668 ?  362 ASP A CB    1 
ATOM   2820  C CG    . ASP A 1 362 ? 187.26967 256.64144 127.52584 1.000 118.85897 ?  362 ASP A CG    1 
ATOM   2821  O OD1   . ASP A 1 362 ? 186.92154 255.49595 127.15105 1.000 117.45934 ?  362 ASP A OD1   1 
ATOM   2822  O OD2   . ASP A 1 362 ? 187.58296 256.90109 128.70318 1.000 123.00234 ?  362 ASP A OD2   1 
ATOM   2823  N N     . GLU A 1 363 ? 190.17516 259.09530 126.27465 1.000 122.27740 ?  363 GLU A N     1 
ATOM   2824  C CA    . GLU A 1 363 ? 191.45188 259.47818 126.89285 1.000 123.08536 ?  363 GLU A CA    1 
ATOM   2825  C C     . GLU A 1 363 ? 191.56489 258.95990 128.32172 1.000 115.26316 ?  363 GLU A C     1 
ATOM   2826  O O     . GLU A 1 363 ? 192.66650 258.63802 128.78985 1.000 107.64177 ?  363 GLU A O     1 
ATOM   2827  C CB    . GLU A 1 363 ? 191.58574 261.00104 126.88582 1.000 121.88691 ?  363 GLU A CB    1 
ATOM   2828  C CG    . GLU A 1 363 ? 191.39173 261.62248 125.50716 1.000 123.60079 ?  363 GLU A CG    1 
ATOM   2829  C CD    . GLU A 1 363 ? 189.96993 262.12110 125.29819 1.000 132.91274 ?  363 GLU A CD    1 
ATOM   2830  O OE1   . GLU A 1 363 ? 189.09464 261.79219 126.13295 1.000 138.44844 ?  363 GLU A OE1   1 
ATOM   2831  O OE2   . GLU A 1 363 ? 189.72495 262.83474 124.30012 1.000 131.66693 ?  363 GLU A OE2   1 
ATOM   2832  N N     . LYS A 1 364 ? 190.43214 258.92356 129.03852 1.000 115.21374 ?  364 LYS A N     1 
ATOM   2833  C CA    . LYS A 1 364 ? 190.40722 258.41392 130.40879 1.000 121.96888 ?  364 LYS A CA    1 
ATOM   2834  C C     . LYS A 1 364 ? 190.81836 256.94178 130.47408 1.000 124.75249 ?  364 LYS A C     1 
ATOM   2835  O O     . LYS A 1 364 ? 191.45917 256.50945 131.44325 1.000 120.49558 ?  364 LYS A O     1 
ATOM   2836  C CB    . LYS A 1 364 ? 189.01660 258.60307 131.02962 1.000 116.96791 ?  364 LYS A CB    1 
ATOM   2837  C CG    . LYS A 1 364 ? 188.48956 260.01892 130.98013 1.000 121.31924 ?  364 LYS A CG    1 
ATOM   2838  C CD    . LYS A 1 364 ? 187.08871 260.12343 131.57787 1.000 129.43958 ?  364 LYS A CD    1 
ATOM   2839  C CE    . LYS A 1 364 ? 186.59622 261.56937 131.53150 1.000 128.32705 ?  364 LYS A CE    1 
ATOM   2840  N NZ    . LYS A 1 364 ? 185.23451 261.75871 132.10515 1.000 122.41184 ?  364 LYS A NZ    1 
ATOM   2841  N N     . GLU A 1 365 ? 190.38803 256.14146 129.49182 1.000 119.62857 ?  365 GLU A N     1 
ATOM   2842  C CA    . GLU A 1 365 ? 190.78408 254.73720 129.43042 1.000 113.15405 ?  365 GLU A CA    1 
ATOM   2843  C C     . GLU A 1 365 ? 192.28815 254.62136 129.22475 1.000 112.46510 ?  365 GLU A C     1 
ATOM   2844  O O     . GLU A 1 365 ? 192.91567 253.67101 129.70808 1.000 112.70807 ?  365 GLU A O     1 
ATOM   2845  C CB    . GLU A 1 365 ? 190.01594 254.03005 128.31030 1.000 110.35159 ?  365 GLU A CB    1 
ATOM   2846  C CG    . GLU A 1 365 ? 190.23227 252.50495 128.20550 1.000 112.82687 ?  365 GLU A CG    1 
ATOM   2847  C CD    . GLU A 1 365 ? 189.48933 251.83906 127.01429 1.000 120.27102 ?  365 GLU A CD    1 
ATOM   2848  O OE1   . GLU A 1 365 ? 188.72356 252.51903 126.28403 1.000 113.66513 ?  365 GLU A OE1   1 
ATOM   2849  O OE2   . GLU A 1 365 ? 189.70484 250.62378 126.79232 1.000 118.49154 ?  365 GLU A OE2   1 
ATOM   2850  N N     . LEU A 1 366 ? 192.86263 255.54558 128.43604 1.000 104.92727 ?  366 LEU A N     1 
ATOM   2851  C CA    . LEU A 1 366 ? 194.30633 255.58314 128.19415 1.000 105.46940 ?  366 LEU A CA    1 
ATOM   2852  C C     . LEU A 1 366 ? 195.09403 255.85796 129.47215 1.000 115.05230 ?  366 LEU A C     1 
ATOM   2853  O O     . LEU A 1 366 ? 196.17031 255.27789 129.69718 1.000 112.53844 ?  366 LEU A O     1 
ATOM   2854  C CB    . LEU A 1 366 ? 194.62521 256.64518 127.14396 1.000 99.71160  ?  366 LEU A CB    1 
ATOM   2855  C CG    . LEU A 1 366 ? 196.09015 256.67996 126.68724 1.000 104.39722 ?  366 LEU A CG    1 
ATOM   2856  C CD1   . LEU A 1 366 ? 196.23904 256.98706 125.19906 1.000 100.08963 ?  366 LEU A CD1   1 
ATOM   2857  C CD2   . LEU A 1 366 ? 196.90851 257.66666 127.54626 1.000 97.47375  ?  366 LEU A CD2   1 
ATOM   2858  N N     . GLN A 1 367 ? 194.62631 256.83577 130.25760 1.000 117.17079 ?  367 GLN A N     1 
ATOM   2859  C CA    . GLN A 1 367 ? 195.27373 257.17679 131.51866 1.000 116.69577 ?  367 GLN A CA    1 
ATOM   2860  C C     . GLN A 1 367 ? 195.17087 256.02209 132.50913 1.000 120.31342 ?  367 GLN A C     1 
ATOM   2861  O O     . GLN A 1 367 ? 196.11497 255.75494 133.26393 1.000 123.37801 ?  367 GLN A O     1 
ATOM   2862  C CB    . GLN A 1 367 ? 194.62681 258.43893 132.10110 1.000 113.31385 ?  367 GLN A CB    1 
ATOM   2863  C CG    . GLN A 1 367 ? 194.67968 259.66521 131.16649 1.000 123.84577 ?  367 GLN A CG    1 
ATOM   2864  C CD    . GLN A 1 367 ? 193.55297 260.67533 131.43889 1.000 131.50850 ?  367 GLN A CD    1 
ATOM   2865  O OE1   . GLN A 1 367 ? 192.85384 260.60103 132.46198 1.000 126.69820 ?  367 GLN A OE1   1 
ATOM   2866  N NE2   . GLN A 1 367 ? 193.29163 261.53468 130.45426 1.000 124.21658 ?  367 GLN A NE2   1 
ATOM   2867  N N     . GLU A 1 368 ? 194.01760 255.33362 132.52635 1.000 118.03112 ?  368 GLU A N     1 
ATOM   2868  C CA    . GLU A 1 368 ? 193.82213 254.21921 133.45493 1.000 126.09769 ?  368 GLU A CA    1 
ATOM   2869  C C     . GLU A 1 368 ? 194.76522 253.06183 133.15218 1.000 126.13820 ?  368 GLU A C     1 
ATOM   2870  O O     . GLU A 1 368 ? 195.25397 252.40008 134.08024 1.000 126.91322 ?  368 GLU A O     1 
ATOM   2871  C CB    . GLU A 1 368 ? 192.37021 253.72102 133.43411 1.000 132.81046 ?  368 GLU A CB    1 
ATOM   2872  C CG    . GLU A 1 368 ? 191.30945 254.69941 133.96370 1.000 137.46664 ?  368 GLU A CG    1 
ATOM   2873  C CD    . GLU A 1 368 ? 189.86420 254.24863 133.69376 1.000 142.95323 ?  368 GLU A CD    1 
ATOM   2874  O OE1   . GLU A 1 368 ? 189.64143 253.09421 133.24854 1.000 138.63891 ?  368 GLU A OE1   1 
ATOM   2875  O OE2   . GLU A 1 368 ? 188.94848 255.06652 133.93659 1.000 142.83555 ?  368 GLU A OE2   1 
ATOM   2876  N N     . TYR A 1 369 ? 194.97108 252.76005 131.85590 1.000 121.39796 ?  369 TYR A N     1 
ATOM   2877  C CA    . TYR A 1 369 ? 195.91303 251.71956 131.43905 1.000 123.08037 ?  369 TYR A CA    1 
ATOM   2878  C C     . TYR A 1 369 ? 197.36796 252.12070 131.66613 1.000 127.33513 ?  369 TYR A C     1 
ATOM   2879  O O     . TYR A 1 369 ? 198.19082 251.26417 132.02397 1.000 126.08890 ?  369 TYR A O     1 
ATOM   2880  C CB    . TYR A 1 369 ? 195.69147 251.37441 129.95456 1.000 114.11205 ?  369 TYR A CB    1 
ATOM   2881  C CG    . TYR A 1 369 ? 196.81751 250.55552 129.33980 1.000 109.72030 ?  369 TYR A CG    1 
ATOM   2882  C CD1   . TYR A 1 369 ? 196.96541 249.20281 129.62065 1.000 105.67596 ?  369 TYR A CD1   1 
ATOM   2883  C CD2   . TYR A 1 369 ? 197.74703 251.15192 128.47566 1.000 105.06645 ?  369 TYR A CD2   1 
ATOM   2884  C CE1   . TYR A 1 369 ? 198.01533 248.46157 129.06447 1.000 109.21135 ?  369 TYR A CE1   1 
ATOM   2885  C CE2   . TYR A 1 369 ? 198.78964 250.42275 127.91659 1.000 104.09078 ?  369 TYR A CE2   1 
ATOM   2886  C CZ    . TYR A 1 369 ? 198.92209 249.07606 128.20826 1.000 108.82802 ?  369 TYR A CZ    1 
ATOM   2887  O OH    . TYR A 1 369 ? 199.95833 248.34709 127.64714 1.000 101.98844 ?  369 TYR A OH    1 
ATOM   2888  N N     . GLU A 1 370 ? 197.68710 253.41719 131.57007 1.000 124.97647 ?  370 GLU A N     1 
ATOM   2889  C CA    . GLU A 1 370 ? 199.05895 253.84441 131.82041 1.000 126.74530 ?  370 GLU A CA    1 
ATOM   2890  C C     . GLU A 1 370 ? 199.38637 253.71559 133.30227 1.000 128.83622 ?  370 GLU A C     1 
ATOM   2891  O O     . GLU A 1 370 ? 200.52261 253.37796 133.66483 1.000 121.39328 ?  370 GLU A O     1 
ATOM   2892  C CB    . GLU A 1 370 ? 199.23600 255.29234 131.32289 1.000 118.03680 ?  370 GLU A CB    1 
ATOM   2893  C CG    . GLU A 1 370 ? 200.65009 255.87951 131.44845 1.000 126.13245 ?  370 GLU A CG    1 
ATOM   2894  C CD    . GLU A 1 370 ? 200.83759 256.67818 132.74756 1.000 142.01242 ?  370 GLU A CD    1 
ATOM   2895  O OE1   . GLU A 1 370 ? 199.81586 257.02591 133.38291 1.000 141.24683 ?  370 GLU A OE1   1 
ATOM   2896  O OE2   . GLU A 1 370 ? 201.99134 256.92864 133.16269 1.000 139.74381 ?  370 GLU A OE2   1 
ATOM   2897  N N     . ALA A 1 371 ? 198.35594 253.87162 134.14272 1.000 129.61089 ?  371 ALA A N     1 
ATOM   2898  C CA    . ALA A 1 371 ? 198.46809 253.84324 135.60067 1.000 132.29767 ?  371 ALA A CA    1 
ATOM   2899  C C     . ALA A 1 371 ? 198.68744 252.43909 136.18191 1.000 135.86342 ?  371 ALA A C     1 
ATOM   2900  O O     . ALA A 1 371 ? 199.48522 252.28299 137.11217 1.000 136.37858 ?  371 ALA A O     1 
ATOM   2901  C CB    . ALA A 1 371 ? 197.23383 254.50907 136.17835 1.000 126.05790 ?  371 ALA A CB    1 
ATOM   2902  N N     . ALA A 1 372 ? 197.98759 251.40991 135.69342 1.000 136.09512 ?  372 ALA A N     1 
ATOM   2903  C CA    . ALA A 1 372 ? 198.21943 250.05146 136.23979 1.000 135.01232 ?  372 ALA A CA    1 
ATOM   2904  C C     . ALA A 1 372 ? 199.18965 249.23066 135.37293 1.000 132.34931 ?  372 ALA A C     1 
ATOM   2905  O O     . ALA A 1 372 ? 200.27616 249.69824 135.00848 1.000 128.05791 ?  372 ALA A O     1 
ATOM   2906  C CB    . ALA A 1 372 ? 196.89375 249.27844 136.41347 1.000 121.38213 ?  372 ALA A CB    1 
ATOM   2907  N N     . GLU A 1 398 ? 210.49263 235.47508 129.21349 1.000 114.77332 ?  398 GLU A N     1 
ATOM   2908  C CA    . GLU A 1 398 ? 209.44198 236.32993 129.76806 1.000 121.89792 ?  398 GLU A CA    1 
ATOM   2909  C C     . GLU A 1 398 ? 209.75464 237.80227 129.48114 1.000 121.06656 ?  398 GLU A C     1 
ATOM   2910  O O     . GLU A 1 398 ? 208.93506 238.51573 128.89530 1.000 119.56958 ?  398 GLU A O     1 
ATOM   2911  C CB    . GLU A 1 398 ? 209.30168 236.07256 131.28664 1.000 122.14514 ?  398 GLU A CB    1 
ATOM   2912  C CG    . GLU A 1 398 ? 208.73351 234.67644 131.66396 1.000 119.64619 ?  398 GLU A CG    1 
ATOM   2913  C CD    . GLU A 1 398 ? 207.20261 234.56877 131.56070 1.000 122.22821 ?  398 GLU A CD    1 
ATOM   2914  O OE1   . GLU A 1 398 ? 206.51807 235.61473 131.55804 1.000 126.90799 ?  398 GLU A OE1   1 
ATOM   2915  O OE2   . GLU A 1 398 ? 206.68935 233.43838 131.40917 1.000 112.38787 ?  398 GLU A OE2   1 
ATOM   2916  N N     . THR A 1 399 ? 210.94295 238.24272 129.90076 1.000 119.29222 ?  399 THR A N     1 
ATOM   2917  C CA    . THR A 1 399 ? 211.43675 239.59136 129.63575 1.000 113.36486 ?  399 THR A CA    1 
ATOM   2918  C C     . THR A 1 399 ? 212.44224 239.55072 128.49069 1.000 102.12735 ?  399 THR A C     1 
ATOM   2919  O O     . THR A 1 399 ? 213.39097 238.75853 128.51918 1.000 101.22022 ?  399 THR A O     1 
ATOM   2920  C CB    . THR A 1 399 ? 212.07156 240.19650 130.89639 1.000 119.39892 ?  399 THR A CB    1 
ATOM   2921  O OG1   . THR A 1 399 ? 213.12527 239.34408 131.37147 1.000 118.08845 ?  399 THR A OG1   1 
ATOM   2922  C CG2   . THR A 1 399 ? 211.02808 240.38698 132.01049 1.000 112.85995 ?  399 THR A CG2   1 
ATOM   2923  N N     . ARG A 1 400 ? 212.24140 240.41185 127.49910 1.000 99.64747  ?  400 ARG A N     1 
ATOM   2924  C CA    . ARG A 1 400 ? 213.10980 240.48379 126.32827 1.000 102.33817 ?  400 ARG A CA    1 
ATOM   2925  C C     . ARG A 1 400 ? 214.13582 241.59205 126.52064 1.000 98.41439  ?  400 ARG A C     1 
ATOM   2926  O O     . ARG A 1 400 ? 213.79464 242.77495 126.45542 1.000 100.73928 ?  400 ARG A O     1 
ATOM   2927  C CB    . ARG A 1 400 ? 212.29614 240.71930 125.05842 1.000 101.60014 ?  400 ARG A CB    1 
ATOM   2928  C CG    . ARG A 1 400 ? 213.16728 240.86230 123.84399 1.000 89.63737  ?  400 ARG A CG    1 
ATOM   2929  C CD    . ARG A 1 400 ? 212.35417 241.07686 122.60778 1.000 87.92466  ?  400 ARG A CD    1 
ATOM   2930  N NE    . ARG A 1 400 ? 211.66254 239.86950 122.18165 1.000 90.36425  ?  400 ARG A NE    1 
ATOM   2931  C CZ    . ARG A 1 400 ? 210.86150 239.80675 121.12726 1.000 99.97560  ?  400 ARG A CZ    1 
ATOM   2932  N NH1   . ARG A 1 400 ? 210.63278 240.86949 120.36930 1.000 103.13509 ?  400 ARG A NH1   1 
ATOM   2933  N NH2   . ARG A 1 400 ? 210.29968 238.64270 120.80762 1.000 99.61474  ?  400 ARG A NH2   1 
ATOM   2934  N N     . SER A 1 401 ? 215.39084 241.22011 126.72624 1.000 94.89371  ?  401 SER A N     1 
ATOM   2935  C CA    . SER A 1 401 ? 216.41335 242.23644 126.87213 1.000 90.63580  ?  401 SER A CA    1 
ATOM   2936  C C     . SER A 1 401 ? 217.74189 241.63261 126.47824 1.000 90.00888  ?  401 SER A C     1 
ATOM   2937  O O     . SER A 1 401 ? 217.95448 240.43367 126.68991 1.000 89.86594  ?  401 SER A O     1 
ATOM   2938  C CB    . SER A 1 401 ? 216.50548 242.72805 128.30962 1.000 92.08844  ?  401 SER A CB    1 
ATOM   2939  O OG    . SER A 1 401 ? 217.19745 241.74614 129.07080 1.000 95.60260  ?  401 SER A OG    1 
ATOM   2940  N N     . PRO A 1 402 ? 218.68145 242.43769 125.98818 1.000 87.41974  ?  402 PRO A N     1 
ATOM   2941  C CA    . PRO A 1 402 ? 220.01503 241.88886 125.73923 1.000 85.91032  ?  402 PRO A CA    1 
ATOM   2942  C C     . PRO A 1 402 ? 220.59312 241.24014 126.97631 1.000 84.40062  ?  402 PRO A C     1 
ATOM   2943  O O     . PRO A 1 402 ? 221.11539 240.12531 126.89190 1.000 84.04442  ?  402 PRO A O     1 
ATOM   2944  C CB    . PRO A 1 402 ? 220.80280 243.11988 125.29919 1.000 87.11472  ?  402 PRO A CB    1 
ATOM   2945  C CG    . PRO A 1 402 ? 219.77413 243.99582 124.67352 1.000 87.29035  ?  402 PRO A CG    1 
ATOM   2946  C CD    . PRO A 1 402 ? 218.53412 243.80489 125.47578 1.000 89.15120  ?  402 PRO A CD    1 
ATOM   2947  N N     . GLU A 1 403 ? 220.41522 241.86284 128.14007 1.000 87.94852  ?  403 GLU A N     1 
ATOM   2948  C CA    . GLU A 1 403 ? 220.95688 241.32141 129.38363 1.000 91.79396  ?  403 GLU A CA    1 
ATOM   2949  C C     . GLU A 1 403 ? 220.36975 239.94709 129.69724 1.000 86.08939  ?  403 GLU A C     1 
ATOM   2950  O O     . GLU A 1 403 ? 221.09836 239.02228 130.07782 1.000 83.68454  ?  403 GLU A O     1 
ATOM   2951  C CB    . GLU A 1 403 ? 220.68528 242.30382 130.52197 1.000 91.25252  ?  403 GLU A CB    1 
ATOM   2952  C CG    . GLU A 1 403 ? 221.32810 243.67926 130.32486 1.000 99.02772  ?  403 GLU A CG    1 
ATOM   2953  C CD    . GLU A 1 403 ? 220.54322 244.56285 129.34950 1.000 101.55711 ?  403 GLU A CD    1 
ATOM   2954  O OE1   . GLU A 1 403 ? 219.38939 244.20067 129.03327 1.000 100.10593 ?  403 GLU A OE1   1 
ATOM   2955  O OE2   . GLU A 1 403 ? 221.06041 245.62509 128.92070 1.000 101.23122 ?  403 GLU A OE2   1 
ATOM   2956  N N     . ALA A 1 404 ? 219.05718 239.78750 129.52336 1.000 81.56542  ?  404 ALA A N     1 
ATOM   2957  C CA    . ALA A 1 404 ? 218.43032 238.50597 129.81685 1.000 77.58147  ?  404 ALA A CA    1 
ATOM   2958  C C     . ALA A 1 404 ? 218.95203 237.41586 128.89598 1.000 86.41290  ?  404 ALA A C     1 
ATOM   2959  O O     . ALA A 1 404 ? 219.21292 236.29182 129.33900 1.000 83.25524  ?  404 ALA A O     1 
ATOM   2960  C CB    . ALA A 1 404 ? 216.91184 238.61575 129.68899 1.000 82.39633  ?  404 ALA A CB    1 
ATOM   2961  N N     . VAL A 1 405 ? 219.07236 237.71617 127.59911 1.000 90.25819  ?  405 VAL A N     1 
ATOM   2962  C CA    . VAL A 1 405 ? 219.55821 236.71529 126.65629 1.000 84.34345  ?  405 VAL A CA    1 
ATOM   2963  C C     . VAL A 1 405 ? 221.00266 236.35783 126.95998 1.000 85.90828  ?  405 VAL A C     1 
ATOM   2964  O O     . VAL A 1 405 ? 221.36456 235.17772 126.98666 1.000 88.57673  ?  405 VAL A O     1 
ATOM   2965  C CB    . VAL A 1 405 ? 219.35510 237.19936 125.21031 1.000 78.52926  ?  405 VAL A CB    1 
ATOM   2966  C CG1   . VAL A 1 405 ? 219.89377 236.18993 124.21426 1.000 74.75004  ?  405 VAL A CG1   1 
ATOM   2967  C CG2   . VAL A 1 405 ? 217.87866 237.41109 124.98525 1.000 81.70897  ?  405 VAL A CG2   1 
ATOM   2968  N N     . TYR A 1 406 ? 221.83786 237.35446 127.25657 1.000 83.68169  ?  406 TYR A N     1 
ATOM   2969  C CA    . TYR A 1 406 ? 223.22466 237.04113 127.56668 1.000 80.21995  ?  406 TYR A CA    1 
ATOM   2970  C C     . TYR A 1 406 ? 223.32720 236.14754 128.79728 1.000 81.90623  ?  406 TYR A C     1 
ATOM   2971  O O     . TYR A 1 406 ? 224.07856 235.16291 128.79493 1.000 80.07975  ?  406 TYR A O     1 
ATOM   2972  C CB    . TYR A 1 406 ? 224.02146 238.31897 127.76230 1.000 80.41690  ?  406 TYR A CB    1 
ATOM   2973  C CG    . TYR A 1 406 ? 225.47283 238.06362 128.04512 1.000 79.59416  ?  406 TYR A CG    1 
ATOM   2974  C CD1   . TYR A 1 406 ? 226.31262 237.63175 127.03765 1.000 82.78440  ?  406 TYR A CD1   1 
ATOM   2975  C CD2   . TYR A 1 406 ? 226.01573 238.29555 129.30044 1.000 79.59082  ?  406 TYR A CD2   1 
ATOM   2976  C CE1   . TYR A 1 406 ? 227.63783 237.39668 127.27193 1.000 81.64245  ?  406 TYR A CE1   1 
ATOM   2977  C CE2   . TYR A 1 406 ? 227.34746 238.07288 129.54086 1.000 83.07533  ?  406 TYR A CE2   1 
ATOM   2978  C CZ    . TYR A 1 406 ? 228.15088 237.61665 128.51158 1.000 82.01115  ?  406 TYR A CZ    1 
ATOM   2979  O OH    . TYR A 1 406 ? 229.48587 237.36895 128.68057 1.000 85.38962  ?  406 TYR A OH    1 
ATOM   2980  N N     . THR A 1 407 ? 222.55494 236.44777 129.85107 1.000 89.81602  ?  407 THR A N     1 
ATOM   2981  C CA    . THR A 1 407 ? 222.60794 235.59425 131.03890 1.000 90.93519  ?  407 THR A CA    1 
ATOM   2982  C C     . THR A 1 407 ? 222.11140 234.18588 130.72297 1.000 88.55155  ?  407 THR A C     1 
ATOM   2983  O O     . THR A 1 407 ? 222.64243 233.20161 131.24863 1.000 91.33796  ?  407 THR A O     1 
ATOM   2984  C CB    . THR A 1 407 ? 221.79599 236.18024 132.20177 1.000 81.81603  ?  407 THR A CB    1 
ATOM   2985  O OG1   . THR A 1 407 ? 220.44452 236.42188 131.79724 1.000 88.17819  ?  407 THR A OG1   1 
ATOM   2986  C CG2   . THR A 1 407 ? 222.40650 237.48637 132.68838 1.000 83.41870  ?  407 THR A CG2   1 
ATOM   2987  N N     . ARG A 1 408 ? 221.08432 234.07068 129.87640 1.000 83.56690  ?  408 ARG A N     1 
ATOM   2988  C CA    . ARG A 1 408 ? 220.60207 232.75354 129.48363 1.000 81.37397  ?  408 ARG A CA    1 
ATOM   2989  C C     . ARG A 1 408 ? 221.71415 231.97059 128.79832 1.000 80.10881  ?  408 ARG A C     1 
ATOM   2990  O O     . ARG A 1 408 ? 221.92854 230.78956 129.09876 1.000 78.19761  ?  408 ARG A O     1 
ATOM   2991  C CB    . ARG A 1 408 ? 219.37968 232.90245 128.57087 1.000 86.33367  ?  408 ARG A CB    1 
ATOM   2992  C CG    . ARG A 1 408 ? 218.24893 231.87266 128.74060 1.000 87.37737  ?  408 ARG A CG    1 
ATOM   2993  C CD    . ARG A 1 408 ? 217.13201 232.12865 127.70304 1.000 91.77077  ?  408 ARG A CD    1 
ATOM   2994  N NE    . ARG A 1 408 ? 216.54613 233.45774 127.88766 1.000 98.60547  ?  408 ARG A NE    1 
ATOM   2995  C CZ    . ARG A 1 408 ? 216.16949 234.28172 126.91502 1.000 96.11464  ?  408 ARG A CZ    1 
ATOM   2996  N NH1   . ARG A 1 408 ? 216.26571 233.93984 125.63531 1.000 92.39914  ?  408 ARG A NH1   1 
ATOM   2997  N NH2   . ARG A 1 408 ? 215.71070 235.49235 127.23414 1.000 91.99349  ?  408 ARG A NH2   1 
ATOM   2998  N N     . ILE A 1 409 ? 222.46593 232.62951 127.90807 1.000 79.80553  ?  409 ILE A N     1 
ATOM   2999  C CA    . ILE A 1 409 ? 223.57291 231.96278 127.22766 1.000 79.94428  ?  409 ILE A CA    1 
ATOM   3000  C C     . ILE A 1 409 ? 224.60070 231.51067 128.23168 1.000 81.93516  ?  409 ILE A C     1 
ATOM   3001  O O     . ILE A 1 409 ? 225.03206 230.35400 128.21732 1.000 84.01655  ?  409 ILE A O     1 
ATOM   3002  C CB    . ILE A 1 409 ? 224.21981 232.90059 126.19195 1.000 78.84916  ?  409 ILE A CB    1 
ATOM   3003  C CG1   . ILE A 1 409 ? 223.24930 233.24067 125.08000 1.000 77.73337  ?  409 ILE A CG1   1 
ATOM   3004  C CG2   . ILE A 1 409 ? 225.54826 232.35289 125.65271 1.000 74.65377  ?  409 ILE A CG2   1 
ATOM   3005  C CD1   . ILE A 1 409 ? 223.80286 234.28619 124.23060 1.000 75.73659  ?  409 ILE A CD1   1 
ATOM   3006  N N     . MET A 1 410 ? 224.96043 232.40094 129.15927 1.000 79.15827  ?  410 MET A N     1 
ATOM   3007  C CA    . MET A 1 410 ? 225.99175 232.09250 130.14218 1.000 76.99534  ?  410 MET A CA    1 
ATOM   3008  C C     . MET A 1 410 ? 225.57568 230.92586 131.01274 1.000 78.60463  ?  410 MET A C     1 
ATOM   3009  O O     . MET A 1 410 ? 226.40216 230.07604 131.35611 1.000 79.49331  ?  410 MET A O     1 
ATOM   3010  C CB    . MET A 1 410 ? 226.26200 233.31272 131.01152 1.000 75.29960  ?  410 MET A CB    1 
ATOM   3011  C CG    . MET A 1 410 ? 226.80401 234.49026 130.25362 1.000 78.98579  ?  410 MET A CG    1 
ATOM   3012  S SD    . MET A 1 410 ? 228.41954 234.13962 129.58375 1.000 86.23170  ?  410 MET A SD    1 
ATOM   3013  C CE    . MET A 1 410 ? 228.02054 233.89382 127.86610 1.000 91.98206  ?  410 MET A CE    1 
ATOM   3014  N N     . MET A 1 411 ? 224.28903 230.84541 131.35501 1.000 80.77474  ?  411 MET A N     1 
ATOM   3015  C CA    . MET A 1 411 ? 223.85015 229.74831 132.20199 1.000 82.12620  ?  411 MET A CA    1 
ATOM   3016  C C     . MET A 1 411 ? 224.09971 228.41716 131.52455 1.000 84.35849  ?  411 MET A C     1 
ATOM   3017  O O     . MET A 1 411 ? 224.47270 227.44265 132.18377 1.000 93.90148  ?  411 MET A O     1 
ATOM   3018  C CB    . MET A 1 411 ? 222.38144 229.89047 132.56114 1.000 85.95426  ?  411 MET A CB    1 
ATOM   3019  C CG    . MET A 1 411 ? 222.10993 230.96907 133.58363 1.000 95.54621  ?  411 MET A CG    1 
ATOM   3020  S SD    . MET A 1 411 ? 220.40141 230.94909 134.17115 1.000 130.71897 ?  411 MET A SD    1 
ATOM   3021  C CE    . MET A 1 411 ? 220.43828 229.66100 135.43007 1.000 114.29211 ?  411 MET A CE    1 
ATOM   3022  N N     . ASN A 1 412 ? 223.92200 228.34980 130.21056 1.000 82.42882  ?  412 ASN A N     1 
ATOM   3023  C CA    . ASN A 1 412 ? 224.19425 227.11225 129.49353 1.000 82.30423  ?  412 ASN A CA    1 
ATOM   3024  C C     . ASN A 1 412 ? 225.62924 227.03485 128.98868 1.000 80.35359  ?  412 ASN A C     1 
ATOM   3025  O O     . ASN A 1 412 ? 225.90969 226.27560 128.05699 1.000 80.14685  ?  412 ASN A O     1 
ATOM   3026  C CB    . ASN A 1 412 ? 223.20191 226.93277 128.35313 1.000 86.47757  ?  412 ASN A CB    1 
ATOM   3027  C CG    . ASN A 1 412 ? 221.76059 226.96440 128.83695 1.000 94.07830  ?  412 ASN A CG    1 
ATOM   3028  O OD1   . ASN A 1 412 ? 221.19314 228.03652 129.09012 1.000 88.29042  ?  412 ASN A OD1   1 
ATOM   3029  N ND2   . ASN A 1 412 ? 221.17341 225.78208 129.01141 1.000 99.40906  ?  412 ASN A ND2   1 
ATOM   3030  N N     . GLY A 1 413 ? 226.51820 227.86750 129.51733 1.000 78.07773  ?  413 GLY A N     1 
ATOM   3031  C CA    . GLY A 1 413 ? 227.92241 227.78370 129.17424 1.000 75.88143  ?  413 GLY A CA    1 
ATOM   3032  C C     . GLY A 1 413 ? 228.22738 228.08963 127.73164 1.000 78.19833  ?  413 GLY A C     1 
ATOM   3033  O O     . GLY A 1 413 ? 229.23038 227.60336 127.20941 1.000 80.67594  ?  413 GLY A O     1 
ATOM   3034  N N     . GLY A 1 414 ? 227.40464 228.90516 127.07271 1.000 84.01682  ?  414 GLY A N     1 
ATOM   3035  C CA    . GLY A 1 414 ? 227.63130 229.18757 125.66522 1.000 83.78645  ?  414 GLY A CA    1 
ATOM   3036  C C     . GLY A 1 414 ? 227.42768 227.99040 124.77015 1.000 76.29376  ?  414 GLY A C     1 
ATOM   3037  O O     . GLY A 1 414 ? 228.04483 227.90932 123.71359 1.000 74.64592  ?  414 GLY A O     1 
ATOM   3038  N N     . ARG A 1 415 ? 226.61323 227.03701 125.20338 1.000 76.34041  ?  415 ARG A N     1 
ATOM   3039  C CA    . ARG A 1 415 ? 226.31593 225.81299 124.48309 1.000 78.18789  ?  415 ARG A CA    1 
ATOM   3040  C C     . ARG A 1 415 ? 224.85794 225.77933 124.03480 1.000 80.55091  ?  415 ARG A C     1 
ATOM   3041  O O     . ARG A 1 415 ? 223.96248 226.18317 124.78228 1.000 84.28194  ?  415 ARG A O     1 
ATOM   3042  C CB    . ARG A 1 415 ? 226.58929 224.60785 125.35685 1.000 82.02331  ?  415 ARG A CB    1 
ATOM   3043  C CG    . ARG A 1 415 ? 226.61729 223.34789 124.54678 1.000 88.70083  ?  415 ARG A CG    1 
ATOM   3044  C CD    . ARG A 1 415 ? 227.59025 222.42584 125.14483 1.000 91.02920  ?  415 ARG A CD    1 
ATOM   3045  N NE    . ARG A 1 415 ? 228.45496 221.87487 124.12336 1.000 91.72984  ?  415 ARG A NE    1 
ATOM   3046  C CZ    . ARG A 1 415 ? 229.70372 221.52099 124.36422 1.000 100.55418 ?  415 ARG A CZ    1 
ATOM   3047  N NH1   . ARG A 1 415 ? 230.24603 221.67982 125.56995 1.000 96.06832  ?  415 ARG A NH1   1 
ATOM   3048  N NH2   . ARG A 1 415 ? 230.41696 220.97108 123.38484 1.000 97.81884  ?  415 ARG A NH2   1 
ATOM   3049  N N     . LEU A 1 416 ? 224.62014 225.29017 122.81966 1.000 77.83486  ?  416 LEU A N     1 
ATOM   3050  C CA    . LEU A 1 416 ? 223.26108 225.23544 122.29730 1.000 78.34975  ?  416 LEU A CA    1 
ATOM   3051  C C     . LEU A 1 416 ? 222.38767 224.32454 123.15577 1.000 82.94120  ?  416 LEU A C     1 
ATOM   3052  O O     . LEU A 1 416 ? 222.85167 223.30509 123.67127 1.000 81.38915  ?  416 LEU A O     1 
ATOM   3053  C CB    . LEU A 1 416 ? 223.27472 224.77672 120.83745 1.000 76.29908  ?  416 LEU A CB    1 
ATOM   3054  C CG    . LEU A 1 416 ? 223.50880 225.85719 119.76669 1.000 78.80151  ?  416 LEU A CG    1 
ATOM   3055  C CD1   . LEU A 1 416 ? 223.68377 225.23928 118.40597 1.000 84.37616  ?  416 LEU A CD1   1 
ATOM   3056  C CD2   . LEU A 1 416 ? 222.34615 226.82959 119.71316 1.000 75.86494  ?  416 LEU A CD2   1 
ATOM   3057  N N     . LYS A 1 417 ? 221.13631 224.74729 123.36674 1.000 86.40065  ?  417 LYS A N     1 
ATOM   3058  C CA    . LYS A 1 417 ? 220.11038 223.95234 124.02726 1.000 80.91636  ?  417 LYS A CA    1 
ATOM   3059  C C     . LYS A 1 417 ? 219.62010 222.86832 123.07741 1.000 88.50584  ?  417 LYS A C     1 
ATOM   3060  O O     . LYS A 1 417 ? 219.71838 222.99424 121.85390 1.000 91.21285  ?  417 LYS A O     1 
ATOM   3061  C CB    . LYS A 1 417 ? 218.92438 224.81283 124.45981 1.000 86.10396  ?  417 LYS A CB    1 
ATOM   3062  C CG    . LYS A 1 417 ? 219.21517 225.86923 125.52876 1.000 91.18592  ?  417 LYS A CG    1 
ATOM   3063  C CD    . LYS A 1 417 ? 217.96840 226.71165 125.84817 1.000 91.32209  ?  417 LYS A CD    1 
ATOM   3064  C CE    . LYS A 1 417 ? 218.21718 227.65966 127.01264 1.000 96.23275  ?  417 LYS A CE    1 
ATOM   3065  N NZ    . LYS A 1 417 ? 217.17209 228.72159 127.09878 1.000 99.06883  ?  417 LYS A NZ    1 
ATOM   3066  N N     . ARG A 1 418 ? 219.06362 221.80217 123.65543 1.000 91.42121  ?  418 ARG A N     1 
ATOM   3067  C CA    . ARG A 1 418 ? 218.53905 220.71120 122.84210 1.000 90.05606  ?  418 ARG A CA    1 
ATOM   3068  C C     . ARG A 1 418 ? 217.43714 221.20878 121.92731 1.000 90.22479  ?  418 ARG A C     1 
ATOM   3069  O O     . ARG A 1 418 ? 217.43584 220.91283 120.72469 1.000 91.07451  ?  418 ARG A O     1 
ATOM   3070  C CB    . ARG A 1 418 ? 218.01215 219.61837 123.76711 1.000 98.26834  ?  418 ARG A CB    1 
ATOM   3071  C CG    . ARG A 1 418 ? 218.94717 218.44124 123.92356 1.000 104.94693 ?  418 ARG A CG    1 
ATOM   3072  C CD    . ARG A 1 418 ? 218.44695 217.43178 124.95970 1.000 112.99158 ?  418 ARG A CD    1 
ATOM   3073  N NE    . ARG A 1 418 ? 218.67287 217.90169 126.32666 1.000 118.83974 ?  418 ARG A NE    1 
ATOM   3074  C CZ    . ARG A 1 418 ? 218.73396 217.12318 127.40334 1.000 124.76819 ?  418 ARG A CZ    1 
ATOM   3075  N NH1   . ARG A 1 418 ? 218.60536 215.80826 127.31762 1.000 123.18397 ?  418 ARG A NH1   1 
ATOM   3076  N NH2   . ARG A 1 418 ? 218.93871 217.67853 128.59747 1.000 127.16867 ?  418 ARG A NH2   1 
ATOM   3077  N N     . SER A 1 419 ? 216.56093 222.06863 122.46462 1.000 89.76732  ?  419 SER A N     1 
ATOM   3078  C CA    . SER A 1 419 ? 215.46930 222.62729 121.67335 1.000 86.14532  ?  419 SER A CA    1 
ATOM   3079  C C     . SER A 1 419 ? 216.00711 223.42123 120.50067 1.000 82.57031  ?  419 SER A C     1 
ATOM   3080  O O     . SER A 1 419 ? 215.49741 223.30623 119.38454 1.000 80.82938  ?  419 SER A O     1 
ATOM   3081  C CB    . SER A 1 419 ? 214.57066 223.49833 122.55554 1.000 88.10279  ?  419 SER A CB    1 
ATOM   3082  O OG    . SER A 1 419 ? 215.31095 224.42773 123.33139 1.000 96.39052  ?  419 SER A OG    1 
ATOM   3083  N N     . HIS A 1 420 ? 217.08694 224.16929 120.72111 1.000 84.31328  ?  420 HIS A N     1 
ATOM   3084  C CA    . HIS A 1 420 ? 217.72707 224.87144 119.62489 1.000 81.54404  ?  420 HIS A CA    1 
ATOM   3085  C C     . HIS A 1 420 ? 218.11236 223.90522 118.53291 1.000 80.27426  ?  420 HIS A C     1 
ATOM   3086  O O     . HIS A 1 420 ? 217.85969 224.15542 117.35155 1.000 85.01485  ?  420 HIS A O     1 
ATOM   3087  C CB    . HIS A 1 420 ? 218.97893 225.58900 120.10077 1.000 83.71753  ?  420 HIS A CB    1 
ATOM   3088  C CG    . HIS A 1 420 ? 218.69628 226.70305 121.04381 1.000 86.27421  ?  420 HIS A CG    1 
ATOM   3089  N ND1   . HIS A 1 420 ? 219.67400 227.29724 121.80813 1.000 86.26629  ?  420 HIS A ND1   1 
ATOM   3090  C CD2   . HIS A 1 420 ? 217.53225 227.30050 121.38550 1.000 86.57812  ?  420 HIS A CD2   1 
ATOM   3091  C CE1   . HIS A 1 420 ? 219.13000 228.24043 122.55516 1.000 87.51798  ?  420 HIS A CE1   1 
ATOM   3092  N NE2   . HIS A 1 420 ? 217.83079 228.25942 122.31971 1.000 89.56602  ?  420 HIS A NE2   1 
ATOM   3093  N N     . ILE A 1 421 ? 218.73848 222.78985 118.89569 1.000 82.20078  ?  421 ILE A N     1 
ATOM   3094  C CA    . ILE A 1 421 ? 219.16364 221.89365 117.82796 1.000 87.59025  ?  421 ILE A CA    1 
ATOM   3095  C C     . ILE A 1 421 ? 217.95961 221.29098 117.12555 1.000 86.30264  ?  421 ILE A C     1 
ATOM   3096  O O     . ILE A 1 421 ? 217.89315 221.30135 115.89220 1.000 85.80478  ?  421 ILE A O     1 
ATOM   3097  C CB    . ILE A 1 421 ? 220.13330 220.82448 118.34150 1.000 83.57015  ?  421 ILE A CB    1 
ATOM   3098  C CG1   . ILE A 1 421 ? 221.33724 221.53650 118.96739 1.000 83.73540  ?  421 ILE A CG1   1 
ATOM   3099  C CG2   . ILE A 1 421 ? 220.54624 219.94960 117.16724 1.000 80.98118  ?  421 ILE A CG2   1 
ATOM   3100  C CD1   . ILE A 1 421 ? 222.60714 220.75113 119.00924 1.000 78.88064  ?  421 ILE A CD1   1 
ATOM   3101  N N     . ARG A 1 422 ? 216.94885 220.86241 117.89355 1.000 83.13898  ?  422 ARG A N     1 
ATOM   3102  C CA    . ARG A 1 422 ? 215.72983 220.29440 117.31242 1.000 84.61834  ?  422 ARG A CA    1 
ATOM   3103  C C     . ARG A 1 422 ? 215.07996 221.25836 116.32201 1.000 90.10643  ?  422 ARG A C     1 
ATOM   3104  O O     . ARG A 1 422 ? 214.71885 220.86791 115.20454 1.000 91.82923  ?  422 ARG A O     1 
ATOM   3105  C CB    . ARG A 1 422 ? 214.73873 219.93808 118.42847 1.000 87.08324  ?  422 ARG A CB    1 
ATOM   3106  C CG    . ARG A 1 422 ? 214.97755 218.59638 119.13582 1.000 92.57276  ?  422 ARG A CG    1 
ATOM   3107  C CD    . ARG A 1 422 ? 213.78210 218.14396 119.98497 1.000 92.16208  ?  422 ARG A CD    1 
ATOM   3108  N NE    . ARG A 1 422 ? 213.61967 219.00362 121.14931 1.000 99.21135  ?  422 ARG A NE    1 
ATOM   3109  C CZ    . ARG A 1 422 ? 214.14653 218.76149 122.34259 1.000 108.88660 ?  422 ARG A CZ    1 
ATOM   3110  N NH1   . ARG A 1 422 ? 214.88494 217.68729 122.56512 1.000 112.67126 ?  422 ARG A NH1   1 
ATOM   3111  N NH2   . ARG A 1 422 ? 213.94217 219.62870 123.33465 1.000 114.86518 ?  422 ARG A NH2   1 
ATOM   3112  N N     . ARG A 1 423 ? 214.94111 222.53008 116.70416 1.000 91.07844  ?  423 ARG A N     1 
ATOM   3113  C CA    . ARG A 1 423 ? 214.34034 223.50707 115.79815 1.000 88.78748  ?  423 ARG A CA    1 
ATOM   3114  C C     . ARG A 1 423 ? 215.16858 223.65188 114.52553 1.000 84.56898  ?  423 ARG A C     1 
ATOM   3115  O O     . ARG A 1 423 ? 214.63299 223.54617 113.41677 1.000 82.50832  ?  423 ARG A O     1 
ATOM   3116  C CB    . ARG A 1 423 ? 214.20613 224.85105 116.51581 1.000 82.85388  ?  423 ARG A CB    1 
ATOM   3117  C CG    . ARG A 1 423 ? 213.78088 225.99583 115.67716 1.000 73.67535  ?  423 ARG A CG    1 
ATOM   3118  C CD    . ARG A 1 423 ? 212.39170 225.82852 115.25299 1.000 73.68142  ?  423 ARG A CD    1 
ATOM   3119  N NE    . ARG A 1 423 ? 212.16710 226.72812 114.15081 1.000 80.59879  ?  423 ARG A NE    1 
ATOM   3120  C CZ    . ARG A 1 423 ? 210.98664 226.91803 113.59491 1.000 85.57802  ?  423 ARG A CZ    1 
ATOM   3121  N NH1   . ARG A 1 423 ? 209.91020 226.30424 114.05597 1.000 83.21994  ?  423 ARG A NH1   1 
ATOM   3122  N NH2   . ARG A 1 423 ? 210.88860 227.72348 112.53574 1.000 88.02168  ?  423 ARG A NH2   1 
ATOM   3123  N N     . TYR A 1 424 ? 216.49058 223.82781 114.67416 1.000 83.54139  ?  424 TYR A N     1 
ATOM   3124  C CA    . TYR A 1 424 ? 217.38032 223.96160 113.52091 1.000 84.48821  ?  424 TYR A CA    1 
ATOM   3125  C C     . TYR A 1 424 ? 217.25833 222.77335 112.58442 1.000 84.73554  ?  424 TYR A C     1 
ATOM   3126  O O     . TYR A 1 424 ? 217.33339 222.92838 111.35890 1.000 78.87644  ?  424 TYR A O     1 
ATOM   3127  C CB    . TYR A 1 424 ? 218.83673 224.10400 113.95689 1.000 85.94224  ?  424 TYR A CB    1 
ATOM   3128  C CG    . TYR A 1 424 ? 219.35832 225.50020 114.14860 1.000 77.71847  ?  424 TYR A CG    1 
ATOM   3129  C CD1   . TYR A 1 424 ? 219.13759 226.48179 113.20842 1.000 76.06362  ?  424 TYR A CD1   1 
ATOM   3130  C CD2   . TYR A 1 424 ? 220.12027 225.81291 115.24751 1.000 78.11712  ?  424 TYR A CD2   1 
ATOM   3131  C CE1   . TYR A 1 424 ? 219.64700 227.76114 113.37378 1.000 76.56510  ?  424 TYR A CE1   1 
ATOM   3132  C CE2   . TYR A 1 424 ? 220.62344 227.07517 115.43085 1.000 77.54148  ?  424 TYR A CE2   1 
ATOM   3133  C CZ    . TYR A 1 424 ? 220.38614 228.04611 114.49657 1.000 75.17118  ?  424 TYR A CZ    1 
ATOM   3134  O OH    . TYR A 1 424 ? 220.90053 229.30097 114.69417 1.000 75.07173  ?  424 TYR A OH    1 
ATOM   3135  N N     . VAL A 1 425 ? 217.19814 221.56137 113.14582 1.000 87.05847  ?  425 VAL A N     1 
ATOM   3136  C CA    . VAL A 1 425 ? 217.08864 220.38647 112.28903 1.000 89.02379  ?  425 VAL A CA    1 
ATOM   3137  C C     . VAL A 1 425 ? 215.73679 220.36741 111.60382 1.000 91.86800  ?  425 VAL A C     1 
ATOM   3138  O O     . VAL A 1 425 ? 215.63799 220.09940 110.39917 1.000 92.26880  ?  425 VAL A O     1 
ATOM   3139  C CB    . VAL A 1 425 ? 217.30452 219.08320 113.07902 1.000 87.77649  ?  425 VAL A CB    1 
ATOM   3140  C CG1   . VAL A 1 425 ? 217.16913 217.92025 112.13843 1.000 92.53496  ?  425 VAL A CG1   1 
ATOM   3141  C CG2   . VAL A 1 425 ? 218.67152 219.04356 113.78079 1.000 90.46815  ?  425 VAL A CG2   1 
ATOM   3142  N N     . SER A 1 426 ? 214.67710 220.69193 112.35067 1.000 88.79926  ?  426 SER A N     1 
ATOM   3143  C CA    . SER A 1 426 ? 213.34069 220.64890 111.77792 1.000 89.50109  ?  426 SER A CA    1 
ATOM   3144  C C     . SER A 1 426 ? 213.22690 221.60565 110.60246 1.000 86.83368  ?  426 SER A C     1 
ATOM   3145  O O     . SER A 1 426 ? 212.68918 221.24777 109.55245 1.000 87.98819  ?  426 SER A O     1 
ATOM   3146  C CB    . SER A 1 426 ? 212.30698 220.96967 112.85573 1.000 90.27291  ?  426 SER A CB    1 
ATOM   3147  O OG    . SER A 1 426 ? 211.00254 220.96572 112.30903 1.000 95.35264  ?  426 SER A OG    1 
ATOM   3148  N N     . VAL A 1 427 ? 213.78988 222.80085 110.73683 1.000 84.59420  ?  427 VAL A N     1 
ATOM   3149  C CA    . VAL A 1 427 ? 213.72763 223.77456 109.65812 1.000 76.14907  ?  427 VAL A CA    1 
ATOM   3150  C C     . VAL A 1 427 ? 214.55583 223.30922 108.47804 1.000 81.87329  ?  427 VAL A C     1 
ATOM   3151  O O     . VAL A 1 427 ? 214.15669 223.46481 107.32102 1.000 89.30225  ?  427 VAL A O     1 
ATOM   3152  C CB    . VAL A 1 427 ? 214.21401 225.14978 110.13920 1.000 77.62241  ?  427 VAL A CB    1 
ATOM   3153  C CG1   . VAL A 1 427 ? 214.25588 226.09697 108.97762 1.000 80.94933  ?  427 VAL A CG1   1 
ATOM   3154  C CG2   . VAL A 1 427 ? 213.34217 225.67649 111.24074 1.000 78.66612  ?  427 VAL A CG2   1 
ATOM   3155  N N     . SER A 1 428 ? 215.76816 222.82156 108.74414 1.000 87.45321  ?  428 SER A N     1 
ATOM   3156  C CA    . SER A 1 428 ? 216.67123 222.49312 107.64593 1.000 89.94921  ?  428 SER A CA    1 
ATOM   3157  C C     . SER A 1 428 ? 216.17859 221.29070 106.86812 1.000 93.97690  ?  428 SER A C     1 
ATOM   3158  O O     . SER A 1 428 ? 216.24624 221.26770 105.63489 1.000 97.16511  ?  428 SER A O     1 
ATOM   3159  C CB    . SER A 1 428 ? 218.07658 222.22978 108.17807 1.000 95.69758  ?  428 SER A CB    1 
ATOM   3160  O OG    . SER A 1 428 ? 218.09986 221.10232 109.05129 1.000 94.45750  ?  428 SER A OG    1 
ATOM   3161  N N     . SER A 1 429 ? 215.69110 220.27664 107.57184 1.000 93.19093  ?  429 SER A N     1 
ATOM   3162  C CA    . SER A 1 429 ? 215.31914 219.04541 106.89637 1.000 93.69322  ?  429 SER A CA    1 
ATOM   3163  C C     . SER A 1 429 ? 214.10168 219.24386 105.99488 1.000 95.05984  ?  429 SER A C     1 
ATOM   3164  O O     . SER A 1 429 ? 214.10124 218.78998 104.84157 1.000 102.64804 ?  429 SER A O     1 
ATOM   3165  C CB    . SER A 1 429 ? 215.07020 217.97159 107.94657 1.000 97.36867  ?  429 SER A CB    1 
ATOM   3166  O OG    . SER A 1 429 ? 214.06929 218.41120 108.84484 1.000 99.55050  ?  429 SER A OG    1 
ATOM   3167  N N     . ASN A 1 430 ? 213.08875 219.97701 106.47061 1.000 93.56869  ?  430 ASN A N     1 
ATOM   3168  C CA    . ASN A 1 430 ? 211.86056 220.22253 105.70551 1.000 90.49216  ?  430 ASN A CA    1 
ATOM   3169  C C     . ASN A 1 430 ? 212.06067 221.41735 104.76676 1.000 93.55528  ?  430 ASN A C     1 
ATOM   3170  O O     . ASN A 1 430 ? 211.24207 222.33687 104.66157 1.000 89.42564  ?  430 ASN A O     1 
ATOM   3171  C CB    . ASN A 1 430 ? 210.67166 220.44176 106.64207 1.000 95.17558  ?  430 ASN A CB    1 
ATOM   3172  C CG    . ASN A 1 430 ? 210.38378 219.23416 107.54355 1.000 106.77889 ?  430 ASN A CG    1 
ATOM   3173  O OD1   . ASN A 1 430 ? 210.53665 218.08060 107.13982 1.000 112.35825 ?  430 ASN A OD1   1 
ATOM   3174  N ND2   . ASN A 1 430 ? 209.90005 219.50876 108.75855 1.000 104.97863 ?  430 ASN A ND2   1 
ATOM   3175  N N     . HIS A 1 431 ? 213.16557 221.35987 104.03056 1.000 94.61629  ?  431 HIS A N     1 
ATOM   3176  C CA    . HIS A 1 431 ? 213.49215 222.39718 103.06576 1.000 93.56551  ?  431 HIS A CA    1 
ATOM   3177  C C     . HIS A 1 431 ? 214.41128 221.80150 102.02170 1.000 93.96577  ?  431 HIS A C     1 
ATOM   3178  O O     . HIS A 1 431 ? 215.24731 220.93744 102.31957 1.000 91.65636  ?  431 HIS A O     1 
ATOM   3179  C CB    . HIS A 1 431 ? 214.17870 223.60942 103.68768 1.000 88.98333  ?  431 HIS A CB    1 
ATOM   3180  C CG    . HIS A 1 431 ? 214.43210 224.71245 102.70992 1.000 88.10574  ?  431 HIS A CG    1 
ATOM   3181  N ND1   . HIS A 1 431 ? 213.51045 225.70487 102.45044 1.000 91.33210  ?  431 HIS A ND1   1 
ATOM   3182  C CD2   . HIS A 1 431 ? 215.48237 224.94849 101.88727 1.000 83.48645  ?  431 HIS A CD2   1 
ATOM   3183  C CE1   . HIS A 1 431 ? 213.99254 226.51920 101.52702 1.000 88.41211  ?  431 HIS A CE1   1 
ATOM   3184  N NE2   . HIS A 1 431 ? 215.18791 226.08272 101.16988 1.000 84.87330  ?  431 HIS A NE2   1 
ATOM   3185  N N     . GLN A 1 432 ? 214.24941 222.28951 100.79577 1.000 92.11363  ?  432 GLN A N     1 
ATOM   3186  C CA    . GLN A 1 432 ? 215.08143 221.85496 99.67962  1.000 97.03904  ?  432 GLN A CA    1 
ATOM   3187  C C     . GLN A 1 432 ? 216.40330 222.60065 99.82513  1.000 96.96890  ?  432 GLN A C     1 
ATOM   3188  O O     . GLN A 1 432 ? 216.56595 223.74361 99.38752  1.000 98.94396  ?  432 GLN A O     1 
ATOM   3189  C CB    . GLN A 1 432 ? 214.38876 222.11993 98.34602  1.000 101.80839 ?  432 GLN A CB    1 
ATOM   3190  C CG    . GLN A 1 432 ? 213.00586 221.48191 98.22903  1.000 107.59744 ?  432 GLN A CG    1 
ATOM   3191  C CD    . GLN A 1 432 ? 212.77299 220.80534 96.89059  1.000 112.30331 ?  432 GLN A CD    1 
ATOM   3192  O OE1   . GLN A 1 432 ? 213.45751 221.09258 95.91275  1.000 116.11550 ?  432 GLN A OE1   1 
ATOM   3193  N NE2   . GLN A 1 432 ? 211.76797 219.92941 96.83229  1.000 108.61893 ?  432 GLN A NE2   1 
ATOM   3194  N N     . ALA A 1 433 ? 217.34847 221.93879 100.48608 1.000 95.29182  ?  433 ALA A N     1 
ATOM   3195  C CA    . ALA A 1 433 ? 218.61037 222.57356 100.82409 1.000 93.26767  ?  433 ALA A CA    1 
ATOM   3196  C C     . ALA A 1 433 ? 219.38791 222.93015 99.56206  1.000 84.93221  ?  433 ALA A C     1 
ATOM   3197  O O     . ALA A 1 433 ? 219.73667 222.05243 98.77504  1.000 81.13098  ?  433 ALA A O     1 
ATOM   3198  C CB    . ALA A 1 433 ? 219.42742 221.62128 101.70927 1.000 93.33857  ?  433 ALA A CB    1 
ATOM   3199  N N     . ARG A 1 434 ? 219.71319 224.21285 99.40251  1.000 83.84195  ?  434 ARG A N     1 
ATOM   3200  C CA    . ARG A 1 434 ? 220.50045 224.63419 98.25387  1.000 88.24463  ?  434 ARG A CA    1 
ATOM   3201  C C     . ARG A 1 434 ? 221.98709 224.35784 98.48542  1.000 89.92514  ?  434 ARG A C     1 
ATOM   3202  O O     . ARG A 1 434 ? 222.40785 224.11290 99.61729  1.000 93.57063  ?  434 ARG A O     1 
ATOM   3203  C CB    . ARG A 1 434 ? 220.26454 226.11201 97.94152  1.000 91.28902  ?  434 ARG A CB    1 
ATOM   3204  C CG    . ARG A 1 434 ? 219.44108 226.35852 96.66068  1.000 91.93030  ?  434 ARG A CG    1 
ATOM   3205  C CD    . ARG A 1 434 ? 219.51643 227.82299 96.27008  1.000 93.07663  ?  434 ARG A CD    1 
ATOM   3206  N NE    . ARG A 1 434 ? 218.40005 228.58464 96.80386  1.000 96.80127  ?  434 ARG A NE    1 
ATOM   3207  C CZ    . ARG A 1 434 ? 217.32734 228.92053 96.10751  1.000 102.12074 ?  434 ARG A CZ    1 
ATOM   3208  N NH1   . ARG A 1 434 ? 217.20028 228.58944 94.83491  1.000 105.03693 ?  434 ARG A NH1   1 
ATOM   3209  N NH2   . ARG A 1 434 ? 216.35321 229.59782 96.70539  1.000 102.33581 ?  434 ARG A NH2   1 
ATOM   3210  N N     . PRO A 1 435 ? 222.81455 224.36630 97.39961  1.000 92.98782  ?  435 PRO A N     1 
ATOM   3211  C CA    . PRO A 1 435 ? 224.20230 223.89060 97.50800  1.000 96.61819  ?  435 PRO A CA    1 
ATOM   3212  C C     . PRO A 1 435 ? 224.99466 224.33967 98.72189  1.000 99.62059  ?  435 PRO A C     1 
ATOM   3213  O O     . PRO A 1 435 ? 225.35135 223.50860 99.56092  1.000 100.17812 ?  435 PRO A O     1 
ATOM   3214  C CB    . PRO A 1 435 ? 224.83746 224.44274 96.23128  1.000 98.46040  ?  435 PRO A CB    1 
ATOM   3215  C CG    . PRO A 1 435 ? 223.75421 224.36824 95.24824  1.000 103.46874 ?  435 PRO A CG    1 
ATOM   3216  C CD    . PRO A 1 435 ? 222.45533 224.60041 95.98993  1.000 95.85395  ?  435 PRO A CD    1 
ATOM   3217  N N     . ASN A 1 436 ? 225.26915 225.62457 98.86250  1.000 95.67964  ?  436 ASN A N     1 
ATOM   3218  C CA    . ASN A 1 436 ? 226.07347 226.07567 99.98808  1.000 94.48521  ?  436 ASN A CA    1 
ATOM   3219  C C     . ASN A 1 436 ? 225.24734 226.88717 100.95804 1.000 90.23257  ?  436 ASN A C     1 
ATOM   3220  O O     . ASN A 1 436 ? 225.74809 227.80762 101.60661 1.000 87.60965  ?  436 ASN A O     1 
ATOM   3221  C CB    . ASN A 1 436 ? 227.27280 226.88189 99.51528  1.000 101.21075 ?  436 ASN A CB    1 
ATOM   3222  C CG    . ASN A 1 436 ? 228.27750 226.03351 98.83180  1.000 109.19641 ?  436 ASN A CG    1 
ATOM   3223  O OD1   . ASN A 1 436 ? 228.89227 225.16517 99.46746  1.000 111.88879 ?  436 ASN A OD1   1 
ATOM   3224  N ND2   . ASN A 1 436 ? 228.47304 226.26457 97.53313  1.000 105.68307 ?  436 ASN A ND2   1 
ATOM   3225  N N     . SER A 1 437 ? 223.97157 226.57091 101.04039 1.000 87.74773  ?  437 SER A N     1 
ATOM   3226  C CA    . SER A 1 437 ? 223.10486 227.42672 101.81338 1.000 85.49997  ?  437 SER A CA    1 
ATOM   3227  C C     . SER A 1 437 ? 223.27110 227.20383 103.30679 1.000 82.83497  ?  437 SER A C     1 
ATOM   3228  O O     . SER A 1 437 ? 223.80906 226.19635 103.77977 1.000 82.56223  ?  437 SER A O     1 
ATOM   3229  C CB    . SER A 1 437 ? 221.64973 227.17394 101.46040 1.000 88.71224  ?  437 SER A CB    1 
ATOM   3230  O OG    . SER A 1 437 ? 221.23046 225.93772 102.02244 1.000 91.58550  ?  437 SER A OG    1 
ATOM   3231  N N     . PHE A 1 438 ? 222.69472 228.14817 104.04198 1.000 78.62613  ?  438 PHE A N     1 
ATOM   3232  C CA    . PHE A 1 438 ? 222.55301 228.01134 105.47424 1.000 76.82204  ?  438 PHE A CA    1 
ATOM   3233  C C     . PHE A 1 438 ? 221.76479 226.76317 105.80325 1.000 82.24806  ?  438 PHE A C     1 
ATOM   3234  O O     . PHE A 1 438 ? 222.05117 226.08424 106.79581 1.000 83.55334  ?  438 PHE A O     1 
ATOM   3235  C CB    . PHE A 1 438 ? 221.82166 229.23396 106.00274 1.000 75.19034  ?  438 PHE A CB    1 
ATOM   3236  C CG    . PHE A 1 438 ? 222.70297 230.38780 106.20120 1.000 77.28583  ?  438 PHE A CG    1 
ATOM   3237  C CD1   . PHE A 1 438 ? 222.98144 231.25135 105.16376 1.000 81.61839  ?  438 PHE A CD1   1 
ATOM   3238  C CD2   . PHE A 1 438 ? 223.26528 230.62422 107.42758 1.000 81.30005  ?  438 PHE A CD2   1 
ATOM   3239  C CE1   . PHE A 1 438 ? 223.81794 232.32485 105.34238 1.000 82.66022  ?  438 PHE A CE1   1 
ATOM   3240  C CE2   . PHE A 1 438 ? 224.10073 231.69220 107.62659 1.000 81.06767  ?  438 PHE A CE2   1 
ATOM   3241  C CZ    . PHE A 1 438 ? 224.37938 232.55312 106.57643 1.000 84.15094  ?  438 PHE A CZ    1 
ATOM   3242  N N     . ALA A 1 439 ? 220.77490 226.43884 104.96826 1.000 82.33140  ?  439 ALA A N     1 
ATOM   3243  C CA    . ALA A 1 439 ? 220.02174 225.20606 105.15093 1.000 84.40494  ?  439 ALA A CA    1 
ATOM   3244  C C     . ALA A 1 439 ? 220.92654 224.00167 105.03479 1.000 86.47359  ?  439 ALA A C     1 
ATOM   3245  O O     . ALA A 1 439 ? 220.90873 223.11276 105.89531 1.000 87.47956  ?  439 ALA A O     1 
ATOM   3246  C CB    . ALA A 1 439 ? 218.92294 225.10293 104.10265 1.000 81.52451  ?  439 ALA A CB    1 
ATOM   3247  N N     . GLU A 1 440 ? 221.76696 223.98425 104.00325 1.000 83.44136  ?  440 GLU A N     1 
ATOM   3248  C CA    . GLU A 1 440 ? 222.67199 222.86576 103.84846 1.000 87.40456  ?  440 GLU A CA    1 
ATOM   3249  C C     . GLU A 1 440 ? 223.60489 222.78083 105.04065 1.000 88.03280  ?  440 GLU A C     1 
ATOM   3250  O O     . GLU A 1 440 ? 223.78992 221.70172 105.61555 1.000 87.43676  ?  440 GLU A O     1 
ATOM   3251  C CB    . GLU A 1 440 ? 223.45264 223.01369 102.55149 1.000 94.09293  ?  440 GLU A CB    1 
ATOM   3252  C CG    . GLU A 1 440 ? 224.02601 221.71541 102.09187 1.000 101.97783 ?  440 GLU A CG    1 
ATOM   3253  C CD    . GLU A 1 440 ? 225.51552 221.79468 101.90308 1.000 114.66000 ?  440 GLU A CD    1 
ATOM   3254  O OE1   . GLU A 1 440 ? 226.10255 222.87044 102.17318 1.000 111.53964 ?  440 GLU A OE1   1 
ATOM   3255  O OE2   . GLU A 1 440 ? 226.10063 220.77952 101.48333 1.000 124.56296 ?  440 GLU A OE2   1 
ATOM   3256  N N     . PHE A 1 441 ? 224.12895 223.92748 105.48282 1.000 85.37251  ?  441 PHE A N     1 
ATOM   3257  C CA    . PHE A 1 441 ? 225.00653 223.93749 106.64851 1.000 82.39229  ?  441 PHE A CA    1 
ATOM   3258  C C     . PHE A 1 441 ? 224.28326 223.39819 107.88130 1.000 85.31217  ?  441 PHE A C     1 
ATOM   3259  O O     . PHE A 1 441 ? 224.85459 222.62915 108.66090 1.000 87.59392  ?  441 PHE A O     1 
ATOM   3260  C CB    . PHE A 1 441 ? 225.54084 225.34749 106.90005 1.000 79.25886  ?  441 PHE A CB    1 
ATOM   3261  C CG    . PHE A 1 441 ? 226.40083 225.46805 108.14448 1.000 80.03098  ?  441 PHE A CG    1 
ATOM   3262  C CD1   . PHE A 1 441 ? 225.82250 225.62923 109.39673 1.000 87.65927  ?  441 PHE A CD1   1 
ATOM   3263  C CD2   . PHE A 1 441 ? 227.78313 225.47493 108.05498 1.000 78.49629  ?  441 PHE A CD2   1 
ATOM   3264  C CE1   . PHE A 1 441 ? 226.60436 225.74201 110.52809 1.000 89.18207  ?  441 PHE A CE1   1 
ATOM   3265  C CE2   . PHE A 1 441 ? 228.57116 225.60275 109.19048 1.000 83.00221  ?  441 PHE A CE2   1 
ATOM   3266  C CZ    . PHE A 1 441 ? 227.98243 225.73520 110.42243 1.000 87.72597  ?  441 PHE A CZ    1 
ATOM   3267  N N     . LEU A 1 442 ? 223.03475 223.81558 108.09534 1.000 83.41273  ?  442 LEU A N     1 
ATOM   3268  C CA    . LEU A 1 442 ? 222.31318 223.35198 109.27358 1.000 85.08943  ?  442 LEU A CA    1 
ATOM   3269  C C     . LEU A 1 442 ? 222.07156 221.84978 109.21785 1.000 87.84809  ?  442 LEU A C     1 
ATOM   3270  O O     . LEU A 1 442 ? 222.22150 221.15033 110.22745 1.000 86.84629  ?  442 LEU A O     1 
ATOM   3271  C CB    . LEU A 1 442 ? 221.00820 224.11996 109.41594 1.000 85.35870  ?  442 LEU A CB    1 
ATOM   3272  C CG    . LEU A 1 442 ? 221.18537 225.53535 109.94567 1.000 81.19414  ?  442 LEU A CG    1 
ATOM   3273  C CD1   . LEU A 1 442 ? 219.86039 226.19260 109.88634 1.000 78.26334  ?  442 LEU A CD1   1 
ATOM   3274  C CD2   . LEU A 1 442 ? 221.66709 225.49645 111.37496 1.000 76.83733  ?  442 LEU A CD2   1 
ATOM   3275  N N     . ASN A 1 443 ? 221.72877 221.32532 108.04208 1.000 92.60893  ?  443 ASN A N     1 
ATOM   3276  C CA    . ASN A 1 443 ? 221.49605 219.88970 107.93653 1.000 93.37532  ?  443 ASN A CA    1 
ATOM   3277  C C     . ASN A 1 443 ? 222.76802 219.10985 108.21164 1.000 90.29160  ?  443 ASN A C     1 
ATOM   3278  O O     . ASN A 1 443 ? 222.78890 218.22659 109.07713 1.000 86.44627  ?  443 ASN A O     1 
ATOM   3279  C CB    . ASN A 1 443 ? 220.97041 219.56484 106.54614 1.000 99.68664  ?  443 ASN A CB    1 
ATOM   3280  C CG    . ASN A 1 443 ? 219.55395 219.10499 106.57622 1.000 106.41016 ?  443 ASN A CG    1 
ATOM   3281  O OD1   . ASN A 1 443 ? 219.07329 218.60777 107.60045 1.000 104.64968 ?  443 ASN A OD1   1 
ATOM   3282  N ND2   . ASN A 1 443 ? 218.83806 219.33871 105.48105 1.000 106.64050 ?  443 ASN A ND2   1 
ATOM   3283  N N     . LYS A 1 444 ? 223.86581 219.50759 107.55668 1.000 91.61831  ?  444 LYS A N     1 
ATOM   3284  C CA    . LYS A 1 444 ? 225.13133 218.78966 107.67613 1.000 90.00240  ?  444 LYS A CA    1 
ATOM   3285  C C     . LYS A 1 444 ? 225.67493 218.86676 109.09501 1.000 88.38335  ?  444 LYS A C     1 
ATOM   3286  O O     . LYS A 1 444 ? 226.27459 217.90421 109.57660 1.000 92.23685  ?  444 LYS A O     1 
ATOM   3287  C CB    . LYS A 1 444 ? 226.16917 219.36736 106.69422 1.000 92.60570  ?  444 LYS A CB    1 
ATOM   3288  C CG    . LYS A 1 444 ? 226.01905 218.93728 105.23274 1.000 98.45084  ?  444 LYS A CG    1 
ATOM   3289  C CD    . LYS A 1 444 ? 226.35331 217.47697 105.04806 1.000 105.05365 ?  444 LYS A CD    1 
ATOM   3290  C CE    . LYS A 1 444 ? 226.03543 216.98365 103.65504 1.000 108.12518 ?  444 LYS A CE    1 
ATOM   3291  N NZ    . LYS A 1 444 ? 226.21243 215.50834 103.66182 1.000 111.24892 ?  444 LYS A NZ    1 
ATOM   3292  N N     . THR A 1 445 ? 225.46801 219.99300 109.77965 1.000 82.60415  ?  445 THR A N     1 
ATOM   3293  C CA    . THR A 1 445 ? 226.08201 220.20333 111.08381 1.000 83.16451  ?  445 THR A CA    1 
ATOM   3294  C C     . THR A 1 445 ? 225.31406 219.49779 112.19406 1.000 86.92027  ?  445 THR A C     1 
ATOM   3295  O O     . THR A 1 445 ? 225.89645 218.75033 112.98274 1.000 91.43190  ?  445 THR A O     1 
ATOM   3296  C CB    . THR A 1 445 ? 226.16486 221.69450 111.38706 1.000 86.40639  ?  445 THR A CB    1 
ATOM   3297  O OG1   . THR A 1 445 ? 226.89528 222.34674 110.34764 1.000 78.93385  ?  445 THR A OG1   1 
ATOM   3298  C CG2   . THR A 1 445 ? 226.88803 221.91327 112.69369 1.000 90.88442  ?  445 THR A CG2   1 
ATOM   3299  N N     . TYR A 1 446 ? 224.01175 219.71533 112.26889 1.000 85.25940  ?  446 TYR A N     1 
ATOM   3300  C CA    . TYR A 1 446 ? 223.16821 219.20254 113.34446 1.000 87.38843  ?  446 TYR A CA    1 
ATOM   3301  C C     . TYR A 1 446 ? 222.19323 218.16607 112.80120 1.000 91.86442  ?  446 TYR A C     1 
ATOM   3302  O O     . TYR A 1 446 ? 221.33361 218.49535 111.98260 1.000 95.07875  ?  446 TYR A O     1 
ATOM   3303  C CB    . TYR A 1 446 ? 222.41946 220.34401 114.02244 1.000 86.54146  ?  446 TYR A CB    1 
ATOM   3304  C CG    . TYR A 1 446 ? 223.23500 221.57401 114.41687 1.000 87.10725  ?  446 TYR A CG    1 
ATOM   3305  C CD1   . TYR A 1 446 ? 223.87849 221.61680 115.64337 1.000 88.65111  ?  446 TYR A CD1   1 
ATOM   3306  C CD2   . TYR A 1 446 ? 223.38722 222.67720 113.56509 1.000 87.59349  ?  446 TYR A CD2   1 
ATOM   3307  C CE1   . TYR A 1 446 ? 224.61061 222.72647 116.04405 1.000 87.76494  ?  446 TYR A CE1   1 
ATOM   3308  C CE2   . TYR A 1 446 ? 224.14495 223.80632 113.95999 1.000 82.61094  ?  446 TYR A CE2   1 
ATOM   3309  C CZ    . TYR A 1 446 ? 224.75325 223.80766 115.20813 1.000 81.07751  ?  446 TYR A CZ    1 
ATOM   3310  O OH    . TYR A 1 446 ? 225.51060 224.85461 115.69069 1.000 78.56809  ?  446 TYR A OH    1 
ATOM   3311  N N     . SER A 1 447 ? 222.41448 216.89586 113.12365 1.000 98.20044  ?  447 SER A N     1 
ATOM   3312  C CA    . SER A 1 447 ? 221.47113 215.88055 112.67001 1.000 102.52852 ?  447 SER A CA    1 
ATOM   3313  C C     . SER A 1 447 ? 221.10057 214.90758 113.78484 1.000 113.45444 ?  447 SER A C     1 
ATOM   3314  O O     . SER A 1 447 ? 220.69399 215.32544 114.88336 1.000 105.13966 ?  447 SER A O     1 
ATOM   3315  C CB    . SER A 1 447 ? 222.03574 215.14121 111.45827 1.000 100.08604 ?  447 SER A CB    1 
ATOM   3316  O OG    . SER A 1 447 ? 221.90323 215.96281 110.31422 1.000 101.16363 ?  447 SER A OG    1 
ATOM   3317  N N     . SER A 1 448 ? 221.25305 213.61001 113.48204 1.000 116.10944 ?  448 SER A N     1 
ATOM   3318  C CA    . SER A 1 448 ? 221.03480 212.47166 114.38982 1.000 110.47868 ?  448 SER A CA    1 
ATOM   3319  C C     . SER A 1 448 ? 221.62497 212.69219 115.77783 1.000 106.85536 ?  448 SER A C     1 
ATOM   3320  O O     . SER A 1 448 ? 221.15873 212.10221 116.75503 1.000 115.84334 ?  448 SER A O     1 
ATOM   3321  C CB    . SER A 1 448 ? 221.63619 211.17987 113.79500 1.000 108.10761 ?  448 SER A CB    1 
ATOM   3322  O OG    . SER A 1 448 ? 221.38733 211.03410 112.40056 1.000 107.04076 ?  448 SER A OG    1 
ATOM   3323  N N     . LYS B 1 5   ? 221.45046 258.15791 123.95300 1.000 90.26219  ?  5   LYS B N     1 
ATOM   3324  C CA    . LYS B 1 5   ? 221.01302 258.66315 122.68531 1.000 88.86203  ?  5   LYS B CA    1 
ATOM   3325  C C     . LYS B 1 5   ? 220.54900 257.49994 121.79771 1.000 89.60338  ?  5   LYS B C     1 
ATOM   3326  O O     . LYS B 1 5   ? 220.25215 256.41676 122.28705 1.000 83.07947  ?  5   LYS B O     1 
ATOM   3327  C CB    . LYS B 1 5   ? 222.13948 259.44298 122.03612 1.000 93.57117  ?  5   LYS B CB    1 
ATOM   3328  C CG    . LYS B 1 5   ? 221.64169 260.49446 121.07692 1.000 105.86353 ?  5   LYS B CG    1 
ATOM   3329  C CD    . LYS B 1 5   ? 222.71253 260.94009 120.16407 1.000 103.47958 ?  5   LYS B CD    1 
ATOM   3330  C CE    . LYS B 1 5   ? 222.11736 261.60752 118.97774 1.000 96.80195  ?  5   LYS B CE    1 
ATOM   3331  N NZ    . LYS B 1 5   ? 223.24328 261.89329 118.07063 1.000 92.30251  ?  5   LYS B NZ    1 
ATOM   3332  N N     . ILE B 1 6   ? 220.45827 257.74696 120.49551 1.000 103.25301 ?  6   ILE B N     1 
ATOM   3333  C CA    . ILE B 1 6   ? 220.15991 256.71679 119.50731 1.000 103.35330 ?  6   ILE B CA    1 
ATOM   3334  C C     . ILE B 1 6   ? 221.43595 256.07055 118.96736 1.000 99.55403  ?  6   ILE B C     1 
ATOM   3335  O O     . ILE B 1 6   ? 221.42005 255.49501 117.89004 1.000 90.32898  ?  6   ILE B O     1 
ATOM   3336  C CB    . ILE B 1 6   ? 219.29648 257.27252 118.35908 1.000 102.15836 ?  6   ILE B CB    1 
ATOM   3337  C CG1   . ILE B 1 6   ? 219.99525 258.45373 117.66858 1.000 93.96012  ?  6   ILE B CG1   1 
ATOM   3338  C CG2   . ILE B 1 6   ? 217.90714 257.64340 118.83612 1.000 109.50812 ?  6   ILE B CG2   1 
ATOM   3339  C CD1   . ILE B 1 6   ? 219.13192 259.12207 116.57525 1.000 95.20350  ?  6   ILE B CD1   1 
ATOM   3340  N N     . VAL B 1 7   ? 222.53309 256.14948 119.70742 1.000 105.49218 ?  7   VAL B N     1 
ATOM   3341  C CA    . VAL B 1 7   ? 223.83508 255.68982 119.25530 1.000 98.79593  ?  7   VAL B CA    1 
ATOM   3342  C C     . VAL B 1 7   ? 224.31660 254.59099 120.20328 1.000 92.73889  ?  7   VAL B C     1 
ATOM   3343  O O     . VAL B 1 7   ? 223.99920 254.62555 121.39907 1.000 95.54804  ?  7   VAL B O     1 
ATOM   3344  C CB    . VAL B 1 7   ? 224.78859 256.90391 119.16049 1.000 106.88790 ?  7   VAL B CB    1 
ATOM   3345  C CG1   . VAL B 1 7   ? 225.40555 257.24941 120.45827 1.000 104.33593 ?  7   VAL B CG1   1 
ATOM   3346  C CG2   . VAL B 1 7   ? 225.84940 256.68170 118.17035 1.000 103.79787 ?  7   VAL B CG2   1 
ATOM   3347  N N     . PHE B 1 8   ? 225.00431 253.57995 119.65740 1.000 88.52395  ?  8   PHE B N     1 
ATOM   3348  C CA    . PHE B 1 8   ? 225.57014 252.47644 120.43763 1.000 95.88000  ?  8   PHE B CA    1 
ATOM   3349  C C     . PHE B 1 8   ? 227.07762 252.68262 120.49561 1.000 99.45468  ?  8   PHE B C     1 
ATOM   3350  O O     . PHE B 1 8   ? 227.66446 253.28870 119.59743 1.000 94.69391  ?  8   PHE B O     1 
ATOM   3351  C CB    . PHE B 1 8   ? 225.32541 251.11349 119.80334 1.000 82.14609  ?  8   PHE B CB    1 
ATOM   3352  C CG    . PHE B 1 8   ? 226.06476 250.96390 118.53869 1.000 92.59161  ?  8   PHE B CG    1 
ATOM   3353  C CD1   . PHE B 1 8   ? 225.48418 251.39572 117.35990 1.000 116.23416 ?  8   PHE B CD1   1 
ATOM   3354  C CD2   . PHE B 1 8   ? 227.38077 250.47850 118.49156 1.000 90.61584  ?  8   PHE B CD2   1 
ATOM   3355  C CE1   . PHE B 1 8   ? 226.17877 251.33575 116.14341 1.000 119.22334 ?  8   PHE B CE1   1 
ATOM   3356  C CE2   . PHE B 1 8   ? 228.08252 250.41371 117.27502 1.000 106.46092 ?  8   PHE B CE2   1 
ATOM   3357  C CZ    . PHE B 1 8   ? 227.47874 250.83877 116.10960 1.000 119.35783 ?  8   PHE B CZ    1 
ATOM   3358  N N     . LYS B 1 9   ? 227.70719 252.19374 121.55870 1.000 98.58391  ?  9   LYS B N     1 
ATOM   3359  C CA    . LYS B 1 9   ? 229.14279 252.37352 121.72349 1.000 93.07352  ?  9   LYS B CA    1 
ATOM   3360  C C     . LYS B 1 9   ? 229.91305 251.08974 122.02742 1.000 94.21041  ?  9   LYS B C     1 
ATOM   3361  O O     . LYS B 1 9   ? 229.64636 250.38694 123.00736 1.000 88.02270  ?  9   LYS B O     1 
ATOM   3362  C CB    . LYS B 1 9   ? 229.40460 253.35438 122.75729 1.000 92.68550  ?  9   LYS B CB    1 
ATOM   3363  C CG    . LYS B 1 9   ? 228.71585 252.98505 123.97117 1.000 96.73835  ?  9   LYS B CG    1 
ATOM   3364  C CD    . LYS B 1 9   ? 229.54551 253.54766 125.02629 1.000 112.30094 ?  9   LYS B CD    1 
ATOM   3365  C CE    . LYS B 1 9   ? 230.70945 252.58795 125.17458 1.000 114.38304 ?  9   LYS B CE    1 
ATOM   3366  N NZ    . LYS B 1 9   ? 230.05848 251.37551 125.69703 1.000 111.82155 ?  9   LYS B NZ    1 
ATOM   3367  N N     . VAL B 1 10  ? 230.95809 250.89539 121.22792 1.000 105.39699 ?  10  VAL B N     1 
ATOM   3368  C CA    . VAL B 1 10  ? 231.83823 249.73884 121.14622 1.000 97.32117  ?  10  VAL B CA    1 
ATOM   3369  C C     . VAL B 1 10  ? 233.19382 250.15157 121.71751 1.000 100.00842 ?  10  VAL B C     1 
ATOM   3370  O O     . VAL B 1 10  ? 233.48164 251.34495 121.84386 1.000 104.50596 ?  10  VAL B O     1 
ATOM   3371  C CB    . VAL B 1 10  ? 231.86240 249.19303 119.64786 1.000 86.95639  ?  10  VAL B CB    1 
ATOM   3372  C CG1   . VAL B 1 10  ? 232.21280 250.23159 118.56099 1.000 74.07281  ?  10  VAL B CG1   1 
ATOM   3373  C CG2   . VAL B 1 10  ? 232.83399 248.07653 119.51323 1.000 88.49602  ?  10  VAL B CG2   1 
ATOM   3374  N N     . ASN B 1 11  ? 233.93926 249.18656 122.25726 1.000 94.15058  ?  11  ASN B N     1 
ATOM   3375  C CA    . ASN B 1 11  ? 235.25994 249.47164 122.82776 1.000 105.87707 ?  11  ASN B CA    1 
ATOM   3376  C C     . ASN B 1 11  ? 236.31883 248.86076 121.92209 1.000 113.48918 ?  11  ASN B C     1 
ATOM   3377  O O     . ASN B 1 11  ? 236.40315 247.63664 121.80208 1.000 119.38690 ?  11  ASN B O     1 
ATOM   3378  C CB    . ASN B 1 11  ? 235.41255 248.94736 124.26089 1.000 111.64955 ?  11  ASN B CB    1 
ATOM   3379  C CG    . ASN B 1 11  ? 236.65764 249.52987 124.99840 1.000 117.47287 ?  11  ASN B CG    1 
ATOM   3380  O OD1   . ASN B 1 11  ? 237.36652 250.39133 124.47415 1.000 111.84998 ?  11  ASN B OD1   1 
ATOM   3381  N ND2   . ASN B 1 11  ? 236.89659 249.06163 126.23182 1.000 123.45663 ?  11  ASN B ND2   1 
ATOM   3382  N N     . ASN B 1 12  ? 237.06886 249.72349 121.22311 1.000 114.01967 ?  12  ASN B N     1 
ATOM   3383  C CA    . ASN B 1 12  ? 238.23807 249.33914 120.41886 1.000 113.89623 ?  12  ASN B CA    1 
ATOM   3384  C C     . ASN B 1 12  ? 239.49998 250.02929 120.99674 1.000 116.63401 ?  12  ASN B C     1 
ATOM   3385  O O     . ASN B 1 12  ? 239.88973 251.10906 120.54189 1.000 113.75572 ?  12  ASN B O     1 
ATOM   3386  C CB    . ASN B 1 12  ? 237.98431 249.66876 118.96791 1.000 109.17453 ?  12  ASN B CB    1 
ATOM   3387  C CG    . ASN B 1 12  ? 238.99133 249.04308 118.05772 1.000 122.56994 ?  12  ASN B CG    1 
ATOM   3388  O OD1   . ASN B 1 12  ? 239.81087 248.23162 118.48976 1.000 121.27392 ?  12  ASN B OD1   1 
ATOM   3389  N ND2   . ASN B 1 12  ? 238.91345 249.37473 116.77320 1.000 125.21690 ?  12  ASN B ND2   1 
ATOM   3390  N N     . GLN B 1 13  ? 240.17351 249.35273 121.94352 1.000 120.29515 ?  13  GLN B N     1 
ATOM   3391  C CA    . GLN B 1 13  ? 241.31717 249.82417 122.74119 1.000 117.29406 ?  13  GLN B CA    1 
ATOM   3392  C C     . GLN B 1 13  ? 240.99259 251.06017 123.57070 1.000 115.11748 ?  13  GLN B C     1 
ATOM   3393  O O     . GLN B 1 13  ? 241.36364 251.13511 124.74950 1.000 111.38711 ?  13  GLN B O     1 
ATOM   3394  C CB    . GLN B 1 13  ? 242.52274 250.13158 121.85420 1.000 111.81680 ?  13  GLN B CB    1 
ATOM   3395  C CG    . GLN B 1 13  ? 242.92402 248.94880 121.04948 1.000 113.16253 ?  13  GLN B CG    1 
ATOM   3396  C CD    . GLN B 1 13  ? 243.30527 247.80560 121.94670 1.000 124.15318 ?  13  GLN B CD    1 
ATOM   3397  O OE1   . GLN B 1 13  ? 243.93162 247.99623 122.99086 1.000 124.94917 ?  13  GLN B OE1   1 
ATOM   3398  N NE2   . GLN B 1 13  ? 242.94283 246.59422 121.53655 1.000 118.27223 ?  13  GLN B NE2   1 
ATOM   3399  N N     . VAL B 1 14  ? 240.29400 252.02195 122.96111 1.000 116.87984 ?  14  VAL B N     1 
ATOM   3400  C CA    . VAL B 1 14  ? 239.72110 253.17662 123.63991 1.000 117.58046 ?  14  VAL B CA    1 
ATOM   3401  C C     . VAL B 1 14  ? 238.23733 253.12828 123.29450 1.000 114.79856 ?  14  VAL B C     1 
ATOM   3402  O O     . VAL B 1 14  ? 237.82878 252.49412 122.31349 1.000 110.38271 ?  14  VAL B O     1 
ATOM   3403  C CB    . VAL B 1 14  ? 240.35117 254.53147 123.20221 1.000 120.96940 ?  14  VAL B CB    1 
ATOM   3404  C CG1   . VAL B 1 14  ? 240.17369 254.77228 121.66934 1.000 106.75604 ?  14  VAL B CG1   1 
ATOM   3405  C CG2   . VAL B 1 14  ? 239.84908 255.71381 124.08630 1.000 107.59886 ?  14  VAL B CG2   1 
ATOM   3406  N N     . VAL B 1 15  ? 237.43822 253.88574 124.04729 1.000 108.63323 ?  15  VAL B N     1 
ATOM   3407  C CA    . VAL B 1 15  ? 235.99310 253.83368 123.86610 1.000 103.55558 ?  15  VAL B CA    1 
ATOM   3408  C C     . VAL B 1 15  ? 235.60022 254.55919 122.58698 1.000 101.56839 ?  15  VAL B C     1 
ATOM   3409  O O     . VAL B 1 15  ? 236.04525 255.68499 122.32674 1.000 104.66945 ?  15  VAL B O     1 
ATOM   3410  C CB    . VAL B 1 15  ? 235.28818 254.40860 125.10109 1.000 96.32484  ?  15  VAL B CB    1 
ATOM   3411  C CG1   . VAL B 1 15  ? 233.79539 254.40734 124.90216 1.000 96.11752  ?  15  VAL B CG1   1 
ATOM   3412  C CG2   . VAL B 1 15  ? 235.60139 253.52534 126.30018 1.000 92.01263  ?  15  VAL B CG2   1 
ATOM   3413  N N     . SER B 1 16  ? 234.75184 253.91711 121.78383 1.000 96.32317  ?  16  SER B N     1 
ATOM   3414  C CA    . SER B 1 16  ? 234.35328 254.46809 120.50017 1.000 93.30754  ?  16  SER B CA    1 
ATOM   3415  C C     . SER B 1 16  ? 232.83705 254.50526 120.36062 1.000 96.56678  ?  16  SER B C     1 
ATOM   3416  O O     . SER B 1 16  ? 232.15272 253.52628 120.66087 1.000 97.12969  ?  16  SER B O     1 
ATOM   3417  C CB    . SER B 1 16  ? 234.95110 253.65916 119.36663 1.000 87.64991  ?  16  SER B CB    1 
ATOM   3418  O OG    . SER B 1 16  ? 234.45090 254.13150 118.12810 1.000 97.80835  ?  16  SER B OG    1 
ATOM   3419  N N     . LEU B 1 17  ? 232.31873 255.64417 119.90810 1.000 98.97472  ?  17  LEU B N     1 
ATOM   3420  C CA    . LEU B 1 17  ? 230.88797 255.85918 119.70497 1.000 97.73210  ?  17  LEU B CA    1 
ATOM   3421  C C     . LEU B 1 17  ? 230.59775 255.97182 118.21480 1.000 96.52367  ?  17  LEU B C     1 
ATOM   3422  O O     . LEU B 1 17  ? 231.13963 256.86058 117.54312 1.000 91.71288  ?  17  LEU B O     1 
ATOM   3423  C CB    . LEU B 1 17  ? 230.43852 257.13166 120.41975 1.000 102.41163 ?  17  LEU B CB    1 
ATOM   3424  C CG    . LEU B 1 17  ? 228.95528 257.46014 120.55847 1.000 103.35674 ?  17  LEU B CG    1 
ATOM   3425  C CD1   . LEU B 1 17  ? 228.43287 256.64697 121.71820 1.000 95.24908  ?  17  LEU B CD1   1 
ATOM   3426  C CD2   . LEU B 1 17  ? 228.71003 258.98421 120.77306 1.000 102.58931 ?  17  LEU B CD2   1 
ATOM   3427  N N     . LYS B 1 18  ? 229.71751 255.10288 117.71096 1.000 96.61032  ?  18  LYS B N     1 
ATOM   3428  C CA    . LYS B 1 18  ? 229.36823 255.09187 116.29789 1.000 96.98782  ?  18  LYS B CA    1 
ATOM   3429  C C     . LYS B 1 18  ? 227.85301 255.13046 116.11230 1.000 101.70194 ?  18  LYS B C     1 
ATOM   3430  O O     . LYS B 1 18  ? 227.12380 254.39201 116.78497 1.000 98.57351  ?  18  LYS B O     1 
ATOM   3431  C CB    . LYS B 1 18  ? 229.96800 253.85094 115.63514 1.000 85.93642  ?  18  LYS B CB    1 
ATOM   3432  C CG    . LYS B 1 18  ? 229.61847 253.68771 114.20676 1.000 86.53580  ?  18  LYS B CG    1 
ATOM   3433  C CD    . LYS B 1 18  ? 230.84690 253.19224 113.39680 1.000 103.28327 ?  18  LYS B CD    1 
ATOM   3434  C CE    . LYS B 1 18  ? 231.98349 254.24669 113.18450 1.000 106.57598 ?  18  LYS B CE    1 
ATOM   3435  N NZ    . LYS B 1 18  ? 233.06843 253.87340 112.16957 1.000 96.05388  ?  18  LYS B NZ    1 
ATOM   3436  N N     . PRO B 1 19  ? 227.33859 256.02086 115.27292 1.000 109.22182 ?  19  PRO B N     1 
ATOM   3437  C CA    . PRO B 1 19  ? 225.90740 256.00076 114.93045 1.000 103.79870 ?  19  PRO B CA    1 
ATOM   3438  C C     . PRO B 1 19  ? 225.61390 255.02082 113.80305 1.000 104.11928 ?  19  PRO B C     1 
ATOM   3439  O O     . PRO B 1 19  ? 226.37579 254.90118 112.83930 1.000 108.10865 ?  19  PRO B O     1 
ATOM   3440  C CB    . PRO B 1 19  ? 225.63580 257.44154 114.47301 1.000 108.08318 ?  19  PRO B CB    1 
ATOM   3441  C CG    . PRO B 1 19  ? 226.99894 257.95130 113.96866 1.000 114.88068 ?  19  PRO B CG    1 
ATOM   3442  C CD    . PRO B 1 19  ? 228.02516 257.25488 114.83063 1.000 112.11486 ?  19  PRO B CD    1 
ATOM   3443  N N     . GLU B 1 20  ? 224.52363 254.28416 113.93493 1.000 98.37068  ?  20  GLU B N     1 
ATOM   3444  C CA    . GLU B 1 20  ? 224.11944 253.32751 112.90871 1.000 99.18733  ?  20  GLU B CA    1 
ATOM   3445  C C     . GLU B 1 20  ? 223.16401 254.03522 111.94814 1.000 98.01148  ?  20  GLU B C     1 
ATOM   3446  O O     . GLU B 1 20  ? 222.28519 254.76612 112.40073 1.000 103.49582 ?  20  GLU B O     1 
ATOM   3447  C CB    . GLU B 1 20  ? 223.48920 252.09787 113.55967 1.000 94.80937  ?  20  GLU B CB    1 
ATOM   3448  C CG    . GLU B 1 20  ? 222.09895 252.30188 114.12513 1.000 100.53355 ?  20  GLU B CG    1 
ATOM   3449  C CD    . GLU B 1 20  ? 222.04374 253.12288 115.40273 1.000 113.14296 ?  20  GLU B CD    1 
ATOM   3450  O OE1   . GLU B 1 20  ? 223.10753 253.34612 116.01568 1.000 118.10689 ?  20  GLU B OE1   1 
ATOM   3451  O OE2   . GLU B 1 20  ? 220.91392 253.43395 115.86228 1.000 113.87049 ?  20  GLU B OE2   1 
ATOM   3452  N N     . ILE B 1 21  ? 223.39213 253.93103 110.63794 1.000 92.28890  ?  21  ILE B N     1 
ATOM   3453  C CA    . ILE B 1 21  ? 222.56458 254.62003 109.63845 1.000 101.18480 ?  21  ILE B CA    1 
ATOM   3454  C C     . ILE B 1 21  ? 221.90761 253.57055 108.72872 1.000 106.73274 ?  21  ILE B C     1 
ATOM   3455  O O     . ILE B 1 21  ? 222.57684 252.64050 108.26090 1.000 106.81837 ?  21  ILE B O     1 
ATOM   3456  C CB    . ILE B 1 21  ? 223.37739 255.65726 108.82147 1.000 103.60705 ?  21  ILE B CB    1 
ATOM   3457  C CG1   . ILE B 1 21  ? 224.70147 255.05108 108.32224 1.000 106.94702 ?  21  ILE B CG1   1 
ATOM   3458  C CG2   . ILE B 1 21  ? 223.58471 256.99891 109.57540 1.000 83.57160  ?  21  ILE B CG2   1 
ATOM   3459  C CD1   . ILE B 1 21  ? 225.63617 256.02467 107.58530 1.000 102.50809 ?  21  ILE B CD1   1 
ATOM   3460  N N     . ILE B 1 22  ? 220.58101 253.66122 108.56813 1.000 107.91986 ?  22  ILE B N     1 
ATOM   3461  C CA    . ILE B 1 22  ? 219.79312 252.76857 107.71454 1.000 107.48207 ?  22  ILE B CA    1 
ATOM   3462  C C     . ILE B 1 22  ? 218.75440 253.61848 106.97173 1.000 116.49095 ?  22  ILE B C     1 
ATOM   3463  O O     . ILE B 1 22  ? 218.39287 254.70504 107.43392 1.000 124.44565 ?  22  ILE B O     1 
ATOM   3464  C CB    . ILE B 1 22  ? 219.16118 251.63487 108.55751 1.000 94.68111  ?  22  ILE B CB    1 
ATOM   3465  C CG1   . ILE B 1 22  ? 218.23903 252.23392 109.62755 1.000 98.58244  ?  22  ILE B CG1   1 
ATOM   3466  C CG2   . ILE B 1 22  ? 220.26062 250.81480 109.21711 1.000 84.51324  ?  22  ILE B CG2   1 
ATOM   3467  C CD1   . ILE B 1 22  ? 217.46477 251.23012 110.48983 1.000 101.67216 ?  22  ILE B CD1   1 
ATOM   3468  N N     . VAL B 1 23  ? 218.30968 253.17131 105.78843 1.000 112.07244 ?  23  VAL B N     1 
ATOM   3469  C CA    . VAL B 1 23  ? 217.39675 253.96806 104.95417 1.000 113.20499 ?  23  VAL B CA    1 
ATOM   3470  C C     . VAL B 1 23  ? 215.94704 253.54237 105.18420 1.000 117.52446 ?  23  VAL B C     1 
ATOM   3471  O O     . VAL B 1 23  ? 215.60284 252.36919 105.00046 1.000 115.01109 ?  23  VAL B O     1 
ATOM   3472  C CB    . VAL B 1 23  ? 217.78778 253.85681 103.46740 1.000 108.29562 ?  23  VAL B CB    1 
ATOM   3473  C CG1   . VAL B 1 23  ? 217.86930 252.39213 103.04905 1.000 94.35428  ?  23  VAL B CG1   1 
ATOM   3474  C CG2   . VAL B 1 23  ? 216.77661 254.62886 102.56032 1.000 100.16803 ?  23  VAL B CG2   1 
ATOM   3475  N N     . ASP B 1 24  ? 215.08086 254.50902 105.59470 1.000 119.63343 ?  24  ASP B N     1 
ATOM   3476  C CA    . ASP B 1 24  ? 213.62125 254.25843 105.75585 1.000 124.22141 ?  24  ASP B CA    1 
ATOM   3477  C C     . ASP B 1 24  ? 212.84484 255.57061 105.55890 1.000 122.32524 ?  24  ASP B C     1 
ATOM   3478  O O     . ASP B 1 24  ? 212.37028 256.22720 106.48701 1.000 126.04219 ?  24  ASP B O     1 
ATOM   3479  C CB    . ASP B 1 24  ? 213.26946 253.63595 107.11423 1.000 118.59429 ?  24  ASP B CB    1 
ATOM   3480  C CG    . ASP B 1 24  ? 214.02212 254.27375 108.27340 1.000 125.70208 ?  24  ASP B CG    1 
ATOM   3481  O OD1   . ASP B 1 24  ? 214.63760 255.34233 108.05814 1.000 134.26775 ?  24  ASP B OD1   1 
ATOM   3482  O OD2   . ASP B 1 24  ? 213.98600 253.72639 109.40181 1.000 126.09537 ?  24  ASP B OD2   1 
ATOM   3483  N N     . GLN B 1 25  ? 212.65039 255.97835 104.31239 1.000 120.38021 ?  25  GLN B N     1 
ATOM   3484  C CA    . GLN B 1 25  ? 211.90509 257.19600 104.01034 1.000 124.32184 ?  25  GLN B CA    1 
ATOM   3485  C C     . GLN B 1 25  ? 210.88773 256.89281 102.92281 1.000 131.32532 ?  25  GLN B C     1 
ATOM   3486  O O     . GLN B 1 25  ? 211.21523 256.20282 101.95032 1.000 136.25976 ?  25  GLN B O     1 
ATOM   3487  C CB    . GLN B 1 25  ? 212.84424 258.33482 103.59729 1.000 125.84189 ?  25  GLN B CB    1 
ATOM   3488  C CG    . GLN B 1 25  ? 212.15263 259.64372 103.25366 1.000 120.96693 ?  25  GLN B CG    1 
ATOM   3489  C CD    . GLN B 1 25  ? 213.13476 260.79482 103.14406 1.000 124.69108 ?  25  GLN B CD    1 
ATOM   3490  O OE1   . GLN B 1 25  ? 214.28753 260.69013 103.58101 1.000 122.77041 ?  25  GLN B OE1   1 
ATOM   3491  N NE2   . GLN B 1 25  ? 212.70133 261.88351 102.51600 1.000 126.99345 ?  25  GLN B NE2   1 
ATOM   3492  N N     . HIS B 1 26  ? 209.65090 257.36839 103.10752 1.000 132.75535 ?  26  HIS B N     1 
ATOM   3493  C CA    . HIS B 1 26  ? 208.59470 257.14955 102.12138 1.000 130.41713 ?  26  HIS B CA    1 
ATOM   3494  C C     . HIS B 1 26  ? 207.43577 258.12230 102.36759 1.000 127.12754 ?  26  HIS B C     1 
ATOM   3495  O O     . HIS B 1 26  ? 207.13255 258.45779 103.51892 1.000 130.75263 ?  26  HIS B O     1 
ATOM   3496  C CB    . HIS B 1 26  ? 208.06432 255.71064 102.16012 1.000 128.04573 ?  26  HIS B CB    1 
ATOM   3497  C CG    . HIS B 1 26  ? 207.53128 255.25232 100.84443 1.000 126.51490 ?  26  HIS B CG    1 
ATOM   3498  N ND1   . HIS B 1 26  ? 206.23732 255.50249 100.43868 1.000 126.17654 ?  26  HIS B ND1   1 
ATOM   3499  C CD2   . HIS B 1 26  ? 208.09503 254.49902 99.87024  1.000 130.57141 ?  26  HIS B CD2   1 
ATOM   3500  C CE1   . HIS B 1 26  ? 206.04498 254.97259 99.24289  1.000 127.07776 ?  26  HIS B CE1   1 
ATOM   3501  N NE2   . HIS B 1 26  ? 207.15167 254.34622 98.88145  1.000 132.68803 ?  26  HIS B NE2   1 
ATOM   3502  N N     . GLU B 1 27  ? 206.83754 258.62390 101.27950 1.000 114.19493 ?  27  GLU B N     1 
ATOM   3503  C CA    . GLU B 1 27  ? 205.69022 259.53199 101.33366 1.000 110.60263 ?  27  GLU B CA    1 
ATOM   3504  C C     . GLU B 1 27  ? 204.46430 258.90464 100.66929 1.000 113.16708 ?  27  GLU B C     1 
ATOM   3505  O O     . GLU B 1 27  ? 204.58872 258.08587 99.74414  1.000 116.45341 ?  27  GLU B O     1 
ATOM   3506  C CB    . GLU B 1 27  ? 206.01355 260.87464 100.63667 1.000 113.85661 ?  27  GLU B CB    1 
ATOM   3507  C CG    . GLU B 1 27  ? 205.86932 260.83384 99.10225  1.000 125.07636 ?  27  GLU B CG    1 
ATOM   3508  C CD    . GLU B 1 27  ? 206.88818 259.93250 98.39287  1.000 133.99443 ?  27  GLU B CD    1 
ATOM   3509  O OE1   . GLU B 1 27  ? 208.05455 259.85630 98.83718  1.000 137.53601 ?  27  GLU B OE1   1 
ATOM   3510  O OE2   . GLU B 1 27  ? 206.49809 259.26148 97.40415  1.000 127.91687 ?  27  GLU B OE2   1 
ATOM   3511  N N     . TYR B 1 28  ? 203.26868 259.31368 101.12351 1.000 102.64341 ?  28  TYR B N     1 
ATOM   3512  C CA    . TYR B 1 28  ? 201.98692 258.83680 100.59032 1.000 102.83369 ?  28  TYR B CA    1 
ATOM   3513  C C     . TYR B 1 28  ? 201.05252 260.01493 100.38778 1.000 99.37566  ?  28  TYR B C     1 
ATOM   3514  O O     . TYR B 1 28  ? 200.95555 260.88132 101.25740 1.000 103.67928 ?  28  TYR B O     1 
ATOM   3515  C CB    . TYR B 1 28  ? 201.29584 257.82354 101.50707 1.000 94.32811  ?  28  TYR B CB    1 
ATOM   3516  C CG    . TYR B 1 28  ? 201.86758 256.42673 101.49523 1.000 91.00527  ?  28  TYR B CG    1 
ATOM   3517  C CD1   . TYR B 1 28  ? 201.54867 255.53124 100.48784 1.000 92.53727  ?  28  TYR B CD1   1 
ATOM   3518  C CD2   . TYR B 1 28  ? 202.75596 256.01746 102.47362 1.000 93.37779  ?  28  TYR B CD2   1 
ATOM   3519  C CE1   . TYR B 1 28  ? 202.06215 254.24906 100.48434 1.000 97.57501  ?  28  TYR B CE1   1 
ATOM   3520  C CE2   . TYR B 1 28  ? 203.28657 254.75276 102.46844 1.000 93.33886  ?  28  TYR B CE2   1 
ATOM   3521  C CZ    . TYR B 1 28  ? 202.93794 253.86765 101.47674 1.000 96.45891  ?  28  TYR B CZ    1 
ATOM   3522  O OH    . TYR B 1 28  ? 203.46996 252.59927 101.48230 1.000 101.45917 ?  28  TYR B OH    1 
ATOM   3523  N N     . LYS B 1 29  ? 200.41877 260.07486 99.21799  1.000 92.48372  ?  29  LYS B N     1 
ATOM   3524  C CA    . LYS B 1 29  ? 199.47800 261.12939 98.85989  1.000 98.00507  ?  29  LYS B CA    1 
ATOM   3525  C C     . LYS B 1 29  ? 198.03404 260.63261 98.91605  1.000 101.15123 ?  29  LYS B C     1 
ATOM   3526  O O     . LYS B 1 29  ? 197.72356 259.57505 98.35976  1.000 103.76432 ?  29  LYS B O     1 
ATOM   3527  C CB    . LYS B 1 29  ? 199.79881 261.61126 97.44300  1.000 114.61225 ?  29  LYS B CB    1 
ATOM   3528  C CG    . LYS B 1 29  ? 201.22598 262.12897 97.26147  1.000 124.98091 ?  29  LYS B CG    1 
ATOM   3529  C CD    . LYS B 1 29  ? 201.84780 261.60054 95.95832  1.000 129.08023 ?  29  LYS B CD    1 
ATOM   3530  C CE    . LYS B 1 29  ? 202.10010 260.06055 95.95473  1.000 116.66819 ?  29  LYS B CE    1 
ATOM   3531  N NZ    . LYS B 1 29  ? 203.04181 259.43740 96.96615  1.000 114.54428 ?  29  LYS B NZ    1 
ATOM   3532  N N     . TYR B 1 30  ? 197.16267 261.41723 99.44551  1.000 100.55680 ?  30  TYR B N     1 
ATOM   3533  C CA    . TYR B 1 30  ? 195.76790 260.98871 99.54136  1.000 96.16074  ?  30  TYR B CA    1 
ATOM   3534  C C     . TYR B 1 30  ? 194.93558 261.57441 98.38834  1.000 97.56220  ?  30  TYR B C     1 
ATOM   3535  O O     . TYR B 1 30  ? 195.37706 262.50054 97.68700  1.000 89.56523  ?  30  TYR B O     1 
ATOM   3536  C CB    . TYR B 1 30  ? 195.16449 261.38222 100.90155 1.000 89.21652  ?  30  TYR B CB    1 
ATOM   3537  C CG    . TYR B 1 30  ? 195.89895 260.79602 102.11005 1.000 96.36439  ?  30  TYR B CG    1 
ATOM   3538  C CD1   . TYR B 1 30  ? 195.62977 259.50819 102.57995 1.000 93.57613  ?  30  TYR B CD1   1 
ATOM   3539  C CD2   . TYR B 1 30  ? 196.87561 261.51966 102.77703 1.000 108.30618 ?  30  TYR B CD2   1 
ATOM   3540  C CE1   . TYR B 1 30  ? 196.31634 258.95995 103.70007 1.000 93.16388  ?  30  TYR B CE1   1 
ATOM   3541  C CE2   . TYR B 1 30  ? 197.56651 260.98462 103.89176 1.000 112.02767 ?  30  TYR B CE2   1 
ATOM   3542  C CZ    . TYR B 1 30  ? 197.28052 259.69788 104.34724 1.000 102.52356 ?  30  TYR B CZ    1 
ATOM   3543  O OH    . TYR B 1 30  ? 197.94299 259.14938 105.43951 1.000 103.54093 ?  30  TYR B OH    1 
ATOM   3544  N N     . PRO B 1 31  ? 193.80296 260.90914 98.04565  1.000 95.52049  ?  31  PRO B N     1 
ATOM   3545  C CA    . PRO B 1 31  ? 192.92392 261.36531 96.94937  1.000 87.08154  ?  31  PRO B CA    1 
ATOM   3546  C C     . PRO B 1 31  ? 191.83976 262.34225 97.38054  1.000 92.69454  ?  31  PRO B C     1 
ATOM   3547  O O     . PRO B 1 31  ? 190.95609 262.00522 98.17624  1.000 102.10305 ?  31  PRO B O     1 
ATOM   3548  C CB    . PRO B 1 31  ? 192.26783 260.07266 96.47934  1.000 84.09579  ?  31  PRO B CB    1 
ATOM   3549  C CG    . PRO B 1 31  ? 192.19342 259.22362 97.74260  1.000 89.08508  ?  31  PRO B CG    1 
ATOM   3550  C CD    . PRO B 1 31  ? 193.33001 259.64622 98.63725  1.000 90.90348  ?  31  PRO B CD    1 
ATOM   3551  N N     . ALA B 1 32  ? 191.83901 263.54856 96.86067  1.000 93.82098  ?  32  ALA B N     1 
ATOM   3552  C CA    . ALA B 1 32  ? 190.77072 264.43859 97.27436  1.000 95.13209  ?  32  ALA B CA    1 
ATOM   3553  C C     . ALA B 1 32  ? 190.56550 265.45527 96.17236  1.000 101.86744 ?  32  ALA B C     1 
ATOM   3554  O O     . ALA B 1 32  ? 191.53680 265.94339 95.58963  1.000 111.87334 ?  32  ALA B O     1 
ATOM   3555  C CB    . ALA B 1 32  ? 191.12106 265.10048 98.60323  1.000 88.18727  ?  32  ALA B CB    1 
ATOM   3556  N N     . ILE B 1 33  ? 189.31669 265.78757 95.88720  1.000 94.79952  ?  33  ILE B N     1 
ATOM   3557  C CA    . ILE B 1 33  ? 189.14652 266.77784 94.83594  1.000 105.47248 ?  33  ILE B CA    1 
ATOM   3558  C C     . ILE B 1 33  ? 188.91601 268.10994 95.54259  1.000 109.07820 ?  33  ILE B C     1 
ATOM   3559  O O     . ILE B 1 33  ? 187.79500 268.43927 95.96890  1.000 104.10883 ?  33  ILE B O     1 
ATOM   3560  C CB    . ILE B 1 33  ? 188.03600 266.38045 93.83481  1.000 111.13673 ?  33  ILE B CB    1 
ATOM   3561  C CG1   . ILE B 1 33  ? 188.28053 264.96728 93.31735  1.000 103.79573 ?  33  ILE B CG1   1 
ATOM   3562  C CG2   . ILE B 1 33  ? 188.04624 267.22697 92.56292  1.000 105.05878 ?  33  ILE B CG2   1 
ATOM   3563  C CD1   . ILE B 1 33  ? 187.45045 264.64402 92.08247  1.000 99.88556  ?  33  ILE B CD1   1 
ATOM   3564  N N     . LYS B 1 34  ? 190.03046 268.84154 95.73140  1.000 111.06500 ?  34  LYS B N     1 
ATOM   3565  C CA    . LYS B 1 34  ? 190.01663 270.16482 96.34618  1.000 117.10863 ?  34  LYS B CA    1 
ATOM   3566  C C     . LYS B 1 34  ? 189.65028 271.25523 95.33470  1.000 111.95269 ?  34  LYS B C     1 
ATOM   3567  O O     . LYS B 1 34  ? 188.80806 272.11232 95.63836  1.000 108.72168 ?  34  LYS B O     1 
ATOM   3568  C CB    . LYS B 1 34  ? 191.39136 270.45174 96.99449  1.000 122.10026 ?  34  LYS B CB    1 
ATOM   3569  C CG    . LYS B 1 34  ? 191.60118 271.91743 97.45580  1.000 128.66372 ?  34  LYS B CG    1 
ATOM   3570  C CD    . LYS B 1 34  ? 192.51431 272.72358 96.49246  1.000 124.06464 ?  34  LYS B CD    1 
ATOM   3571  C CE    . LYS B 1 34  ? 192.58005 274.24523 96.82214  1.000 117.40185 ?  34  LYS B CE    1 
ATOM   3572  N NZ    . LYS B 1 34  ? 193.39677 275.11516 95.88747  1.000 102.41827 ?  34  LYS B NZ    1 
ATOM   3573  N N     . ASP B 1 35  ? 190.23130 271.20051 94.11498  1.000 106.99049 ?  35  ASP B N     1 
ATOM   3574  C CA    . ASP B 1 35  ? 189.98319 272.16705 93.03161  1.000 106.28264 ?  35  ASP B CA    1 
ATOM   3575  C C     . ASP B 1 35  ? 188.54897 272.12089 92.52202  1.000 107.62511 ?  35  ASP B C     1 
ATOM   3576  O O     . ASP B 1 35  ? 188.15016 273.01149 91.75980  1.000 108.41388 ?  35  ASP B O     1 
ATOM   3577  C CB    . ASP B 1 35  ? 190.96042 271.99002 91.83067  1.000 105.59952 ?  35  ASP B CB    1 
ATOM   3578  C CG    . ASP B 1 35  ? 191.00429 270.55299 91.25412  1.000 115.55804 ?  35  ASP B CG    1 
ATOM   3579  O OD1   . ASP B 1 35  ? 190.31093 269.66663 91.77590  1.000 119.30097 ?  35  ASP B OD1   1 
ATOM   3580  O OD2   . ASP B 1 35  ? 191.73708 270.30764 90.25717  1.000 112.27698 ?  35  ASP B OD2   1 
ATOM   3581  N N     . LEU B 1 36  ? 187.79012 271.08681 92.89664  1.000 107.35162 ?  36  LEU B N     1 
ATOM   3582  C CA    . LEU B 1 36  ? 186.40472 270.89599 92.46328  1.000 105.96738 ?  36  LEU B CA    1 
ATOM   3583  C C     . LEU B 1 36  ? 186.31926 270.70262 90.95511  1.000 110.61565 ?  36  LEU B C     1 
ATOM   3584  O O     . LEU B 1 36  ? 185.30659 271.02178 90.32716  1.000 112.45294 ?  36  LEU B O     1 
ATOM   3585  C CB    . LEU B 1 36  ? 185.52040 272.04503 92.94034  1.000 95.94330  ?  36  LEU B CB    1 
ATOM   3586  C CG    . LEU B 1 36  ? 184.72432 271.65653 94.17772  1.000 97.86359  ?  36  LEU B CG    1 
ATOM   3587  C CD1   . LEU B 1 36  ? 185.61877 271.29476 95.37240  1.000 108.18730 ?  36  LEU B CD1   1 
ATOM   3588  C CD2   . LEU B 1 36  ? 183.86542 272.85105 94.47867  1.000 92.95401  ?  36  LEU B CD2   1 
ATOM   3589  N N     . LYS B 1 37  ? 187.38128 270.14073 90.38015  1.000 112.35693 ?  37  LYS B N     1 
ATOM   3590  C CA    . LYS B 1 37  ? 187.47894 269.87706 88.95213  1.000 110.19869 ?  37  LYS B CA    1 
ATOM   3591  C C     . LYS B 1 37  ? 187.40354 268.37075 88.71369  1.000 105.81443 ?  37  LYS B C     1 
ATOM   3592  O O     . LYS B 1 37  ? 188.16989 267.60149 89.31139  1.000 104.38600 ?  37  LYS B O     1 
ATOM   3593  C CB    . LYS B 1 37  ? 188.78562 270.46360 88.40357  1.000 105.39554 ?  37  LYS B CB    1 
ATOM   3594  C CG    . LYS B 1 37  ? 188.80797 272.00100 88.37592  1.000 104.43781 ?  37  LYS B CG    1 
ATOM   3595  C CD    . LYS B 1 37  ? 190.06307 272.56211 87.69767  1.000 114.10476 ?  37  LYS B CD    1 
ATOM   3596  C CE    . LYS B 1 37  ? 190.01662 274.09151 87.59017  1.000 117.13282 ?  37  LYS B CE    1 
ATOM   3597  N NZ    . LYS B 1 37  ? 191.19932 274.66905 86.87884  1.000 116.51769 ?  37  LYS B NZ    1 
ATOM   3598  N N     . LYS B 1 38  ? 186.49965 267.96428 87.81857  1.000 102.16617 ?  38  LYS B N     1 
ATOM   3599  C CA    . LYS B 1 38  ? 186.31524 266.55886 87.48741  1.000 101.07281 ?  38  LYS B CA    1 
ATOM   3600  C C     . LYS B 1 38  ? 187.58358 266.02307 86.82616  1.000 98.31540  ?  38  LYS B C     1 
ATOM   3601  O O     . LYS B 1 38  ? 188.32400 266.77847 86.19879  1.000 100.39977 ?  38  LYS B O     1 
ATOM   3602  C CB    . LYS B 1 38  ? 185.09583 266.38176 86.56698  1.000 99.82228  ?  38  LYS B CB    1 
ATOM   3603  C CG    . LYS B 1 38  ? 183.76132 266.83409 87.19967  1.000 99.85787  ?  38  LYS B CG    1 
ATOM   3604  C CD    . LYS B 1 38  ? 182.56280 266.84244 86.24513  1.000 90.82776  ?  38  LYS B CD    1 
ATOM   3605  C CE    . LYS B 1 38  ? 182.78271 267.81502 85.11746  1.000 99.91928  ?  38  LYS B CE    1 
ATOM   3606  N NZ    . LYS B 1 38  ? 181.59761 267.88547 84.23684  1.000 108.65609 ?  38  LYS B NZ    1 
ATOM   3607  N N     . PRO B 1 39  ? 187.89154 264.74076 87.01621  1.000 97.23368  ?  39  PRO B N     1 
ATOM   3608  C CA    . PRO B 1 39  ? 189.12675 264.18234 86.44074  1.000 97.31682  ?  39  PRO B CA    1 
ATOM   3609  C C     . PRO B 1 39  ? 189.17535 264.37584 84.92511  1.000 97.84467  ?  39  PRO B C     1 
ATOM   3610  O O     . PRO B 1 39  ? 188.16587 264.20649 84.24550  1.000 98.64710  ?  39  PRO B O     1 
ATOM   3611  C CB    . PRO B 1 39  ? 189.03068 262.69620 86.82067  1.000 93.87334  ?  39  PRO B CB    1 
ATOM   3612  C CG    . PRO B 1 39  ? 188.23622 262.70415 88.13515  1.000 94.35656  ?  39  PRO B CG    1 
ATOM   3613  C CD    . PRO B 1 39  ? 187.23074 263.81111 87.96086  1.000 96.23476  ?  39  PRO B CD    1 
ATOM   3614  N N     . CYS B 1 40  ? 190.35673 264.75164 84.38668  1.000 98.15624  ?  40  CYS B N     1 
ATOM   3615  C CA    . CYS B 1 40  ? 190.47851 265.04517 82.95195  1.000 107.53503 ?  40  CYS B CA    1 
ATOM   3616  C C     . CYS B 1 40  ? 191.69491 264.36002 82.34186  1.000 107.20352 ?  40  CYS B C     1 
ATOM   3617  O O     . CYS B 1 40  ? 192.74922 264.28012 82.98367  1.000 103.50818 ?  40  CYS B O     1 
ATOM   3618  C CB    . CYS B 1 40  ? 190.60164 266.56382 82.62498  1.000 110.21304 ?  40  CYS B CB    1 
ATOM   3619  S SG    . CYS B 1 40  ? 192.10241 267.41826 83.22126  1.000 133.68005 ?  40  CYS B SG    1 
ATOM   3620  N N     . ILE B 1 41  ? 191.53675 263.87967 81.08840  1.000 105.84683 ?  41  ILE B N     1 
ATOM   3621  C CA    . ILE B 1 41  ? 192.61817 263.33595 80.26381  1.000 104.46876 ?  41  ILE B CA    1 
ATOM   3622  C C     . ILE B 1 41  ? 192.56360 263.96620 78.87984  1.000 105.27336 ?  41  ILE B C     1 
ATOM   3623  O O     . ILE B 1 41  ? 191.49437 264.35866 78.39865  1.000 105.62278 ?  41  ILE B O     1 
ATOM   3624  C CB    . ILE B 1 41  ? 192.60387 261.78471 80.12855  1.000 100.36921 ?  41  ILE B CB    1 
ATOM   3625  C CG1   . ILE B 1 41  ? 191.23550 261.24704 79.67345  1.000 102.48306 ?  41  ILE B CG1   1 
ATOM   3626  C CG2   . ILE B 1 41  ? 193.07995 261.13183 81.39704  1.000 100.52202 ?  41  ILE B CG2   1 
ATOM   3627  C CD1   . ILE B 1 41  ? 191.26121 259.77694 79.15214  1.000 94.92989  ?  41  ILE B CD1   1 
ATOM   3628  N N     . THR B 1 42  ? 193.74650 264.10159 78.26214  1.000 104.77637 ?  42  THR B N     1 
ATOM   3629  C CA    . THR B 1 42  ? 193.90435 264.62619 76.90471  1.000 104.18019 ?  42  THR B CA    1 
ATOM   3630  C C     . THR B 1 42  ? 194.04717 263.45514 75.92362  1.000 108.13409 ?  42  THR B C     1 
ATOM   3631  O O     . THR B 1 42  ? 194.91738 262.59333 76.10017  1.000 106.00401 ?  42  THR B O     1 
ATOM   3632  C CB    . THR B 1 42  ? 195.09168 265.59467 76.78935  1.000 104.01957 ?  42  THR B CB    1 
ATOM   3633  O OG1   . THR B 1 42  ? 196.29953 264.86431 76.55106  1.000 113.15050 ?  42  THR B OG1   1 
ATOM   3634  C CG2   . THR B 1 42  ? 195.25146 266.46238 78.05630  1.000 105.55002 ?  42  THR B CG2   1 
ATOM   3635  N N     . LEU B 1 43  ? 193.13606 263.38223 74.94925  1.000 111.54247 ?  43  LEU B N     1 
ATOM   3636  C CA    . LEU B 1 43  ? 193.06207 262.35854 73.90318  1.000 109.66251 ?  43  LEU B CA    1 
ATOM   3637  C C     . LEU B 1 43  ? 193.19507 263.04178 72.54572  1.000 111.64176 ?  43  LEU B C     1 
ATOM   3638  O O     . LEU B 1 43  ? 193.32565 264.25910 72.46150  1.000 111.22902 ?  43  LEU B O     1 
ATOM   3639  C CB    . LEU B 1 43  ? 191.74163 261.58625 73.96553  1.000 102.83183 ?  43  LEU B CB    1 
ATOM   3640  C CG    . LEU B 1 43  ? 191.72369 260.63631 75.13724  1.000 98.72195  ?  43  LEU B CG    1 
ATOM   3641  C CD1   . LEU B 1 43  ? 190.42039 259.87017 75.07348  1.000 94.74148  ?  43  LEU B CD1   1 
ATOM   3642  C CD2   . LEU B 1 43  ? 192.96482 259.76071 75.09169  1.000 95.97804  ?  43  LEU B CD2   1 
ATOM   3643  N N     . GLY B 1 44  ? 193.10556 262.26128 71.47111  1.000 111.73336 ?  44  GLY B N     1 
ATOM   3644  C CA    . GLY B 1 44  ? 193.25777 262.80129 70.13205  1.000 108.17197 ?  44  GLY B CA    1 
ATOM   3645  C C     . GLY B 1 44  ? 191.97834 263.46451 69.63563  1.000 110.07282 ?  44  GLY B C     1 
ATOM   3646  O O     . GLY B 1 44  ? 191.05739 263.76588 70.39819  1.000 105.76266 ?  44  GLY B O     1 
ATOM   3647  N N     . LYS B 1 45  ? 191.97583 263.78425 68.34334  1.000 109.99722 ?  45  LYS B N     1 
ATOM   3648  C CA    . LYS B 1 45  ? 190.82742 264.44566 67.73204  1.000 108.88271 ?  45  LYS B CA    1 
ATOM   3649  C C     . LYS B 1 45  ? 189.61248 263.52709 67.67313  1.000 107.37833 ?  45  LYS B C     1 
ATOM   3650  O O     . LYS B 1 45  ? 189.73159 262.31950 67.44870  1.000 103.43376 ?  45  LYS B O     1 
ATOM   3651  C CB    . LYS B 1 45  ? 191.17478 264.90579 66.31367  1.000 106.32010 ?  45  LYS B CB    1 
ATOM   3652  C CG    . LYS B 1 45  ? 190.36871 266.10856 65.88710  1.000 110.04668 ?  45  LYS B CG    1 
ATOM   3653  C CD    . LYS B 1 45  ? 190.76036 266.60318 64.51236  1.000 112.45501 ?  45  LYS B CD    1 
ATOM   3654  C CE    . LYS B 1 45  ? 189.98051 267.85631 64.14331  1.000 111.85673 ?  45  LYS B CE    1 
ATOM   3655  N NZ    . LYS B 1 45  ? 190.40256 268.34363 62.80466  1.000 123.89222 ?  45  LYS B NZ    1 
ATOM   3656  N N     . ALA B 1 46  ? 188.43206 264.13458 67.79071  1.000 103.35873 ?  46  ALA B N     1 
ATOM   3657  C CA    . ALA B 1 46  ? 187.19325 263.37244 67.83876  1.000 101.08843 ?  46  ALA B CA    1 
ATOM   3658  C C     . ALA B 1 46  ? 187.06164 262.50490 66.58842  1.000 106.08664 ?  46  ALA B C     1 
ATOM   3659  O O     . ALA B 1 46  ? 187.25093 263.00289 65.47061  1.000 111.75424 ?  46  ALA B O     1 
ATOM   3660  C CB    . ALA B 1 46  ? 186.00428 264.33338 67.93608  1.000 98.85942  ?  46  ALA B CB    1 
ATOM   3661  N N     . PRO B 1 47  ? 186.78430 261.21262 66.72961  1.000 107.62602 ?  47  PRO B N     1 
ATOM   3662  C CA    . PRO B 1 47  ? 186.66214 260.33363 65.56183  1.000 108.49640 ?  47  PRO B CA    1 
ATOM   3663  C C     . PRO B 1 47  ? 185.25827 260.24748 64.97102  1.000 111.61042 ?  47  PRO B C     1 
ATOM   3664  O O     . PRO B 1 47  ? 184.25333 260.56366 65.61166  1.000 113.69153 ?  47  PRO B O     1 
ATOM   3665  C CB    . PRO B 1 47  ? 187.06745 258.96158 66.12890  1.000 106.45904 ?  47  PRO B CB    1 
ATOM   3666  C CG    . PRO B 1 47  ? 186.67675 259.03301 67.55856  1.000 108.27720 ?  47  PRO B CG    1 
ATOM   3667  C CD    . PRO B 1 47  ? 186.93400 260.45743 67.98216  1.000 107.32639 ?  47  PRO B CD    1 
ATOM   3668  N N     . ASP B 1 48  ? 185.21733 259.80208 63.71145  1.000 111.21524 ?  48  ASP B N     1 
ATOM   3669  C CA    . ASP B 1 48  ? 183.96627 259.37967 63.08681  1.000 112.37405 ?  48  ASP B CA    1 
ATOM   3670  C C     . ASP B 1 48  ? 183.57514 258.04174 63.69143  1.000 108.47911 ?  48  ASP B C     1 
ATOM   3671  O O     . ASP B 1 48  ? 184.29083 257.04668 63.51668  1.000 101.44746 ?  48  ASP B O     1 
ATOM   3672  C CB    . ASP B 1 48  ? 184.11096 259.26461 61.56992  1.000 114.96159 ?  48  ASP B CB    1 
ATOM   3673  C CG    . ASP B 1 48  ? 184.45573 260.59367 60.91365  1.000 129.05191 ?  48  ASP B CG    1 
ATOM   3674  O OD1   . ASP B 1 48  ? 184.47376 261.62643 61.62825  1.000 136.98866 ?  48  ASP B OD1   1 
ATOM   3675  O OD2   . ASP B 1 48  ? 184.70326 260.60854 59.68584  1.000 129.60763 ?  48  ASP B OD2   1 
ATOM   3676  N N     . LEU B 1 49  ? 182.45743 258.02858 64.41715  1.000 108.63037 ?  49  LEU B N     1 
ATOM   3677  C CA    . LEU B 1 49  ? 182.05146 256.84085 65.15871  1.000 106.13643 ?  49  LEU B CA    1 
ATOM   3678  C C     . LEU B 1 49  ? 182.08375 255.59049 64.28678  1.000 104.91981 ?  49  LEU B C     1 
ATOM   3679  O O     . LEU B 1 49  ? 182.80041 254.62625 64.59387  1.000 102.87326 ?  49  LEU B O     1 
ATOM   3680  C CB    . LEU B 1 49  ? 180.66914 257.05612 65.77282  1.000 106.17142 ?  49  LEU B CB    1 
ATOM   3681  C CG    . LEU B 1 49  ? 180.76168 257.91541 67.04373  1.000 110.84661 ?  49  LEU B CG    1 
ATOM   3682  C CD1   . LEU B 1 49  ? 181.50437 257.16686 68.15696  1.000 97.52392  ?  49  LEU B CD1   1 
ATOM   3683  C CD2   . LEU B 1 49  ? 181.40770 259.27763 66.74229  1.000 115.02315 ?  49  LEU B CD2   1 
ATOM   3684  N N     . ASN B 1 50  ? 181.33376 255.59618 63.18197  1.000 101.47324 ?  50  ASN B N     1 
ATOM   3685  C CA    . ASN B 1 50  ? 181.28566 254.41596 62.32018  1.000 98.96744  ?  50  ASN B CA    1 
ATOM   3686  C C     . ASN B 1 50  ? 182.66469 254.00206 61.82880  1.000 95.94141  ?  50  ASN B C     1 
ATOM   3687  O O     . ASN B 1 50  ? 182.99640 252.81066 61.83104  1.000 94.22176  ?  50  ASN B O     1 
ATOM   3688  C CB    . ASN B 1 50  ? 180.35481 254.65787 61.13947  1.000 99.28951  ?  50  ASN B CB    1 
ATOM   3689  C CG    . ASN B 1 50  ? 178.99084 255.06474 61.56823  1.000 102.55457 ?  50  ASN B CG    1 
ATOM   3690  O OD1   . ASN B 1 50  ? 178.45620 254.51260 62.52449  1.000 104.76899 ?  50  ASN B OD1   1 
ATOM   3691  N ND2   . ASN B 1 50  ? 178.41954 256.05562 60.89189  1.000 107.03161 ?  50  ASN B ND2   1 
ATOM   3692  N N     . LYS B 1 51  ? 183.48643 254.96787 61.40106  1.000 93.35379  ?  51  LYS B N     1 
ATOM   3693  C CA    . LYS B 1 51  ? 184.80148 254.59768 60.88506  1.000 96.73483  ?  51  LYS B CA    1 
ATOM   3694  C C     . LYS B 1 51  ? 185.70879 254.09123 61.99948  1.000 98.36579  ?  51  LYS B C     1 
ATOM   3695  O O     . LYS B 1 51  ? 186.45092 253.11408 61.81213  1.000 93.71663  ?  51  LYS B O     1 
ATOM   3696  C CB    . LYS B 1 51  ? 185.44257 255.77981 60.14948  1.000 100.63675 ?  51  LYS B CB    1 
ATOM   3697  C CG    . LYS B 1 51  ? 184.66556 256.25817 58.89559  1.000 114.27606 ?  51  LYS B CG    1 
ATOM   3698  C CD    . LYS B 1 51  ? 185.36303 257.40854 58.14702  1.000 118.77108 ?  51  LYS B CD    1 
ATOM   3699  C CE    . LYS B 1 51  ? 184.57144 257.88985 56.92710  1.000 96.84044  ?  51  LYS B CE    1 
ATOM   3700  N NZ    . LYS B 1 51  ? 185.24669 259.07202 56.33574  1.000 98.00255  ?  51  LYS B NZ    1 
ATOM   3701  N N     . ALA B 1 52  ? 185.63382 254.72602 63.17604  1.000 100.62148 ?  52  ALA B N     1 
ATOM   3702  C CA    . ALA B 1 52  ? 186.44573 254.29478 64.30637  1.000 96.93193  ?  52  ALA B CA    1 
ATOM   3703  C C     . ALA B 1 52  ? 186.04688 252.89459 64.75405  1.000 95.82545  ?  52  ALA B C     1 
ATOM   3704  O O     . ALA B 1 52  ? 186.91750 252.05164 65.00832  1.000 96.67101  ?  52  ALA B O     1 
ATOM   3705  C CB    . ALA B 1 52  ? 186.33901 255.31214 65.43792  1.000 95.03558  ?  52  ALA B CB    1 
ATOM   3706  N N     . TYR B 1 53  ? 184.73521 252.60017 64.75577  1.000 92.97816  ?  53  TYR B N     1 
ATOM   3707  C CA    . TYR B 1 53  ? 184.26055 251.27315 65.14942  1.000 93.73984  ?  53  TYR B CA    1 
ATOM   3708  C C     . TYR B 1 53  ? 184.84717 250.18665 64.24670  1.000 89.38053  ?  53  TYR B C     1 
ATOM   3709  O O     . TYR B 1 53  ? 185.18985 249.08793 64.71185  1.000 79.38978  ?  53  TYR B O     1 
ATOM   3710  C CB    . TYR B 1 53  ? 182.72321 251.20321 65.06848  1.000 92.90933  ?  53  TYR B CB    1 
ATOM   3711  C CG    . TYR B 1 53  ? 182.22846 249.76447 65.20255  1.000 90.97221  ?  53  TYR B CG    1 
ATOM   3712  C CD1   . TYR B 1 53  ? 182.20015 248.91752 64.10599  1.000 86.70537  ?  53  TYR B CD1   1 
ATOM   3713  C CD2   . TYR B 1 53  ? 181.73477 249.27544 66.41022  1.000 92.91533  ?  53  TYR B CD2   1 
ATOM   3714  C CE1   . TYR B 1 53  ? 181.80092 247.61175 64.21091  1.000 88.23023  ?  53  TYR B CE1   1 
ATOM   3715  C CE2   . TYR B 1 53  ? 181.29141 247.95096 66.51585  1.000 93.57661  ?  53  TYR B CE2   1 
ATOM   3716  C CZ    . TYR B 1 53  ? 181.33058 247.12552 65.39872  1.000 88.92383  ?  53  TYR B CZ    1 
ATOM   3717  O OH    . TYR B 1 53  ? 180.91402 245.80906 65.43370  1.000 87.09477  ?  53  TYR B OH    1 
ATOM   3718  N N     . LYS B 1 54  ? 184.86220 250.44854 62.93546  1.000 91.02272  ?  54  LYS B N     1 
ATOM   3719  C CA    . LYS B 1 54  ? 185.37646 249.49934 61.95135  1.000 91.10902  ?  54  LYS B CA    1 
ATOM   3720  C C     . LYS B 1 54  ? 186.87637 249.29142 62.09067  1.000 89.19842  ?  54  LYS B C     1 
ATOM   3721  O O     . LYS B 1 54  ? 187.38303 248.20131 61.78672  1.000 86.97499  ?  54  LYS B O     1 
ATOM   3722  C CB    . LYS B 1 54  ? 185.00863 249.95312 60.53884  1.000 90.06650  ?  54  LYS B CB    1 
ATOM   3723  C CG    . LYS B 1 54  ? 183.49120 250.01250 60.27803  1.000 91.02440  ?  54  LYS B CG    1 
ATOM   3724  C CD    . LYS B 1 54  ? 183.15845 250.48027 58.84984  1.000 99.96583  ?  54  LYS B CD    1 
ATOM   3725  C CE    . LYS B 1 54  ? 181.65110 250.43894 58.57796  1.000 101.60707 ?  54  LYS B CE    1 
ATOM   3726  N NZ    . LYS B 1 54  ? 181.30013 250.85826 57.18828  1.000 95.92217  ?  54  LYS B NZ    1 
ATOM   3727  N N     . SER B 1 55  ? 187.61556 250.36289 62.40063  1.000 86.98275  ?  55  SER B N     1 
ATOM   3728  C CA    . SER B 1 55  ? 189.06176 250.23761 62.54176  1.000 89.36584  ?  55  SER B CA    1 
ATOM   3729  C C     . SER B 1 55  ? 189.43241 249.39234 63.74573  1.000 89.64101  ?  55  SER B C     1 
ATOM   3730  O O     . SER B 1 55  ? 190.30525 248.51734 63.66190  1.000 89.50637  ?  55  SER B O     1 
ATOM   3731  C CB    . SER B 1 55  ? 189.70587 251.59930 62.67433  1.000 90.79562  ?  55  SER B CB    1 
ATOM   3732  O OG    . SER B 1 55  ? 191.02856 251.41452 63.12352  1.000 89.52170  ?  55  SER B OG    1 
ATOM   3733  N N     . VAL B 1 56  ? 188.80961 249.67686 64.89024  1.000 90.07685  ?  56  VAL B N     1 
ATOM   3734  C CA    . VAL B 1 56  ? 189.16812 248.96850 66.11081  1.000 89.95466  ?  56  VAL B CA    1 
ATOM   3735  C C     . VAL B 1 56  ? 188.69577 247.51558 66.03021  1.000 87.45396  ?  56  VAL B C     1 
ATOM   3736  O O     . VAL B 1 56  ? 189.40212 246.58854 66.45667  1.000 78.29736  ?  56  VAL B O     1 
ATOM   3737  C CB    . VAL B 1 56  ? 188.62094 249.72203 67.33778  1.000 82.56048  ?  56  VAL B CB    1 
ATOM   3738  C CG1   . VAL B 1 56  ? 189.37163 251.03726 67.48941  1.000 81.33094  ?  56  VAL B CG1   1 
ATOM   3739  C CG2   . VAL B 1 56  ? 187.14566 249.92432 67.24888  1.000 89.66145  ?  56  VAL B CG2   1 
ATOM   3740  N N     . LEU B 1 57  ? 187.52926 247.29068 65.41683  1.000 86.99093  ?  57  LEU B N     1 
ATOM   3741  C CA    . LEU B 1 57  ? 187.05657 245.92786 65.20820  1.000 87.97501  ?  57  LEU B CA    1 
ATOM   3742  C C     . LEU B 1 57  ? 188.03661 245.12604 64.37642  1.000 88.16455  ?  57  LEU B C     1 
ATOM   3743  O O     . LEU B 1 57  ? 188.25535 243.93285 64.63614  1.000 86.56919  ?  57  LEU B O     1 
ATOM   3744  C CB    . LEU B 1 57  ? 185.65739 245.94591 64.59229  1.000 83.93881  ?  57  LEU B CB    1 
ATOM   3745  C CG    . LEU B 1 57  ? 185.12444 244.53424 64.34041  1.000 81.95066  ?  57  LEU B CG    1 
ATOM   3746  C CD1   . LEU B 1 57  ? 185.09601 243.70263 65.57057  1.000 83.61223  ?  57  LEU B CD1   1 
ATOM   3747  C CD2   . LEU B 1 57  ? 183.67003 244.65694 63.86689  1.000 84.76854  ?  57  LEU B CD2   1 
ATOM   3748  N N     . SER B 1 58  ? 188.60697 245.75488 63.34948  1.000 88.48103  ?  58  SER B N     1 
ATOM   3749  C CA    . SER B 1 58  ? 189.67422 245.10684 62.60166  1.000 94.22639  ?  58  SER B CA    1 
ATOM   3750  C C     . SER B 1 58  ? 190.89189 244.88744 63.48933  1.000 88.62617  ?  58  SER B C     1 
ATOM   3751  O O     . SER B 1 58  ? 191.49608 243.79787 63.49113  1.000 86.18168  ?  58  SER B O     1 
ATOM   3752  C CB    . SER B 1 58  ? 190.07899 245.96998 61.41535  1.000 93.38250  ?  58  SER B CB    1 
ATOM   3753  O OG    . SER B 1 58  ? 191.05615 246.90767 61.84006  1.000 97.96175  ?  58  SER B OG    1 
ATOM   3754  N N     . GLY B 1 59  ? 191.25369 245.91336 64.27155  1.000 85.75183  ?  59  GLY B N     1 
ATOM   3755  C CA    . GLY B 1 59  ? 192.40477 245.77527 65.13989  1.000 90.79772  ?  59  GLY B CA    1 
ATOM   3756  C C     . GLY B 1 59  ? 192.23174 244.63074 66.10607  1.000 93.14153  ?  59  GLY B C     1 
ATOM   3757  O O     . GLY B 1 59  ? 193.17039 243.88049 66.38674  1.000 92.29835  ?  59  GLY B O     1 
ATOM   3758  N N     . MET B 1 60  ? 191.01147 244.47369 66.60579  1.000 85.98025  ?  60  MET B N     1 
ATOM   3759  C CA    . MET B 1 60  ? 190.70457 243.37766 67.50996  1.000 84.68577  ?  60  MET B CA    1 
ATOM   3760  C C     . MET B 1 60  ? 190.93981 242.02734 66.89447  1.000 89.39351  ?  60  MET B C     1 
ATOM   3761  O O     . MET B 1 60  ? 191.67460 241.19792 67.43384  1.000 90.29616  ?  60  MET B O     1 
ATOM   3762  C CB    . MET B 1 60  ? 189.27201 243.47242 67.96021  1.000 84.79151  ?  60  MET B CB    1 
ATOM   3763  C CG    . MET B 1 60  ? 188.99275 242.33092 68.88514  1.000 82.97386  ?  60  MET B CG    1 
ATOM   3764  S SD    . MET B 1 60  ? 189.58784 242.87083 70.45609  1.000 83.10819  ?  60  MET B SD    1 
ATOM   3765  C CE    . MET B 1 60  ? 188.53775 241.88824 71.51145  1.000 98.78933  ?  60  MET B CE    1 
ATOM   3766  N N     . SER B 1 61  ? 190.31052 241.77583 65.75948  1.000 91.46374  ?  61  SER B N     1 
ATOM   3767  C CA    . SER B 1 61  ? 190.50079 240.47236 65.16515  1.000 87.65184  ?  61  SER B CA    1 
ATOM   3768  C C     . SER B 1 61  ? 191.95564 240.28960 64.80054  1.000 86.60111  ?  61  SER B C     1 
ATOM   3769  O O     . SER B 1 61  ? 192.52378 239.19487 65.01494  1.000 86.50493  ?  61  SER B O     1 
ATOM   3770  C CB    . SER B 1 61  ? 189.58353 240.27817 63.95115  1.000 76.74908  ?  61  SER B CB    1 
ATOM   3771  O OG    . SER B 1 61  ? 188.24687 240.76542 64.16642  1.000 72.77144  ?  61  SER B OG    1 
ATOM   3772  N N     . ALA B 1 62  ? 192.61795 241.38582 64.43357  1.000 86.19674  ?  62  ALA B N     1 
ATOM   3773  C CA    . ALA B 1 62  ? 193.98798 241.27528 63.98401  1.000 92.38220  ?  62  ALA B CA    1 
ATOM   3774  C C     . ALA B 1 62  ? 194.99107 241.17781 65.11471  1.000 93.62554  ?  62  ALA B C     1 
ATOM   3775  O O     . ALA B 1 62  ? 196.18214 240.97689 64.84775  1.000 98.07002  ?  62  ALA B O     1 
ATOM   3776  C CB    . ALA B 1 62  ? 194.35978 242.52264 63.16906  1.000 92.62762  ?  62  ALA B CB    1 
ATOM   3777  N N     . ALA B 1 63  ? 194.52935 241.28472 66.35970  1.000 89.96717  ?  63  ALA B N     1 
ATOM   3778  C CA    . ALA B 1 63  ? 195.40209 241.26780 67.51187  1.000 91.83695  ?  63  ALA B CA    1 
ATOM   3779  C C     . ALA B 1 63  ? 196.42451 242.39122 67.45607  1.000 89.58784  ?  63  ALA B C     1 
ATOM   3780  O O     . ALA B 1 63  ? 197.52529 242.25689 68.02423  1.000 91.61484  ?  63  ALA B O     1 
ATOM   3781  C CB    . ALA B 1 63  ? 196.09837 239.91759 67.70683  1.000 90.14589  ?  63  ALA B CB    1 
ATOM   3782  N N     . LYS B 1 64  ? 196.15186 243.42959 66.65368  1.000 85.40522  ?  64  LYS B N     1 
ATOM   3783  C CA    . LYS B 1 64  ? 196.97047 244.63164 66.61756  1.000 89.55105  ?  64  LYS B CA    1 
ATOM   3784  C C     . LYS B 1 64  ? 196.05864 245.83169 66.87389  1.000 88.12159  ?  64  LYS B C     1 
ATOM   3785  O O     . LYS B 1 64  ? 195.17168 246.12889 66.06469  1.000 89.79918  ?  64  LYS B O     1 
ATOM   3786  C CB    . LYS B 1 64  ? 197.71795 244.74415 65.27721  1.000 97.11607  ?  64  LYS B CB    1 
ATOM   3787  C CG    . LYS B 1 64  ? 198.43633 246.08854 65.00328  1.000 108.02244 ?  64  LYS B CG    1 
ATOM   3788  C CD    . LYS B 1 64  ? 199.63254 246.33340 65.96235  1.000 112.86870 ?  64  LYS B CD    1 
ATOM   3789  C CE    . LYS B 1 64  ? 200.23630 247.75281 65.83892  1.000 110.70799 ?  64  LYS B CE    1 
ATOM   3790  N NZ    . LYS B 1 64  ? 200.74405 248.12399 64.47976  1.000 106.45750 ?  64  LYS B NZ    1 
ATOM   3791  N N     . LEU B 1 65  ? 196.29471 246.53160 67.98676  1.000 85.09939  ?  65  LEU B N     1 
ATOM   3792  C CA    . LEU B 1 65  ? 195.47950 247.65625 68.41840  1.000 82.65026  ?  65  LEU B CA    1 
ATOM   3793  C C     . LEU B 1 65  ? 196.37312 248.82477 68.79369  1.000 87.22630  ?  65  LEU B C     1 
ATOM   3794  O O     . LEU B 1 65  ? 197.41595 248.63852 69.43495  1.000 87.92180  ?  65  LEU B O     1 
ATOM   3795  C CB    . LEU B 1 65  ? 194.62054 247.31635 69.63107  1.000 87.91757  ?  65  LEU B CB    1 
ATOM   3796  C CG    . LEU B 1 65  ? 193.34617 246.57134 69.29817  1.000 84.76654  ?  65  LEU B CG    1 
ATOM   3797  C CD1   . LEU B 1 65  ? 192.76263 245.94028 70.55428  1.000 78.29038  ?  65  LEU B CD1   1 
ATOM   3798  C CD2   . LEU B 1 65  ? 192.39407 247.52164 68.58646  1.000 85.74750  ?  65  LEU B CD2   1 
ATOM   3799  N N     . ASP B 1 66  ? 195.90766 250.04293 68.47323  1.000 88.45852  ?  66  ASP B N     1 
ATOM   3800  C CA    . ASP B 1 66  ? 196.64498 251.26155 68.79301  1.000 94.62896  ?  66  ASP B CA    1 
ATOM   3801  C C     . ASP B 1 66  ? 196.04387 251.84378 70.05405  1.000 99.44610  ?  66  ASP B C     1 
ATOM   3802  O O     . ASP B 1 66  ? 194.84359 252.18103 70.06143  1.000 96.76512  ?  66  ASP B O     1 
ATOM   3803  C CB    . ASP B 1 66  ? 196.56793 252.27990 67.64580  1.000 95.88734  ?  66  ASP B CB    1 
ATOM   3804  C CG    . ASP B 1 66  ? 197.41536 253.56749 67.88701  1.000 105.45602 ?  66  ASP B CG    1 
ATOM   3805  O OD1   . ASP B 1 66  ? 198.66570 253.49900 67.83877  1.000 109.46137 ?  66  ASP B OD1   1 
ATOM   3806  O OD2   . ASP B 1 66  ? 196.83825 254.66252 68.06386  1.000 104.97805 ?  66  ASP B OD2   1 
ATOM   3807  N N     . PRO B 1 67  ? 196.83206 251.97660 71.12867  1.000 103.12077 ?  67  PRO B N     1 
ATOM   3808  C CA    . PRO B 1 67  ? 196.26228 252.43161 72.40460  1.000 98.26432  ?  67  PRO B CA    1 
ATOM   3809  C C     . PRO B 1 67  ? 195.58901 253.78285 72.30509  1.000 97.34398  ?  67  PRO B C     1 
ATOM   3810  O O     . PRO B 1 67  ? 194.46361 253.92797 72.79297  1.000 96.77521  ?  67  PRO B O     1 
ATOM   3811  C CB    . PRO B 1 67  ? 197.48401 252.46428 73.33452  1.000 97.90343  ?  67  PRO B CB    1 
ATOM   3812  C CG    . PRO B 1 67  ? 198.68009 252.46303 72.42576  1.000 99.30287  ?  67  PRO B CG    1 
ATOM   3813  C CD    . PRO B 1 67  ? 198.27413 251.69507 71.22058  1.000 99.27160  ?  67  PRO B CD    1 
ATOM   3814  N N     . ASP B 1 68  ? 196.21167 254.75653 71.63380  1.000 96.30292  ?  68  ASP B N     1 
ATOM   3815  C CA    . ASP B 1 68  ? 195.61582 256.08867 71.55329  1.000 98.65435  ?  68  ASP B CA    1 
ATOM   3816  C C     . ASP B 1 68  ? 194.28084 256.05816 70.82452  1.000 97.80476  ?  68  ASP B C     1 
ATOM   3817  O O     . ASP B 1 68  ? 193.31787 256.72748 71.23729  1.000 94.38016  ?  68  ASP B O     1 
ATOM   3818  C CB    . ASP B 1 68  ? 196.57494 257.06032 70.87004  1.000 96.27210  ?  68  ASP B CB    1 
ATOM   3819  C CG    . ASP B 1 68  ? 197.99325 256.89102 71.34202  1.000 104.88051 ?  68  ASP B CG    1 
ATOM   3820  O OD1   . ASP B 1 68  ? 198.35991 257.53950 72.34877  1.000 108.96501 ?  68  ASP B OD1   1 
ATOM   3821  O OD2   . ASP B 1 68  ? 198.71949 256.05889 70.75322  1.000 104.14161 ?  68  ASP B OD2   1 
ATOM   3822  N N     . ASP B 1 69  ? 194.21320 255.29839 69.72483  1.000 99.53501  ?  69  ASP B N     1 
ATOM   3823  C CA    . ASP B 1 69  ? 192.97834 255.21081 68.95188  1.000 103.35413 ?  69  ASP B CA    1 
ATOM   3824  C C     . ASP B 1 69  ? 191.88473 254.52420 69.76626  1.000 95.59199  ?  69  ASP B C     1 
ATOM   3825  O O     . ASP B 1 69  ? 190.75181 255.02208 69.84929  1.000 94.17782  ?  69  ASP B O     1 
ATOM   3826  C CB    . ASP B 1 69  ? 193.24378 254.45008 67.64544  1.000 102.65738 ?  69  ASP B CB    1 
ATOM   3827  C CG    . ASP B 1 69  ? 194.16599 255.20528 66.67628  1.000 99.82382  ?  69  ASP B CG    1 
ATOM   3828  O OD1   . ASP B 1 69  ? 194.36401 256.43916 66.79811  1.000 97.90086  ?  69  ASP B OD1   1 
ATOM   3829  O OD2   . ASP B 1 69  ? 194.72765 254.52422 65.79397  1.000 98.33639  ?  69  ASP B OD2   1 
ATOM   3830  N N     . VAL B 1 70  ? 192.23802 253.42678 70.44965  1.000 85.51140  ?  70  VAL B N     1 
ATOM   3831  C CA    . VAL B 1 70  ? 191.24843 252.70493 71.23562  1.000 81.86827  ?  70  VAL B CA    1 
ATOM   3832  C C     . VAL B 1 70  ? 190.63722 253.64119 72.26558  1.000 94.41640  ?  70  VAL B C     1 
ATOM   3833  O O     . VAL B 1 70  ? 189.40801 253.73197 72.39259  1.000 95.06306  ?  70  VAL B O     1 
ATOM   3834  C CB    . VAL B 1 70  ? 191.88521 251.47880 71.91085  1.000 73.80784  ?  70  VAL B CB    1 
ATOM   3835  C CG1   . VAL B 1 70  ? 191.00428 251.04482 73.00680  1.000 86.17836  ?  70  VAL B CG1   1 
ATOM   3836  C CG2   . VAL B 1 70  ? 192.05515 250.33752 70.95300  1.000 73.62579  ?  70  VAL B CG2   1 
ATOM   3837  N N     . CYS B 1 71  ? 191.48528 254.43456 72.93283  1.000 95.25354  ?  71  CYS B N     1 
ATOM   3838  C CA    . CYS B 1 71  ? 191.01271 255.37293 73.94801  1.000 89.33964  ?  71  CYS B CA    1 
ATOM   3839  C C     . CYS B 1 71  ? 190.07770 256.41470 73.36747  1.000 92.75324  ?  71  CYS B C     1 
ATOM   3840  O O     . CYS B 1 71  ? 189.10358 256.81830 74.01719  1.000 91.10931  ?  71  CYS B O     1 
ATOM   3841  C CB    . CYS B 1 71  ? 192.18283 256.10068 74.59484  1.000 88.82825  ?  71  CYS B CB    1 
ATOM   3842  S SG    . CYS B 1 71  ? 193.24749 255.09046 75.55698  1.000 100.49466 ?  71  CYS B SG    1 
ATOM   3843  N N     . SER B 1 72  ? 190.41378 256.93724 72.18983  1.000 96.35516  ?  72  SER B N     1 
ATOM   3844  C CA    . SER B 1 72  ? 189.55835 257.94507 71.57799  1.000 98.44338  ?  72  SER B CA    1 
ATOM   3845  C C     . SER B 1 72  ? 188.19570 257.36791 71.26332  1.000 95.98209  ?  72  SER B C     1 
ATOM   3846  O O     . SER B 1 72  ? 187.17812 258.07132 71.34052  1.000 97.18745  ?  72  SER B O     1 
ATOM   3847  C CB    . SER B 1 72  ? 190.20074 258.49768 70.31168  1.000 98.62141  ?  72  SER B CB    1 
ATOM   3848  O OG    . SER B 1 72  ? 191.46960 259.04955 70.59802  1.000 105.85375 ?  72  SER B OG    1 
ATOM   3849  N N     . TYR B 1 73  ? 188.17109 256.11300 70.81218  1.000 88.65750  ?  73  TYR B N     1 
ATOM   3850  C CA    . TYR B 1 73  ? 186.90185 255.47433 70.50156  1.000 92.88613  ?  73  TYR B CA    1 
ATOM   3851  C C     . TYR B 1 73  ? 186.06328 255.29331 71.76201  1.000 94.96106  ?  73  TYR B C     1 
ATOM   3852  O O     . TYR B 1 73  ? 184.85859 255.57883 71.76398  1.000 95.02531  ?  73  TYR B O     1 
ATOM   3853  C CB    . TYR B 1 73  ? 187.15640 254.14333 69.79426  1.000 94.84902  ?  73  TYR B CB    1 
ATOM   3854  C CG    . TYR B 1 73  ? 185.93977 253.26830 69.70061  1.000 97.50919  ?  73  TYR B CG    1 
ATOM   3855  C CD1   . TYR B 1 73  ? 184.89676 253.62633 68.86726  1.000 97.99606  ?  73  TYR B CD1   1 
ATOM   3856  C CD2   . TYR B 1 73  ? 185.84509 252.06692 70.39572  1.000 94.98069  ?  73  TYR B CD2   1 
ATOM   3857  C CE1   . TYR B 1 73  ? 183.77741 252.84584 68.74895  1.000 97.97658  ?  73  TYR B CE1   1 
ATOM   3858  C CE2   . TYR B 1 73  ? 184.71925 251.26594 70.27644  1.000 95.13469  ?  73  TYR B CE2   1 
ATOM   3859  C CZ    . TYR B 1 73  ? 183.68531 251.67002 69.44648  1.000 95.84993  ?  73  TYR B CZ    1 
ATOM   3860  O OH    . TYR B 1 73  ? 182.54380 250.92366 69.27792  1.000 95.77202  ?  73  TYR B OH    1 
ATOM   3861  N N     . LEU B 1 74  ? 186.69295 254.84865 72.85448  1.000 93.75046  ?  74  LEU B N     1 
ATOM   3862  C CA    . LEU B 1 74  ? 185.96113 254.63374 74.09797  1.000 90.01606  ?  74  LEU B CA    1 
ATOM   3863  C C     . LEU B 1 74  ? 185.36912 255.93654 74.61455  1.000 96.51507  ?  74  LEU B C     1 
ATOM   3864  O O     . LEU B 1 74  ? 184.23500 255.96063 75.11365  1.000 99.68496  ?  74  LEU B O     1 
ATOM   3865  C CB    . LEU B 1 74  ? 186.88687 253.99239 75.13609  1.000 82.83762  ?  74  LEU B CB    1 
ATOM   3866  C CG    . LEU B 1 74  ? 187.38530 252.59225 74.78913  1.000 84.29671  ?  74  LEU B CG    1 
ATOM   3867  C CD1   . LEU B 1 74  ? 188.48341 252.10403 75.72368  1.000 78.21756  ?  74  LEU B CD1   1 
ATOM   3868  C CD2   . LEU B 1 74  ? 186.16764 251.70810 74.95618  1.000 83.59619  ?  74  LEU B CD2   1 
ATOM   3869  N N     . ALA B 1 75  ? 186.12978 257.03007 74.51739  1.000 96.12939  ?  75  ALA B N     1 
ATOM   3870  C CA    . ALA B 1 75  ? 185.62736 258.32007 74.97012  1.000 94.55299  ?  75  ALA B CA    1 
ATOM   3871  C C     . ALA B 1 75  ? 184.45804 258.78795 74.10754  1.000 99.42163  ?  75  ALA B C     1 
ATOM   3872  O O     . ALA B 1 75  ? 183.47800 259.33857 74.62589  1.000 100.37084 ?  75  ALA B O     1 
ATOM   3873  C CB    . ALA B 1 75  ? 186.76725 259.33299 74.98627  1.000 94.90341  ?  75  ALA B CB    1 
ATOM   3874  N N     . ALA B 1 76  ? 184.53893 258.56114 72.78881  1.000 96.81709  ?  76  ALA B N     1 
ATOM   3875  C CA    . ALA B 1 76  ? 183.44799 258.91297 71.87801  1.000 100.98068 ?  76  ALA B CA    1 
ATOM   3876  C C     . ALA B 1 76  ? 182.19697 258.07352 72.13846  1.000 103.75250 ?  76  ALA B C     1 
ATOM   3877  O O     . ALA B 1 76  ? 181.06853 258.55133 71.95394  1.000 107.20583 ?  76  ALA B O     1 
ATOM   3878  C CB    . ALA B 1 76  ? 183.90780 258.75215 70.43476  1.000 104.65212 ?  76  ALA B CB    1 
ATOM   3879  N N     . ALA B 1 77  ? 182.37959 256.80330 72.50393  1.000 96.72745  ?  77  ALA B N     1 
ATOM   3880  C CA    . ALA B 1 77  ? 181.26863 255.90282 72.77622  1.000 95.74378  ?  77  ALA B CA    1 
ATOM   3881  C C     . ALA B 1 77  ? 180.50356 256.25584 74.05156  1.000 102.10931 ?  77  ALA B C     1 
ATOM   3882  O O     . ALA B 1 77  ? 179.41060 255.70927 74.26273  1.000 101.99415 ?  77  ALA B O     1 
ATOM   3883  C CB    . ALA B 1 77  ? 181.78484 254.46659 72.84366  1.000 93.02519  ?  77  ALA B CB    1 
ATOM   3884  N N     . MET B 1 78  ? 181.05911 257.12949 74.91366  1.000 104.45749 ?  78  MET B N     1 
ATOM   3885  C CA    . MET B 1 78  ? 180.39093 257.48867 76.16614  1.000 98.94419  ?  78  MET B CA    1 
ATOM   3886  C C     . MET B 1 78  ? 179.03959 258.12905 75.90937  1.000 100.48534 ?  78  MET B C     1 
ATOM   3887  O O     . MET B 1 78  ? 178.12458 257.99788 76.73253  1.000 98.17769  ?  78  MET B O     1 
ATOM   3888  C CB    . MET B 1 78  ? 181.23979 258.47368 76.99055  1.000 96.41191  ?  78  MET B CB    1 
ATOM   3889  C CG    . MET B 1 78  ? 182.50972 257.90644 77.63920  1.000 99.69511  ?  78  MET B CG    1 
ATOM   3890  S SD    . MET B 1 78  ? 183.47818 259.05007 78.68556  1.000 108.90044 ?  78  MET B SD    1 
ATOM   3891  C CE    . MET B 1 78  ? 184.72106 257.93261 79.32644  1.000 97.47001  ?  78  MET B CE    1 
ATOM   3892  N N     . GLN B 1 79  ? 178.89753 258.81467 74.77363  1.000 100.99180 ?  79  GLN B N     1 
ATOM   3893  C CA    . GLN B 1 79  ? 177.62813 259.44681 74.46220  1.000 105.41983 ?  79  GLN B CA    1 
ATOM   3894  C C     . GLN B 1 79  ? 176.53110 258.40968 74.25708  1.000 108.64194 ?  79  GLN B C     1 
ATOM   3895  O O     . GLN B 1 79  ? 175.37164 258.67146 74.59368  1.000 111.68290 ?  79  GLN B O     1 
ATOM   3896  C CB    . GLN B 1 79  ? 177.76802 260.33162 73.22384  1.000 106.06467 ?  79  GLN B CB    1 
ATOM   3897  C CG    . GLN B 1 79  ? 178.02152 259.52556 71.94981  1.000 110.03038 ?  79  GLN B CG    1 
ATOM   3898  C CD    . GLN B 1 79  ? 177.54217 260.22826 70.70621  1.000 118.90056 ?  79  GLN B CD    1 
ATOM   3899  O OE1   . GLN B 1 79  ? 177.06119 261.37224 70.75295  1.000 124.49282 ?  79  GLN B OE1   1 
ATOM   3900  N NE2   . GLN B 1 79  ? 177.65020 259.54239 69.58110  1.000 110.67779 ?  79  GLN B NE2   1 
ATOM   3901  N N     . PHE B 1 80  ? 176.87039 257.22881 73.72967  1.000 105.41346 ?  80  PHE B N     1 
ATOM   3902  C CA    . PHE B 1 80  ? 175.84141 256.22375 73.46317  1.000 105.84584 ?  80  PHE B CA    1 
ATOM   3903  C C     . PHE B 1 80  ? 175.12215 255.78498 74.73684  1.000 108.03116 ?  80  PHE B C     1 
ATOM   3904  O O     . PHE B 1 80  ? 173.89967 255.58604 74.72729  1.000 110.12656 ?  80  PHE B O     1 
ATOM   3905  C CB    . PHE B 1 80  ? 176.43476 255.01182 72.74030  1.000 103.77906 ?  80  PHE B CB    1 
ATOM   3906  C CG    . PHE B 1 80  ? 176.82921 255.27734 71.31611  1.000 103.85599 ?  80  PHE B CG    1 
ATOM   3907  C CD1   . PHE B 1 80  ? 175.88677 255.35692 70.31014  1.000 102.28045 ?  80  PHE B CD1   1 
ATOM   3908  C CD2   . PHE B 1 80  ? 178.14826 255.53204 71.01087  1.000 107.52496 ?  80  PHE B CD2   1 
ATOM   3909  C CE1   . PHE B 1 80  ? 176.27513 255.61065 69.00382  1.000 113.09260 ?  80  PHE B CE1   1 
ATOM   3910  C CE2   . PHE B 1 80  ? 178.53847 255.79993 69.72125  1.000 111.06377 ?  80  PHE B CE2   1 
ATOM   3911  C CZ    . PHE B 1 80  ? 177.60399 255.84029 68.71283  1.000 113.45900 ?  80  PHE B CZ    1 
ATOM   3912  N N     . PHE B 1 81  ? 175.84488 255.64404 75.84681  1.000 108.42339 ?  81  PHE B N     1 
ATOM   3913  C CA    . PHE B 1 81  ? 175.25330 255.11343 77.07677  1.000 107.92180 ?  81  PHE B CA    1 
ATOM   3914  C C     . PHE B 1 81  ? 174.62852 256.24934 77.89140  1.000 105.87530 ?  81  PHE B C     1 
ATOM   3915  O O     . PHE B 1 81  ? 175.33757 257.13892 78.38573  1.000 101.83852 ?  81  PHE B O     1 
ATOM   3916  C CB    . PHE B 1 81  ? 176.30426 254.35704 77.88703  1.000 98.95608  ?  81  PHE B CB    1 
ATOM   3917  C CG    . PHE B 1 81  ? 177.10172 253.36645 77.07656  1.000 97.03940  ?  81  PHE B CG    1 
ATOM   3918  C CD1   . PHE B 1 81  ? 176.58466 252.11257 76.76724  1.000 94.56804  ?  81  PHE B CD1   1 
ATOM   3919  C CD2   . PHE B 1 81  ? 178.36748 253.70402 76.59396  1.000 96.60750  ?  81  PHE B CD2   1 
ATOM   3920  C CE1   . PHE B 1 81  ? 177.33419 251.18827 76.01989  1.000 94.54104  ?  81  PHE B CE1   1 
ATOM   3921  C CE2   . PHE B 1 81  ? 179.11570 252.80055 75.84444  1.000 95.42649  ?  81  PHE B CE2   1 
ATOM   3922  C CZ    . PHE B 1 81  ? 178.60167 251.53862 75.55494  1.000 93.74809  ?  81  PHE B CZ    1 
ATOM   3923  N N     . GLU B 1 82  ? 173.30370 256.20929 78.04856  1.000 104.41316 ?  82  GLU B N     1 
ATOM   3924  C CA    . GLU B 1 82  ? 172.59289 257.26917 78.74716  1.000 104.40907 ?  82  GLU B CA    1 
ATOM   3925  C C     . GLU B 1 82  ? 171.59690 256.65622 79.71317  1.000 104.27084 ?  82  GLU B C     1 
ATOM   3926  O O     . GLU B 1 82  ? 170.95562 255.64690 79.40596  1.000 104.50983 ?  82  GLU B O     1 
ATOM   3927  C CB    . GLU B 1 82  ? 171.82149 258.18299 77.77950  1.000 108.00937 ?  82  GLU B CB    1 
ATOM   3928  C CG    . GLU B 1 82  ? 171.93661 259.68078 78.05531  1.000 111.75246 ?  82  GLU B CG    1 
ATOM   3929  C CD    . GLU B 1 82  ? 171.19820 260.52665 77.01034  1.000 122.38181 ?  82  GLU B CD    1 
ATOM   3930  O OE1   . GLU B 1 82  ? 170.46785 259.94293 76.17405  1.000 119.05106 ?  82  GLU B OE1   1 
ATOM   3931  O OE2   . GLU B 1 82  ? 171.35592 261.77082 77.01466  1.000 126.12037 ?  82  GLU B OE2   1 
ATOM   3932  N N     . GLY B 1 83  ? 171.48646 257.26725 80.88595  1.000 105.43175 ?  83  GLY B N     1 
ATOM   3933  C CA    . GLY B 1 83  ? 170.53817 256.81429 81.88696  1.000 108.24465 ?  83  GLY B CA    1 
ATOM   3934  C C     . GLY B 1 83  ? 170.13861 257.93685 82.81317  1.000 110.82724 ?  83  GLY B C     1 
ATOM   3935  O O     . GLY B 1 83  ? 170.86952 258.91842 82.98269  1.000 110.31024 ?  83  GLY B O     1 
ATOM   3936  N N     . THR B 1 84  ? 168.94262 257.80344 83.38274  1.000 108.56645 ?  84  THR B N     1 
ATOM   3937  C CA    . THR B 1 84  ? 168.44390 258.74034 84.37915  1.000 109.69184 ?  84  THR B CA    1 
ATOM   3938  C C     . THR B 1 84  ? 169.06546 258.48904 85.75385  1.000 109.08927 ?  84  THR B C     1 
ATOM   3939  O O     . THR B 1 84  ? 169.22005 257.34048 86.18153  1.000 107.00846 ?  84  THR B O     1 
ATOM   3940  C CB    . THR B 1 84  ? 166.93111 258.62476 84.43945  1.000 111.68132 ?  84  THR B CB    1 
ATOM   3941  O OG1   . THR B 1 84  ? 166.42356 258.65877 83.09726  1.000 107.70820 ?  84  THR B OG1   1 
ATOM   3942  C CG2   . THR B 1 84  ? 166.33824 259.74594 85.27169  1.000 111.84347 ?  84  THR B CG2   1 
ATOM   3943  N N     . CYS B 1 85  ? 169.37435 259.57874 86.46909  1.000 111.56878 ?  85  CYS B N     1 
ATOM   3944  C CA    . CYS B 1 85  ? 170.04823 259.49155 87.76326  1.000 114.40705 ?  85  CYS B CA    1 
ATOM   3945  C C     . CYS B 1 85  ? 169.02698 259.27724 88.88080  1.000 118.21463 ?  85  CYS B C     1 
ATOM   3946  O O     . CYS B 1 85  ? 168.16974 260.14964 89.08948  1.000 122.52473 ?  85  CYS B O     1 
ATOM   3947  C CB    . CYS B 1 85  ? 170.83980 260.76734 88.00380  1.000 111.46112 ?  85  CYS B CB    1 
ATOM   3948  S SG    . CYS B 1 85  ? 172.08092 260.65123 89.26619  1.000 110.37745 ?  85  CYS B SG    1 
ATOM   3949  N N     . PRO B 1 86  ? 169.11197 258.18401 89.66192  1.000 115.22791 ?  86  PRO B N     1 
ATOM   3950  C CA    . PRO B 1 86  ? 168.03322 257.90609 90.64134  1.000 114.67596 ?  86  PRO B CA    1 
ATOM   3951  C C     . PRO B 1 86  ? 167.94216 258.90551 91.78428  1.000 119.02233 ?  86  PRO B C     1 
ATOM   3952  O O     . PRO B 1 86  ? 166.83401 259.29957 92.17892  1.000 121.60673 ?  86  PRO B O     1 
ATOM   3953  C CB    . PRO B 1 86  ? 168.36020 256.49063 91.13684  1.000 109.01136 ?  86  PRO B CB    1 
ATOM   3954  C CG    . PRO B 1 86  ? 169.24235 255.90426 90.07398  1.000 112.11678 ?  86  PRO B CG    1 
ATOM   3955  C CD    . PRO B 1 86  ? 170.05641 257.06041 89.55651  1.000 110.24454 ?  86  PRO B CD    1 
ATOM   3956  N N     . GLU B 1 87  ? 169.07718 259.34558 92.31613  1.000 119.46965 ?  87  GLU B N     1 
ATOM   3957  C CA    . GLU B 1 87  ? 169.13927 260.22089 93.47762  1.000 118.13393 ?  87  GLU B CA    1 
ATOM   3958  C C     . GLU B 1 87  ? 170.15306 261.30395 93.16827  1.000 117.00866 ?  87  GLU B C     1 
ATOM   3959  O O     . GLU B 1 87  ? 170.89262 261.20892 92.18558  1.000 115.40116 ?  87  GLU B O     1 
ATOM   3960  C CB    . GLU B 1 87  ? 169.55266 259.44819 94.72918  1.000 114.73418 ?  87  GLU B CB    1 
ATOM   3961  C CG    . GLU B 1 87  ? 169.28237 260.13380 96.03351  1.000 119.70831 ?  87  GLU B CG    1 
ATOM   3962  C CD    . GLU B 1 87  ? 169.92286 259.37727 97.18746  1.000 135.82757 ?  87  GLU B CD    1 
ATOM   3963  O OE1   . GLU B 1 87  ? 170.53154 258.30240 96.94213  1.000 130.08548 ?  87  GLU B OE1   1 
ATOM   3964  O OE2   . GLU B 1 87  ? 169.88449 259.89148 98.32486  1.000 133.35033 ?  87  GLU B OE2   1 
ATOM   3965  N N     . ASP B 1 88  ? 170.14300 262.36841 93.96485  1.000 114.93874 ?  88  ASP B N     1 
ATOM   3966  C CA    . ASP B 1 88  ? 171.14261 263.41038 93.76784  1.000 113.67176 ?  88  ASP B CA    1 
ATOM   3967  C C     . ASP B 1 88  ? 172.54102 262.83861 93.95856  1.000 113.06475 ?  88  ASP B C     1 
ATOM   3968  O O     . ASP B 1 88  ? 172.81321 262.15627 94.94889  1.000 113.49238 ?  88  ASP B O     1 
ATOM   3969  C CB    . ASP B 1 88  ? 170.89212 264.55756 94.73472  1.000 107.56057 ?  88  ASP B CB    1 
ATOM   3970  C CG    . ASP B 1 88  ? 169.53991 265.18218 94.53638  1.000 116.58401 ?  88  ASP B CG    1 
ATOM   3971  O OD1   . ASP B 1 88  ? 169.37139 265.89206 93.52053  1.000 119.48794 ?  88  ASP B OD1   1 
ATOM   3972  O OD2   . ASP B 1 88  ? 168.63999 264.95473 95.37617  1.000 113.38487 ?  88  ASP B OD2   1 
ATOM   3973  N N     . TRP B 1 89  ? 173.43406 263.11954 93.00631  1.000 114.23636 ?  89  TRP B N     1 
ATOM   3974  C CA    . TRP B 1 89  ? 174.77095 262.52071 92.96996  1.000 110.17794 ?  89  TRP B CA    1 
ATOM   3975  C C     . TRP B 1 89  ? 175.85608 263.56398 93.23422  1.000 110.25787 ?  89  TRP B C     1 
ATOM   3976  O O     . TRP B 1 89  ? 176.19787 264.34914 92.34591  1.000 109.25245 ?  89  TRP B O     1 
ATOM   3977  C CB    . TRP B 1 89  ? 175.01249 261.83375 91.62343  1.000 110.23284 ?  89  TRP B CB    1 
ATOM   3978  C CG    . TRP B 1 89  ? 176.16379 260.84148 91.66732  1.000 106.82470 ?  89  TRP B CG    1 
ATOM   3979  C CD1   . TRP B 1 89  ? 176.86743 260.48421 92.76952  1.000 104.00296 ?  89  TRP B CD1   1 
ATOM   3980  C CD2   . TRP B 1 89  ? 176.69243 260.03793 90.58369  1.000 106.36371 ?  89  TRP B CD2   1 
ATOM   3981  N NE1   . TRP B 1 89  ? 177.80796 259.53973 92.45397  1.000 102.92067 ?  89  TRP B NE1   1 
ATOM   3982  C CE2   . TRP B 1 89  ? 177.72431 259.24676 91.12278  1.000 102.47138 ?  89  TRP B CE2   1 
ATOM   3983  C CE3   . TRP B 1 89  ? 176.39987 259.91915 89.21831  1.000 106.89548 ?  89  TRP B CE3   1 
ATOM   3984  C CZ2   . TRP B 1 89  ? 178.46847 258.35177 90.35497  1.000 99.36355  ?  89  TRP B CZ2   1 
ATOM   3985  C CZ3   . TRP B 1 89  ? 177.14432 259.02080 88.45345  1.000 102.38094 ?  89  TRP B CZ3   1 
ATOM   3986  C CH2   . TRP B 1 89  ? 178.16650 258.25218 89.02726  1.000 94.42667  ?  89  TRP B CH2   1 
ATOM   3987  N N     . THR B 1 90  ? 176.39219 263.58355 94.44847  1.000 112.17332 ?  90  THR B N     1 
ATOM   3988  C CA    . THR B 1 90  ? 177.47751 264.48445 94.81288  1.000 113.13831 ?  90  THR B CA    1 
ATOM   3989  C C     . THR B 1 90  ? 178.72921 263.69554 95.18005  1.000 114.22357 ?  90  THR B C     1 
ATOM   3990  O O     . THR B 1 90  ? 178.65526 262.69009 95.89587  1.000 111.21137 ?  90  THR B O     1 
ATOM   3991  C CB    . THR B 1 90  ? 177.06420 265.40700 95.95269  1.000 113.53013 ?  90  THR B CB    1 
ATOM   3992  O OG1   . THR B 1 90  ? 175.73774 265.88099 95.70129  1.000 111.06484 ?  90  THR B OG1   1 
ATOM   3993  C CG2   . THR B 1 90  ? 178.01399 266.59070 96.02762  1.000 111.92284 ?  90  THR B CG2   1 
ATOM   3994  N N     . SER B 1 91  ? 179.87055 264.14689 94.66559  1.000 108.78694 ?  91  SER B N     1 
ATOM   3995  C CA    . SER B 1 91  ? 181.18085 263.56114 94.93233  1.000 102.30686 ?  91  SER B CA    1 
ATOM   3996  C C     . SER B 1 91  ? 181.94671 264.46939 95.87275  1.000 102.69343 ?  91  SER B C     1 
ATOM   3997  O O     . SER B 1 91  ? 181.32455 265.22182 96.63689  1.000 108.84905 ?  91  SER B O     1 
ATOM   3998  C CB    . SER B 1 91  ? 181.99259 263.40949 93.66221  1.000 114.19888 ?  91  SER B CB    1 
ATOM   3999  O OG    . SER B 1 91  ? 182.12925 264.68967 93.06051  1.000 119.18171 ?  91  SER B OG    1 
ATOM   4000  N N     . TYR B 1 92  ? 183.27817 264.30367 95.89897  1.000 102.24349 ?  92  TYR B N     1 
ATOM   4001  C CA    . TYR B 1 92  ? 184.13873 265.10291 96.76965  1.000 102.02590 ?  92  TYR B CA    1 
ATOM   4002  C C     . TYR B 1 92  ? 183.62448 266.52692 96.90504  1.000 106.10910 ?  92  TYR B C     1 
ATOM   4003  O O     . TYR B 1 92  ? 183.47553 267.03716 98.01944  1.000 115.38973 ?  92  TYR B O     1 
ATOM   4004  C CB    . TYR B 1 92  ? 185.59717 265.10302 96.29285  1.000 102.96070 ?  92  TYR B CB    1 
ATOM   4005  C CG    . TYR B 1 92  ? 186.29635 263.83994 96.74717  1.000 103.11220 ?  92  TYR B CG    1 
ATOM   4006  C CD1   . TYR B 1 92  ? 186.63462 263.63842 98.07082  1.000 100.15415 ?  92  TYR B CD1   1 
ATOM   4007  C CD2   . TYR B 1 92  ? 186.64194 262.85677 95.83250  1.000 104.16178 ?  92  TYR B CD2   1 
ATOM   4008  C CE1   . TYR B 1 92  ? 187.24123 262.46751 98.47860  1.000 97.14413  ?  92  TYR B CE1   1 
ATOM   4009  C CE2   . TYR B 1 92  ? 187.26599 261.69441 96.22370  1.000 98.88976  ?  92  TYR B CE2   1 
ATOM   4010  C CZ    . TYR B 1 92  ? 187.56460 261.50313 97.55110  1.000 98.83909  ?  92  TYR B CZ    1 
ATOM   4011  O OH    . TYR B 1 92  ? 188.18389 260.34778 97.96740  1.000 106.36976 ?  92  TYR B OH    1 
ATOM   4012  N N     . GLY B 1 93  ? 183.29877 267.17251 95.79890  1.000 102.94797 ?  93  GLY B N     1 
ATOM   4013  C CA    . GLY B 1 93  ? 182.75160 268.49573 95.96920  1.000 104.48371 ?  93  GLY B CA    1 
ATOM   4014  C C     . GLY B 1 93  ? 181.83981 268.83348 94.82370  1.000 105.15079 ?  93  GLY B C     1 
ATOM   4015  O O     . GLY B 1 93  ? 181.23528 269.91212 94.80071  1.000 97.41390  ?  93  GLY B O     1 
ATOM   4016  N N     . ILE B 1 94  ? 181.69628 267.89022 93.88560  1.000 110.42004 ?  94  ILE B N     1 
ATOM   4017  C CA    . ILE B 1 94  ? 180.98665 268.10041 92.63246  1.000 108.82420 ?  94  ILE B CA    1 
ATOM   4018  C C     . ILE B 1 94  ? 179.62546 267.41806 92.64412  1.000 108.93911 ?  94  ILE B C     1 
ATOM   4019  O O     . ILE B 1 94  ? 179.49721 266.26428 93.09040  1.000 105.14593 ?  94  ILE B O     1 
ATOM   4020  C CB    . ILE B 1 94  ? 181.82873 267.61636 91.43217  1.000 102.57326 ?  94  ILE B CB    1 
ATOM   4021  C CG1   . ILE B 1 94  ? 183.28987 268.09751 91.56529  1.000 98.34559  ?  94  ILE B CG1   1 
ATOM   4022  C CG2   . ILE B 1 94  ? 181.30348 268.16922 90.11291  1.000 103.52043 ?  94  ILE B CG2   1 
ATOM   4023  C CD1   . ILE B 1 94  ? 184.29632 267.41012 90.68378  1.000 98.83981  ?  94  ILE B CD1   1 
ATOM   4024  N N     . VAL B 1 95  ? 178.61985 268.13425 92.12110  1.000 108.93573 ?  95  VAL B N     1 
ATOM   4025  C CA    . VAL B 1 95  ? 177.25978 267.58948 91.91534  1.000 110.87694 ?  95  VAL B CA    1 
ATOM   4026  C C     . VAL B 1 95  ? 177.22916 267.12437 90.46019  1.000 110.06601 ?  95  VAL B C     1 
ATOM   4027  O O     . VAL B 1 95  ? 177.02409 267.89606 89.50317  1.000 110.71330 ?  95  VAL B O     1 
ATOM   4028  C CB    . VAL B 1 95  ? 176.14623 268.60989 92.23636  1.000 111.14359 ?  95  VAL B CB    1 
ATOM   4029  C CG1   . VAL B 1 95  ? 176.31314 270.02636 91.39478  1.000 95.56368  ?  95  VAL B CG1   1 
ATOM   4030  C CG2   . VAL B 1 95  ? 174.66788 267.94750 92.16572  1.000 98.74712  ?  95  VAL B CG2   1 
ATOM   4031  N N     . ILE B 1 96  ? 177.46222 265.82188 90.29441  1.000 109.32306 ?  96  ILE B N     1 
ATOM   4032  C CA    . ILE B 1 96  ? 177.54163 265.26091 88.95708  1.000 109.81074 ?  96  ILE B CA    1 
ATOM   4033  C C     . ILE B 1 96  ? 176.15497 265.15340 88.33206  1.000 113.26495 ?  96  ILE B C     1 
ATOM   4034  O O     . ILE B 1 96  ? 175.97353 265.33490 87.10946  1.000 111.73156 ?  96  ILE B O     1 
ATOM   4035  C CB    . ILE B 1 96  ? 178.27764 263.89734 88.99703  1.000 109.47311 ?  96  ILE B CB    1 
ATOM   4036  C CG1   . ILE B 1 96  ? 178.33996 263.24124 87.61105  1.000 114.89108 ?  96  ILE B CG1   1 
ATOM   4037  C CG2   . ILE B 1 96  ? 177.68432 262.96866 90.07423  1.000 103.85020 ?  96  ILE B CG2   1 
ATOM   4038  C CD1   . ILE B 1 96  ? 179.15081 264.01393 86.57955  1.000 118.11124 ?  96  ILE B CD1   1 
ATOM   4039  N N     . ALA B 1 97  ? 175.13489 264.95887 89.16436  1.000 111.81051 ?  97  ALA B N     1 
ATOM   4040  C CA    . ALA B 1 97  ? 173.78960 264.77526 88.63782  1.000 115.23821 ?  97  ALA B CA    1 
ATOM   4041  C C     . ALA B 1 97  ? 172.80405 265.12644 89.72674  1.000 112.95528 ?  97  ALA B C     1 
ATOM   4042  O O     . ALA B 1 97  ? 173.12468 265.08312 90.91613  1.000 109.28344 ?  97  ALA B O     1 
ATOM   4043  C CB    . ALA B 1 97  ? 173.58247 263.34656 88.12567  1.000 109.16660 ?  97  ALA B CB    1 
ATOM   4044  N N     . ARG B 1 98  ? 171.58524 265.39368 89.30504  1.000 117.18383 ?  98  ARG B N     1 
ATOM   4045  C CA    . ARG B 1 98  ? 170.48410 265.68039 90.19900  1.000 117.99980 ?  98  ARG B CA    1 
ATOM   4046  C C     . ARG B 1 98  ? 169.44663 264.62301 89.89131  1.000 121.13690 ?  98  ARG B C     1 
ATOM   4047  O O     . ARG B 1 98  ? 169.42829 264.08678 88.78081  1.000 120.31784 ?  98  ARG B O     1 
ATOM   4048  C CB    . ARG B 1 98  ? 169.92285 267.08751 89.97337  1.000 116.63949 ?  98  ARG B CB    1 
ATOM   4049  C CG    . ARG B 1 98  ? 170.74324 268.18314 90.62643  1.000 122.33740 ?  98  ARG B CG    1 
ATOM   4050  C CD    . ARG B 1 98  ? 169.97746 269.48798 90.60776  1.000 125.89913 ?  98  ARG B CD    1 
ATOM   4051  N NE    . ARG B 1 98  ? 170.61783 270.51951 91.41292  1.000 123.89334 ?  98  ARG B NE    1 
ATOM   4052  C CZ    . ARG B 1 98  ? 170.35815 270.70729 92.70153  1.000 130.10375 ?  98  ARG B CZ    1 
ATOM   4053  N NH1   . ARG B 1 98  ? 169.51578 269.92271 93.36011  1.000 125.70211 ?  98  ARG B NH1   1 
ATOM   4054  N NH2   . ARG B 1 98  ? 170.94488 271.71309 93.34378  1.000 137.32782 ?  98  ARG B NH2   1 
ATOM   4055  N N     . LYS B 1 99  ? 168.63668 264.26138 90.88758  1.000 120.34688 ?  99  LYS B N     1 
ATOM   4056  C CA    . LYS B 1 99  ? 167.69941 263.16576 90.67790  1.000 120.51810 ?  99  LYS B CA    1 
ATOM   4057  C C     . LYS B 1 99  ? 166.80815 263.50003 89.48165  1.000 123.56097 ?  99  LYS B C     1 
ATOM   4058  O O     . LYS B 1 99  ? 166.25139 264.60205 89.39002  1.000 119.09314 ?  99  LYS B O     1 
ATOM   4059  C CB    . LYS B 1 99  ? 166.89216 262.90512 91.95670  1.000 119.10294 ?  99  LYS B CB    1 
ATOM   4060  C CG    . LYS B 1 99  ? 166.29818 264.15326 92.64295  1.000 125.63946 ?  99  LYS B CG    1 
ATOM   4061  C CD    . LYS B 1 99  ? 165.48236 263.83679 93.92177  1.000 130.10212 ?  99  LYS B CD    1 
ATOM   4062  C CE    . LYS B 1 99  ? 164.34868 262.84879 93.68113  1.000 132.14533 ?  99  LYS B CE    1 
ATOM   4063  N NZ    . LYS B 1 99  ? 163.34169 263.36541 92.71491  1.000 128.06761 ?  99  LYS B NZ    1 
ATOM   4064  N N     . GLY B 1 100 ? 166.66749 262.53051 88.57134  1.000 119.25359 ?  100 GLY B N     1 
ATOM   4065  C CA    . GLY B 1 100 ? 165.93515 262.72491 87.33733  1.000 113.09688 ?  100 GLY B CA    1 
ATOM   4066  C C     . GLY B 1 100 ? 166.69305 263.37518 86.20501  1.000 119.32950 ?  100 GLY B C     1 
ATOM   4067  O O     . GLY B 1 100 ? 166.06735 263.71926 85.18589  1.000 121.45917 ?  100 GLY B O     1 
ATOM   4068  N N     . ASP B 1 101 ? 168.02106 263.57320 86.30731  1.000 119.10541 ?  101 ASP B N     1 
ATOM   4069  C CA    . ASP B 1 101 ? 168.79761 264.11765 85.19037  1.000 119.09932 ?  101 ASP B CA    1 
ATOM   4070  C C     . ASP B 1 101 ? 169.37291 262.93087 84.44992  1.000 115.01248 ?  101 ASP B C     1 
ATOM   4071  O O     . ASP B 1 101 ? 170.00852 262.05605 85.05567  1.000 115.59230 ?  101 ASP B O     1 
ATOM   4072  C CB    . ASP B 1 101 ? 169.95601 265.01631 85.63082  1.000 117.73198 ?  101 ASP B CB    1 
ATOM   4073  C CG    . ASP B 1 101 ? 169.51414 266.23371 86.34506  1.000 120.60529 ?  101 ASP B CG    1 
ATOM   4074  O OD1   . ASP B 1 101 ? 168.30082 266.36351 86.54638  1.000 125.10009 ?  101 ASP B OD1   1 
ATOM   4075  O OD2   . ASP B 1 101 ? 170.40091 267.04019 86.68196  1.000 116.11882 ?  101 ASP B OD2   1 
ATOM   4076  N N     . LYS B 1 102 ? 169.10456 262.84542 83.13412  1.000 112.64223 ?  102 LYS B N     1 
ATOM   4077  C CA    . LYS B 1 102 ? 169.69741 261.74487 82.37698  1.000 112.03584 ?  102 LYS B CA    1 
ATOM   4078  C C     . LYS B 1 102 ? 171.13754 262.15262 82.10508  1.000 112.76944 ?  102 LYS B C     1 
ATOM   4079  O O     . LYS B 1 102 ? 171.40497 263.32607 81.79011  1.000 109.97054 ?  102 LYS B O     1 
ATOM   4080  C CB    . LYS B 1 102 ? 168.87455 261.51180 81.08788  1.000 111.17227 ?  102 LYS B CB    1 
ATOM   4081  C CG    . LYS B 1 102 ? 169.15604 260.11832 80.36529  1.000 103.50482 ?  102 LYS B CG    1 
ATOM   4082  C CD    . LYS B 1 102 ? 168.16801 259.71228 79.15720  1.000 101.15193 ?  102 LYS B CD    1 
ATOM   4083  C CE    . LYS B 1 102 ? 168.05559 260.90247 78.12232  1.000 113.02053 ?  102 LYS B CE    1 
ATOM   4084  N NZ    . LYS B 1 102 ? 167.34066 260.92155 76.66985  1.000 105.92802 ?  102 LYS B NZ    1 
ATOM   4085  N N     . ILE B 1 103 ? 172.06825 261.19240 82.22663  1.000 112.72408 ?  103 ILE B N     1 
ATOM   4086  C CA    . ILE B 1 103 ? 173.50196 261.46266 82.16793  1.000 108.60678 ?  103 ILE B CA    1 
ATOM   4087  C C     . ILE B 1 103 ? 174.18306 260.37940 81.34069  1.000 104.45997 ?  103 ILE B C     1 
ATOM   4088  O O     . ILE B 1 103 ? 173.61806 259.31099 81.07728  1.000 104.06687 ?  103 ILE B O     1 
ATOM   4089  C CB    . ILE B 1 103 ? 174.13835 261.54786 83.56938  1.000 113.32970 ?  103 ILE B CB    1 
ATOM   4090  C CG1   . ILE B 1 103 ? 173.72461 260.33914 84.43293  1.000 111.45713 ?  103 ILE B CG1   1 
ATOM   4091  C CG2   . ILE B 1 103 ? 173.87476 262.89188 84.24024  1.000 111.13232 ?  103 ILE B CG2   1 
ATOM   4092  C CD1   . ILE B 1 103 ? 174.34785 260.33310 85.84973  1.000 108.63652 ?  103 ILE B CD1   1 
ATOM   4093  N N     . THR B 1 104 ? 175.41467 260.66504 80.92487  1.000 100.09195 ?  104 THR B N     1 
ATOM   4094  C CA    . THR B 1 104 ? 176.30883 259.75709 80.22576  1.000 99.74534  ?  104 THR B CA    1 
ATOM   4095  C C     . THR B 1 104 ? 177.54922 259.56323 81.07330  1.000 97.55974  ?  104 THR B C     1 
ATOM   4096  O O     . THR B 1 104 ? 177.78484 260.32324 82.02256  1.000 97.54560  ?  104 THR B O     1 
ATOM   4097  C CB    . THR B 1 104 ? 176.71898 260.36646 78.87800  1.000 104.25043 ?  104 THR B CB    1 
ATOM   4098  O OG1   . THR B 1 104 ? 177.36982 261.63006 79.10960  1.000 105.59069 ?  104 THR B OG1   1 
ATOM   4099  C CG2   . THR B 1 104 ? 175.51954 260.58636 77.98626  1.000 105.45787 ?  104 THR B CG2   1 
ATOM   4100  N N     . PRO B 1 105 ? 178.36946 258.57457 80.74950  1.000 94.28823  ?  105 PRO B N     1 
ATOM   4101  C CA    . PRO B 1 105 ? 179.69978 258.52403 81.36613  1.000 91.31339  ?  105 PRO B CA    1 
ATOM   4102  C C     . PRO B 1 105 ? 180.48927 259.78247 81.12059  1.000 95.73655  ?  105 PRO B C     1 
ATOM   4103  O O     . PRO B 1 105 ? 181.26095 260.16921 81.99093  1.000 96.83768  ?  105 PRO B O     1 
ATOM   4104  C CB    . PRO B 1 105 ? 180.33139 257.28664 80.70567  1.000 87.99508  ?  105 PRO B CB    1 
ATOM   4105  C CG    . PRO B 1 105 ? 179.14533 256.41160 80.43162  1.000 92.76062  ?  105 PRO B CG    1 
ATOM   4106  C CD    . PRO B 1 105 ? 178.03617 257.32913 80.04520  1.000 95.57509  ?  105 PRO B CD    1 
ATOM   4107  N N     . GLY B 1 106 ? 180.32352 260.45442 79.98864  1.000 101.35937 ?  106 GLY B N     1 
ATOM   4108  C CA    . GLY B 1 106 ? 181.05862 261.67792 79.76616  1.000 102.06162 ?  106 GLY B CA    1 
ATOM   4109  C C     . GLY B 1 106 ? 180.81288 262.72697 80.83283  1.000 111.42065 ?  106 GLY B C     1 
ATOM   4110  O O     . GLY B 1 106 ? 181.66932 263.58860 81.08946  1.000 112.73704 ?  106 GLY B O     1 
ATOM   4111  N N     . SER B 1 107 ? 179.63433 262.66295 81.49741  1.000 107.58085 ?  107 SER B N     1 
ATOM   4112  C CA    . SER B 1 107 ? 179.33121 263.72501 82.46113  1.000 110.03635 ?  107 SER B CA    1 
ATOM   4113  C C     . SER B 1 107 ? 180.17397 263.62837 83.72537  1.000 106.27441 ?  107 SER B C     1 
ATOM   4114  O O     . SER B 1 107 ? 180.30765 264.62633 84.44534  1.000 99.21437  ?  107 SER B O     1 
ATOM   4115  C CB    . SER B 1 107 ? 177.82856 263.79485 82.87228  1.000 111.41786 ?  107 SER B CB    1 
ATOM   4116  O OG    . SER B 1 107 ? 177.32786 262.66638 83.57761  1.000 104.59073 ?  107 SER B OG    1 
ATOM   4117  N N     . LEU B 1 108 ? 180.73526 262.44029 84.01008  1.000 104.59299 ?  108 LEU B N     1 
ATOM   4118  C CA    . LEU B 1 108 ? 181.50745 262.21123 85.23519  1.000 99.18101  ?  108 LEU B CA    1 
ATOM   4119  C C     . LEU B 1 108 ? 182.90795 262.79854 85.12788  1.000 95.62029  ?  108 LEU B C     1 
ATOM   4120  O O     . LEU B 1 108 ? 183.45052 263.30315 86.11165  1.000 91.43684  ?  108 LEU B O     1 
ATOM   4121  C CB    . LEU B 1 108 ? 181.56437 260.70178 85.49443  1.000 90.44557  ?  108 LEU B CB    1 
ATOM   4122  C CG    . LEU B 1 108 ? 180.43721 259.97372 86.22692  1.000 93.62099  ?  108 LEU B CG    1 
ATOM   4123  C CD1   . LEU B 1 108 ? 179.18298 260.01656 85.41106  1.000 98.15401  ?  108 LEU B CD1   1 
ATOM   4124  C CD2   . LEU B 1 108 ? 180.81132 258.50028 86.35780  1.000 91.64310  ?  108 LEU B CD2   1 
ATOM   4125  N N     . VAL B 1 109 ? 183.51441 262.74728 83.94984  1.000 97.54291  ?  109 VAL B N     1 
ATOM   4126  C CA    . VAL B 1 109 ? 184.86353 263.27941 83.81842  1.000 101.87922 ?  109 VAL B CA    1 
ATOM   4127  C C     . VAL B 1 109 ? 184.95189 264.24791 82.65066  1.000 105.58639 ?  109 VAL B C     1 
ATOM   4128  O O     . VAL B 1 109 ? 184.13322 264.22201 81.72771  1.000 103.37587 ?  109 VAL B O     1 
ATOM   4129  C CB    . VAL B 1 109 ? 185.91182 262.14825 83.67558  1.000 100.39188 ?  109 VAL B CB    1 
ATOM   4130  C CG1   . VAL B 1 109 ? 185.93581 261.29342 84.92128  1.000 96.53747  ?  109 VAL B CG1   1 
ATOM   4131  C CG2   . VAL B 1 109 ? 185.58730 261.29786 82.46574  1.000 97.91287  ?  109 VAL B CG2   1 
ATOM   4132  N N     . GLU B 1 110 ? 186.01296 265.05200 82.65770  1.000 106.49220 ?  110 GLU B N     1 
ATOM   4133  C CA    . GLU B 1 110 ? 186.25214 265.98644 81.57345  1.000 108.56376 ?  110 GLU B CA    1 
ATOM   4134  C C     . GLU B 1 110 ? 187.18033 265.32015 80.54560  1.000 109.99556 ?  110 GLU B C     1 
ATOM   4135  O O     . GLU B 1 110 ? 188.26614 264.85263 80.90202  1.000 109.45689 ?  110 GLU B O     1 
ATOM   4136  C CB    . GLU B 1 110 ? 186.84280 267.28475 82.14313  1.000 105.83158 ?  110 GLU B CB    1 
ATOM   4137  C CG    . GLU B 1 110 ? 187.36832 268.31336 81.11010  1.000 120.51180 ?  110 GLU B CG    1 
ATOM   4138  C CD    . GLU B 1 110 ? 186.25862 269.01481 80.30336  1.000 134.64885 ?  110 GLU B CD    1 
ATOM   4139  O OE1   . GLU B 1 110 ? 185.10251 269.09105 80.77797  1.000 135.89316 ?  110 GLU B OE1   1 
ATOM   4140  O OE2   . GLU B 1 110 ? 186.53651 269.43774 79.15316  1.000 131.98039 ?  110 GLU B OE2   1 
ATOM   4141  N N     . ILE B 1 111 ? 186.74532 265.22416 79.28298  1.000 106.94424 ?  111 ILE B N     1 
ATOM   4142  C CA    . ILE B 1 111 ? 187.58274 264.67355 78.20766  1.000 106.72527 ?  111 ILE B CA    1 
ATOM   4143  C C     . ILE B 1 111 ? 188.04102 265.81921 77.30160  1.000 107.24117 ?  111 ILE B C     1 
ATOM   4144  O O     . ILE B 1 111 ? 187.20726 266.52744 76.71651  1.000 108.12898 ?  111 ILE B O     1 
ATOM   4145  C CB    . ILE B 1 111 ? 186.83640 263.59791 77.39600  1.000 105.53593 ?  111 ILE B CB    1 
ATOM   4146  C CG1   . ILE B 1 111 ? 186.43796 262.41030 78.25859  1.000 101.83549 ?  111 ILE B CG1   1 
ATOM   4147  C CG2   . ILE B 1 111 ? 187.71805 263.06132 76.24466  1.000 100.41740 ?  111 ILE B CG2   1 
ATOM   4148  C CD1   . ILE B 1 111 ? 187.62490 261.61021 78.72262  1.000 95.29324  ?  111 ILE B CD1   1 
ATOM   4149  N N     . LYS B 1 112 ? 189.36586 265.96808 77.16982  1.000 107.26778 ?  112 LYS B N     1 
ATOM   4150  C CA    . LYS B 1 112 ? 190.03791 266.99085 76.36398  1.000 109.73169 ?  112 LYS B CA    1 
ATOM   4151  C C     . LYS B 1 112 ? 190.65996 266.36628 75.11571  1.000 112.41319 ?  112 LYS B C     1 
ATOM   4152  O O     . LYS B 1 112 ? 191.44702 265.42080 75.22373  1.000 109.72324 ?  112 LYS B O     1 
ATOM   4153  C CB    . LYS B 1 112 ? 191.11845 267.70681 77.18834  1.000 112.42466 ?  112 LYS B CB    1 
ATOM   4154  C CG    . LYS B 1 112 ? 190.60121 268.42967 78.44857  1.000 113.64158 ?  112 LYS B CG    1 
ATOM   4155  C CD    . LYS B 1 112 ? 191.71696 269.01804 79.33102  1.000 110.67398 ?  112 LYS B CD    1 
ATOM   4156  C CE    . LYS B 1 112 ? 191.13631 269.81920 80.49082  1.000 113.86685 ?  112 LYS B CE    1 
ATOM   4157  N NZ    . LYS B 1 112 ? 192.22406 270.31593 81.37492  1.000 115.54801 ?  112 LYS B NZ    1 
ATOM   4158  N N     . ARG B 1 113 ? 190.27809 266.84868 73.93626  1.000 115.18684 ?  113 ARG B N     1 
ATOM   4159  C CA    . ARG B 1 113 ? 190.77306 266.29403 72.68114  1.000 114.75975 ?  113 ARG B CA    1 
ATOM   4160  C C     . ARG B 1 113 ? 191.78942 267.24572 72.04346  1.000 113.38385 ?  113 ARG B C     1 
ATOM   4161  O O     . ARG B 1 113 ? 191.56386 268.46410 71.99975  1.000 110.60686 ?  113 ARG B O     1 
ATOM   4162  C CB    . ARG B 1 113 ? 189.59230 265.99590 71.75616  1.000 114.40895 ?  113 ARG B CB    1 
ATOM   4163  C CG    . ARG B 1 113 ? 188.68975 264.90534 72.35929  1.000 110.73356 ?  113 ARG B CG    1 
ATOM   4164  C CD    . ARG B 1 113 ? 187.65698 264.39741 71.38624  1.000 106.74331 ?  113 ARG B CD    1 
ATOM   4165  N NE    . ARG B 1 113 ? 187.03793 263.14356 71.81682  1.000 106.40661 ?  113 ARG B NE    1 
ATOM   4166  C CZ    . ARG B 1 113 ? 187.52902 261.93152 71.56826  1.000 102.33922 ?  113 ARG B CZ    1 
ATOM   4167  N NH1   . ARG B 1 113 ? 188.69393 261.76825 70.95783  1.000 99.80431  ?  113 ARG B NH1   1 
ATOM   4168  N NH2   . ARG B 1 113 ? 186.81100 260.85634 71.89638  1.000 92.88444  ?  113 ARG B NH2   1 
ATOM   4169  N N     . THR B 1 114 ? 192.90502 266.69285 71.55074  1.000 110.45491 ?  114 THR B N     1 
ATOM   4170  C CA    . THR B 1 114 ? 193.93050 267.48493 70.88064  1.000 109.29317 ?  114 THR B CA    1 
ATOM   4171  C C     . THR B 1 114 ? 193.57845 267.58600 69.40531  1.000 113.74795 ?  114 THR B C     1 
ATOM   4172  O O     . THR B 1 114 ? 192.86339 266.74054 68.85787  1.000 115.36335 ?  114 THR B O     1 
ATOM   4173  C CB    . THR B 1 114 ? 195.35297 266.89051 71.00468  1.000 106.90004 ?  114 THR B CB    1 
ATOM   4174  O OG1   . THR B 1 114 ? 195.41230 265.56904 70.44131  1.000 103.89839 ?  114 THR B OG1   1 
ATOM   4175  C CG2   . THR B 1 114 ? 195.85452 266.86236 72.43985  1.000 109.84838 ?  114 THR B CG2   1 
ATOM   4176  N N     . ASP B 1 115 ? 194.01177 268.68423 68.78218  1.000 115.73755 ?  115 ASP B N     1 
ATOM   4177  C CA    . ASP B 1 115 ? 193.78742 268.84603 67.34949  1.000 114.15479 ?  115 ASP B CA    1 
ATOM   4178  C C     . ASP B 1 115 ? 194.50504 267.78293 66.51930  1.000 113.27511 ?  115 ASP B C     1 
ATOM   4179  O O     . ASP B 1 115 ? 194.28053 267.72857 65.30597  1.000 115.02674 ?  115 ASP B O     1 
ATOM   4180  C CB    . ASP B 1 115 ? 194.24149 270.24098 66.87978  1.000 116.32635 ?  115 ASP B CB    1 
ATOM   4181  C CG    . ASP B 1 115 ? 195.74806 270.50979 67.11844  1.000 124.28276 ?  115 ASP B CG    1 
ATOM   4182  O OD1   . ASP B 1 115 ? 196.37238 269.85380 67.98629  1.000 122.65000 ?  115 ASP B OD1   1 
ATOM   4183  O OD2   . ASP B 1 115 ? 196.31061 271.39895 66.43837  1.000 128.94539 ?  115 ASP B OD2   1 
ATOM   4184  N N     . VAL B 1 116 ? 195.26333 266.87040 67.13776  1.000 108.92006 ?  116 VAL B N     1 
ATOM   4185  C CA    . VAL B 1 116 ? 196.00727 265.88989 66.35693  1.000 107.18208 ?  116 VAL B CA    1 
ATOM   4186  C C     . VAL B 1 116 ? 195.02565 264.82016 65.90888  1.000 109.90048 ?  116 VAL B C     1 
ATOM   4187  O O     . VAL B 1 116 ? 194.17808 264.35690 66.69114  1.000 110.20946 ?  116 VAL B O     1 
ATOM   4188  C CB    . VAL B 1 116 ? 197.18448 265.29434 67.15186  1.000 104.95173 ?  116 VAL B CB    1 
ATOM   4189  C CG1   . VAL B 1 116 ? 198.01447 264.32887 66.28068  1.000 96.07226  ?  116 VAL B CG1   1 
ATOM   4190  C CG2   . VAL B 1 116 ? 198.09336 266.40801 67.66722  1.000 109.93614 ?  116 VAL B CG2   1 
ATOM   4191  N N     . GLU B 1 117 ? 195.11514 264.45048 64.63331  1.000 109.27104 ?  117 GLU B N     1 
ATOM   4192  C CA    . GLU B 1 117 ? 194.17567 263.52119 64.03382  1.000 111.68613 ?  117 GLU B CA    1 
ATOM   4193  C C     . GLU B 1 117 ? 194.59444 262.10241 64.40588  1.000 109.28283 ?  117 GLU B C     1 
ATOM   4194  O O     . GLU B 1 117 ? 195.76696 261.82800 64.69896  1.000 104.21752 ?  117 GLU B O     1 
ATOM   4195  C CB    . GLU B 1 117 ? 194.14389 263.68275 62.50080  1.000 118.05115 ?  117 GLU B CB    1 
ATOM   4196  C CG    . GLU B 1 117 ? 195.26159 262.92451 61.73152  1.000 122.14089 ?  117 GLU B CG    1 
ATOM   4197  C CD    . GLU B 1 117 ? 196.67423 263.50488 61.89336  1.000 128.27961 ?  117 GLU B CD    1 
ATOM   4198  O OE1   . GLU B 1 117 ? 196.81969 264.73013 62.09989  1.000 133.05469 ?  117 GLU B OE1   1 
ATOM   4199  O OE2   . GLU B 1 117 ? 197.65107 262.71913 61.83579  1.000 122.35261 ?  117 GLU B OE2   1 
ATOM   4200  N N     . GLY B 1 118 ? 193.62580 261.19470 64.42196  1.000 104.25737 ?  118 GLY B N     1 
ATOM   4201  C CA    . GLY B 1 118 ? 193.93689 259.83269 64.79678  1.000 100.36477 ?  118 GLY B CA    1 
ATOM   4202  C C     . GLY B 1 118 ? 194.42356 259.01925 63.62638  1.000 102.62634 ?  118 GLY B C     1 
ATOM   4203  O O     . GLY B 1 118 ? 194.17034 259.33074 62.46659  1.000 113.92973 ?  118 GLY B O     1 
ATOM   4204  N N     . ASN B 1 119 ? 195.16115 257.95969 63.93838  1.000 103.17308 ?  119 ASN B N     1 
ATOM   4205  C CA    . ASN B 1 119 ? 195.77442 257.12056 62.91884  1.000 103.61943 ?  119 ASN B CA    1 
ATOM   4206  C C     . ASN B 1 119 ? 194.97726 255.83713 62.71268  1.000 98.54637  ?  119 ASN B C     1 
ATOM   4207  O O     . ASN B 1 119 ? 195.55447 254.76530 62.51067  1.000 95.01397  ?  119 ASN B O     1 
ATOM   4208  C CB    . ASN B 1 119 ? 197.22556 256.80914 63.28796  1.000 103.20119 ?  119 ASN B CB    1 
ATOM   4209  C CG    . ASN B 1 119 ? 198.09071 258.06223 63.36642  1.000 112.12136 ?  119 ASN B CG    1 
ATOM   4210  O OD1   . ASN B 1 119 ? 197.67910 259.15375 62.96539  1.000 121.66626 ?  119 ASN B OD1   1 
ATOM   4211  N ND2   . ASN B 1 119 ? 199.29574 257.90913 63.90033  1.000 113.40617 ?  119 ASN B ND2   1 
ATOM   4212  N N     . TRP B 1 120 ? 193.64765 255.93329 62.76369  1.000 95.35948  ?  120 TRP B N     1 
ATOM   4213  C CA    . TRP B 1 120 ? 192.81332 254.74977 62.60795  1.000 94.91841  ?  120 TRP B CA    1 
ATOM   4214  C C     . TRP B 1 120 ? 193.07403 254.03767 61.28783  1.000 96.24704  ?  120 TRP B C     1 
ATOM   4215  O O     . TRP B 1 120 ? 192.92986 254.62524 60.21668  1.000 105.03743 ?  120 TRP B O     1 
ATOM   4216  C CB    . TRP B 1 120 ? 191.34963 255.13191 62.72489  1.000 90.81565  ?  120 TRP B CB    1 
ATOM   4217  C CG    . TRP B 1 120 ? 190.91004 255.27011 64.12776  1.000 103.18437 ?  120 TRP B CG    1 
ATOM   4218  C CD1   . TRP B 1 120 ? 190.52176 254.26167 64.97067  1.000 107.96665 ?  120 TRP B CD1   1 
ATOM   4219  C CD2   . TRP B 1 120 ? 190.75432 256.47768 64.84893  1.000 102.55668 ?  120 TRP B CD2   1 
ATOM   4220  N NE1   . TRP B 1 120 ? 190.15019 254.77515 66.19198  1.000 100.26577 ?  120 TRP B NE1   1 
ATOM   4221  C CE2   . TRP B 1 120 ? 190.27964 256.13655 66.14305  1.000 99.20481  ?  120 TRP B CE2   1 
ATOM   4222  C CE3   . TRP B 1 120 ? 190.97111 257.81404 64.53555  1.000 98.35089  ?  120 TRP B CE3   1 
ATOM   4223  C CZ2   . TRP B 1 120 ? 190.02091 257.08512 67.11136  1.000 97.25049  ?  120 TRP B CZ2   1 
ATOM   4224  C CZ3   . TRP B 1 120 ? 190.71103 258.75587 65.50079  1.000 108.57702 ?  120 TRP B CZ3   1 
ATOM   4225  C CH2   . TRP B 1 120 ? 190.24897 258.39047 66.77907  1.000 108.84600 ?  120 TRP B CH2   1 
ATOM   4226  N N     . ALA B 1 121 ? 193.43068 252.75493 61.37769  1.000 91.36142  ?  121 ALA B N     1 
ATOM   4227  C CA    . ALA B 1 121 ? 193.86312 251.95360 60.24371  1.000 97.33242  ?  121 ALA B CA    1 
ATOM   4228  C C     . ALA B 1 121 ? 193.20317 250.58588 60.24750  1.000 96.68672  ?  121 ALA B C     1 
ATOM   4229  O O     . ALA B 1 121 ? 192.86416 250.03922 61.30050  1.000 94.10573  ?  121 ALA B O     1 
ATOM   4230  C CB    . ALA B 1 121 ? 195.38119 251.77277 60.24953  1.000 96.65394  ?  121 ALA B CB    1 
ATOM   4231  N N     . LEU B 1 122 ? 193.06351 250.01390 59.05797  1.000 98.56041  ?  122 LEU B N     1 
ATOM   4232  C CA    . LEU B 1 122 ? 192.40290 248.72679 58.90654  1.000 93.55361  ?  122 LEU B CA    1 
ATOM   4233  C C     . LEU B 1 122 ? 193.50519 247.68361 58.79000  1.000 94.08841  ?  122 LEU B C     1 
ATOM   4234  O O     . LEU B 1 122 ? 194.33984 247.74167 57.88227  1.000 101.13819 ?  122 LEU B O     1 
ATOM   4235  C CB    . LEU B 1 122 ? 191.49437 248.70700 57.68070  1.000 89.03374  ?  122 LEU B CB    1 
ATOM   4236  C CG    . LEU B 1 122 ? 190.00030 248.99446 57.87526  1.000 88.77731  ?  122 LEU B CG    1 
ATOM   4237  C CD1   . LEU B 1 122 ? 189.72024 250.47245 58.23346  1.000 91.63413  ?  122 LEU B CD1   1 
ATOM   4238  C CD2   . LEU B 1 122 ? 189.16131 248.50615 56.71954  1.000 87.56796  ?  122 LEU B CD2   1 
ATOM   4239  N N     . THR B 1 123 ? 193.55901 246.77939 59.74921  1.000 86.39321  ?  123 THR B N     1 
ATOM   4240  C CA    . THR B 1 123 ? 194.57774 245.74647 59.75222  1.000 92.31202  ?  123 THR B CA    1 
ATOM   4241  C C     . THR B 1 123 ? 193.99815 244.35005 59.79756  1.000 92.67990  ?  123 THR B C     1 
ATOM   4242  O O     . THR B 1 123 ? 194.65917 243.40266 59.34655  1.000 96.91526  ?  123 THR B O     1 
ATOM   4243  C CB    . THR B 1 123 ? 195.56234 245.95427 60.91562  1.000 98.48245  ?  123 THR B CB    1 
ATOM   4244  O OG1   . THR B 1 123 ? 194.86207 245.86928 62.16697  1.000 97.20672  ?  123 THR B OG1   1 
ATOM   4245  C CG2   . THR B 1 123 ? 196.30820 247.28663 60.76741  1.000 106.91383 ?  123 THR B CG2   1 
ATOM   4246  N N     . GLY B 1 124 ? 192.82234 244.18855 60.39902  1.000 88.94335  ?  124 GLY B N     1 
ATOM   4247  C CA    . GLY B 1 124 ? 192.22887 242.88368 60.60706  1.000 90.75477  ?  124 GLY B CA    1 
ATOM   4248  C C     . GLY B 1 124 ? 190.80975 242.76288 60.08567  1.000 83.41533  ?  124 GLY B C     1 
ATOM   4249  O O     . GLY B 1 124 ? 190.20135 243.73593 59.65260  1.000 82.24711  ?  124 GLY B O     1 
ATOM   4250  N N     . GLY B 1 125 ? 190.25926 241.57383 60.26561  1.000 75.19236  ?  125 GLY B N     1 
ATOM   4251  C CA    . GLY B 1 125 ? 188.99247 241.27635 59.63837  1.000 78.26602  ?  125 GLY B CA    1 
ATOM   4252  C C     . GLY B 1 125 ? 187.76536 242.07017 60.04105  1.000 84.82192  ?  125 GLY B C     1 
ATOM   4253  O O     . GLY B 1 125 ? 187.24967 241.86966 61.14202  1.000 93.96968  ?  125 GLY B O     1 
ATOM   4254  N N     . MET B 1 126 ? 187.34607 243.06643 59.25589  1.000 82.72030  ?  126 MET B N     1 
ATOM   4255  C CA    . MET B 1 126 ? 186.07605 243.72872 59.53589  1.000 85.13323  ?  126 MET B CA    1 
ATOM   4256  C C     . MET B 1 126 ? 185.21586 243.55840 58.27646  1.000 88.77172  ?  126 MET B C     1 
ATOM   4257  O O     . MET B 1 126 ? 185.62020 244.02128 57.20866  1.000 93.38258  ?  126 MET B O     1 
ATOM   4258  C CB    . MET B 1 126 ? 186.32572 245.20363 59.85224  1.000 80.61869  ?  126 MET B CB    1 
ATOM   4259  C CG    . MET B 1 126 ? 185.13512 245.97296 60.34711  1.000 76.84890  ?  126 MET B CG    1 
ATOM   4260  S SD    . MET B 1 126 ? 184.15984 246.69679 59.03312  1.000 97.10934  ?  126 MET B SD    1 
ATOM   4261  C CE    . MET B 1 126 ? 185.33284 247.49803 57.92322  1.000 98.07601  ?  126 MET B CE    1 
ATOM   4262  N N     . GLU B 1 127 ? 184.03977 242.90927 58.38591  1.000 90.58551  ?  127 GLU B N     1 
ATOM   4263  C CA    . GLU B 1 127 ? 183.16058 242.58933 57.24434  1.000 88.60164  ?  127 GLU B CA    1 
ATOM   4264  C C     . GLU B 1 127 ? 181.90431 243.45876 57.15559  1.000 91.57308  ?  127 GLU B C     1 
ATOM   4265  O O     . GLU B 1 127 ? 181.01290 243.15896 56.34877  1.000 94.59015  ?  127 GLU B O     1 
ATOM   4266  C CB    . GLU B 1 127 ? 182.75983 241.10662 57.23736  1.000 89.66672  ?  127 GLU B CB    1 
ATOM   4267  C CG    . GLU B 1 127 ? 183.93655 240.16890 57.03158  1.000 99.80349  ?  127 GLU B CG    1 
ATOM   4268  C CD    . GLU B 1 127 ? 183.54753 238.69940 56.88817  1.000 114.96319 ?  127 GLU B CD    1 
ATOM   4269  O OE1   . GLU B 1 127 ? 182.33826 238.37245 56.89778  1.000 115.48369 ?  127 GLU B OE1   1 
ATOM   4270  O OE2   . GLU B 1 127 ? 184.47174 237.86532 56.76927  1.000 117.41956 ?  127 GLU B OE2   1 
ATOM   4271  N N     . LEU B 1 128 ? 181.76936 244.46567 58.01107  1.000 89.67539  ?  128 LEU B N     1 
ATOM   4272  C CA    . LEU B 1 128 ? 180.55376 245.26944 58.03154  1.000 94.40618  ?  128 LEU B CA    1 
ATOM   4273  C C     . LEU B 1 128 ? 180.46811 246.14314 56.79417  1.000 99.28461  ?  128 LEU B C     1 
ATOM   4274  O O     . LEU B 1 128 ? 181.35587 246.95874 56.52833  1.000 100.52778 ?  128 LEU B O     1 
ATOM   4275  C CB    . LEU B 1 128 ? 180.48171 246.14724 59.27711  1.000 97.90744  ?  128 LEU B CB    1 
ATOM   4276  C CG    . LEU B 1 128 ? 179.59094 245.73548 60.45413  1.000 105.49954 ?  128 LEU B CG    1 
ATOM   4277  C CD1   . LEU B 1 128 ? 179.40303 246.90556 61.39573  1.000 105.34072 ?  128 LEU B CD1   1 
ATOM   4278  C CD2   . LEU B 1 128 ? 178.23559 245.24946 59.97257  1.000 103.22319 ?  128 LEU B CD2   1 
ATOM   4279  N N     . THR B 1 129 ? 179.39268 245.96281 56.04260  1.000 99.49613  ?  129 THR B N     1 
ATOM   4280  C CA    . THR B 1 129 ? 179.10250 246.76869 54.87613  1.000 100.64687 ?  129 THR B CA    1 
ATOM   4281  C C     . THR B 1 129 ? 178.25733 247.97507 55.23534  1.000 103.02538 ?  129 THR B C     1 
ATOM   4282  O O     . THR B 1 129 ? 178.01448 248.84107 54.38864  1.000 107.15857 ?  129 THR B O     1 
ATOM   4283  C CB    . THR B 1 129 ? 178.37821 245.89938 53.84193  1.000 108.16661 ?  129 THR B CB    1 
ATOM   4284  O OG1   . THR B 1 129 ? 178.96766 244.59178 53.85894  1.000 116.52472 ?  129 THR B OG1   1 
ATOM   4285  C CG2   . THR B 1 129 ? 178.46080 246.47802 52.42946  1.000 105.17562 ?  129 THR B CG2   1 
ATOM   4286  N N     . ARG B 1 130 ? 177.74536 248.01914 56.45104  1.000 105.61754 ?  130 ARG B N     1 
ATOM   4287  C CA    . ARG B 1 130 ? 176.90740 249.11601 56.88185  1.000 107.80432 ?  130 ARG B CA    1 
ATOM   4288  C C     . ARG B 1 130 ? 177.46428 249.73200 58.15813  1.000 109.70653 ?  130 ARG B C     1 
ATOM   4289  O O     . ARG B 1 130 ? 178.40428 249.21319 58.77673  1.000 105.97783 ?  130 ARG B O     1 
ATOM   4290  C CB    . ARG B 1 130 ? 175.45032 248.65457 57.01158  1.000 103.49417 ?  130 ARG B CB    1 
ATOM   4291  C CG    . ARG B 1 130 ? 175.28095 247.36228 57.73891  1.000 107.33854 ?  130 ARG B CG    1 
ATOM   4292  C CD    . ARG B 1 130 ? 174.96877 247.55843 59.20043  1.000 113.32083 ?  130 ARG B CD    1 
ATOM   4293  N NE    . ARG B 1 130 ? 174.79545 246.27049 59.86361  1.000 115.62180 ?  130 ARG B NE    1 
ATOM   4294  C CZ    . ARG B 1 130 ? 174.56414 246.12755 61.15746  1.000 114.73578 ?  130 ARG B CZ    1 
ATOM   4295  N NH1   . ARG B 1 130 ? 174.46210 247.17871 61.95914  1.000 115.11104 ?  130 ARG B NH1   1 
ATOM   4296  N NH2   . ARG B 1 130 ? 174.43055 244.90268 61.65807  1.000 110.45003 ?  130 ARG B NH2   1 
ATOM   4297  N N     . ASP B 1 131 ? 176.92179 250.90475 58.48283  1.000 111.12528 ?  131 ASP B N     1 
ATOM   4298  C CA    . ASP B 1 131 ? 177.27598 251.58951 59.72062  1.000 108.11298 ?  131 ASP B CA    1 
ATOM   4299  C C     . ASP B 1 131 ? 176.81824 250.76090 60.91832  1.000 110.00759 ?  131 ASP B C     1 
ATOM   4300  O O     . ASP B 1 131 ? 175.72887 250.17292 60.88329  1.000 108.74196 ?  131 ASP B O     1 
ATOM   4301  C CB    . ASP B 1 131 ? 176.64009 252.97956 59.77421  1.000 109.81259 ?  131 ASP B CB    1 
ATOM   4302  C CG    . ASP B 1 131 ? 177.15348 253.88722 58.68279  1.000 120.65299 ?  131 ASP B CG    1 
ATOM   4303  O OD1   . ASP B 1 131 ? 178.13720 253.50221 58.00609  1.000 119.30574 ?  131 ASP B OD1   1 
ATOM   4304  O OD2   . ASP B 1 131 ? 176.57666 254.98136 58.50480  1.000 125.97822 ?  131 ASP B OD2   1 
ATOM   4305  N N     . PRO B 1 132 ? 177.63462 250.66867 61.96734  1.000 112.82262 ?  132 PRO B N     1 
ATOM   4306  C CA    . PRO B 1 132 ? 177.30737 249.81722 63.12258  1.000 107.24106 ?  132 PRO B CA    1 
ATOM   4307  C C     . PRO B 1 132 ? 176.16431 250.34876 63.98608  1.000 101.80720 ?  132 PRO B C     1 
ATOM   4308  O O     . PRO B 1 132 ? 175.94817 251.55849 64.11352  1.000 97.44020  ?  132 PRO B O     1 
ATOM   4309  C CB    . PRO B 1 132 ? 178.61989 249.80194 63.92057  1.000 103.54386 ?  132 PRO B CB    1 
ATOM   4310  C CG    . PRO B 1 132 ? 179.33867 251.06749 63.47904  1.000 105.66034 ?  132 PRO B CG    1 
ATOM   4311  C CD    . PRO B 1 132 ? 178.99805 251.21911 62.03846  1.000 109.07378 ?  132 PRO B CD    1 
ATOM   4312  N N     . THR B 1 133 ? 175.43477 249.40631 64.60194  1.000 100.44851 ?  133 THR B N     1 
ATOM   4313  C CA    . THR B 1 133 ? 174.35882 249.68304 65.55566  1.000 103.48347 ?  133 THR B CA    1 
ATOM   4314  C C     . THR B 1 133 ? 174.89668 249.94330 66.95253  1.000 106.22124 ?  133 THR B C     1 
ATOM   4315  O O     . THR B 1 133 ? 176.01483 249.58208 67.29942  1.000 106.46824 ?  133 THR B O     1 
ATOM   4316  C CB    . THR B 1 133 ? 173.36603 248.50637 65.62112  1.000 104.69525 ?  133 THR B CB    1 
ATOM   4317  O OG1   . THR B 1 133 ? 172.29574 248.81467 66.53460  1.000 112.55171 ?  133 THR B OG1   1 
ATOM   4318  C CG2   . THR B 1 133 ? 174.02862 247.16020 66.00157  1.000 92.30553  ?  133 THR B CG2   1 
ATOM   4319  N N     . VAL B 1 134 ? 174.05634 250.53833 67.79099  1.000 105.90560 ?  134 VAL B N     1 
ATOM   4320  C CA    . VAL B 1 134 ? 174.50587 250.85699 69.15029  1.000 102.32773 ?  134 VAL B CA    1 
ATOM   4321  C C     . VAL B 1 134 ? 175.02208 249.59762 69.86312  1.000 97.83363  ?  134 VAL B C     1 
ATOM   4322  O O     . VAL B 1 134 ? 176.17580 249.61821 70.30934  1.000 99.39464  ?  134 VAL B O     1 
ATOM   4323  C CB    . VAL B 1 134 ? 173.40270 251.57248 69.95011  1.000 104.13506 ?  134 VAL B CB    1 
ATOM   4324  C CG1   . VAL B 1 134 ? 173.90942 251.85874 71.33531  1.000 94.37022  ?  134 VAL B CG1   1 
ATOM   4325  C CG2   . VAL B 1 134 ? 172.95888 252.84305 69.24356  1.000 107.73933 ?  134 VAL B CG2   1 
ATOM   4326  N N     . PRO B 1 135 ? 174.24965 248.49292 69.97068  1.000 95.50811  ?  135 PRO B N     1 
ATOM   4327  C CA    . PRO B 1 135 ? 174.78185 247.23904 70.57830  1.000 98.24850  ?  135 PRO B CA    1 
ATOM   4328  C C     . PRO B 1 135 ? 176.11620 246.83912 70.07642  1.000 96.31055  ?  135 PRO B C     1 
ATOM   4329  O O     . PRO B 1 135 ? 176.99879 246.40956 70.84842  1.000 96.95825  ?  135 PRO B O     1 
ATOM   4330  C CB    . PRO B 1 135 ? 173.72749 246.15827 70.22651  1.000 98.21857  ?  135 PRO B CB    1 
ATOM   4331  C CG    . PRO B 1 135 ? 172.77406 246.85614 69.14396  1.000 98.66735  ?  135 PRO B CG    1 
ATOM   4332  C CD    . PRO B 1 135 ? 172.84791 248.36300 69.50950  1.000 98.34612  ?  135 PRO B CD    1 
ATOM   4333  N N     . GLU B 1 136 ? 176.27657 246.84738 68.76076  1.000 93.88488  ?  136 GLU B N     1 
ATOM   4334  C CA    . GLU B 1 136 ? 177.58150 246.56333 68.16688  1.000 96.73294  ?  136 GLU B CA    1 
ATOM   4335  C C     . GLU B 1 136 ? 178.62993 247.44595 68.77856  1.000 97.34262  ?  136 GLU B C     1 
ATOM   4336  O O     . GLU B 1 136 ? 179.64261 246.94013 69.26357  1.000 97.41798  ?  136 GLU B O     1 
ATOM   4337  C CB    . GLU B 1 136 ? 177.44332 246.68700 66.64012  1.000 99.73238  ?  136 GLU B CB    1 
ATOM   4338  C CG    . GLU B 1 136 ? 177.12893 245.38486 65.99388  1.000 95.97245  ?  136 GLU B CG    1 
ATOM   4339  C CD    . GLU B 1 136 ? 176.71856 245.57961 64.58205  1.000 101.14575 ?  136 GLU B CD    1 
ATOM   4340  O OE1   . GLU B 1 136 ? 176.38754 246.73175 64.21949  1.000 98.21134  ?  136 GLU B OE1   1 
ATOM   4341  O OE2   . GLU B 1 136 ? 176.85001 244.62759 63.79871  1.000 104.00770 ?  136 GLU B OE2   1 
ATOM   4342  N N     . HIS B 1 137 ? 178.33670 248.73601 68.87041  1.000 94.60350  ?  137 HIS B N     1 
ATOM   4343  C CA    . HIS B 1 137 ? 179.24952 249.61772 69.54890  1.000 93.98956  ?  137 HIS B CA    1 
ATOM   4344  C C     . HIS B 1 137 ? 179.45590 249.16139 70.99297  1.000 92.54816  ?  137 HIS B C     1 
ATOM   4345  O O     . HIS B 1 137 ? 180.59903 248.99557 71.45162  1.000 91.06743  ?  137 HIS B O     1 
ATOM   4346  C CB    . HIS B 1 137 ? 178.74795 251.06170 69.53548  1.000 97.10202  ?  137 HIS B CB    1 
ATOM   4347  C CG    . HIS B 1 137 ? 179.10501 251.84534 68.30930  1.000 101.59079 ?  137 HIS B CG    1 
ATOM   4348  N ND1   . HIS B 1 137 ? 180.32325 252.46740 68.12303  1.000 103.06880 ?  137 HIS B ND1   1 
ATOM   4349  C CD2   . HIS B 1 137 ? 178.37783 252.11709 67.20175  1.000 106.82219 ?  137 HIS B CD2   1 
ATOM   4350  C CE1   . HIS B 1 137 ? 180.32129 253.09696 66.95873  1.000 105.89682 ?  137 HIS B CE1   1 
ATOM   4351  N NE2   . HIS B 1 137 ? 179.15463 252.89289 66.37584  1.000 109.89429 ?  137 HIS B NE2   1 
ATOM   4352  N N     . ALA B 1 138 ? 178.36200 248.85126 71.69217  1.000 93.36421  ?  138 ALA B N     1 
ATOM   4353  C CA    . ALA B 1 138 ? 178.46930 248.45687 73.08592  1.000 92.60722  ?  138 ALA B CA    1 
ATOM   4354  C C     . ALA B 1 138 ? 179.25734 247.16590 73.22547  1.000 91.39129  ?  138 ALA B C     1 
ATOM   4355  O O     . ALA B 1 138 ? 180.09613 247.04977 74.12551  1.000 91.66103  ?  138 ALA B O     1 
ATOM   4356  C CB    . ALA B 1 138 ? 177.07750 248.32639 73.69085  1.000 93.46118  ?  138 ALA B CB    1 
ATOM   4357  N N     . SER B 1 139 ? 179.02769 246.19341 72.33113  1.000 89.67846  ?  139 SER B N     1 
ATOM   4358  C CA    . SER B 1 139 ? 179.78927 244.94468 72.39505  1.000 90.59116  ?  139 SER B CA    1 
ATOM   4359  C C     . SER B 1 139 ? 181.27651 245.20664 72.22260  1.000 90.60240  ?  139 SER B C     1 
ATOM   4360  O O     . SER B 1 139 ? 182.10733 244.51569 72.82528  1.000 90.40475  ?  139 SER B O     1 
ATOM   4361  C CB    . SER B 1 139 ? 179.31076 243.93705 71.35240  1.000 89.57368  ?  139 SER B CB    1 
ATOM   4362  O OG    . SER B 1 139 ? 177.90379 243.86146 71.31021  1.000 90.40265  ?  139 SER B OG    1 
ATOM   4363  N N     . LEU B 1 140 ? 181.63430 246.12349 71.31371  1.000 86.47318  ?  140 LEU B N     1 
ATOM   4364  C CA    . LEU B 1 140 ? 183.03942 246.47154 71.14920  1.000 85.99594  ?  140 LEU B CA    1 
ATOM   4365  C C     . LEU B 1 140 ? 183.57468 247.17864 72.39293  1.000 89.03484  ?  140 LEU B C     1 
ATOM   4366  O O     . LEU B 1 140 ? 184.66230 246.84629 72.88698  1.000 89.94611  ?  140 LEU B O     1 
ATOM   4367  C CB    . LEU B 1 140 ? 183.23358 247.35741 69.92358  1.000 81.37467  ?  140 LEU B CB    1 
ATOM   4368  C CG    . LEU B 1 140 ? 184.65639 247.36478 69.37908  1.000 78.51230  ?  140 LEU B CG    1 
ATOM   4369  C CD1   . LEU B 1 140 ? 185.24414 245.96099 69.48213  1.000 86.92966  ?  140 LEU B CD1   1 
ATOM   4370  C CD2   . LEU B 1 140 ? 184.66021 247.82914 67.96467  1.000 87.55397  ?  140 LEU B CD2   1 
ATOM   4371  N N     . VAL B 1 141 ? 182.79831 248.11935 72.94867  1.000 87.17394  ?  141 VAL B N     1 
ATOM   4372  C CA    . VAL B 1 141 ? 183.27401 248.88152 74.10152  1.000 88.13479  ?  141 VAL B CA    1 
ATOM   4373  C C     . VAL B 1 141 ? 183.56881 247.93787 75.27165  1.000 91.30654  ?  141 VAL B C     1 
ATOM   4374  O O     . VAL B 1 141 ? 184.62568 248.02460 75.91044  1.000 92.39141  ?  141 VAL B O     1 
ATOM   4375  C CB    . VAL B 1 141 ? 182.26093 249.98640 74.47417  1.000 86.31099  ?  141 VAL B CB    1 
ATOM   4376  C CG1   . VAL B 1 141 ? 182.57422 250.57896 75.85530  1.000 86.34752  ?  141 VAL B CG1   1 
ATOM   4377  C CG2   . VAL B 1 141 ? 182.23413 251.08054 73.41808  1.000 88.00783  ?  141 VAL B CG2   1 
ATOM   4378  N N     . GLY B 1 142 ? 182.65820 246.99494 75.53903  1.000 88.13260  ?  142 GLY B N     1 
ATOM   4379  C CA    . GLY B 1 142 ? 182.87435 246.04758 76.61944  1.000 85.21690  ?  142 GLY B CA    1 
ATOM   4380  C C     . GLY B 1 142 ? 184.05413 245.12523 76.37521  1.000 88.17147  ?  142 GLY B C     1 
ATOM   4381  O O     . GLY B 1 142 ? 184.77448 244.75486 77.31045  1.000 92.73093  ?  142 GLY B O     1 
ATOM   4382  N N     . LEU B 1 143 ? 184.21628 244.67270 75.13020  1.000 83.80892  ?  143 LEU B N     1 
ATOM   4383  C CA    . LEU B 1 143 ? 185.32320 243.78127 74.80035  1.000 83.50962  ?  143 LEU B CA    1 
ATOM   4384  C C     . LEU B 1 143 ? 186.65882 244.47416 74.97582  1.000 85.23302  ?  143 LEU B C     1 
ATOM   4385  O O     . LEU B 1 143 ? 187.63083 243.85825 75.43630  1.000 83.47360  ?  143 LEU B O     1 
ATOM   4386  C CB    . LEU B 1 143 ? 185.16878 243.27472 73.37555  1.000 85.74764  ?  143 LEU B CB    1 
ATOM   4387  C CG    . LEU B 1 143 ? 184.09035 242.22532 73.22603  1.000 88.00003  ?  143 LEU B CG    1 
ATOM   4388  C CD1   . LEU B 1 143 ? 183.68286 242.17641 71.77777  1.000 85.51733  ?  143 LEU B CD1   1 
ATOM   4389  C CD2   . LEU B 1 143 ? 184.69039 240.90046 73.66659  1.000 89.29426  ?  143 LEU B CD2   1 
ATOM   4390  N N     . LEU B 1 144 ? 186.73836 245.74439 74.56632  1.000 84.99378  ?  144 LEU B N     1 
ATOM   4391  C CA    . LEU B 1 144 ? 187.98552 246.48260 74.72241  1.000 85.21570  ?  144 LEU B CA    1 
ATOM   4392  C C     . LEU B 1 144 ? 188.32602 246.68144 76.20112  1.000 87.70602  ?  144 LEU B C     1 
ATOM   4393  O O     . LEU B 1 144 ? 189.43471 246.34442 76.63966  1.000 86.92659  ?  144 LEU B O     1 
ATOM   4394  C CB    . LEU B 1 144 ? 187.88260 247.82301 73.97936  1.000 82.96919  ?  144 LEU B CB    1 
ATOM   4395  C CG    . LEU B 1 144 ? 187.88056 247.87470 72.43931  1.000 85.86876  ?  144 LEU B CG    1 
ATOM   4396  C CD1   . LEU B 1 144 ? 187.71432 249.32096 71.95540  1.000 84.32450  ?  144 LEU B CD1   1 
ATOM   4397  C CD2   . LEU B 1 144 ? 189.15279 247.24676 71.81526  1.000 84.34592  ?  144 LEU B CD2   1 
ATOM   4398  N N     . LEU B 1 145 ? 187.34753 247.12842 77.00297  1.000 87.19102  ?  145 LEU B N     1 
ATOM   4399  C CA    . LEU B 1 145 ? 187.57219 247.34856 78.43027  1.000 82.51296  ?  145 LEU B CA    1 
ATOM   4400  C C     . LEU B 1 145 ? 187.92687 246.05529 79.14299  1.000 83.99332  ?  145 LEU B C     1 
ATOM   4401  O O     . LEU B 1 145 ? 188.78587 246.05586 80.03113  1.000 86.83632  ?  145 LEU B O     1 
ATOM   4402  C CB    . LEU B 1 145 ? 186.31752 247.98004 79.04609  1.000 80.36858  ?  145 LEU B CB    1 
ATOM   4403  C CG    . LEU B 1 145 ? 186.01871 249.42244 78.64703  1.000 81.72336  ?  145 LEU B CG    1 
ATOM   4404  C CD1   . LEU B 1 145 ? 184.71816 249.95659 79.23885  1.000 84.55585  ?  145 LEU B CD1   1 
ATOM   4405  C CD2   . LEU B 1 145 ? 187.17511 250.25421 79.16176  1.000 83.32358  ?  145 LEU B CD2   1 
ATOM   4406  N N     . SER B 1 146 ? 187.32846 244.94425 78.72474  1.000 77.99475  ?  146 SER B N     1 
ATOM   4407  C CA    . SER B 1 146 ? 187.64857 243.66893 79.32696  1.000 76.36275  ?  146 SER B CA    1 
ATOM   4408  C C     . SER B 1 146 ? 189.12318 243.33506 79.16464  1.000 82.88758  ?  146 SER B C     1 
ATOM   4409  O O     . SER B 1 146 ? 189.62256 242.41624 79.82227  1.000 91.91727  ?  146 SER B O     1 
ATOM   4410  C CB    . SER B 1 146 ? 186.74259 242.59607 78.75021  1.000 77.03011  ?  146 SER B CB    1 
ATOM   4411  O OG    . SER B 1 146 ? 187.20351 242.13427 77.51021  1.000 92.44545  ?  146 SER B OG    1 
ATOM   4412  N N     . LEU B 1 147 ? 189.81327 243.99419 78.23142  1.000 84.49252  ?  147 LEU B N     1 
ATOM   4413  C CA    . LEU B 1 147 ? 191.25449 243.79040 78.10475  1.000 85.02531  ?  147 LEU B CA    1 
ATOM   4414  C C     . LEU B 1 147 ? 191.98713 244.23909 79.36159  1.000 84.64967  ?  147 LEU B C     1 
ATOM   4415  O O     . LEU B 1 147 ? 193.06566 243.71347 79.66711  1.000 88.98317  ?  147 LEU B O     1 
ATOM   4416  C CB    . LEU B 1 147 ? 191.78794 244.49351 76.85276  1.000 84.94894  ?  147 LEU B CB    1 
ATOM   4417  C CG    . LEU B 1 147 ? 191.41121 243.80389 75.53585  1.000 78.58431  ?  147 LEU B CG    1 
ATOM   4418  C CD1   . LEU B 1 147 ? 191.79545 244.70590 74.41512  1.000 77.42146  ?  147 LEU B CD1   1 
ATOM   4419  C CD2   . LEU B 1 147 ? 192.03324 242.42234 75.35146  1.000 76.62207  ?  147 LEU B CD2   1 
ATOM   4420  N N     . TYR B 1 148 ? 191.44063 245.23289 80.07308  1.000 85.88681  ?  148 TYR B N     1 
ATOM   4421  C CA    . TYR B 1 148 ? 192.08274 245.71013 81.29697  1.000 83.67057  ?  148 TYR B CA    1 
ATOM   4422  C C     . TYR B 1 148 ? 192.13555 244.61022 82.35086  1.000 80.14573  ?  148 TYR B C     1 
ATOM   4423  O O     . TYR B 1 148 ? 193.21126 244.27193 82.86131  1.000 79.53734  ?  148 TYR B O     1 
ATOM   4424  C CB    . TYR B 1 148 ? 191.34266 246.94547 81.83273  1.000 81.39089  ?  148 TYR B CB    1 
ATOM   4425  C CG    . TYR B 1 148 ? 192.04083 247.60281 83.00172  1.000 82.83110  ?  148 TYR B CG    1 
ATOM   4426  C CD1   . TYR B 1 148 ? 193.15065 248.39780 82.77530  1.000 88.33952  ?  148 TYR B CD1   1 
ATOM   4427  C CD2   . TYR B 1 148 ? 191.57592 247.49264 84.29895  1.000 80.75195  ?  148 TYR B CD2   1 
ATOM   4428  C CE1   . TYR B 1 148 ? 193.81431 249.00451 83.79362  1.000 90.10744  ?  148 TYR B CE1   1 
ATOM   4429  C CE2   . TYR B 1 148 ? 192.24412 248.11562 85.34999  1.000 83.94033  ?  148 TYR B CE2   1 
ATOM   4430  C CZ    . TYR B 1 148 ? 193.36558 248.87414 85.07952  1.000 87.19812  ?  148 TYR B CZ    1 
ATOM   4431  O OH    . TYR B 1 148 ? 194.06396 249.51293 86.07366  1.000 86.12632  ?  148 TYR B OH    1 
ATOM   4432  N N     . ARG B 1 149 ? 190.99667 243.95675 82.59220  1.000 75.64985  ?  149 ARG B N     1 
ATOM   4433  C CA    . ARG B 1 149 ? 190.93769 242.90097 83.59690  1.000 77.05226  ?  149 ARG B CA    1 
ATOM   4434  C C     . ARG B 1 149 ? 191.91079 241.76775 83.31082  1.000 84.15602  ?  149 ARG B C     1 
ATOM   4435  O O     . ARG B 1 149 ? 192.55272 241.24000 84.22766  1.000 83.60419  ?  149 ARG B O     1 
ATOM   4436  C CB    . ARG B 1 149 ? 189.50262 242.41402 83.72251  1.000 72.75704  ?  149 ARG B CB    1 
ATOM   4437  C CG    . ARG B 1 149 ? 189.37708 241.38407 84.75859  1.000 72.80562  ?  149 ARG B CG    1 
ATOM   4438  C CD    . ARG B 1 149 ? 187.96354 241.01798 84.94828  1.000 74.03717  ?  149 ARG B CD    1 
ATOM   4439  N NE    . ARG B 1 149 ? 187.85563 240.08239 86.06310  1.000 74.26908  ?  149 ARG B NE    1 
ATOM   4440  C CZ    . ARG B 1 149 ? 186.71425 239.56356 86.47972  1.000 77.17231  ?  149 ARG B CZ    1 
ATOM   4441  N NH1   . ARG B 1 149 ? 185.55957 239.94601 85.96205  1.000 76.65950  ?  149 ARG B NH1   1 
ATOM   4442  N NH2   . ARG B 1 149 ? 186.73657 238.61792 87.41219  1.000 82.53955  ?  149 ARG B NH2   1 
ATOM   4443  N N     . LEU B 1 150 ? 192.01715 241.38058 82.04690  1.000 86.98749  ?  150 LEU B N     1 
ATOM   4444  C CA    . LEU B 1 150 ? 192.94585 240.34771 81.62310  1.000 88.06318  ?  150 LEU B CA    1 
ATOM   4445  C C     . LEU B 1 150 ? 194.39039 240.78562 81.81962  1.000 91.20178  ?  150 LEU B C     1 
ATOM   4446  O O     . LEU B 1 150 ? 195.22257 240.02015 82.32749  1.000 92.15881  ?  150 LEU B O     1 
ATOM   4447  C CB    . LEU B 1 150 ? 192.64891 240.06411 80.15481  1.000 87.38019  ?  150 LEU B CB    1 
ATOM   4448  C CG    . LEU B 1 150 ? 191.41835 239.17945 79.99178  1.000 87.04175  ?  150 LEU B CG    1 
ATOM   4449  C CD1   . LEU B 1 150 ? 190.73565 239.45911 78.68461  1.000 89.03332  ?  150 LEU B CD1   1 
ATOM   4450  C CD2   . LEU B 1 150 ? 191.90007 237.73619 80.00747  1.000 93.67950  ?  150 LEU B CD2   1 
ATOM   4451  N N     . SER B 1 151 ? 194.70064 242.03373 81.46264  1.000 91.50768  ?  151 SER B N     1 
ATOM   4452  C CA    . SER B 1 151 ? 196.08111 242.48225 81.57265  1.000 93.51154  ?  151 SER B CA    1 
ATOM   4453  C C     . SER B 1 151 ? 196.51959 242.47564 83.02608  1.000 90.82559  ?  151 SER B C     1 
ATOM   4454  O O     . SER B 1 151 ? 197.64925 242.08067 83.33855  1.000 90.48740  ?  151 SER B O     1 
ATOM   4455  C CB    . SER B 1 151 ? 196.23709 243.85458 80.91893  1.000 94.73856  ?  151 SER B CB    1 
ATOM   4456  O OG    . SER B 1 151 ? 197.50316 244.42201 81.19876  1.000 98.05253  ?  151 SER B OG    1 
ATOM   4457  N N     . LYS B 1 152 ? 195.60570 242.85698 83.92814  1.000 90.56829  ?  152 LYS B N     1 
ATOM   4458  C CA    . LYS B 1 152 ? 195.90373 242.90792 85.35551  1.000 90.79717  ?  152 LYS B CA    1 
ATOM   4459  C C     . LYS B 1 152 ? 196.18367 241.51674 85.92091  1.000 92.52996  ?  152 LYS B C     1 
ATOM   4460  O O     . LYS B 1 152 ? 197.05353 241.35934 86.78597  1.000 93.77418  ?  152 LYS B O     1 
ATOM   4461  C CB    . LYS B 1 152 ? 194.73238 243.56930 86.09233  1.000 88.31435  ?  152 LYS B CB    1 
ATOM   4462  C CG    . LYS B 1 152 ? 195.01907 243.97075 87.53407  1.000 93.25320  ?  152 LYS B CG    1 
ATOM   4463  C CD    . LYS B 1 152 ? 193.87435 244.77585 88.14475  1.000 100.52710 ?  152 LYS B CD    1 
ATOM   4464  C CE    . LYS B 1 152 ? 194.17705 245.19746 89.58368  1.000 107.09527 ?  152 LYS B CE    1 
ATOM   4465  N NZ    . LYS B 1 152 ? 195.42846 246.01900 89.67024  1.000 103.07552 ?  152 LYS B NZ    1 
ATOM   4466  N N     . ILE B 1 153 ? 195.43883 240.50006 85.47516  1.000 90.48455  ?  153 ILE B N     1 
ATOM   4467  C CA    . ILE B 1 153 ? 195.59876 239.16075 86.03897  1.000 87.98071  ?  153 ILE B CA    1 
ATOM   4468  C C     . ILE B 1 153 ? 196.77208 238.41044 85.42051  1.000 96.46031  ?  153 ILE B C     1 
ATOM   4469  O O     . ILE B 1 153 ? 196.59179 237.36809 84.77941  1.000 97.74457  ?  153 ILE B O     1 
ATOM   4470  C CB    . ILE B 1 153 ? 194.30588 238.32657 85.94203  1.000 86.98627  ?  153 ILE B CB    1 
ATOM   4471  C CG1   . ILE B 1 153 ? 193.77250 238.23388 84.52635  1.000 90.97610  ?  153 ILE B CG1   1 
ATOM   4472  C CG2   . ILE B 1 153 ? 193.22656 238.94447 86.79894  1.000 95.58567  ?  153 ILE B CG2   1 
ATOM   4473  C CD1   . ILE B 1 153 ? 192.47642 237.52117 84.49121  1.000 85.14359  ?  153 ILE B CD1   1 
ATOM   4474  N N     . SER B 1 154 ? 197.98367 238.92763 85.60233  1.000 105.16848 ?  154 SER B N     1 
ATOM   4475  C CA    . SER B 1 154 ? 199.17798 238.23199 85.14514  1.000 112.97038 ?  154 SER B CA    1 
ATOM   4476  C C     . SER B 1 154 ? 199.99343 237.85086 86.37742  1.000 109.21967 ?  154 SER B C     1 
ATOM   4477  O O     . SER B 1 154 ? 200.10800 238.63516 87.32895  1.000 102.93749 ?  154 SER B O     1 
ATOM   4478  C CB    . SER B 1 154 ? 199.98306 239.07144 84.11908  1.000 112.74960 ?  154 SER B CB    1 
ATOM   4479  O OG    . SER B 1 154 ? 199.19824 239.36119 82.95713  1.000 105.45854 ?  154 SER B OG    1 
ATOM   4480  N N     . GLY B 1 155 ? 200.53319 236.63740 86.35470  1.000 109.94328 ?  155 GLY B N     1 
ATOM   4481  C CA    . GLY B 1 155 ? 201.21696 236.05834 87.49850  1.000 111.72660 ?  155 GLY B CA    1 
ATOM   4482  C C     . GLY B 1 155 ? 201.40914 234.57608 87.25039  1.000 112.94956 ?  155 GLY B C     1 
ATOM   4483  O O     . GLY B 1 155 ? 201.05234 234.04276 86.19457  1.000 110.51139 ?  155 GLY B O     1 
ATOM   4484  N N     . GLN B 1 156 ? 201.95942 233.90495 88.25683  1.000 115.87179 ?  156 GLN B N     1 
ATOM   4485  C CA    . GLN B 1 156 ? 202.17388 232.46226 88.13416  1.000 110.92518 ?  156 GLN B CA    1 
ATOM   4486  C C     . GLN B 1 156 ? 200.86387 231.67765 88.23711  1.000 104.89444 ?  156 GLN B C     1 
ATOM   4487  O O     . GLN B 1 156 ? 199.91770 232.10889 88.88494  1.000 112.41935 ?  156 GLN B O     1 
ATOM   4488  C CB    . GLN B 1 156 ? 203.13117 232.01473 89.25726  1.000 118.49569 ?  156 GLN B CB    1 
ATOM   4489  C CG    . GLN B 1 156 ? 202.53161 231.90977 90.71691  1.000 118.22158 ?  156 GLN B CG    1 
ATOM   4490  C CD    . GLN B 1 156 ? 202.10628 233.25234 91.38575  1.000 118.14088 ?  156 GLN B CD    1 
ATOM   4491  O OE1   . GLN B 1 156 ? 202.89943 234.18863 91.56725  1.000 116.78035 ?  156 GLN B OE1   1 
ATOM   4492  N NE2   . GLN B 1 156 ? 200.84407 233.29589 91.81820  1.000 112.85951 ?  156 GLN B NE2   1 
ATOM   4493  N N     . ASN B 1 157 ? 200.80857 230.52677 87.54942  1.000 102.59373 ?  157 ASN B N     1 
ATOM   4494  C CA    . ASN B 1 157 ? 199.69103 229.57726 87.62974  1.000 102.01099 ?  157 ASN B CA    1 
ATOM   4495  C C     . ASN B 1 157 ? 198.32595 230.27539 87.53050  1.000 96.17887  ?  157 ASN B C     1 
ATOM   4496  O O     . ASN B 1 157 ? 197.36889 229.95609 88.25228  1.000 112.19345 ?  157 ASN B O     1 
ATOM   4497  C CB    . ASN B 1 157 ? 199.73199 228.72539 88.90973  1.000 95.19632  ?  157 ASN B CB    1 
ATOM   4498  C CG    . ASN B 1 157 ? 201.23799 228.10290 89.29401  1.000 103.71607 ?  157 ASN B CG    1 
ATOM   4499  O OD1   . ASN B 1 157 ? 201.85880 228.48359 90.44264  1.000 106.97658 ?  157 ASN B OD1   1 
ATOM   4500  N ND2   . ASN B 1 157 ? 201.75131 227.03478 88.44788  1.000 89.13071  ?  157 ASN B ND2   1 
ATOM   4501  N N     . THR B 1 158 ? 198.24241 231.28214 86.65347  1.000 100.68254 ?  158 THR B N     1 
ATOM   4502  C CA    . THR B 1 158 ? 196.95186 231.92989 86.45494  1.000 105.76512 ?  158 THR B CA    1 
ATOM   4503  C C     . THR B 1 158 ? 196.35460 231.66439 85.05493  1.000 113.94310 ?  158 THR B C     1 
ATOM   4504  O O     . THR B 1 158 ? 195.45123 232.38226 84.55209  1.000 105.93541 ?  158 THR B O     1 
ATOM   4505  C CB    . THR B 1 158 ? 197.06191 233.40208 86.80645  1.000 106.04471 ?  158 THR B CB    1 
ATOM   4506  O OG1   . THR B 1 158 ? 198.26053 233.94319 86.21770  1.000 106.56517 ?  158 THR B OG1   1 
ATOM   4507  C CG2   . THR B 1 158 ? 197.11801 233.55415 88.32700  1.000 107.03841 ?  158 THR B CG2   1 
ATOM   4508  N N     . GLY B 1 159 ? 196.77240 230.53644 84.45864  1.000 119.38967 ?  159 GLY B N     1 
ATOM   4509  C CA    . GLY B 1 159 ? 196.39985 230.18232 83.10583  1.000 113.88156 ?  159 GLY B CA    1 
ATOM   4510  C C     . GLY B 1 159 ? 194.93780 229.85727 82.92638  1.000 109.35966 ?  159 GLY B C     1 
ATOM   4511  O O     . GLY B 1 159 ? 194.21266 230.63428 82.29632  1.000 103.87840 ?  159 GLY B O     1 
ATOM   4512  N N     . ASN B 1 160 ? 194.48509 228.75384 83.53777  1.000 107.27680 ?  160 ASN B N     1 
ATOM   4513  C CA    . ASN B 1 160 ? 193.07430 228.35560 83.44592  1.000 106.91947 ?  160 ASN B CA    1 
ATOM   4514  C C     . ASN B 1 160 ? 192.14064 229.46185 83.92694  1.000 110.32832 ?  160 ASN B C     1 
ATOM   4515  O O     . ASN B 1 160 ? 190.96040 229.49556 83.53926  1.000 109.62329 ?  160 ASN B O     1 
ATOM   4516  C CB    . ASN B 1 160 ? 192.81603 227.08798 84.26362  1.000 112.70396 ?  160 ASN B CB    1 
ATOM   4517  C CG    . ASN B 1 160 ? 193.22770 227.24289 85.75435  1.000 132.05665 ?  160 ASN B CG    1 
ATOM   4518  O OD1   . ASN B 1 160 ? 194.03626 228.11078 86.11173  1.000 127.84416 ?  160 ASN B OD1   1 
ATOM   4519  N ND2   . ASN B 1 160 ? 192.66178 226.39761 86.62116  1.000 128.60910 ?  160 ASN B ND2   1 
ATOM   4520  N N     . TYR B 1 161 ? 192.62241 230.30853 84.84947  1.000 105.51841 ?  161 TYR B N     1 
ATOM   4521  C CA    . TYR B 1 161 ? 191.77606 231.36635 85.39366  1.000 100.72266 ?  161 TYR B CA    1 
ATOM   4522  C C     . TYR B 1 161 ? 191.53525 232.47599 84.35913  1.000 102.05966 ?  161 TYR B C     1 
ATOM   4523  O O     . TYR B 1 161 ? 190.38008 232.84803 84.11197  1.000 100.22749 ?  161 TYR B O     1 
ATOM   4524  C CB    . TYR B 1 161 ? 192.36536 231.90438 86.72492  1.000 96.72720  ?  161 TYR B CB    1 
ATOM   4525  C CG    . TYR B 1 161 ? 191.75967 233.23168 87.19706  1.000 90.23354  ?  161 TYR B CG    1 
ATOM   4526  C CD1   . TYR B 1 161 ? 190.49575 233.27654 87.79321  1.000 88.23994  ?  161 TYR B CD1   1 
ATOM   4527  C CD2   . TYR B 1 161 ? 192.44790 234.43039 87.06237  1.000 87.82200  ?  161 TYR B CD2   1 
ATOM   4528  C CE1   . TYR B 1 161 ? 189.92539 234.48845 88.20345  1.000 86.56541  ?  161 TYR B CE1   1 
ATOM   4529  C CE2   . TYR B 1 161 ? 191.88028 235.64572 87.47207  1.000 86.54025  ?  161 TYR B CE2   1 
ATOM   4530  C CZ    . TYR B 1 161 ? 190.61902 235.66837 88.04554  1.000 87.13281  ?  161 TYR B CZ    1 
ATOM   4531  O OH    . TYR B 1 161 ? 190.04215 236.85882 88.45851  1.000 83.14370  ?  161 TYR B OH    1 
ATOM   4532  N N     . LYS B 1 162 ? 192.58800 232.94861 83.66244  1.000 99.67289  ?  162 LYS B N     1 
ATOM   4533  C CA    . LYS B 1 162 ? 192.36972 234.01838 82.67748  1.000 96.41707  ?  162 LYS B CA    1 
ATOM   4534  C C     . LYS B 1 162 ? 191.52072 233.53261 81.50738  1.000 96.59235  ?  162 LYS B C     1 
ATOM   4535  O O     . LYS B 1 162 ? 190.63958 234.25802 81.02953  1.000 95.00208  ?  162 LYS B O     1 
ATOM   4536  C CB    . LYS B 1 162 ? 193.69923 234.65816 82.23663  1.000 93.37729  ?  162 LYS B CB    1 
ATOM   4537  C CG    . LYS B 1 162 ? 194.65779 233.76703 81.49786  1.000 103.62076 ?  162 LYS B CG    1 
ATOM   4538  C CD    . LYS B 1 162 ? 196.08999 234.27389 81.61542  1.000 101.79756 ?  162 LYS B CD    1 
ATOM   4539  C CE    . LYS B 1 162 ? 196.15251 235.77954 81.58550  1.000 88.98525  ?  162 LYS B CE    1 
ATOM   4540  N NZ    . LYS B 1 162 ? 197.57009 236.20165 81.71604  1.000 94.52909  ?  162 LYS B NZ    1 
ATOM   4541  N N     . THR B 1 163 ? 191.77165 232.31431 81.02432  1.000 101.35070 ?  163 THR B N     1 
ATOM   4542  C CA    . THR B 1 163 ? 190.96030 231.79716 79.93362  1.000 105.07236 ?  163 THR B CA    1 
ATOM   4543  C C     . THR B 1 163 ? 189.50897 231.64871 80.38407  1.000 104.72648 ?  163 THR B C     1 
ATOM   4544  O O     . THR B 1 163 ? 188.58218 232.00146 79.64437  1.000 104.21633 ?  163 THR B O     1 
ATOM   4545  C CB    . THR B 1 163 ? 191.54202 230.46759 79.43259  1.000 103.71579 ?  163 THR B CB    1 
ATOM   4546  O OG1   . THR B 1 163 ? 191.55128 229.50719 80.49279  1.000 106.62756 ?  163 THR B OG1   1 
ATOM   4547  C CG2   . THR B 1 163 ? 193.00040 230.66410 78.99867  1.000 95.40008  ?  163 THR B CG2   1 
ATOM   4548  N N     . ASN B 1 164 ? 189.29077 231.18445 81.61851  1.000 101.30256 ?  164 ASN B N     1 
ATOM   4549  C CA    . ASN B 1 164 ? 187.92292 230.97082 82.07786  1.000 101.08456 ?  164 ASN B CA    1 
ATOM   4550  C C     . ASN B 1 164 ? 187.15803 232.29688 82.17203  1.000 102.77597 ?  164 ASN B C     1 
ATOM   4551  O O     . ASN B 1 164 ? 185.97873 232.37332 81.79077  1.000 105.13675 ?  164 ASN B O     1 
ATOM   4552  C CB    . ASN B 1 164 ? 187.92143 230.20853 83.40616  1.000 98.81358  ?  164 ASN B CB    1 
ATOM   4553  C CG    . ASN B 1 164 ? 186.58963 230.28499 84.11171  1.000 111.06710 ?  164 ASN B CG    1 
ATOM   4554  O OD1   . ASN B 1 164 ? 186.46586 230.88127 85.17840  1.000 122.89543 ?  164 ASN B OD1   1 
ATOM   4555  N ND2   . ASN B 1 164 ? 185.56984 229.68249 83.50463  1.000 107.52713 ?  164 ASN B ND2   1 
ATOM   4556  N N     . ILE B 1 165 ? 187.80148 233.34568 82.71084  1.000 99.72106  ?  165 ILE B N     1 
ATOM   4557  C CA    . ILE B 1 165 ? 187.13420 234.64615 82.79251  1.000 100.33687 ?  165 ILE B CA    1 
ATOM   4558  C C     . ILE B 1 165 ? 186.93080 235.22047 81.38860  1.000 99.20548  ?  165 ILE B C     1 
ATOM   4559  O O     . ILE B 1 165 ? 185.88133 235.81130 81.08948  1.000 98.39511  ?  165 ILE B O     1 
ATOM   4560  C CB    . ILE B 1 165 ? 187.86550 235.61626 83.76110  1.000 88.29490  ?  165 ILE B CB    1 
ATOM   4561  C CG1   . ILE B 1 165 ? 189.31588 235.86763 83.40325  1.000 94.66198  ?  165 ILE B CG1   1 
ATOM   4562  C CG2   . ILE B 1 165 ? 187.82121 235.11448 85.19511  1.000 91.51623  ?  165 ILE B CG2   1 
ATOM   4563  C CD1   . ILE B 1 165 ? 189.50260 236.88347 82.34341  1.000 103.13365 ?  165 ILE B CD1   1 
ATOM   4564  N N     . ALA B 1 166 ? 187.90424 235.00446 80.48987  1.000 96.11909  ?  166 ALA B N     1 
ATOM   4565  C CA    . ALA B 1 166 ? 187.76777 235.49173 79.12497  1.000 95.24566  ?  166 ALA B CA    1 
ATOM   4566  C C     . ALA B 1 166 ? 186.54820 234.86986 78.46495  1.000 96.38404  ?  166 ALA B C     1 
ATOM   4567  O O     . ALA B 1 166 ? 185.69717 235.58300 77.91522  1.000 91.86851  ?  166 ALA B O     1 
ATOM   4568  C CB    . ALA B 1 166 ? 189.02855 235.15392 78.33108  1.000 96.96388  ?  166 ALA B CB    1 
ATOM   4569  N N     . ASP B 1 167 ? 186.37574 233.55670 78.65785  1.000 99.55181  ?  167 ASP B N     1 
ATOM   4570  C CA    . ASP B 1 167 ? 185.22765 232.84771 78.10466  1.000 100.91046 ?  167 ASP B CA    1 
ATOM   4571  C C     . ASP B 1 167 ? 183.92257 233.41105 78.63512  1.000 101.58230 ?  167 ASP B C     1 
ATOM   4572  O O     . ASP B 1 167 ? 182.95532 233.56164 77.87838  1.000 104.25157 ?  167 ASP B O     1 
ATOM   4573  C CB    . ASP B 1 167 ? 185.31842 231.35535 78.42897  1.000 100.89906 ?  167 ASP B CB    1 
ATOM   4574  C CG    . ASP B 1 167 ? 186.46167 230.66746 77.71175  1.000 112.50108 ?  167 ASP B CG    1 
ATOM   4575  O OD1   . ASP B 1 167 ? 187.11224 231.30466 76.84753  1.000 116.11032 ?  167 ASP B OD1   1 
ATOM   4576  O OD2   . ASP B 1 167 ? 186.69727 229.47447 78.00633  1.000 116.25579 ?  167 ASP B OD2   1 
ATOM   4577  N N     . ARG B 1 168 ? 183.87181 233.71053 79.93471  1.000 98.07253  ?  168 ARG B N     1 
ATOM   4578  C CA    . ARG B 1 168 ? 182.67939 234.31844 80.51098  1.000 100.29599 ?  168 ARG B CA    1 
ATOM   4579  C C     . ARG B 1 168 ? 182.42995 235.69885 79.90366  1.000 99.11824  ?  168 ARG B C     1 
ATOM   4580  O O     . ARG B 1 168 ? 181.27754 236.08172 79.66391  1.000 97.32987  ?  168 ARG B O     1 
ATOM   4581  C CB    . ARG B 1 168 ? 182.80202 234.39266 82.03541  1.000 101.69599 ?  168 ARG B CB    1 
ATOM   4582  C CG    . ARG B 1 168 ? 181.55976 234.97826 82.69377  1.000 108.32787 ?  168 ARG B CG    1 
ATOM   4583  C CD    . ARG B 1 168 ? 181.55956 234.90347 84.22383  1.000 106.26202 ?  168 ARG B CD    1 
ATOM   4584  N NE    . ARG B 1 168 ? 182.52935 235.76128 84.89267  1.000 106.32566 ?  168 ARG B NE    1 
ATOM   4585  C CZ    . ARG B 1 168 ? 183.66082 235.33628 85.43543  1.000 112.24521 ?  168 ARG B CZ    1 
ATOM   4586  N NH1   . ARG B 1 168 ? 184.02246 234.06225 85.36955  1.000 107.82597 ?  168 ARG B NH1   1 
ATOM   4587  N NH2   . ARG B 1 168 ? 184.42524 236.20133 86.10291  1.000 106.58521 ?  168 ARG B NH2   1 
ATOM   4588  N N     . ILE B 1 169 ? 183.50078 236.47901 79.69220  1.000 95.06552  ?  169 ILE B N     1 
ATOM   4589  C CA    . ILE B 1 169 ? 183.35640 237.80824 79.09382  1.000 95.47168  ?  169 ILE B CA    1 
ATOM   4590  C C     . ILE B 1 169 ? 182.80644 237.69681 77.67749  1.000 98.80966  ?  169 ILE B C     1 
ATOM   4591  O O     . ILE B 1 169 ? 181.91128 238.45841 77.27711  1.000 97.53030  ?  169 ILE B O     1 
ATOM   4592  C CB    . ILE B 1 169 ? 184.70431 238.54579 79.07221  1.000 91.92605  ?  169 ILE B CB    1 
ATOM   4593  C CG1   . ILE B 1 169 ? 185.17029 238.96217 80.44042  1.000 82.47366  ?  169 ILE B CG1   1 
ATOM   4594  C CG2   . ILE B 1 169 ? 184.61540 239.82799 78.26601  1.000 93.08385  ?  169 ILE B CG2   1 
ATOM   4595  C CD1   . ILE B 1 169 ? 186.52371 239.51105 80.30313  1.000 81.03135  ?  169 ILE B CD1   1 
ATOM   4596  N N     . GLU B 1 170 ? 183.34975 236.75262 76.88928  1.000 100.66129 ?  170 GLU B N     1 
ATOM   4597  C CA    . GLU B 1 170 ? 182.87709 236.56059 75.51819  1.000 102.09950 ?  170 GLU B CA    1 
ATOM   4598  C C     . GLU B 1 170 ? 181.39256 236.19967 75.50514  1.000 101.49471 ?  170 GLU B C     1 
ATOM   4599  O O     . GLU B 1 170 ? 180.60924 236.80362 74.75987  1.000 99.50160  ?  170 GLU B O     1 
ATOM   4600  C CB    . GLU B 1 170 ? 183.74466 235.49534 74.80800  1.000 100.24792 ?  170 GLU B CB    1 
ATOM   4601  C CG    . GLU B 1 170 ? 185.13765 236.00485 74.27103  1.000 109.56080 ?  170 GLU B CG    1 
ATOM   4602  C CD    . GLU B 1 170 ? 186.03864 234.89805 73.66330  1.000 107.69784 ?  170 GLU B CD    1 
ATOM   4603  O OE1   . GLU B 1 170 ? 185.80997 233.70612 73.96658  1.000 110.45359 ?  170 GLU B OE1   1 
ATOM   4604  O OE2   . GLU B 1 170 ? 186.95647 235.21829 72.86327  1.000 95.42041  ?  170 GLU B OE2   1 
ATOM   4605  N N     . GLN B 1 171 ? 180.96810 235.31141 76.41255  1.000 101.26927 ?  171 GLN B N     1 
ATOM   4606  C CA    . GLN B 1 171 ? 179.56198 234.91997 76.47132  1.000 101.80387 ?  171 GLN B CA    1 
ATOM   4607  C C     . GLN B 1 171 ? 178.67321 236.11388 76.78636  1.000 104.38212 ?  171 GLN B C     1 
ATOM   4608  O O     . GLN B 1 171 ? 177.53020 236.18104 76.32254  1.000 107.38888 ?  171 GLN B O     1 
ATOM   4609  C CB    . GLN B 1 171 ? 179.34754 233.81978 77.50732  1.000 101.31443 ?  171 GLN B CB    1 
ATOM   4610  C CG    . GLN B 1 171 ? 179.92888 232.45748 77.13522  1.000 108.99459 ?  171 GLN B CG    1 
ATOM   4611  C CD    . GLN B 1 171 ? 179.99860 231.51036 78.32704  1.000 118.85770 ?  171 GLN B CD    1 
ATOM   4612  O OE1   . GLN B 1 171 ? 179.59692 231.86105 79.44195  1.000 115.50686 ?  171 GLN B OE1   1 
ATOM   4613  N NE2   . GLN B 1 171 ? 180.53799 230.31550 78.10322  1.000 116.17055 ?  171 GLN B NE2   1 
ATOM   4614  N N     . ILE B 1 172 ? 179.15285 237.03329 77.62793  1.000 102.89156 ?  172 ILE B N     1 
ATOM   4615  C CA    . ILE B 1 172 ? 178.35979 238.21170 77.98466  1.000 102.82703 ?  172 ILE B CA    1 
ATOM   4616  C C     . ILE B 1 172 ? 178.08336 239.06033 76.74419  1.000 103.79172 ?  172 ILE B C     1 
ATOM   4617  O O     . ILE B 1 172 ? 176.94324 239.47595 76.49656  1.000 103.70916 ?  172 ILE B O     1 
ATOM   4618  C CB    . ILE B 1 172 ? 179.04744 239.02102 79.10391  1.000 99.22622  ?  172 ILE B CB    1 
ATOM   4619  C CG1   . ILE B 1 172 ? 179.20185 238.18424 80.37730  1.000 102.41278 ?  172 ILE B CG1   1 
ATOM   4620  C CG2   . ILE B 1 172 ? 178.19993 240.19717 79.49411  1.000 93.48104  ?  172 ILE B CG2   1 
ATOM   4621  C CD1   . ILE B 1 172 ? 177.92007 237.51205 80.82098  1.000 106.90607 ?  172 ILE B CD1   1 
ATOM   4622  N N     . PHE B 1 173 ? 179.13635 239.38224 75.98549  1.000 99.67945  ?  173 PHE B N     1 
ATOM   4623  C CA    . PHE B 1 173 ? 179.04683 240.27983 74.84059  1.000 95.65185  ?  173 PHE B CA    1 
ATOM   4624  C C     . PHE B 1 173 ? 178.61367 239.61349 73.53410  1.000 100.60640 ?  173 PHE B C     1 
ATOM   4625  O O     . PHE B 1 173 ? 178.40836 240.32105 72.54022  1.000 98.94985  ?  173 PHE B O     1 
ATOM   4626  C CB    . PHE B 1 173 ? 180.37918 241.00813 74.67748  1.000 92.14048  ?  173 PHE B CB    1 
ATOM   4627  C CG    . PHE B 1 173 ? 180.77234 241.80775 75.90177  1.000 97.77727  ?  173 PHE B CG    1 
ATOM   4628  C CD1   . PHE B 1 173 ? 179.92432 242.78285 76.40757  1.000 94.81381  ?  173 PHE B CD1   1 
ATOM   4629  C CD2   . PHE B 1 173 ? 182.00991 241.62670 76.51330  1.000 94.96454  ?  173 PHE B CD2   1 
ATOM   4630  C CE1   . PHE B 1 173 ? 180.28317 243.52787 77.51848  1.000 89.12642  ?  173 PHE B CE1   1 
ATOM   4631  C CE2   . PHE B 1 173 ? 182.36646 242.37438 77.61152  1.000 85.63360  ?  173 PHE B CE2   1 
ATOM   4632  C CZ    . PHE B 1 173 ? 181.49943 243.32162 78.11323  1.000 84.66873  ?  173 PHE B CZ    1 
ATOM   4633  N N     . GLU B 1 174 ? 178.49312 238.28956 73.48973  1.000 101.46644 ?  174 GLU B N     1 
ATOM   4634  C CA    . GLU B 1 174 ? 177.92626 237.60631 72.33117  1.000 96.69804  ?  174 GLU B CA    1 
ATOM   4635  C C     . GLU B 1 174 ? 176.43282 237.33845 72.50965  1.000 102.95317 ?  174 GLU B C     1 
ATOM   4636  O O     . GLU B 1 174 ? 175.80021 236.81165 71.59064  1.000 105.61325 ?  174 GLU B O     1 
ATOM   4637  C CB    . GLU B 1 174 ? 178.65608 236.29302 72.02140  1.000 85.62318  ?  174 GLU B CB    1 
ATOM   4638  C CG    . GLU B 1 174 ? 178.24859 235.15496 72.91315  1.000 94.91430  ?  174 GLU B CG    1 
ATOM   4639  C CD    . GLU B 1 174 ? 178.97165 233.85977 72.60531  1.000 106.29835 ?  174 GLU B CD    1 
ATOM   4640  O OE1   . GLU B 1 174 ? 179.80208 233.84105 71.67315  1.000 104.68752 ?  174 GLU B OE1   1 
ATOM   4641  O OE2   . GLU B 1 174 ? 178.71681 232.85994 73.31154  1.000 114.06055 ?  174 GLU B OE2   1 
ATOM   4642  N N     . THR B 1 175 ? 175.86242 237.64232 73.68676  1.000 102.95449 ?  175 THR B N     1 
ATOM   4643  C CA    . THR B 1 175 ? 174.44649 237.43529 73.98434  1.000 102.17409 ?  175 THR B CA    1 
ATOM   4644  C C     . THR B 1 175 ? 173.76160 238.77371 74.23186  1.000 103.97656 ?  175 THR B C     1 
ATOM   4645  O O     . THR B 1 175 ? 174.39259 239.74307 74.66464  1.000 104.09081 ?  175 THR B O     1 
ATOM   4646  C CB    . THR B 1 175 ? 174.23764 236.52578 75.22200  1.000 109.41589 ?  175 THR B CB    1 
ATOM   4647  O OG1   . THR B 1 175 ? 175.02502 235.33329 75.10131  1.000 115.65877 ?  175 THR B OG1   1 
ATOM   4648  C CG2   . THR B 1 175 ? 172.75731 236.15480 75.42959  1.000 109.93963 ?  175 THR B CG2   1 
ATOM   4649  N N     . ALA B 1 176 ? 172.43689 238.77965 74.05396  1.000 105.03178 ?  176 ALA B N     1 
ATOM   4650  C CA    . ALA B 1 176 ? 171.65964 240.00913 74.13835  1.000 100.64086 ?  176 ALA B CA    1 
ATOM   4651  C C     . ALA B 1 176 ? 171.85145 240.63953 75.51156  1.000 98.22309  ?  176 ALA B C     1 
ATOM   4652  O O     . ALA B 1 176 ? 172.00679 239.91653 76.50442  1.000 96.35522  ?  176 ALA B O     1 
ATOM   4653  C CB    . ALA B 1 176 ? 170.17557 239.72298 73.89040  1.000 96.46405  ?  176 ALA B CB    1 
ATOM   4654  N N     . PRO B 1 177 ? 171.91934 241.98241 75.60053  1.000 97.94817  ?  177 PRO B N     1 
ATOM   4655  C CA    . PRO B 1 177 ? 171.68762 243.00342 74.55546  1.000 100.01256 ?  177 PRO B CA    1 
ATOM   4656  C C     . PRO B 1 177 ? 172.86573 243.25807 73.62004  1.000 100.77111 ?  177 PRO B C     1 
ATOM   4657  O O     . PRO B 1 177 ? 172.82292 244.14261 72.75619  1.000 103.76550 ?  177 PRO B O     1 
ATOM   4658  C CB    . PRO B 1 177 ? 171.39556 244.25370 75.38080  1.000 102.75779 ?  177 PRO B CB    1 
ATOM   4659  C CG    . PRO B 1 177 ? 172.26826 244.09909 76.58282  1.000 103.86673 ?  177 PRO B CG    1 
ATOM   4660  C CD    . PRO B 1 177 ? 172.25436 242.60945 76.89493  1.000 107.20219 ?  177 PRO B CD    1 
ATOM   4661  N N     . PHE B 1 178 ? 173.93154 242.48805 73.79251  1.000 101.15544 ?  178 PHE B N     1 
ATOM   4662  C CA    . PHE B 1 178 ? 175.13165 242.63058 72.98410  1.000 106.37954 ?  178 PHE B CA    1 
ATOM   4663  C C     . PHE B 1 178 ? 175.06936 241.69363 71.78849  1.000 104.24558 ?  178 PHE B C     1 
ATOM   4664  O O     . PHE B 1 178 ? 174.29100 240.74315 71.76697  1.000 105.25156 ?  178 PHE B O     1 
ATOM   4665  C CB    . PHE B 1 178 ? 176.39577 242.34954 73.81451  1.000 103.29123 ?  178 PHE B CB    1 
ATOM   4666  C CG    . PHE B 1 178 ? 176.48761 243.18928 75.03931  1.000 100.03946 ?  178 PHE B CG    1 
ATOM   4667  C CD1   . PHE B 1 178 ? 176.92083 244.49295 74.93538  1.000 99.30094  ?  178 PHE B CD1   1 
ATOM   4668  C CD2   . PHE B 1 178 ? 176.25166 242.65980 76.28930  1.000 96.54462  ?  178 PHE B CD2   1 
ATOM   4669  C CE1   . PHE B 1 178 ? 177.00696 245.29379 76.02800  1.000 98.67692  ?  178 PHE B CE1   1 
ATOM   4670  C CE2   . PHE B 1 178 ? 176.36192 243.45721 77.41042  1.000 100.47305 ?  178 PHE B CE2   1 
ATOM   4671  C CZ    . PHE B 1 178 ? 176.74416 244.78081 77.27657  1.000 98.62539  ?  178 PHE B CZ    1 
ATOM   4672  N N     . VAL B 1 179 ? 175.84769 242.01207 70.75960  1.000 103.19122 ?  179 VAL B N     1 
ATOM   4673  C CA    . VAL B 1 179 ? 175.88538 241.19184 69.55113  1.000 101.20707 ?  179 VAL B CA    1 
ATOM   4674  C C     . VAL B 1 179 ? 177.28267 240.61857 69.32580  1.000 93.61003  ?  179 VAL B C     1 
ATOM   4675  O O     . VAL B 1 179 ? 178.29135 241.26646 69.62354  1.000 92.69634  ?  179 VAL B O     1 
ATOM   4676  C CB    . VAL B 1 179 ? 175.40617 242.02168 68.34870  1.000 98.04908  ?  179 VAL B CB    1 
ATOM   4677  C CG1   . VAL B 1 179 ? 173.90582 242.09350 68.37067  1.000 99.95010  ?  179 VAL B CG1   1 
ATOM   4678  C CG2   . VAL B 1 179 ? 175.92336 243.42459 68.47828  1.000 99.90883  ?  179 VAL B CG2   1 
ATOM   4679  N N     . LYS B 1 180 ? 177.33730 239.39205 68.79269  1.000 88.72075  ?  180 LYS B N     1 
ATOM   4680  C CA    . LYS B 1 180 ? 178.61611 238.71619 68.56206  1.000 93.17266  ?  180 LYS B CA    1 
ATOM   4681  C C     . LYS B 1 180 ? 179.32421 239.37104 67.39258  1.000 91.22936  ?  180 LYS B C     1 
ATOM   4682  O O     . LYS B 1 180 ? 178.85608 239.28658 66.25383  1.000 106.92413 ?  180 LYS B O     1 
ATOM   4683  C CB    . LYS B 1 180 ? 178.42607 237.22862 68.27379  1.000 90.96842  ?  180 LYS B CB    1 
ATOM   4684  C CG    . LYS B 1 180 ? 179.72563 236.39706 68.26903  1.000 89.59267  ?  180 LYS B CG    1 
ATOM   4685  C CD    . LYS B 1 180 ? 179.41989 234.91953 68.00859  1.000 93.52463  ?  180 LYS B CD    1 
ATOM   4686  C CE    . LYS B 1 180 ? 180.62199 234.01823 68.23281  1.000 96.56617  ?  180 LYS B CE    1 
ATOM   4687  N NZ    . LYS B 1 180 ? 180.34382 232.58455 67.95124  1.000 96.69945  ?  180 LYS B NZ    1 
ATOM   4688  N N     . ILE B 1 181 ? 180.45376 240.01992 67.65142  1.000 88.33376  ?  181 ILE B N     1 
ATOM   4689  C CA    . ILE B 1 181 ? 181.20578 240.65655 66.58349  1.000 86.07838  ?  181 ILE B CA    1 
ATOM   4690  C C     . ILE B 1 181 ? 182.61028 240.09580 66.44155  1.000 88.22926  ?  181 ILE B C     1 
ATOM   4691  O O     . ILE B 1 181 ? 183.27458 240.38023 65.43130  1.000 96.98364  ?  181 ILE B O     1 
ATOM   4692  C CB    . ILE B 1 181 ? 181.25000 242.18603 66.75216  1.000 84.22125  ?  181 ILE B CB    1 
ATOM   4693  C CG1   . ILE B 1 181 ? 181.76829 242.56900 68.12672  1.000 88.67316  ?  181 ILE B CG1   1 
ATOM   4694  C CG2   . ILE B 1 181 ? 179.83614 242.73446 66.66099  1.000 86.97901  ?  181 ILE B CG2   1 
ATOM   4695  C CD1   . ILE B 1 181 ? 181.77418 244.05952 68.34419  1.000 89.38067  ?  181 ILE B CD1   1 
ATOM   4696  N N     . VAL B 1 182 ? 183.12464 239.36176 67.42716  1.000 83.72625  ?  182 VAL B N     1 
ATOM   4697  C CA    . VAL B 1 182 ? 184.50942 238.91452 67.39631  1.000 92.57200  ?  182 VAL B CA    1 
ATOM   4698  C C     . VAL B 1 182 ? 184.64304 237.39236 67.42365  1.000 97.69482  ?  182 VAL B C     1 
ATOM   4699  O O     . VAL B 1 182 ? 185.74719 236.88356 67.60740  1.000 99.80749  ?  182 VAL B O     1 
ATOM   4700  C CB    . VAL B 1 182 ? 185.32617 239.55080 68.54327  1.000 97.12249  ?  182 VAL B CB    1 
ATOM   4701  C CG1   . VAL B 1 182 ? 185.38520 241.07227 68.39795  1.000 94.97751  ?  182 VAL B CG1   1 
ATOM   4702  C CG2   . VAL B 1 182 ? 184.74203 239.15238 69.88893  1.000 104.68985 ?  182 VAL B CG2   1 
ATOM   4703  N N     . GLU B 1 183 ? 183.55611 236.65047 67.21881  1.000 98.17409  ?  183 GLU B N     1 
ATOM   4704  C CA    . GLU B 1 183 ? 183.63972 235.19437 67.26191  1.000 103.68929 ?  183 GLU B CA    1 
ATOM   4705  C C     . GLU B 1 183 ? 184.32094 234.73578 68.55020  1.000 103.65401 ?  183 GLU B C     1 
ATOM   4706  O O     . GLU B 1 183 ? 184.16887 235.38346 69.58741  1.000 110.43572 ?  183 GLU B O     1 
ATOM   4707  C CB    . GLU B 1 183 ? 184.36933 234.64590 66.02581  1.000 108.19774 ?  183 GLU B CB    1 
ATOM   4708  C CG    . GLU B 1 183 ? 183.83968 233.28762 65.57714  1.000 116.10254 ?  183 GLU B CG    1 
ATOM   4709  C CD    . GLU B 1 183 ? 184.61468 232.69493 64.40430  1.000 129.78511 ?  183 GLU B CD    1 
ATOM   4710  O OE1   . GLU B 1 183 ? 185.59758 233.32005 63.94754  1.000 130.37068 ?  183 GLU B OE1   1 
ATOM   4711  O OE2   . GLU B 1 183 ? 184.21141 231.61331 63.91695  1.000 131.83163 ?  183 GLU B OE2   1 
ATOM   4712  N N     . HIS B 1 184 ? 185.03742 233.62043 68.55094  1.000 99.58419  ?  184 HIS B N     1 
ATOM   4713  C CA    . HIS B 1 184 ? 185.55089 233.16302 69.83198  1.000 99.11668  ?  184 HIS B CA    1 
ATOM   4714  C C     . HIS B 1 184 ? 187.07078 233.20558 69.83121  1.000 101.55867 ?  184 HIS B C     1 
ATOM   4715  O O     . HIS B 1 184 ? 187.70728 233.17565 68.76745  1.000 103.23352 ?  184 HIS B O     1 
ATOM   4716  C CB    . HIS B 1 184 ? 185.02083 231.77145 70.11792  1.000 96.28032  ?  184 HIS B CB    1 
ATOM   4717  C CG    . HIS B 1 184 ? 183.75165 231.76627 70.91569  1.000 101.06750 ?  184 HIS B CG    1 
ATOM   4718  N ND1   . HIS B 1 184 ? 182.60078 231.15348 70.46878  1.000 105.89370 ?  184 HIS B ND1   1 
ATOM   4719  C CD2   . HIS B 1 184 ? 183.41611 232.38757 72.06854  1.000 104.70325 ?  184 HIS B CD2   1 
ATOM   4720  C CE1   . HIS B 1 184 ? 181.63390 231.33477 71.34758  1.000 97.72760  ?  184 HIS B CE1   1 
ATOM   4721  N NE2   . HIS B 1 184 ? 182.09903 232.08749 72.32382  1.000 100.54292 ?  184 HIS B NE2   1 
ATOM   4722  N N     . HIS B 1 185 ? 187.63886 233.28909 71.03535  1.000 99.83550  ?  185 HIS B N     1 
ATOM   4723  C CA    . HIS B 1 185 ? 189.07931 233.23347 71.30013  1.000 98.47449  ?  185 HIS B CA    1 
ATOM   4724  C C     . HIS B 1 185 ? 189.88036 234.39336 70.74261  1.000 96.68296  ?  185 HIS B C     1 
ATOM   4725  O O     . HIS B 1 185 ? 191.10638 234.38590 70.89742  1.000 99.26839  ?  185 HIS B O     1 
ATOM   4726  C CB    . HIS B 1 185 ? 189.68719 231.92974 70.75170  1.000 95.06277  ?  185 HIS B CB    1 
ATOM   4727  C CG    . HIS B 1 185 ? 189.05962 230.71167 71.32149  1.000 95.95653  ?  185 HIS B CG    1 
ATOM   4728  N ND1   . HIS B 1 185 ? 189.36848 230.24077 72.57665  1.000 106.07227 ?  185 HIS B ND1   1 
ATOM   4729  C CD2   . HIS B 1 185 ? 188.06919 229.92734 70.85269  1.000 91.54327  ?  185 HIS B CD2   1 
ATOM   4730  C CE1   . HIS B 1 185 ? 188.64089 229.17212 72.82856  1.000 104.87861 ?  185 HIS B CE1   1 
ATOM   4731  N NE2   . HIS B 1 185 ? 187.84034 228.96565 71.80072  1.000 96.38646  ?  185 HIS B NE2   1 
ATOM   4732  N N     . THR B 1 186 ? 189.25883 235.33147 70.02809  1.000 93.19913  ?  186 THR B N     1 
ATOM   4733  C CA    . THR B 1 186 ? 189.98622 236.51861 69.60100  1.000 96.24514  ?  186 THR B CA    1 
ATOM   4734  C C     . THR B 1 186 ? 190.38845 237.37425 70.80424  1.000 102.51469 ?  186 THR B C     1 
ATOM   4735  O O     . THR B 1 186 ? 191.42169 238.05916 70.77268  1.000 103.60248 ?  186 THR B O     1 
ATOM   4736  C CB    . THR B 1 186 ? 189.15763 237.32979 68.59955  1.000 99.85554  ?  186 THR B CB    1 
ATOM   4737  O OG1   . THR B 1 186 ? 187.78757 237.33173 69.02541  1.000 95.77326  ?  186 THR B OG1   1 
ATOM   4738  C CG2   . THR B 1 186 ? 189.27043 236.74607 67.15424  1.000 99.71057  ?  186 THR B CG2   1 
ATOM   4739  N N     . LEU B 1 187 ? 189.54936 237.40169 71.84511  1.000 97.71698  ?  187 LEU B N     1 
ATOM   4740  C CA    . LEU B 1 187 ? 189.84893 238.19984 73.02804  1.000 86.78988  ?  187 LEU B CA    1 
ATOM   4741  C C     . LEU B 1 187 ? 191.10877 237.69219 73.71704  1.000 90.92672  ?  187 LEU B C     1 
ATOM   4742  O O     . LEU B 1 187 ? 191.93837 238.48435 74.17372  1.000 95.41986  ?  187 LEU B O     1 
ATOM   4743  C CB    . LEU B 1 187 ? 188.65389 238.19148 73.97701  1.000 86.85935  ?  187 LEU B CB    1 
ATOM   4744  C CG    . LEU B 1 187 ? 188.69885 238.96326 75.29782  1.000 88.79978  ?  187 LEU B CG    1 
ATOM   4745  C CD1   . LEU B 1 187 ? 188.87468 240.47498 75.07630  1.000 89.06015  ?  187 LEU B CD1   1 
ATOM   4746  C CD2   . LEU B 1 187 ? 187.43062 238.67396 76.10710  1.000 86.36432  ?  187 LEU B CD2   1 
ATOM   4747  N N     . MET B 1 188 ? 191.26752 236.37342 73.80904  1.000 87.61704  ?  188 MET B N     1 
ATOM   4748  C CA    . MET B 1 188 ? 192.46592 235.82280 74.42553  1.000 89.29726  ?  188 MET B CA    1 
ATOM   4749  C C     . MET B 1 188 ? 193.72531 236.16810 73.63418  1.000 88.62353  ?  188 MET B C     1 
ATOM   4750  O O     . MET B 1 188 ? 194.76320 236.49131 74.22669  1.000 90.17064  ?  188 MET B O     1 
ATOM   4751  C CB    . MET B 1 188 ? 192.29363 234.31915 74.59475  1.000 91.45941  ?  188 MET B CB    1 
ATOM   4752  C CG    . MET B 1 188 ? 191.79100 233.97786 75.98719  1.000 100.07326 ?  188 MET B CG    1 
ATOM   4753  S SD    . MET B 1 188 ? 192.99659 234.56648 77.20773  1.000 100.35955 ?  188 MET B SD    1 
ATOM   4754  C CE    . MET B 1 188 ? 194.43549 233.58329 76.77680  1.000 93.36108  ?  188 MET B CE    1 
ATOM   4755  N N     . THR B 1 189 ? 193.65395 236.08933 72.30055  1.000 89.20329  ?  189 THR B N     1 
ATOM   4756  C CA    . THR B 1 189 ? 194.81775 236.35592 71.45043  1.000 93.27578  ?  189 THR B CA    1 
ATOM   4757  C C     . THR B 1 189 ? 195.24449 237.82631 71.48944  1.000 95.71590  ?  189 THR B C     1 
ATOM   4758  O O     . THR B 1 189 ? 196.44725 238.12857 71.51665  1.000 96.11208  ?  189 THR B O     1 
ATOM   4759  C CB    . THR B 1 189 ? 194.53984 235.89441 70.01093  1.000 89.89797  ?  189 THR B CB    1 
ATOM   4760  O OG1   . THR B 1 189 ? 193.38324 236.56466 69.47960  1.000 94.12009  ?  189 THR B OG1   1 
ATOM   4761  C CG2   . THR B 1 189 ? 194.37312 234.37297 69.92041  1.000 78.48383  ?  189 THR B CG2   1 
ATOM   4762  N N     . THR B 1 190 ? 194.27685 238.75336 71.47559  1.000 96.42260  ?  190 THR B N     1 
ATOM   4763  C CA    . THR B 1 190 ? 194.60776 240.16789 71.62023  1.000 98.00939  ?  190 THR B CA    1 
ATOM   4764  C C     . THR B 1 190 ? 195.19037 240.44949 73.00804  1.000 98.70805  ?  190 THR B C     1 
ATOM   4765  O O     . THR B 1 190 ? 196.13049 241.24239 73.13297  1.000 101.18214 ?  190 THR B O     1 
ATOM   4766  C CB    . THR B 1 190 ? 193.37568 241.04770 71.36833  1.000 91.82977  ?  190 THR B CB    1 
ATOM   4767  O OG1   . THR B 1 190 ? 192.27354 240.54739 72.11598  1.000 104.16227 ?  190 THR B OG1   1 
ATOM   4768  C CG2   . THR B 1 190 ? 192.95804 240.93359 69.95859  1.000 86.54700  ?  190 THR B CG2   1 
ATOM   4769  N N     . HIS B 1 191 ? 194.67345 239.78573 74.06540  1.000 95.39553  ?  191 HIS B N     1 
ATOM   4770  C CA    . HIS B 1 191 ? 195.23374 240.00331 75.40590  1.000 100.15869 ?  191 HIS B CA    1 
ATOM   4771  C C     . HIS B 1 191 ? 196.68756 239.59405 75.45387  1.000 101.46668 ?  191 HIS B C     1 
ATOM   4772  O O     . HIS B 1 191 ? 197.48676 240.22191 76.15806  1.000 102.98943 ?  191 HIS B O     1 
ATOM   4773  C CB    . HIS B 1 191 ? 194.47582 239.25608 76.51955  1.000 97.70909  ?  191 HIS B CB    1 
ATOM   4774  C CG    . HIS B 1 191 ? 195.35346 238.85954 77.68440  1.000 94.82173  ?  191 HIS B CG    1 
ATOM   4775  N ND1   . HIS B 1 191 ? 195.96844 239.78287 78.50477  1.000 92.94665  ?  191 HIS B ND1   1 
ATOM   4776  C CD2   . HIS B 1 191 ? 195.67055 237.63991 78.19361  1.000 94.84658  ?  191 HIS B CD2   1 
ATOM   4777  C CE1   . HIS B 1 191 ? 196.66549 239.14981 79.43457  1.000 96.17853  ?  191 HIS B CE1   1 
ATOM   4778  N NE2   . HIS B 1 191 ? 196.49503 237.85000 79.27503  1.000 96.17891  ?  191 HIS B NE2   1 
ATOM   4779  N N     . LYS B 1 192 ? 197.04176 238.51385 74.75195  1.000 95.14711  ?  192 LYS B N     1 
ATOM   4780  C CA    . LYS B 1 192 ? 198.43442 238.09654 74.73108  1.000 95.39754  ?  192 LYS B CA    1 
ATOM   4781  C C     . LYS B 1 192 ? 199.30745 239.19531 74.14282  1.000 102.25584 ?  192 LYS B C     1 
ATOM   4782  O O     . LYS B 1 192 ? 200.43802 239.40843 74.59416  1.000 107.36423 ?  192 LYS B O     1 
ATOM   4783  C CB    . LYS B 1 192 ? 198.58303 236.76742 73.98826  1.000 92.33557  ?  192 LYS B CB    1 
ATOM   4784  C CG    . LYS B 1 192 ? 197.78160 235.60840 74.60877  1.000 89.45245  ?  192 LYS B CG    1 
ATOM   4785  C CD    . LYS B 1 192 ? 198.12748 235.39994 76.08750  1.000 102.93483 ?  192 LYS B CD    1 
ATOM   4786  C CE    . LYS B 1 192 ? 199.56447 234.88331 76.34889  1.000 110.46828 ?  192 LYS B CE    1 
ATOM   4787  N NZ    . LYS B 1 192 ? 199.86896 233.54023 75.75260  1.000 110.40442 ?  192 LYS B NZ    1 
ATOM   4788  N N     . MET B 1 193 ? 198.79869 239.90687 73.13452  1.000 101.31434 ?  193 MET B N     1 
ATOM   4789  C CA    . MET B 1 193 ? 199.53729 241.02964 72.56208  1.000 101.54557 ?  193 MET B CA    1 
ATOM   4790  C C     . MET B 1 193 ? 199.43783 242.29271 73.40792  1.000 106.74060 ?  193 MET B C     1 
ATOM   4791  O O     . MET B 1 193 ? 200.28877 243.18400 73.29317  1.000 110.30518 ?  193 MET B O     1 
ATOM   4792  C CB    . MET B 1 193 ? 199.03373 241.30540 71.14029  1.000 103.00547 ?  193 MET B CB    1 
ATOM   4793  C CG    . MET B 1 193 ? 200.04698 240.90882 70.06225  1.000 112.96835 ?  193 MET B CG    1 
ATOM   4794  S SD    . MET B 1 193 ? 200.62742 239.20077 70.32059  1.000 119.90783 ?  193 MET B SD    1 
ATOM   4795  C CE    . MET B 1 193 ? 199.18823 238.23523 69.86932  1.000 96.27081  ?  193 MET B CE    1 
ATOM   4796  N N     . CYS B 1 194 ? 198.39991 242.39972 74.22572  1.000 105.21980 ?  194 CYS B N     1 
ATOM   4797  C CA    . CYS B 1 194 ? 198.12705 243.59741 75.00152  1.000 99.30233  ?  194 CYS B CA    1 
ATOM   4798  C C     . CYS B 1 194 ? 198.15502 243.27706 76.49308  1.000 101.18485 ?  194 CYS B C     1 
ATOM   4799  O O     . CYS B 1 194 ? 197.34559 243.77666 77.27149  1.000 105.77773 ?  194 CYS B O     1 
ATOM   4800  C CB    . CYS B 1 194 ? 196.77356 244.13928 74.55629  1.000 99.22168  ?  194 CYS B CB    1 
ATOM   4801  S SG    . CYS B 1 194 ? 196.72974 244.22429 72.70076  1.000 119.03870 ?  194 CYS B SG    1 
ATOM   4802  N N     . ALA B 1 195 ? 199.11033 242.44503 76.91088  1.000 102.02141 ?  195 ALA B N     1 
ATOM   4803  C CA    . ALA B 1 195 ? 199.10000 241.94509 78.27874  1.000 102.28940 ?  195 ALA B CA    1 
ATOM   4804  C C     . ALA B 1 195 ? 199.49009 243.01950 79.28359  1.000 101.10764 ?  195 ALA B C     1 
ATOM   4805  O O     . ALA B 1 195 ? 199.11190 242.91691 80.46201  1.000 99.88967  ?  195 ALA B O     1 
ATOM   4806  C CB    . ALA B 1 195 ? 199.99758 240.72007 78.39858  1.000 98.40513  ?  195 ALA B CB    1 
ATOM   4807  N N     . ASN B 1 196 ? 200.26110 244.02487 78.85287  1.000 99.17084  ?  196 ASN B N     1 
ATOM   4808  C CA    . ASN B 1 196 ? 200.70058 245.11213 79.71647  1.000 103.36095 ?  196 ASN B CA    1 
ATOM   4809  C C     . ASN B 1 196 ? 199.88565 246.38274 79.48497  1.000 102.87949 ?  196 ASN B C     1 
ATOM   4810  O O     . ASN B 1 196 ? 200.33600 247.48244 79.83256  1.000 104.97821 ?  196 ASN B O     1 
ATOM   4811  C CB    . ASN B 1 196 ? 202.19640 245.40431 79.49717  1.000 109.00123 ?  196 ASN B CB    1 
ATOM   4812  C CG    . ASN B 1 196 ? 203.11562 244.24781 79.91690  1.000 110.34624 ?  196 ASN B CG    1 
ATOM   4813  O OD1   . ASN B 1 196 ? 202.67527 243.28702 80.55515  1.000 107.70225 ?  196 ASN B OD1   1 
ATOM   4814  N ND2   . ASN B 1 196 ? 204.40851 244.36971 79.60322  1.000 103.80117 ?  196 ASN B ND2   1 
ATOM   4815  N N     . TRP B 1 197 ? 198.67678 246.24758 78.93266  1.000 98.35901  ?  197 TRP B N     1 
ATOM   4816  C CA    . TRP B 1 197 ? 197.86144 247.42222 78.64419  1.000 96.73474  ?  197 TRP B CA    1 
ATOM   4817  C C     . TRP B 1 197 ? 197.33987 248.08983 79.90947  1.000 92.75540  ?  197 TRP B C     1 
ATOM   4818  O O     . TRP B 1 197 ? 196.86894 249.22798 79.84907  1.000 91.83186  ?  197 TRP B O     1 
ATOM   4819  C CB    . TRP B 1 197 ? 196.72606 247.04579 77.69134  1.000 98.85383  ?  197 TRP B CB    1 
ATOM   4820  C CG    . TRP B 1 197 ? 197.07201 247.35565 76.25523  1.000 99.01664  ?  197 TRP B CG    1 
ATOM   4821  C CD1   . TRP B 1 197 ? 198.29454 247.20821 75.64679  1.000 101.62798 ?  197 TRP B CD1   1 
ATOM   4822  C CD2   . TRP B 1 197 ? 196.20182 247.92723 75.27972  1.000 95.89857  ?  197 TRP B CD2   1 
ATOM   4823  N NE1   . TRP B 1 197 ? 198.21688 247.63193 74.34217  1.000 106.55815 ?  197 TRP B NE1   1 
ATOM   4824  C CE2   . TRP B 1 197 ? 196.94414 248.08167 74.09353  1.000 104.35071 ?  197 TRP B CE2   1 
ATOM   4825  C CE3   . TRP B 1 197 ? 194.86311 248.31604 75.29122  1.000 89.65038  ?  197 TRP B CE3   1 
ATOM   4826  C CZ2   . TRP B 1 197 ? 196.38665 248.61272 72.92807  1.000 100.83510 ?  197 TRP B CZ2   1 
ATOM   4827  C CZ3   . TRP B 1 197 ? 194.31204 248.83881 74.13683  1.000 91.83286  ?  197 TRP B CZ3   1 
ATOM   4828  C CH2   . TRP B 1 197 ? 195.07060 248.98452 72.97236  1.000 94.86106  ?  197 TRP B CH2   1 
ATOM   4829  N N     . SER B 1 198 ? 197.39232 247.39559 81.04803  1.000 94.00395  ?  198 SER B N     1 
ATOM   4830  C CA    . SER B 1 198 ? 197.00678 248.00888 82.31814  1.000 90.77225  ?  198 SER B CA    1 
ATOM   4831  C C     . SER B 1 198 ? 197.89776 249.19553 82.66594  1.000 89.91983  ?  198 SER B C     1 
ATOM   4832  O O     . SER B 1 198 ? 197.43862 250.13794 83.32152  1.000 91.99971  ?  198 SER B O     1 
ATOM   4833  C CB    . SER B 1 198 ? 197.02939 246.96292 83.43227  1.000 86.92924  ?  198 SER B CB    1 
ATOM   4834  O OG    . SER B 1 198 ? 198.31011 246.36923 83.57865  1.000 83.40236  ?  198 SER B OG    1 
ATOM   4835  N N     . THR B 1 199 ? 199.17515 249.15319 82.26568  1.000 87.94521  ?  199 THR B N     1 
ATOM   4836  C CA    . THR B 1 199 ? 200.09836 250.23958 82.58435  1.000 89.28184  ?  199 THR B CA    1 
ATOM   4837  C C     . THR B 1 199 ? 199.68099 251.54111 81.89895  1.000 89.30796  ?  199 THR B C     1 
ATOM   4838  O O     . THR B 1 199 ? 199.95984 252.63570 82.41475  1.000 83.17590  ?  199 THR B O     1 
ATOM   4839  C CB    . THR B 1 199 ? 201.54544 249.83609 82.22642  1.000 93.19931  ?  199 THR B CB    1 
ATOM   4840  O OG1   . THR B 1 199 ? 202.47287 250.56564 83.04316  1.000 90.49600  ?  199 THR B OG1   1 
ATOM   4841  C CG2   . THR B 1 199 ? 201.88730 250.12152 80.75675  1.000 92.78329  ?  199 THR B CG2   1 
ATOM   4842  N N     . ILE B 1 200 ? 199.03568 251.44397 80.73887  1.000 91.51378  ?  200 ILE B N     1 
ATOM   4843  C CA    . ILE B 1 200 ? 198.65842 252.64245 79.98015  1.000 93.25355  ?  200 ILE B CA    1 
ATOM   4844  C C     . ILE B 1 200 ? 197.70943 253.50648 80.79329  1.000 90.98302  ?  200 ILE B C     1 
ATOM   4845  O O     . ILE B 1 200 ? 196.60462 253.04720 81.15387  1.000 86.10337  ?  200 ILE B O     1 
ATOM   4846  C CB    . ILE B 1 200 ? 198.01374 252.25157 78.65551  1.000 90.64975  ?  200 ILE B CB    1 
ATOM   4847  C CG1   . ILE B 1 200 ? 198.97656 251.33154 77.91161  1.000 94.24235  ?  200 ILE B CG1   1 
ATOM   4848  C CG2   . ILE B 1 200 ? 197.56819 253.52647 77.93083  1.000 82.33425  ?  200 ILE B CG2   1 
ATOM   4849  C CD1   . ILE B 1 200 ? 198.45649 250.80513 76.65266  1.000 95.21407  ?  200 ILE B CD1   1 
ATOM   4850  N N     . PRO B 1 201 ? 198.03156 254.76580 81.01406  1.000 89.82741  ?  201 PRO B N     1 
ATOM   4851  C CA    . PRO B 1 201 ? 197.21166 255.57940 81.90035  1.000 93.43702  ?  201 PRO B CA    1 
ATOM   4852  C C     . PRO B 1 201 ? 195.82126 255.85874 81.37146  1.000 93.66675  ?  201 PRO B C     1 
ATOM   4853  O O     . PRO B 1 201 ? 194.84258 255.63061 82.08638  1.000 96.02521  ?  201 PRO B O     1 
ATOM   4854  C CB    . PRO B 1 201 ? 197.99960 256.88776 81.98993  1.000 95.87760  ?  201 PRO B CB    1 
ATOM   4855  C CG    . PRO B 1 201 ? 199.36912 256.54077 81.59442  1.000 94.48062  ?  201 PRO B CG    1 
ATOM   4856  C CD    . PRO B 1 201 ? 199.21665 255.49585 80.55153  1.000 91.47204  ?  201 PRO B CD    1 
ATOM   4857  N N     . ASN B 1 202 ? 195.69065 256.30299 80.12469  1.000 88.04106  ?  202 ASN B N     1 
ATOM   4858  C CA    . ASN B 1 202 ? 194.36323 256.71601 79.67841  1.000 92.35143  ?  202 ASN B CA    1 
ATOM   4859  C C     . ASN B 1 202 ? 193.39950 255.54873 79.63617  1.000 94.33120  ?  202 ASN B C     1 
ATOM   4860  O O     . ASN B 1 202 ? 192.20084 255.72331 79.88606  1.000 97.88868  ?  202 ASN B O     1 
ATOM   4861  C CB    . ASN B 1 202 ? 194.44435 257.40818 78.33696  1.000 95.81051  ?  202 ASN B CB    1 
ATOM   4862  C CG    . ASN B 1 202 ? 195.22129 258.66432 78.42257  1.000 100.44638 ?  202 ASN B CG    1 
ATOM   4863  O OD1   . ASN B 1 202 ? 195.44363 259.16756 79.51735  1.000 105.10471 ?  202 ASN B OD1   1 
ATOM   4864  N ND2   . ASN B 1 202 ? 195.65428 259.18739 77.28724  1.000 96.65581  ?  202 ASN B ND2   1 
ATOM   4865  N N     . PHE B 1 203 ? 193.90151 254.36150 79.29264  1.000 90.54623  ?  203 PHE B N     1 
ATOM   4866  C CA    . PHE B 1 203 ? 193.05470 253.17730 79.25893  1.000 89.57305  ?  203 PHE B CA    1 
ATOM   4867  C C     . PHE B 1 203 ? 192.50010 252.88772 80.64510  1.000 94.86374  ?  203 PHE B C     1 
ATOM   4868  O O     . PHE B 1 203 ? 191.27702 252.77973 80.82707  1.000 95.90885  ?  203 PHE B O     1 
ATOM   4869  C CB    . PHE B 1 203 ? 193.89228 252.00884 78.75638  1.000 84.72648  ?  203 PHE B CB    1 
ATOM   4870  C CG    . PHE B 1 203 ? 193.14233 250.73950 78.54473  1.000 74.67672  ?  203 PHE B CG    1 
ATOM   4871  C CD1   . PHE B 1 203 ? 191.93736 250.74909 77.86657  1.000 74.97637  ?  203 PHE B CD1   1 
ATOM   4872  C CD2   . PHE B 1 203 ? 193.69960 249.52810 78.90576  1.000 78.84271  ?  203 PHE B CD2   1 
ATOM   4873  C CE1   . PHE B 1 203 ? 191.27217 249.57524 77.60644  1.000 82.03047  ?  203 PHE B CE1   1 
ATOM   4874  C CE2   . PHE B 1 203 ? 193.04128 248.34566 78.64649  1.000 82.97794  ?  203 PHE B CE2   1 
ATOM   4875  C CZ    . PHE B 1 203 ? 191.82171 248.36867 77.99992  1.000 85.04263  ?  203 PHE B CZ    1 
ATOM   4876  N N     . ARG B 1 204 ? 193.37810 252.90612 81.65789  1.000 94.16823  ?  204 ARG B N     1 
ATOM   4877  C CA    . ARG B 1 204 ? 192.93001 252.68488 83.02632  1.000 92.25914  ?  204 ARG B CA    1 
ATOM   4878  C C     . ARG B 1 204 ? 191.87755 253.70791 83.40609  1.000 88.60876  ?  204 ARG B C     1 
ATOM   4879  O O     . ARG B 1 204 ? 190.76485 253.33499 83.79438  1.000 87.24161  ?  204 ARG B O     1 
ATOM   4880  C CB    . ARG B 1 204 ? 194.14598 252.74306 83.95584  1.000 92.56605  ?  204 ARG B CB    1 
ATOM   4881  C CG    . ARG B 1 204 ? 193.86611 252.83927 85.42723  1.000 91.20897  ?  204 ARG B CG    1 
ATOM   4882  C CD    . ARG B 1 204 ? 195.15186 253.15057 86.20382  1.000 95.03226  ?  204 ARG B CD    1 
ATOM   4883  N NE    . ARG B 1 204 ? 195.83604 251.96944 86.73193  1.000 98.37875  ?  204 ARG B NE    1 
ATOM   4884  C CZ    . ARG B 1 204 ? 195.75800 251.55832 87.99664  1.000 98.40722  ?  204 ARG B CZ    1 
ATOM   4885  N NH1   . ARG B 1 204 ? 195.04801 252.21564 88.90301  1.000 88.24383  ?  204 ARG B NH1   1 
ATOM   4886  N NH2   . ARG B 1 204 ? 196.41229 250.46286 88.36618  1.000 105.20068 ?  204 ARG B NH2   1 
ATOM   4887  N N     . PHE B 1 205 ? 192.13788 254.97506 83.08480  1.000 86.73295  ?  205 PHE B N     1 
ATOM   4888  C CA    . PHE B 1 205 ? 191.21725 256.05101 83.42865  1.000 92.64954  ?  205 PHE B CA    1 
ATOM   4889  C C     . PHE B 1 205 ? 189.83594 255.81258 82.81404  1.000 92.84091  ?  205 PHE B C     1 
ATOM   4890  O O     . PHE B 1 205 ? 188.80281 255.99355 83.47822  1.000 93.49354  ?  205 PHE B O     1 
ATOM   4891  C CB    . PHE B 1 205 ? 191.80126 257.38238 82.94752  1.000 95.06471  ?  205 PHE B CB    1 
ATOM   4892  C CG    . PHE B 1 205 ? 190.95939 258.58868 83.27101  1.000 97.14690  ?  205 PHE B CG    1 
ATOM   4893  C CD1   . PHE B 1 205 ? 189.87990 258.95205 82.48222  1.000 89.13669  ?  205 PHE B CD1   1 
ATOM   4894  C CD2   . PHE B 1 205 ? 191.33170 259.43095 84.30468  1.000 101.85544 ?  205 PHE B CD2   1 
ATOM   4895  C CE1   . PHE B 1 205 ? 189.12410 260.07380 82.77493  1.000 92.10613  ?  205 PHE B CE1   1 
ATOM   4896  C CE2   . PHE B 1 205 ? 190.58639 260.56992 84.59043  1.000 107.64144 ?  205 PHE B CE2   1 
ATOM   4897  C CZ    . PHE B 1 205 ? 189.48016 260.88907 83.82053  1.000 101.08594 ?  205 PHE B CZ    1 
ATOM   4898  N N     . LEU B 1 206 ? 189.79618 255.42101 81.53323  1.000 89.69584  ?  206 LEU B N     1 
ATOM   4899  C CA    . LEU B 1 206 ? 188.51363 255.20200 80.86248  1.000 89.69927  ?  206 LEU B CA    1 
ATOM   4900  C C     . LEU B 1 206 ? 187.78239 254.01746 81.46616  1.000 90.18792  ?  206 LEU B C     1 
ATOM   4901  O O     . LEU B 1 206 ? 186.55570 254.05551 81.63259  1.000 93.87090  ?  206 LEU B O     1 
ATOM   4902  C CB    . LEU B 1 206 ? 188.73549 255.00120 79.36876  1.000 88.55888  ?  206 LEU B CB    1 
ATOM   4903  C CG    . LEU B 1 206 ? 189.26501 256.26542 78.71084  1.000 86.13711  ?  206 LEU B CG    1 
ATOM   4904  C CD1   . LEU B 1 206 ? 189.56212 255.97257 77.27776  1.000 90.79047  ?  206 LEU B CD1   1 
ATOM   4905  C CD2   . LEU B 1 206 ? 188.25498 257.38374 78.83826  1.000 86.55193  ?  206 LEU B CD2   1 
ATOM   4906  N N     . ALA B 1 207 ? 188.53245 252.96739 81.81777  1.000 85.32909  ?  207 ALA B N     1 
ATOM   4907  C CA    . ALA B 1 207 ? 187.92587 251.81380 82.46082  1.000 83.14439  ?  207 ALA B CA    1 
ATOM   4908  C C     . ALA B 1 207 ? 187.23522 252.22895 83.74294  1.000 88.96821  ?  207 ALA B C     1 
ATOM   4909  O O     . ALA B 1 207 ? 186.06661 251.88779 83.97272  1.000 89.14417  ?  207 ALA B O     1 
ATOM   4910  C CB    . ALA B 1 207 ? 188.99407 250.77777 82.78967  1.000 79.47584  ?  207 ALA B CB    1 
ATOM   4911  N N     . GLY B 1 208 ? 187.91313 253.04160 84.54955  1.000 89.03186  ?  208 GLY B N     1 
ATOM   4912  C CA    . GLY B 1 208 ? 187.29932 253.48842 85.77618  1.000 87.94867  ?  208 GLY B CA    1 
ATOM   4913  C C     . GLY B 1 208 ? 186.06604 254.31728 85.50807  1.000 88.65091  ?  208 GLY B C     1 
ATOM   4914  O O     . GLY B 1 208 ? 185.00379 254.06839 86.08672  1.000 91.23647  ?  208 GLY B O     1 
ATOM   4915  N N     . THR B 1 209 ? 186.15097 255.21667 84.53058  1.000 84.38700  ?  209 THR B N     1 
ATOM   4916  C CA    . THR B 1 209 ? 185.04544 256.13426 84.28363  1.000 89.29176  ?  209 THR B CA    1 
ATOM   4917  C C     . THR B 1 209 ? 183.76775 255.38388 83.97334  1.000 90.66182  ?  209 THR B C     1 
ATOM   4918  O O     . THR B 1 209 ? 182.67648 255.75098 84.44188  1.000 87.64549  ?  209 THR B O     1 
ATOM   4919  C CB    . THR B 1 209 ? 185.37280 257.04172 83.11638  1.000 81.59328  ?  209 THR B CB    1 
ATOM   4920  O OG1   . THR B 1 209 ? 186.58341 257.74346 83.39839  1.000 78.06261  ?  209 THR B OG1   1 
ATOM   4921  C CG2   . THR B 1 209 ? 184.23147 258.01968 82.94225  1.000 80.95954  ?  209 THR B CG2   1 
ATOM   4922  N N     . TYR B 1 210 ? 183.88927 254.36525 83.12092  1.000 90.71556  ?  210 TYR B N     1 
ATOM   4923  C CA    . TYR B 1 210 ? 182.74653 253.55444 82.74666  1.000 91.14545  ?  210 TYR B CA    1 
ATOM   4924  C C     . TYR B 1 210 ? 182.19506 252.81227 83.94965  1.000 91.39266  ?  210 TYR B C     1 
ATOM   4925  O O     . TYR B 1 210 ? 180.97350 252.77271 84.15533  1.000 91.19185  ?  210 TYR B O     1 
ATOM   4926  C CB    . TYR B 1 210 ? 183.16722 252.58412 81.64541  1.000 93.09940  ?  210 TYR B CB    1 
ATOM   4927  C CG    . TYR B 1 210 ? 182.93991 253.10857 80.24963  1.000 92.37666  ?  210 TYR B CG    1 
ATOM   4928  C CD1   . TYR B 1 210 ? 181.67613 253.07913 79.68786  1.000 91.05967  ?  210 TYR B CD1   1 
ATOM   4929  C CD2   . TYR B 1 210 ? 183.98852 253.62678 79.49106  1.000 94.24055  ?  210 TYR B CD2   1 
ATOM   4930  C CE1   . TYR B 1 210 ? 181.44488 253.55561 78.41994  1.000 93.04438  ?  210 TYR B CE1   1 
ATOM   4931  C CE2   . TYR B 1 210 ? 183.76578 254.10882 78.19983  1.000 97.45546  ?  210 TYR B CE2   1 
ATOM   4932  C CZ    . TYR B 1 210 ? 182.48316 254.06578 77.67664  1.000 94.93180  ?  210 TYR B CZ    1 
ATOM   4933  O OH    . TYR B 1 210 ? 182.20930 254.52636 76.41565  1.000 89.32528  ?  210 TYR B OH    1 
ATOM   4934  N N     . ASP B 1 211 ? 183.08930 252.25038 84.77626  1.000 91.19469  ?  211 ASP B N     1 
ATOM   4935  C CA    . ASP B 1 211 ? 182.64337 251.45952 85.91988  1.000 94.99629  ?  211 ASP B CA    1 
ATOM   4936  C C     . ASP B 1 211 ? 181.87123 252.34314 86.90131  1.000 95.58604  ?  211 ASP B C     1 
ATOM   4937  O O     . ASP B 1 211 ? 180.86789 251.91169 87.48635  1.000 98.20551  ?  211 ASP B O     1 
ATOM   4938  C CB    . ASP B 1 211 ? 183.83399 250.75477 86.58909  1.000 90.87739  ?  211 ASP B CB    1 
ATOM   4939  C CG    . ASP B 1 211 ? 183.40017 249.61071 87.53684  1.000 92.55023  ?  211 ASP B CG    1 
ATOM   4940  O OD1   . ASP B 1 211 ? 182.22979 249.17433 87.47178  1.000 92.61015  ?  211 ASP B OD1   1 
ATOM   4941  O OD2   . ASP B 1 211 ? 184.23465 249.11456 88.32550  1.000 97.41990  ?  211 ASP B OD2   1 
ATOM   4942  N N     . MET B 1 212 ? 182.32141 253.58404 87.10496  1.000 92.08370  ?  212 MET B N     1 
ATOM   4943  C CA    . MET B 1 212 ? 181.57775 254.46979 87.99288  1.000 92.63948  ?  212 MET B CA    1 
ATOM   4944  C C     . MET B 1 212 ? 180.18280 254.73288 87.45567  1.000 95.59813  ?  212 MET B C     1 
ATOM   4945  O O     . MET B 1 212 ? 179.19393 254.65384 88.20039  1.000 94.81899  ?  212 MET B O     1 
ATOM   4946  C CB    . MET B 1 212 ? 182.32778 255.77731 88.19224  1.000 85.73596  ?  212 MET B CB    1 
ATOM   4947  C CG    . MET B 1 212 ? 181.86311 256.55788 89.39635  1.000 80.30009  ?  212 MET B CG    1 
ATOM   4948  S SD    . MET B 1 212 ? 183.04279 257.87219 89.71316  1.000 81.92177  ?  212 MET B SD    1 
ATOM   4949  C CE    . MET B 1 212 ? 182.18310 258.94059 90.86170  1.000 102.81253 ?  212 MET B CE    1 
ATOM   4950  N N     . PHE B 1 213 ? 180.08036 255.01591 86.15207  1.000 93.79500  ?  213 PHE B N     1 
ATOM   4951  C CA    . PHE B 1 213 ? 178.77545 255.32094 85.58378  1.000 96.48700  ?  213 PHE B CA    1 
ATOM   4952  C C     . PHE B 1 213 ? 177.82065 254.12861 85.71608  1.000 100.73855 ?  213 PHE B C     1 
ATOM   4953  O O     . PHE B 1 213 ? 176.65937 254.29238 86.11567  1.000 105.18186 ?  213 PHE B O     1 
ATOM   4954  C CB    . PHE B 1 213 ? 178.91778 255.76174 84.13128  1.000 91.79030  ?  213 PHE B CB    1 
ATOM   4955  C CG    . PHE B 1 213 ? 177.60443 255.92478 83.43100  1.000 98.82131  ?  213 PHE B CG    1 
ATOM   4956  C CD1   . PHE B 1 213 ? 176.82880 257.05170 83.64730  1.000 102.06735 ?  213 PHE B CD1   1 
ATOM   4957  C CD2   . PHE B 1 213 ? 177.11775 254.92728 82.59647  1.000 97.96520  ?  213 PHE B CD2   1 
ATOM   4958  C CE1   . PHE B 1 213 ? 175.60823 257.20384 83.01840  1.000 103.35350 ?  213 PHE B CE1   1 
ATOM   4959  C CE2   . PHE B 1 213 ? 175.90100 255.07537 81.96413  1.000 102.49024 ?  213 PHE B CE2   1 
ATOM   4960  C CZ    . PHE B 1 213 ? 175.14284 256.21355 82.17823  1.000 104.03781 ?  213 PHE B CZ    1 
ATOM   4961  N N     . PHE B 1 214 ? 178.28587 252.91647 85.38437  1.000 100.12865 ?  214 PHE B N     1 
ATOM   4962  C CA    . PHE B 1 214 ? 177.37977 251.76180 85.43365  1.000 102.08936 ?  214 PHE B CA    1 
ATOM   4963  C C     . PHE B 1 214 ? 176.99876 251.36566 86.86992  1.000 103.85300 ?  214 PHE B C     1 
ATOM   4964  O O     . PHE B 1 214 ? 175.91732 250.79794 87.08164  1.000 103.90654 ?  214 PHE B O     1 
ATOM   4965  C CB    . PHE B 1 214 ? 177.96362 250.57480 84.65009  1.000 94.54756  ?  214 PHE B CB    1 
ATOM   4966  C CG    . PHE B 1 214 ? 177.87620 250.74137 83.14058  1.000 98.07618  ?  214 PHE B CG    1 
ATOM   4967  C CD1   . PHE B 1 214 ? 176.69058 251.11481 82.52130  1.000 94.06800  ?  214 PHE B CD1   1 
ATOM   4968  C CD2   . PHE B 1 214 ? 178.99097 250.52700 82.34510  1.000 103.08716 ?  214 PHE B CD2   1 
ATOM   4969  C CE1   . PHE B 1 214 ? 176.63021 251.27748 81.15254  1.000 94.25301  ?  214 PHE B CE1   1 
ATOM   4970  C CE2   . PHE B 1 214 ? 178.93001 250.68502 80.97395  1.000 99.27413  ?  214 PHE B CE2   1 
ATOM   4971  C CZ    . PHE B 1 214 ? 177.74687 251.06136 80.38051  1.000 96.08463  ?  214 PHE B CZ    1 
ATOM   4972  N N     . SER B 1 215 ? 177.87861 251.59827 87.85275  1.000 103.34258 ?  215 SER B N     1 
ATOM   4973  C CA    . SER B 1 215 ? 177.54624 251.24840 89.23527  1.000 101.65729 ?  215 SER B CA    1 
ATOM   4974  C C     . SER B 1 215 ? 176.39708 252.09359 89.75757  1.000 105.30094 ?  215 SER B C     1 
ATOM   4975  O O     . SER B 1 215 ? 175.49235 251.58001 90.43108  1.000 107.58271 ?  215 SER B O     1 
ATOM   4976  C CB    . SER B 1 215 ? 178.77138 251.40096 90.13306  1.000 100.17247 ?  215 SER B CB    1 
ATOM   4977  O OG    . SER B 1 215 ? 179.85499 250.63711 89.63061  1.000 102.37433 ?  215 SER B OG    1 
ATOM   4978  N N     . ARG B 1 216 ? 176.43601 253.40046 89.48046  1.000 106.15633 ?  216 ARG B N     1 
ATOM   4979  C CA    . ARG B 1 216 ? 175.38434 254.29538 89.94477  1.000 106.41394 ?  216 ARG B CA    1 
ATOM   4980  C C     . ARG B 1 216 ? 174.09807 254.14198 89.12441  1.000 108.78181 ?  216 ARG B C     1 
ATOM   4981  O O     . ARG B 1 216 ? 173.00103 254.08834 89.69536  1.000 107.29879 ?  216 ARG B O     1 
ATOM   4982  C CB    . ARG B 1 216 ? 175.89009 255.73312 89.91767  1.000 102.58116 ?  216 ARG B CB    1 
ATOM   4983  C CG    . ARG B 1 216 ? 174.86627 256.71876 90.40988  1.000 105.98608 ?  216 ARG B CG    1 
ATOM   4984  C CD    . ARG B 1 216 ? 174.53995 256.48736 91.88579  1.000 102.36672 ?  216 ARG B CD    1 
ATOM   4985  N NE    . ARG B 1 216 ? 173.99342 257.70900 92.45867  1.000 108.06845 ?  216 ARG B NE    1 
ATOM   4986  C CZ    . ARG B 1 216 ? 173.53531 257.84758 93.69598  1.000 111.71926 ?  216 ARG B CZ    1 
ATOM   4987  N NH1   . ARG B 1 216 ? 173.51958 256.83623 94.54753  1.000 106.30772 ?  216 ARG B NH1   1 
ATOM   4988  N NH2   . ARG B 1 216 ? 173.06291 259.03164 94.08138  1.000 115.04735 ?  216 ARG B NH2   1 
ATOM   4989  N N     . ILE B 1 217 ? 174.20354 254.04431 87.79611  1.000 108.47017 ?  217 ILE B N     1 
ATOM   4990  C CA    . ILE B 1 217 ? 173.04103 254.03925 86.90433  1.000 105.83479 ?  217 ILE B CA    1 
ATOM   4991  C C     . ILE B 1 217 ? 172.83905 252.64057 86.34615  1.000 109.86182 ?  217 ILE B C     1 
ATOM   4992  O O     . ILE B 1 217 ? 173.73074 252.10835 85.67808  1.000 110.80352 ?  217 ILE B O     1 
ATOM   4993  C CB    . ILE B 1 217 ? 173.21167 255.04177 85.75330  1.000 100.90300 ?  217 ILE B CB    1 
ATOM   4994  C CG1   . ILE B 1 217 ? 173.80044 256.34791 86.27405  1.000 99.53840  ?  217 ILE B CG1   1 
ATOM   4995  C CG2   . ILE B 1 217 ? 171.89707 255.21974 84.99792  1.000 104.81674 ?  217 ILE B CG2   1 
ATOM   4996  C CD1   . ILE B 1 217 ? 172.85470 257.10098 87.15245  1.000 103.62329 ?  217 ILE B CD1   1 
ATOM   4997  N N     . GLU B 1 218 ? 171.66280 252.05455 86.57410  1.000 111.64069 ?  218 GLU B N     1 
ATOM   4998  C CA    . GLU B 1 218 ? 171.36625 250.78414 85.91836  1.000 117.35214 ?  218 GLU B CA    1 
ATOM   4999  C C     . GLU B 1 218 ? 171.14874 251.03997 84.43367  1.000 114.40225 ?  218 GLU B C     1 
ATOM   5000  O O     . GLU B 1 218 ? 170.50529 252.02803 84.06828  1.000 116.30146 ?  218 GLU B O     1 
ATOM   5001  C CB    . GLU B 1 218 ? 170.13863 250.10043 86.51829  1.000 118.37237 ?  218 GLU B CB    1 
ATOM   5002  C CG    . GLU B 1 218 ? 169.80868 248.75060 85.83785  1.000 122.52846 ?  218 GLU B CG    1 
ATOM   5003  C CD    . GLU B 1 218 ? 170.94032 247.71230 85.90078  1.000 125.72586 ?  218 GLU B CD    1 
ATOM   5004  O OE1   . GLU B 1 218 ? 171.56568 247.57023 86.97409  1.000 131.00436 ?  218 GLU B OE1   1 
ATOM   5005  O OE2   . GLU B 1 218 ? 171.20230 247.03895 84.87270  1.000 113.47311 ?  218 GLU B OE2   1 
ATOM   5006  N N     . HIS B 1 219 ? 171.71611 250.18038 83.57584  1.000 109.22079 ?  219 HIS B N     1 
ATOM   5007  C CA    . HIS B 1 219 ? 171.67612 250.38850 82.12736  1.000 106.43328 ?  219 HIS B CA    1 
ATOM   5008  C C     . HIS B 1 219 ? 171.48640 249.06518 81.40412  1.000 104.62064 ?  219 HIS B C     1 
ATOM   5009  O O     . HIS B 1 219 ? 171.76192 247.99145 81.94905  1.000 108.16757 ?  219 HIS B O     1 
ATOM   5010  C CB    . HIS B 1 219 ? 172.96426 251.02001 81.62545  1.000 103.55687 ?  219 HIS B CB    1 
ATOM   5011  C CG    . HIS B 1 219 ? 172.83286 251.71268 80.31337  1.000 99.19934  ?  219 HIS B CG    1 
ATOM   5012  N ND1   . HIS B 1 219 ? 173.19668 251.13213 79.12413  1.000 99.77944  ?  219 HIS B ND1   1 
ATOM   5013  C CD2   . HIS B 1 219 ? 172.45127 252.97558 80.01349  1.000 100.96906 ?  219 HIS B CD2   1 
ATOM   5014  C CE1   . HIS B 1 219 ? 173.01726 251.99927 78.14171  1.000 103.69500 ?  219 HIS B CE1   1 
ATOM   5015  N NE2   . HIS B 1 219 ? 172.56747 253.12810 78.65617  1.000 101.07231 ?  219 HIS B NE2   1 
ATOM   5016  N N     . LEU B 1 220 ? 171.06000 249.14611 80.14419  1.000 98.93751  ?  220 LEU B N     1 
ATOM   5017  C CA    . LEU B 1 220 ? 170.92643 247.91073 79.37905  1.000 105.90324 ?  220 LEU B CA    1 
ATOM   5018  C C     . LEU B 1 220 ? 172.27136 247.21571 79.23441  1.000 107.39760 ?  220 LEU B C     1 
ATOM   5019  O O     . LEU B 1 220 ? 172.38692 246.00059 79.46297  1.000 107.00515 ?  220 LEU B O     1 
ATOM   5020  C CB    . LEU B 1 220 ? 170.31519 248.20374 78.00754  1.000 105.69738 ?  220 LEU B CB    1 
ATOM   5021  C CG    . LEU B 1 220 ? 169.88983 246.99532 77.16744  1.000 103.94978 ?  220 LEU B CG    1 
ATOM   5022  C CD1   . LEU B 1 220 ? 168.89281 246.10453 77.90368  1.000 111.60990 ?  220 LEU B CD1   1 
ATOM   5023  C CD2   . LEU B 1 220 ? 169.25389 247.54200 75.91558  1.000 108.80122 ?  220 LEU B CD2   1 
ATOM   5024  N N     . TYR B 1 221 ? 173.32055 248.00164 78.99332  1.000 107.99520 ?  221 TYR B N     1 
ATOM   5025  C CA    . TYR B 1 221 ? 174.66305 247.49428 78.75836  1.000 107.66138 ?  221 TYR B CA    1 
ATOM   5026  C C     . TYR B 1 221 ? 175.51410 247.56018 80.02701  1.000 103.18840 ?  221 TYR B C     1 
ATOM   5027  O O     . TYR B 1 221 ? 176.74404 247.68085 79.95266  1.000 100.96454 ?  221 TYR B O     1 
ATOM   5028  C CB    . TYR B 1 221 ? 175.29791 248.28357 77.60020  1.000 102.62724 ?  221 TYR B CB    1 
ATOM   5029  C CG    . TYR B 1 221 ? 174.44468 248.33951 76.32012  1.000 102.61538 ?  221 TYR B CG    1 
ATOM   5030  C CD1   . TYR B 1 221 ? 174.17046 247.17918 75.60242  1.000 106.75592 ?  221 TYR B CD1   1 
ATOM   5031  C CD2   . TYR B 1 221 ? 173.90052 249.54000 75.84107  1.000 98.37504  ?  221 TYR B CD2   1 
ATOM   5032  C CE1   . TYR B 1 221 ? 173.39508 247.20229 74.42721  1.000 107.41340 ?  221 TYR B CE1   1 
ATOM   5033  C CE2   . TYR B 1 221 ? 173.11212 249.57124 74.65644  1.000 100.71000 ?  221 TYR B CE2   1 
ATOM   5034  C CZ    . TYR B 1 221 ? 172.86797 248.38666 73.95413  1.000 104.53298 ?  221 TYR B CZ    1 
ATOM   5035  O OH    . TYR B 1 221 ? 172.11009 248.34070 72.79097  1.000 103.49699 ?  221 TYR B OH    1 
ATOM   5036  N N     . SER B 1 222 ? 174.87724 247.44486 81.20123  1.000 102.08121 ?  222 SER B N     1 
ATOM   5037  C CA    . SER B 1 222 ? 175.63038 247.49325 82.44851  1.000 100.93748 ?  222 SER B CA    1 
ATOM   5038  C C     . SER B 1 222 ? 176.57778 246.32372 82.55482  1.000 94.59467  ?  222 SER B C     1 
ATOM   5039  O O     . SER B 1 222 ? 177.49905 246.36226 83.37050  1.000 90.67784  ?  222 SER B O     1 
ATOM   5040  C CB    . SER B 1 222 ? 174.70786 247.48498 83.67862  1.000 101.33896 ?  222 SER B CB    1 
ATOM   5041  O OG    . SER B 1 222 ? 173.90214 246.31632 83.74116  1.000 98.53132  ?  222 SER B OG    1 
ATOM   5042  N N     . ALA B 1 223 ? 176.37719 245.29130 81.73564  1.000 94.20143  ?  223 ALA B N     1 
ATOM   5043  C CA    . ALA B 1 223 ? 177.23005 244.11040 81.77005  1.000 90.36142  ?  223 ALA B CA    1 
ATOM   5044  C C     . ALA B 1 223 ? 178.66587 244.40732 81.34739  1.000 89.77424  ?  223 ALA B C     1 
ATOM   5045  O O     . ALA B 1 223 ? 179.54139 243.55747 81.55580  1.000 84.08281  ?  223 ALA B O     1 
ATOM   5046  C CB    . ALA B 1 223 ? 176.61558 243.01204 80.90680  1.000 86.79746  ?  223 ALA B CB    1 
ATOM   5047  N N     . ILE B 1 224 ? 178.92483 245.59830 80.79048  1.000 92.00109  ?  224 ILE B N     1 
ATOM   5048  C CA    . ILE B 1 224 ? 180.27584 246.02139 80.44012  1.000 91.10874  ?  224 ILE B CA    1 
ATOM   5049  C C     . ILE B 1 224 ? 181.17211 245.99212 81.66801  1.000 91.11416  ?  224 ILE B C     1 
ATOM   5050  O O     . ILE B 1 224 ? 182.38789 245.78229 81.55078  1.000 91.26715  ?  224 ILE B O     1 
ATOM   5051  C CB    . ILE B 1 224 ? 180.19930 247.43518 79.79440  1.000 90.62038  ?  224 ILE B CB    1 
ATOM   5052  C CG1   . ILE B 1 224 ? 179.58413 247.34352 78.39070  1.000 95.86201  ?  224 ILE B CG1   1 
ATOM   5053  C CG2   . ILE B 1 224 ? 181.55212 248.15371 79.78722  1.000 90.37310  ?  224 ILE B CG2   1 
ATOM   5054  C CD1   . ILE B 1 224 ? 179.51930 248.65045 77.63715  1.000 97.53409  ?  224 ILE B CD1   1 
ATOM   5055  N N     . ARG B 1 225 ? 180.57540 246.07980 82.86258  1.000 90.74820  ?  225 ARG B N     1 
ATOM   5056  C CA    . ARG B 1 225 ? 181.35218 246.14975 84.09463  1.000 87.18185  ?  225 ARG B CA    1 
ATOM   5057  C C     . ARG B 1 225 ? 182.20099 244.91707 84.33669  1.000 84.40591  ?  225 ARG B C     1 
ATOM   5058  O O     . ARG B 1 225 ? 183.14829 244.98855 85.11492  1.000 87.85474  ?  225 ARG B O     1 
ATOM   5059  C CB    . ARG B 1 225 ? 180.43779 246.35242 85.29187  1.000 90.74116  ?  225 ARG B CB    1 
ATOM   5060  C CG    . ARG B 1 225 ? 179.98655 247.79707 85.49263  1.000 97.55813  ?  225 ARG B CG    1 
ATOM   5061  C CD    . ARG B 1 225 ? 179.33656 247.95388 86.85675  1.000 100.58059 ?  225 ARG B CD    1 
ATOM   5062  N NE    . ARG B 1 225 ? 180.27530 247.57010 87.91085  1.000 98.51083  ?  225 ARG B NE    1 
ATOM   5063  C CZ    . ARG B 1 225 ? 179.97703 247.51038 89.19679  1.000 95.12559  ?  225 ARG B CZ    1 
ATOM   5064  N NH1   . ARG B 1 225 ? 178.75341 247.76900 89.63375  1.000 103.62779 ?  225 ARG B NH1   1 
ATOM   5065  N NH2   . ARG B 1 225 ? 180.93494 247.21355 90.06291  1.000 89.61844  ?  225 ARG B NH2   1 
ATOM   5066  N N     . VAL B 1 226 ? 181.89876 243.79040 83.70256  1.000 80.71729  ?  226 VAL B N     1 
ATOM   5067  C CA    . VAL B 1 226 ? 182.67160 242.58198 83.97565  1.000 82.53401  ?  226 VAL B CA    1 
ATOM   5068  C C     . VAL B 1 226 ? 184.14782 242.78966 83.62203  1.000 80.70669  ?  226 VAL B C     1 
ATOM   5069  O O     . VAL B 1 226 ? 185.03585 242.08535 84.12882  1.000 80.02387  ?  226 VAL B O     1 
ATOM   5070  C CB    . VAL B 1 226 ? 182.05088 241.38348 83.23979  1.000 83.15796  ?  226 VAL B CB    1 
ATOM   5071  C CG1   . VAL B 1 226 ? 182.00236 241.64526 81.76414  1.000 84.67739  ?  226 VAL B CG1   1 
ATOM   5072  C CG2   . VAL B 1 226 ? 182.82034 240.13944 83.53453  1.000 89.23314  ?  226 VAL B CG2   1 
ATOM   5073  N N     . GLY B 1 227 ? 184.42243 243.67141 82.65831  1.000 85.53158  ?  227 GLY B N     1 
ATOM   5074  C CA    . GLY B 1 227 ? 185.80039 244.06288 82.39883  1.000 88.01436  ?  227 GLY B CA    1 
ATOM   5075  C C     . GLY B 1 227 ? 186.35380 245.03829 83.42425  1.000 85.89357  ?  227 GLY B C     1 
ATOM   5076  O O     . GLY B 1 227 ? 187.50719 244.91357 83.84582  1.000 92.02472  ?  227 GLY B O     1 
ATOM   5077  N N     . THR B 1 228 ? 185.52506 246.01022 83.84843  1.000 82.43821  ?  228 THR B N     1 
ATOM   5078  C CA    . THR B 1 228 ? 185.89551 247.17436 84.65291  1.000 85.97662  ?  228 THR B CA    1 
ATOM   5079  C C     . THR B 1 228 ? 185.66361 247.01835 86.14776  1.000 88.30262  ?  228 THR B C     1 
ATOM   5080  O O     . THR B 1 228 ? 185.92136 247.96399 86.89881  1.000 87.78780  ?  228 THR B O     1 
ATOM   5081  C CB    . THR B 1 228 ? 185.10863 248.39800 84.19199  1.000 88.24979  ?  228 THR B CB    1 
ATOM   5082  O OG1   . THR B 1 228 ? 183.75381 248.28020 84.64093  1.000 90.93953  ?  228 THR B OG1   1 
ATOM   5083  C CG2   . THR B 1 228 ? 185.08821 248.42158 82.69989  1.000 85.93523  ?  228 THR B CG2   1 
ATOM   5084  N N     . VAL B 1 229 ? 185.15365 245.88005 86.60279  1.000 87.34820  ?  229 VAL B N     1 
ATOM   5085  C CA    . VAL B 1 229 ? 184.89367 245.75499 88.02607  1.000 81.70131  ?  229 VAL B CA    1 
ATOM   5086  C C     . VAL B 1 229 ? 186.18458 245.90260 88.79684  1.000 83.11606  ?  229 VAL B C     1 
ATOM   5087  O O     . VAL B 1 229 ? 186.19269 246.50967 89.86990  1.000 87.63220  ?  229 VAL B O     1 
ATOM   5088  C CB    . VAL B 1 229 ? 184.19132 244.41655 88.30564  1.000 80.94235  ?  229 VAL B CB    1 
ATOM   5089  C CG1   . VAL B 1 229 ? 185.13862 243.24416 88.02807  1.000 87.29403  ?  229 VAL B CG1   1 
ATOM   5090  C CG2   . VAL B 1 229 ? 183.68835 244.38331 89.69178  1.000 83.80005  ?  229 VAL B CG2   1 
ATOM   5091  N N     . VAL B 1 230 ? 187.30833 245.44547 88.22321  1.000 80.59437  ?  230 VAL B N     1 
ATOM   5092  C CA    . VAL B 1 230 ? 188.59427 245.45479 88.92729  1.000 82.45042  ?  230 VAL B CA    1 
ATOM   5093  C C     . VAL B 1 230 ? 189.08187 246.86499 89.24743  1.000 84.68728  ?  230 VAL B C     1 
ATOM   5094  O O     . VAL B 1 230 ? 189.97916 247.02588 90.08769  1.000 86.33882  ?  230 VAL B O     1 
ATOM   5095  C CB    . VAL B 1 230 ? 189.68105 244.65830 88.17198  1.000 75.46633  ?  230 VAL B CB    1 
ATOM   5096  C CG1   . VAL B 1 230 ? 189.51778 243.17272 88.38567  1.000 77.00062  ?  230 VAL B CG1   1 
ATOM   5097  C CG2   . VAL B 1 230 ? 189.69708 245.00030 86.70692  1.000 79.90404  ?  230 VAL B CG2   1 
ATOM   5098  N N     . THR B 1 231 ? 188.64417 247.87323 88.48063  1.000 81.24472  ?  231 THR B N     1 
ATOM   5099  C CA    . THR B 1 231 ? 189.06774 249.24732 88.74735  1.000 83.44328  ?  231 THR B CA    1 
ATOM   5100  C C     . THR B 1 231 ? 188.55850 249.71861 90.10259  1.000 88.72374  ?  231 THR B C     1 
ATOM   5101  O O     . THR B 1 231 ? 189.20947 250.53972 90.76303  1.000 91.99424  ?  231 THR B O     1 
ATOM   5102  C CB    . THR B 1 231 ? 188.58135 250.18957 87.64401  1.000 87.02487  ?  231 THR B CB    1 
ATOM   5103  O OG1   . THR B 1 231 ? 187.16233 250.35747 87.72938  1.000 89.20055  ?  231 THR B OG1   1 
ATOM   5104  C CG2   . THR B 1 231 ? 188.89555 249.60336 86.28201  1.000 88.19569  ?  231 THR B CG2   1 
ATOM   5105  N N     . ALA B 1 232 ? 187.39029 249.22673 90.51667  1.000 86.09588  ?  232 ALA B N     1 
ATOM   5106  C CA    . ALA B 1 232 ? 186.80678 249.61487 91.79110  1.000 82.51897  ?  232 ALA B CA    1 
ATOM   5107  C C     . ALA B 1 232 ? 187.66334 249.12548 92.94937  1.000 82.25460  ?  232 ALA B C     1 
ATOM   5108  O O     . ALA B 1 232 ? 187.99963 247.93864 93.03069  1.000 78.82556  ?  232 ALA B O     1 
ATOM   5109  C CB    . ALA B 1 232 ? 185.39356 249.06337 91.91656  1.000 86.35195  ?  232 ALA B CB    1 
ATOM   5110  N N     . TYR B 1 233 ? 187.94989 250.03992 93.88029  1.000 88.08884  ?  233 TYR B N     1 
ATOM   5111  C CA    . TYR B 1 233 ? 188.80804 249.78102 95.03969  1.000 86.29898  ?  233 TYR B CA    1 
ATOM   5112  C C     . TYR B 1 233 ? 190.15419 249.22040 94.59898  1.000 86.73589  ?  233 TYR B C     1 
ATOM   5113  O O     . TYR B 1 233 ? 190.73096 248.34466 95.24760  1.000 87.38342  ?  233 TYR B O     1 
ATOM   5114  C CB    . TYR B 1 233 ? 188.12655 248.84370 96.03761  1.000 83.11993  ?  233 TYR B CB    1 
ATOM   5115  C CG    . TYR B 1 233 ? 187.06188 249.53472 96.79949  1.000 79.19279  ?  233 TYR B CG    1 
ATOM   5116  C CD1   . TYR B 1 233 ? 187.37727 250.55818 97.66957  1.000 87.87075  ?  233 TYR B CD1   1 
ATOM   5117  C CD2   . TYR B 1 233 ? 185.73220 249.21197 96.61572  1.000 80.77139  ?  233 TYR B CD2   1 
ATOM   5118  C CE1   . TYR B 1 233 ? 186.39433 251.22974 98.36437  1.000 91.77702  ?  233 TYR B CE1   1 
ATOM   5119  C CE2   . TYR B 1 233 ? 184.73899 249.86946 97.29752  1.000 85.06391  ?  233 TYR B CE2   1 
ATOM   5120  C CZ    . TYR B 1 233 ? 185.07906 250.87814 98.17457  1.000 88.80578  ?  233 TYR B CZ    1 
ATOM   5121  O OH    . TYR B 1 233 ? 184.11407 251.56001 98.86071  1.000 93.80210  ?  233 TYR B OH    1 
ATOM   5122  N N     . GLU B 1 234 ? 190.66770 249.73728 93.48303  1.000 85.54543  ?  234 GLU B N     1 
ATOM   5123  C CA    . GLU B 1 234 ? 191.95743 249.27828 92.99660  1.000 86.09605  ?  234 GLU B CA    1 
ATOM   5124  C C     . GLU B 1 234 ? 193.06275 249.79590 93.88953  1.000 88.05183  ?  234 GLU B C     1 
ATOM   5125  O O     . GLU B 1 234 ? 193.10675 250.98413 94.21223  1.000 88.02514  ?  234 GLU B O     1 
ATOM   5126  C CB    . GLU B 1 234 ? 192.18862 249.74182 91.56850  1.000 91.03532  ?  234 GLU B CB    1 
ATOM   5127  C CG    . GLU B 1 234 ? 193.26934 248.93990 90.86051  1.000 97.69829  ?  234 GLU B CG    1 
ATOM   5128  C CD    . GLU B 1 234 ? 193.29161 249.18935 89.36400  1.000 96.31294  ?  234 GLU B CD    1 
ATOM   5129  O OE1   . GLU B 1 234 ? 192.52842 250.07073 88.90387  1.000 92.22376  ?  234 GLU B OE1   1 
ATOM   5130  O OE2   . GLU B 1 234 ? 194.06900 248.50940 88.65456  1.000 91.71233  ?  234 GLU B OE2   1 
ATOM   5131  N N     . ASP B 1 235 ? 193.98158 248.89746 94.24864  1.000 88.00533  ?  235 ASP B N     1 
ATOM   5132  C CA    . ASP B 1 235 ? 195.12463 249.23431 95.09918  1.000 91.53968  ?  235 ASP B CA    1 
ATOM   5133  C C     . ASP B 1 235 ? 194.70033 249.70230 96.49218  1.000 91.34948  ?  235 ASP B C     1 
ATOM   5134  O O     . ASP B 1 235 ? 195.37199 250.51998 97.12568  1.000 89.70755  ?  235 ASP B O     1 
ATOM   5135  C CB    . ASP B 1 235 ? 196.02131 250.26256 94.41293  1.000 94.81187  ?  235 ASP B CB    1 
ATOM   5136  C CG    . ASP B 1 235 ? 196.36601 249.86149 92.98938  1.000 100.03840 ?  235 ASP B CG    1 
ATOM   5137  O OD1   . ASP B 1 235 ? 196.17940 248.66803 92.65564  1.000 102.08643 ?  235 ASP B OD1   1 
ATOM   5138  O OD2   . ASP B 1 235 ? 196.82740 250.72399 92.21001  1.000 103.42364 ?  235 ASP B OD2   1 
ATOM   5139  N N     . CYS B 1 236 ? 193.58521 249.18043 96.98788  1.000 88.82120  ?  236 CYS B N     1 
ATOM   5140  C CA    . CYS B 1 236 ? 193.07441 249.54792 98.29646  1.000 84.81402  ?  236 CYS B CA    1 
ATOM   5141  C C     . CYS B 1 236 ? 192.86160 248.31196 99.15477  1.000 85.34018  ?  236 CYS B C     1 
ATOM   5142  O O     . CYS B 1 236 ? 191.93959 248.25544 99.96962  1.000 88.14281  ?  236 CYS B O     1 
ATOM   5143  C CB    . CYS B 1 236 ? 191.78362 250.32430 98.11031  1.000 80.79956  ?  236 CYS B CB    1 
ATOM   5144  S SG    . CYS B 1 236 ? 192.16034 251.72900 97.08550  1.000 84.11148  ?  236 CYS B SG    1 
ATOM   5145  N N     . SER B 1 237 ? 193.68718 247.29004 98.93259  1.000 82.75926  ?  237 SER B N     1 
ATOM   5146  C CA    . SER B 1 237 ? 193.46547 246.00186 99.57562  1.000 83.60709  ?  237 SER B CA    1 
ATOM   5147  C C     . SER B 1 237 ? 193.57664 246.06732 101.08855 1.000 82.07638  ?  237 SER B C     1 
ATOM   5148  O O     . SER B 1 237 ? 192.97478 245.23260 101.77007 1.000 81.01295  ?  237 SER B O     1 
ATOM   5149  C CB    . SER B 1 237 ? 194.39700 244.95372 98.98844  1.000 88.67286  ?  237 SER B CB    1 
ATOM   5150  O OG    . SER B 1 237 ? 193.84163 244.46668 97.78042  1.000 85.81547  ?  237 SER B OG    1 
ATOM   5151  N N     . GLY B 1 238 ? 194.40243 246.95843 101.63717 1.000 82.48514  ?  238 GLY B N     1 
ATOM   5152  C CA    . GLY B 1 238 ? 194.44336 247.06311 103.08650 1.000 80.24005  ?  238 GLY B CA    1 
ATOM   5153  C C     . GLY B 1 238 ? 193.09900 247.49261 103.64841 1.000 80.58997  ?  238 GLY B C     1 
ATOM   5154  O O     . GLY B 1 238 ? 192.51435 246.80889 104.49299 1.000 81.26459  ?  238 GLY B O     1 
ATOM   5155  N N     . LEU B 1 239 ? 192.52219 248.55116 103.07539 1.000 79.95225  ?  239 LEU B N     1 
ATOM   5156  C CA    . LEU B 1 239 ? 191.22513 249.01831 103.53914 1.000 75.79619  ?  239 LEU B CA    1 
ATOM   5157  C C     . LEU B 1 239 ? 190.15144 247.96216 103.37851 1.000 76.89206  ?  239 LEU B C     1 
ATOM   5158  O O     . LEU B 1 239 ? 189.32059 247.77827 104.27575 1.000 82.59884  ?  239 LEU B O     1 
ATOM   5159  C CB    . LEU B 1 239 ? 190.85452 250.29500 102.81082 1.000 74.91222  ?  239 LEU B CB    1 
ATOM   5160  C CG    . LEU B 1 239 ? 189.44473 250.75135 103.12536 1.000 75.15893  ?  239 LEU B CG    1 
ATOM   5161  C CD1   . LEU B 1 239 ? 189.31480 251.38308 104.46455 1.000 82.15549  ?  239 LEU B CD1   1 
ATOM   5162  C CD2   . LEU B 1 239 ? 189.15221 251.78347 102.09144 1.000 88.76624  ?  239 LEU B CD2   1 
ATOM   5163  N N     . VAL B 1 240 ? 190.15065 247.26937 102.23581 1.000 79.06419  ?  240 VAL B N     1 
ATOM   5164  C CA    . VAL B 1 240 ? 189.16447 246.23022 101.93929 1.000 79.11532  ?  240 VAL B CA    1 
ATOM   5165  C C     . VAL B 1 240 ? 189.31438 245.02960 102.87416 1.000 80.76630  ?  240 VAL B C     1 
ATOM   5166  O O     . VAL B 1 240 ? 188.32342 244.36898 103.22701 1.000 78.11541  ?  240 VAL B O     1 
ATOM   5167  C CB    . VAL B 1 240 ? 189.26577 245.83454 100.45900 1.000 75.15396  ?  240 VAL B CB    1 
ATOM   5168  C CG1   . VAL B 1 240 ? 188.44271 244.57846 100.16535 1.000 79.88274  ?  240 VAL B CG1   1 
ATOM   5169  C CG2   . VAL B 1 240 ? 188.85504 247.01512 99.59143  1.000 74.61329  ?  240 VAL B CG2   1 
ATOM   5170  N N     . SER B 1 241 ? 190.55486 244.64908 103.19557 1.000 83.96160  ?  241 SER B N     1 
ATOM   5171  C CA    . SER B 1 241 ? 190.71961 243.54911 104.13707 1.000 80.71905  ?  241 SER B CA    1 
ATOM   5172  C C     . SER B 1 241 ? 190.13495 243.92450 105.48137 1.000 77.88379  ?  241 SER B C     1 
ATOM   5173  O O     . SER B 1 241 ? 189.45727 243.10993 106.12254 1.000 76.10374  ?  241 SER B O     1 
ATOM   5174  C CB    . SER B 1 241 ? 192.19191 243.15135 104.26824 1.000 81.59463  ?  241 SER B CB    1 
ATOM   5175  O OG    . SER B 1 241 ? 192.75591 242.70692 103.04018 1.000 86.40571  ?  241 SER B OG    1 
ATOM   5176  N N     . PHE B 1 242 ? 190.32247 245.18865 105.87890 1.000 79.40421  ?  242 PHE B N     1 
ATOM   5177  C CA    . PHE B 1 242 ? 189.83830 245.64650 107.17130 1.000 78.19636  ?  242 PHE B CA    1 
ATOM   5178  C C     . PHE B 1 242 ? 188.32079 245.59251 107.27027 1.000 77.61669  ?  242 PHE B C     1 
ATOM   5179  O O     . PHE B 1 242 ? 187.77689 245.04315 108.23313 1.000 81.53719  ?  242 PHE B O     1 
ATOM   5180  C CB    . PHE B 1 242 ? 190.33700 247.05796 107.45280 1.000 75.23433  ?  242 PHE B CB    1 
ATOM   5181  C CG    . PHE B 1 242 ? 190.11260 247.44697 108.84638 1.000 78.06170  ?  242 PHE B CG    1 
ATOM   5182  C CD1   . PHE B 1 242 ? 190.50058 246.57851 109.84086 1.000 86.49268  ?  242 PHE B CD1   1 
ATOM   5183  C CD2   . PHE B 1 242 ? 189.44166 248.59858 109.18676 1.000 75.64204  ?  242 PHE B CD2   1 
ATOM   5184  C CE1   . PHE B 1 242 ? 190.26316 246.85353 111.15220 1.000 79.53177  ?  242 PHE B CE1   1 
ATOM   5185  C CE2   . PHE B 1 242 ? 189.19969 248.88747 110.50499 1.000 78.24309  ?  242 PHE B CE2   1 
ATOM   5186  C CZ    . PHE B 1 242 ? 189.61312 248.00972 111.49012 1.000 88.62125  ?  242 PHE B CZ    1 
ATOM   5187  N N     . THR B 1 243 ? 187.61566 246.08918 106.26265 1.000 75.39599  ?  243 THR B N     1 
ATOM   5188  C CA    . THR B 1 243 ? 186.16502 245.99853 106.30698 1.000 75.58674  ?  243 THR B CA    1 
ATOM   5189  C C     . THR B 1 243 ? 185.71265 244.53587 106.34741 1.000 80.37290  ?  243 THR B C     1 
ATOM   5190  O O     . THR B 1 243 ? 184.69813 244.21123 106.97299 1.000 84.92445  ?  243 THR B O     1 
ATOM   5191  C CB    . THR B 1 243 ? 185.57007 246.73925 105.12439 1.000 75.59887  ?  243 THR B CB    1 
ATOM   5192  O OG1   . THR B 1 243 ? 185.97588 246.05281 103.95724 1.000 95.66951  ?  243 THR B OG1   1 
ATOM   5193  C CG2   . THR B 1 243 ? 186.14964 248.12819 105.04602 1.000 75.61256  ?  243 THR B CG2   1 
ATOM   5194  N N     . GLY B 1 244 ? 186.40156 243.65141 105.62665 1.000 80.02889  ?  244 GLY B N     1 
ATOM   5195  C CA    . GLY B 1 244 ? 186.05648 242.24856 105.71352 1.000 81.03780  ?  244 GLY B CA    1 
ATOM   5196  C C     . GLY B 1 244 ? 186.32933 241.68546 107.08967 1.000 83.56165  ?  244 GLY B C     1 
ATOM   5197  O O     . GLY B 1 244 ? 185.49033 240.98550 107.67242 1.000 90.69471  ?  244 GLY B O     1 
ATOM   5198  N N     . PHE B 1 245 ? 187.47678 242.05098 107.65720 1.000 83.44739  ?  245 PHE B N     1 
ATOM   5199  C CA    . PHE B 1 245 ? 187.84413 241.57074 108.97957 1.000 82.57561  ?  245 PHE B CA    1 
ATOM   5200  C C     . PHE B 1 245 ? 186.76395 241.97120 109.98812 1.000 82.83039  ?  245 PHE B C     1 
ATOM   5201  O O     . PHE B 1 245 ? 186.24534 241.12909 110.72771 1.000 83.02982  ?  245 PHE B O     1 
ATOM   5202  C CB    . PHE B 1 245 ? 189.24454 242.11569 109.29105 1.000 75.27418  ?  245 PHE B CB    1 
ATOM   5203  C CG    . PHE B 1 245 ? 189.67610 241.87139 110.62495 1.000 75.34394  ?  245 PHE B CG    1 
ATOM   5204  C CD1   . PHE B 1 245 ? 190.15573 240.64062 110.99626 1.000 78.40530  ?  245 PHE B CD1   1 
ATOM   5205  C CD2   . PHE B 1 245 ? 189.56513 242.87243 111.56707 1.000 79.79381  ?  245 PHE B CD2   1 
ATOM   5206  C CE1   . PHE B 1 245 ? 190.53303 240.41667 112.30858 1.000 84.05820  ?  245 PHE B CE1   1 
ATOM   5207  C CE2   . PHE B 1 245 ? 189.93115 242.67144 112.86011 1.000 77.43605  ?  245 PHE B CE2   1 
ATOM   5208  C CZ    . PHE B 1 245 ? 190.41557 241.43528 113.24156 1.000 81.25081  ?  245 PHE B CZ    1 
ATOM   5209  N N     . ILE B 1 246 ? 186.27216 243.20506 109.87255 1.000 81.94091  ?  246 ILE B N     1 
ATOM   5210  C CA    . ILE B 1 246 ? 185.20820 243.71464 110.73424 1.000 76.80653  ?  246 ILE B CA    1 
ATOM   5211  C C     . ILE B 1 246 ? 183.96734 242.83354 110.65051 1.000 82.40200  ?  246 ILE B C     1 
ATOM   5212  O O     . ILE B 1 246 ? 183.40453 242.42526 111.67272 1.000 85.43454  ?  246 ILE B O     1 
ATOM   5213  C CB    . ILE B 1 246 ? 184.88950 245.16783 110.32996 1.000 76.11270  ?  246 ILE B CB    1 
ATOM   5214  C CG1   . ILE B 1 246 ? 185.99728 246.08281 110.80219 1.000 77.78596  ?  246 ILE B CG1   1 
ATOM   5215  C CG2   . ILE B 1 246 ? 183.48569 245.60815 110.72844 1.000 81.12073  ?  246 ILE B CG2   1 
ATOM   5216  C CD1   . ILE B 1 246 ? 186.06260 247.31844 110.02481 1.000 85.04226  ?  246 ILE B CD1   1 
ATOM   5217  N N     . LYS B 1 247 ? 183.52686 242.51539 109.43201 1.000 84.29020  ?  247 LYS B N     1 
ATOM   5218  C CA    . LYS B 1 247 ? 182.25784 241.81076 109.27146 1.000 85.04457  ?  247 LYS B CA    1 
ATOM   5219  C C     . LYS B 1 247 ? 182.34621 240.34643 109.72756 1.000 85.02197  ?  247 LYS B C     1 
ATOM   5220  O O     . LYS B 1 247 ? 181.36104 239.80068 110.23937 1.000 89.80874  ?  247 LYS B O     1 
ATOM   5221  C CB    . LYS B 1 247 ? 181.76481 241.95643 107.83232 1.000 86.32467  ?  247 LYS B CB    1 
ATOM   5222  C CG    . LYS B 1 247 ? 181.41256 243.41349 107.38121 1.000 83.13356  ?  247 LYS B CG    1 
ATOM   5223  C CD    . LYS B 1 247 ? 181.00032 243.41117 105.88652 1.000 91.78486  ?  247 LYS B CD    1 
ATOM   5224  C CE    . LYS B 1 247 ? 182.13701 242.87693 104.98494 1.000 101.12338 ?  247 LYS B CE    1 
ATOM   5225  N NZ    . LYS B 1 247 ? 181.93356 242.84217 103.48577 1.000 108.94850 ?  247 LYS B NZ    1 
ATOM   5226  N N     . GLN B 1 248 ? 183.46566 239.65843 109.45867 1.000 81.83719  ?  248 GLN B N     1 
ATOM   5227  C CA    . GLN B 1 248 ? 183.59579 238.27038 109.90640 1.000 84.23832  ?  248 GLN B CA    1 
ATOM   5228  C C     . GLN B 1 248 ? 183.68062 238.19366 111.41642 1.000 93.74650  ?  248 GLN B C     1 
ATOM   5229  O O     . GLN B 1 248 ? 183.07033 237.31103 112.03095 1.000 100.50325 ?  248 GLN B O     1 
ATOM   5230  C CB    . GLN B 1 248 ? 184.80117 237.61101 109.27970 1.000 89.23057  ?  248 GLN B CB    1 
ATOM   5231  C CG    . GLN B 1 248 ? 184.61561 237.47442 107.82005 1.000 107.35561 ?  248 GLN B CG    1 
ATOM   5232  C CD    . GLN B 1 248 ? 185.87012 237.04384 107.17916 1.000 119.44445 ?  248 GLN B CD    1 
ATOM   5233  O OE1   . GLN B 1 248 ? 186.88795 236.82590 107.85266 1.000 121.24417 ?  248 GLN B OE1   1 
ATOM   5234  N NE2   . GLN B 1 248 ? 185.84278 236.95267 105.86401 1.000 111.33389 ?  248 GLN B NE2   1 
ATOM   5235  N N     . ILE B 1 249 ? 184.41313 239.12489 112.03641 1.000 90.88041  ?  249 ILE B N     1 
ATOM   5236  C CA    . ILE B 1 249 ? 184.56859 239.13764 113.49152 1.000 82.55776  ?  249 ILE B CA    1 
ATOM   5237  C C     . ILE B 1 249 ? 183.29824 239.58123 114.18279 1.000 89.01507  ?  249 ILE B C     1 
ATOM   5238  O O     . ILE B 1 249 ? 183.05644 239.15479 115.31792 1.000 93.92877  ?  249 ILE B O     1 
ATOM   5239  C CB    . ILE B 1 249 ? 185.80204 240.01515 113.86431 1.000 79.93124  ?  249 ILE B CB    1 
ATOM   5240  C CG1   . ILE B 1 249 ? 187.12641 239.29464 113.62751 1.000 80.53482  ?  249 ILE B CG1   1 
ATOM   5241  C CG2   . ILE B 1 249 ? 185.76014 240.58126 115.27345 1.000 91.62906  ?  249 ILE B CG2   1 
ATOM   5242  C CD1   . ILE B 1 249 ? 187.24339 238.59772 112.32821 1.000 99.25955  ?  249 ILE B CD1   1 
ATOM   5243  N N     . ASN B 1 250 ? 182.40295 240.25200 113.45114 1.000 85.05928  ?  250 ASN B N     1 
ATOM   5244  C CA    . ASN B 1 250 ? 181.11712 240.75369 113.96127 1.000 89.24638  ?  250 ASN B CA    1 
ATOM   5245  C C     . ASN B 1 250 ? 181.34119 241.77354 115.07185 1.000 86.49752  ?  250 ASN B C     1 
ATOM   5246  O O     . ASN B 1 250 ? 180.66932 241.76349 116.10757 1.000 88.63273  ?  250 ASN B O     1 
ATOM   5247  C CB    . ASN B 1 250 ? 180.20894 239.62745 114.44960 1.000 95.66996  ?  250 ASN B CB    1 
ATOM   5248  C CG    . ASN B 1 250 ? 178.73084 239.98110 114.35163 1.000 97.61800  ?  250 ASN B CG    1 
ATOM   5249  O OD1   . ASN B 1 250 ? 178.35546 241.15269 114.26244 1.000 89.94043  ?  250 ASN B OD1   1 
ATOM   5250  N ND2   . ASN B 1 250 ? 177.87991 238.96191 114.45675 1.000 99.30848  ?  250 ASN B ND2   1 
ATOM   5251  N N     . LEU B 1 251 ? 182.31887 242.64697 114.85418 1.000 84.50426  ?  251 LEU B N     1 
ATOM   5252  C CA    . LEU B 1 251 ? 182.67040 243.72647 115.75821 1.000 87.19692  ?  251 LEU B CA    1 
ATOM   5253  C C     . LEU B 1 251 ? 182.55178 245.04615 114.99732 1.000 92.92846  ?  251 LEU B C     1 
ATOM   5254  O O     . LEU B 1 251 ? 182.48767 245.05370 113.76695 1.000 87.30598  ?  251 LEU B O     1 
ATOM   5255  C CB    . LEU B 1 251 ? 184.08531 243.47624 116.31020 1.000 76.77108  ?  251 LEU B CB    1 
ATOM   5256  C CG    . LEU B 1 251 ? 183.92906 243.12803 117.79178 1.000 97.67048  ?  251 LEU B CG    1 
ATOM   5257  C CD1   . LEU B 1 251 ? 183.20325 241.79332 118.09705 1.000 93.37763  ?  251 LEU B CD1   1 
ATOM   5258  C CD2   . LEU B 1 251 ? 185.28286 243.15370 118.47664 1.000 103.33775 ?  251 LEU B CD2   1 
ATOM   5259  N N     . THR B 1 252 ? 182.43005 246.16135 115.72223 1.000 96.63905  ?  252 THR B N     1 
ATOM   5260  C CA    . THR B 1 252 ? 182.47119 247.47325 115.08257 1.000 87.50646  ?  252 THR B CA    1 
ATOM   5261  C C     . THR B 1 252 ? 183.90890 247.85530 114.79197 1.000 89.74568  ?  252 THR B C     1 
ATOM   5262  O O     . THR B 1 252 ? 184.83041 247.39589 115.46901 1.000 95.84266  ?  252 THR B O     1 
ATOM   5263  C CB    . THR B 1 252 ? 181.81654 248.56634 115.94172 1.000 92.97612  ?  252 THR B CB    1 
ATOM   5264  O OG1   . THR B 1 252 ? 181.32807 249.62766 115.11317 1.000 101.15983 ?  252 THR B OG1   1 
ATOM   5265  C CG2   . THR B 1 252 ? 182.78337 249.16433 116.96178 1.000 96.31914  ?  252 THR B CG2   1 
ATOM   5266  N N     . ALA B 1 253 ? 184.10739 248.58235 113.69355 1.000 89.83527  ?  253 ALA B N     1 
ATOM   5267  C CA    . ALA B 1 253 ? 185.44971 249.02877 113.32632 1.000 89.60017  ?  253 ALA B CA    1 
ATOM   5268  C C     . ALA B 1 253 ? 186.24568 249.52720 114.53049 1.000 94.12482  ?  253 ALA B C     1 
ATOM   5269  O O     . ALA B 1 253 ? 187.41569 249.16587 114.69631 1.000 93.78630  ?  253 ALA B O     1 
ATOM   5270  C CB    . ALA B 1 253 ? 185.37910 250.09990 112.24334 1.000 82.34898  ?  253 ALA B CB    1 
ATOM   5271  N N     . ARG B 1 254 ? 185.63019 250.35289 115.38685 1.000 91.53198  ?  254 ARG B N     1 
ATOM   5272  C CA    . ARG B 1 254 ? 186.35916 250.88331 116.53423 1.000 88.75442  ?  254 ARG B CA    1 
ATOM   5273  C C     . ARG B 1 254 ? 186.76979 249.76114 117.47392 1.000 94.49831  ?  254 ARG B C     1 
ATOM   5274  O O     . ARG B 1 254 ? 187.95011 249.63998 117.82628 1.000 96.32744  ?  254 ARG B O     1 
ATOM   5275  C CB    . ARG B 1 254 ? 185.54458 251.92195 117.30454 1.000 96.39647  ?  254 ARG B CB    1 
ATOM   5276  C CG    . ARG B 1 254 ? 186.32079 252.51876 118.51114 1.000 104.57572 ?  254 ARG B CG    1 
ATOM   5277  C CD    . ARG B 1 254 ? 185.41573 253.21896 119.52236 1.000 109.97101 ?  254 ARG B CD    1 
ATOM   5278  N NE    . ARG B 1 254 ? 184.43360 252.32293 120.12100 1.000 110.42956 ?  254 ARG B NE    1 
ATOM   5279  C CZ    . ARG B 1 254 ? 183.61337 252.66841 121.10039 1.000 111.61918 ?  254 ARG B CZ    1 
ATOM   5280  N NH1   . ARG B 1 254 ? 183.61782 253.89565 121.60282 1.000 103.63682 ?  254 ARG B NH1   1 
ATOM   5281  N NH2   . ARG B 1 254 ? 182.78543 251.75495 121.59950 1.000 116.06603 ?  254 ARG B NH2   1 
ATOM   5282  N N     . GLU B 1 255 ? 185.79600 248.94406 117.91627 1.000 97.27237  ?  255 GLU B N     1 
ATOM   5283  C CA    . GLU B 1 255 ? 186.09449 247.84364 118.83864 1.000 96.16643  ?  255 GLU B CA    1 
ATOM   5284  C C     . GLU B 1 255 ? 187.22625 246.97598 118.32212 1.000 95.27734  ?  255 GLU B C     1 
ATOM   5285  O O     . GLU B 1 255 ? 188.08477 246.53743 119.09556 1.000 93.76931  ?  255 GLU B O     1 
ATOM   5286  C CB    . GLU B 1 255 ? 184.84827 246.98126 119.07779 1.000 91.23757  ?  255 GLU B CB    1 
ATOM   5287  C CG    . GLU B 1 255 ? 183.77873 247.68885 119.84650 1.000 99.95668  ?  255 GLU B CG    1 
ATOM   5288  C CD    . GLU B 1 255 ? 184.09802 247.81266 121.33696 1.000 111.88428 ?  255 GLU B CD    1 
ATOM   5289  O OE1   . GLU B 1 255 ? 184.83782 246.95762 121.89909 1.000 109.71874 ?  255 GLU B OE1   1 
ATOM   5290  O OE2   . GLU B 1 255 ? 183.65031 248.81787 121.92703 1.000 106.69692 ?  255 GLU B OE2   1 
ATOM   5291  N N     . ALA B 1 256 ? 187.23868 246.72851 117.00824 1.000 94.95105  ?  256 ALA B N     1 
ATOM   5292  C CA    . ALA B 1 256 ? 188.27393 245.91084 116.40267 1.000 91.34671  ?  256 ALA B CA    1 
ATOM   5293  C C     . ALA B 1 256 ? 189.64035 246.57907 116.51555 1.000 87.90706  ?  256 ALA B C     1 
ATOM   5294  O O     . ALA B 1 256 ? 190.63239 245.92383 116.85236 1.000 91.74093  ?  256 ALA B O     1 
ATOM   5295  C CB    . ALA B 1 256 ? 187.91340 245.62912 114.94852 1.000 92.06203  ?  256 ALA B CB    1 
ATOM   5296  N N     . ILE B 1 257 ? 189.71273 247.89004 116.27919 1.000 81.83900  ?  257 ILE B N     1 
ATOM   5297  C CA    . ILE B 1 257 ? 191.00980 248.55571 116.33520 1.000 81.61224  ?  257 ILE B CA    1 
ATOM   5298  C C     . ILE B 1 257 ? 191.59246 248.50157 117.75545 1.000 83.31828  ?  257 ILE B C     1 
ATOM   5299  O O     . ILE B 1 257 ? 192.81751 248.48483 117.92313 1.000 82.77783  ?  257 ILE B O     1 
ATOM   5300  C CB    . ILE B 1 257 ? 190.85987 249.98871 115.78539 1.000 82.58333  ?  257 ILE B CB    1 
ATOM   5301  C CG1   . ILE B 1 257 ? 190.47184 249.93079 114.32145 1.000 76.18960  ?  257 ILE B CG1   1 
ATOM   5302  C CG2   . ILE B 1 257 ? 192.17762 250.71682 115.77584 1.000 84.37167  ?  257 ILE B CG2   1 
ATOM   5303  C CD1   . ILE B 1 257 ? 190.00057 251.24839 113.80858 1.000 83.57448  ?  257 ILE B CD1   1 
ATOM   5304  N N     . LEU B 1 258 ? 190.73642 248.45288 118.79055 1.000 83.79936  ?  258 LEU B N     1 
ATOM   5305  C CA    . LEU B 1 258 ? 191.21634 248.36033 120.17674 1.000 89.65108  ?  258 LEU B CA    1 
ATOM   5306  C C     . LEU B 1 258 ? 192.03824 247.10493 120.42705 1.000 86.08310  ?  258 LEU B C     1 
ATOM   5307  O O     . LEU B 1 258 ? 192.82892 247.06595 121.38023 1.000 86.10744  ?  258 LEU B O     1 
ATOM   5308  C CB    . LEU B 1 258 ? 190.06355 248.39989 121.17733 1.000 82.79166  ?  258 LEU B CB    1 
ATOM   5309  C CG    . LEU B 1 258 ? 189.01177 249.48922 121.05404 1.000 79.06734  ?  258 LEU B CG    1 
ATOM   5310  C CD1   . LEU B 1 258 ? 187.93799 249.30727 122.10122 1.000 87.57750  ?  258 LEU B CD1   1 
ATOM   5311  C CD2   . LEU B 1 258 ? 189.66078 250.83691 121.19945 1.000 87.65128  ?  258 LEU B CD2   1 
ATOM   5312  N N     . TYR B 1 259 ? 191.71215 246.01644 119.71835 1.000 80.37304  ?  259 TYR B N     1 
ATOM   5313  C CA    . TYR B 1 259 ? 192.39912 244.73743 119.82534 1.000 76.28354  ?  259 TYR B CA    1 
ATOM   5314  C C     . TYR B 1 259 ? 193.77492 244.75739 119.16545 1.000 76.05964  ?  259 TYR B C     1 
ATOM   5315  O O     . TYR B 1 259 ? 194.55884 243.83372 119.37214 1.000 75.95158  ?  259 TYR B O     1 
ATOM   5316  C CB    . TYR B 1 259 ? 191.54297 243.62314 119.20675 1.000 76.23230  ?  259 TYR B CB    1 
ATOM   5317  C CG    . TYR B 1 259 ? 190.38269 243.16639 120.07133 1.000 78.82334  ?  259 TYR B CG    1 
ATOM   5318  C CD1   . TYR B 1 259 ? 189.15041 243.80851 120.01494 1.000 85.31004  ?  259 TYR B CD1   1 
ATOM   5319  C CD2   . TYR B 1 259 ? 190.53543 242.14321 120.99774 1.000 82.03402  ?  259 TYR B CD2   1 
ATOM   5320  C CE1   . TYR B 1 259 ? 188.08530 243.41154 120.81638 1.000 91.09126  ?  259 TYR B CE1   1 
ATOM   5321  C CE2   . TYR B 1 259 ? 189.47723 241.74198 121.80836 1.000 85.23937  ?  259 TYR B CE2   1 
ATOM   5322  C CZ    . TYR B 1 259 ? 188.25644 242.38444 121.71366 1.000 90.79521  ?  259 TYR B CZ    1 
ATOM   5323  O OH    . TYR B 1 259 ? 187.19715 242.01058 122.50777 1.000 95.29995  ?  259 TYR B OH    1 
ATOM   5324  N N     . PHE B 1 260 ? 194.09901 245.77929 118.39112 1.000 75.98968  ?  260 PHE B N     1 
ATOM   5325  C CA    . PHE B 1 260 ? 195.37855 245.81371 117.68732 1.000 76.23577  ?  260 PHE B CA    1 
ATOM   5326  C C     . PHE B 1 260 ? 196.44683 246.24761 118.67201 1.000 80.27092  ?  260 PHE B C     1 
ATOM   5327  O O     . PHE B 1 260 ? 196.81145 247.42051 118.70554 1.000 84.51076  ?  260 PHE B O     1 
ATOM   5328  C CB    . PHE B 1 260 ? 195.32660 246.80231 116.52952 1.000 76.49200  ?  260 PHE B CB    1 
ATOM   5329  C CG    . PHE B 1 260 ? 194.48237 246.37192 115.36115 1.000 80.49548  ?  260 PHE B CG    1 
ATOM   5330  C CD1   . PHE B 1 260 ? 193.58404 245.33515 115.46598 1.000 77.50967  ?  260 PHE B CD1   1 
ATOM   5331  C CD2   . PHE B 1 260 ? 194.57502 247.05380 114.16237 1.000 78.26482  ?  260 PHE B CD2   1 
ATOM   5332  C CE1   . PHE B 1 260 ? 192.81815 244.97158 114.40620 1.000 75.62545  ?  260 PHE B CE1   1 
ATOM   5333  C CE2   . PHE B 1 260 ? 193.81150 246.70223 113.10089 1.000 75.47201  ?  260 PHE B CE2   1 
ATOM   5334  C CZ    . PHE B 1 260 ? 192.92763 245.65902 113.21652 1.000 76.53755  ?  260 PHE B CZ    1 
ATOM   5335  N N     . PHE B 1 261 ? 197.04713 245.31096 119.41961 1.000 78.35367  ?  261 PHE B N     1 
ATOM   5336  C CA    . PHE B 1 261 ? 197.93640 245.72888 120.52587 1.000 80.35072  ?  261 PHE B CA    1 
ATOM   5337  C C     . PHE B 1 261 ? 199.40550 245.82565 120.11045 1.000 82.86506  ?  261 PHE B C     1 
ATOM   5338  O O     . PHE B 1 261 ? 200.25443 245.04938 120.55202 1.000 82.64385  ?  261 PHE B O     1 
ATOM   5339  C CB    . PHE B 1 261 ? 197.84467 244.78929 121.71519 1.000 81.13998  ?  261 PHE B CB    1 
ATOM   5340  C CG    . PHE B 1 261 ? 196.47678 244.41746 122.09135 1.000 80.43245  ?  261 PHE B CG    1 
ATOM   5341  C CD1   . PHE B 1 261 ? 195.56936 245.37641 122.46828 1.000 81.49662  ?  261 PHE B CD1   1 
ATOM   5342  C CD2   . PHE B 1 261 ? 196.15070 243.08859 122.24652 1.000 80.64132  ?  261 PHE B CD2   1 
ATOM   5343  C CE1   . PHE B 1 261 ? 194.31284 245.01893 122.85267 1.000 82.96512  ?  261 PHE B CE1   1 
ATOM   5344  C CE2   . PHE B 1 261 ? 194.90928 242.72346 122.65049 1.000 76.66216  ?  261 PHE B CE2   1 
ATOM   5345  C CZ    . PHE B 1 261 ? 193.98262 243.68546 122.95125 1.000 81.48297  ?  261 PHE B CZ    1 
ATOM   5346  N N     . HIS B 1 262 ? 199.71617 246.81804 119.28390 1.000 78.19935  ?  262 HIS B N     1 
ATOM   5347  C CA    . HIS B 1 262 ? 201.11469 246.99997 118.93534 1.000 77.86803  ?  262 HIS B CA    1 
ATOM   5348  C C     . HIS B 1 262 ? 201.40692 248.40429 118.45253 1.000 85.41761  ?  262 HIS B C     1 
ATOM   5349  O O     . HIS B 1 262 ? 200.55661 249.04236 117.83726 1.000 90.70954  ?  262 HIS B O     1 
ATOM   5350  C CB    . HIS B 1 262 ? 201.52058 245.99594 117.88483 1.000 85.39130  ?  262 HIS B CB    1 
ATOM   5351  C CG    . HIS B 1 262 ? 202.98678 245.77376 117.83499 1.000 92.33049  ?  262 HIS B CG    1 
ATOM   5352  N ND1   . HIS B 1 262 ? 203.80174 246.49806 116.98788 1.000 91.54792  ?  262 HIS B ND1   1 
ATOM   5353  C CD2   . HIS B 1 262 ? 203.79508 244.94943 118.53881 1.000 94.35491  ?  262 HIS B CD2   1 
ATOM   5354  C CE1   . HIS B 1 262 ? 205.05262 246.11990 117.16548 1.000 97.14033  ?  262 HIS B CE1   1 
ATOM   5355  N NE2   . HIS B 1 262 ? 205.07601 245.18076 118.09832 1.000 101.36668 ?  262 HIS B NE2   1 
ATOM   5356  N N     . LYS B 1 263 ? 202.64985 248.84894 118.67196 1.000 86.76890  ?  263 LYS B N     1 
ATOM   5357  C CA    . LYS B 1 263 ? 203.00285 250.21347 118.28246 1.000 91.13399  ?  263 LYS B CA    1 
ATOM   5358  C C     . LYS B 1 263 ? 202.92184 250.40266 116.77559 1.000 86.98541  ?  263 LYS B C     1 
ATOM   5359  O O     . LYS B 1 263 ? 202.42651 251.42827 116.29456 1.000 88.08776  ?  263 LYS B O     1 
ATOM   5360  C CB    . LYS B 1 263 ? 204.40782 250.57422 118.77654 1.000 92.57183  ?  263 LYS B CB    1 
ATOM   5361  C CG    . LYS B 1 263 ? 204.77704 252.06235 118.60834 1.000 98.35924  ?  263 LYS B CG    1 
ATOM   5362  C CD    . LYS B 1 263 ? 206.27898 252.34828 118.85959 1.000 108.17068 ?  263 LYS B CD    1 
ATOM   5363  C CE    . LYS B 1 263 ? 206.75474 251.85191 120.24342 1.000 123.24293 ?  263 LYS B CE    1 
ATOM   5364  N NZ    . LYS B 1 263 ? 208.21379 252.06198 120.54929 1.000 119.90939 ?  263 LYS B NZ    1 
ATOM   5365  N N     . ASN B 1 264 ? 203.34123 249.40447 116.01155 1.000 80.27802  ?  264 ASN B N     1 
ATOM   5366  C CA    . ASN B 1 264 ? 203.43077 249.61184 114.57805 1.000 85.02112  ?  264 ASN B CA    1 
ATOM   5367  C C     . ASN B 1 264 ? 202.07745 249.95089 113.96929 1.000 85.63303  ?  264 ASN B C     1 
ATOM   5368  O O     . ASN B 1 264 ? 202.02681 250.68547 112.98292 1.000 93.38858  ?  264 ASN B O     1 
ATOM   5369  C CB    . ASN B 1 264 ? 204.06124 248.39067 113.94260 1.000 88.47027  ?  264 ASN B CB    1 
ATOM   5370  C CG    . ASN B 1 264 ? 205.44659 248.17406 114.43997 1.000 89.07962  ?  264 ASN B CG    1 
ATOM   5371  O OD1   . ASN B 1 264 ? 205.99755 249.04270 115.11830 1.000 87.65495  ?  264 ASN B OD1   1 
ATOM   5372  N ND2   . ASN B 1 264 ? 206.01808 247.01817 114.14629 1.000 89.96301  ?  264 ASN B ND2   1 
ATOM   5373  N N     . PHE B 1 265 ? 200.97575 249.45692 114.54816 1.000 81.32404  ?  265 PHE B N     1 
ATOM   5374  C CA    . PHE B 1 265 ? 199.66698 249.69177 113.94034 1.000 80.31157  ?  265 PHE B CA    1 
ATOM   5375  C C     . PHE B 1 265 ? 199.33731 251.18001 113.87696 1.000 88.62534  ?  265 PHE B C     1 
ATOM   5376  O O     . PHE B 1 265 ? 198.52638 251.58842 113.03193 1.000 91.76169  ?  265 PHE B O     1 
ATOM   5377  C CB    . PHE B 1 265 ? 198.54574 248.95947 114.69052 1.000 77.89425  ?  265 PHE B CB    1 
ATOM   5378  C CG    . PHE B 1 265 ? 198.65799 247.46501 114.64473 1.000 81.46036  ?  265 PHE B CG    1 
ATOM   5379  C CD1   . PHE B 1 265 ? 198.82133 246.79678 113.44419 1.000 77.98208  ?  265 PHE B CD1   1 
ATOM   5380  C CD2   . PHE B 1 265 ? 198.61192 246.72495 115.81987 1.000 80.18644  ?  265 PHE B CD2   1 
ATOM   5381  C CE1   . PHE B 1 265 ? 198.96457 245.42681 113.41856 1.000 78.26888  ?  265 PHE B CE1   1 
ATOM   5382  C CE2   . PHE B 1 265 ? 198.73992 245.34235 115.79590 1.000 79.59322  ?  265 PHE B CE2   1 
ATOM   5383  C CZ    . PHE B 1 265 ? 198.91930 244.69776 114.59448 1.000 76.47234  ?  265 PHE B CZ    1 
ATOM   5384  N N     . GLU B 1 266 ? 199.93505 252.00136 114.76352 1.000 85.52314  ?  266 GLU B N     1 
ATOM   5385  C CA    . GLU B 1 266 ? 199.51568 253.40177 114.89804 1.000 87.66343  ?  266 GLU B CA    1 
ATOM   5386  C C     . GLU B 1 266 ? 199.65014 254.15282 113.58081 1.000 89.66021  ?  266 GLU B C     1 
ATOM   5387  O O     . GLU B 1 266 ? 198.72189 254.84746 113.14725 1.000 91.33480  ?  266 GLU B O     1 
ATOM   5388  C CB    . GLU B 1 266 ? 200.32007 254.13672 115.98248 1.000 92.78605  ?  266 GLU B CB    1 
ATOM   5389  C CG    . GLU B 1 266 ? 200.14531 253.59604 117.41774 1.000 103.51766 ?  266 GLU B CG    1 
ATOM   5390  C CD    . GLU B 1 266 ? 200.91031 254.37415 118.49389 1.000 101.16491 ?  266 GLU B CD    1 
ATOM   5391  O OE1   . GLU B 1 266 ? 202.13892 254.56992 118.37067 1.000 96.09384  ?  266 GLU B OE1   1 
ATOM   5392  O OE2   . GLU B 1 266 ? 200.27624 254.71715 119.51546 1.000 101.34017 ?  266 GLU B OE2   1 
ATOM   5393  N N     . GLU B 1 267 ? 200.81203 254.04999 112.94126 1.000 93.27553  ?  267 GLU B N     1 
ATOM   5394  C CA    . GLU B 1 267 ? 200.99858 254.75677 111.68244 1.000 96.68305  ?  267 GLU B CA    1 
ATOM   5395  C C     . GLU B 1 267 ? 200.00546 254.26639 110.64963 1.000 89.41101  ?  267 GLU B C     1 
ATOM   5396  O O     . GLU B 1 267 ? 199.43750 255.05874 109.88808 1.000 89.68954  ?  267 GLU B O     1 
ATOM   5397  C CB    . GLU B 1 267 ? 202.41829 254.55055 111.17452 1.000 105.83590 ?  267 GLU B CB    1 
ATOM   5398  C CG    . GLU B 1 267 ? 203.46770 254.92299 112.20096 1.000 119.19842 ?  267 GLU B CG    1 
ATOM   5399  C CD    . GLU B 1 267 ? 204.87545 254.78483 111.66319 1.000 126.92138 ?  267 GLU B CD    1 
ATOM   5400  O OE1   . GLU B 1 267 ? 205.02947 254.48084 110.45935 1.000 114.86045 ?  267 GLU B OE1   1 
ATOM   5401  O OE2   . GLU B 1 267 ? 205.82604 254.91578 112.46223 1.000 133.25986 ?  267 GLU B OE2   1 
ATOM   5402  N N     . GLU B 1 268 ? 199.79811 252.95133 110.59483 1.000 82.63119  ?  268 GLU B N     1 
ATOM   5403  C CA    . GLU B 1 268 ? 198.92730 252.42091 109.56073 1.000 85.00459  ?  268 GLU B CA    1 
ATOM   5404  C C     . GLU B 1 268 ? 197.47503 252.82171 109.78452 1.000 84.05637  ?  268 GLU B C     1 
ATOM   5405  O O     . GLU B 1 268 ? 196.82941 253.33536 108.86231 1.000 90.90572  ?  268 GLU B O     1 
ATOM   5406  C CB    . GLU B 1 268 ? 199.10980 250.91381 109.46225 1.000 80.31016  ?  268 GLU B CB    1 
ATOM   5407  C CG    . GLU B 1 268 ? 200.55938 250.56405 109.18810 1.000 83.19126  ?  268 GLU B CG    1 
ATOM   5408  C CD    . GLU B 1 268 ? 200.73702 249.10062 108.90953 1.000 87.45902  ?  268 GLU B CD    1 
ATOM   5409  O OE1   . GLU B 1 268 ? 199.84785 248.32592 109.31397 1.000 84.43829  ?  268 GLU B OE1   1 
ATOM   5410  O OE2   . GLU B 1 268 ? 201.74191 248.72767 108.26466 1.000 91.23211  ?  268 GLU B OE2   1 
ATOM   5411  N N     . ILE B 1 269 ? 196.98823 252.71924 111.02419 1.000 78.87104  ?  269 ILE B N     1 
ATOM   5412  C CA    . ILE B 1 269 ? 195.60435 253.08436 111.31893 1.000 77.36868  ?  269 ILE B CA    1 
ATOM   5413  C C     . ILE B 1 269 ? 195.35700 254.54061 110.98021 1.000 79.34347  ?  269 ILE B C     1 
ATOM   5414  O O     . ILE B 1 269 ? 194.33587 254.89610 110.37479 1.000 80.81481  ?  269 ILE B O     1 
ATOM   5415  C CB    . ILE B 1 269 ? 195.28401 252.78218 112.79119 1.000 79.93401  ?  269 ILE B CB    1 
ATOM   5416  C CG1   . ILE B 1 269 ? 195.20463 251.28823 112.97759 1.000 82.89577  ?  269 ILE B CG1   1 
ATOM   5417  C CG2   . ILE B 1 269 ? 193.95269 253.34411 113.15235 1.000 84.08436  ?  269 ILE B CG2   1 
ATOM   5418  C CD1   . ILE B 1 269 ? 194.02794 250.77418 112.22861 1.000 80.28125  ?  269 ILE B CD1   1 
ATOM   5419  N N     . ARG B 1 270 ? 196.30801 255.39802 111.33754 1.000 83.13232  ?  270 ARG B N     1 
ATOM   5420  C CA    . ARG B 1 270 ? 196.20842 256.80593 111.00147 1.000 83.80556  ?  270 ARG B CA    1 
ATOM   5421  C C     . ARG B 1 270 ? 196.16518 256.97185 109.49516 1.000 88.77026  ?  270 ARG B C     1 
ATOM   5422  O O     . ARG B 1 270 ? 195.37834 257.76672 108.97051 1.000 93.27567  ?  270 ARG B O     1 
ATOM   5423  C CB    . ARG B 1 270 ? 197.41241 257.55141 111.58598 1.000 90.56351  ?  270 ARG B CB    1 
ATOM   5424  C CG    . ARG B 1 270 ? 197.71210 258.90689 110.91219 1.000 108.63303 ?  270 ARG B CG    1 
ATOM   5425  C CD    . ARG B 1 270 ? 199.18380 259.41469 110.97422 1.000 115.83711 ?  270 ARG B CD    1 
ATOM   5426  N NE    . ARG B 1 270 ? 200.12800 258.47904 110.34989 1.000 126.04150 ?  270 ARG B NE    1 
ATOM   5427  C CZ    . ARG B 1 270 ? 200.51806 258.47904 109.07081 1.000 115.01184 ?  270 ARG B CZ    1 
ATOM   5428  N NH1   . ARG B 1 270 ? 200.09616 259.39402 108.20870 1.000 103.56324 ?  270 ARG B NH1   1 
ATOM   5429  N NH2   . ARG B 1 270 ? 201.32577 257.50967 108.63738 1.000 108.73147 ?  270 ARG B NH2   1 
ATOM   5430  N N     . ARG B 1 271 ? 196.98228 256.19137 108.77822 1.000 84.99684  ?  271 ARG B N     1 
ATOM   5431  C CA    . ARG B 1 271 ? 197.07332 256.34509 107.33032 1.000 88.92491  ?  271 ARG B CA    1 
ATOM   5432  C C     . ARG B 1 271 ? 195.76577 255.98793 106.63843 1.000 90.54361  ?  271 ARG B C     1 
ATOM   5433  O O     . ARG B 1 271 ? 195.30458 256.73627 105.76733 1.000 89.29423  ?  271 ARG B O     1 
ATOM   5434  C CB    . ARG B 1 271 ? 198.21543 255.49342 106.77716 1.000 88.79819  ?  271 ARG B CB    1 
ATOM   5435  C CG    . ARG B 1 271 ? 198.70961 255.94638 105.40789 1.000 84.84938  ?  271 ARG B CG    1 
ATOM   5436  C CD    . ARG B 1 271 ? 199.88146 255.12314 105.02027 1.000 79.44481  ?  271 ARG B CD    1 
ATOM   5437  N NE    . ARG B 1 271 ? 200.86034 255.18397 106.08848 1.000 85.00087  ?  271 ARG B NE    1 
ATOM   5438  C CZ    . ARG B 1 271 ? 201.91854 254.39209 106.18447 1.000 90.73356  ?  271 ARG B CZ    1 
ATOM   5439  N NH1   . ARG B 1 271 ? 202.14301 253.43961 105.30469 1.000 100.13243 ?  271 ARG B NH1   1 
ATOM   5440  N NH2   . ARG B 1 271 ? 202.76989 254.55289 107.19454 1.000 97.83904  ?  271 ARG B NH2   1 
ATOM   5441  N N     . MET B 1 272 ? 195.16140 254.84939 106.99726 1.000 88.72129  ?  272 MET B N     1 
ATOM   5442  C CA    . MET B 1 272 ? 193.96255 254.40176 106.29806 1.000 84.83762  ?  272 MET B CA    1 
ATOM   5443  C C     . MET B 1 272 ? 192.68194 255.06371 106.79276 1.000 89.25386  ?  272 MET B C     1 
ATOM   5444  O O     . MET B 1 272 ? 191.63669 254.94348 106.13554 1.000 95.79067  ?  272 MET B O     1 
ATOM   5445  C CB    . MET B 1 272 ? 193.80896 252.88851 106.37307 1.000 78.64631  ?  272 MET B CB    1 
ATOM   5446  C CG    . MET B 1 272 ? 193.59738 252.33342 107.73795 1.000 90.40575  ?  272 MET B CG    1 
ATOM   5447  S SD    . MET B 1 272 ? 193.49844 250.55028 107.57528 1.000 82.12391  ?  272 MET B SD    1 
ATOM   5448  C CE    . MET B 1 272 ? 192.29097 250.46779 106.26072 1.000 88.32955  ?  272 MET B CE    1 
ATOM   5449  N N     . PHE B 1 273 ? 192.67935 255.67345 107.97130 1.000 90.80050  ?  273 PHE B N     1 
ATOM   5450  C CA    . PHE B 1 273 ? 191.45846 256.33557 108.40495 1.000 91.05727  ?  273 PHE B CA    1 
ATOM   5451  C C     . PHE B 1 273 ? 191.62242 257.85263 108.40905 1.000 92.32112  ?  273 PHE B C     1 
ATOM   5452  O O     . PHE B 1 273 ? 190.92682 258.55557 109.14791 1.000 90.06118  ?  273 PHE B O     1 
ATOM   5453  C CB    . PHE B 1 273 ? 190.97859 255.82229 109.75734 1.000 89.56360  ?  273 PHE B CB    1 
ATOM   5454  C CG    . PHE B 1 273 ? 190.37990 254.47971 109.64876 1.000 92.10103  ?  273 PHE B CG    1 
ATOM   5455  C CD1   . PHE B 1 273 ? 189.31764 254.27198 108.79514 1.000 96.67333  ?  273 PHE B CD1   1 
ATOM   5456  C CD2   . PHE B 1 273 ? 190.88844 253.41591 110.35544 1.000 89.69839  ?  273 PHE B CD2   1 
ATOM   5457  C CE1   . PHE B 1 273 ? 188.78415 253.02175 108.63612 1.000 97.97046  ?  273 PHE B CE1   1 
ATOM   5458  C CE2   . PHE B 1 273 ? 190.34478 252.16875 110.21036 1.000 91.45214  ?  273 PHE B CE2   1 
ATOM   5459  C CZ    . PHE B 1 273 ? 189.28861 251.97444 109.34763 1.000 93.53429  ?  273 PHE B CZ    1 
ATOM   5460  N N     . GLU B 1 274 ? 192.52805 258.36069 107.56104 1.000 96.26879  ?  274 GLU B N     1 
ATOM   5461  C CA    . GLU B 1 274 ? 192.71449 259.79935 107.42399 1.000 93.84195  ?  274 GLU B CA    1 
ATOM   5462  C C     . GLU B 1 274 ? 191.42317 260.42854 106.92698 1.000 94.41763  ?  274 GLU B C     1 
ATOM   5463  O O     . GLU B 1 274 ? 190.88887 260.01286 105.88706 1.000 98.16626  ?  274 GLU B O     1 
ATOM   5464  C CB    . GLU B 1 274 ? 193.84120 260.12662 106.44710 1.000 96.15428  ?  274 GLU B CB    1 
ATOM   5465  C CG    . GLU B 1 274 ? 194.06635 261.62701 106.18943 1.000 99.12153  ?  274 GLU B CG    1 
ATOM   5466  C CD    . GLU B 1 274 ? 194.92439 262.29421 107.23586 1.000 109.33028 ?  274 GLU B CD    1 
ATOM   5467  O OE1   . GLU B 1 274 ? 195.65410 261.57599 107.95437 1.000 108.66391 ?  274 GLU B OE1   1 
ATOM   5468  O OE2   . GLU B 1 274 ? 194.89457 263.54103 107.30381 1.000 114.82386 ?  274 GLU B OE2   1 
ATOM   5469  N N     . PRO B 1 275 ? 190.93567 261.45772 107.59008 1.000 96.01909  ?  275 PRO B N     1 
ATOM   5470  C CA    . PRO B 1 275 ? 189.65763 262.07400 107.22527 1.000 96.72695  ?  275 PRO B CA    1 
ATOM   5471  C C     . PRO B 1 275 ? 189.81027 262.94253 105.98769 1.000 99.56202  ?  275 PRO B C     1 
ATOM   5472  O O     . PRO B 1 275 ? 190.91358 263.27514 105.55787 1.000 99.79972  ?  275 PRO B O     1 
ATOM   5473  C CB    . PRO B 1 275 ? 189.32629 262.91884 108.46118 1.000 99.55444  ?  275 PRO B CB    1 
ATOM   5474  C CG    . PRO B 1 275 ? 190.69050 263.28038 108.99220 1.000 102.01998 ?  275 PRO B CG    1 
ATOM   5475  C CD    . PRO B 1 275 ? 191.57612 262.11281 108.73994 1.000 97.05515  ?  275 PRO B CD    1 
ATOM   5476  N N     . GLY B 1 276 ? 188.66643 263.32618 105.43567 1.000 101.51015 ?  276 GLY B N     1 
ATOM   5477  C CA    . GLY B 1 276 ? 188.61547 264.15477 104.24365 1.000 103.29711 ?  276 GLY B CA    1 
ATOM   5478  C C     . GLY B 1 276 ? 188.53089 263.39362 102.94805 1.000 95.35699  ?  276 GLY B C     1 
ATOM   5479  O O     . GLY B 1 276 ? 188.34033 264.01635 101.90178 1.000 95.47764  ?  276 GLY B O     1 
ATOM   5480  N N     . GLN B 1 277 ? 188.77201 262.08960 102.98105 1.000 96.61161  ?  277 GLN B N     1 
ATOM   5481  C CA    . GLN B 1 277 ? 188.52039 261.17519 101.87814 1.000 90.77349  ?  277 GLN B CA    1 
ATOM   5482  C C     . GLN B 1 277 ? 187.20511 260.45011 102.07484 1.000 91.39361  ?  277 GLN B C     1 
ATOM   5483  O O     . GLN B 1 277 ? 186.99493 259.82063 103.11707 1.000 105.23047 ?  277 GLN B O     1 
ATOM   5484  C CB    . GLN B 1 277 ? 189.64994 260.17754 101.76412 1.000 94.42431  ?  277 GLN B CB    1 
ATOM   5485  C CG    . GLN B 1 277 ? 190.79420 260.71316 100.96676 1.000 91.18207  ?  277 GLN B CG    1 
ATOM   5486  C CD    . GLN B 1 277 ? 191.66304 261.67050 101.70647 1.000 91.37481  ?  277 GLN B CD    1 
ATOM   5487  O OE1   . GLN B 1 277 ? 191.96864 261.47060 102.88167 1.000 103.11030 ?  277 GLN B OE1   1 
ATOM   5488  N NE2   . GLN B 1 277 ? 192.12342 262.69353 101.00770 1.000 85.05156  ?  277 GLN B NE2   1 
ATOM   5489  N N     . GLU B 1 278 ? 186.35098 260.47746 101.06138 1.000 78.55799  ?  278 GLU B N     1 
ATOM   5490  C CA    . GLU B 1 278 ? 185.00817 259.91878 101.20727 1.000 84.59270  ?  278 GLU B CA    1 
ATOM   5491  C C     . GLU B 1 278 ? 184.98890 258.39084 101.24464 1.000 91.25018  ?  278 GLU B C     1 
ATOM   5492  O O     . GLU B 1 278 ? 184.27945 257.73003 100.49110 1.000 92.00886  ?  278 GLU B O     1 
ATOM   5493  C CB    . GLU B 1 278 ? 184.09645 260.44564 100.11470 1.000 89.06123  ?  278 GLU B CB    1 
ATOM   5494  C CG    . GLU B 1 278 ? 183.82965 261.90539 100.27140 1.000 98.52884  ?  278 GLU B CG    1 
ATOM   5495  C CD    . GLU B 1 278 ? 183.13293 262.49209 99.08033  1.000 96.88797  ?  278 GLU B CD    1 
ATOM   5496  O OE1   . GLU B 1 278 ? 183.29658 261.94228 97.96841  1.000 97.65608  ?  278 GLU B OE1   1 
ATOM   5497  O OE2   . GLU B 1 278 ? 182.33034 263.43418 99.27766  1.000 83.80839  ?  278 GLU B OE2   1 
ATOM   5498  N N     . THR B 1 279 ? 185.68538 257.83677 102.23366 1.000 98.92846  ?  279 THR B N     1 
ATOM   5499  C CA    . THR B 1 279 ? 185.69398 256.38580 102.37877 1.000 96.30191  ?  279 THR B CA    1 
ATOM   5500  C C     . THR B 1 279 ? 184.28507 255.82888 102.54365 1.000 99.66682  ?  279 THR B C     1 
ATOM   5501  O O     . THR B 1 279 ? 183.93978 254.81951 101.91890 1.000 100.49711 ?  279 THR B O     1 
ATOM   5502  C CB    . THR B 1 279 ? 186.49411 255.98720 103.61445 1.000 99.46042  ?  279 THR B CB    1 
ATOM   5503  O OG1   . THR B 1 279 ? 187.83207 256.48165 103.51376 1.000 96.62528  ?  279 THR B OG1   1 
ATOM   5504  C CG2   . THR B 1 279 ? 186.50724 254.47489 103.77240 1.000 95.26467  ?  279 THR B CG2   1 
ATOM   5505  N N     . ALA B 1 280 ? 183.44574 256.50399 103.34429 1.000 105.26859 ?  280 ALA B N     1 
ATOM   5506  C CA    . ALA B 1 280 ? 182.10495 256.00804 103.64619 1.000 103.64686 ?  280 ALA B CA    1 
ATOM   5507  C C     . ALA B 1 280 ? 181.10102 256.24378 102.50720 1.000 104.82942 ?  280 ALA B C     1 
ATOM   5508  O O     . ALA B 1 280 ? 180.13221 255.47844 102.39492 1.000 108.11193 ?  280 ALA B O     1 
ATOM   5509  C CB    . ALA B 1 280 ? 181.60853 256.63705 104.94799 1.000 101.73068 ?  280 ALA B CB    1 
ATOM   5510  N N     . VAL B 1 281 ? 181.30794 257.25532 101.65562 1.000 98.69641  ?  281 VAL B N     1 
ATOM   5511  C CA    . VAL B 1 281 ? 180.31116 257.60474 100.62626 1.000 95.04931  ?  281 VAL B CA    1 
ATOM   5512  C C     . VAL B 1 281 ? 180.18793 256.47731 99.61631  1.000 97.59618  ?  281 VAL B C     1 
ATOM   5513  O O     . VAL B 1 281 ? 181.21045 256.04953 99.05096  1.000 102.49067 ?  281 VAL B O     1 
ATOM   5514  C CB    . VAL B 1 281 ? 180.71008 258.89099 99.91142  1.000 96.26335  ?  281 VAL B CB    1 
ATOM   5515  C CG1   . VAL B 1 281 ? 179.78174 259.11531 98.71056  1.000 98.03292  ?  281 VAL B CG1   1 
ATOM   5516  C CG2   . VAL B 1 281 ? 180.65228 260.03965 100.86771 1.000 98.06136  ?  281 VAL B CG2   1 
ATOM   5517  N N     . PRO B 1 282 ? 178.97257 256.01195 99.30211  1.000 98.13416  ?  282 PRO B N     1 
ATOM   5518  C CA    . PRO B 1 282 ? 178.84146 254.84763 98.41008  1.000 106.08580 ?  282 PRO B CA    1 
ATOM   5519  C C     . PRO B 1 282 ? 179.27642 255.09745 96.97650  1.000 106.31775 ?  282 PRO B C     1 
ATOM   5520  O O     . PRO B 1 282 ? 179.90034 254.22415 96.36352  1.000 104.45790 ?  282 PRO B O     1 
ATOM   5521  C CB    . PRO B 1 282 ? 177.35054 254.50080 98.49430  1.000 100.76375 ?  282 PRO B CB    1 
ATOM   5522  C CG    . PRO B 1 282 ? 176.90455 255.09730 99.75441  1.000 95.86926  ?  282 PRO B CG    1 
ATOM   5523  C CD    . PRO B 1 282 ? 177.68065 256.37571 99.88714  1.000 99.35868  ?  282 PRO B CD    1 
ATOM   5524  N N     . HIS B 1 283 ? 178.92035 256.21811 96.37843  1.000 99.36984  ?  283 HIS B N     1 
ATOM   5525  C CA    . HIS B 1 283 ? 179.35333 256.30604 94.99699  1.000 97.13868  ?  283 HIS B CA    1 
ATOM   5526  C C     . HIS B 1 283 ? 180.31134 257.46822 94.83962  1.000 98.02757  ?  283 HIS B C     1 
ATOM   5527  O O     . HIS B 1 283 ? 180.10338 258.32592 93.98179  1.000 101.39237 ?  283 HIS B O     1 
ATOM   5528  C CB    . HIS B 1 283 ? 178.15112 256.50051 94.07905  1.000 97.18852  ?  283 HIS B CB    1 
ATOM   5529  C CG    . HIS B 1 283 ? 177.19965 255.35325 94.07943  1.000 102.84294 ?  283 HIS B CG    1 
ATOM   5530  N ND1   . HIS B 1 283 ? 177.39978 254.21458 93.33088  1.000 107.17139 ?  283 HIS B ND1   1 
ATOM   5531  C CD2   . HIS B 1 283 ? 176.05342 255.15444 94.77009  1.000 106.53908 ?  283 HIS B CD2   1 
ATOM   5532  C CE1   . HIS B 1 283 ? 176.39658 253.37821 93.53329  1.000 107.61176 ?  283 HIS B CE1   1 
ATOM   5533  N NE2   . HIS B 1 283 ? 175.56863 253.92334 94.40603  1.000 108.55940 ?  283 HIS B NE2   1 
ATOM   5534  N N     . SER B 1 284 ? 181.40931 257.46952 95.56972  1.000 96.33543  ?  284 SER B N     1 
ATOM   5535  C CA    . SER B 1 284 ? 182.25387 258.64671 95.47674  1.000 95.97155  ?  284 SER B CA    1 
ATOM   5536  C C     . SER B 1 284 ? 183.38334 258.34147 94.51807  1.000 91.20907  ?  284 SER B C     1 
ATOM   5537  O O     . SER B 1 284 ? 183.52207 257.22336 94.02826  1.000 87.67649  ?  284 SER B O     1 
ATOM   5538  C CB    . SER B 1 284 ? 182.81824 259.05234 96.82778  1.000 93.15870  ?  284 SER B CB    1 
ATOM   5539  O OG    . SER B 1 284 ? 183.51574 257.96364 97.37791  1.000 92.41150  ?  284 SER B OG    1 
ATOM   5540  N N     . TYR B 1 285 ? 184.14529 259.37372 94.17310  1.000 93.32321  ?  285 TYR B N     1 
ATOM   5541  C CA    . TYR B 1 285 ? 185.30558 259.12314 93.33694  1.000 94.16431  ?  285 TYR B CA    1 
ATOM   5542  C C     . TYR B 1 285 ? 186.31306 258.21352 94.03229  1.000 94.76956  ?  285 TYR B C     1 
ATOM   5543  O O     . TYR B 1 285 ? 187.20061 257.66178 93.37306  1.000 91.48443  ?  285 TYR B O     1 
ATOM   5544  C CB    . TYR B 1 285 ? 185.98548 260.42736 92.96048  1.000 98.79126  ?  285 TYR B CB    1 
ATOM   5545  C CG    . TYR B 1 285 ? 185.33067 261.16789 91.82946  1.000 104.94580 ?  285 TYR B CG    1 
ATOM   5546  C CD1   . TYR B 1 285 ? 185.25269 260.64143 90.53631  1.000 99.79741  ?  285 TYR B CD1   1 
ATOM   5547  C CD2   . TYR B 1 285 ? 184.81086 262.42268 92.05729  1.000 106.49140 ?  285 TYR B CD2   1 
ATOM   5548  C CE1   . TYR B 1 285 ? 184.65139 261.36664 89.51929  1.000 95.75300  ?  285 TYR B CE1   1 
ATOM   5549  C CE2   . TYR B 1 285 ? 184.22046 263.14344 91.06187  1.000 106.44534 ?  285 TYR B CE2   1 
ATOM   5550  C CZ    . TYR B 1 285 ? 184.13585 262.62888 89.80452  1.000 100.87587 ?  285 TYR B CZ    1 
ATOM   5551  O OH    . TYR B 1 285 ? 183.52509 263.44088 88.88693  1.000 98.20972  ?  285 TYR B OH    1 
ATOM   5552  N N     . PHE B 1 286 ? 186.22784 258.08446 95.35654  1.000 94.47206  ?  286 PHE B N     1 
ATOM   5553  C CA    . PHE B 1 286 ? 187.21132 257.29520 96.08110  1.000 90.72590  ?  286 PHE B CA    1 
ATOM   5554  C C     . PHE B 1 286 ? 187.25551 255.84576 95.60166  1.000 90.83999  ?  286 PHE B C     1 
ATOM   5555  O O     . PHE B 1 286 ? 188.33865 255.25000 95.53048  1.000 91.42710  ?  286 PHE B O     1 
ATOM   5556  C CB    . PHE B 1 286 ? 186.92211 257.33765 97.57097  1.000 89.48893  ?  286 PHE B CB    1 
ATOM   5557  C CG    . PHE B 1 286 ? 187.82521 256.46385 98.36923  1.000 89.71190  ?  286 PHE B CG    1 
ATOM   5558  C CD1   . PHE B 1 286 ? 189.08191 256.90534 98.73468  1.000 84.41170  ?  286 PHE B CD1   1 
ATOM   5559  C CD2   . PHE B 1 286 ? 187.44143 255.17435 98.69828  1.000 90.29202  ?  286 PHE B CD2   1 
ATOM   5560  C CE1   . PHE B 1 286 ? 189.91795 256.10067 99.45302  1.000 80.51834  ?  286 PHE B CE1   1 
ATOM   5561  C CE2   . PHE B 1 286 ? 188.27545 254.35901 99.41413  1.000 88.69925  ?  286 PHE B CE2   1 
ATOM   5562  C CZ    . PHE B 1 286 ? 189.52291 254.82258 99.79333  1.000 86.53350  ?  286 PHE B CZ    1 
ATOM   5563  N N     . ILE B 1 287 ? 186.09958 255.24739 95.28339  1.000 88.73367  ?  287 ILE B N     1 
ATOM   5564  C CA    . ILE B 1 287 ? 186.12152 253.82763 94.92006  1.000 86.64449  ?  287 ILE B CA    1 
ATOM   5565  C C     . ILE B 1 287 ? 187.01656 253.61150 93.71608  1.000 89.51193  ?  287 ILE B C     1 
ATOM   5566  O O     . ILE B 1 287 ? 187.61928 252.54101 93.56372  1.000 98.49468  ?  287 ILE B O     1 
ATOM   5567  C CB    . ILE B 1 287 ? 184.71442 253.26300 94.62847  1.000 87.75834  ?  287 ILE B CB    1 
ATOM   5568  C CG1   . ILE B 1 287 ? 183.91454 254.22356 93.74419  1.000 96.46172  ?  287 ILE B CG1   1 
ATOM   5569  C CG2   . ILE B 1 287 ? 183.97911 253.03857 95.92815  1.000 85.66059  ?  287 ILE B CG2   1 
ATOM   5570  C CD1   . ILE B 1 287 ? 182.43969 253.83437 93.43801  1.000 94.79626  ?  287 ILE B CD1   1 
ATOM   5571  N N     . HIS B 1 288 ? 187.10406 254.60305 92.83348  1.000 83.39462  ?  288 HIS B N     1 
ATOM   5572  C CA    . HIS B 1 288 ? 187.90460 254.49415 91.62461  1.000 84.37864  ?  288 HIS B CA    1 
ATOM   5573  C C     . HIS B 1 288 ? 189.06359 255.48185 91.59258  1.000 84.47566  ?  288 HIS B C     1 
ATOM   5574  O O     . HIS B 1 288 ? 189.53995 255.83425 90.50766  1.000 79.92001  ?  288 HIS B O     1 
ATOM   5575  C CB    . HIS B 1 288 ? 186.99790 254.69266 90.41269  1.000 86.75630  ?  288 HIS B CB    1 
ATOM   5576  C CG    . HIS B 1 288 ? 185.85136 253.73741 90.37475  1.000 86.03868  ?  288 HIS B CG    1 
ATOM   5577  N ND1   . HIS B 1 288 ? 184.55836 254.11574 90.66112  1.000 84.57257  ?  288 HIS B ND1   1 
ATOM   5578  C CD2   . HIS B 1 288 ? 185.80365 252.41893 90.08020  1.000 82.37151  ?  288 HIS B CD2   1 
ATOM   5579  C CE1   . HIS B 1 288 ? 183.76587 253.06427 90.56557  1.000 86.97139  ?  288 HIS B CE1   1 
ATOM   5580  N NE2   . HIS B 1 288 ? 184.49649 252.02429 90.20873  1.000 83.16599  ?  288 HIS B NE2   1 
ATOM   5581  N N     . PHE B 1 289 ? 189.53027 255.93295 92.75809  1.000 85.29770  ?  289 PHE B N     1 
ATOM   5582  C CA    . PHE B 1 289 ? 190.51610 257.00912 92.78406  1.000 85.52988  ?  289 PHE B CA    1 
ATOM   5583  C C     . PHE B 1 289 ? 191.82810 256.60848 92.11318  1.000 87.11167  ?  289 PHE B C     1 
ATOM   5584  O O     . PHE B 1 289 ? 192.45341 257.43611 91.44490  1.000 93.25127  ?  289 PHE B O     1 
ATOM   5585  C CB    . PHE B 1 289 ? 190.71073 257.52229 94.22241  1.000 81.05388  ?  289 PHE B CB    1 
ATOM   5586  C CG    . PHE B 1 289 ? 191.78176 256.82062 95.01916  1.000 79.63374  ?  289 PHE B CG    1 
ATOM   5587  C CD1   . PHE B 1 289 ? 191.48219 255.70441 95.78773  1.000 77.51506  ?  289 PHE B CD1   1 
ATOM   5588  C CD2   . PHE B 1 289 ? 193.08472 257.27978 95.00466  1.000 81.94655  ?  289 PHE B CD2   1 
ATOM   5589  C CE1   . PHE B 1 289 ? 192.47139 255.07320 96.51513  1.000 77.25111  ?  289 PHE B CE1   1 
ATOM   5590  C CE2   . PHE B 1 289 ? 194.08452 256.64937 95.72721  1.000 78.94340  ?  289 PHE B CE2   1 
ATOM   5591  C CZ    . PHE B 1 289 ? 193.77902 255.54683 96.48169  1.000 75.69560  ?  289 PHE B CZ    1 
ATOM   5592  N N     . ARG B 1 290 ? 192.27185 255.36255 92.28780  1.000 81.40963  ?  290 ARG B N     1 
ATOM   5593  C CA    . ARG B 1 290 ? 193.53871 254.94269 91.69245  1.000 82.41245  ?  290 ARG B CA    1 
ATOM   5594  C C     . ARG B 1 290 ? 193.46780 254.93552 90.17271  1.000 89.02548  ?  290 ARG B C     1 
ATOM   5595  O O     . ARG B 1 290 ? 194.45540 255.24112 89.48974  1.000 88.78085  ?  290 ARG B O     1 
ATOM   5596  C CB    . ARG B 1 290 ? 193.95573 253.58200 92.22275  1.000 89.19746  ?  290 ARG B CB    1 
ATOM   5597  C CG    . ARG B 1 290 ? 194.63979 253.66985 93.56190  1.000 92.22872  ?  290 ARG B CG    1 
ATOM   5598  C CD    . ARG B 1 290 ? 195.96992 254.42815 93.53047  1.000 93.28625  ?  290 ARG B CD    1 
ATOM   5599  N NE    . ARG B 1 290 ? 197.07219 253.71930 92.89116  1.000 94.48714  ?  290 ARG B NE    1 
ATOM   5600  C CZ    . ARG B 1 290 ? 197.58742 254.02266 91.70885  1.000 96.05001  ?  290 ARG B CZ    1 
ATOM   5601  N NH1   . ARG B 1 290 ? 197.12308 255.03077 90.98746  1.000 96.59939  ?  290 ARG B NH1   1 
ATOM   5602  N NH2   . ARG B 1 290 ? 198.60192 253.30122 91.24410  1.000 94.88775  ?  290 ARG B NH2   1 
ATOM   5603  N N     . SER B 1 291 ? 192.32831 254.51592 89.62503  1.000 90.49544  ?  291 SER B N     1 
ATOM   5604  C CA    . SER B 1 291 ? 192.17443 254.48939 88.18072  1.000 88.30803  ?  291 SER B CA    1 
ATOM   5605  C C     . SER B 1 291 ? 192.27559 255.90120 87.59055  1.000 91.30073  ?  291 SER B C     1 
ATOM   5606  O O     . SER B 1 291 ? 192.93446 256.09773 86.56254  1.000 96.26081  ?  291 SER B O     1 
ATOM   5607  C CB    . SER B 1 291 ? 190.86741 253.79689 87.83183  1.000 83.12251  ?  291 SER B CB    1 
ATOM   5608  O OG    . SER B 1 291 ? 189.81923 254.71661 87.97174  1.000 97.00938  ?  291 SER B OG    1 
ATOM   5609  N N     . LEU B 1 292 ? 191.60151 256.88872 88.19525  1.000 89.90274  ?  292 LEU B N     1 
ATOM   5610  C CA    . LEU B 1 292 ? 191.67117 258.28153 87.74731  1.000 93.35469  ?  292 LEU B CA    1 
ATOM   5611  C C     . LEU B 1 292 ? 193.02978 258.87947 88.12234  1.000 97.13689  ?  292 LEU B C     1 
ATOM   5612  O O     . LEU B 1 292 ? 193.82547 258.25052 88.82322  1.000 88.41159  ?  292 LEU B O     1 
ATOM   5613  C CB    . LEU B 1 292 ? 190.53449 259.08391 88.36443  1.000 91.72969  ?  292 LEU B CB    1 
ATOM   5614  C CG    . LEU B 1 292 ? 189.22798 258.28683 88.23286  1.000 89.67743  ?  292 LEU B CG    1 
ATOM   5615  C CD1   . LEU B 1 292 ? 188.10635 258.79144 89.11789  1.000 88.95999  ?  292 LEU B CD1   1 
ATOM   5616  C CD2   . LEU B 1 292 ? 188.77372 258.27397 86.80732  1.000 91.50090  ?  292 LEU B CD2   1 
ATOM   5617  N N     . GLY B 1 293 ? 193.29429 260.11407 87.67431  1.000 103.85551 ?  293 GLY B N     1 
ATOM   5618  C CA    . GLY B 1 293 ? 194.60862 260.72033 87.89108  1.000 109.04294 ?  293 GLY B CA    1 
ATOM   5619  C C     . GLY B 1 293 ? 194.96119 261.11518 89.31808  1.000 110.63234 ?  293 GLY B C     1 
ATOM   5620  O O     . GLY B 1 293 ? 196.13533 261.08413 89.70525  1.000 113.86681 ?  293 GLY B O     1 
ATOM   5621  N N     . LEU B 1 294 ? 193.96797 261.52330 90.10014  1.000 110.30205 ?  294 LEU B N     1 
ATOM   5622  C CA    . LEU B 1 294 ? 194.13523 262.08620 91.43932  1.000 106.91320 ?  294 LEU B CA    1 
ATOM   5623  C C     . LEU B 1 294 ? 194.88040 261.19867 92.44978  1.000 94.08423  ?  294 LEU B C     1 
ATOM   5624  O O     . LEU B 1 294 ? 195.49884 261.73928 93.38118  1.000 90.49026  ?  294 LEU B O     1 
ATOM   5625  C CB    . LEU B 1 294 ? 192.71564 262.48000 91.87713  1.000 101.47195 ?  294 LEU B CB    1 
ATOM   5626  C CG    . LEU B 1 294 ? 191.75588 261.29439 91.91634  1.000 87.91651  ?  294 LEU B CG    1 
ATOM   5627  C CD1   . LEU B 1 294 ? 191.80040 260.78669 93.28910  1.000 103.96122 ?  294 LEU B CD1   1 
ATOM   5628  C CD2   . LEU B 1 294 ? 190.31431 261.70907 91.59196  1.000 83.45441  ?  294 LEU B CD2   1 
ATOM   5629  N N     . SER B 1 295 ? 194.91443 259.88716 92.23964  1.000 98.14876  ?  295 SER B N     1 
ATOM   5630  C CA    . SER B 1 295 ? 195.43516 258.95501 93.24214  1.000 101.47256 ?  295 SER B CA    1 
ATOM   5631  C C     . SER B 1 295 ? 196.86101 259.25846 93.70737  1.000 98.99503  ?  295 SER B C     1 
ATOM   5632  O O     . SER B 1 295 ? 197.09413 259.49947 94.89892  1.000 97.76918  ?  295 SER B O     1 
ATOM   5633  C CB    . SER B 1 295 ? 195.36347 257.53678 92.68368  1.000 105.25643 ?  295 SER B CB    1 
ATOM   5634  O OG    . SER B 1 295 ? 195.93867 257.40202 91.37757  1.000 119.67345 ?  295 SER B OG    1 
ATOM   5635  N N     . GLY B 1 296 ? 197.81873 259.26505 92.78191  1.000 94.24326  ?  296 GLY B N     1 
ATOM   5636  C CA    . GLY B 1 296 ? 199.21809 259.10836 93.16569  1.000 98.31966  ?  296 GLY B CA    1 
ATOM   5637  C C     . GLY B 1 296 ? 199.45608 257.65286 93.54387  1.000 97.94870  ?  296 GLY B C     1 
ATOM   5638  O O     . GLY B 1 296 ? 198.92397 256.73405 92.91137  1.000 88.50920  ?  296 GLY B O     1 
ATOM   5639  N N     . LYS B 1 297 ? 200.26018 257.43032 94.58321  1.000 100.83924 ?  297 LYS B N     1 
ATOM   5640  C CA    . LYS B 1 297 ? 200.43274 256.10920 95.17312  1.000 91.52435  ?  297 LYS B CA    1 
ATOM   5641  C C     . LYS B 1 297 ? 199.36637 255.92155 96.23503  1.000 85.47434  ?  297 LYS B C     1 
ATOM   5642  O O     . LYS B 1 297 ? 199.04101 256.86903 96.94678  1.000 88.73155  ?  297 LYS B O     1 
ATOM   5643  C CB    . LYS B 1 297 ? 201.82904 255.95925 95.76678  1.000 93.06304  ?  297 LYS B CB    1 
ATOM   5644  C CG    . LYS B 1 297 ? 202.12256 254.56116 96.21401  1.000 98.40247  ?  297 LYS B CG    1 
ATOM   5645  C CD    . LYS B 1 297 ? 203.47347 254.55593 96.83786  1.000 108.48816 ?  297 LYS B CD    1 
ATOM   5646  C CE    . LYS B 1 297 ? 204.49668 255.16227 95.88650  1.000 116.41407 ?  297 LYS B CE    1 
ATOM   5647  N NZ    . LYS B 1 297 ? 204.59800 254.42111 94.58385  1.000 112.46804 ?  297 LYS B NZ    1 
ATOM   5648  N N     . SER B 1 298 ? 198.79497 254.73810 96.31896  1.000 83.68303  ?  298 SER B N     1 
ATOM   5649  C CA    . SER B 1 298 ? 197.66731 254.59517 97.25158  1.000 87.73921  ?  298 SER B CA    1 
ATOM   5650  C C     . SER B 1 298 ? 198.15956 254.33275 98.66816  1.000 89.14223  ?  298 SER B C     1 
ATOM   5651  O O     . SER B 1 298 ? 199.02995 253.47459 98.86421  1.000 92.59419  ?  298 SER B O     1 
ATOM   5652  C CB    . SER B 1 298 ? 196.73293 253.47516 96.85759  1.000 89.81668  ?  298 SER B CB    1 
ATOM   5653  O OG    . SER B 1 298 ? 195.74188 253.34100 97.86872  1.000 88.53081  ?  298 SER B OG    1 
ATOM   5654  N N     . PRO B 1 299 ? 197.65303 255.06918 99.66561  1.000 84.25967  ?  299 PRO B N     1 
ATOM   5655  C CA    . PRO B 1 299 ? 198.01991 254.79386 101.05450 1.000 87.67240  ?  299 PRO B CA    1 
ATOM   5656  C C     . PRO B 1 299 ? 197.22316 253.66025 101.68700 1.000 88.11505  ?  299 PRO B C     1 
ATOM   5657  O O     . PRO B 1 299 ? 197.56256 253.24452 102.80092 1.000 91.10567  ?  299 PRO B O     1 
ATOM   5658  C CB    . PRO B 1 299 ? 197.73600 256.12547 101.74198 1.000 93.55017  ?  299 PRO B CB    1 
ATOM   5659  C CG    . PRO B 1 299 ? 196.56842 256.64526 100.98784 1.000 88.17387  ?  299 PRO B CG    1 
ATOM   5660  C CD    . PRO B 1 299 ? 196.70326 256.18622 99.56879  1.000 85.36304  ?  299 PRO B CD    1 
ATOM   5661  N N     . TYR B 1 300 ? 196.21056 253.12799 100.99254 1.000 89.11225  ?  300 TYR B N     1 
ATOM   5662  C CA    . TYR B 1 300 ? 195.35867 252.04024 101.47359 1.000 88.72968  ?  300 TYR B CA    1 
ATOM   5663  C C     . TYR B 1 300 ? 195.77631 250.69237 100.89773 1.000 89.55357  ?  300 TYR B C     1 
ATOM   5664  O O     . TYR B 1 300 ? 195.10494 249.68352 101.14051 1.000 88.22837  ?  300 TYR B O     1 
ATOM   5665  C CB    . TYR B 1 300 ? 193.88314 252.31919 101.13243 1.000 88.11193  ?  300 TYR B CB    1 
ATOM   5666  C CG    . TYR B 1 300 ? 193.45476 253.75989 101.32351 1.000 89.28224  ?  300 TYR B CG    1 
ATOM   5667  C CD1   . TYR B 1 300 ? 193.19399 254.25362 102.59411 1.000 91.53389  ?  300 TYR B CD1   1 
ATOM   5668  C CD2   . TYR B 1 300 ? 193.35134 254.63726 100.25068 1.000 84.57355  ?  300 TYR B CD2   1 
ATOM   5669  C CE1   . TYR B 1 300 ? 192.80874 255.56180 102.79537 1.000 85.94677  ?  300 TYR B CE1   1 
ATOM   5670  C CE2   . TYR B 1 300 ? 192.97895 255.96416 100.45056 1.000 83.72088  ?  300 TYR B CE2   1 
ATOM   5671  C CZ    . TYR B 1 300 ? 192.70566 256.41007 101.73717 1.000 86.44166  ?  300 TYR B CZ    1 
ATOM   5672  O OH    . TYR B 1 300 ? 192.32716 257.69375 102.03872 1.000 93.40748  ?  300 TYR B OH    1 
ATOM   5673  N N     . SER B 1 301 ? 196.88852 250.65070 100.16543 1.000 90.73089  ?  301 SER B N     1 
ATOM   5674  C CA    . SER B 1 301 ? 197.37443 249.41208 99.57401  1.000 88.93345  ?  301 SER B CA    1 
ATOM   5675  C C     . SER B 1 301 ? 197.84736 248.45913 100.67071 1.000 80.15391  ?  301 SER B C     1 
ATOM   5676  O O     . SER B 1 301 ? 198.10752 248.86942 101.80132 1.000 80.97428  ?  301 SER B O     1 
ATOM   5677  C CB    . SER B 1 301 ? 198.49637 249.70514 98.58290  1.000 87.74801  ?  301 SER B CB    1 
ATOM   5678  O OG    . SER B 1 301 ? 199.65941 250.17814 99.22841  1.000 94.92934  ?  301 SER B OG    1 
ATOM   5679  N N     . SER B 1 302 ? 197.93749 247.16848 100.33705 1.000 79.47524  ?  302 SER B N     1 
ATOM   5680  C CA    . SER B 1 302 ? 198.30172 246.17962 101.35150 1.000 79.13439  ?  302 SER B CA    1 
ATOM   5681  C C     . SER B 1 302 ? 199.68696 246.43399 101.92068 1.000 81.33415  ?  302 SER B C     1 
ATOM   5682  O O     . SER B 1 302 ? 199.98473 245.99461 103.03720 1.000 89.38096  ?  302 SER B O     1 
ATOM   5683  C CB    . SER B 1 302 ? 198.22739 244.74746 100.81272 1.000 83.63658  ?  302 SER B CB    1 
ATOM   5684  O OG    . SER B 1 302 ? 199.08614 244.50363 99.70863  1.000 87.82360  ?  302 SER B OG    1 
ATOM   5685  N N     . ASN B 1 303 ? 200.59437 247.00743 101.12132 1.000 78.65321  ?  303 ASN B N     1 
ATOM   5686  C CA    . ASN B 1 303 ? 201.93538 247.28359 101.63659 1.000 78.16173  ?  303 ASN B CA    1 
ATOM   5687  C C     . ASN B 1 303 ? 201.92994 248.46497 102.60066 1.000 81.98252  ?  303 ASN B C     1 
ATOM   5688  O O     . ASN B 1 303 ? 202.65375 248.45319 103.59958 1.000 88.19022  ?  303 ASN B O     1 
ATOM   5689  C CB    . ASN B 1 303 ? 202.92713 247.48341 100.49504 1.000 83.43319  ?  303 ASN B CB    1 
ATOM   5690  C CG    . ASN B 1 303 ? 202.90130 246.32329 99.49760  1.000 100.00038 ?  303 ASN B CG    1 
ATOM   5691  O OD1   . ASN B 1 303 ? 201.86320 246.02543 98.89338  1.000 97.43431  ?  303 ASN B OD1   1 
ATOM   5692  N ND2   . ASN B 1 303 ? 204.02517 245.61088 99.38664  1.000 101.92300 ?  303 ASN B ND2   1 
ATOM   5693  N N     . ALA B 1 304 ? 201.13575 249.49806 102.31383 1.000 78.14543  ?  304 ALA B N     1 
ATOM   5694  C CA    . ALA B 1 304 ? 201.07628 250.65547 103.19216 1.000 77.80406  ?  304 ALA B CA    1 
ATOM   5695  C C     . ALA B 1 304 ? 200.48665 250.28901 104.55085 1.000 83.38512  ?  304 ALA B C     1 
ATOM   5696  O O     . ALA B 1 304 ? 200.81986 250.90814 105.56975 1.000 93.21396  ?  304 ALA B O     1 
ATOM   5697  C CB    . ALA B 1 304 ? 200.27652 251.77673 102.55611 1.000 76.43562  ?  304 ALA B CB    1 
ATOM   5698  N N     . VAL B 1 305 ? 199.58087 249.33231 104.58351 1.000 75.81203  ?  305 VAL B N     1 
ATOM   5699  C CA    . VAL B 1 305 ? 198.93138 248.99942 105.83340 1.000 74.65935  ?  305 VAL B CA    1 
ATOM   5700  C C     . VAL B 1 305 ? 199.37331 247.56923 106.15217 1.000 77.82051  ?  305 VAL B C     1 
ATOM   5701  O O     . VAL B 1 305 ? 198.55934 246.70729 106.48981 1.000 86.05489  ?  305 VAL B O     1 
ATOM   5702  C CB    . VAL B 1 305 ? 197.41277 249.21417 105.70130 1.000 75.16666  ?  305 VAL B CB    1 
ATOM   5703  C CG1   . VAL B 1 305 ? 196.65818 248.94754 106.98887 1.000 92.14553  ?  305 VAL B CG1   1 
ATOM   5704  C CG2   . VAL B 1 305 ? 197.15891 250.61750 105.26640 1.000 75.93340  ?  305 VAL B CG2   1 
ATOM   5705  N N     . GLY B 1 306 ? 200.68795 247.32982 106.01356 1.000 74.03099  ?  306 GLY B N     1 
ATOM   5706  C CA    . GLY B 1 306 ? 201.24339 245.97850 106.03445 1.000 75.88598  ?  306 GLY B CA    1 
ATOM   5707  C C     . GLY B 1 306 ? 201.01018 245.22128 107.32261 1.000 76.31053  ?  306 GLY B C     1 
ATOM   5708  O O     . GLY B 1 306 ? 200.58314 244.06532 107.30173 1.000 75.24567  ?  306 GLY B O     1 
ATOM   5709  N N     . HIS B 1 307 ? 201.28317 245.85731 108.45483 1.000 76.38580  ?  307 HIS B N     1 
ATOM   5710  C CA    . HIS B 1 307 ? 201.12600 245.18758 109.73912 1.000 77.69706  ?  307 HIS B CA    1 
ATOM   5711  C C     . HIS B 1 307 ? 199.67667 244.81864 110.00061 1.000 80.48678  ?  307 HIS B C     1 
ATOM   5712  O O     . HIS B 1 307 ? 199.38505 243.73462 110.52718 1.000 83.23616  ?  307 HIS B O     1 
ATOM   5713  C CB    . HIS B 1 307 ? 201.64498 246.08314 110.83734 1.000 79.49432  ?  307 HIS B CB    1 
ATOM   5714  C CG    . HIS B 1 307 ? 203.11444 246.30055 110.79726 1.000 81.21020  ?  307 HIS B CG    1 
ATOM   5715  N ND1   . HIS B 1 307 ? 203.67689 247.41821 110.22910 1.000 82.77914  ?  307 HIS B ND1   1 
ATOM   5716  C CD2   . HIS B 1 307 ? 204.13773 245.57791 111.31319 1.000 82.31084  ?  307 HIS B CD2   1 
ATOM   5717  C CE1   . HIS B 1 307 ? 204.98902 247.36138 110.36745 1.000 86.52987  ?  307 HIS B CE1   1 
ATOM   5718  N NE2   . HIS B 1 307 ? 205.29456 246.25960 111.03096 1.000 81.20617  ?  307 HIS B NE2   1 
ATOM   5719  N N     . VAL B 1 308 ? 198.76666 245.75591 109.71592 1.000 76.65675  ?  308 VAL B N     1 
ATOM   5720  C CA    . VAL B 1 308 ? 197.33817 245.51188 109.84416 1.000 75.64640  ?  308 VAL B CA    1 
ATOM   5721  C C     . VAL B 1 308 ? 196.90796 244.42383 108.89491 1.000 76.06881  ?  308 VAL B C     1 
ATOM   5722  O O     . VAL B 1 308 ? 196.11139 243.53623 109.24709 1.000 78.15003  ?  308 VAL B O     1 
ATOM   5723  C CB    . VAL B 1 308 ? 196.56486 246.80638 109.56270 1.000 74.86467  ?  308 VAL B CB    1 
ATOM   5724  C CG1   . VAL B 1 308 ? 195.05378 246.54339 109.44676 1.000 76.64451  ?  308 VAL B CG1   1 
ATOM   5725  C CG2   . VAL B 1 308 ? 196.82659 247.76918 110.65127 1.000 86.83600  ?  308 VAL B CG2   1 
ATOM   5726  N N     . PHE B 1 309 ? 197.41215 244.48814 107.66971 1.000 77.45764  ?  309 PHE B N     1 
ATOM   5727  C CA    . PHE B 1 309 ? 197.04043 243.49136 106.69026 1.000 78.93763  ?  309 PHE B CA    1 
ATOM   5728  C C     . PHE B 1 309 ? 197.46671 242.12413 107.19172 1.000 77.02385  ?  309 PHE B C     1 
ATOM   5729  O O     . PHE B 1 309 ? 196.62239 241.24432 107.41005 1.000 83.96466  ?  309 PHE B O     1 
ATOM   5730  C CB    . PHE B 1 309 ? 197.67104 243.88463 105.35451 1.000 76.29284  ?  309 PHE B CB    1 
ATOM   5731  C CG    . PHE B 1 309 ? 197.39069 242.97100 104.22735 1.000 73.88704  ?  309 PHE B CG    1 
ATOM   5732  C CD1   . PHE B 1 309 ? 196.22989 243.11777 103.50150 1.000 79.23760  ?  309 PHE B CD1   1 
ATOM   5733  C CD2   . PHE B 1 309 ? 198.33065 242.07918 103.80171 1.000 73.70524  ?  309 PHE B CD2   1 
ATOM   5734  C CE1   . PHE B 1 309 ? 195.95815 242.32635 102.41629 1.000 81.23538  ?  309 PHE B CE1   1 
ATOM   5735  C CE2   . PHE B 1 309 ? 198.08316 241.28002 102.70489 1.000 85.17780  ?  309 PHE B CE2   1 
ATOM   5736  C CZ    . PHE B 1 309 ? 196.88747 241.40323 102.00276 1.000 87.57824  ?  309 PHE B CZ    1 
ATOM   5737  N N     . ASN B 1 310 ? 198.72501 242.01904 107.62935 1.000 74.09321  ?  310 ASN B N     1 
ATOM   5738  C CA    . ASN B 1 310 ? 199.20512 240.72189 108.08415 1.000 76.32389  ?  310 ASN B CA    1 
ATOM   5739  C C     . ASN B 1 310 ? 198.38143 240.22232 109.27044 1.000 81.18454  ?  310 ASN B C     1 
ATOM   5740  O O     . ASN B 1 310 ? 197.90980 239.08009 109.26087 1.000 81.84080  ?  310 ASN B O     1 
ATOM   5741  C CB    . ASN B 1 310 ? 200.69209 240.78257 108.43373 1.000 75.84256  ?  310 ASN B CB    1 
ATOM   5742  C CG    . ASN B 1 310 ? 201.54835 241.03166 107.23124 1.000 73.75183  ?  310 ASN B CG    1 
ATOM   5743  O OD1   . ASN B 1 310 ? 201.06059 241.07032 106.11920 1.000 85.67138  ?  310 ASN B OD1   1 
ATOM   5744  N ND2   . ASN B 1 310 ? 202.84447 241.10938 107.43478 1.000 77.67495  ?  310 ASN B ND2   1 
ATOM   5745  N N     . LEU B 1 311 ? 198.10284 241.09108 110.25034 1.000 79.84449  ?  311 LEU B N     1 
ATOM   5746  C CA    . LEU B 1 311 ? 197.29817 240.66077 111.38299 1.000 74.57489  ?  311 LEU B CA    1 
ATOM   5747  C C     . LEU B 1 311 ? 195.92997 240.20691 110.90509 1.000 75.73742  ?  311 LEU B C     1 
ATOM   5748  O O     . LEU B 1 311 ? 195.41725 239.18002 111.35823 1.000 80.71787  ?  311 LEU B O     1 
ATOM   5749  C CB    . LEU B 1 311 ? 197.15203 241.78067 112.40068 1.000 74.75975  ?  311 LEU B CB    1 
ATOM   5750  C CG    . LEU B 1 311 ? 196.24698 241.46872 113.59238 1.000 79.29997  ?  311 LEU B CG    1 
ATOM   5751  C CD1   . LEU B 1 311 ? 196.89276 240.45220 114.51858 1.000 75.43934  ?  311 LEU B CD1   1 
ATOM   5752  C CD2   . LEU B 1 311 ? 195.89212 242.70180 114.36519 1.000 83.50344  ?  311 LEU B CD2   1 
ATOM   5753  N N     . ILE B 1 312 ? 195.33097 240.92659 109.95574 1.000 74.60575  ?  312 ILE B N     1 
ATOM   5754  C CA    . ILE B 1 312 ? 193.99350 240.53388 109.53533 1.000 74.67383  ?  312 ILE B CA    1 
ATOM   5755  C C     . ILE B 1 312 ? 193.98492 239.11544 108.98574 1.000 74.72243  ?  312 ILE B C     1 
ATOM   5756  O O     . ILE B 1 312 ? 193.11883 238.30783 109.33762 1.000 83.09975  ?  312 ILE B O     1 
ATOM   5757  C CB    . ILE B 1 312 ? 193.41300 241.52082 108.52556 1.000 74.67428  ?  312 ILE B CB    1 
ATOM   5758  C CG1   . ILE B 1 312 ? 193.04507 242.79676 109.24691 1.000 74.86092  ?  312 ILE B CG1   1 
ATOM   5759  C CG2   . ILE B 1 312 ? 192.17389 240.91797 107.95758 1.000 82.84640  ?  312 ILE B CG2   1 
ATOM   5760  C CD1   . ILE B 1 312 ? 192.84327 243.91949 108.35201 1.000 74.84960  ?  312 ILE B CD1   1 
ATOM   5761  N N     . HIS B 1 313 ? 194.92379 238.78888 108.09799 1.000 76.22827  ?  313 HIS B N     1 
ATOM   5762  C CA    . HIS B 1 313 ? 194.86732 237.46755 107.46189 1.000 85.14456  ?  313 HIS B CA    1 
ATOM   5763  C C     . HIS B 1 313 ? 195.38097 236.34401 108.36301 1.000 81.25836  ?  313 HIS B C     1 
ATOM   5764  O O     . HIS B 1 313 ? 194.92876 235.19622 108.22966 1.000 81.25307  ?  313 HIS B O     1 
ATOM   5765  C CB    . HIS B 1 313 ? 195.57936 237.54917 106.12452 1.000 75.92941  ?  313 HIS B CB    1 
ATOM   5766  C CG    . HIS B 1 313 ? 194.89249 238.49853 105.20498 1.000 74.02050  ?  313 HIS B CG    1 
ATOM   5767  N ND1   . HIS B 1 313 ? 193.52313 238.51958 105.06089 1.000 74.15455  ?  313 HIS B ND1   1 
ATOM   5768  C CD2   . HIS B 1 313 ? 195.35793 239.57305 104.52701 1.000 76.07217  ?  313 HIS B CD2   1 
ATOM   5769  C CE1   . HIS B 1 313 ? 193.18546 239.51152 104.25508 1.000 75.93631  ?  313 HIS B CE1   1 
ATOM   5770  N NE2   . HIS B 1 313 ? 194.28090 240.16564 103.91445 1.000 74.04416  ?  313 HIS B NE2   1 
ATOM   5771  N N     . PHE B 1 314 ? 196.32845 236.63781 109.25790 1.000 76.40064  ?  314 PHE B N     1 
ATOM   5772  C CA    . PHE B 1 314 ? 196.73030 235.63235 110.23678 1.000 75.37869  ?  314 PHE B CA    1 
ATOM   5773  C C     . PHE B 1 314 ? 195.55473 235.25376 111.11059 1.000 77.40084  ?  314 PHE B C     1 
ATOM   5774  O O     . PHE B 1 314 ? 195.37582 234.07876 111.44499 1.000 81.70093  ?  314 PHE B O     1 
ATOM   5775  C CB    . PHE B 1 314 ? 197.89511 236.13375 111.08719 1.000 82.65037  ?  314 PHE B CB    1 
ATOM   5776  C CG    . PHE B 1 314 ? 199.23871 235.95061 110.44337 1.000 75.89981  ?  314 PHE B CG    1 
ATOM   5777  C CD1   . PHE B 1 314 ? 199.68135 234.69600 110.05973 1.000 75.72832  ?  314 PHE B CD1   1 
ATOM   5778  C CD2   . PHE B 1 314 ? 200.02173 237.04663 110.15191 1.000 77.25319  ?  314 PHE B CD2   1 
ATOM   5779  C CE1   . PHE B 1 314 ? 200.91334 234.54342 109.44751 1.000 75.08671  ?  314 PHE B CE1   1 
ATOM   5780  C CE2   . PHE B 1 314 ? 201.23794 236.90536 109.53514 1.000 73.84670  ?  314 PHE B CE2   1 
ATOM   5781  C CZ    . PHE B 1 314 ? 201.68843 235.65183 109.18155 1.000 73.72828  ?  314 PHE B CZ    1 
ATOM   5782  N N     . VAL B 1 315 ? 194.72834 236.23022 111.47362 1.000 74.72148  ?  315 VAL B N     1 
ATOM   5783  C CA    . VAL B 1 315 ? 193.51190 235.89408 112.18824 1.000 74.82463  ?  315 VAL B CA    1 
ATOM   5784  C C     . VAL B 1 315 ? 192.63854 235.01304 111.32039 1.000 82.72376  ?  315 VAL B C     1 
ATOM   5785  O O     . VAL B 1 315 ? 192.11502 233.98711 111.77685 1.000 84.46564  ?  315 VAL B O     1 
ATOM   5786  C CB    . VAL B 1 315 ? 192.76913 237.16966 112.60638 1.000 74.98890  ?  315 VAL B CB    1 
ATOM   5787  C CG1   . VAL B 1 315 ? 191.43282 236.81981 113.14844 1.000 76.31643  ?  315 VAL B CG1   1 
ATOM   5788  C CG2   . VAL B 1 315 ? 193.54500 237.88539 113.65030 1.000 84.95056  ?  315 VAL B CG2   1 
ATOM   5789  N N     . GLY B 1 316 ? 192.52872 235.35762 110.03276 1.000 79.98583  ?  316 GLY B N     1 
ATOM   5790  C CA    . GLY B 1 316 ? 191.71383 234.56281 109.12926 1.000 80.26833  ?  316 GLY B CA    1 
ATOM   5791  C C     . GLY B 1 316 ? 192.18785 233.12967 109.00052 1.000 75.75648  ?  316 GLY B C     1 
ATOM   5792  O O     . GLY B 1 316 ? 191.38246 232.19855 109.06476 1.000 79.44045  ?  316 GLY B O     1 
ATOM   5793  N N     . CYS B 1 317 ? 193.49770 232.92436 108.87542 1.000 74.35842  ?  317 CYS B N     1 
ATOM   5794  C CA    . CYS B 1 317 ? 193.97578 231.55347 108.81914 1.000 74.27658  ?  317 CYS B CA    1 
ATOM   5795  C C     . CYS B 1 317 ? 193.60360 230.81670 110.09428 1.000 75.04470  ?  317 CYS B C     1 
ATOM   5796  O O     . CYS B 1 317 ? 193.16801 229.66367 110.04349 1.000 80.65687  ?  317 CYS B O     1 
ATOM   5797  C CB    . CYS B 1 317 ? 195.48180 231.49307 108.57361 1.000 74.08149  ?  317 CYS B CB    1 
ATOM   5798  S SG    . CYS B 1 317 ? 196.05745 232.33016 107.07243 1.000 78.39809  ?  317 CYS B SG    1 
ATOM   5799  N N     . TYR B 1 318 ? 193.70837 231.47029 111.25130 1.000 74.58233  ?  318 TYR B N     1 
ATOM   5800  C CA    . TYR B 1 318 ? 193.27902 230.78071 112.46270 1.000 74.74660  ?  318 TYR B CA    1 
ATOM   5801  C C     . TYR B 1 318 ? 191.81898 230.39118 112.35541 1.000 76.32015  ?  318 TYR B C     1 
ATOM   5802  O O     . TYR B 1 318 ? 191.43873 229.29860 112.78105 1.000 79.92373  ?  318 TYR B O     1 
ATOM   5803  C CB    . TYR B 1 318 ? 193.58507 231.63809 113.68618 1.000 79.21540  ?  318 TYR B CB    1 
ATOM   5804  C CG    . TYR B 1 318 ? 193.64763 230.94180 115.04480 1.000 76.75200  ?  318 TYR B CG    1 
ATOM   5805  C CD1   . TYR B 1 318 ? 192.48892 230.63705 115.75690 1.000 81.80017  ?  318 TYR B CD1   1 
ATOM   5806  C CD2   . TYR B 1 318 ? 194.86465 230.56653 115.59748 1.000 78.66141  ?  318 TYR B CD2   1 
ATOM   5807  C CE1   . TYR B 1 318 ? 192.55299 230.02985 116.99106 1.000 85.92261  ?  318 TYR B CE1   1 
ATOM   5808  C CE2   . TYR B 1 318 ? 194.93522 229.93202 116.83563 1.000 80.46375  ?  318 TYR B CE2   1 
ATOM   5809  C CZ    . TYR B 1 318 ? 193.77648 229.67036 117.52131 1.000 84.51385  ?  318 TYR B CZ    1 
ATOM   5810  O OH    . TYR B 1 318 ? 193.83691 229.04773 118.74088 1.000 82.12676  ?  318 TYR B OH    1 
ATOM   5811  N N     . MET B 1 319 ? 191.01457 231.20284 111.68240 1.000 76.61681  ?  319 MET B N     1 
ATOM   5812  C CA    . MET B 1 319 ? 189.60303 230.88065 111.50822 1.000 84.30612  ?  319 MET B CA    1 
ATOM   5813  C C     . MET B 1 319 ? 189.30084 230.08330 110.23175 1.000 82.27745  ?  319 MET B C     1 
ATOM   5814  O O     . MET B 1 319 ? 188.12446 229.88226 109.89503 1.000 84.54505  ?  319 MET B O     1 
ATOM   5815  C CB    . MET B 1 319 ? 188.79519 232.16511 111.57268 1.000 77.12102  ?  319 MET B CB    1 
ATOM   5816  C CG    . MET B 1 319 ? 189.02574 232.81493 112.91199 1.000 80.07856  ?  319 MET B CG    1 
ATOM   5817  S SD    . MET B 1 319 ? 188.00442 234.22891 113.09787 1.000 90.82405  ?  319 MET B SD    1 
ATOM   5818  C CE    . MET B 1 319 ? 188.29279 235.02401 111.49024 1.000 91.81678  ?  319 MET B CE    1 
ATOM   5819  N N     . GLY B 1 320 ? 190.32626 229.67646 109.49198 1.000 80.89084  ?  320 GLY B N     1 
ATOM   5820  C CA    . GLY B 1 320 ? 190.14880 228.82494 108.32793 1.000 79.84073  ?  320 GLY B CA    1 
ATOM   5821  C C     . GLY B 1 320 ? 189.64973 229.51457 107.08879 1.000 77.95761  ?  320 GLY B C     1 
ATOM   5822  O O     . GLY B 1 320 ? 189.08513 228.84640 106.22251 1.000 81.51221  ?  320 GLY B O     1 
ATOM   5823  N N     . GLN B 1 321 ? 189.80273 230.83476 106.99544 1.000 81.17612  ?  321 GLN B N     1 
ATOM   5824  C CA    . GLN B 1 321 ? 189.32351 231.59491 105.84374 1.000 89.16292  ?  321 GLN B CA    1 
ATOM   5825  C C     . GLN B 1 321 ? 190.21738 231.37841 104.63864 1.000 84.57978  ?  321 GLN B C     1 
ATOM   5826  O O     . GLN B 1 321 ? 191.40299 231.72303 104.67071 1.000 80.68508  ?  321 GLN B O     1 
ATOM   5827  C CB    . GLN B 1 321 ? 189.26365 233.08450 106.15983 1.000 91.31406  ?  321 GLN B CB    1 
ATOM   5828  C CG    . GLN B 1 321 ? 188.21897 233.37690 107.19304 1.000 95.77046  ?  321 GLN B CG    1 
ATOM   5829  C CD    . GLN B 1 321 ? 186.83639 233.02757 106.70497 1.000 103.32635 ?  321 GLN B CD    1 
ATOM   5830  O OE1   . GLN B 1 321 ? 186.29372 231.98451 107.07401 1.000 104.16519 ?  321 GLN B OE1   1 
ATOM   5831  N NE2   . GLN B 1 321 ? 186.23906 233.90554 105.90186 1.000 109.42426 ?  321 GLN B NE2   1 
ATOM   5832  N N     . VAL B 1 322 ? 189.62905 230.89913 103.54667 1.000 82.02954  ?  322 VAL B N     1 
ATOM   5833  C CA    . VAL B 1 322 ? 190.44927 230.55900 102.39707 1.000 77.40111  ?  322 VAL B CA    1 
ATOM   5834  C C     . VAL B 1 322 ? 191.11880 231.80036 101.82461 1.000 75.76777  ?  322 VAL B C     1 
ATOM   5835  O O     . VAL B 1 322 ? 192.33030 231.80229 101.58400 1.000 77.36385  ?  322 VAL B O     1 
ATOM   5836  C CB    . VAL B 1 322 ? 189.59433 229.83249 101.35382 1.000 82.89863  ?  322 VAL B CB    1 
ATOM   5837  C CG1   . VAL B 1 322 ? 190.49313 229.08662 100.38826 1.000 88.53040  ?  322 VAL B CG1   1 
ATOM   5838  C CG2   . VAL B 1 322 ? 188.61840 228.91263 102.06844 1.000 84.83989  ?  322 VAL B CG2   1 
ATOM   5839  N N     . ARG B 1 323 ? 190.38253 232.91374 101.74587 1.000 73.95710  ?  323 ARG B N     1 
ATOM   5840  C CA    . ARG B 1 323 ? 190.93239 234.13295 101.15761 1.000 76.13676  ?  323 ARG B CA    1 
ATOM   5841  C C     . ARG B 1 323 ? 192.22585 234.53624 101.85216 1.000 79.54098  ?  323 ARG B C     1 
ATOM   5842  O O     . ARG B 1 323 ? 193.17709 234.99500 101.21128 1.000 81.98880  ?  323 ARG B O     1 
ATOM   5843  C CB    . ARG B 1 323 ? 189.93454 235.26205 101.29980 1.000 74.75794  ?  323 ARG B CB    1 
ATOM   5844  C CG    . ARG B 1 323 ? 190.37913 236.57635 100.74815 1.000 75.22313  ?  323 ARG B CG    1 
ATOM   5845  C CD    . ARG B 1 323 ? 190.80043 237.51848 101.79836 1.000 81.60631  ?  323 ARG B CD    1 
ATOM   5846  N NE    . ARG B 1 323 ? 190.97290 238.85086 101.24633 1.000 82.54050  ?  323 ARG B NE    1 
ATOM   5847  C CZ    . ARG B 1 323 ? 192.03964 239.25320 100.57833 1.000 86.00635  ?  323 ARG B CZ    1 
ATOM   5848  N NH1   . ARG B 1 323 ? 192.98732 238.40155 100.21648 1.000 81.41802  ?  323 ARG B NH1   1 
ATOM   5849  N NH2   . ARG B 1 323 ? 192.16427 240.54247 100.27966 1.000 97.31846  ?  323 ARG B NH2   1 
ATOM   5850  N N     . SER B 1 324 ? 192.24984 234.44465 103.18053 1.000 81.06858  ?  324 SER B N     1 
ATOM   5851  C CA    . SER B 1 324 ? 193.46881 234.78432 103.89667 1.000 79.21543  ?  324 SER B CA    1 
ATOM   5852  C C     . SER B 1 324 ? 194.57846 233.76965 103.63310 1.000 76.59986  ?  324 SER B C     1 
ATOM   5853  O O     . SER B 1 324 ? 195.73148 234.16406 103.43699 1.000 81.84719  ?  324 SER B O     1 
ATOM   5854  C CB    . SER B 1 324 ? 193.15717 234.96439 105.36751 1.000 77.83043  ?  324 SER B CB    1 
ATOM   5855  O OG    . SER B 1 324 ? 192.14821 235.94741 105.44334 1.000 74.21691  ?  324 SER B OG    1 
ATOM   5856  N N     . LEU B 1 325 ? 194.24651 232.47758 103.53095 1.000 73.70327  ?  325 LEU B N     1 
ATOM   5857  C CA    . LEU B 1 325 ? 195.27661 231.47798 103.26752 1.000 73.55554  ?  325 LEU B CA    1 
ATOM   5858  C C     . LEU B 1 325 ? 196.04044 231.79235 101.98891 1.000 83.60543  ?  325 LEU B C     1 
ATOM   5859  O O     . LEU B 1 325 ? 197.25562 231.57421 101.91863 1.000 85.83702  ?  325 LEU B O     1 
ATOM   5860  C CB    . LEU B 1 325 ? 194.65468 230.09689 103.17145 1.000 73.57923  ?  325 LEU B CB    1 
ATOM   5861  C CG    . LEU B 1 325 ? 194.49512 229.23940 104.40992 1.000 73.69719  ?  325 LEU B CG    1 
ATOM   5862  C CD1   . LEU B 1 325 ? 195.83635 228.86981 104.87453 1.000 73.59805  ?  325 LEU B CD1   1 
ATOM   5863  C CD2   . LEU B 1 325 ? 193.81262 229.98476 105.47357 1.000 87.79584  ?  325 LEU B CD2   1 
ATOM   5864  N N     . ASN B 1 326 ? 195.34855 232.32170 100.97015 1.000 87.24836  ?  326 ASN B N     1 
ATOM   5865  C CA    . ASN B 1 326 ? 195.94141 232.61972 99.66284  1.000 85.09579  ?  326 ASN B CA    1 
ATOM   5866  C C     . ASN B 1 326 ? 196.45062 234.04258 99.52091  1.000 84.72594  ?  326 ASN B C     1 
ATOM   5867  O O     . ASN B 1 326 ? 196.92020 234.40667 98.43778  1.000 90.09717  ?  326 ASN B O     1 
ATOM   5868  C CB    . ASN B 1 326 ? 194.93789 232.41300 98.54101  1.000 86.93866  ?  326 ASN B CB    1 
ATOM   5869  C CG    . ASN B 1 326 ? 194.38124 231.05066 98.52657  1.000 90.60347  ?  326 ASN B CG    1 
ATOM   5870  O OD1   . ASN B 1 326 ? 195.08503 230.07067 98.79552  1.000 91.25415  ?  326 ASN B OD1   1 
ATOM   5871  N ND2   . ASN B 1 326 ? 193.08813 230.96075 98.22846  1.000 91.78214  ?  326 ASN B ND2   1 
ATOM   5872  N N     . ALA B 1 327 ? 196.22893 234.90623 100.49776 1.000 81.31201  ?  327 ALA B N     1 
ATOM   5873  C CA    . ALA B 1 327 ? 196.77749 236.24116 100.34965 1.000 84.17735  ?  327 ALA B CA    1 
ATOM   5874  C C     . ALA B 1 327 ? 198.27772 236.17010 100.55564 1.000 85.45485  ?  327 ALA B C     1 
ATOM   5875  O O     . ALA B 1 327 ? 198.77884 235.31086 101.29002 1.000 84.60449  ?  327 ALA B O     1 
ATOM   5876  C CB    . ALA B 1 327 ? 196.14115 237.21208 101.33119 1.000 85.44346  ?  327 ALA B CB    1 
ATOM   5877  N N     . THR B 1 328 ? 198.99852 237.07529 99.89350  1.000 83.28683  ?  328 THR B N     1 
ATOM   5878  C CA    . THR B 1 328 ? 200.45325 237.10872 99.98434  1.000 82.68838  ?  328 THR B CA    1 
ATOM   5879  C C     . THR B 1 328 ? 200.87187 237.96338 101.17912 1.000 87.80696  ?  328 THR B C     1 
ATOM   5880  O O     . THR B 1 328 ? 200.47621 239.12826 101.28259 1.000 87.86110  ?  328 THR B O     1 
ATOM   5881  C CB    . THR B 1 328 ? 201.05316 237.69652 98.71675  1.000 81.94738  ?  328 THR B CB    1 
ATOM   5882  O OG1   . THR B 1 328 ? 200.71083 239.07738 98.69045  1.000 94.14999  ?  328 THR B OG1   1 
ATOM   5883  C CG2   . THR B 1 328 ? 200.46534 237.05099 97.48101  1.000 87.86901  ?  328 THR B CG2   1 
ATOM   5884  N N     . VAL B 1 329 ? 201.67599 237.38382 102.07148 1.000 84.91265  ?  329 VAL B N     1 
ATOM   5885  C CA    . VAL B 1 329 ? 202.12205 238.07105 103.27773 1.000 76.12690  ?  329 VAL B CA    1 
ATOM   5886  C C     . VAL B 1 329 ? 203.16085 239.13475 102.94355 1.000 79.18906  ?  329 VAL B C     1 
ATOM   5887  O O     . VAL B 1 329 ? 204.04325 238.91346 102.10843 1.000 89.51688  ?  329 VAL B O     1 
ATOM   5888  C CB    . VAL B 1 329 ? 202.66957 237.02003 104.25353 1.000 75.05843  ?  329 VAL B CB    1 
ATOM   5889  C CG1   . VAL B 1 329 ? 203.69511 236.18667 103.56519 1.000 84.21837  ?  329 VAL B CG1   1 
ATOM   5890  C CG2   . VAL B 1 329 ? 203.36295 237.69428 105.40570 1.000 82.57028  ?  329 VAL B CG2   1 
ATOM   5891  N N     . ILE B 1 330 ? 203.09997 240.27833 103.63111 1.000 74.90562  ?  330 ILE B N     1 
ATOM   5892  C CA    . ILE B 1 330 ? 204.08457 241.34658 103.45398 1.000 75.11248  ?  330 ILE B CA    1 
ATOM   5893  C C     . ILE B 1 330 ? 205.27621 241.04589 104.35598 1.000 77.99862  ?  330 ILE B C     1 
ATOM   5894  O O     . ILE B 1 330 ? 205.17041 241.14032 105.57880 1.000 85.01141  ?  330 ILE B O     1 
ATOM   5895  C CB    . ILE B 1 330 ? 203.50315 242.73599 103.74874 1.000 78.75632  ?  330 ILE B CB    1 
ATOM   5896  C CG1   . ILE B 1 330 ? 202.11617 242.91383 103.13624 1.000 75.04364  ?  330 ILE B CG1   1 
ATOM   5897  C CG2   . ILE B 1 330 ? 204.42291 243.80495 103.17413 1.000 83.22790  ?  330 ILE B CG2   1 
ATOM   5898  C CD1   . ILE B 1 330 ? 202.12954 242.97617 101.64626 1.000 82.03167  ?  330 ILE B CD1   1 
ATOM   5899  N N     . ALA B 1 331 ? 206.40168 240.64062 103.75403 1.000 75.09303  ?  331 ALA B N     1 
ATOM   5900  C CA    . ALA B 1 331 ? 207.54350 240.17860 104.54415 1.000 83.48295  ?  331 ALA B CA    1 
ATOM   5901  C C     . ALA B 1 331 ? 208.16807 241.29624 105.36262 1.000 91.19918  ?  331 ALA B C     1 
ATOM   5902  O O     . ALA B 1 331 ? 208.65250 241.05746 106.47933 1.000 87.79592  ?  331 ALA B O     1 
ATOM   5903  C CB    . ALA B 1 331 ? 208.59693 239.56342 103.63611 1.000 91.81372  ?  331 ALA B CB    1 
ATOM   5904  N N     . ALA B 1 332 ? 208.17412 242.51858 104.82199 1.000 92.48201  ?  332 ALA B N     1 
ATOM   5905  C CA    . ALA B 1 332 ? 208.81988 243.62485 105.51811 1.000 91.99865  ?  332 ALA B CA    1 
ATOM   5906  C C     . ALA B 1 332 ? 208.13227 243.89035 106.84210 1.000 85.55102  ?  332 ALA B C     1 
ATOM   5907  O O     . ALA B 1 332 ? 208.79281 244.20992 107.83415 1.000 80.82232  ?  332 ALA B O     1 
ATOM   5908  C CB    . ALA B 1 332 ? 208.79780 244.88596 104.65325 1.000 88.48063  ?  332 ALA B CB    1 
ATOM   5909  N N     . CYS B 1 333 ? 206.81060 243.76030 106.87386 1.000 81.36550  ?  333 CYS B N     1 
ATOM   5910  C CA    . CYS B 1 333 ? 206.04708 244.15394 108.04110 1.000 79.04443  ?  333 CYS B CA    1 
ATOM   5911  C C     . CYS B 1 333 ? 205.87619 243.00021 109.04605 1.000 79.77871  ?  333 CYS B C     1 
ATOM   5912  O O     . CYS B 1 333 ? 204.80397 242.45607 109.28313 1.000 80.83164  ?  333 CYS B O     1 
ATOM   5913  C CB    . CYS B 1 333 ? 204.75107 244.80719 107.58880 1.000 78.55043  ?  333 CYS B CB    1 
ATOM   5914  S SG    . CYS B 1 333 ? 205.14969 246.38509 106.71340 1.000 78.46399  ?  333 CYS B SG    1 
ATOM   5915  N N     . ALA B 1 334 ? 207.00733 242.62674 109.62493 1.000 77.96098  ?  334 ALA B N     1 
ATOM   5916  C CA    . ALA B 1 334 ? 207.09008 241.85967 110.85639 1.000 78.57908  ?  334 ALA B CA    1 
ATOM   5917  C C     . ALA B 1 334 ? 206.01925 240.80546 110.95495 1.000 80.73756  ?  334 ALA B C     1 
ATOM   5918  O O     . ALA B 1 334 ? 205.14725 240.89435 111.82365 1.000 83.32017  ?  334 ALA B O     1 
ATOM   5919  C CB    . ALA B 1 334 ? 206.95717 242.81943 112.03901 1.000 92.36559  ?  334 ALA B CB    1 
ATOM   5920  N N     . PRO B 1 335 ? 206.01353 239.83027 110.05894 1.000 87.65024  ?  335 PRO B N     1 
ATOM   5921  C CA    . PRO B 1 335 ? 204.92781 238.85474 110.06868 1.000 85.65558  ?  335 PRO B CA    1 
ATOM   5922  C C     . PRO B 1 335 ? 204.90879 238.01801 111.31645 1.000 91.62944  ?  335 PRO B C     1 
ATOM   5923  O O     . PRO B 1 335 ? 203.82238 237.72002 111.82071 1.000 92.91949  ?  335 PRO B O     1 
ATOM   5924  C CB    . PRO B 1 335 ? 205.20719 238.00431 108.82767 1.000 75.83110  ?  335 PRO B CB    1 
ATOM   5925  C CG    . PRO B 1 335 ? 206.08248 238.86996 107.97610 1.000 85.93050  ?  335 PRO B CG    1 
ATOM   5926  C CD    . PRO B 1 335 ? 206.91746 239.65346 108.91649 1.000 90.21574  ?  335 PRO B CD    1 
ATOM   5927  N N     . HIS B 1 336 ? 206.06733 237.67146 111.87322 1.000 92.83306  ?  336 HIS B N     1 
ATOM   5928  C CA    . HIS B 1 336 ? 206.04156 236.77381 113.02057 1.000 91.67723  ?  336 HIS B CA    1 
ATOM   5929  C C     . HIS B 1 336 ? 205.31842 237.41583 114.17872 1.000 91.84648  ?  336 HIS B C     1 
ATOM   5930  O O     . HIS B 1 336 ? 204.40845 236.80675 114.75362 1.000 94.73734  ?  336 HIS B O     1 
ATOM   5931  C CB    . HIS B 1 336 ? 207.44771 236.39792 113.44742 1.000 93.93533  ?  336 HIS B CB    1 
ATOM   5932  C CG    . HIS B 1 336 ? 208.27125 235.86381 112.33029 1.000 97.54250  ?  336 HIS B CG    1 
ATOM   5933  N ND1   . HIS B 1 336 ? 208.29670 234.52483 111.99375 1.000 93.18232  ?  336 HIS B ND1   1 
ATOM   5934  C CD2   . HIS B 1 336 ? 209.01473 236.50705 111.39911 1.000 96.46374  ?  336 HIS B CD2   1 
ATOM   5935  C CE1   . HIS B 1 336 ? 209.08014 234.36057 110.94262 1.000 96.28014  ?  336 HIS B CE1   1 
ATOM   5936  N NE2   . HIS B 1 336 ? 209.52343 235.54780 110.56058 1.000 98.26646  ?  336 HIS B NE2   1 
ATOM   5937  N N     . GLU B 1 337 ? 205.66423 238.66623 114.51024 1.000 90.19600  ?  337 GLU B N     1 
ATOM   5938  C CA    . GLU B 1 337 ? 204.99479 239.27119 115.65531 1.000 90.89530  ?  337 GLU B CA    1 
ATOM   5939  C C     . GLU B 1 337 ? 203.49470 239.38373 115.39455 1.000 88.96874  ?  337 GLU B C     1 
ATOM   5940  O O     . GLU B 1 337 ? 202.69273 238.90347 116.20721 1.000 90.21723  ?  337 GLU B O     1 
ATOM   5941  C CB    . GLU B 1 337 ? 205.65083 240.61837 116.02907 1.000 90.66211  ?  337 GLU B CB    1 
ATOM   5942  C CG    . GLU B 1 337 ? 207.05901 240.45731 116.70465 1.000 94.47624  ?  337 GLU B CG    1 
ATOM   5943  C CD    . GLU B 1 337 ? 207.40811 241.54932 117.73734 1.000 101.30880 ?  337 GLU B CD    1 
ATOM   5944  O OE1   . GLU B 1 337 ? 206.57079 242.43521 117.99864 1.000 101.37174 ?  337 GLU B OE1   1 
ATOM   5945  O OE2   . GLU B 1 337 ? 208.50644 241.48662 118.33364 1.000 102.21822 ?  337 GLU B OE2   1 
ATOM   5946  N N     . MET B 1 338 ? 203.11010 239.82246 114.18943 1.000 83.28407  ?  338 MET B N     1 
ATOM   5947  C CA    . MET B 1 338 ? 201.69594 239.88928 113.84309 1.000 77.98276  ?  338 MET B CA    1 
ATOM   5948  C C     . MET B 1 338 ? 201.04174 238.52771 113.96754 1.000 83.59309  ?  338 MET B C     1 
ATOM   5949  O O     . MET B 1 338 ? 199.89273 238.41994 114.40978 1.000 90.28696  ?  338 MET B O     1 
ATOM   5950  C CB    . MET B 1 338 ? 201.52413 240.40690 112.42220 1.000 82.63547  ?  338 MET B CB    1 
ATOM   5951  C CG    . MET B 1 338 ? 202.07134 241.79391 112.15731 1.000 88.29785  ?  338 MET B CG    1 
ATOM   5952  S SD    . MET B 1 338 ? 201.63672 242.91877 113.51880 1.000 83.71325  ?  338 MET B SD    1 
ATOM   5953  C CE    . MET B 1 338 ? 203.21299 243.72506 113.88260 1.000 86.56548  ?  338 MET B CE    1 
ATOM   5954  N N     . SER B 1 339 ? 201.76803 237.46875 113.61036 1.000 83.13816  ?  339 SER B N     1 
ATOM   5955  C CA    . SER B 1 339 ? 201.20582 236.13218 113.73836 1.000 81.61596  ?  339 SER B CA    1 
ATOM   5956  C C     . SER B 1 339 ? 200.92201 235.78698 115.19474 1.000 81.26323  ?  339 SER B C     1 
ATOM   5957  O O     . SER B 1 339 ? 199.90416 235.15183 115.48770 1.000 81.77071  ?  339 SER B O     1 
ATOM   5958  C CB    . SER B 1 339 ? 202.13106 235.10662 113.07935 1.000 82.06748  ?  339 SER B CB    1 
ATOM   5959  O OG    . SER B 1 339 ? 203.08541 234.57280 113.97480 1.000 87.25012  ?  339 SER B OG    1 
ATOM   5960  N N     . VAL B 1 340 ? 201.77711 236.21810 116.12727 1.000 76.95775  ?  340 VAL B N     1 
ATOM   5961  C CA    . VAL B 1 340 ? 201.54072 235.90285 117.53825 1.000 80.07152  ?  340 VAL B CA    1 
ATOM   5962  C C     . VAL B 1 340 ? 200.27355 236.59122 118.05114 1.000 83.59081  ?  340 VAL B C     1 
ATOM   5963  O O     . VAL B 1 340 ? 199.42462 235.96044 118.70050 1.000 83.77810  ?  340 VAL B O     1 
ATOM   5964  C CB    . VAL B 1 340 ? 202.77429 236.25726 118.37879 1.000 81.92967  ?  340 VAL B CB    1 
ATOM   5965  C CG1   . VAL B 1 340 ? 202.56718 235.88416 119.85754 1.000 84.32993  ?  340 VAL B CG1   1 
ATOM   5966  C CG2   . VAL B 1 340 ? 203.96588 235.57444 117.78530 1.000 82.16678  ?  340 VAL B CG2   1 
ATOM   5967  N N     . LEU B 1 341 ? 200.13622 237.89872 117.78288 1.000 79.74444  ?  341 LEU B N     1 
ATOM   5968  C CA    . LEU B 1 341 ? 198.91246 238.61183 118.14328 1.000 77.00633  ?  341 LEU B CA    1 
ATOM   5969  C C     . LEU B 1 341 ? 197.70520 238.00814 117.45281 1.000 82.86402  ?  341 LEU B C     1 
ATOM   5970  O O     . LEU B 1 341 ? 196.60842 237.93878 118.02647 1.000 79.39484  ?  341 LEU B O     1 
ATOM   5971  C CB    . LEU B 1 341 ? 199.00863 240.07182 117.73508 1.000 76.62236  ?  341 LEU B CB    1 
ATOM   5972  C CG    . LEU B 1 341 ? 197.87136 240.95408 118.21647 1.000 75.33189  ?  341 LEU B CG    1 
ATOM   5973  C CD1   . LEU B 1 341 ? 197.89483 241.00528 119.69191 1.000 80.65982  ?  341 LEU B CD1   1 
ATOM   5974  C CD2   . LEU B 1 341 ? 197.94502 242.35749 117.61289 1.000 77.90376  ?  341 LEU B CD2   1 
ATOM   5975  N N     . GLY B 1 342 ? 197.88545 237.60790 116.19165 1.000 87.56069  ?  342 GLY B N     1 
ATOM   5976  C CA    . GLY B 1 342 ? 196.79042 237.02009 115.44875 1.000 82.91215  ?  342 GLY B CA    1 
ATOM   5977  C C     . GLY B 1 342 ? 196.33845 235.71131 116.04745 1.000 83.91371  ?  342 GLY B C     1 
ATOM   5978  O O     . GLY B 1 342 ? 195.14466 235.39104 116.04450 1.000 88.79467  ?  342 GLY B O     1 
ATOM   5979  N N     . GLY B 1 343 ? 197.28316 234.94528 116.58185 1.000 82.74666  ?  343 GLY B N     1 
ATOM   5980  C CA    . GLY B 1 343 ? 196.91342 233.71141 117.23730 1.000 81.65999  ?  343 GLY B CA    1 
ATOM   5981  C C     . GLY B 1 343 ? 196.01463 233.94906 118.42655 1.000 79.23130  ?  343 GLY B C     1 
ATOM   5982  O O     . GLY B 1 343 ? 194.98256 233.29188 118.57172 1.000 82.18724  ?  343 GLY B O     1 
ATOM   5983  N N     . TYR B 1 344 ? 196.36845 234.92814 119.26665 1.000 78.63622  ?  344 TYR B N     1 
ATOM   5984  C CA    . TYR B 1 344 ? 195.52805 235.22383 120.42168 1.000 84.08865  ?  344 TYR B CA    1 
ATOM   5985  C C     . TYR B 1 344 ? 194.17085 235.74597 119.98170 1.000 84.70925  ?  344 TYR B C     1 
ATOM   5986  O O     . TYR B 1 344 ? 193.12946 235.26235 120.44922 1.000 87.09472  ?  344 TYR B O     1 
ATOM   5987  C CB    . TYR B 1 344 ? 196.21212 236.23530 121.34623 1.000 83.76989  ?  344 TYR B CB    1 
ATOM   5988  C CG    . TYR B 1 344 ? 197.17389 235.57764 122.27670 1.000 86.67810  ?  344 TYR B CG    1 
ATOM   5989  C CD1   . TYR B 1 344 ? 196.74230 235.03109 123.47426 1.000 93.18605  ?  344 TYR B CD1   1 
ATOM   5990  C CD2   . TYR B 1 344 ? 198.51444 235.47246 121.95389 1.000 88.69663  ?  344 TYR B CD2   1 
ATOM   5991  C CE1   . TYR B 1 344 ? 197.61929 234.38193 124.32101 1.000 93.45697  ?  344 TYR B CE1   1 
ATOM   5992  C CE2   . TYR B 1 344 ? 199.40305 234.83432 122.79707 1.000 93.64353  ?  344 TYR B CE2   1 
ATOM   5993  C CZ    . TYR B 1 344 ? 198.94850 234.29225 123.97283 1.000 90.90022  ?  344 TYR B CZ    1 
ATOM   5994  O OH    . TYR B 1 344 ? 199.83470 233.66339 124.79150 1.000 88.82316  ?  344 TYR B OH    1 
ATOM   5995  N N     . LEU B 1 345 ? 194.16837 236.69790 119.04454 1.000 80.39926  ?  345 LEU B N     1 
ATOM   5996  C CA    . LEU B 1 345 ? 192.91811 237.27895 118.57405 1.000 79.86594  ?  345 LEU B CA    1 
ATOM   5997  C C     . LEU B 1 345 ? 192.07373 236.22572 117.87535 1.000 85.46969  ?  345 LEU B C     1 
ATOM   5998  O O     . LEU B 1 345 ? 190.86806 236.11259 118.13644 1.000 87.78797  ?  345 LEU B O     1 
ATOM   5999  C CB    . LEU B 1 345 ? 193.23118 238.45647 117.65205 1.000 75.61050  ?  345 LEU B CB    1 
ATOM   6000  C CG    . LEU B 1 345 ? 193.10271 239.87149 118.18418 1.000 75.74720  ?  345 LEU B CG    1 
ATOM   6001  C CD1   . LEU B 1 345 ? 193.94594 239.96521 119.38029 1.000 75.81591  ?  345 LEU B CD1   1 
ATOM   6002  C CD2   . LEU B 1 345 ? 193.73567 240.77197 117.17562 1.000 75.61010  ?  345 LEU B CD2   1 
ATOM   6003  N N     . GLY B 1 346 ? 192.70854 235.40893 117.02677 1.000 83.42151  ?  346 GLY B N     1 
ATOM   6004  C CA    . GLY B 1 346 ? 191.98404 234.34306 116.36579 1.000 80.71265  ?  346 GLY B CA    1 
ATOM   6005  C C     . GLY B 1 346 ? 191.40222 233.36490 117.35818 1.000 82.97966  ?  346 GLY B C     1 
ATOM   6006  O O     . GLY B 1 346 ? 190.28423 232.88003 117.18277 1.000 93.72543  ?  346 GLY B O     1 
ATOM   6007  N N     . GLU B 1 347 ? 192.13393 233.09266 118.43203 1.000 79.07322  ?  347 GLU B N     1 
ATOM   6008  C CA    . GLU B 1 347 ? 191.58698 232.24923 119.47943 1.000 81.54574  ?  347 GLU B CA    1 
ATOM   6009  C C     . GLU B 1 347 ? 190.30670 232.85879 120.02317 1.000 85.00787  ?  347 GLU B C     1 
ATOM   6010  O O     . GLU B 1 347 ? 189.28729 232.17003 120.14417 1.000 87.87860  ?  347 GLU B O     1 
ATOM   6011  C CB    . GLU B 1 347 ? 192.60766 232.08448 120.59898 1.000 85.72592  ?  347 GLU B CB    1 
ATOM   6012  C CG    . GLU B 1 347 ? 192.16104 231.23719 121.74086 1.000 89.28974  ?  347 GLU B CG    1 
ATOM   6013  C CD    . GLU B 1 347 ? 193.06827 231.39265 122.94350 1.000 98.83276  ?  347 GLU B CD    1 
ATOM   6014  O OE1   . GLU B 1 347 ? 193.73027 232.45214 123.04591 1.000 93.31034  ?  347 GLU B OE1   1 
ATOM   6015  O OE2   . GLU B 1 347 ? 193.12951 230.45277 123.76968 1.000 109.00787 ?  347 GLU B OE2   1 
ATOM   6016  N N     . GLU B 1 348 ? 190.31839 234.17874 120.28561 1.000 83.36794  ?  348 GLU B N     1 
ATOM   6017  C CA    . GLU B 1 348 ? 189.14506 234.82294 120.88286 1.000 84.57162  ?  348 GLU B CA    1 
ATOM   6018  C C     . GLU B 1 348 ? 187.94605 234.78600 119.95175 1.000 81.57689  ?  348 GLU B C     1 
ATOM   6019  O O     . GLU B 1 348 ? 186.80979 234.60583 120.40136 1.000 87.43387  ?  348 GLU B O     1 
ATOM   6020  C CB    . GLU B 1 348 ? 189.44398 236.26781 121.30153 1.000 85.50626  ?  348 GLU B CB    1 
ATOM   6021  C CG    . GLU B 1 348 ? 188.20386 237.05920 121.83048 1.000 90.45060  ?  348 GLU B CG    1 
ATOM   6022  C CD    . GLU B 1 348 ? 187.52771 236.45793 123.08874 1.000 97.20807  ?  348 GLU B CD    1 
ATOM   6023  O OE1   . GLU B 1 348 ? 188.22509 236.10978 124.06796 1.000 96.48231  ?  348 GLU B OE1   1 
ATOM   6024  O OE2   . GLU B 1 348 ? 186.27679 236.33835 123.08999 1.000 98.47926  ?  348 GLU B OE2   1 
ATOM   6025  N N     . PHE B 1 349 ? 188.15958 234.97952 118.66440 1.000 80.01638  ?  349 PHE B N     1 
ATOM   6026  C CA    . PHE B 1 349 ? 187.01754 235.07680 117.76977 1.000 87.86419  ?  349 PHE B CA    1 
ATOM   6027  C C     . PHE B 1 349 ? 186.63863 233.75178 117.09693 1.000 94.22343  ?  349 PHE B C     1 
ATOM   6028  O O     . PHE B 1 349 ? 185.59535 233.68146 116.43032 1.000 100.15395 ?  349 PHE B O     1 
ATOM   6029  C CB    . PHE B 1 349 ? 187.27415 236.17372 116.73061 1.000 82.65975  ?  349 PHE B CB    1 
ATOM   6030  C CG    . PHE B 1 349 ? 187.37094 237.52172 117.31824 1.000 76.17072  ?  349 PHE B CG    1 
ATOM   6031  C CD1   . PHE B 1 349 ? 186.24557 238.09518 117.86709 1.000 81.89419  ?  349 PHE B CD1   1 
ATOM   6032  C CD2   . PHE B 1 349 ? 188.54499 238.23795 117.29371 1.000 76.04754  ?  349 PHE B CD2   1 
ATOM   6033  C CE1   . PHE B 1 349 ? 186.28712 239.35440 118.43791 1.000 89.51767  ?  349 PHE B CE1   1 
ATOM   6034  C CE2   . PHE B 1 349 ? 188.59559 239.51293 117.84585 1.000 85.00200  ?  349 PHE B CE2   1 
ATOM   6035  C CZ    . PHE B 1 349 ? 187.46210 240.07215 118.42115 1.000 86.38412  ?  349 PHE B CZ    1 
ATOM   6036  N N     . PHE B 1 350 ? 187.42586 232.69625 117.26714 1.000 91.68111  ?  350 PHE B N     1 
ATOM   6037  C CA    . PHE B 1 350 ? 187.16071 231.43621 116.58206 1.000 91.89940  ?  350 PHE B CA    1 
ATOM   6038  C C     . PHE B 1 350 ? 186.31187 230.55380 117.49443 1.000 94.55467  ?  350 PHE B C     1 
ATOM   6039  O O     . PHE B 1 350 ? 186.72874 230.22243 118.61409 1.000 90.88618  ?  350 PHE B O     1 
ATOM   6040  C CB    . PHE B 1 350 ? 188.47738 230.74627 116.22293 1.000 89.89550  ?  350 PHE B CB    1 
ATOM   6041  C CG    . PHE B 1 350 ? 188.33336 229.34013 115.70415 1.000 89.50282  ?  350 PHE B CG    1 
ATOM   6042  C CD1   . PHE B 1 350 ? 187.86527 229.08018 114.42351 1.000 88.13444  ?  350 PHE B CD1   1 
ATOM   6043  C CD2   . PHE B 1 350 ? 188.61833 228.27386 116.53159 1.000 91.12416  ?  350 PHE B CD2   1 
ATOM   6044  C CE1   . PHE B 1 350 ? 187.75401 227.77362 113.96822 1.000 88.20883  ?  350 PHE B CE1   1 
ATOM   6045  C CE2   . PHE B 1 350 ? 188.48827 226.98767 116.09196 1.000 88.54772  ?  350 PHE B CE2   1 
ATOM   6046  C CZ    . PHE B 1 350 ? 188.05012 226.73271 114.81330 1.000 83.61218  ?  350 PHE B CZ    1 
ATOM   6047  N N     . GLY B 1 351 ? 185.12906 230.16843 117.01225 1.000 95.62670  ?  351 GLY B N     1 
ATOM   6048  C CA    . GLY B 1 351 ? 184.25961 229.28648 117.76038 1.000 95.36198  ?  351 GLY B CA    1 
ATOM   6049  C C     . GLY B 1 351 ? 183.49591 229.94377 118.88562 1.000 90.92733  ?  351 GLY B C     1 
ATOM   6050  O O     . GLY B 1 351 ? 182.84275 229.23697 119.66243 1.000 86.48110  ?  351 GLY B O     1 
ATOM   6051  N N     . LYS B 1 352 ? 183.52259 231.27211 118.98125 1.000 86.95613  ?  352 LYS B N     1 
ATOM   6052  C CA    . LYS B 1 352 ? 182.89224 231.98450 120.08276 1.000 89.25571  ?  352 LYS B CA    1 
ATOM   6053  C C     . LYS B 1 352 ? 182.04469 233.11828 119.53399 1.000 91.45010  ?  352 LYS B C     1 
ATOM   6054  O O     . LYS B 1 352 ? 182.40063 233.74724 118.52924 1.000 86.59360  ?  352 LYS B O     1 
ATOM   6055  C CB    . LYS B 1 352 ? 183.95796 232.54239 121.06292 1.000 94.37217  ?  352 LYS B CB    1 
ATOM   6056  C CG    . LYS B 1 352 ? 183.46704 233.16045 122.38907 1.000 86.85330  ?  352 LYS B CG    1 
ATOM   6057  C CD    . LYS B 1 352 ? 184.67481 233.60716 123.26243 1.000 94.00838  ?  352 LYS B CD    1 
ATOM   6058  C CE    . LYS B 1 352 ? 184.24111 234.31695 124.55943 1.000 111.33385 ?  352 LYS B CE    1 
ATOM   6059  N NZ    . LYS B 1 352 ? 185.34768 234.90903 125.38078 1.000 106.19988 ?  352 LYS B NZ    1 
ATOM   6060  N N     . GLY B 1 353 ? 180.92400 233.37217 120.19088 1.000 96.56498  ?  353 GLY B N     1 
ATOM   6061  C CA    . GLY B 1 353 ? 180.07892 234.48468 119.81277 1.000 96.51075  ?  353 GLY B CA    1 
ATOM   6062  C C     . GLY B 1 353 ? 179.52527 235.15715 121.04841 1.000 100.75646 ?  353 GLY B C     1 
ATOM   6063  O O     . GLY B 1 353 ? 179.34878 234.53645 122.10187 1.000 98.98973  ?  353 GLY B O     1 
ATOM   6064  N N     . THR B 1 354 ? 179.24540 236.44382 120.90061 1.000 99.25343  ?  354 THR B N     1 
ATOM   6065  C CA    . THR B 1 354 ? 178.63013 237.24971 121.94113 1.000 93.49821  ?  354 THR B CA    1 
ATOM   6066  C C     . THR B 1 354 ? 177.13144 237.26633 121.63789 1.000 92.95976  ?  354 THR B C     1 
ATOM   6067  O O     . THR B 1 354 ? 176.70499 237.81626 120.61524 1.000 94.48294  ?  354 THR B O     1 
ATOM   6068  C CB    . THR B 1 354 ? 179.25276 238.64440 121.94905 1.000 96.33775  ?  354 THR B CB    1 
ATOM   6069  O OG1   . THR B 1 354 ? 179.31055 239.15131 120.61412 1.000 108.55226 ?  354 THR B OG1   1 
ATOM   6070  C CG2   . THR B 1 354 ? 180.67554 238.56168 122.45053 1.000 90.65640  ?  354 THR B CG2   1 
ATOM   6071  N N     . PHE B 1 355 ? 176.34618 236.57283 122.45585 1.000 89.64308  ?  355 PHE B N     1 
ATOM   6072  C CA    . PHE B 1 355 ? 174.92513 236.41533 122.19118 1.000 90.29038  ?  355 PHE B CA    1 
ATOM   6073  C C     . PHE B 1 355 ? 174.13080 237.06131 123.30934 1.000 89.57334  ?  355 PHE B C     1 
ATOM   6074  O O     . PHE B 1 355 ? 174.46301 236.90128 124.48699 1.000 88.33812  ?  355 PHE B O     1 
ATOM   6075  C CB    . PHE B 1 355 ? 174.55346 234.95437 122.06838 1.000 84.07668  ?  355 PHE B CB    1 
ATOM   6076  C CG    . PHE B 1 355 ? 175.36367 234.26273 121.08354 1.000 83.47521  ?  355 PHE B CG    1 
ATOM   6077  C CD1   . PHE B 1 355 ? 175.26223 234.60242 119.76061 1.000 82.71320  ?  355 PHE B CD1   1 
ATOM   6078  C CD2   . PHE B 1 355 ? 176.27361 233.30584 121.47006 1.000 89.71578  ?  355 PHE B CD2   1 
ATOM   6079  C CE1   . PHE B 1 355 ? 176.02836 233.99278 118.83109 1.000 85.16144  ?  355 PHE B CE1   1 
ATOM   6080  C CE2   . PHE B 1 355 ? 177.04755 232.68235 120.53369 1.000 87.69396  ?  355 PHE B CE2   1 
ATOM   6081  C CZ    . PHE B 1 355 ? 176.92074 233.02798 119.20993 1.000 83.51833  ?  355 PHE B CZ    1 
ATOM   6082  N N     . GLU B 1 356 ? 173.07069 237.76989 122.93415 1.000 91.83382  ?  356 GLU B N     1 
ATOM   6083  C CA    . GLU B 1 356 ? 172.17603 238.41302 123.88408 1.000 95.20551  ?  356 GLU B CA    1 
ATOM   6084  C C     . GLU B 1 356 ? 170.74594 238.23785 123.40831 1.000 99.65320  ?  356 GLU B C     1 
ATOM   6085  O O     . GLU B 1 356 ? 170.47276 238.32298 122.20714 1.000 104.18999 ?  356 GLU B O     1 
ATOM   6086  C CB    . GLU B 1 356 ? 172.41512 239.91423 124.00536 1.000 98.66460  ?  356 GLU B CB    1 
ATOM   6087  C CG    . GLU B 1 356 ? 172.45637 240.60750 122.65593 1.000 103.69790 ?  356 GLU B CG    1 
ATOM   6088  C CD    . GLU B 1 356 ? 172.39653 242.10625 122.79070 1.000 107.55128 ?  356 GLU B CD    1 
ATOM   6089  O OE1   . GLU B 1 356 ? 172.30069 242.58737 123.93597 1.000 98.52699  ?  356 GLU B OE1   1 
ATOM   6090  O OE2   . GLU B 1 356 ? 172.45780 242.80402 121.75952 1.000 117.22819 ?  356 GLU B OE2   1 
ATOM   6091  N N     . ARG B 1 357 ? 169.82599 238.06175 124.35280 1.000 101.83460 ?  357 ARG B N     1 
ATOM   6092  C CA    . ARG B 1 357 ? 168.41927 237.93972 123.99497 1.000 103.75365 ?  357 ARG B CA    1 
ATOM   6093  C C     . ARG B 1 357 ? 167.88592 239.26981 123.46753 1.000 104.58909 ?  357 ARG B C     1 
ATOM   6094  O O     . ARG B 1 357 ? 168.11256 240.33402 124.05134 1.000 105.43674 ?  357 ARG B O     1 
ATOM   6095  C CB    . ARG B 1 357 ? 167.59409 237.45843 125.18449 1.000 103.09385 ?  357 ARG B CB    1 
ATOM   6096  C CG    . ARG B 1 357 ? 167.85409 236.01179 125.57332 1.000 101.84301 ?  357 ARG B CG    1 
ATOM   6097  C CD    . ARG B 1 357 ? 166.71769 235.46341 126.42612 1.000 107.90411 ?  357 ARG B CD    1 
ATOM   6098  N NE    . ARG B 1 357 ? 165.45349 235.50119 125.69632 1.000 116.78589 ?  357 ARG B NE    1 
ATOM   6099  C CZ    . ARG B 1 357 ? 164.26512 235.24609 126.22817 1.000 119.09514 ?  357 ARG B CZ    1 
ATOM   6100  N NH1   . ARG B 1 357 ? 164.13355 234.93571 127.50725 1.000 115.52781 ?  357 ARG B NH1   1 
ATOM   6101  N NH2   . ARG B 1 357 ? 163.18237 235.31869 125.45851 1.000 115.97443 ?  357 ARG B NH2   1 
ATOM   6102  N N     . ARG B 1 358 ? 167.26143 239.21810 122.30385 1.000 100.28227 ?  358 ARG B N     1 
ATOM   6103  C CA    . ARG B 1 358 ? 166.69771 240.39609 121.69923 1.000 101.82963 ?  358 ARG B CA    1 
ATOM   6104  C C     . ARG B 1 358 ? 165.22777 240.24413 121.36249 1.000 103.60495 ?  358 ARG B C     1 
ATOM   6105  O O     . ARG B 1 358 ? 164.60332 241.22949 120.96212 1.000 108.98109 ?  358 ARG B O     1 
ATOM   6106  C CB    . ARG B 1 358 ? 167.50016 240.75360 120.45229 1.000 99.69933  ?  358 ARG B CB    1 
ATOM   6107  C CG    . ARG B 1 358 ? 168.77117 241.47634 120.78040 1.000 100.65456 ?  358 ARG B CG    1 
ATOM   6108  C CD    . ARG B 1 358 ? 168.44248 242.79055 121.38522 1.000 108.17550 ?  358 ARG B CD    1 
ATOM   6109  N NE    . ARG B 1 358 ? 169.62120 243.63494 121.38445 1.000 117.96236 ?  358 ARG B NE    1 
ATOM   6110  C CZ    . ARG B 1 358 ? 169.62333 244.90154 121.76725 1.000 117.74996 ?  358 ARG B CZ    1 
ATOM   6111  N NH1   . ARG B 1 358 ? 168.51927 245.49530 122.18346 1.000 117.12859 ?  358 ARG B NH1   1 
ATOM   6112  N NH2   . ARG B 1 358 ? 170.75456 245.59769 121.70253 1.000 114.77828 ?  358 ARG B NH2   1 
ATOM   6113  N N     . PHE B 1 359 ? 164.69168 239.02861 121.42102 1.000 101.64618 ?  359 PHE B N     1 
ATOM   6114  C CA    . PHE B 1 359 ? 163.30719 238.72324 121.08283 1.000 106.14145 ?  359 PHE B CA    1 
ATOM   6115  C C     . PHE B 1 359 ? 162.58886 238.06586 122.25121 1.000 113.93628 ?  359 PHE B C     1 
ATOM   6116  O O     . PHE B 1 359 ? 163.08103 237.06625 122.79310 1.000 118.54124 ?  359 PHE B O     1 
ATOM   6117  C CB    . PHE B 1 359 ? 163.25832 237.80725 119.87618 1.000 105.12858 ?  359 PHE B CB    1 
ATOM   6118  C CG    . PHE B 1 359 ? 163.84815 238.40460 118.66745 1.000 107.24154 ?  359 PHE B CG    1 
ATOM   6119  C CD1   . PHE B 1 359 ? 163.13818 239.34865 117.95278 1.000 114.01737 ?  359 PHE B CD1   1 
ATOM   6120  C CD2   . PHE B 1 359 ? 165.10378 238.03295 118.23109 1.000 104.95386 ?  359 PHE B CD2   1 
ATOM   6121  C CE1   . PHE B 1 359 ? 163.66459 239.92146 116.82588 1.000 114.88959 ?  359 PHE B CE1   1 
ATOM   6122  C CE2   . PHE B 1 359 ? 165.64164 238.60298 117.09413 1.000 104.03991 ?  359 PHE B CE2   1 
ATOM   6123  C CZ    . PHE B 1 359 ? 164.92052 239.54783 116.39077 1.000 105.58676 ?  359 PHE B CZ    1 
ATOM   6124  N N     . PHE B 1 360 ? 161.39536 238.57924 122.58571 1.000 117.09693 ?  360 PHE B N     1 
ATOM   6125  C CA    . PHE B 1 360 ? 160.61827 238.11359 123.74016 1.000 122.78528 ?  360 PHE B CA    1 
ATOM   6126  C C     . PHE B 1 360 ? 159.14297 237.95046 123.36604 1.000 124.79592 ?  360 PHE B C     1 
ATOM   6127  O O     . PHE B 1 360 ? 158.63290 238.59409 122.44137 1.000 123.66874 ?  360 PHE B O     1 
ATOM   6128  C CB    . PHE B 1 360 ? 160.75344 239.06358 124.93712 1.000 114.50124 ?  360 PHE B CB    1 
ATOM   6129  C CG    . PHE B 1 360 ? 162.16881 239.40031 125.26540 1.000 112.40544 ?  360 PHE B CG    1 
ATOM   6130  C CD1   . PHE B 1 360 ? 162.91944 238.58271 126.09747 1.000 110.49796 ?  360 PHE B CD1   1 
ATOM   6131  C CD2   . PHE B 1 360 ? 162.75437 240.52501 124.72206 1.000 106.68169 ?  360 PHE B CD2   1 
ATOM   6132  C CE1   . PHE B 1 360 ? 164.22922 238.90165 126.38312 1.000 113.06874 ?  360 PHE B CE1   1 
ATOM   6133  C CE2   . PHE B 1 360 ? 164.05031 240.84658 124.99345 1.000 110.11595 ?  360 PHE B CE2   1 
ATOM   6134  C CZ    . PHE B 1 360 ? 164.79406 240.04028 125.82645 1.000 115.08641 ?  360 PHE B CZ    1 
ATOM   6135  N N     . ARG B 1 361 ? 158.44574 237.08247 124.11903 1.000 120.16572 ?  361 ARG B N     1 
ATOM   6136  C CA    . ARG B 1 361 ? 157.05017 236.77741 123.79062 1.000 116.24403 ?  361 ARG B CA    1 
ATOM   6137  C C     . ARG B 1 361 ? 156.14567 237.98830 124.00320 1.000 114.95310 ?  361 ARG B C     1 
ATOM   6138  O O     . ARG B 1 361 ? 155.24055 238.22998 123.19336 1.000 112.71728 ?  361 ARG B O     1 
ATOM   6139  C CB    . ARG B 1 361 ? 156.53589 235.56677 124.58241 1.000 111.09158 ?  361 ARG B CB    1 
ATOM   6140  C CG    . ARG B 1 361 ? 157.28715 234.25990 124.33467 1.000 108.13448 ?  361 ARG B CG    1 
ATOM   6141  C CD    . ARG B 1 361 ? 156.73811 233.13317 125.19177 1.000 112.19541 ?  361 ARG B CD    1 
ATOM   6142  N NE    . ARG B 1 361 ? 157.53629 231.91631 125.12767 1.000 118.23388 ?  361 ARG B NE    1 
ATOM   6143  C CZ    . ARG B 1 361 ? 158.55439 231.65143 125.93618 1.000 126.61097 ?  361 ARG B CZ    1 
ATOM   6144  N NH1   . ARG B 1 361 ? 158.92212 232.50342 126.88147 1.000 121.89735 ?  361 ARG B NH1   1 
ATOM   6145  N NH2   . ARG B 1 361 ? 159.21219 230.50030 125.79893 1.000 123.28199 ?  361 ARG B NH2   1 
ATOM   6146  N N     . ASP B 1 362 ? 156.36099 238.74458 125.09238 1.000 119.15773 ?  362 ASP B N     1 
ATOM   6147  C CA    . ASP B 1 362 ? 155.56233 239.91741 125.45945 1.000 120.61302 ?  362 ASP B CA    1 
ATOM   6148  C C     . ASP B 1 362 ? 156.49035 241.07235 125.83781 1.000 124.97813 ?  362 ASP B C     1 
ATOM   6149  O O     . ASP B 1 362 ? 157.66447 240.86815 126.16556 1.000 125.00528 ?  362 ASP B O     1 
ATOM   6150  C CB    . ASP B 1 362 ? 154.60176 239.65413 126.64219 1.000 113.45633 ?  362 ASP B CB    1 
ATOM   6151  C CG    . ASP B 1 362 ? 155.29828 239.02024 127.84005 1.000 117.71282 ?  362 ASP B CG    1 
ATOM   6152  O OD1   . ASP B 1 362 ? 155.70848 237.83920 127.77662 1.000 113.99547 ?  362 ASP B OD1   1 
ATOM   6153  O OD2   . ASP B 1 362 ? 155.50117 239.74829 128.83044 1.000 120.81993 ?  362 ASP B OD2   1 
ATOM   6154  N N     . GLU B 1 363 ? 155.94832 242.29883 125.81125 1.000 129.08203 ?  363 GLU B N     1 
ATOM   6155  C CA    . GLU B 1 363 ? 156.75045 243.47644 126.16205 1.000 129.21729 ?  363 GLU B CA    1 
ATOM   6156  C C     . GLU B 1 363 ? 157.25252 243.41600 127.60255 1.000 120.14185 ?  363 GLU B C     1 
ATOM   6157  O O     . GLU B 1 363 ? 158.40438 243.77386 127.88685 1.000 110.49011 ?  363 GLU B O     1 
ATOM   6158  C CB    . GLU B 1 363 ? 155.92707 244.75722 125.95935 1.000 124.14213 ?  363 GLU B CB    1 
ATOM   6159  C CG    . GLU B 1 363 ? 155.27729 244.85316 124.59632 1.000 129.97914 ?  363 GLU B CG    1 
ATOM   6160  C CD    . GLU B 1 363 ? 153.88853 244.25470 124.58795 1.000 134.07356 ?  363 GLU B CD    1 
ATOM   6161  O OE1   . GLU B 1 363 ? 153.38931 243.88418 125.67982 1.000 125.61540 ?  363 GLU B OE1   1 
ATOM   6162  O OE2   . GLU B 1 363 ? 153.31374 244.13135 123.48512 1.000 131.62626 ?  363 GLU B OE2   1 
ATOM   6163  N N     . LYS B 1 364 ? 156.40682 242.92975 128.51605 1.000 120.66516 ?  364 LYS B N     1 
ATOM   6164  C CA    . LYS B 1 364 ? 156.77507 242.86654 129.92960 1.000 129.97100 ?  364 LYS B CA    1 
ATOM   6165  C C     . LYS B 1 364 ? 157.99341 241.98098 130.14098 1.000 129.05313 ?  364 LYS B C     1 
ATOM   6166  O O     . LYS B 1 364 ? 158.80717 242.23087 131.04091 1.000 127.94970 ?  364 LYS B O     1 
ATOM   6167  C CB    . LYS B 1 364 ? 155.59608 242.37585 130.77501 1.000 129.41194 ?  364 LYS B CB    1 
ATOM   6168  C CG    . LYS B 1 364 ? 154.35062 243.28241 130.73813 1.000 126.01344 ?  364 LYS B CG    1 
ATOM   6169  C CD    . LYS B 1 364 ? 153.42285 242.93480 129.56497 1.000 131.16588 ?  364 LYS B CD    1 
ATOM   6170  C CE    . LYS B 1 364 ? 152.28702 243.94114 129.38280 1.000 125.45420 ?  364 LYS B CE    1 
ATOM   6171  N NZ    . LYS B 1 364 ? 151.43755 243.59094 128.20104 1.000 121.81791 ?  364 LYS B NZ    1 
ATOM   6172  N N     . GLU B 1 365 ? 158.09962 240.90601 129.35515 1.000 124.53729 ?  365 GLU B N     1 
ATOM   6173  C CA    . GLU B 1 365 ? 159.25332 240.01886 129.44216 1.000 121.44878 ?  365 GLU B CA    1 
ATOM   6174  C C     . GLU B 1 365 ? 160.54018 240.76420 129.10248 1.000 118.76430 ?  365 GLU B C     1 
ATOM   6175  O O     . GLU B 1 365 ? 161.60475 240.46811 129.66269 1.000 115.54159 ?  365 GLU B O     1 
ATOM   6176  C CB    . GLU B 1 365 ? 159.04276 238.81336 128.52498 1.000 113.86025 ?  365 GLU B CB    1 
ATOM   6177  C CG    . GLU B 1 365 ? 160.07640 237.72105 128.67469 1.000 118.48535 ?  365 GLU B CG    1 
ATOM   6178  C CD    . GLU B 1 365 ? 159.81280 236.52494 127.76172 1.000 124.21705 ?  365 GLU B CD    1 
ATOM   6179  O OE1   . GLU B 1 365 ? 158.72433 236.45032 127.14680 1.000 118.40386 ?  365 GLU B OE1   1 
ATOM   6180  O OE2   . GLU B 1 365 ? 160.71420 235.66652 127.64148 1.000 125.06414 ?  365 GLU B OE2   1 
ATOM   6181  N N     . LEU B 1 366 ? 160.46441 241.71245 128.16036 1.000 113.32078 ?  366 LEU B N     1 
ATOM   6182  C CA    . LEU B 1 366 ? 161.63689 242.49834 127.78331 1.000 113.77344 ?  366 LEU B CA    1 
ATOM   6183  C C     . LEU B 1 366 ? 162.16396 243.31965 128.95746 1.000 117.81832 ?  366 LEU B C     1 
ATOM   6184  O O     . LEU B 1 366 ? 163.37429 243.33322 129.22438 1.000 117.27893 ?  366 LEU B O     1 
ATOM   6185  C CB    . LEU B 1 366 ? 161.29430 243.40294 126.58923 1.000 114.49333 ?  366 LEU B CB    1 
ATOM   6186  C CG    . LEU B 1 366 ? 162.43929 244.24569 125.99465 1.000 111.36568 ?  366 LEU B CG    1 
ATOM   6187  C CD1   . LEU B 1 366 ? 162.39637 244.30778 124.47178 1.000 106.88670 ?  366 LEU B CD1   1 
ATOM   6188  C CD2   . LEU B 1 366 ? 162.50991 245.64709 126.57860 1.000 106.38709 ?  366 LEU B CD2   1 
ATOM   6189  N N     . GLN B 1 367 ? 161.26815 244.02914 129.65952 1.000 117.73584 ?  367 GLN B N     1 
ATOM   6190  C CA    . GLN B 1 367 ? 161.67367 244.82552 130.81740 1.000 120.51429 ?  367 GLN B CA    1 
ATOM   6191  C C     . GLN B 1 367 ? 162.16709 243.95139 131.96466 1.000 121.47613 ?  367 GLN B C     1 
ATOM   6192  O O     . GLN B 1 367 ? 163.08947 244.34685 132.69026 1.000 115.70705 ?  367 GLN B O     1 
ATOM   6193  C CB    . GLN B 1 367 ? 160.52074 245.69907 131.28572 1.000 122.57954 ?  367 GLN B CB    1 
ATOM   6194  C CG    . GLN B 1 367 ? 160.24373 246.88107 130.39752 1.000 120.14218 ?  367 GLN B CG    1 
ATOM   6195  C CD    . GLN B 1 367 ? 159.07793 246.61907 129.50543 1.000 124.56065 ?  367 GLN B CD    1 
ATOM   6196  O OE1   . GLN B 1 367 ? 158.04516 246.11995 129.94700 1.000 131.74964 ?  367 GLN B OE1   1 
ATOM   6197  N NE2   . GLN B 1 367 ? 159.22645 246.95752 128.23168 1.000 120.84741 ?  367 GLN B NE2   1 
ATOM   6198  N N     . GLU B 1 368 ? 161.51559 242.79249 132.18566 1.000 124.89432 ?  368 GLU B N     1 
ATOM   6199  C CA    . GLU B 1 368 ? 161.93751 241.87888 133.25314 1.000 131.81841 ?  368 GLU B CA    1 
ATOM   6200  C C     . GLU B 1 368 ? 163.30103 241.25593 132.95167 1.000 130.28500 ?  368 GLU B C     1 
ATOM   6201  O O     . GLU B 1 368 ? 164.10626 241.04162 133.86941 1.000 130.19964 ?  368 GLU B O     1 
ATOM   6202  C CB    . GLU B 1 368 ? 160.87813 240.80029 133.52352 1.000 130.76177 ?  368 GLU B CB    1 
ATOM   6203  C CG    . GLU B 1 368 ? 160.99294 239.52261 132.69888 1.000 134.05378 ?  368 GLU B CG    1 
ATOM   6204  C CD    . GLU B 1 368 ? 159.75280 238.66230 132.81078 1.000 138.82895 ?  368 GLU B CD    1 
ATOM   6205  O OE1   . GLU B 1 368 ? 158.72718 239.17282 133.31700 1.000 134.03309 ?  368 GLU B OE1   1 
ATOM   6206  O OE2   . GLU B 1 368 ? 159.81620 237.47422 132.42181 1.000 140.65635 ?  368 GLU B OE2   1 
ATOM   6207  N N     . TYR B 1 369 ? 163.56129 240.91712 131.68285 1.000 121.28340 ?  369 TYR B N     1 
ATOM   6208  C CA    . TYR B 1 369 ? 164.88672 240.43009 131.32568 1.000 121.54571 ?  369 TYR B CA    1 
ATOM   6209  C C     . TYR B 1 369 ? 165.93565 241.53469 131.44980 1.000 126.96159 ?  369 TYR B C     1 
ATOM   6210  O O     . TYR B 1 369 ? 167.08991 241.24079 131.79358 1.000 129.57248 ?  369 TYR B O     1 
ATOM   6211  C CB    . TYR B 1 369 ? 164.86749 239.85114 129.89181 1.000 120.00904 ?  369 TYR B CB    1 
ATOM   6212  C CG    . TYR B 1 369 ? 166.23472 239.46341 129.31342 1.000 114.87963 ?  369 TYR B CG    1 
ATOM   6213  C CD1   . TYR B 1 369 ? 166.84263 238.24502 129.60619 1.000 113.89827 ?  369 TYR B CD1   1 
ATOM   6214  C CD2   . TYR B 1 369 ? 166.91251 240.33626 128.46309 1.000 113.57136 ?  369 TYR B CD2   1 
ATOM   6215  C CE1   . TYR B 1 369 ? 168.10436 237.91338 129.07065 1.000 116.49152 ?  369 TYR B CE1   1 
ATOM   6216  C CE2   . TYR B 1 369 ? 168.16247 240.01349 127.92719 1.000 114.67432 ?  369 TYR B CE2   1 
ATOM   6217  C CZ    . TYR B 1 369 ? 168.75738 238.80222 128.23153 1.000 114.08963 ?  369 TYR B CZ    1 
ATOM   6218  O OH    . TYR B 1 369 ? 169.99615 238.47935 127.70472 1.000 102.30409 ?  369 TYR B OH    1 
ATOM   6219  N N     . GLU B 1 370 ? 165.53856 242.81200 131.30641 1.000 125.47891 ?  370 GLU B N     1 
ATOM   6220  C CA    . GLU B 1 370 ? 166.51485 243.90080 131.39473 1.000 123.22900 ?  370 GLU B CA    1 
ATOM   6221  C C     . GLU B 1 370 ? 166.95642 244.11313 132.83226 1.000 124.67842 ?  370 GLU B C     1 
ATOM   6222  O O     . GLU B 1 370 ? 168.13824 244.38124 133.09465 1.000 124.32033 ?  370 GLU B O     1 
ATOM   6223  C CB    . GLU B 1 370 ? 165.91542 245.19877 130.83748 1.000 118.62808 ?  370 GLU B CB    1 
ATOM   6224  C CG    . GLU B 1 370 ? 166.90340 246.15768 130.15116 1.000 116.65355 ?  370 GLU B CG    1 
ATOM   6225  C CD    . GLU B 1 370 ? 167.22611 245.76152 128.71982 1.000 129.63003 ?  370 GLU B CD    1 
ATOM   6226  O OE1   . GLU B 1 370 ? 166.47052 244.95658 128.13884 1.000 133.47735 ?  370 GLU B OE1   1 
ATOM   6227  O OE2   . GLU B 1 370 ? 168.24375 246.25388 128.18018 1.000 137.91112 ?  370 GLU B OE2   1 
ATOM   6228  N N     . ALA B 1 371 ? 166.02961 243.91286 133.77244 1.000 125.00763 ?  371 ALA B N     1 
ATOM   6229  C CA    . ALA B 1 371 ? 166.33876 244.02947 135.19235 1.000 136.09350 ?  371 ALA B CA    1 
ATOM   6230  C C     . ALA B 1 371 ? 167.21108 242.87072 135.66517 1.000 138.89473 ?  371 ALA B C     1 
ATOM   6231  O O     . ALA B 1 371 ? 168.03857 243.04063 136.57126 1.000 138.06580 ?  371 ALA B O     1 
ATOM   6232  C CB    . ALA B 1 371 ? 165.04044 244.09517 135.99481 1.000 134.84041 ?  371 ALA B CB    1 
ATOM   6233  N N     . ALA B 1 372 ? 167.09493 241.70912 135.02254 1.000 132.00232 ?  372 ALA B N     1 
ATOM   6234  C CA    . ALA B 1 372 ? 167.85942 240.54509 135.45425 1.000 130.18965 ?  372 ALA B CA    1 
ATOM   6235  C C     . ALA B 1 372 ? 169.14728 240.42133 134.65053 1.000 127.34166 ?  372 ALA B C     1 
ATOM   6236  O O     . ALA B 1 372 ? 170.23857 240.45562 135.22584 1.000 126.59060 ?  372 ALA B O     1 
ATOM   6237  C CB    . ALA B 1 372 ? 167.02171 239.26526 135.32675 1.000 122.28050 ?  372 ALA B CB    1 
ATOM   6238  N N     . GLU B 1 398 ? 185.78620 233.60941 128.66519 1.000 113.02346 ?  398 GLU B N     1 
ATOM   6239  C CA    . GLU B 1 398 ? 184.40689 233.78415 129.11952 1.000 123.23285 ?  398 GLU B CA    1 
ATOM   6240  C C     . GLU B 1 398 ? 183.90906 235.20649 128.74254 1.000 129.18299 ?  398 GLU B C     1 
ATOM   6241  O O     . GLU B 1 398 ? 182.84760 235.35306 128.12902 1.000 132.38142 ?  398 GLU B O     1 
ATOM   6242  C CB    . GLU B 1 398 ? 184.31760 233.49369 130.63635 1.000 124.50204 ?  398 GLU B CB    1 
ATOM   6243  C CG    . GLU B 1 398 ? 184.27974 231.96564 130.97210 1.000 124.06672 ?  398 GLU B CG    1 
ATOM   6244  C CD    . GLU B 1 398 ? 182.87906 231.30551 131.04736 1.000 122.34372 ?  398 GLU B CD    1 
ATOM   6245  O OE1   . GLU B 1 398 ? 181.85801 232.00624 131.24119 1.000 119.57881 ?  398 GLU B OE1   1 
ATOM   6246  O OE2   . GLU B 1 398 ? 182.80421 230.07108 130.81999 1.000 114.39604 ?  398 GLU B OE2   1 
ATOM   6247  N N     . THR B 1 399 ? 184.66684 236.24709 129.08790 1.000 120.37846 ?  399 THR B N     1 
ATOM   6248  C CA    . THR B 1 399 ? 184.32240 237.62139 128.73361 1.000 113.58098 ?  399 THR B CA    1 
ATOM   6249  C C     . THR B 1 399 ? 185.10690 238.07956 127.50182 1.000 108.96625 ?  399 THR B C     1 
ATOM   6250  O O     . THR B 1 399 ? 186.32868 237.89557 127.43743 1.000 106.96472 ?  399 THR B O     1 
ATOM   6251  C CB    . THR B 1 399 ? 184.58602 238.53891 129.93208 1.000 114.52377 ?  399 THR B CB    1 
ATOM   6252  O OG1   . THR B 1 399 ? 185.75932 238.08493 130.61909 1.000 117.97440 ?  399 THR B OG1   1 
ATOM   6253  C CG2   . THR B 1 399 ? 183.39260 238.53198 130.90381 1.000 109.36288 ?  399 THR B CG2   1 
ATOM   6254  N N     . ARG B 1 400 ? 184.40892 238.67241 126.52278 1.000 106.17883 ?  400 ARG B N     1 
ATOM   6255  C CA    . ARG B 1 400 ? 185.04686 239.20739 125.31865 1.000 106.69203 ?  400 ARG B CA    1 
ATOM   6256  C C     . ARG B 1 400 ? 185.33511 240.69570 125.51120 1.000 104.96396 ?  400 ARG B C     1 
ATOM   6257  O O     . ARG B 1 400 ? 184.42516 241.52704 125.42831 1.000 102.04396 ?  400 ARG B O     1 
ATOM   6258  C CB    . ARG B 1 400 ? 184.18446 238.99975 124.07468 1.000 105.29943 ?  400 ARG B CB    1 
ATOM   6259  C CG    . ARG B 1 400 ? 184.81768 239.62786 122.82226 1.000 96.09144  ?  400 ARG B CG    1 
ATOM   6260  C CD    . ARG B 1 400 ? 184.11415 239.23732 121.55148 1.000 90.46300  ?  400 ARG B CD    1 
ATOM   6261  N NE    . ARG B 1 400 ? 184.39282 237.85325 121.19770 1.000 89.67449  ?  400 ARG B NE    1 
ATOM   6262  C CZ    . ARG B 1 400 ? 183.87232 237.24348 120.14454 1.000 99.30011  ?  400 ARG B CZ    1 
ATOM   6263  N NH1   . ARG B 1 400 ? 183.03437 237.86812 119.33269 1.000 104.32465 ?  400 ARG B NH1   1 
ATOM   6264  N NH2   . ARG B 1 400 ? 184.21841 235.98608 119.88642 1.000 100.10311 ?  400 ARG B NH2   1 
ATOM   6265  N N     . SER B 1 401 ? 186.60672 241.04217 125.69783 1.000 101.51316 ?  401 SER B N     1 
ATOM   6266  C CA    . SER B 1 401 ? 186.99123 242.43502 125.86644 1.000 97.50370  ?  401 SER B CA    1 
ATOM   6267  C C     . SER B 1 401 ? 188.43794 242.61295 125.44340 1.000 97.26213  ?  401 SER B C     1 
ATOM   6268  O O     . SER B 1 401 ? 189.24611 241.69585 125.62866 1.000 96.40921  ?  401 SER B O     1 
ATOM   6269  C CB    . SER B 1 401 ? 186.81566 242.85250 127.32600 1.000 99.80151  ?  401 SER B CB    1 
ATOM   6270  O OG    . SER B 1 401 ? 187.83711 242.26118 128.12186 1.000 98.11931  ?  401 SER B OG    1 
ATOM   6271  N N     . PRO B 1 402 ? 188.81411 243.78986 124.93018 1.000 95.99400  ?  402 PRO B N     1 
ATOM   6272  C CA    . PRO B 1 402 ? 190.24099 244.00814 124.64676 1.000 95.81470  ?  402 PRO B CA    1 
ATOM   6273  C C     . PRO B 1 402 ? 191.08606 243.81036 125.87850 1.000 94.00899  ?  402 PRO B C     1 
ATOM   6274  O O     . PRO B 1 402 ? 192.12056 243.13950 125.81665 1.000 89.62075  ?  402 PRO B O     1 
ATOM   6275  C CB    . PRO B 1 402 ? 190.28393 245.45723 124.14390 1.000 88.59231  ?  402 PRO B CB    1 
ATOM   6276  C CG    . PRO B 1 402 ? 188.94708 245.66643 123.55914 1.000 91.02339  ?  402 PRO B CG    1 
ATOM   6277  C CD    . PRO B 1 402 ? 187.98025 244.88765 124.41994 1.000 94.23172  ?  402 PRO B CD    1 
ATOM   6278  N N     . GLU B 1 403 ? 190.61490 244.30059 127.01815 1.000 98.47913  ?  403 GLU B N     1 
ATOM   6279  C CA    . GLU B 1 403 ? 191.37837 244.17152 128.24897 1.000 103.27420 ?  403 GLU B CA    1 
ATOM   6280  C C     . GLU B 1 403 ? 191.61820 242.70178 128.57413 1.000 99.45871  ?  403 GLU B C     1 
ATOM   6281  O O     . GLU B 1 403 ? 192.74371 242.29894 128.89791 1.000 100.05960 ?  403 GLU B O     1 
ATOM   6282  C CB    . GLU B 1 403 ? 190.62810 244.86475 129.38775 1.000 101.95695 ?  403 GLU B CB    1 
ATOM   6283  C CG    . GLU B 1 403 ? 190.35307 246.35343 129.11902 1.000 108.11210 ?  403 GLU B CG    1 
ATOM   6284  C CD    . GLU B 1 403 ? 189.16002 246.60078 128.16790 1.000 109.28344 ?  403 GLU B CD    1 
ATOM   6285  O OE1   . GLU B 1 403 ? 188.37593 245.65716 127.92105 1.000 107.46116 ?  403 GLU B OE1   1 
ATOM   6286  O OE2   . GLU B 1 403 ? 189.01279 247.73469 127.65467 1.000 104.63942 ?  403 GLU B OE2   1 
ATOM   6287  N N     . ALA B 1 404 ? 190.58546 241.87206 128.41754 1.000 91.72151  ?  404 ALA B N     1 
ATOM   6288  C CA    . ALA B 1 404 ? 190.72923 240.45536 128.72024 1.000 93.98305  ?  404 ALA B CA    1 
ATOM   6289  C C     . ALA B 1 404 ? 191.76977 239.80176 127.82029 1.000 100.63069 ?  404 ALA B C     1 
ATOM   6290  O O     . ALA B 1 404 ? 192.63521 239.05704 128.29902 1.000 94.78693  ?  404 ALA B O     1 
ATOM   6291  C CB    . ALA B 1 404 ? 189.38229 239.74525 128.56141 1.000 95.92747  ?  404 ALA B CB    1 
ATOM   6292  N N     . VAL B 1 405 ? 191.71392 240.08373 126.51507 1.000 100.19901 ?  405 VAL B N     1 
ATOM   6293  C CA    . VAL B 1 405 ? 192.67438 239.48999 125.59532 1.000 94.16953  ?  405 VAL B CA    1 
ATOM   6294  C C     . VAL B 1 405 ? 194.07918 239.96191 125.93092 1.000 97.83759  ?  405 VAL B C     1 
ATOM   6295  O O     . VAL B 1 405 ? 195.01988 239.16057 125.98059 1.000 101.61189 ?  405 VAL B O     1 
ATOM   6296  C CB    . VAL B 1 405 ? 192.27461 239.80848 124.14434 1.000 90.06506  ?  405 VAL B CB    1 
ATOM   6297  C CG1   . VAL B 1 405 ? 193.26931 239.22496 123.16163 1.000 83.07452  ?  405 VAL B CG1   1 
ATOM   6298  C CG2   . VAL B 1 405 ? 190.88699 239.26449 123.88909 1.000 93.21922  ?  405 VAL B CG2   1 
ATOM   6299  N N     . TYR B 1 406 ? 194.23280 241.25066 126.24911 1.000 94.77680  ?  406 TYR B N     1 
ATOM   6300  C CA    . TYR B 1 406 ? 195.57038 241.75983 126.52346 1.000 92.67793  ?  406 TYR B CA    1 
ATOM   6301  C C     . TYR B 1 406 ? 196.18246 241.07630 127.74338 1.000 92.74304  ?  406 TYR B C     1 
ATOM   6302  O O     . TYR B 1 406 ? 197.29095 240.52848 127.65951 1.000 90.42339  ?  406 TYR B O     1 
ATOM   6303  C CB    . TYR B 1 406 ? 195.53282 243.27545 126.70607 1.000 89.64495  ?  406 TYR B CB    1 
ATOM   6304  C CG    . TYR B 1 406 ? 196.90223 243.88846 126.90565 1.000 88.75851  ?  406 TYR B CG    1 
ATOM   6305  C CD1   . TYR B 1 406 ? 197.77489 243.98458 125.84080 1.000 91.08595  ?  406 TYR B CD1   1 
ATOM   6306  C CD2   . TYR B 1 406 ? 197.30902 244.39797 128.12630 1.000 91.17340  ?  406 TYR B CD2   1 
ATOM   6307  C CE1   . TYR B 1 406 ? 199.01634 244.54436 125.97903 1.000 91.33758  ?  406 TYR B CE1   1 
ATOM   6308  C CE2   . TYR B 1 406 ? 198.57200 244.97167 128.27869 1.000 93.70543  ?  406 TYR B CE2   1 
ATOM   6309  C CZ    . TYR B 1 406 ? 199.41741 245.03811 127.18773 1.000 90.05327  ?  406 TYR B CZ    1 
ATOM   6310  O OH    . TYR B 1 406 ? 200.67766 245.59070 127.26381 1.000 93.90078  ?  406 TYR B OH    1 
ATOM   6311  N N     . THR B 1 407 ? 195.42715 240.97465 128.83925 1.000 94.22799  ?  407 THR B N     1 
ATOM   6312  C CA    . THR B 1 407 ? 195.97014 240.32038 130.02406 1.000 101.06976 ?  407 THR B CA    1 
ATOM   6313  C C     . THR B 1 407 ? 196.33611 238.86929 129.71432 1.000 99.26310  ?  407 THR B C     1 
ATOM   6314  O O     . THR B 1 407 ? 197.37542 238.37319 130.16839 1.000 96.84369  ?  407 THR B O     1 
ATOM   6315  C CB    . THR B 1 407 ? 194.96181 240.40691 131.17561 1.000 103.66057 ?  407 THR B CB    1 
ATOM   6316  O OG1   . THR B 1 407 ? 193.70964 239.87058 130.73899 1.000 109.11011 ?  407 THR B OG1   1 
ATOM   6317  C CG2   . THR B 1 407 ? 194.74653 241.87197 131.62889 1.000 92.48170  ?  407 THR B CG2   1 
ATOM   6318  N N     . ARG B 1 408 ? 195.52375 238.19997 128.88471 1.000 95.71094  ?  408 ARG B N     1 
ATOM   6319  C CA    . ARG B 1 408 ? 195.81056 236.82710 128.47514 1.000 96.62213  ?  408 ARG B CA    1 
ATOM   6320  C C     . ARG B 1 408 ? 197.13729 236.73731 127.74159 1.000 92.29279  ?  408 ARG B C     1 
ATOM   6321  O O     . ARG B 1 408 ? 197.91569 235.80144 127.97057 1.000 92.06054  ?  408 ARG B O     1 
ATOM   6322  C CB    . ARG B 1 408 ? 194.68437 236.30070 127.58484 1.000 97.85386  ?  408 ARG B CB    1 
ATOM   6323  C CG    . ARG B 1 408 ? 194.35973 234.82161 127.76233 1.000 102.80217 ?  408 ARG B CG    1 
ATOM   6324  C CD    . ARG B 1 408 ? 193.27561 234.36999 126.78209 1.000 98.26218  ?  408 ARG B CD    1 
ATOM   6325  N NE    . ARG B 1 408 ? 192.04991 235.12409 127.01300 1.000 104.17609 ?  408 ARG B NE    1 
ATOM   6326  C CZ    . ARG B 1 408 ? 191.25246 235.57799 126.05555 1.000 104.93247 ?  408 ARG B CZ    1 
ATOM   6327  N NH1   . ARG B 1 408 ? 191.51518 235.35639 124.77203 1.000 101.02625 ?  408 ARG B NH1   1 
ATOM   6328  N NH2   . ARG B 1 408 ? 190.17735 236.29072 126.39332 1.000 98.89035  ?  408 ARG B NH2   1 
ATOM   6329  N N     . ILE B 1 409 ? 197.39074 237.67773 126.82267 1.000 87.52514  ?  409 ILE B N     1 
ATOM   6330  C CA    . ILE B 1 409 ? 198.67669 237.72601 126.13737 1.000 88.91546  ?  409 ILE B CA    1 
ATOM   6331  C C     . ILE B 1 409 ? 199.77620 238.00188 127.13920 1.000 92.23698  ?  409 ILE B C     1 
ATOM   6332  O O     . ILE B 1 409 ? 200.79112 237.29677 127.17640 1.000 98.29738  ?  409 ILE B O     1 
ATOM   6333  C CB    . ILE B 1 409 ? 198.66040 238.78129 125.01289 1.000 89.53400  ?  409 ILE B CB    1 
ATOM   6334  C CG1   . ILE B 1 409 ? 197.65258 238.40866 123.92324 1.000 87.20846  ?  409 ILE B CG1   1 
ATOM   6335  C CG2   . ILE B 1 409 ? 200.05265 239.00811 124.42766 1.000 85.54216  ?  409 ILE B CG2   1 
ATOM   6336  C CD1   . ILE B 1 409 ? 197.41934 239.51033 122.91918 1.000 79.06198  ?  409 ILE B CD1   1 
ATOM   6337  N N     . MET B 1 410 ? 199.55558 238.96750 128.02963 1.000 90.22228  ?  410 MET B N     1 
ATOM   6338  C CA    . MET B 1 410 ? 200.59777 239.31365 128.98590 1.000 89.75369  ?  410 MET B CA    1 
ATOM   6339  C C     . MET B 1 410 ? 200.93382 238.14977 129.89718 1.000 93.62649  ?  410 MET B C     1 
ATOM   6340  O O     . MET B 1 410 ? 202.10439 237.93011 130.21031 1.000 94.71556  ?  410 MET B O     1 
ATOM   6341  C CB    . MET B 1 410 ? 200.15546 240.51012 129.79911 1.000 89.81218  ?  410 MET B CB    1 
ATOM   6342  C CG    . MET B 1 410 ? 199.95333 241.73252 128.92186 1.000 96.27955  ?  410 MET B CG    1 
ATOM   6343  S SD    . MET B 1 410 ? 201.44061 242.38425 128.10570 1.000 94.64696  ?  410 MET B SD    1 
ATOM   6344  C CE    . MET B 1 410 ? 201.31005 241.87304 126.38276 1.000 98.23539  ?  410 MET B CE    1 
ATOM   6345  N N     . MET B 1 411 ? 199.94105 237.35976 130.28214 1.000 96.85511  ?  411 MET B N     1 
ATOM   6346  C CA    . MET B 1 411 ? 200.21092 236.23666 131.16911 1.000 101.32355 ?  411 MET B CA    1 
ATOM   6347  C C     . MET B 1 411 ? 201.16525 235.21468 130.54473 1.000 101.35337 ?  411 MET B C     1 
ATOM   6348  O O     . MET B 1 411 ? 201.97378 234.60313 131.25536 1.000 104.88759 ?  411 MET B O     1 
ATOM   6349  C CB    . MET B 1 411 ? 198.89796 235.58992 131.57184 1.000 107.23305 ?  411 MET B CB    1 
ATOM   6350  C CG    . MET B 1 411 ? 198.14114 236.41490 132.57142 1.000 109.61463 ?  411 MET B CG    1 
ATOM   6351  S SD    . MET B 1 411 ? 196.73974 235.46488 133.11279 1.000 133.02504 ?  411 MET B SD    1 
ATOM   6352  C CE    . MET B 1 411 ? 197.56473 234.22322 134.09953 1.000 103.75404 ?  411 MET B CE    1 
ATOM   6353  N N     . ASN B 1 412 ? 201.07609 234.98556 129.23520 1.000 95.35073  ?  412 ASN B N     1 
ATOM   6354  C CA    . ASN B 1 412 ? 201.97225 234.03816 128.57797 1.000 95.89793  ?  412 ASN B CA    1 
ATOM   6355  C C     . ASN B 1 412 ? 203.22803 234.67090 128.03740 1.000 94.27614  ?  412 ASN B C     1 
ATOM   6356  O O     . ASN B 1 412 ? 203.88339 234.08244 127.17125 1.000 92.48412  ?  412 ASN B O     1 
ATOM   6357  C CB    . ASN B 1 412 ? 201.25396 233.29689 127.47886 1.000 99.14555  ?  412 ASN B CB    1 
ATOM   6358  C CG    . ASN B 1 412 ? 200.07355 232.57355 127.99765 1.000 100.53871 ?  412 ASN B CG    1 
ATOM   6359  O OD1   . ASN B 1 412 ? 199.01243 233.16791 128.22293 1.000 97.12475  ?  412 ASN B OD1   1 
ATOM   6360  N ND2   . ASN B 1 412 ? 200.25748 231.28455 128.26925 1.000 93.77506  ?  412 ASN B ND2   1 
ATOM   6361  N N     . GLY B 1 413 ? 203.54910 235.86915 128.49572 1.000 91.08691  ?  413 GLY B N     1 
ATOM   6362  C CA    . GLY B 1 413 ? 204.77927 236.52097 128.10401 1.000 95.85575  ?  413 GLY B CA    1 
ATOM   6363  C C     . GLY B 1 413 ? 204.83327 236.93536 126.65419 1.000 95.57293  ?  413 GLY B C     1 
ATOM   6364  O O     . GLY B 1 413 ? 205.92383 237.03934 126.09655 1.000 96.19297  ?  413 GLY B O     1 
ATOM   6365  N N     . GLY B 1 414 ? 203.69057 237.22226 126.03654 1.000 93.94843  ?  414 GLY B N     1 
ATOM   6366  C CA    . GLY B 1 414 ? 203.70929 237.57562 124.63256 1.000 91.98044  ?  414 GLY B CA    1 
ATOM   6367  C C     . GLY B 1 414 ? 204.12874 236.42013 123.75497 1.000 94.47873  ?  414 GLY B C     1 
ATOM   6368  O O     . GLY B 1 414 ? 204.65310 236.63661 122.65024 1.000 93.04458  ?  414 GLY B O     1 
ATOM   6369  N N     . ARG B 1 415 ? 203.94055 235.19108 124.23419 1.000 94.46315  ?  415 ARG B N     1 
ATOM   6370  C CA    . ARG B 1 415 ? 204.36939 234.00052 123.52067 1.000 95.94179  ?  415 ARG B CA    1 
ATOM   6371  C C     . ARG B 1 415 ? 203.17650 233.13950 123.11433 1.000 93.36809  ?  415 ARG B C     1 
ATOM   6372  O O     . ARG B 1 415 ? 202.22019 232.97218 123.87961 1.000 93.64050  ?  415 ARG B O     1 
ATOM   6373  C CB    . ARG B 1 415 ? 205.35794 233.20389 124.36868 1.000 94.68667  ?  415 ARG B CB    1 
ATOM   6374  C CG    . ARG B 1 415 ? 206.26637 232.35235 123.51044 1.000 100.41156 ?  415 ARG B CG    1 
ATOM   6375  C CD    . ARG B 1 415 ? 207.61996 232.15609 124.16811 1.000 103.68853 ?  415 ARG B CD    1 
ATOM   6376  N NE    . ARG B 1 415 ? 208.64912 231.78982 123.19814 1.000 107.27528 ?  415 ARG B NE    1 
ATOM   6377  C CZ    . ARG B 1 415 ? 209.75489 232.49207 122.97043 1.000 102.41582 ?  415 ARG B CZ    1 
ATOM   6378  N NH1   . ARG B 1 415 ? 210.00386 233.62099 123.61540 1.000 98.88856  ?  415 ARG B NH1   1 
ATOM   6379  N NH2   . ARG B 1 415 ? 210.63864 232.04536 122.07867 1.000 96.68633  ?  415 ARG B NH2   1 
ATOM   6380  N N     . LEU B 1 416 ? 203.25032 232.59131 121.90451 1.000 88.19937  ?  416 LEU B N     1 
ATOM   6381  C CA    . LEU B 1 416 ? 202.17168 231.76854 121.38533 1.000 87.93348  ?  416 LEU B CA    1 
ATOM   6382  C C     . LEU B 1 416 ? 201.92983 230.56758 122.28975 1.000 91.98338  ?  416 LEU B C     1 
ATOM   6383  O O     . LEU B 1 416 ? 202.86281 230.00175 122.86476 1.000 95.04969  ?  416 LEU B O     1 
ATOM   6384  C CB    . LEU B 1 416 ? 202.50086 231.28614 119.96938 1.000 88.44533  ?  416 LEU B CB    1 
ATOM   6385  C CG    . LEU B 1 416 ? 202.17630 232.21567 118.79612 1.000 90.40022  ?  416 LEU B CG    1 
ATOM   6386  C CD1   . LEU B 1 416 ? 202.69056 231.65374 117.45681 1.000 83.55085  ?  416 LEU B CD1   1 
ATOM   6387  C CD2   . LEU B 1 416 ? 200.68532 232.52283 118.75608 1.000 90.20132  ?  416 LEU B CD2   1 
ATOM   6388  N N     . LYS B 1 417 ? 200.65904 230.22798 122.46807 1.000 90.57372  ?  417 LYS B N     1 
ATOM   6389  C CA    . LYS B 1 417 ? 200.27034 229.01226 123.15835 1.000 92.58939  ?  417 LYS B CA    1 
ATOM   6390  C C     . LYS B 1 417 ? 200.50797 227.81817 122.24075 1.000 93.99358  ?  417 LYS B C     1 
ATOM   6391  O O     . LYS B 1 417 ? 200.67569 227.96131 121.02604 1.000 94.37812  ?  417 LYS B O     1 
ATOM   6392  C CB    . LYS B 1 417 ? 198.80528 229.06880 123.56447 1.000 97.70090  ?  417 LYS B CB    1 
ATOM   6393  C CG    . LYS B 1 417 ? 198.46730 230.16648 124.55860 1.000 103.19576 ?  417 LYS B CG    1 
ATOM   6394  C CD    . LYS B 1 417 ? 196.96763 230.14823 124.86352 1.000 105.66645 ?  417 LYS B CD    1 
ATOM   6395  C CE    . LYS B 1 417 ? 196.57725 231.15240 125.94381 1.000 103.63054 ?  417 LYS B CE    1 
ATOM   6396  N NZ    . LYS B 1 417 ? 195.09189 231.37709 126.02549 1.000 105.64777 ?  417 LYS B NZ    1 
ATOM   6397  N N     . ARG B 1 418 ? 200.59550 226.63525 122.84770 1.000 92.54130  ?  418 ARG B N     1 
ATOM   6398  C CA    . ARG B 1 418 ? 200.74820 225.40950 122.06856 1.000 92.11986  ?  418 ARG B CA    1 
ATOM   6399  C C     . ARG B 1 418 ? 199.52528 225.16035 121.19438 1.000 94.83704  ?  418 ARG B C     1 
ATOM   6400  O O     . ARG B 1 418 ? 199.64978 224.71820 120.04498 1.000 91.85765  ?  418 ARG B O     1 
ATOM   6401  C CB    . ARG B 1 418 ? 200.99135 224.23909 123.01426 1.000 97.61886  ?  418 ARG B CB    1 
ATOM   6402  C CG    . ARG B 1 418 ? 202.41149 223.68098 122.97770 1.000 104.47021 ?  418 ARG B CG    1 
ATOM   6403  C CD    . ARG B 1 418 ? 202.52778 222.44457 123.87390 1.000 112.92981 ?  418 ARG B CD    1 
ATOM   6404  N NE    . ARG B 1 418 ? 202.64982 222.77775 125.29217 1.000 118.12977 ?  418 ARG B NE    1 
ATOM   6405  C CZ    . ARG B 1 418 ? 203.34554 222.07229 126.17545 1.000 124.88389 ?  418 ARG B CZ    1 
ATOM   6406  N NH1   . ARG B 1 418 ? 204.00141 220.97862 125.82007 1.000 127.81972 ?  418 ARG B NH1   1 
ATOM   6407  N NH2   . ARG B 1 418 ? 203.38500 222.47498 127.44701 1.000 116.59649 ?  418 ARG B NH2   1 
ATOM   6408  N N     . SER B 1 419 ? 198.33081 225.44961 121.72448 1.000 97.13104  ?  419 SER B N     1 
ATOM   6409  C CA    . SER B 1 419 ? 197.10378 225.28620 120.95057 1.000 93.15488  ?  419 SER B CA    1 
ATOM   6410  C C     . SER B 1 419 ? 197.10640 226.19005 119.73717 1.000 88.87191  ?  419 SER B C     1 
ATOM   6411  O O     . SER B 1 419 ? 196.61812 225.80598 118.66796 1.000 87.67841  ?  419 SER B O     1 
ATOM   6412  C CB    . SER B 1 419 ? 195.89859 225.61303 121.81435 1.000 93.00831  ?  419 SER B CB    1 
ATOM   6413  O OG    . SER B 1 419 ? 196.13075 226.84044 122.46859 1.000 93.98489  ?  419 SER B OG    1 
ATOM   6414  N N     . HIS B 1 420 ? 197.62759 227.41011 119.89642 1.000 90.99751  ?  420 HIS B N     1 
ATOM   6415  C CA    . HIS B 1 420 ? 197.73139 228.33673 118.77512 1.000 89.36812  ?  420 HIS B CA    1 
ATOM   6416  C C     . HIS B 1 420 ? 198.55612 227.73551 117.65456 1.000 85.05922  ?  420 HIS B C     1 
ATOM   6417  O O     . HIS B 1 420 ? 198.16369 227.78170 116.48450 1.000 82.22722  ?  420 HIS B O     1 
ATOM   6418  C CB    . HIS B 1 420 ? 198.36686 229.64654 119.23504 1.000 88.82722  ?  420 HIS B CB    1 
ATOM   6419  C CG    . HIS B 1 420 ? 197.52716 230.41510 120.19748 1.000 87.05356  ?  420 HIS B CG    1 
ATOM   6420  N ND1   . HIS B 1 420 ? 198.02336 231.43926 120.96921 1.000 90.25385  ?  420 HIS B ND1   1 
ATOM   6421  C CD2   . HIS B 1 420 ? 196.21852 230.30367 120.51545 1.000 88.41219  ?  420 HIS B CD2   1 
ATOM   6422  C CE1   . HIS B 1 420 ? 197.05269 231.93119 121.71842 1.000 92.02750  ?  420 HIS B CE1   1 
ATOM   6423  N NE2   . HIS B 1 420 ? 195.94617 231.25898 121.46142 1.000 90.44370  ?  420 HIS B NE2   1 
ATOM   6424  N N     . ILE B 1 421 ? 199.71545 227.17508 117.99945 1.000 81.66068  ?  421 ILE B N     1 
ATOM   6425  C CA    . ILE B 1 421 ? 200.57712 226.58656 116.98586 1.000 81.44848  ?  421 ILE B CA    1 
ATOM   6426  C C     . ILE B 1 421 ? 199.92206 225.36440 116.36508 1.000 80.60396  ?  421 ILE B C     1 
ATOM   6427  O O     . ILE B 1 421 ? 199.98139 225.15733 115.14488 1.000 78.20138  ?  421 ILE B O     1 
ATOM   6428  C CB    . ILE B 1 421 ? 201.95859 226.25541 117.56881 1.000 82.64264  ?  421 ILE B CB    1 
ATOM   6429  C CG1   . ILE B 1 421 ? 202.59847 227.52438 118.13955 1.000 89.45736  ?  421 ILE B CG1   1 
ATOM   6430  C CG2   . ILE B 1 421 ? 202.83085 225.63229 116.50377 1.000 85.13037  ?  421 ILE B CG2   1 
ATOM   6431  C CD1   . ILE B 1 421 ? 204.12953 227.50879 118.17554 1.000 84.51004  ?  421 ILE B CD1   1 
ATOM   6432  N N     . ARG B 1 422 ? 199.28168 224.53542 117.18251 1.000 84.69423  ?  422 ARG B N     1 
ATOM   6433  C CA    . ARG B 1 422 ? 198.60058 223.37573 116.62241 1.000 87.31899  ?  422 ARG B CA    1 
ATOM   6434  C C     . ARG B 1 422 ? 197.60336 223.81455 115.55972 1.000 85.49810  ?  422 ARG B C     1 
ATOM   6435  O O     . ARG B 1 422 ? 197.65099 223.35289 114.41426 1.000 83.49349  ?  422 ARG B O     1 
ATOM   6436  C CB    . ARG B 1 422 ? 197.91562 222.59964 117.75306 1.000 97.06930  ?  422 ARG B CB    1 
ATOM   6437  C CG    . ARG B 1 422 ? 198.87061 221.67838 118.52213 1.000 99.72852  ?  422 ARG B CG    1 
ATOM   6438  C CD    . ARG B 1 422 ? 198.13697 220.68452 119.42005 1.000 93.77037  ?  422 ARG B CD    1 
ATOM   6439  N NE    . ARG B 1 422 ? 197.51946 221.36388 120.54941 1.000 97.56758  ?  422 ARG B NE    1 
ATOM   6440  C CZ    . ARG B 1 422 ? 198.09690 221.49122 121.73715 1.000 106.81156 ?  422 ARG B CZ    1 
ATOM   6441  N NH1   . ARG B 1 422 ? 199.29312 220.98184 121.97604 1.000 110.65428 ?  422 ARG B NH1   1 
ATOM   6442  N NH2   . ARG B 1 422 ? 197.46760 222.16430 122.70352 1.000 107.27919 ?  422 ARG B NH2   1 
ATOM   6443  N N     . ARG B 1 423 ? 196.80064 224.82203 115.88745 1.000 90.07679  ?  423 ARG B N     1 
ATOM   6444  C CA    . ARG B 1 423 ? 195.76738 225.30018 114.98215 1.000 85.73493  ?  423 ARG B CA    1 
ATOM   6445  C C     . ARG B 1 423 ? 196.35725 225.87099 113.68882 1.000 85.53626  ?  423 ARG B C     1 
ATOM   6446  O O     . ARG B 1 423 ? 195.86153 225.57698 112.59493 1.000 88.30248  ?  423 ARG B O     1 
ATOM   6447  C CB    . ARG B 1 423 ? 194.94910 226.34843 115.70879 1.000 80.83389  ?  423 ARG B CB    1 
ATOM   6448  C CG    . ARG B 1 423 ? 193.91694 227.03911 114.89610 1.000 81.51155  ?  423 ARG B CG    1 
ATOM   6449  C CD    . ARG B 1 423 ? 192.75192 226.12643 114.52529 1.000 76.02802  ?  423 ARG B CD    1 
ATOM   6450  N NE    . ARG B 1 423 ? 192.00025 226.71556 113.43009 1.000 82.89049  ?  423 ARG B NE    1 
ATOM   6451  C CZ    . ARG B 1 423 ? 190.85199 226.24014 112.98050 1.000 80.04679  ?  423 ARG B CZ    1 
ATOM   6452  N NH1   . ARG B 1 423 ? 190.27870 225.18838 113.53725 1.000 75.15780  ?  423 ARG B NH1   1 
ATOM   6453  N NH2   . ARG B 1 423 ? 190.22772 226.88131 111.99771 1.000 83.08493  ?  423 ARG B NH2   1 
ATOM   6454  N N     . TYR B 1 424 ? 197.39104 226.72339 113.79617 1.000 82.15261  ?  424 TYR B N     1 
ATOM   6455  C CA    . TYR B 1 424 ? 198.04228 227.29720 112.61172 1.000 76.99277  ?  424 TYR B CA    1 
ATOM   6456  C C     . TYR B 1 424 ? 198.57295 226.21000 111.70074 1.000 82.58674  ?  424 TYR B C     1 
ATOM   6457  O O     . TYR B 1 424 ? 198.48726 226.31556 110.47259 1.000 81.55896  ?  424 TYR B O     1 
ATOM   6458  C CB    . TYR B 1 424 ? 199.18230 228.21496 113.02117 1.000 81.66720  ?  424 TYR B CB    1 
ATOM   6459  C CG    . TYR B 1 424 ? 198.82313 229.64040 113.31929 1.000 83.25307  ?  424 TYR B CG    1 
ATOM   6460  C CD1   . TYR B 1 424 ? 197.50738 230.05615 113.43302 1.000 84.78090  ?  424 TYR B CD1   1 
ATOM   6461  C CD2   . TYR B 1 424 ? 199.82122 230.56788 113.57077 1.000 87.90076  ?  424 TYR B CD2   1 
ATOM   6462  C CE1   . TYR B 1 424 ? 197.19891 231.38373 113.72664 1.000 80.56184  ?  424 TYR B CE1   1 
ATOM   6463  C CE2   . TYR B 1 424 ? 199.52661 231.87109 113.87268 1.000 84.12306  ?  424 TYR B CE2   1 
ATOM   6464  C CZ    . TYR B 1 424 ? 198.22012 232.27292 113.94974 1.000 82.33835  ?  424 TYR B CZ    1 
ATOM   6465  O OH    . TYR B 1 424 ? 197.96128 233.58090 114.24794 1.000 88.23286  ?  424 TYR B OH    1 
ATOM   6466  N N     . VAL B 1 425 ? 199.19465 225.18478 112.29056 1.000 85.01625  ?  425 VAL B N     1 
ATOM   6467  C CA    . VAL B 1 425 ? 199.73662 224.09515 111.49154 1.000 85.76549  ?  425 VAL B CA    1 
ATOM   6468  C C     . VAL B 1 425 ? 198.61953 223.31839 110.82823 1.000 86.00813  ?  425 VAL B C     1 
ATOM   6469  O O     . VAL B 1 425 ? 198.69399 222.98075 109.63943 1.000 82.67728  ?  425 VAL B O     1 
ATOM   6470  C CB    . VAL B 1 425 ? 200.56805 223.16266 112.37395 1.000 84.10326  ?  425 VAL B CB    1 
ATOM   6471  C CG1   . VAL B 1 425 ? 201.11531 222.03890 111.52219 1.000 88.84961  ?  425 VAL B CG1   1 
ATOM   6472  C CG2   . VAL B 1 425 ? 201.65187 223.93089 113.03824 1.000 90.14757  ?  425 VAL B CG2   1 
ATOM   6473  N N     . SER B 1 426 ? 197.55931 223.03882 111.58789 1.000 85.99721  ?  426 SER B N     1 
ATOM   6474  C CA    . SER B 1 426 ? 196.44057 222.28800 111.04586 1.000 85.44806  ?  426 SER B CA    1 
ATOM   6475  C C     . SER B 1 426 ? 195.81376 223.00469 109.87447 1.000 85.01420  ?  426 SER B C     1 
ATOM   6476  O O     . SER B 1 426 ? 195.34829 222.36903 108.92379 1.000 90.32073  ?  426 SER B O     1 
ATOM   6477  C CB    . SER B 1 426 ? 195.37969 222.05780 112.10805 1.000 88.51385  ?  426 SER B CB    1 
ATOM   6478  O OG    . SER B 1 426 ? 194.30075 221.38483 111.49149 1.000 99.88972  ?  426 SER B OG    1 
ATOM   6479  N N     . VAL B 1 427 ? 195.69772 224.32161 109.96378 1.000 82.99627  ?  427 VAL B N     1 
ATOM   6480  C CA    . VAL B 1 427 ? 195.09303 225.04178 108.85940 1.000 79.07486  ?  427 VAL B CA    1 
ATOM   6481  C C     . VAL B 1 427 ? 196.03444 225.07289 107.67563 1.000 79.05834  ?  427 VAL B C     1 
ATOM   6482  O O     . VAL B 1 427 ? 195.61712 224.92109 106.52605 1.000 81.64123  ?  427 VAL B O     1 
ATOM   6483  C CB    . VAL B 1 427 ? 194.69170 226.45862 109.26738 1.000 78.46083  ?  427 VAL B CB    1 
ATOM   6484  C CG1   . VAL B 1 427 ? 194.12722 227.09805 108.05584 1.000 77.84615  ?  427 VAL B CG1   1 
ATOM   6485  C CG2   . VAL B 1 427 ? 193.68784 226.44174 110.40388 1.000 76.64329  ?  427 VAL B CG2   1 
ATOM   6486  N N     . SER B 1 428 ? 197.30362 225.36538 107.93575 1.000 81.09750  ?  428 SER B N     1 
ATOM   6487  C CA    . SER B 1 428 ? 198.25750 225.52780 106.84965 1.000 83.95012  ?  428 SER B CA    1 
ATOM   6488  C C     . SER B 1 428 ? 198.53079 224.20522 106.14202 1.000 86.91445  ?  428 SER B C     1 
ATOM   6489  O O     . SER B 1 428 ? 198.65970 224.16328 104.91561 1.000 84.65359  ?  428 SER B O     1 
ATOM   6490  C CB    . SER B 1 428 ? 199.54818 226.11752 107.39693 1.000 83.61595  ?  428 SER B CB    1 
ATOM   6491  O OG    . SER B 1 428 ? 200.13580 225.19532 108.29865 1.000 86.85692  ?  428 SER B OG    1 
ATOM   6492  N N     . SER B 1 429 ? 198.66125 223.11745 106.89193 1.000 91.93630  ?  429 SER B N     1 
ATOM   6493  C CA    . SER B 1 429 ? 199.03571 221.86090 106.25599 1.000 94.24322  ?  429 SER B CA    1 
ATOM   6494  C C     . SER B 1 429 ? 197.90471 221.28664 105.38540 1.000 93.98137  ?  429 SER B C     1 
ATOM   6495  O O     . SER B 1 429 ? 198.17716 220.78227 104.28665 1.000 92.16640  ?  429 SER B O     1 
ATOM   6496  C CB    . SER B 1 429 ? 199.52934 220.88819 107.32301 1.000 93.84853  ?  429 SER B CB    1 
ATOM   6497  O OG    . SER B 1 429 ? 198.55081 220.68832 108.31160 1.000 92.48767  ?  429 SER B OG    1 
ATOM   6498  N N     . ASN B 1 430 ? 196.63612 221.37089 105.83692 1.000 91.99582  ?  430 ASN B N     1 
ATOM   6499  C CA    . ASN B 1 430 ? 195.46020 220.89795 105.07216 1.000 93.97962  ?  430 ASN B CA    1 
ATOM   6500  C C     . ASN B 1 430 ? 194.95650 221.95856 104.09144 1.000 97.69357  ?  430 ASN B C     1 
ATOM   6501  O O     . ASN B 1 430 ? 193.76250 222.25585 103.99434 1.000 100.14999 ?  430 ASN B O     1 
ATOM   6502  C CB    . ASN B 1 430 ? 194.32260 220.46324 105.99581 1.000 95.16726  ?  430 ASN B CB    1 
ATOM   6503  C CG    . ASN B 1 430 ? 194.66892 219.25668 106.85361 1.000 110.46193 ?  430 ASN B CG    1 
ATOM   6504  O OD1   . ASN B 1 430 ? 195.37904 218.35305 106.41237 1.000 114.98348 ?  430 ASN B OD1   1 
ATOM   6505  N ND2   . ASN B 1 430 ? 194.12125 219.21031 108.07198 1.000 107.85265 ?  430 ASN B ND2   1 
ATOM   6506  N N     . HIS B 1 431 ? 195.89667 222.49202 103.31781 1.000 98.08453  ?  431 HIS B N     1 
ATOM   6507  C CA    . HIS B 1 431 ? 195.61129 223.50537 102.31190 1.000 94.15018  ?  431 HIS B CA    1 
ATOM   6508  C C     . HIS B 1 431 ? 196.74437 223.49800 101.29854 1.000 92.61411  ?  431 HIS B C     1 
ATOM   6509  O O     . HIS B 1 431 ? 197.91008 223.28745 101.64842 1.000 92.99120  ?  431 HIS B O     1 
ATOM   6510  C CB    . HIS B 1 431 ? 195.46685 224.90071 102.92543 1.000 90.37948  ?  431 HIS B CB    1 
ATOM   6511  C CG    . HIS B 1 431 ? 195.06235 225.95280 101.94333 1.000 89.08278  ?  431 HIS B CG    1 
ATOM   6512  N ND1   . HIS B 1 431 ? 193.74492 226.24152 101.66733 1.000 92.08314  ?  431 HIS B ND1   1 
ATOM   6513  C CD2   . HIS B 1 431 ? 195.80127 226.75342 101.13683 1.000 88.11415  ?  431 HIS B CD2   1 
ATOM   6514  C CE1   . HIS B 1 431 ? 193.68882 227.18620 100.74441 1.000 91.86412  ?  431 HIS B CE1   1 
ATOM   6515  N NE2   . HIS B 1 431 ? 194.92290 227.51830 100.40827 1.000 87.61071  ?  431 HIS B NE2   1 
ATOM   6516  N N     . GLN B 1 432 ? 196.37767 223.75035 100.04247 1.000 97.53312  ?  432 GLN B N     1 
ATOM   6517  C CA    . GLN B 1 432 ? 197.30398 223.81652 98.91569  1.000 102.42914 ?  432 GLN B CA    1 
ATOM   6518  C C     . GLN B 1 432 ? 197.94925 225.19306 98.94880  1.000 103.70313 ?  432 GLN B C     1 
ATOM   6519  O O     . GLN B 1 432 ? 197.49030 226.13969 98.30880  1.000 103.33165 ?  432 GLN B O     1 
ATOM   6520  C CB    . GLN B 1 432 ? 196.56191 223.56045 97.60646  1.000 106.47878 ?  432 GLN B CB    1 
ATOM   6521  C CG    . GLN B 1 432 ? 197.45421 223.15587 96.43277  1.000 120.37722 ?  432 GLN B CG    1 
ATOM   6522  C CD    . GLN B 1 432 ? 196.88987 221.99845 95.60958  1.000 128.20639 ?  432 GLN B CD    1 
ATOM   6523  O OE1   . GLN B 1 432 ? 196.92867 220.84072 96.04044  1.000 132.82175 ?  432 GLN B OE1   1 
ATOM   6524  N NE2   . GLN B 1 432 ? 196.42179 222.30201 94.39139  1.000 115.77743 ?  432 GLN B NE2   1 
ATOM   6525  N N     . ALA B 1 433 ? 199.07287 225.27381 99.65743  1.000 103.26559 ?  433 ALA B N     1 
ATOM   6526  C CA    . ALA B 1 433 ? 199.72975 226.54775 99.91241  1.000 94.28577  ?  433 ALA B CA    1 
ATOM   6527  C C     . ALA B 1 433 ? 200.20329 227.18445 98.61281  1.000 87.97194  ?  433 ALA B C     1 
ATOM   6528  O O     . ALA B 1 433 ? 200.88636 226.55098 97.80915  1.000 89.89707  ?  433 ALA B O     1 
ATOM   6529  C CB    . ALA B 1 433 ? 200.90892 226.32361 100.86198 1.000 90.96079  ?  433 ALA B CB    1 
ATOM   6530  N N     . ARG B 1 434 ? 199.82140 228.42677 98.39762  1.000 86.18936  ?  434 ARG B N     1 
ATOM   6531  C CA    . ARG B 1 434 ? 200.27030 229.15487 97.22009  1.000 88.46402  ?  434 ARG B CA    1 
ATOM   6532  C C     . ARG B 1 434 ? 201.67096 229.70151 97.45179  1.000 89.57767  ?  434 ARG B C     1 
ATOM   6533  O O     . ARG B 1 434 ? 202.13343 229.75317 98.59081  1.000 94.28130  ?  434 ARG B O     1 
ATOM   6534  C CB    . ARG B 1 434 ? 199.30523 230.28180 96.90300  1.000 92.50974  ?  434 ARG B CB    1 
ATOM   6535  C CG    . ARG B 1 434 ? 197.93017 229.83375 96.59599  1.000 90.47974  ?  434 ARG B CG    1 
ATOM   6536  C CD    . ARG B 1 434 ? 197.48645 230.45958 95.34563  1.000 86.23882  ?  434 ARG B CD    1 
ATOM   6537  N NE    . ARG B 1 434 ? 196.04582 230.33088 95.26558  1.000 87.08810  ?  434 ARG B NE    1 
ATOM   6538  C CZ    . ARG B 1 434 ? 195.23626 231.36035 95.09228  1.000 90.50571  ?  434 ARG B CZ    1 
ATOM   6539  N NH1   . ARG B 1 434 ? 195.70884 232.59067 94.98423  1.000 91.25151  ?  434 ARG B NH1   1 
ATOM   6540  N NH2   . ARG B 1 434 ? 193.92274 231.15054 95.02139  1.000 93.02345  ?  434 ARG B NH2   1 
ATOM   6541  N N     . PRO B 1 435 ? 202.36859 230.13038 96.37289  1.000 90.65695  ?  435 PRO B N     1 
ATOM   6542  C CA    . PRO B 1 435 ? 203.80216 230.46153 96.47327  1.000 90.23656  ?  435 PRO B CA    1 
ATOM   6543  C C     . PRO B 1 435 ? 204.23622 231.29620 97.67409  1.000 92.78304  ?  435 PRO B C     1 
ATOM   6544  O O     . PRO B 1 435 ? 204.98518 230.80108 98.51736  1.000 94.19021  ?  435 PRO B O     1 
ATOM   6545  C CB    . PRO B 1 435 ? 204.05251 231.23420 95.17463  1.000 98.16632  ?  435 PRO B CB    1 
ATOM   6546  C CG    . PRO B 1 435 ? 203.10744 230.63745 94.19121  1.000 103.52298 ?  435 PRO B CG    1 
ATOM   6547  C CD    . PRO B 1 435 ? 201.90187 230.15842 94.96944  1.000 100.10290 ?  435 PRO B CD    1 
ATOM   6548  N N     . ASN B 1 436 ? 203.78450 232.54393 97.79010  1.000 91.44612  ?  436 ASN B N     1 
ATOM   6549  C CA    . ASN B 1 436 ? 204.17185 233.40054 98.90845  1.000 92.95906  ?  436 ASN B CA    1 
ATOM   6550  C C     . ASN B 1 436 ? 203.00855 233.69959 99.82992  1.000 94.29338  ?  436 ASN B C     1 
ATOM   6551  O O     . ASN B 1 436 ? 202.98551 234.73677 100.49979 1.000 92.51982  ?  436 ASN B O     1 
ATOM   6552  C CB    . ASN B 1 436 ? 204.77935 234.70151 98.41939  1.000 91.93953  ?  436 ASN B CB    1 
ATOM   6553  C CG    . ASN B 1 436 ? 206.09352 234.48819 97.77975  1.000 95.82215  ?  436 ASN B CG    1 
ATOM   6554  O OD1   . ASN B 1 436 ? 207.06201 234.14684 98.45789  1.000 100.31363 ?  436 ASN B OD1   1 
ATOM   6555  N ND2   . ASN B 1 436 ? 206.14155 234.60161 96.46147  1.000 104.48197 ?  436 ASN B ND2   1 
ATOM   6556  N N     . SER B 1 437 ? 202.06544 232.77310 99.89998  1.000 91.26541  ?  437 SER B N     1 
ATOM   6557  C CA    . SER B 1 437 ? 200.84223 232.97939 100.64193 1.000 87.76587  ?  437 SER B CA    1 
ATOM   6558  C C     . SER B 1 437 ? 201.08963 232.88585 102.15034 1.000 85.38953  ?  437 SER B C     1 
ATOM   6559  O O     . SER B 1 437 ? 202.12056 232.39336 102.61859 1.000 81.87477  ?  437 SER B O     1 
ATOM   6560  C CB    . SER B 1 437 ? 199.80232 231.96200 100.17005 1.000 86.36363  ?  437 SER B CB    1 
ATOM   6561  O OG    . SER B 1 437 ? 200.08565 230.66320 100.66135 1.000 90.60608  ?  437 SER B OG    1 
ATOM   6562  N N     . PHE B 1 438 ? 200.09997 233.35260 102.91258 1.000 82.69398  ?  438 PHE B N     1 
ATOM   6563  C CA    . PHE B 1 438 ? 200.14020 233.19403 104.36149 1.000 80.57832  ?  438 PHE B CA    1 
ATOM   6564  C C     . PHE B 1 438 ? 200.17128 231.74172 104.76313 1.000 82.66643  ?  438 PHE B C     1 
ATOM   6565  O O     . PHE B 1 438 ? 200.80349 231.38779 105.76511 1.000 86.23800  ?  438 PHE B O     1 
ATOM   6566  C CB    . PHE B 1 438 ? 198.92442 233.85029 104.97547 1.000 80.56748  ?  438 PHE B CB    1 
ATOM   6567  C CG    . PHE B 1 438 ? 199.08018 235.29146 105.14722 1.000 76.83633  ?  438 PHE B CG    1 
ATOM   6568  C CD1   . PHE B 1 438 ? 198.82125 236.13148 104.09499 1.000 73.84538  ?  438 PHE B CD1   1 
ATOM   6569  C CD2   . PHE B 1 438 ? 199.38805 235.81332 106.37915 1.000 74.06044  ?  438 PHE B CD2   1 
ATOM   6570  C CE1   . PHE B 1 438 ? 198.94865 237.45027 104.23267 1.000 73.46878  ?  438 PHE B CE1   1 
ATOM   6571  C CE2   . PHE B 1 438 ? 199.50326 237.14143 106.53160 1.000 79.73853  ?  438 PHE B CE2   1 
ATOM   6572  C CZ    . PHE B 1 438 ? 199.28128 237.96934 105.44960 1.000 79.37134  ?  438 PHE B CZ    1 
ATOM   6573  N N     . ALA B 1 439 ? 199.48782 230.88818 104.00158 1.000 80.06514  ?  439 ALA B N     1 
ATOM   6574  C CA    . ALA B 1 439 ? 199.53979 229.46299 104.28330 1.000 78.22251  ?  439 ALA B CA    1 
ATOM   6575  C C     . ALA B 1 439 ? 200.96960 228.96460 104.22062 1.000 81.95294  ?  439 ALA B C     1 
ATOM   6576  O O     . ALA B 1 439 ? 201.44269 228.29330 105.14593 1.000 84.88108  ?  439 ALA B O     1 
ATOM   6577  C CB    . ALA B 1 439 ? 198.68794 228.70549 103.27500 1.000 81.32025  ?  439 ALA B CB    1 
ATOM   6578  N N     . GLU B 1 440 ? 201.69897 229.37113 103.17840 1.000 81.07600  ?  440 GLU B N     1 
ATOM   6579  C CA    . GLU B 1 440 ? 203.08589 228.95557 103.02544 1.000 82.50211  ?  440 GLU B CA    1 
ATOM   6580  C C     . GLU B 1 440 ? 203.92876 229.45667 104.18322 1.000 84.48589  ?  440 GLU B C     1 
ATOM   6581  O O     . GLU B 1 440 ? 204.76870 228.72050 104.71483 1.000 85.48668  ?  440 GLU B O     1 
ATOM   6582  C CB    . GLU B 1 440 ? 203.63126 229.47474 101.69361 1.000 91.17743  ?  440 GLU B CB    1 
ATOM   6583  C CG    . GLU B 1 440 ? 204.86761 228.73057 101.18262 1.000 98.84785  ?  440 GLU B CG    1 
ATOM   6584  C CD    . GLU B 1 440 ? 206.06207 229.63859 100.91363 1.000 101.38893 ?  440 GLU B CD    1 
ATOM   6585  O OE1   . GLU B 1 440 ? 205.96863 230.85720 101.18645 1.000 106.51824 ?  440 GLU B OE1   1 
ATOM   6586  O OE2   . GLU B 1 440 ? 207.09556 229.13020 100.41987 1.000 94.26166  ?  440 GLU B OE2   1 
ATOM   6587  N N     . PHE B 1 441 ? 203.71037 230.70898 104.59240 1.000 87.72211  ?  441 PHE B N     1 
ATOM   6588  C CA    . PHE B 1 441 ? 204.41896 231.24158 105.74834 1.000 87.25234  ?  441 PHE B CA    1 
ATOM   6589  C C     . PHE B 1 441 ? 204.10497 230.42039 106.98618 1.000 83.55157  ?  441 PHE B C     1 
ATOM   6590  O O     . PHE B 1 441 ? 204.99325 230.13051 107.79577 1.000 85.33643  ?  441 PHE B O     1 
ATOM   6591  C CB    . PHE B 1 441 ? 204.06518 232.70797 105.97904 1.000 83.95817  ?  441 PHE B CB    1 
ATOM   6592  C CG    . PHE B 1 441 ? 204.71310 233.30764 107.21247 1.000 78.89640  ?  441 PHE B CG    1 
ATOM   6593  C CD1   . PHE B 1 441 ? 204.16012 233.14243 108.47398 1.000 77.02102  ?  441 PHE B CD1   1 
ATOM   6594  C CD2   . PHE B 1 441 ? 205.85137 234.07495 107.08862 1.000 78.61816  ?  441 PHE B CD2   1 
ATOM   6595  C CE1   . PHE B 1 441 ? 204.75050 233.70375 109.57149 1.000 82.57141  ?  441 PHE B CE1   1 
ATOM   6596  C CE2   . PHE B 1 441 ? 206.44023 234.63833 108.18968 1.000 82.22756  ?  441 PHE B CE2   1 
ATOM   6597  C CZ    . PHE B 1 441 ? 205.89165 234.45878 109.42475 1.000 84.40179  ?  441 PHE B CZ    1 
ATOM   6598  N N     . LEU B 1 442 ? 202.83907 230.07135 107.18542 1.000 77.49730  ?  442 LEU B N     1 
ATOM   6599  C CA    . LEU B 1 442 ? 202.55963 229.28201 108.37128 1.000 84.12606  ?  442 LEU B CA    1 
ATOM   6600  C C     . LEU B 1 442 ? 203.25484 227.92860 108.28459 1.000 84.18642  ?  442 LEU B C     1 
ATOM   6601  O O     . LEU B 1 442 ? 203.90315 227.49626 109.24709 1.000 85.22737  ?  442 LEU B O     1 
ATOM   6602  C CB    . LEU B 1 442 ? 201.05468 229.14260 108.61528 1.000 84.30446  ?  442 LEU B CB    1 
ATOM   6603  C CG    . LEU B 1 442 ? 200.36141 230.37168 109.22652 1.000 76.88463  ?  442 LEU B CG    1 
ATOM   6604  C CD1   . LEU B 1 442 ? 198.85464 230.17217 109.30214 1.000 77.95327  ?  442 LEU B CD1   1 
ATOM   6605  C CD2   . LEU B 1 442 ? 200.94019 230.68270 110.58941 1.000 73.83702  ?  442 LEU B CD2   1 
ATOM   6606  N N     . ASN B 1 443 ? 203.25076 227.30869 107.10430 1.000 83.26990  ?  443 ASN B N     1 
ATOM   6607  C CA    . ASN B 1 443 ? 203.84519 225.98036 106.99143 1.000 87.96220  ?  443 ASN B CA    1 
ATOM   6608  C C     . ASN B 1 443 ? 205.34315 226.01903 107.25309 1.000 93.06504  ?  443 ASN B C     1 
ATOM   6609  O O     . ASN B 1 443 ? 205.86408 225.20603 108.02450 1.000 99.37763  ?  443 ASN B O     1 
ATOM   6610  C CB    . ASN B 1 443 ? 203.55765 225.39426 105.62274 1.000 88.69540  ?  443 ASN B CB    1 
ATOM   6611  C CG    . ASN B 1 443 ? 202.59530 224.25863 105.70853 1.000 94.24130  ?  443 ASN B CG    1 
ATOM   6612  O OD1   . ASN B 1 443 ? 202.41113 223.66597 106.77825 1.000 89.65544  ?  443 ASN B OD1   1 
ATOM   6613  N ND2   . ASN B 1 443 ? 201.95289 223.94452 104.59202 1.000 99.31598  ?  443 ASN B ND2   1 
ATOM   6614  N N     . LYS B 1 444 ? 206.05279 226.97795 106.63212 1.000 92.89656  ?  444 LYS B N     1 
ATOM   6615  C CA    . LYS B 1 444 ? 207.49742 227.10731 106.83140 1.000 84.35043  ?  444 LYS B CA    1 
ATOM   6616  C C     . LYS B 1 444 ? 207.82823 227.50662 108.26322 1.000 90.66428  ?  444 LYS B C     1 
ATOM   6617  O O     . LYS B 1 444 ? 208.86714 227.10072 108.78411 1.000 94.55075  ?  444 LYS B O     1 
ATOM   6618  C CB    . LYS B 1 444 ? 208.09800 228.13545 105.87285 1.000 76.06682  ?  444 LYS B CB    1 
ATOM   6619  C CG    . LYS B 1 444 ? 208.64407 227.58209 104.56823 1.000 80.92509  ?  444 LYS B CG    1 
ATOM   6620  C CD    . LYS B 1 444 ? 207.48979 227.11846 103.69872 1.000 96.20336  ?  444 LYS B CD    1 
ATOM   6621  C CE    . LYS B 1 444 ? 207.96641 226.41930 102.42268 1.000 110.17041 ?  444 LYS B CE    1 
ATOM   6622  N NZ    . LYS B 1 444 ? 206.88487 225.71859 101.63335 1.000 105.71165 ?  444 LYS B NZ    1 
ATOM   6623  N N     . THR B 1 445 ? 206.98110 228.30864 108.91431 1.000 92.10202  ?  445 THR B N     1 
ATOM   6624  C CA    . THR B 1 445 ? 207.37298 228.84095 110.21712 1.000 92.20115  ?  445 THR B CA    1 
ATOM   6625  C C     . THR B 1 445 ? 207.13713 227.86894 111.37013 1.000 95.66011  ?  445 THR B C     1 
ATOM   6626  O O     . THR B 1 445 ? 208.04771 227.62909 112.16734 1.000 101.08659 ?  445 THR B O     1 
ATOM   6627  C CB    . THR B 1 445 ? 206.66656 230.15773 110.50122 1.000 91.56192  ?  445 THR B CB    1 
ATOM   6628  O OG1   . THR B 1 445 ? 206.96611 231.09409 109.45081 1.000 85.00821  ?  445 THR B OG1   1 
ATOM   6629  C CG2   . THR B 1 445 ? 207.14195 230.70582 111.84470 1.000 91.83918  ?  445 THR B CG2   1 
ATOM   6630  N N     . TYR B 1 446 ? 205.92190 227.33204 111.50949 1.000 93.92409  ?  446 TYR B N     1 
ATOM   6631  C CA    . TYR B 1 446 ? 205.55273 226.43970 112.62450 1.000 96.39636  ?  446 TYR B CA    1 
ATOM   6632  C C     . TYR B 1 446 ? 205.26801 225.05773 112.03910 1.000 105.30659 ?  446 TYR B C     1 
ATOM   6633  O O     . TYR B 1 446 ? 204.22809 224.85646 111.41300 1.000 110.84136 ?  446 TYR B O     1 
ATOM   6634  C CB    . TYR B 1 446 ? 204.32752 226.97375 113.36671 1.000 90.81781  ?  446 TYR B CB    1 
ATOM   6635  C CG    . TYR B 1 446 ? 204.31186 228.47116 113.65043 1.000 92.75160  ?  446 TYR B CG    1 
ATOM   6636  C CD1   . TYR B 1 446 ? 204.86716 229.00334 114.81375 1.000 89.59362  ?  446 TYR B CD1   1 
ATOM   6637  C CD2   . TYR B 1 446 ? 203.81925 229.36077 112.70464 1.000 91.53203  ?  446 TYR B CD2   1 
ATOM   6638  C CE1   . TYR B 1 446 ? 204.85846 230.38718 115.06026 1.000 88.18916  ?  446 TYR B CE1   1 
ATOM   6639  C CE2   . TYR B 1 446 ? 203.81861 230.72844 112.92738 1.000 89.37846  ?  446 TYR B CE2   1 
ATOM   6640  C CZ    . TYR B 1 446 ? 204.33743 231.24620 114.10187 1.000 88.69047  ?  446 TYR B CZ    1 
ATOM   6641  O OH    . TYR B 1 446 ? 204.32293 232.62214 114.28282 1.000 85.14156  ?  446 TYR B OH    1 
ATOM   6642  N N     . SER B 1 447 ? 206.20561 224.12116 112.15267 1.000 110.71109 ?  447 SER B N     1 
ATOM   6643  C CA    . SER B 1 447 ? 205.96922 222.79207 111.58852 1.000 113.66566 ?  447 SER B CA    1 
ATOM   6644  C C     . SER B 1 447 ? 206.31645 221.61854 112.48730 1.000 114.74540 ?  447 SER B C     1 
ATOM   6645  O O     . SER B 1 447 ? 206.19057 220.47318 112.03976 1.000 118.23863 ?  447 SER B O     1 
ATOM   6646  C CB    . SER B 1 447 ? 206.69660 222.61579 110.25117 1.000 108.84278 ?  447 SER B CB    1 
ATOM   6647  O OG    . SER B 1 447 ? 206.01085 223.34402 109.25260 1.000 104.46218 ?  447 SER B OG    1 
ATOM   6648  N N     . SER B 1 448 ? 206.87171 221.84500 113.66280 1.000 109.13362 ?  448 SER B N     1 
ATOM   6649  C CA    . SER B 1 448 ? 207.12631 220.71180 114.52242 1.000 116.96509 ?  448 SER B CA    1 
ATOM   6650  C C     . SER B 1 448 ? 206.73131 221.01307 115.96958 1.000 116.43635 ?  448 SER B C     1 
ATOM   6651  O O     . SER B 1 448 ? 206.61374 220.10456 116.79610 1.000 116.62854 ?  448 SER B O     1 
ATOM   6652  C CB    . SER B 1 448 ? 208.60291 220.31111 114.41584 1.000 119.76288 ?  448 SER B CB    1 
ATOM   6653  O OG    . SER B 1 448 ? 208.94086 219.91653 113.08601 1.000 113.47789 ?  448 SER B OG    1 
ATOM   6654  N N     . ILE C 1 6   ? 181.11945 256.55972 116.96269 1.000 92.69752  ?  6   ILE C N     1 
ATOM   6655  C CA    . ILE C 1 6   ? 182.14702 256.44174 117.99426 1.000 105.82672 ?  6   ILE C CA    1 
ATOM   6656  C C     . ILE C 1 6   ? 183.54353 256.69535 117.42336 1.000 107.04084 ?  6   ILE C C     1 
ATOM   6657  O O     . ILE C 1 6   ? 183.76621 256.67122 116.20878 1.000 103.16223 ?  6   ILE C O     1 
ATOM   6658  C CB    . ILE C 1 6   ? 182.03939 255.07452 118.70063 1.000 106.71807 ?  6   ILE C CB    1 
ATOM   6659  C CG1   . ILE C 1 6   ? 181.90978 253.97120 117.64690 1.000 109.20797 ?  6   ILE C CG1   1 
ATOM   6660  C CG2   . ILE C 1 6   ? 180.89136 255.07475 119.72063 1.000 98.71490  ?  6   ILE C CG2   1 
ATOM   6661  C CD1   . ILE C 1 6   ? 181.68809 252.57347 118.19368 1.000 108.10451 ?  6   ILE C CD1   1 
ATOM   6662  N N     . VAL C 1 7   ? 184.45506 257.06766 118.31882 1.000 111.52642 ?  7   VAL C N     1 
ATOM   6663  C CA    . VAL C 1 7   ? 185.82314 257.41282 117.96520 1.000 112.59897 ?  7   VAL C CA    1 
ATOM   6664  C C     . VAL C 1 7   ? 186.77762 256.57573 118.81648 1.000 107.10970 ?  7   VAL C C     1 
ATOM   6665  O O     . VAL C 1 7   ? 186.38828 255.97623 119.81810 1.000 111.17459 ?  7   VAL C O     1 
ATOM   6666  C CB    . VAL C 1 7   ? 186.08103 258.94601 118.11138 1.000 121.81029 ?  7   VAL C CB    1 
ATOM   6667  C CG1   . VAL C 1 7   ? 185.43011 259.73369 116.93352 1.000 109.96271 ?  7   VAL C CG1   1 
ATOM   6668  C CG2   . VAL C 1 7   ? 185.57708 259.49038 119.46315 1.000 109.22659 ?  7   VAL C CG2   1 
ATOM   6669  N N     . PHE C 1 8   ? 188.02735 256.50253 118.38104 1.000 104.61492 ?  8   PHE C N     1 
ATOM   6670  C CA    . PHE C 1 8   ? 189.09160 255.86087 119.13947 1.000 106.67546 ?  8   PHE C CA    1 
ATOM   6671  C C     . PHE C 1 8   ? 190.18164 256.90937 119.33001 1.000 109.69189 ?  8   PHE C C     1 
ATOM   6672  O O     . PHE C 1 8   ? 190.33860 257.81784 118.50317 1.000 112.72370 ?  8   PHE C O     1 
ATOM   6673  C CB    . PHE C 1 8   ? 189.65778 254.60847 118.44348 1.000 97.37513  ?  8   PHE C CB    1 
ATOM   6674  C CG    . PHE C 1 8   ? 190.05693 254.87001 117.03436 1.000 108.95139 ?  8   PHE C CG    1 
ATOM   6675  C CD1   . PHE C 1 8   ? 191.32629 255.34012 116.72008 1.000 111.04238 ?  8   PHE C CD1   1 
ATOM   6676  C CD2   . PHE C 1 8   ? 189.15511 254.65345 115.99572 1.000 123.05440 ?  8   PHE C CD2   1 
ATOM   6677  C CE1   . PHE C 1 8   ? 191.68960 255.61382 115.38689 1.000 119.63424 ?  8   PHE C CE1   1 
ATOM   6678  C CE2   . PHE C 1 8   ? 189.51159 254.90925 114.65121 1.000 130.41997 ?  8   PHE C CE2   1 
ATOM   6679  C CZ    . PHE C 1 8   ? 190.78366 255.39036 114.35302 1.000 126.34056 ?  8   PHE C CZ    1 
ATOM   6680  N N     . LYS C 1 9   ? 190.92199 256.79147 120.43228 1.000 102.61412 ?  9   LYS C N     1 
ATOM   6681  C CA    . LYS C 1 9   ? 191.95995 257.74154 120.80602 1.000 96.66521  ?  9   LYS C CA    1 
ATOM   6682  C C     . LYS C 1 9   ? 193.28595 257.00865 120.81388 1.000 98.34600  ?  9   LYS C C     1 
ATOM   6683  O O     . LYS C 1 9   ? 193.46029 256.03448 121.55768 1.000 92.11990  ?  9   LYS C O     1 
ATOM   6684  C CB    . LYS C 1 9   ? 191.72663 258.31144 122.18803 1.000 106.83515 ?  9   LYS C CB    1 
ATOM   6685  C CG    . LYS C 1 9   ? 190.29663 258.68599 122.50022 1.000 119.15952 ?  9   LYS C CG    1 
ATOM   6686  C CD    . LYS C 1 9   ? 189.85290 259.94479 121.78582 1.000 118.83763 ?  9   LYS C CD    1 
ATOM   6687  C CE    . LYS C 1 9   ? 188.38501 260.21759 122.11918 1.000 123.28139 ?  9   LYS C CE    1 
ATOM   6688  N NZ    . LYS C 1 9   ? 187.82660 261.47380 121.54911 1.000 111.20950 ?  9   LYS C NZ    1 
ATOM   6689  N N     . VAL C 1 10  ? 194.22244 257.51102 120.01424 1.000 105.54096 ?  10  VAL C N     1 
ATOM   6690  C CA    . VAL C 1 10  ? 195.51310 256.87997 119.77277 1.000 103.93922 ?  10  VAL C CA    1 
ATOM   6691  C C     . VAL C 1 10  ? 196.55204 257.60359 120.59995 1.000 108.66595 ?  10  VAL C C     1 
ATOM   6692  O O     . VAL C 1 10  ? 196.50010 258.83153 120.74044 1.000 104.78860 ?  10  VAL C O     1 
ATOM   6693  C CB    . VAL C 1 10  ? 195.88594 256.93080 118.27310 1.000 99.53210  ?  10  VAL C CB    1 
ATOM   6694  C CG1   . VAL C 1 10  ? 197.08200 256.08110 117.97146 1.000 98.40425  ?  10  VAL C CG1   1 
ATOM   6695  C CG2   . VAL C 1 10  ? 194.72845 256.50045 117.41278 1.000 96.74960  ?  10  VAL C CG2   1 
ATOM   6696  N N     . ASN C 1 11  ? 197.47216 256.83558 121.17163 1.000 115.03828 ?  11  ASN C N     1 
ATOM   6697  C CA    . ASN C 1 11  ? 198.55195 257.41427 121.95609 1.000 127.59204 ?  11  ASN C CA    1 
ATOM   6698  C C     . ASN C 1 11  ? 199.59102 258.01708 121.01509 1.000 129.39548 ?  11  ASN C C     1 
ATOM   6699  O O     . ASN C 1 11  ? 199.92628 257.42215 119.98574 1.000 125.53107 ?  11  ASN C O     1 
ATOM   6700  C CB    . ASN C 1 11  ? 199.17511 256.33573 122.85284 1.000 126.53362 ?  11  ASN C CB    1 
ATOM   6701  C CG    . ASN C 1 11  ? 200.25141 256.87528 123.76556 1.000 131.91801 ?  11  ASN C CG    1 
ATOM   6702  O OD1   . ASN C 1 11  ? 201.29222 256.23701 123.94724 1.000 133.89659 ?  11  ASN C OD1   1 
ATOM   6703  N ND2   . ASN C 1 11  ? 200.02418 258.06293 124.32551 1.000 128.39024 ?  11  ASN C ND2   1 
ATOM   6704  N N     . ASN C 1 12  ? 200.07750 259.21444 121.34229 1.000 132.58252 ?  12  ASN C N     1 
ATOM   6705  C CA    . ASN C 1 12  ? 201.13626 259.82090 120.54280 1.000 131.93784 ?  12  ASN C CA    1 
ATOM   6706  C C     . ASN C 1 12  ? 201.81276 260.88299 121.40740 1.000 138.94796 ?  12  ASN C C     1 
ATOM   6707  O O     . ASN C 1 12  ? 201.55484 260.97440 122.61466 1.000 140.80349 ?  12  ASN C O     1 
ATOM   6708  C CB    . ASN C 1 12  ? 200.55851 260.43064 119.26160 1.000 125.09135 ?  12  ASN C CB    1 
ATOM   6709  C CG    . ASN C 1 12  ? 201.09225 259.76929 118.01167 1.000 124.64198 ?  12  ASN C CG    1 
ATOM   6710  O OD1   . ASN C 1 12  ? 201.84945 258.79927 118.07736 1.000 114.89418 ?  12  ASN C OD1   1 
ATOM   6711  N ND2   . ASN C 1 12  ? 200.72762 260.31334 116.86000 1.000 129.83083 ?  12  ASN C ND2   1 
ATOM   6712  N N     . GLN C 1 13  ? 202.69950 261.68182 120.79772 1.000 131.56419 ?  13  GLN C N     1 
ATOM   6713  C CA    . GLN C 1 13  ? 203.26959 262.81792 121.52392 1.000 140.92382 ?  13  GLN C CA    1 
ATOM   6714  C C     . GLN C 1 13  ? 202.15495 263.71913 122.04037 1.000 143.25773 ?  13  GLN C C     1 
ATOM   6715  O O     . GLN C 1 13  ? 202.20501 264.19348 123.18287 1.000 129.21268 ?  13  GLN C O     1 
ATOM   6716  C CB    . GLN C 1 13  ? 204.22412 263.59340 120.61817 1.000 132.46151 ?  13  GLN C CB    1 
ATOM   6717  C CG    . GLN C 1 13  ? 205.25538 262.72468 119.95734 1.000 122.92556 ?  13  GLN C CG    1 
ATOM   6718  C CD    . GLN C 1 13  ? 204.71958 262.16738 118.67172 1.000 130.10749 ?  13  GLN C CD    1 
ATOM   6719  O OE1   . GLN C 1 13  ? 203.81596 262.74621 118.06919 1.000 134.47972 ?  13  GLN C OE1   1 
ATOM   6720  N NE2   . GLN C 1 13  ? 205.27773 261.05027 118.22755 1.000 128.46047 ?  13  GLN C NE2   1 
ATOM   6721  N N     . VAL C 1 14  ? 201.12936 263.94002 121.20983 1.000 147.20317 ?  14  VAL C N     1 
ATOM   6722  C CA    . VAL C 1 14  ? 199.88987 264.60996 121.58855 1.000 142.94568 ?  14  VAL C CA    1 
ATOM   6723  C C     . VAL C 1 14  ? 198.76613 263.62538 121.25582 1.000 140.42972 ?  14  VAL C C     1 
ATOM   6724  O O     . VAL C 1 14  ? 198.82227 262.94058 120.22356 1.000 133.70104 ?  14  VAL C O     1 
ATOM   6725  C CB    . VAL C 1 14  ? 199.70695 265.97130 120.86369 1.000 130.07341 ?  14  VAL C CB    1 
ATOM   6726  C CG1   . VAL C 1 14  ? 198.45570 266.70708 121.37312 1.000 118.68465 ?  14  VAL C CG1   1 
ATOM   6727  C CG2   . VAL C 1 14  ? 200.97178 266.85551 120.98007 1.000 123.29611 ?  14  VAL C CG2   1 
ATOM   6728  N N     . VAL C 1 15  ? 197.73593 263.56945 122.10803 1.000 131.41989 ?  15  VAL C N     1 
ATOM   6729  C CA    . VAL C 1 15  ? 196.67043 262.58592 121.93063 1.000 123.27018 ?  15  VAL C CA    1 
ATOM   6730  C C     . VAL C 1 15  ? 195.77614 262.98209 120.75938 1.000 125.32422 ?  15  VAL C C     1 
ATOM   6731  O O     . VAL C 1 15  ? 195.37975 264.14999 120.61005 1.000 128.54189 ?  15  VAL C O     1 
ATOM   6732  C CB    . VAL C 1 15  ? 195.87370 262.44128 123.23838 1.000 117.72203 ?  15  VAL C CB    1 
ATOM   6733  C CG1   . VAL C 1 15  ? 194.77312 261.41138 123.09964 1.000 118.21398 ?  15  VAL C CG1   1 
ATOM   6734  C CG2   . VAL C 1 15  ? 196.81371 262.02356 124.35929 1.000 112.94858 ?  15  VAL C CG2   1 
ATOM   6735  N N     . SER C 1 16  ? 195.46332 262.00471 119.90408 1.000 126.29235 ?  16  SER C N     1 
ATOM   6736  C CA    . SER C 1 16  ? 194.67497 262.22714 118.69530 1.000 118.68575 ?  16  SER C CA    1 
ATOM   6737  C C     . SER C 1 16  ? 193.50884 261.24522 118.63022 1.000 111.84824 ?  16  SER C C     1 
ATOM   6738  O O     . SER C 1 16  ? 193.61340 260.10453 119.09534 1.000 110.57016 ?  16  SER C O     1 
ATOM   6739  C CB    . SER C 1 16  ? 195.55975 262.14660 117.45249 1.000 101.93664 ?  16  SER C CB    1 
ATOM   6740  O OG    . SER C 1 16  ? 196.20704 260.89685 117.36543 1.000 107.99175 ?  16  SER C OG    1 
ATOM   6741  N N     . LEU C 1 17  ? 192.35797 261.76260 118.20869 1.000 104.71049 ?  17  LEU C N     1 
ATOM   6742  C CA    . LEU C 1 17  ? 191.11029 261.02082 118.06018 1.000 106.96605 ?  17  LEU C CA    1 
ATOM   6743  C C     . LEU C 1 17  ? 190.71361 260.95842 116.59272 1.000 103.55724 ?  17  LEU C C     1 
ATOM   6744  O O     . LEU C 1 17  ? 190.69244 261.99219 115.91720 1.000 104.23206 ?  17  LEU C O     1 
ATOM   6745  C CB    . LEU C 1 17  ? 189.99111 261.67840 118.87944 1.000 113.57650 ?  17  LEU C CB    1 
ATOM   6746  C CG    . LEU C 1 17  ? 189.57992 263.12670 118.53791 1.000 116.83541 ?  17  LEU C CG    1 
ATOM   6747  C CD1   . LEU C 1 17  ? 188.39834 263.21547 117.54536 1.000 111.85767 ?  17  LEU C CD1   1 
ATOM   6748  C CD2   . LEU C 1 17  ? 189.34778 263.98025 119.80267 1.000 105.13542 ?  17  LEU C CD2   1 
ATOM   6749  N N     . LYS C 1 18  ? 190.44394 259.75124 116.08653 1.000 104.32281 ?  18  LYS C N     1 
ATOM   6750  C CA    . LYS C 1 18  ? 190.02313 259.57471 114.69399 1.000 104.36861 ?  18  LYS C CA    1 
ATOM   6751  C C     . LYS C 1 18  ? 188.73002 258.76307 114.66033 1.000 105.60551 ?  18  LYS C C     1 
ATOM   6752  O O     . LYS C 1 18  ? 188.49226 257.93554 115.55888 1.000 98.90754  ?  18  LYS C O     1 
ATOM   6753  C CB    . LYS C 1 18  ? 191.11895 258.92596 113.80600 1.000 98.54027  ?  18  LYS C CB    1 
ATOM   6754  C CG    . LYS C 1 18  ? 192.30177 259.87897 113.44810 1.000 100.46177 ?  18  LYS C CG    1 
ATOM   6755  C CD    . LYS C 1 18  ? 192.99577 259.59545 112.09660 1.000 103.34757 ?  18  LYS C CD    1 
ATOM   6756  C CE    . LYS C 1 18  ? 194.02283 260.69724 111.71434 1.000 106.50465 ?  18  LYS C CE    1 
ATOM   6757  N NZ    . LYS C 1 18  ? 194.54990 260.52810 110.32012 1.000 104.75208 ?  18  LYS C NZ    1 
ATOM   6758  N N     . PRO C 1 19  ? 187.79058 259.12842 113.79299 1.000 106.68876 ?  19  PRO C N     1 
ATOM   6759  C CA    . PRO C 1 19  ? 186.61787 258.28520 113.52899 1.000 103.13607 ?  19  PRO C CA    1 
ATOM   6760  C C     . PRO C 1 19  ? 186.90424 257.24891 112.44807 1.000 105.24218 ?  19  PRO C C     1 
ATOM   6761  O O     . PRO C 1 19  ? 187.46381 257.55094 111.39095 1.000 107.73636 ?  19  PRO C O     1 
ATOM   6762  C CB    . PRO C 1 19  ? 185.57286 259.28525 113.02915 1.000 100.40399 ?  19  PRO C CB    1 
ATOM   6763  C CG    . PRO C 1 19  ? 186.39774 260.41292 112.42826 1.000 103.94359 ?  19  PRO C CG    1 
ATOM   6764  C CD    . PRO C 1 19  ? 187.65542 260.48567 113.24245 1.000 106.65496 ?  19  PRO C CD    1 
ATOM   6765  N N     . GLU C 1 20  ? 186.45717 256.02830 112.69125 1.000 102.00803 ?  20  GLU C N     1 
ATOM   6766  C CA    . GLU C 1 20  ? 186.64673 254.91980 111.76010 1.000 101.12560 ?  20  GLU C CA    1 
ATOM   6767  C C     . GLU C 1 20  ? 185.47985 254.88996 110.76538 1.000 106.27579 ?  20  GLU C C     1 
ATOM   6768  O O     . GLU C 1 20  ? 184.31060 254.87302 111.16120 1.000 107.22287 ?  20  GLU C O     1 
ATOM   6769  C CB    . GLU C 1 20  ? 186.74678 253.61316 112.54058 1.000 99.50351  ?  20  GLU C CB    1 
ATOM   6770  C CG    . GLU C 1 20  ? 185.45257 253.23557 113.29581 1.000 112.59095 ?  20  GLU C CG    1 
ATOM   6771  C CD    . GLU C 1 20  ? 185.13816 254.08730 114.52859 1.000 127.53610 ?  20  GLU C CD    1 
ATOM   6772  O OE1   . GLU C 1 20  ? 186.06239 254.72005 115.08573 1.000 125.54136 ?  20  GLU C OE1   1 
ATOM   6773  O OE2   . GLU C 1 20  ? 183.95692 254.09346 114.96554 1.000 132.57829 ?  20  GLU C OE2   1 
ATOM   6774  N N     . ILE C 1 21  ? 185.77905 254.91755 109.47691 1.000 105.54236 ?  21  ILE C N     1 
ATOM   6775  C CA    . ILE C 1 21  ? 184.72824 255.01017 108.47197 1.000 106.98271 ?  21  ILE C CA    1 
ATOM   6776  C C     . ILE C 1 21  ? 184.81841 253.80859 107.53243 1.000 113.34997 ?  21  ILE C C     1 
ATOM   6777  O O     . ILE C 1 21  ? 185.89771 253.49026 107.01638 1.000 113.34113 ?  21  ILE C O     1 
ATOM   6778  C CB    . ILE C 1 21  ? 184.79519 256.34770 107.70947 1.000 113.81076 ?  21  ILE C CB    1 
ATOM   6779  C CG1   . ILE C 1 21  ? 186.23326 256.65980 107.23273 1.000 116.40995 ?  21  ILE C CG1   1 
ATOM   6780  C CG2   . ILE C 1 21  ? 184.26570 257.45680 108.60664 1.000 101.47507 ?  21  ILE C CG2   1 
ATOM   6781  C CD1   . ILE C 1 21  ? 186.42757 258.03051 106.53685 1.000 115.32364 ?  21  ILE C CD1   1 
ATOM   6782  N N     . ILE C 1 22  ? 183.70117 253.09961 107.37469 1.000 116.09681 ?  22  ILE C N     1 
ATOM   6783  C CA    . ILE C 1 22  ? 183.58505 251.97776 106.45269 1.000 114.26697 ?  22  ILE C CA    1 
ATOM   6784  C C     . ILE C 1 22  ? 182.21241 252.07842 105.79747 1.000 118.03664 ?  22  ILE C C     1 
ATOM   6785  O O     . ILE C 1 22  ? 181.29529 252.70272 106.33449 1.000 121.18664 ?  22  ILE C O     1 
ATOM   6786  C CB    . ILE C 1 22  ? 183.78727 250.62407 107.15695 1.000 99.69815  ?  22  ILE C CB    1 
ATOM   6787  C CG1   . ILE C 1 22  ? 182.79779 250.51809 108.33083 1.000 104.46764 ?  22  ILE C CG1   1 
ATOM   6788  C CG2   . ILE C 1 22  ? 185.26221 250.49057 107.54228 1.000 86.38496  ?  22  ILE C CG2   1 
ATOM   6789  C CD1   . ILE C 1 22  ? 182.74087 249.18040 109.06596 1.000 101.23870 ?  22  ILE C CD1   1 
ATOM   6790  N N     . VAL C 1 23  ? 182.07239 251.48944 104.61482 1.000 111.99294 ?  23  VAL C N     1 
ATOM   6791  C CA    . VAL C 1 23  ? 180.81748 251.62441 103.88370 1.000 112.05953 ?  23  VAL C CA    1 
ATOM   6792  C C     . VAL C 1 23  ? 179.84517 250.59317 104.44402 1.000 117.64039 ?  23  VAL C C     1 
ATOM   6793  O O     . VAL C 1 23  ? 180.19702 249.42305 104.61852 1.000 114.75387 ?  23  VAL C O     1 
ATOM   6794  C CB    . VAL C 1 23  ? 181.04333 251.42279 102.38171 1.000 101.43445 ?  23  VAL C CB    1 
ATOM   6795  C CG1   . VAL C 1 23  ? 179.80299 251.86269 101.53964 1.000 95.94473  ?  23  VAL C CG1   1 
ATOM   6796  C CG2   . VAL C 1 23  ? 182.29722 252.14338 102.00143 1.000 100.75561 ?  23  VAL C CG2   1 
ATOM   6797  N N     . ASP C 1 24  ? 178.63897 251.03995 104.79554 1.000 118.09008 ?  24  ASP C N     1 
ATOM   6798  C CA    . ASP C 1 24  ? 177.58427 250.15457 105.29973 1.000 120.72920 ?  24  ASP C CA    1 
ATOM   6799  C C     . ASP C 1 24  ? 176.22903 250.74624 104.89081 1.000 123.10602 ?  24  ASP C C     1 
ATOM   6800  O O     . ASP C 1 24  ? 175.43723 251.23848 105.68019 1.000 129.89959 ?  24  ASP C O     1 
ATOM   6801  C CB    . ASP C 1 24  ? 177.71247 249.95147 106.81114 1.000 117.78240 ?  24  ASP C CB    1 
ATOM   6802  C CG    . ASP C 1 24  ? 178.03695 251.24031 107.53704 1.000 126.74230 ?  24  ASP C CG    1 
ATOM   6803  O OD1   . ASP C 1 24  ? 177.83352 252.30877 106.92515 1.000 132.64657 ?  24  ASP C OD1   1 
ATOM   6804  O OD2   . ASP C 1 24  ? 178.46285 251.19356 108.71255 1.000 130.53561 ?  24  ASP C OD2   1 
ATOM   6805  N N     . GLN C 1 25  ? 175.91316 250.66192 103.60576 1.000 121.77765 ?  25  GLN C N     1 
ATOM   6806  C CA    . GLN C 1 25  ? 174.68733 251.24597 103.07151 1.000 129.34486 ?  25  GLN C CA    1 
ATOM   6807  C C     . GLN C 1 25  ? 173.92173 250.23426 102.22899 1.000 134.55993 ?  25  GLN C C     1 
ATOM   6808  O O     . GLN C 1 25  ? 174.52598 249.47760 101.46448 1.000 137.27489 ?  25  GLN C O     1 
ATOM   6809  C CB    . GLN C 1 25  ? 175.00803 252.50150 102.24437 1.000 129.93947 ?  25  GLN C CB    1 
ATOM   6810  C CG    . GLN C 1 25  ? 173.80855 253.09801 101.50747 1.000 127.80647 ?  25  GLN C CG    1 
ATOM   6811  C CD    . GLN C 1 25  ? 172.75199 253.68821 102.42231 1.000 128.27156 ?  25  GLN C CD    1 
ATOM   6812  O OE1   . GLN C 1 25  ? 173.06095 254.25553 103.47885 1.000 126.52063 ?  25  GLN C OE1   1 
ATOM   6813  N NE2   . GLN C 1 25  ? 171.49332 253.54309 102.02730 1.000 126.56526 ?  25  GLN C NE2   1 
ATOM   6814  N N     . HIS C 1 26  ? 172.59639 250.19284 102.40105 1.000 133.20418 ?  26  HIS C N     1 
ATOM   6815  C CA    . HIS C 1 26  ? 171.74800 249.29205 101.62836 1.000 136.98415 ?  26  HIS C CA    1 
ATOM   6816  C C     . HIS C 1 26  ? 170.43147 249.96924 101.23446 1.000 128.74813 ?  26  HIS C C     1 
ATOM   6817  O O     . HIS C 1 26  ? 169.88011 250.76632 102.00014 1.000 130.11012 ?  26  HIS C O     1 
ATOM   6818  C CB    . HIS C 1 26  ? 171.50301 247.98750 102.41433 1.000 145.39353 ?  26  HIS C CB    1 
ATOM   6819  C CG    . HIS C 1 26  ? 172.47834 246.88477 102.09002 1.000 150.54808 ?  26  HIS C CG    1 
ATOM   6820  N ND1   . HIS C 1 26  ? 172.38784 246.11743 100.94367 1.000 147.27452 ?  26  HIS C ND1   1 
ATOM   6821  C CD2   . HIS C 1 26  ? 173.55285 246.41365 102.77218 1.000 147.68340 ?  26  HIS C CD2   1 
ATOM   6822  C CE1   . HIS C 1 26  ? 173.36675 245.22910 100.92951 1.000 141.10489 ?  26  HIS C CE1   1 
ATOM   6823  N NE2   . HIS C 1 26  ? 174.08786 245.38788 102.02720 1.000 147.68280 ?  26  HIS C NE2   1 
ATOM   6824  N N     . GLU C 1 27  ? 169.96243 249.69049 100.01487 1.000 128.14783 ?  27  GLU C N     1 
ATOM   6825  C CA    . GLU C 1 27  ? 168.70296 250.21006 99.47720  1.000 129.77671 ?  27  GLU C CA    1 
ATOM   6826  C C     . GLU C 1 27  ? 167.71316 249.07026 99.24776  1.000 121.31869 ?  27  GLU C C     1 
ATOM   6827  O O     . GLU C 1 27  ? 168.04357 248.09958 98.55151  1.000 113.03566 ?  27  GLU C O     1 
ATOM   6828  C CB    . GLU C 1 27  ? 168.93546 250.92852 98.13590  1.000 138.85381 ?  27  GLU C CB    1 
ATOM   6829  C CG    . GLU C 1 27  ? 167.65566 251.41267 97.44518  1.000 134.88300 ?  27  GLU C CG    1 
ATOM   6830  C CD    . GLU C 1 27  ? 167.10651 250.39453 96.44031  1.000 136.54964 ?  27  GLU C CD    1 
ATOM   6831  O OE1   . GLU C 1 27  ? 167.88142 249.53878 95.96146  1.000 130.72125 ?  27  GLU C OE1   1 
ATOM   6832  O OE2   . GLU C 1 27  ? 165.88924 250.45023 96.14432  1.000 139.41481 ?  27  GLU C OE2   1 
ATOM   6833  N N     . TYR C 1 28  ? 166.48649 249.20780 99.77764  1.000 116.94408 ?  28  TYR C N     1 
ATOM   6834  C CA    . TYR C 1 28  ? 165.44396 248.18304 99.63458  1.000 123.07397 ?  28  TYR C CA    1 
ATOM   6835  C C     . TYR C 1 28  ? 164.08760 248.80196 99.30428  1.000 121.13118 ?  28  TYR C C     1 
ATOM   6836  O O     . TYR C 1 28  ? 163.75447 249.89325 99.76765  1.000 118.72877 ?  28  TYR C O     1 
ATOM   6837  C CB    . TYR C 1 28  ? 165.32622 247.29887 100.89273 1.000 119.71913 ?  28  TYR C CB    1 
ATOM   6838  C CG    . TYR C 1 28  ? 166.53300 246.40188 101.10868 1.000 115.69288 ?  28  TYR C CG    1 
ATOM   6839  C CD1   . TYR C 1 28  ? 166.77040 245.29530 100.29628 1.000 106.97959 ?  28  TYR C CD1   1 
ATOM   6840  C CD2   . TYR C 1 28  ? 167.49145 246.73022 102.06090 1.000 119.80516 ?  28  TYR C CD2   1 
ATOM   6841  C CE1   . TYR C 1 28  ? 167.88613 244.50677 100.47977 1.000 111.48042 ?  28  TYR C CE1   1 
ATOM   6842  C CE2   . TYR C 1 28  ? 168.61646 245.95211 102.24631 1.000 120.11869 ?  28  TYR C CE2   1 
ATOM   6843  C CZ    . TYR C 1 28  ? 168.81428 244.84466 101.45669 1.000 119.36717 ?  28  TYR C CZ    1 
ATOM   6844  O OH    . TYR C 1 28  ? 169.94531 244.08306 101.65776 1.000 120.07304 ?  28  TYR C OH    1 
ATOM   6845  N N     . LYS C 1 29  ? 163.30385 248.06437 98.49937  1.000 123.59696 ?  29  LYS C N     1 
ATOM   6846  C CA    . LYS C 1 29  ? 161.97757 248.43770 98.00397  1.000 121.08290 ?  29  LYS C CA    1 
ATOM   6847  C C     . LYS C 1 29  ? 160.98682 247.29609 98.21290  1.000 121.96763 ?  29  LYS C C     1 
ATOM   6848  O O     . LYS C 1 29  ? 161.31559 246.13020 97.96746  1.000 121.91415 ?  29  LYS C O     1 
ATOM   6849  C CB    . LYS C 1 29  ? 162.02290 248.76908 96.50866  1.000 123.08931 ?  29  LYS C CB    1 
ATOM   6850  C CG    . LYS C 1 29  ? 160.67657 249.22124 95.93696  1.000 126.59265 ?  29  LYS C CG    1 
ATOM   6851  C CD    . LYS C 1 29  ? 160.72020 249.36575 94.41227  1.000 128.68239 ?  29  LYS C CD    1 
ATOM   6852  C CE    . LYS C 1 29  ? 159.33201 249.65054 93.82254  1.000 127.99406 ?  29  LYS C CE    1 
ATOM   6853  N NZ    . LYS C 1 29  ? 159.33362 249.77362 92.32785  1.000 120.58525 ?  29  LYS C NZ    1 
ATOM   6854  N N     . TYR C 1 30  ? 159.75010 247.63502 98.61498  1.000 119.52135 ?  30  TYR C N     1 
ATOM   6855  C CA    . TYR C 1 30  ? 158.75222 246.62064 98.96459  1.000 120.65547 ?  30  TYR C CA    1 
ATOM   6856  C C     . TYR C 1 30  ? 157.71689 246.37409 97.84377  1.000 126.47804 ?  30  TYR C C     1 
ATOM   6857  O O     . TYR C 1 30  ? 157.60414 247.17336 96.90797  1.000 123.01502 ?  30  TYR C O     1 
ATOM   6858  C CB    . TYR C 1 30  ? 158.08568 247.02154 100.28310 1.000 116.64593 ?  30  TYR C CB    1 
ATOM   6859  C CG    . TYR C 1 30  ? 159.02056 246.75459 101.46296 1.000 125.54674 ?  30  TYR C CG    1 
ATOM   6860  C CD1   . TYR C 1 30  ? 159.15484 245.47981 102.03269 1.000 121.48452 ?  30  TYR C CD1   1 
ATOM   6861  C CD2   . TYR C 1 30  ? 159.84710 247.76212 101.94570 1.000 128.30721 ?  30  TYR C CD2   1 
ATOM   6862  C CE1   . TYR C 1 30  ? 160.04535 245.25187 103.11353 1.000 119.16706 ?  30  TYR C CE1   1 
ATOM   6863  C CE2   . TYR C 1 30  ? 160.73044 247.54339 103.00598 1.000 128.65997 ?  30  TYR C CE2   1 
ATOM   6864  C CZ    . TYR C 1 30  ? 160.82959 246.28908 103.59113 1.000 121.65899 ?  30  TYR C CZ    1 
ATOM   6865  O OH    . TYR C 1 30  ? 161.71367 246.09188 104.64098 1.000 111.82956 ?  30  TYR C OH    1 
ATOM   6866  N N     . PRO C 1 31  ? 157.05596 245.17714 97.84440  1.000 131.12897 ?  31  PRO C N     1 
ATOM   6867  C CA    . PRO C 1 31  ? 156.11811 244.73643 96.77793  1.000 130.00106 ?  31  PRO C CA    1 
ATOM   6868  C C     . PRO C 1 31  ? 154.69766 245.24476 96.98990  1.000 136.37422 ?  31  PRO C C     1 
ATOM   6869  O O     . PRO C 1 31  ? 153.76447 244.46819 97.24792  1.000 140.77120 ?  31  PRO C O     1 
ATOM   6870  C CB    . PRO C 1 31  ? 156.15892 243.20607 96.89583  1.000 122.71553 ?  31  PRO C CB    1 
ATOM   6871  C CG    . PRO C 1 31  ? 157.20894 242.86073 97.85994  1.000 125.07030 ?  31  PRO C CG    1 
ATOM   6872  C CD    . PRO C 1 31  ? 157.42835 244.06078 98.73035  1.000 126.49086 ?  31  PRO C CD    1 
ATOM   6873  N N     . ALA C 1 32  ? 154.52943 246.55587 96.98690  1.000 136.96106 ?  32  ALA C N     1 
ATOM   6874  C CA    . ALA C 1 32  ? 153.19996 247.13282 97.13034  1.000 134.09569 ?  32  ALA C CA    1 
ATOM   6875  C C     . ALA C 1 32  ? 153.22376 248.49364 96.45358  1.000 136.35406 ?  32  ALA C C     1 
ATOM   6876  O O     . ALA C 1 32  ? 154.22155 249.20731 96.55276  1.000 131.62391 ?  32  ALA C O     1 
ATOM   6877  C CB    . ALA C 1 32  ? 152.80792 247.24524 98.61253  1.000 120.36734 ?  32  ALA C CB    1 
ATOM   6878  N N     . ILE C 1 33  ? 152.15296 248.82045 95.72861  1.000 141.17806 ?  33  ILE C N     1 
ATOM   6879  C CA    . ILE C 1 33  ? 151.99765 250.12284 95.08032  1.000 140.59654 ?  33  ILE C CA    1 
ATOM   6880  C C     . ILE C 1 33  ? 151.01234 250.95513 95.89856  1.000 139.99580 ?  33  ILE C C     1 
ATOM   6881  O O     . ILE C 1 33  ? 149.93153 250.47025 96.26974  1.000 136.55102 ?  33  ILE C O     1 
ATOM   6882  C CB    . ILE C 1 33  ? 151.55407 249.98500 93.60767  1.000 137.78394 ?  33  ILE C CB    1 
ATOM   6883  C CG1   . ILE C 1 33  ? 152.30886 248.84134 92.90808  1.000 130.81634 ?  33  ILE C CG1   1 
ATOM   6884  C CG2   . ILE C 1 33  ? 151.72599 251.31030 92.83789  1.000 136.77578 ?  33  ILE C CG2   1 
ATOM   6885  C CD1   . ILE C 1 33  ? 151.97675 248.66057 91.45060  1.000 125.44701 ?  33  ILE C CD1   1 
ATOM   6886  N N     . LYS C 1 34  ? 151.40438 252.20900 96.17873  1.000 140.27189 ?  34  LYS C N     1 
ATOM   6887  C CA    . LYS C 1 34  ? 150.54289 253.14932 96.89572  1.000 142.21472 ?  34  LYS C CA    1 
ATOM   6888  C C     . LYS C 1 34  ? 149.45693 253.69118 95.97448  1.000 144.53114 ?  34  LYS C C     1 
ATOM   6889  O O     . LYS C 1 34  ? 148.32447 253.94719 96.41733  1.000 142.72987 ?  34  LYS C O     1 
ATOM   6890  C CB    . LYS C 1 34  ? 151.40302 254.30749 97.42779  1.000 135.56909 ?  34  LYS C CB    1 
ATOM   6891  C CG    . LYS C 1 34  ? 150.67272 255.39756 98.22088  1.000 130.24223 ?  34  LYS C CG    1 
ATOM   6892  C CD    . LYS C 1 34  ? 151.62045 256.50950 98.67567  1.000 125.17639 ?  34  LYS C CD    1 
ATOM   6893  C CE    . LYS C 1 34  ? 150.88429 257.56175 99.48874  1.000 131.37293 ?  34  LYS C CE    1 
ATOM   6894  N NZ    . LYS C 1 34  ? 151.80029 258.63093 99.96803  1.000 126.60213 ?  34  LYS C NZ    1 
ATOM   6895  N N     . ASP C 1 35  ? 149.79413 253.85837 94.68153  1.000 145.59616 ?  35  ASP C N     1 
ATOM   6896  C CA    . ASP C 1 35  ? 148.84156 254.26194 93.65023  1.000 146.28886 ?  35  ASP C CA    1 
ATOM   6897  C C     . ASP C 1 35  ? 147.83603 253.16235 93.32872  1.000 141.70447 ?  35  ASP C C     1 
ATOM   6898  O O     . ASP C 1 35  ? 146.74715 253.44636 92.81747  1.000 136.88523 ?  35  ASP C O     1 
ATOM   6899  C CB    . ASP C 1 35  ? 149.60156 254.62462 92.34672  1.000 138.95932 ?  35  ASP C CB    1 
ATOM   6900  C CG    . ASP C 1 35  ? 150.58938 255.78600 92.51196  1.000 138.95893 ?  35  ASP C CG    1 
ATOM   6901  O OD1   . ASP C 1 35  ? 150.63892 256.40064 93.60034  1.000 139.18183 ?  35  ASP C OD1   1 
ATOM   6902  O OD2   . ASP C 1 35  ? 151.33936 256.07594 91.54760  1.000 136.68890 ?  35  ASP C OD2   1 
ATOM   6903  N N     . LEU C 1 36  ? 148.20033 251.91790 93.63519  1.000 144.31812 ?  36  LEU C N     1 
ATOM   6904  C CA    . LEU C 1 36  ? 147.42800 250.70905 93.35212  1.000 144.00515 ?  36  LEU C CA    1 
ATOM   6905  C C     . LEU C 1 36  ? 147.18267 250.54128 91.84437  1.000 140.02819 ?  36  LEU C C     1 
ATOM   6906  O O     . LEU C 1 36  ? 146.25494 249.84671 91.42528  1.000 134.57663 ?  36  LEU C O     1 
ATOM   6907  C CB    . LEU C 1 36  ? 146.12625 250.67620 94.16839  1.000 136.22890 ?  36  LEU C CB    1 
ATOM   6908  C CG    . LEU C 1 36  ? 146.34281 250.42088 95.67769  1.000 131.59349 ?  36  LEU C CG    1 
ATOM   6909  C CD1   . LEU C 1 36  ? 145.04649 250.66153 96.46436  1.000 130.76001 ?  36  LEU C CD1   1 
ATOM   6910  C CD2   . LEU C 1 36  ? 147.02852 249.07644 96.05599  1.000 124.74820 ?  36  LEU C CD2   1 
ATOM   6911  N N     . LYS C 1 37  ? 148.06883 251.13444 91.03918  1.000 134.29551 ?  37  LYS C N     1 
ATOM   6912  C CA    . LYS C 1 37  ? 148.01132 251.00440 89.59134  1.000 132.08043 ?  37  LYS C CA    1 
ATOM   6913  C C     . LYS C 1 37  ? 148.51720 249.61984 89.19345  1.000 133.55375 ?  37  LYS C C     1 
ATOM   6914  O O     . LYS C 1 37  ? 149.51867 249.14418 89.73148  1.000 130.93736 ?  37  LYS C O     1 
ATOM   6915  C CB    . LYS C 1 37  ? 148.86651 252.09485 88.92048  1.000 133.02505 ?  37  LYS C CB    1 
ATOM   6916  C CG    . LYS C 1 37  ? 148.34520 253.53862 89.04004  1.000 134.55739 ?  37  LYS C CG    1 
ATOM   6917  C CD    . LYS C 1 37  ? 149.30860 254.53445 88.36738  1.000 131.82454 ?  37  LYS C CD    1 
ATOM   6918  C CE    . LYS C 1 37  ? 148.75824 255.95552 88.31600  1.000 133.26416 ?  37  LYS C CE    1 
ATOM   6919  N NZ    . LYS C 1 37  ? 148.50533 256.48532 89.68834  1.000 132.39465 ?  37  LYS C NZ    1 
ATOM   6920  N N     . LYS C 1 38  ? 147.79616 248.95154 88.28717  1.000 138.93691 ?  38  LYS C N     1 
ATOM   6921  C CA    . LYS C 1 38  ? 148.23400 247.64339 87.80868  1.000 136.11604 ?  38  LYS C CA    1 
ATOM   6922  C C     . LYS C 1 38  ? 149.56220 247.77508 87.06625  1.000 135.44369 ?  38  LYS C C     1 
ATOM   6923  O O     . LYS C 1 38  ? 149.76360 248.74837 86.32660  1.000 134.13295 ?  38  LYS C O     1 
ATOM   6924  C CB    . LYS C 1 38  ? 147.20739 247.06168 86.84166  1.000 133.63041 ?  38  LYS C CB    1 
ATOM   6925  C CG    . LYS C 1 38  ? 145.94563 246.54534 87.45619  1.000 134.21175 ?  38  LYS C CG    1 
ATOM   6926  C CD    . LYS C 1 38  ? 144.97636 246.16845 86.35043  1.000 140.88310 ?  38  LYS C CD    1 
ATOM   6927  C CE    . LYS C 1 38  ? 143.86862 245.25796 86.83781  1.000 141.72320 ?  38  LYS C CE    1 
ATOM   6928  N NZ    . LYS C 1 38  ? 142.97975 244.88756 85.69811  1.000 140.06699 ?  38  LYS C NZ    1 
ATOM   6929  N N     . PRO C 1 39  ? 150.47875 246.81518 87.22517  1.000 134.40013 ?  39  PRO C N     1 
ATOM   6930  C CA    . PRO C 1 39  ? 151.77098 246.89484 86.53138  1.000 132.38625 ?  39  PRO C CA    1 
ATOM   6931  C C     . PRO C 1 39  ? 151.61233 246.62549 85.05209  1.000 131.27532 ?  39  PRO C C     1 
ATOM   6932  O O     . PRO C 1 39  ? 150.94992 245.66744 84.64945  1.000 130.04657 ?  39  PRO C O     1 
ATOM   6933  C CB    . PRO C 1 39  ? 152.60524 245.79019 87.18566  1.000 128.23062 ?  39  PRO C CB    1 
ATOM   6934  C CG    . PRO C 1 39  ? 151.94405 245.51180 88.44527  1.000 131.95260 ?  39  PRO C CG    1 
ATOM   6935  C CD    . PRO C 1 39  ? 150.47282 245.74115 88.21711  1.000 132.32780 ?  39  PRO C CD    1 
ATOM   6936  N N     . CYS C 1 40  ? 152.31625 247.41077 84.25304  1.000 124.70432 ?  40  CYS C N     1 
ATOM   6937  C CA    . CYS C 1 40  ? 152.21220 247.36700 82.80794  1.000 125.93411 ?  40  CYS C CA    1 
ATOM   6938  C C     . CYS C 1 40  ? 153.61131 247.34439 82.22449  1.000 125.07134 ?  40  CYS C C     1 
ATOM   6939  O O     . CYS C 1 40  ? 154.54898 247.89444 82.80991  1.000 121.96272 ?  40  CYS C O     1 
ATOM   6940  C CB    . CYS C 1 40  ? 151.43214 248.56729 82.27462  1.000 129.41562 ?  40  CYS C CB    1 
ATOM   6941  S SG    . CYS C 1 40  ? 151.49723 248.77445 80.48635  1.000 144.07551 ?  40  CYS C SG    1 
ATOM   6942  N N     . ILE C 1 41  ? 153.75047 246.70116 81.07187  1.000 125.72962 ?  41  ILE C N     1 
ATOM   6943  C CA    . ILE C 1 41  ? 155.02455 246.70541 80.36240  1.000 126.17743 ?  41  ILE C CA    1 
ATOM   6944  C C     . ILE C 1 41  ? 154.74713 247.26848 78.97618  1.000 129.54351 ?  41  ILE C C     1 
ATOM   6945  O O     . ILE C 1 41  ? 153.61686 247.20778 78.47692  1.000 126.42450 ?  41  ILE C O     1 
ATOM   6946  C CB    . ILE C 1 41  ? 155.69749 245.29626 80.30459  1.000 122.10243 ?  41  ILE C CB    1 
ATOM   6947  C CG1   . ILE C 1 41  ? 157.20895 245.43737 80.17805  1.000 118.11427 ?  41  ILE C CG1   1 
ATOM   6948  C CG2   . ILE C 1 41  ? 155.23103 244.44559 79.12525  1.000 116.63900 ?  41  ILE C CG2   1 
ATOM   6949  C CD1   . ILE C 1 41  ? 157.83203 246.14729 81.32314  1.000 122.36314 ?  41  ILE C CD1   1 
ATOM   6950  N N     . THR C 1 42  ? 155.76498 247.90987 78.40395  1.000 127.97428 ?  42  THR C N     1 
ATOM   6951  C CA    . THR C 1 42  ? 155.66195 248.52458 77.09162  1.000 128.72922 ?  42  THR C CA    1 
ATOM   6952  C C     . THR C 1 42  ? 156.12582 247.49752 76.07028  1.000 128.70216 ?  42  THR C C     1 
ATOM   6953  O O     . THR C 1 42  ? 157.16668 246.85850 76.25802  1.000 126.86162 ?  42  THR C O     1 
ATOM   6954  C CB    . THR C 1 42  ? 156.49626 249.80360 77.01014  1.000 130.28519 ?  42  THR C CB    1 
ATOM   6955  O OG1   . THR C 1 42  ? 156.12552 250.68156 78.08522  1.000 133.71700 ?  42  THR C OG1   1 
ATOM   6956  C CG2   . THR C 1 42  ? 156.25583 250.51016 75.69440  1.000 122.93686 ?  42  THR C CG2   1 
ATOM   6957  N N     . LEU C 1 43  ? 155.33540 247.30985 75.01903  1.000 131.88389 ?  43  LEU C N     1 
ATOM   6958  C CA    . LEU C 1 43  ? 155.59388 246.24325 74.06726  1.000 130.11390 ?  43  LEU C CA    1 
ATOM   6959  C C     . LEU C 1 43  ? 155.20615 246.73322 72.68113  1.000 129.27470 ?  43  LEU C C     1 
ATOM   6960  O O     . LEU C 1 43  ? 154.59667 247.79570 72.53319  1.000 129.37328 ?  43  LEU C O     1 
ATOM   6961  C CB    . LEU C 1 43  ? 154.79621 245.00708 74.45841  1.000 126.08569 ?  43  LEU C CB    1 
ATOM   6962  C CG    . LEU C 1 43  ? 155.52931 243.69719 74.33322  1.000 123.40181 ?  43  LEU C CG    1 
ATOM   6963  C CD1   . LEU C 1 43  ? 156.95809 243.87841 74.81820  1.000 119.50795 ?  43  LEU C CD1   1 
ATOM   6964  C CD2   . LEU C 1 43  ? 154.75019 242.79686 75.23638  1.000 125.40012 ?  43  LEU C CD2   1 
ATOM   6965  N N     . GLY C 1 44  ? 155.48846 245.91326 71.66229  1.000 130.73953 ?  44  GLY C N     1 
ATOM   6966  C CA    . GLY C 1 44  ? 155.29775 246.33029 70.28144  1.000 137.38318 ?  44  GLY C CA    1 
ATOM   6967  C C     . GLY C 1 44  ? 153.88431 246.12757 69.75322  1.000 132.55763 ?  44  GLY C C     1 
ATOM   6968  O O     . GLY C 1 44  ? 152.97521 245.69195 70.46297  1.000 126.64578 ?  44  GLY C O     1 
ATOM   6969  N N     . LYS C 1 45  ? 153.71067 246.45200 68.46604  1.000 130.07676 ?  45  LYS C N     1 
ATOM   6970  C CA    . LYS C 1 45  ? 152.37450 246.39732 67.88225  1.000 127.68371 ?  45  LYS C CA    1 
ATOM   6971  C C     . LYS C 1 45  ? 151.90392 244.95387 67.76549  1.000 126.51163 ?  45  LYS C C     1 
ATOM   6972  O O     . LYS C 1 45  ? 152.69367 244.04050 67.50209  1.000 124.65724 ?  45  LYS C O     1 
ATOM   6973  C CB    . LYS C 1 45  ? 152.34818 247.10795 66.51736  1.000 124.96878 ?  45  LYS C CB    1 
ATOM   6974  C CG    . LYS C 1 45  ? 150.92839 247.49671 66.05841  1.000 124.90157 ?  45  LYS C CG    1 
ATOM   6975  C CD    . LYS C 1 45  ? 150.92820 248.34286 64.79463  1.000 121.76326 ?  45  LYS C CD    1 
ATOM   6976  C CE    . LYS C 1 45  ? 149.55312 248.93057 64.50726  1.000 114.62493 ?  45  LYS C CE    1 
ATOM   6977  N NZ    . LYS C 1 45  ? 149.64367 249.82748 63.32817  1.000 110.98116 ?  45  LYS C NZ    1 
ATOM   6978  N N     . ALA C 1 46  ? 150.60240 244.75911 67.98614  1.000 123.66938 ?  46  ALA C N     1 
ATOM   6979  C CA    . ALA C 1 46  ? 150.03580 243.42162 67.96619  1.000 119.95936 ?  46  ALA C CA    1 
ATOM   6980  C C     . ALA C 1 46  ? 150.22105 242.83403 66.57397  1.000 122.71382 ?  46  ALA C C     1 
ATOM   6981  O O     . ALA C 1 46  ? 149.99214 243.52931 65.57766  1.000 125.52183 ?  46  ALA C O     1 
ATOM   6982  C CB    . ALA C 1 46  ? 148.55291 243.44337 68.35112  1.000 110.51444 ?  46  ALA C CB    1 
ATOM   6983  N N     . PRO C 1 47  ? 150.69267 241.60664 66.45806  1.000 126.19332 ?  47  PRO C N     1 
ATOM   6984  C CA    . PRO C 1 47  ? 150.85908 240.96880 65.15085  1.000 126.66037 ?  47  PRO C CA    1 
ATOM   6985  C C     . PRO C 1 47  ? 149.57191 240.26908 64.71674  1.000 128.18298 ?  47  PRO C C     1 
ATOM   6986  O O     . PRO C 1 47  ? 148.57930 240.20462 65.45012  1.000 126.56461 ?  47  PRO C O     1 
ATOM   6987  C CB    . PRO C 1 47  ? 151.98787 239.95733 65.40863  1.000 122.16873 ?  47  PRO C CB    1 
ATOM   6988  C CG    . PRO C 1 47  ? 151.75603 239.54700 66.81766  1.000 124.67287 ?  47  PRO C CG    1 
ATOM   6989  C CD    . PRO C 1 47  ? 151.23317 240.76898 67.54296  1.000 123.85394 ?  47  PRO C CD    1 
ATOM   6990  N N     . ASP C 1 48  ? 149.60754 239.75322 63.48086  1.000 125.74564 ?  48  ASP C N     1 
ATOM   6991  C CA    . ASP C 1 48  ? 148.53941 238.88786 62.98155  1.000 125.51495 ?  48  ASP C CA    1 
ATOM   6992  C C     . ASP C 1 48  ? 148.45604 237.57303 63.74209  1.000 125.60086 ?  48  ASP C C     1 
ATOM   6993  O O     . ASP C 1 48  ? 147.50809 236.81344 63.52796  1.000 127.11521 ?  48  ASP C O     1 
ATOM   6994  C CB    . ASP C 1 48  ? 148.73788 238.60533 61.48755  1.000 127.46130 ?  48  ASP C CB    1 
ATOM   6995  C CG    . ASP C 1 48  ? 148.54175 239.84825 60.63407  1.000 138.02494 ?  48  ASP C CG    1 
ATOM   6996  O OD1   . ASP C 1 48  ? 148.45586 240.95374 61.21454  1.000 144.46349 ?  48  ASP C OD1   1 
ATOM   6997  O OD2   . ASP C 1 48  ? 148.45637 239.72100 59.39065  1.000 132.69957 ?  48  ASP C OD2   1 
ATOM   6998  N N     . LEU C 1 49  ? 149.41446 237.30953 64.63341  1.000 124.00084 ?  49  LEU C N     1 
ATOM   6999  C CA    . LEU C 1 49  ? 149.49097 236.11734 65.47693  1.000 123.35840 ?  49  LEU C CA    1 
ATOM   7000  C C     . LEU C 1 49  ? 149.86160 234.87890 64.66799  1.000 119.90117 ?  49  LEU C C     1 
ATOM   7001  O O     . LEU C 1 49  ? 150.85243 234.21335 64.99226  1.000 114.81977 ?  49  LEU C O     1 
ATOM   7002  C CB    . LEU C 1 49  ? 148.18250 235.91035 66.25382  1.000 124.67328 ?  49  LEU C CB    1 
ATOM   7003  C CG    . LEU C 1 49  ? 148.27799 236.22404 67.76379  1.000 126.27881 ?  49  LEU C CG    1 
ATOM   7004  C CD1   . LEU C 1 49  ? 146.93398 236.14589 68.46685  1.000 125.22177 ?  49  LEU C CD1   1 
ATOM   7005  C CD2   . LEU C 1 49  ? 149.27589 235.32724 68.47143  1.000 124.19896 ?  49  LEU C CD2   1 
ATOM   7006  N N     . ASN C 1 50  ? 149.05371 234.50542 63.67071  1.000 122.58112 ?  50  ASN C N     1 
ATOM   7007  C CA    . ASN C 1 50  ? 149.45988 233.38767 62.82617  1.000 122.94325 ?  50  ASN C CA    1 
ATOM   7008  C C     . ASN C 1 50  ? 150.78178 233.69381 62.15210  1.000 120.65737 ?  50  ASN C C     1 
ATOM   7009  O O     . ASN C 1 50  ? 151.63652 232.80814 62.00454  1.000 116.70565 ?  50  ASN C O     1 
ATOM   7010  C CB    . ASN C 1 50  ? 148.40008 233.04019 61.78160  1.000 121.87900 ?  50  ASN C CB    1 
ATOM   7011  C CG    . ASN C 1 50  ? 147.13411 232.50536 62.39422  1.000 127.48897 ?  50  ASN C CG    1 
ATOM   7012  O OD1   . ASN C 1 50  ? 147.07076 232.25141 63.59388  1.000 127.51082 ?  50  ASN C OD1   1 
ATOM   7013  N ND2   . ASN C 1 50  ? 146.12875 232.27365 61.55920  1.000 129.60376 ?  50  ASN C ND2   1 
ATOM   7014  N N     . LYS C 1 51  ? 150.94367 234.94009 61.69255  1.000 118.50925 ?  51  LYS C N     1 
ATOM   7015  C CA    . LYS C 1 51  ? 152.20191 235.31841 61.06781  1.000 119.90086 ?  51  LYS C CA    1 
ATOM   7016  C C     . LYS C 1 51  ? 153.31403 235.36756 62.09995  1.000 121.14694 ?  51  LYS C C     1 
ATOM   7017  O O     . LYS C 1 51  ? 154.41236 234.84165 61.86957  1.000 117.66557 ?  51  LYS C O     1 
ATOM   7018  C CB    . LYS C 1 51  ? 152.07079 236.67601 60.37022  1.000 120.35810 ?  51  LYS C CB    1 
ATOM   7019  C CG    . LYS C 1 51  ? 151.15303 236.67409 59.15654  1.000 120.00802 ?  51  LYS C CG    1 
ATOM   7020  C CD    . LYS C 1 51  ? 151.23767 237.99042 58.39919  1.000 119.05639 ?  51  LYS C CD    1 
ATOM   7021  C CE    . LYS C 1 51  ? 150.38645 237.94485 57.13984  1.000 122.13470 ?  51  LYS C CE    1 
ATOM   7022  N NZ    . LYS C 1 51  ? 150.41761 239.22348 56.37917  1.000 125.73467 ?  51  LYS C NZ    1 
ATOM   7023  N N     . ALA C 1 52  ? 153.01502 235.91161 63.28034  1.000 121.50492 ?  52  ALA C N     1 
ATOM   7024  C CA    . ALA C 1 52  ? 154.03435 235.97063 64.31482  1.000 117.61778 ?  52  ALA C CA    1 
ATOM   7025  C C     . ALA C 1 52  ? 154.45467 234.56322 64.73230  1.000 115.28313 ?  52  ALA C C     1 
ATOM   7026  O O     . ALA C 1 52  ? 155.65112 234.31016 64.92274  1.000 111.30351 ?  52  ALA C O     1 
ATOM   7027  C CB    . ALA C 1 52  ? 153.54222 236.81183 65.48686  1.000 106.41730 ?  52  ALA C CB    1 
ATOM   7028  N N     . TYR C 1 53  ? 153.49502 233.61114 64.78488  1.000 113.76774 ?  53  TYR C N     1 
ATOM   7029  C CA    . TYR C 1 53  ? 153.81490 232.23238 65.18459  1.000 111.03873 ?  53  TYR C CA    1 
ATOM   7030  C C     . TYR C 1 53  ? 154.82991 231.60397 64.23181  1.000 108.31408 ?  53  TYR C C     1 
ATOM   7031  O O     . TYR C 1 53  ? 155.78228 230.93966 64.66751  1.000 104.94029 ?  53  TYR C O     1 
ATOM   7032  C CB    . TYR C 1 53  ? 152.54674 231.34501 65.23542  1.000 108.56054 ?  53  TYR C CB    1 
ATOM   7033  C CG    . TYR C 1 53  ? 152.84960 229.83480 65.37241  1.000 108.87988 ?  53  TYR C CG    1 
ATOM   7034  C CD1   . TYR C 1 53  ? 153.05540 229.02660 64.25360  1.000 109.51246 ?  53  TYR C CD1   1 
ATOM   7035  C CD2   . TYR C 1 53  ? 152.90283 229.21586 66.62178  1.000 110.03788 ?  53  TYR C CD2   1 
ATOM   7036  C CE1   . TYR C 1 53  ? 153.34751 227.66279 64.37133  1.000 106.56040 ?  53  TYR C CE1   1 
ATOM   7037  C CE2   . TYR C 1 53  ? 153.18916 227.84156 66.74507  1.000 112.17588 ?  53  TYR C CE2   1 
ATOM   7038  C CZ    . TYR C 1 53  ? 153.41037 227.07423 65.60937  1.000 108.98284 ?  53  TYR C CZ    1 
ATOM   7039  O OH    . TYR C 1 53  ? 153.69812 225.72545 65.69218  1.000 114.34763 ?  53  TYR C OH    1 
ATOM   7040  N N     . LYS C 1 54  ? 154.63543 231.78903 62.92519  1.000 109.94268 ?  54  LYS C N     1 
ATOM   7041  C CA    . LYS C 1 54  ? 155.56415 231.22304 61.95099  1.000 111.88859 ?  54  LYS C CA    1 
ATOM   7042  C C     . LYS C 1 54  ? 156.94500 231.84975 62.09821  1.000 106.35479 ?  54  LYS C C     1 
ATOM   7043  O O     . LYS C 1 54  ? 157.97112 231.18398 61.88107  1.000 102.73959 ?  54  LYS C O     1 
ATOM   7044  C CB    . LYS C 1 54  ? 154.99492 231.38286 60.54481  1.000 108.18600 ?  54  LYS C CB    1 
ATOM   7045  C CG    . LYS C 1 54  ? 153.65626 230.66054 60.41140  1.000 107.66268 ?  54  LYS C CG    1 
ATOM   7046  C CD    . LYS C 1 54  ? 153.12260 230.65820 58.99135  1.000 118.23301 ?  54  LYS C CD    1 
ATOM   7047  C CE    . LYS C 1 54  ? 151.84796 229.81991 58.88456  1.000 120.23492 ?  54  LYS C CE    1 
ATOM   7048  N NZ    . LYS C 1 54  ? 151.37533 229.67041 57.47800  1.000 115.98016 ?  54  LYS C NZ    1 
ATOM   7049  N N     . SER C 1 55  ? 156.98034 233.14933 62.41851  1.000 105.37580 ?  55  SER C N     1 
ATOM   7050  C CA    . SER C 1 55  ? 158.24522 233.85698 62.57550  1.000 105.68815 ?  55  SER C CA    1 
ATOM   7051  C C     . SER C 1 55  ? 159.04092 233.30841 63.75850  1.000 106.60458 ?  55  SER C C     1 
ATOM   7052  O O     . SER C 1 55  ? 160.19294 232.88332 63.59513  1.000 106.04121 ?  55  SER C O     1 
ATOM   7053  C CB    . SER C 1 55  ? 157.95040 235.34926 62.74090  1.000 104.51895 ?  55  SER C CB    1 
ATOM   7054  O OG    . SER C 1 55  ? 159.03033 236.06339 63.30296  1.000 105.93968 ?  55  SER C OG    1 
ATOM   7055  N N     . VAL C 1 56  ? 158.40453 233.21912 64.93965  1.000 107.04472 ?  56  VAL C N     1 
ATOM   7056  C CA    . VAL C 1 56  ? 159.11071 232.75030 66.13368  1.000 106.11058 ?  56  VAL C CA    1 
ATOM   7057  C C     . VAL C 1 56  ? 159.45491 231.26447 65.99422  1.000 104.82936 ?  56  VAL C C     1 
ATOM   7058  O O     . VAL C 1 56  ? 160.51790 230.81702 66.45270  1.000 101.83127 ?  56  VAL C O     1 
ATOM   7059  C CB    . VAL C 1 56  ? 158.32663 233.04378 67.44740  1.000 106.03408 ?  56  VAL C CB    1 
ATOM   7060  C CG1   . VAL C 1 56  ? 158.39933 234.51835 67.85740  1.000 104.46789 ?  56  VAL C CG1   1 
ATOM   7061  C CG2   . VAL C 1 56  ? 156.89233 232.56901 67.42328  1.000 105.19414 ?  56  VAL C CG2   1 
ATOM   7062  N N     . LEU C 1 57  ? 158.57512 230.47716 65.35460  1.000 102.18893 ?  57  LEU C N     1 
ATOM   7063  C CA    . LEU C 1 57  ? 158.88505 229.06393 65.14302  1.000 102.39352 ?  57  LEU C CA    1 
ATOM   7064  C C     . LEU C 1 57  ? 160.12837 228.91394 64.28567  1.000 101.11952 ?  57  LEU C C     1 
ATOM   7065  O O     . LEU C 1 57  ? 161.03112 228.11688 64.59625  1.000 95.36903  ?  57  LEU C O     1 
ATOM   7066  C CB    . LEU C 1 57  ? 157.67517 228.33500 64.54145  1.000 99.89959  ?  57  LEU C CB    1 
ATOM   7067  C CG    . LEU C 1 57  ? 157.83203 226.82845 64.28127  1.000 96.23840  ?  57  LEU C CG    1 
ATOM   7068  C CD1   . LEU C 1 57  ? 158.20847 226.09222 65.53779  1.000 101.69085 ?  57  LEU C CD1   1 
ATOM   7069  C CD2   . LEU C 1 57  ? 156.49530 226.26049 63.79827  1.000 88.71834  ?  57  LEU C CD2   1 
ATOM   7070  N N     . SER C 1 58  ? 160.21747 229.73239 63.24341  1.000 104.61572 ?  58  SER C N     1 
ATOM   7071  C CA    . SER C 1 58  ? 161.41769 229.76411 62.42765  1.000 109.30312 ?  58  SER C CA    1 
ATOM   7072  C C     . SER C 1 58  ? 162.63574 230.18066 63.25827  1.000 107.68221 ?  58  SER C C     1 
ATOM   7073  O O     . SER C 1 58  ? 163.69499 229.53787 63.19383  1.000 105.75539 ?  58  SER C O     1 
ATOM   7074  C CB    . SER C 1 58  ? 161.16873 230.70685 61.25324  1.000 107.74231 ?  58  SER C CB    1 
ATOM   7075  O OG    . SER C 1 58  ? 161.52024 232.02835 61.61246  1.000 105.70854 ?  58  SER C OG    1 
ATOM   7076  N N     . GLY C 1 59  ? 162.47508 231.19461 64.11611  1.000 107.12897 ?  59  GLY C N     1 
ATOM   7077  C CA    . GLY C 1 59  ? 163.58520 231.63511 64.95421  1.000 107.14899 ?  59  GLY C CA    1 
ATOM   7078  C C     . GLY C 1 59  ? 164.08913 230.54935 65.88712  1.000 105.76606 ?  59  GLY C C     1 
ATOM   7079  O O     . GLY C 1 59  ? 165.29048 230.43791 66.13135  1.000 107.88811 ?  59  GLY C O     1 
ATOM   7080  N N     . MET C 1 60  ? 163.17032 229.76396 66.45597  1.000 100.92539 ?  60  MET C N     1 
ATOM   7081  C CA    . MET C 1 60  ? 163.56305 228.67351 67.34121  1.000 103.50868 ?  60  MET C CA    1 
ATOM   7082  C C     . MET C 1 60  ? 164.39593 227.63019 66.62231  1.000 105.39288 ?  60  MET C C     1 
ATOM   7083  O O     . MET C 1 60  ? 165.47993 227.25872 67.08194  1.000 103.76434 ?  60  MET C O     1 
ATOM   7084  C CB    . MET C 1 60  ? 162.33048 228.02870 67.98121  1.000 101.92180 ?  60  MET C CB    1 
ATOM   7085  C CG    . MET C 1 60  ? 162.60205 227.23428 69.24725  1.000 90.51802  ?  60  MET C CG    1 
ATOM   7086  S SD    . MET C 1 60  ? 162.46951 228.35568 70.63344  1.000 109.64838 ?  60  MET C SD    1 
ATOM   7087  C CE    . MET C 1 60  ? 162.64911 227.22652 71.99825  1.000 112.55649 ?  60  MET C CE    1 
ATOM   7088  N N     . SER C 1 61  ? 163.88363 227.10623 65.48715  1.000 104.85349 ?  61  SER C N     1 
ATOM   7089  C CA    . SER C 1 61  ? 164.63740 226.07584 64.79953  1.000 102.49897 ?  61  SER C CA    1 
ATOM   7090  C C     . SER C 1 61  ? 165.92058 226.61505 64.19264  1.000 102.85751 ?  61  SER C C     1 
ATOM   7091  O O     . SER C 1 61  ? 166.67883 225.83941 63.57780  1.000 105.93274 ?  61  SER C O     1 
ATOM   7092  C CB    . SER C 1 61  ? 163.77060 225.30977 63.75719  1.000 90.23429  ?  61  SER C CB    1 
ATOM   7093  O OG    . SER C 1 61  ? 162.43717 225.04882 64.25952  1.000 84.33817  ?  61  SER C OG    1 
ATOM   7094  N N     . ALA C 1 62  ? 166.14307 227.91452 64.28095  1.000 101.94641 ?  62  ALA C N     1 
ATOM   7095  C CA    . ALA C 1 62  ? 167.35011 228.54231 63.78572  1.000 107.21253 ?  62  ALA C CA    1 
ATOM   7096  C C     . ALA C 1 62  ? 168.34594 228.97368 64.83915  1.000 109.37034 ?  62  ALA C C     1 
ATOM   7097  O O     . ALA C 1 62  ? 169.46996 229.35925 64.48968  1.000 112.21545 ?  62  ALA C O     1 
ATOM   7098  C CB    . ALA C 1 62  ? 167.00101 229.80126 62.97802  1.000 107.79995 ?  62  ALA C CB    1 
ATOM   7099  N N     . ALA C 1 63  ? 168.01243 228.89383 66.13073  1.000 110.59922 ?  63  ALA C N     1 
ATOM   7100  C CA    . ALA C 1 63  ? 168.85261 229.40128 67.18738  1.000 112.21305 ?  63  ALA C CA    1 
ATOM   7101  C C     . ALA C 1 63  ? 169.08449 230.91872 67.10280  1.000 109.21776 ?  63  ALA C C     1 
ATOM   7102  O O     . ALA C 1 63  ? 170.06374 231.43767 67.67117  1.000 114.26838 ?  63  ALA C O     1 
ATOM   7103  C CB    . ALA C 1 63  ? 170.20438 228.66354 67.26967  1.000 110.34287 ?  63  ALA C CB    1 
ATOM   7104  N N     . LYS C 1 64  ? 168.27460 231.66348 66.33752  1.000 101.23250 ?  64  LYS C N     1 
ATOM   7105  C CA    . LYS C 1 64  ? 168.32620 233.12025 66.33668  1.000 104.20467 ?  64  LYS C CA    1 
ATOM   7106  C C     . LYS C 1 64  ? 166.94378 233.71457 66.63857  1.000 100.32268 ?  64  LYS C C     1 
ATOM   7107  O O     . LYS C 1 64  ? 165.99536 233.52932 65.85844  1.000 99.82057  ?  64  LYS C O     1 
ATOM   7108  C CB    . LYS C 1 64  ? 168.88592 233.65300 64.99315  1.000 108.03882 ?  64  LYS C CB    1 
ATOM   7109  C CG    . LYS C 1 64  ? 170.38395 233.30142 64.81166  1.000 115.30302 ?  64  LYS C CG    1 
ATOM   7110  C CD    . LYS C 1 64  ? 170.62999 232.07875 63.91865  1.000 119.55649 ?  64  LYS C CD    1 
ATOM   7111  C CE    . LYS C 1 64  ? 172.08368 231.53539 63.95473  1.000 121.30676 ?  64  LYS C CE    1 
ATOM   7112  N NZ    . LYS C 1 64  ? 172.54625 231.06339 65.32122  1.000 116.74702 ?  64  LYS C NZ    1 
ATOM   7113  N N     . LEU C 1 65  ? 166.82697 234.46139 67.74276  1.000 99.54934  ?  65  LEU C N     1 
ATOM   7114  C CA    . LEU C 1 65  ? 165.54726 235.01838 68.16058  1.000 103.16656 ?  65  LEU C CA    1 
ATOM   7115  C C     . LEU C 1 65  ? 165.66033 236.49900 68.47397  1.000 106.55268 ?  65  LEU C C     1 
ATOM   7116  O O     . LEU C 1 65  ? 166.64500 236.95349 69.06285  1.000 104.18110 ?  65  LEU C O     1 
ATOM   7117  C CB    . LEU C 1 65  ? 164.94468 234.32359 69.39712  1.000 104.64545 ?  65  LEU C CB    1 
ATOM   7118  C CG    . LEU C 1 65  ? 164.23392 233.00605 69.10281  1.000 111.34041 ?  65  LEU C CG    1 
ATOM   7119  C CD1   . LEU C 1 65  ? 164.15531 232.15625 70.35653  1.000 107.57689 ?  65  LEU C CD1   1 
ATOM   7120  C CD2   . LEU C 1 65  ? 162.85314 233.25288 68.50603  1.000 108.31476 ?  65  LEU C CD2   1 
ATOM   7121  N N     . ASP C 1 66  ? 164.59354 237.23851 68.12551  1.000 108.38717 ?  66  ASP C N     1 
ATOM   7122  C CA    . ASP C 1 66  ? 164.51231 238.66346 68.42237  1.000 110.43446 ?  66  ASP C CA    1 
ATOM   7123  C C     . ASP C 1 66  ? 163.68847 238.84665 69.67905  1.000 110.06467 ?  66  ASP C C     1 
ATOM   7124  O O     . ASP C 1 66  ? 162.50411 238.46328 69.70442  1.000 104.56357 ?  66  ASP C O     1 
ATOM   7125  C CB    . ASP C 1 66  ? 163.88587 239.45931 67.28007  1.000 116.82635 ?  66  ASP C CB    1 
ATOM   7126  C CG    . ASP C 1 66  ? 163.89367 240.98312 67.54353  1.000 124.49342 ?  66  ASP C CG    1 
ATOM   7127  O OD1   . ASP C 1 66  ? 164.89898 241.64756 67.21044  1.000 126.09062 ?  66  ASP C OD1   1 
ATOM   7128  O OD2   . ASP C 1 66  ? 162.90535 241.51764 68.09751  1.000 124.01365 ?  66  ASP C OD2   1 
ATOM   7129  N N     . PRO C 1 67  ? 164.27713 239.43482 70.72222  1.000 112.41094 ?  67  PRO C N     1 
ATOM   7130  C CA    . PRO C 1 67  ? 163.58582 239.52108 72.01301  1.000 113.47047 ?  67  PRO C CA    1 
ATOM   7131  C C     . PRO C 1 67  ? 162.28732 240.29409 71.94312  1.000 114.57362 ?  67  PRO C C     1 
ATOM   7132  O O     . PRO C 1 67  ? 161.28207 239.85660 72.51254  1.000 114.20785 ?  67  PRO C O     1 
ATOM   7133  C CB    . PRO C 1 67  ? 164.62428 240.22157 72.90017  1.000 111.67489 ?  67  PRO C CB    1 
ATOM   7134  C CG    . PRO C 1 67  ? 165.94788 239.91972 72.24128  1.000 104.03569 ?  67  PRO C CG    1 
ATOM   7135  C CD    . PRO C 1 67  ? 165.66269 239.92786 70.78937  1.000 109.09118 ?  67  PRO C CD    1 
ATOM   7136  N N     . ASP C 1 68  ? 162.28107 241.43647 71.25604  1.000 115.15033 ?  68  ASP C N     1 
ATOM   7137  C CA    . ASP C 1 68  ? 161.07314 242.25056 71.19965  1.000 121.89725 ?  68  ASP C CA    1 
ATOM   7138  C C     . ASP C 1 68  ? 159.94912 241.52435 70.47245  1.000 121.00877 ?  68  ASP C C     1 
ATOM   7139  O O     . ASP C 1 68  ? 158.78091 241.60031 70.87899  1.000 119.31542 ?  68  ASP C O     1 
ATOM   7140  C CB    . ASP C 1 68  ? 161.37214 243.59873 70.54747  1.000 124.50374 ?  68  ASP C CB    1 
ATOM   7141  C CG    . ASP C 1 68  ? 162.44287 244.36256 71.29271  1.000 127.40349 ?  68  ASP C CG    1 
ATOM   7142  O OD1   . ASP C 1 68  ? 162.82291 243.90503 72.39415  1.000 125.64909 ?  68  ASP C OD1   1 
ATOM   7143  O OD2   . ASP C 1 68  ? 162.86948 245.43394 70.81430  1.000 129.28789 ?  68  ASP C OD2   1 
ATOM   7144  N N     . ASP C 1 69  ? 160.27784 240.83923 69.37489  1.000 120.86053 ?  69  ASP C N     1 
ATOM   7145  C CA    . ASP C 1 69  ? 159.25204 240.11999 68.62816  1.000 123.16599 ?  69  ASP C CA    1 
ATOM   7146  C C     . ASP C 1 69  ? 158.68698 238.97662 69.45164  1.000 121.97712 ?  69  ASP C C     1 
ATOM   7147  O O     . ASP C 1 69  ? 157.46862 238.76060 69.47765  1.000 121.80030 ?  69  ASP C O     1 
ATOM   7148  C CB    . ASP C 1 69  ? 159.83389 239.58208 67.32598  1.000 121.23301 ?  69  ASP C CB    1 
ATOM   7149  C CG    . ASP C 1 69  ? 160.32577 240.67638 66.43262  1.000 118.79835 ?  69  ASP C CG    1 
ATOM   7150  O OD1   . ASP C 1 69  ? 160.12367 241.85526 66.80046  1.000 119.51281 ?  69  ASP C OD1   1 
ATOM   7151  O OD2   . ASP C 1 69  ? 160.91934 240.35805 65.37973  1.000 113.25641 ?  69  ASP C OD2   1 
ATOM   7152  N N     . VAL C 1 70  ? 159.56635 238.23192 70.13046  1.000 118.99752 ?  70  VAL C N     1 
ATOM   7153  C CA    . VAL C 1 70  ? 159.11684 237.10904 70.94102  1.000 114.52647 ?  70  VAL C CA    1 
ATOM   7154  C C     . VAL C 1 70  ? 158.20719 237.61311 72.05835  1.000 114.09037 ?  70  VAL C C     1 
ATOM   7155  O O     . VAL C 1 70  ? 157.15030 237.02450 72.32107  1.000 113.66061 ?  70  VAL C O     1 
ATOM   7156  C CB    . VAL C 1 70  ? 160.32268 236.29827 71.46625  1.000 110.76623 ?  70  VAL C CB    1 
ATOM   7157  C CG1   . VAL C 1 70  ? 159.90774 235.42543 72.61330  1.000 110.23355 ?  70  VAL C CG1   1 
ATOM   7158  C CG2   . VAL C 1 70  ? 160.95147 235.42720 70.35128  1.000 103.34197 ?  70  VAL C CG2   1 
ATOM   7159  N N     . CYS C 1 71  ? 158.56663 238.74556 72.69072  1.000 114.64062 ?  71  CYS C N     1 
ATOM   7160  C CA    . CYS C 1 71  ? 157.73742 239.28922 73.77235  1.000 119.91417 ?  71  CYS C CA    1 
ATOM   7161  C C     . CYS C 1 71  ? 156.34720 239.66718 73.27359  1.000 120.97455 ?  71  CYS C C     1 
ATOM   7162  O O     . CYS C 1 71  ? 155.34210 239.38938 73.94535  1.000 118.19652 ?  71  CYS C O     1 
ATOM   7163  C CB    . CYS C 1 71  ? 158.38771 240.52793 74.40683  1.000 119.92821 ?  71  CYS C CB    1 
ATOM   7164  S SG    . CYS C 1 71  ? 159.92837 240.31230 75.32490  1.000 131.15077 ?  71  CYS C SG    1 
ATOM   7165  N N     . SER C 1 72  ? 156.27689 240.31326 72.09852  1.000 121.97973 ?  72  SER C N     1 
ATOM   7166  C CA    . SER C 1 72  ? 154.99344 240.72576 71.52908  1.000 122.58172 ?  72  SER C CA    1 
ATOM   7167  C C     . SER C 1 72  ? 154.11262 239.51202 71.22673  1.000 119.72211 ?  72  SER C C     1 
ATOM   7168  O O     . SER C 1 72  ? 152.88418 239.56422 71.38976  1.000 116.12212 ?  72  SER C O     1 
ATOM   7169  C CB    . SER C 1 72  ? 155.22123 241.63110 70.29844  1.000 119.86294 ?  72  SER C CB    1 
ATOM   7170  O OG    . SER C 1 72  ? 155.75503 240.96769 69.15516  1.000 119.38053 ?  72  SER C OG    1 
ATOM   7171  N N     . TYR C 1 73  ? 154.72598 238.41710 70.76804  1.000 116.32153 ?  73  TYR C N     1 
ATOM   7172  C CA    . TYR C 1 73  ? 153.99029 237.18258 70.50909  1.000 115.48508 ?  73  TYR C CA    1 
ATOM   7173  C C     . TYR C 1 73  ? 153.38732 236.59906 71.78199  1.000 119.70127 ?  73  TYR C C     1 
ATOM   7174  O O     . TYR C 1 73  ? 152.28313 236.03130 71.75747  1.000 118.27307 ?  73  TYR C O     1 
ATOM   7175  C CB    . TYR C 1 73  ? 154.91404 236.18347 69.82257  1.000 112.07486 ?  73  TYR C CB    1 
ATOM   7176  C CG    . TYR C 1 73  ? 154.37301 234.79578 69.82606  1.000 115.05798 ?  73  TYR C CG    1 
ATOM   7177  C CD1   . TYR C 1 73  ? 153.29543 234.46903 69.02704  1.000 117.06220 ?  73  TYR C CD1   1 
ATOM   7178  C CD2   . TYR C 1 73  ? 155.01166 233.77897 70.52733  1.000 114.28926 ?  73  TYR C CD2   1 
ATOM   7179  C CE1   . TYR C 1 73  ? 152.79568 233.19566 69.00062  1.000 116.41727 ?  73  TYR C CE1   1 
ATOM   7180  C CE2   . TYR C 1 73  ? 154.53506 232.49058 70.49028  1.000 115.09348 ?  73  TYR C CE2   1 
ATOM   7181  C CZ    . TYR C 1 73  ? 153.42509 232.20722 69.72354  1.000 116.01744 ?  73  TYR C CZ    1 
ATOM   7182  O OH    . TYR C 1 73  ? 152.94295 230.92960 69.67458  1.000 114.01955 ?  73  TYR C OH    1 
ATOM   7183  N N     . LEU C 1 74  ? 154.15486 236.63647 72.87564  1.000 116.05392 ?  74  LEU C N     1 
ATOM   7184  C CA    . LEU C 1 74  ? 153.69331 236.14272 74.16873  1.000 111.82088 ?  74  LEU C CA    1 
ATOM   7185  C C     . LEU C 1 74  ? 152.56197 237.01173 74.72578  1.000 116.10366 ?  74  LEU C C     1 
ATOM   7186  O O     . LEU C 1 74  ? 151.60237 236.48902 75.30548  1.000 118.79104 ?  74  LEU C O     1 
ATOM   7187  C CB    . LEU C 1 74  ? 154.88779 236.05468 75.12871  1.000 109.04923 ?  74  LEU C CB    1 
ATOM   7188  C CG    . LEU C 1 74  ? 156.03632 235.07231 74.80221  1.000 105.24118 ?  74  LEU C CG    1 
ATOM   7189  C CD1   . LEU C 1 74  ? 157.20530 235.20588 75.78566  1.000 104.07674 ?  74  LEU C CD1   1 
ATOM   7190  C CD2   . LEU C 1 74  ? 155.55589 233.61846 74.77115  1.000 99.51699  ?  74  LEU C CD2   1 
ATOM   7191  N N     . ALA C 1 75  ? 152.66733 238.34170 74.60076  1.000 114.59463 ?  75  ALA C N     1 
ATOM   7192  C CA    . ALA C 1 75  ? 151.55928 239.18752 75.04269  1.000 118.99666 ?  75  ALA C CA    1 
ATOM   7193  C C     . ALA C 1 75  ? 150.32682 238.96649 74.16095  1.000 123.59582 ?  75  ALA C C     1 
ATOM   7194  O O     . ALA C 1 75  ? 149.18911 238.99008 74.65121  1.000 124.70433 ?  75  ALA C O     1 
ATOM   7195  C CB    . ALA C 1 75  ? 151.97065 240.65893 75.08779  1.000 114.50823 ?  75  ALA C CB    1 
ATOM   7196  N N     . ALA C 1 76  ? 150.53420 238.75653 72.85213  1.000 120.92828 ?  76  ALA C N     1 
ATOM   7197  C CA    . ALA C 1 76  ? 149.41873 238.46132 71.95343  1.000 122.15618 ?  76  ALA C CA    1 
ATOM   7198  C C     . ALA C 1 76  ? 148.75367 237.14551 72.32805  1.000 128.56949 ?  76  ALA C C     1 
ATOM   7199  O O     . ALA C 1 76  ? 147.52300 237.02120 72.27549  1.000 132.71445 ?  76  ALA C O     1 
ATOM   7200  C CB    . ALA C 1 76  ? 149.90782 238.40001 70.50651  1.000 118.17026 ?  76  ALA C CB    1 
ATOM   7201  N N     . ALA C 1 77  ? 149.55501 236.15612 72.72114  1.000 123.89491 ?  77  ALA C N     1 
ATOM   7202  C CA    . ALA C 1 77  ? 149.04124 234.84751 73.09330  1.000 125.80711 ?  77  ALA C CA    1 
ATOM   7203  C C     . ALA C 1 77  ? 148.23757 234.87369 74.39757  1.000 130.27776 ?  77  ALA C C     1 
ATOM   7204  O O     . ALA C 1 77  ? 147.55093 233.88455 74.69457  1.000 128.16864 ?  77  ALA C O     1 
ATOM   7205  C CB    . ALA C 1 77  ? 150.20585 233.85442 73.16340  1.000 119.57816 ?  77  ALA C CB    1 
ATOM   7206  N N     . MET C 1 78  ? 148.30411 235.98261 75.16898  1.000 127.74658 ?  78  MET C N     1 
ATOM   7207  C CA    . MET C 1 78  ? 147.61436 236.09881 76.46216  1.000 129.37248 ?  78  MET C CA    1 
ATOM   7208  C C     . MET C 1 78  ? 146.10970 235.97580 76.34440  1.000 134.38427 ?  78  MET C C     1 
ATOM   7209  O O     . MET C 1 78  ? 145.45612 235.47588 77.26687  1.000 133.31850 ?  78  MET C O     1 
ATOM   7210  C CB    . MET C 1 78  ? 147.89716 237.46246 77.10806  1.000 129.17238 ?  78  MET C CB    1 
ATOM   7211  C CG    . MET C 1 78  ? 149.31563 237.68662 77.51469  1.000 131.39087 ?  78  MET C CG    1 
ATOM   7212  S SD    . MET C 1 78  ? 149.80780 236.51621 78.77445  1.000 146.89459 ?  78  MET C SD    1 
ATOM   7213  C CE    . MET C 1 78  ? 151.34948 237.27952 79.29027  1.000 136.20739 ?  78  MET C CE    1 
ATOM   7214  N N     . GLN C 1 79  ? 145.53901 236.44147 75.23684  1.000 138.10745 ?  79  GLN C N     1 
ATOM   7215  C CA    . GLN C 1 79  ? 144.09080 236.39137 75.10151  1.000 140.59277 ?  79  GLN C CA    1 
ATOM   7216  C C     . GLN C 1 79  ? 143.61374 234.95343 74.99139  1.000 140.57174 ?  79  GLN C C     1 
ATOM   7217  O O     . GLN C 1 79  ? 142.56244 234.59424 75.53336  1.000 143.55003 ?  79  GLN C O     1 
ATOM   7218  C CB    . GLN C 1 79  ? 143.67718 237.19981 73.87777  1.000 137.95318 ?  79  GLN C CB    1 
ATOM   7219  C CG    . GLN C 1 79  ? 144.39654 238.53089 73.84324  1.000 136.48620 ?  79  GLN C CG    1 
ATOM   7220  C CD    . GLN C 1 79  ? 144.05368 239.38338 75.04092  1.000 144.63957 ?  79  GLN C CD    1 
ATOM   7221  O OE1   . GLN C 1 79  ? 144.92915 240.02482 75.62955  1.000 144.03543 ?  79  GLN C OE1   1 
ATOM   7222  N NE2   . GLN C 1 79  ? 142.78203 239.37462 75.43180  1.000 144.70465 ?  79  GLN C NE2   1 
ATOM   7223  N N     . PHE C 1 80  ? 144.39102 234.11888 74.29572  1.000 135.27069 ?  80  PHE C N     1 
ATOM   7224  C CA    . PHE C 1 80  ? 144.03941 232.71823 74.09466  1.000 133.96937 ?  80  PHE C CA    1 
ATOM   7225  C C     . PHE C 1 80  ? 144.06553 231.92682 75.41284  1.000 135.84878 ?  80  PHE C C     1 
ATOM   7226  O O     . PHE C 1 80  ? 143.13378 231.15525 75.69368  1.000 135.82355 ?  80  PHE C O     1 
ATOM   7227  C CB    . PHE C 1 80  ? 144.98040 232.13052 73.02860  1.000 135.62812 ?  80  PHE C CB    1 
ATOM   7228  C CG    . PHE C 1 80  ? 144.93563 230.63843 72.93048  1.000 143.63185 ?  80  PHE C CG    1 
ATOM   7229  C CD1   . PHE C 1 80  ? 143.77812 229.94538 73.21504  1.000 146.88170 ?  80  PHE C CD1   1 
ATOM   7230  C CD2   . PHE C 1 80  ? 146.09191 229.91419 72.67303  1.000 137.97719 ?  80  PHE C CD2   1 
ATOM   7231  C CE1   . PHE C 1 80  ? 143.76294 228.56825 73.19915  1.000 150.27003 ?  80  PHE C CE1   1 
ATOM   7232  C CE2   . PHE C 1 80  ? 146.08367 228.51467 72.64611  1.000 135.72147 ?  80  PHE C CE2   1 
ATOM   7233  C CZ    . PHE C 1 80  ? 144.92307 227.84912 72.93611  1.000 143.75977 ?  80  PHE C CZ    1 
ATOM   7234  N N     . PHE C 1 81  ? 145.07466 232.15049 76.26822  1.000 134.28043 ?  81  PHE C N     1 
ATOM   7235  C CA    . PHE C 1 81  ? 145.24073 231.35455 77.49675  1.000 131.02948 ?  81  PHE C CA    1 
ATOM   7236  C C     . PHE C 1 81  ? 144.40189 231.98179 78.60520  1.000 136.96221 ?  81  PHE C C     1 
ATOM   7237  O O     . PHE C 1 81  ? 144.90166 232.70884 79.45986  1.000 141.63406 ?  81  PHE C O     1 
ATOM   7238  C CB    . PHE C 1 81  ? 146.69525 231.31777 77.94582  1.000 125.53008 ?  81  PHE C CB    1 
ATOM   7239  C CG    . PHE C 1 81  ? 147.60363 230.57383 77.04014  1.000 125.31268 ?  81  PHE C CG    1 
ATOM   7240  C CD1   . PHE C 1 81  ? 147.58639 229.18971 77.00333  1.000 121.04947 ?  81  PHE C CD1   1 
ATOM   7241  C CD2   . PHE C 1 81  ? 148.56852 231.25729 76.31046  1.000 124.59443 ?  81  PHE C CD2   1 
ATOM   7242  C CE1   . PHE C 1 81  ? 148.44903 228.50053 76.17275  1.000 123.39342 ?  81  PHE C CE1   1 
ATOM   7243  C CE2   . PHE C 1 81  ? 149.44468 230.57898 75.49441  1.000 125.83808 ?  81  PHE C CE2   1 
ATOM   7244  C CZ    . PHE C 1 81  ? 149.38665 229.19696 75.42555  1.000 123.67754 ?  81  PHE C CZ    1 
ATOM   7245  N N     . GLU C 1 82  ? 143.10953 231.66845 78.62219  1.000 135.96892 ?  82  GLU C N     1 
ATOM   7246  C CA    . GLU C 1 82  ? 142.22067 232.27632 79.60715  1.000 136.53988 ?  82  GLU C CA    1 
ATOM   7247  C C     . GLU C 1 82  ? 141.19729 231.26066 80.10587  1.000 136.94711 ?  82  GLU C C     1 
ATOM   7248  O O     . GLU C 1 82  ? 140.88215 230.28440 79.41802  1.000 141.22281 ?  82  GLU C O     1 
ATOM   7249  C CB    . GLU C 1 82  ? 141.55354 233.53590 79.03822  1.000 133.61920 ?  82  GLU C CB    1 
ATOM   7250  C CG    . GLU C 1 82  ? 140.44509 233.28382 78.03774  1.000 137.54744 ?  82  GLU C CG    1 
ATOM   7251  C CD    . GLU C 1 82  ? 139.08076 233.28370 78.70505  1.000 146.20941 ?  82  GLU C CD    1 
ATOM   7252  O OE1   . GLU C 1 82  ? 139.00758 233.72017 79.87598  1.000 141.03631 ?  82  GLU C OE1   1 
ATOM   7253  O OE2   . GLU C 1 82  ? 138.08384 232.87144 78.06558  1.000 140.53575 ?  82  GLU C OE2   1 
ATOM   7254  N N     . GLY C 1 83  ? 140.76442 231.44453 81.35510  1.000 127.90132 ?  83  GLY C N     1 
ATOM   7255  C CA    . GLY C 1 83  ? 139.78596 230.56156 81.97583  1.000 127.73489 ?  83  GLY C CA    1 
ATOM   7256  C C     . GLY C 1 83  ? 139.04484 231.25166 83.10503  1.000 134.98761 ?  83  GLY C C     1 
ATOM   7257  O O     . GLY C 1 83  ? 139.45186 232.31829 83.57940  1.000 136.99608 ?  83  GLY C O     1 
ATOM   7258  N N     . THR C 1 84  ? 137.91358 230.66365 83.49806  1.000 134.78144 ?  84  THR C N     1 
ATOM   7259  C CA    . THR C 1 84  ? 137.17891 231.20914 84.63301  1.000 134.69214 ?  84  THR C CA    1 
ATOM   7260  C C     . THR C 1 84  ? 137.86749 230.82635 85.94585  1.000 138.24959 ?  84  THR C C     1 
ATOM   7261  O O     . THR C 1 84  ? 138.29514 229.68347 86.14011  1.000 138.91715 ?  84  THR C O     1 
ATOM   7262  C CB    . THR C 1 84  ? 135.71002 230.74202 84.57679  1.000 127.84871 ?  84  THR C CB    1 
ATOM   7263  O OG1   . THR C 1 84  ? 134.90013 231.51883 85.46409  1.000 123.93152 ?  84  THR C OG1   1 
ATOM   7264  C CG2   . THR C 1 84  ? 135.54794 229.25362 84.84276  1.000 121.73576 ?  84  THR C CG2   1 
ATOM   7265  N N     . CYS C 1 85  ? 137.98027 231.83961 86.89434  1.000 136.37639 ?  85  CYS C N     1 
ATOM   7266  C CA    . CYS C 1 85  ? 138.64092 231.64611 88.18433  1.000 137.91435 ?  85  CYS C CA    1 
ATOM   7267  C C     . CYS C 1 85  ? 137.66412 231.06973 89.19653  1.000 140.09548 ?  85  CYS C C     1 
ATOM   7268  O O     . CYS C 1 85  ? 136.48168 231.43458 89.19749  1.000 142.41168 ?  85  CYS C O     1 
ATOM   7269  C CB    . CYS C 1 85  ? 139.21990 232.96628 88.72812  1.000 140.06223 ?  85  CYS C CB    1 
ATOM   7270  S SG    . CYS C 1 85  ? 138.12808 234.38993 89.14098  1.000 134.55831 ?  85  CYS C SG    1 
ATOM   7271  N N     . PRO C 1 86  ? 138.09710 230.11966 90.03110  1.000 141.42939 ?  86  PRO C N     1 
ATOM   7272  C CA    . PRO C 1 86  ? 137.15067 229.55432 91.01869  1.000 139.53850 ?  86  PRO C CA    1 
ATOM   7273  C C     . PRO C 1 86  ? 136.57854 230.59476 91.98836  1.000 135.45197 ?  86  PRO C C     1 
ATOM   7274  O O     . PRO C 1 86  ? 135.36254 230.60837 92.21547  1.000 137.53871 ?  86  PRO C O     1 
ATOM   7275  C CB    . PRO C 1 86  ? 138.00188 228.48785 91.74079  1.000 125.87568 ?  86  PRO C CB    1 
ATOM   7276  C CG    . PRO C 1 86  ? 139.14419 228.18034 90.74836  1.000 130.32380 ?  86  PRO C CG    1 
ATOM   7277  C CD    . PRO C 1 86  ? 139.42143 229.46599 90.05546  1.000 133.30253 ?  86  PRO C CD    1 
ATOM   7278  N N     . GLU C 1 87  ? 137.40992 231.48051 92.53492  1.000 134.31117 ?  87  GLU C N     1 
ATOM   7279  C CA    . GLU C 1 87  ? 137.02568 232.52698 93.48036  1.000 136.49806 ?  87  GLU C CA    1 
ATOM   7280  C C     . GLU C 1 87  ? 137.87765 233.74999 93.16929  1.000 142.17569 ?  87  GLU C C     1 
ATOM   7281  O O     . GLU C 1 87  ? 138.79699 233.66613 92.35218  1.000 141.07509 ?  87  GLU C O     1 
ATOM   7282  C CB    . GLU C 1 87  ? 137.19303 232.05452 94.93696  1.000 127.47062 ?  87  GLU C CB    1 
ATOM   7283  C CG    . GLU C 1 87  ? 136.74247 233.05268 95.98425  1.000 133.16999 ?  87  GLU C CG    1 
ATOM   7284  C CD    . GLU C 1 87  ? 135.25035 233.28518 95.97182  1.000 142.44977 ?  87  GLU C CD    1 
ATOM   7285  O OE1   . GLU C 1 87  ? 134.51369 232.40195 95.48768  1.000 149.47791 ?  87  GLU C OE1   1 
ATOM   7286  O OE2   . GLU C 1 87  ? 134.81401 234.34847 96.45805  1.000 144.04880 ?  87  GLU C OE2   1 
ATOM   7287  N N     . ASP C 1 88  ? 137.52958 234.91421 93.73570  1.000 141.39698 ?  88  ASP C N     1 
ATOM   7288  C CA    . ASP C 1 88  ? 138.44632 236.04201 93.59349  1.000 144.14911 ?  88  ASP C CA    1 
ATOM   7289  C C     . ASP C 1 88  ? 139.77129 235.66410 94.24438  1.000 144.77197 ?  88  ASP C C     1 
ATOM   7290  O O     . ASP C 1 88  ? 139.80581 235.32871 95.43590  1.000 141.64207 ?  88  ASP C O     1 
ATOM   7291  C CB    . ASP C 1 88  ? 137.89663 237.30212 94.26039  1.000 143.40242 ?  88  ASP C CB    1 
ATOM   7292  C CG    . ASP C 1 88  ? 138.94508 238.41984 94.34320  1.000 146.00117 ?  88  ASP C CG    1 
ATOM   7293  O OD1   . ASP C 1 88  ? 139.76807 238.52779 93.40610  1.000 146.89214 ?  88  ASP C OD1   1 
ATOM   7294  O OD2   . ASP C 1 88  ? 139.00472 239.13721 95.36515  1.000 135.14071 ?  88  ASP C OD2   1 
ATOM   7295  N N     . TRP C 1 89  ? 140.87183 235.74455 93.47633  1.000 146.08861 ?  89  TRP C N     1 
ATOM   7296  C CA    . TRP C 1 89  ? 142.19187 235.31809 93.95490  1.000 148.27018 ?  89  TRP C CA    1 
ATOM   7297  C C     . TRP C 1 89  ? 143.18358 236.47329 94.07581  1.000 151.35561 ?  89  TRP C C     1 
ATOM   7298  O O     . TRP C 1 89  ? 144.29609 236.26137 94.56781  1.000 151.60232 ?  89  TRP C O     1 
ATOM   7299  C CB    . TRP C 1 89  ? 142.78300 234.21213 93.05851  1.000 138.12301 ?  89  TRP C CB    1 
ATOM   7300  C CG    . TRP C 1 89  ? 142.82459 234.51843 91.59133  1.000 136.74994 ?  89  TRP C CG    1 
ATOM   7301  C CD1   . TRP C 1 89  ? 141.76693 234.58655 90.73146  1.000 141.04074 ?  89  TRP C CD1   1 
ATOM   7302  C CD2   . TRP C 1 89  ? 144.00340 234.68423 90.78817  1.000 141.07998 ?  89  TRP C CD2   1 
ATOM   7303  N NE1   . TRP C 1 89  ? 142.20853 234.85702 89.45483  1.000 148.40378 ?  89  TRP C NE1   1 
ATOM   7304  C CE2   . TRP C 1 89  ? 143.57833 234.90917 89.46072  1.000 146.67818 ?  89  TRP C CE2   1 
ATOM   7305  C CE3   . TRP C 1 89  ? 145.37357 234.68725 91.06649  1.000 140.54112 ?  89  TRP C CE3   1 
ATOM   7306  C CZ2   . TRP C 1 89  ? 144.47498 235.13489 88.41601  1.000 138.44560 ?  89  TRP C CZ2   1 
ATOM   7307  C CZ3   . TRP C 1 89  ? 146.26162 234.91188 90.02651  1.000 142.68235 ?  89  TRP C CZ3   1 
ATOM   7308  C CH2   . TRP C 1 89  ? 145.80937 235.13404 88.71944  1.000 136.11222 ?  89  TRP C CH2   1 
ATOM   7309  N N     . THR C 1 90  ? 142.83564 237.67946 93.61439  1.000 149.99494 ?  90  THR C N     1 
ATOM   7310  C CA    . THR C 1 90  ? 143.68773 238.85547 93.77450  1.000 149.65676 ?  90  THR C CA    1 
ATOM   7311  C C     . THR C 1 90  ? 142.95693 239.78296 94.74382  1.000 138.31853 ?  90  THR C C     1 
ATOM   7312  O O     . THR C 1 90  ? 141.80309 240.15100 94.50441  1.000 133.09491 ?  90  THR C O     1 
ATOM   7313  C CB    . THR C 1 90  ? 143.98244 239.53636 92.41818  1.000 147.60541 ?  90  THR C CB    1 
ATOM   7314  O OG1   . THR C 1 90  ? 144.57642 238.59949 91.50696  1.000 136.09884 ?  90  THR C OG1   1 
ATOM   7315  C CG2   . THR C 1 90  ? 144.94990 240.71304 92.56998  1.000 141.54825 ?  90  THR C CG2   1 
ATOM   7316  N N     . SER C 1 91  ? 143.56860 240.04060 95.89770  1.000 140.78016 ?  91  SER C N     1 
ATOM   7317  C CA    . SER C 1 91  ? 143.03333 240.98748 96.86925  1.000 148.08283 ?  91  SER C CA    1 
ATOM   7318  C C     . SER C 1 91  ? 143.92344 242.22800 96.96367  1.000 147.88934 ?  91  SER C C     1 
ATOM   7319  O O     . SER C 1 91  ? 143.70950 243.07834 97.83133  1.000 147.71534 ?  91  SER C O     1 
ATOM   7320  C CB    . SER C 1 91  ? 142.84530 240.31049 98.24686  1.000 143.23516 ?  91  SER C CB    1 
ATOM   7321  O OG    . SER C 1 91  ? 142.10093 241.10640 99.17398  1.000 137.47494 ?  91  SER C OG    1 
ATOM   7322  N N     . TYR C 1 92  ? 144.88795 242.37633 96.05724  1.000 141.45011 ?  92  TYR C N     1 
ATOM   7323  C CA    . TYR C 1 92  ? 145.87613 243.44552 96.13958  1.000 137.84522 ?  92  TYR C CA    1 
ATOM   7324  C C     . TYR C 1 92  ? 145.33401 244.70120 95.45349  1.000 144.35187 ?  92  TYR C C     1 
ATOM   7325  O O     . TYR C 1 92  ? 145.27108 244.76292 94.22325  1.000 149.62340 ?  92  TYR C O     1 
ATOM   7326  C CB    . TYR C 1 92  ? 147.18458 242.95405 95.52887  1.000 138.58701 ?  92  TYR C CB    1 
ATOM   7327  C CG    . TYR C 1 92  ? 148.15314 244.03712 95.23683  1.000 147.74369 ?  92  TYR C CG    1 
ATOM   7328  C CD1   . TYR C 1 92  ? 148.78986 244.70018 96.27320  1.000 141.92390 ?  92  TYR C CD1   1 
ATOM   7329  C CD2   . TYR C 1 92  ? 148.44467 244.40047 93.93770  1.000 154.64874 ?  92  TYR C CD2   1 
ATOM   7330  C CE1   . TYR C 1 92  ? 149.68221 245.69848 96.02829  1.000 143.71939 ?  92  TYR C CE1   1 
ATOM   7331  C CE2   . TYR C 1 92  ? 149.33911 245.40494 93.67629  1.000 156.09691 ?  92  TYR C CE2   1 
ATOM   7332  C CZ    . TYR C 1 92  ? 149.95283 246.04725 94.72964  1.000 153.20247 ?  92  TYR C CZ    1 
ATOM   7333  O OH    . TYR C 1 92  ? 150.84588 247.04560 94.49306  1.000 147.07673 ?  92  TYR C OH    1 
ATOM   7334  N N     . GLY C 1 93  ? 144.93630 245.69857 96.25493  1.000 142.06136 ?  93  GLY C N     1 
ATOM   7335  C CA    . GLY C 1 93  ? 144.42048 246.97610 95.76531  1.000 147.42087 ?  93  GLY C CA    1 
ATOM   7336  C C     . GLY C 1 93  ? 143.44680 246.85155 94.60024  1.000 148.33647 ?  93  GLY C C     1 
ATOM   7337  O O     . GLY C 1 93  ? 142.31942 246.38418 94.79507  1.000 145.73932 ?  93  GLY C O     1 
ATOM   7338  N N     . ILE C 1 94  ? 143.85940 247.31972 93.41646  1.000 144.68368 ?  94  ILE C N     1 
ATOM   7339  C CA    . ILE C 1 94  ? 143.07900 247.15107 92.19383  1.000 145.07053 ?  94  ILE C CA    1 
ATOM   7340  C C     . ILE C 1 94  ? 143.13766 245.67240 91.84738  1.000 145.82731 ?  94  ILE C C     1 
ATOM   7341  O O     . ILE C 1 94  ? 144.14688 245.16981 91.34285  1.000 149.03562 ?  94  ILE C O     1 
ATOM   7342  C CB    . ILE C 1 94  ? 143.57386 248.03652 91.03083  1.000 143.83838 ?  94  ILE C CB    1 
ATOM   7343  C CG1   . ILE C 1 94  ? 142.99278 249.45415 91.10326  1.000 141.49844 ?  94  ILE C CG1   1 
ATOM   7344  C CG2   . ILE C 1 94  ? 143.14020 247.42567 89.66640  1.000 134.41242 ?  94  ILE C CG2   1 
ATOM   7345  C CD1   . ILE C 1 94  ? 143.25532 250.25093 92.38330  1.000 131.14858 ?  94  ILE C CD1   1 
ATOM   7346  N N     . VAL C 1 95  ? 142.04852 244.97385 92.15118  1.000 144.37067 ?  95  VAL C N     1 
ATOM   7347  C CA    . VAL C 1 95  ? 142.02092 243.54133 92.04530  1.000 138.81860 ?  95  VAL C CA    1 
ATOM   7348  C C     . VAL C 1 95  ? 141.33759 243.16956 90.74653  1.000 139.55183 ?  95  VAL C C     1 
ATOM   7349  O O     . VAL C 1 95  ? 140.57837 243.95157 90.15619  1.000 139.84820 ?  95  VAL C O     1 
ATOM   7350  C CB    . VAL C 1 95  ? 141.25015 242.93687 93.25442  1.000 138.04133 ?  95  VAL C CB    1 
ATOM   7351  C CG1   . VAL C 1 95  ? 141.81943 243.48323 94.70991  1.000 126.71131 ?  95  VAL C CG1   1 
ATOM   7352  C CG2   . VAL C 1 95  ? 139.66526 243.06094 93.02018  1.000 123.36209 ?  95  VAL C CG2   1 
ATOM   7353  N N     . ILE C 1 96  ? 141.62042 241.94946 90.26051  1.000 135.40577 ?  96  ILE C N     1 
ATOM   7354  C CA    . ILE C 1 96  ? 140.88934 241.50984 89.07917  1.000 141.83703 ?  96  ILE C CA    1 
ATOM   7355  C C     . ILE C 1 96  ? 139.45481 241.11217 89.44759  1.000 147.89002 ?  96  ILE C C     1 
ATOM   7356  O O     . ILE C 1 96  ? 138.55637 241.17647 88.60445  1.000 147.45079 ?  96  ILE C O     1 
ATOM   7357  C CB    . ILE C 1 96  ? 141.61676 240.38300 88.32184  1.000 143.96554 ?  96  ILE C CB    1 
ATOM   7358  C CG1   . ILE C 1 96  ? 141.02516 240.17108 86.89721  1.000 139.29650 ?  96  ILE C CG1   1 
ATOM   7359  C CG2   . ILE C 1 96  ? 141.58469 239.06302 89.13318  1.000 138.17882 ?  96  ILE C CG2   1 
ATOM   7360  C CD1   . ILE C 1 96  ? 141.07587 241.38183 85.92934  1.000 130.69629 ?  96  ILE C CD1   1 
ATOM   7361  N N     . ALA C 1 97  ? 139.21070 240.76183 90.72394  1.000 143.75637 ?  97  ALA C N     1 
ATOM   7362  C CA    . ALA C 1 97  ? 137.91197 240.26353 91.26635  1.000 144.19979 ?  97  ALA C CA    1 
ATOM   7363  C C     . ALA C 1 97  ? 137.32684 239.25861 90.27379  1.000 155.79813 ?  97  ALA C C     1 
ATOM   7364  O O     . ALA C 1 97  ? 138.00237 238.25856 89.97760  1.000 154.17863 ?  97  ALA C O     1 
ATOM   7365  C CB    . ALA C 1 97  ? 136.95998 241.39691 91.64819  1.000 142.50388 ?  97  ALA C CB    1 
ATOM   7366  N N     . ARG C 1 98  ? 136.10008 239.47648 89.78196  1.000 161.15404 ?  98  ARG C N     1 
ATOM   7367  C CA    . ARG C 1 98  ? 135.42157 238.63070 88.79040  1.000 156.44478 ?  98  ARG C CA    1 
ATOM   7368  C C     . ARG C 1 98  ? 135.41710 237.16057 89.21013  1.000 150.95726 ?  98  ARG C C     1 
ATOM   7369  O O     . ARG C 1 98  ? 135.77326 236.26557 88.43884  1.000 146.26688 ?  98  ARG C O     1 
ATOM   7370  C CB    . ARG C 1 98  ? 136.02490 238.82304 87.38436  1.000 145.26643 ?  98  ARG C CB    1 
ATOM   7371  C CG    . ARG C 1 98  ? 135.93974 240.27206 86.85960  1.000 145.02579 ?  98  ARG C CG    1 
ATOM   7372  C CD    . ARG C 1 98  ? 134.51473 240.85553 86.91873  1.000 141.58516 ?  98  ARG C CD    1 
ATOM   7373  N NE    . ARG C 1 98  ? 134.47461 242.31017 86.75465  1.000 150.60359 ?  98  ARG C NE    1 
ATOM   7374  C CZ    . ARG C 1 98  ? 134.47617 243.17270 87.76645  1.000 145.16255 ?  98  ARG C CZ    1 
ATOM   7375  N NH1   . ARG C 1 98  ? 134.52000 242.75969 89.02612  1.000 139.10622 ?  98  ARG C NH1   1 
ATOM   7376  N NH2   . ARG C 1 98  ? 134.43769 244.48118 87.50996  1.000 142.58293 ?  98  ARG C NH2   1 
ATOM   7377  N N     . LYS C 1 99  ? 135.03367 236.91890 90.46726  1.000 143.73575 ?  99  LYS C N     1 
ATOM   7378  C CA    . LYS C 1 99  ? 134.98439 235.55135 90.96047  1.000 140.85713 ?  99  LYS C CA    1 
ATOM   7379  C C     . LYS C 1 99  ? 133.97213 234.77783 90.12322  1.000 142.72532 ?  99  LYS C C     1 
ATOM   7380  O O     . LYS C 1 99  ? 132.83658 235.22769 89.95091  1.000 146.26408 ?  99  LYS C O     1 
ATOM   7381  C CB    . LYS C 1 99  ? 134.58716 235.54703 92.43599  1.000 137.15686 ?  99  LYS C CB    1 
ATOM   7382  C CG    . LYS C 1 99  ? 133.51752 236.57421 92.78373  1.000 136.24199 ?  99  LYS C CG    1 
ATOM   7383  C CD    . LYS C 1 99  ? 132.85376 236.22295 94.09115  1.000 135.68183 ?  99  LYS C CD    1 
ATOM   7384  C CE    . LYS C 1 99  ? 132.24062 234.84098 94.00699  1.000 134.67634 ?  99  LYS C CE    1 
ATOM   7385  N NZ    . LYS C 1 99  ? 131.72211 234.38443 95.32046  1.000 128.98201 ?  99  LYS C NZ    1 
ATOM   7386  N N     . GLY C 1 100 ? 134.38114 233.61550 89.61105  1.000 139.51619 ?  100 GLY C N     1 
ATOM   7387  C CA    . GLY C 1 100 ? 133.53806 232.79114 88.75805  1.000 138.85652 ?  100 GLY C CA    1 
ATOM   7388  C C     . GLY C 1 100 ? 133.43065 233.28903 87.33222  1.000 137.38492 ?  100 GLY C C     1 
ATOM   7389  O O     . GLY C 1 100 ? 132.67289 232.71631 86.52899  1.000 135.25480 ?  100 GLY C O     1 
ATOM   7390  N N     . ASP C 1 101 ? 134.17471 234.34868 86.98497  1.000 136.63482 ?  101 ASP C N     1 
ATOM   7391  C CA    . ASP C 1 101 ? 134.18726 234.97558 85.66900  1.000 140.22411 ?  101 ASP C CA    1 
ATOM   7392  C C     . ASP C 1 101 ? 135.52399 234.76071 84.99833  1.000 140.33046 ?  101 ASP C C     1 
ATOM   7393  O O     . ASP C 1 101 ? 136.56760 234.99692 85.61417  1.000 142.03342 ?  101 ASP C O     1 
ATOM   7394  C CB    . ASP C 1 101 ? 133.86902 236.47318 85.76513  1.000 140.24738 ?  101 ASP C CB    1 
ATOM   7395  C CG    . ASP C 1 101 ? 132.58420 236.75310 86.48303  1.000 144.56738 ?  101 ASP C CG    1 
ATOM   7396  O OD1   . ASP C 1 101 ? 131.52533 236.27556 86.01907  1.000 150.93831 ?  101 ASP C OD1   1 
ATOM   7397  O OD2   . ASP C 1 101 ? 132.65523 237.41298 87.53269  1.000 145.29908 ?  101 ASP C OD2   1 
ATOM   7398  N N     . LYS C 1 102 ? 135.48696 234.36216 83.71794  1.000 134.32412 ?  102 LYS C N     1 
ATOM   7399  C CA    . LYS C 1 102 ? 136.73885 234.11200 82.99967  1.000 132.18617 ?  102 LYS C CA    1 
ATOM   7400  C C     . LYS C 1 102 ? 137.49987 235.42046 82.84004  1.000 138.40103 ?  102 LYS C C     1 
ATOM   7401  O O     . LYS C 1 102 ? 136.89433 236.47070 82.57100  1.000 137.56008 ?  102 LYS C O     1 
ATOM   7402  C CB    . LYS C 1 102 ? 136.40849 233.45937 81.63500  1.000 128.48280 ?  102 LYS C CB    1 
ATOM   7403  C CG    . LYS C 1 102 ? 135.54008 232.02362 81.70964  1.000 114.40033 ?  102 LYS C CG    1 
ATOM   7404  C CD    . LYS C 1 102 ? 135.75119 231.18505 80.37377  1.000 105.81568 ?  102 LYS C CD    1 
ATOM   7405  C CE    . LYS C 1 102 ? 135.19140 229.71205 80.27611  1.000 98.31663  ?  102 LYS C CE    1 
ATOM   7406  N NZ    . LYS C 1 102 ? 135.61935 229.09135 78.84307  1.000 97.76924  ?  102 LYS C NZ    1 
ATOM   7407  N N     . ILE C 1 103 ? 138.83209 235.36609 83.04638  1.000 137.53561 ?  103 ILE C N     1 
ATOM   7408  C CA    . ILE C 1 103 ? 139.70329 236.53318 82.99501  1.000 134.60342 ?  103 ILE C CA    1 
ATOM   7409  C C     . ILE C 1 103 ? 140.94749 236.14784 82.19736  1.000 134.21915 ?  103 ILE C C     1 
ATOM   7410  O O     . ILE C 1 103 ? 141.43758 235.01707 82.30907  1.000 132.49076 ?  103 ILE C O     1 
ATOM   7411  C CB    . ILE C 1 103 ? 140.04835 237.08892 84.39012  1.000 131.08053 ?  103 ILE C CB    1 
ATOM   7412  C CG1   . ILE C 1 103 ? 140.49729 235.99972 85.37273  1.000 130.05194 ?  103 ILE C CG1   1 
ATOM   7413  C CG2   . ILE C 1 103 ? 138.89301 237.86527 84.97435  1.000 133.24403 ?  103 ILE C CG2   1 
ATOM   7414  C CD1   . ILE C 1 103 ? 140.73914 236.55166 86.79784  1.000 122.90280 ?  103 ILE C CD1   1 
ATOM   7415  N N     . THR C 1 104 ? 141.46989 237.11965 81.31099  1.000 139.34232 ?  104 THR C N     1 
ATOM   7416  C CA    . THR C 1 104 ? 142.67774 236.72623 80.58725  1.000 138.55690 ?  104 THR C CA    1 
ATOM   7417  C C     . THR C 1 104 ? 143.89096 237.14546 81.42291  1.000 134.20242 ?  104 THR C C     1 
ATOM   7418  O O     . THR C 1 104 ? 143.74817 237.89711 82.40417  1.000 132.60773 ?  104 THR C O     1 
ATOM   7419  C CB    . THR C 1 104 ? 142.72215 237.39637 79.19094  1.000 137.14919 ?  104 THR C CB    1 
ATOM   7420  O OG1   . THR C 1 104 ? 143.18445 238.74733 79.28112  1.000 135.90107 ?  104 THR C OG1   1 
ATOM   7421  C CG2   . THR C 1 104 ? 141.34395 237.40088 78.49542  1.000 136.41607 ?  104 THR C CG2   1 
ATOM   7422  N N     . PRO C 1 105 ? 145.06432 236.61180 81.11662  1.000 131.15412 ?  105 PRO C N     1 
ATOM   7423  C CA    . PRO C 1 105 ? 146.28065 237.13065 81.75886  1.000 129.30615 ?  105 PRO C CA    1 
ATOM   7424  C C     . PRO C 1 105 ? 146.48288 238.58705 81.45546  1.000 133.82507 ?  105 PRO C C     1 
ATOM   7425  O O     . PRO C 1 105 ? 146.90370 239.34335 82.33899  1.000 133.39164 ?  105 PRO C O     1 
ATOM   7426  C CB    . PRO C 1 105 ? 147.38940 236.25022 81.14665  1.000 123.99094 ?  105 PRO C CB    1 
ATOM   7427  C CG    . PRO C 1 105 ? 146.66367 234.97209 80.81727  1.000 123.03131 ?  105 PRO C CG    1 
ATOM   7428  C CD    . PRO C 1 105 ? 145.31326 235.38251 80.36964  1.000 129.60195 ?  105 PRO C CD    1 
ATOM   7429  N N     . GLY C 1 106 ? 146.13516 239.03082 80.25188  1.000 135.31829 ?  106 GLY C N     1 
ATOM   7430  C CA    . GLY C 1 106 ? 146.29240 240.42194 79.89358  1.000 137.04152 ?  106 GLY C CA    1 
ATOM   7431  C C     . GLY C 1 106 ? 145.46338 241.38964 80.71892  1.000 137.26906 ?  106 GLY C C     1 
ATOM   7432  O O     . GLY C 1 106 ? 145.76900 242.59262 80.79137  1.000 132.61675 ?  106 GLY C O     1 
ATOM   7433  N N     . SER C 1 107 ? 144.35556 240.89496 81.31170  1.000 135.58068 ?  107 SER C N     1 
ATOM   7434  C CA    . SER C 1 107 ? 143.48333 241.80730 82.06077  1.000 137.96845 ?  107 SER C CA    1 
ATOM   7435  C C     . SER C 1 107 ? 144.11883 242.29905 83.34624  1.000 142.11253 ?  107 SER C C     1 
ATOM   7436  O O     . SER C 1 107 ? 143.87112 243.43465 83.78417  1.000 139.85240 ?  107 SER C O     1 
ATOM   7437  C CB    . SER C 1 107 ? 142.12293 241.16441 82.39043  1.000 136.13128 ?  107 SER C CB    1 
ATOM   7438  O OG    . SER C 1 107 ? 141.42561 240.65183 81.26432  1.000 137.00411 ?  107 SER C OG    1 
ATOM   7439  N N     . LEU C 1 108 ? 144.96666 241.46104 83.95619  1.000 141.32827 ?  108 LEU C N     1 
ATOM   7440  C CA    . LEU C 1 108 ? 145.61387 241.77007 85.23683  1.000 139.27472 ?  108 LEU C CA    1 
ATOM   7441  C C     . LEU C 1 108 ? 146.87694 242.60833 85.07629  1.000 136.99618 ?  108 LEU C C     1 
ATOM   7442  O O     . LEU C 1 108 ? 147.20942 243.41335 85.95542  1.000 130.92229 ?  108 LEU C O     1 
ATOM   7443  C CB    . LEU C 1 108 ? 145.91031 240.47726 85.97557  1.000 132.32866 ?  108 LEU C CB    1 
ATOM   7444  C CG    . LEU C 1 108 ? 146.28477 240.74270 87.43103  1.000 141.91812 ?  108 LEU C CG    1 
ATOM   7445  C CD1   . LEU C 1 108 ? 145.29813 241.68806 88.12502  1.000 143.03616 ?  108 LEU C CD1   1 
ATOM   7446  C CD2   . LEU C 1 108 ? 146.35888 239.41266 88.13098  1.000 137.66831 ?  108 LEU C CD2   1 
ATOM   7447  N N     . VAL C 1 109 ? 147.57667 242.43846 83.95051  1.000 138.49721 ?  109 VAL C N     1 
ATOM   7448  C CA    . VAL C 1 109 ? 148.84515 243.12506 83.70056  1.000 139.79738 ?  109 VAL C CA    1 
ATOM   7449  C C     . VAL C 1 109 ? 148.70069 244.29865 82.72331  1.000 140.72721 ?  109 VAL C C     1 
ATOM   7450  O O     . VAL C 1 109 ? 149.66050 245.07492 82.56565  1.000 136.69450 ?  109 VAL C O     1 
ATOM   7451  C CB    . VAL C 1 109 ? 149.94616 242.14317 83.21059  1.000 134.29695 ?  109 VAL C CB    1 
ATOM   7452  C CG1   . VAL C 1 109 ? 150.42866 241.25797 84.34103  1.000 126.48987 ?  109 VAL C CG1   1 
ATOM   7453  C CG2   . VAL C 1 109 ? 149.45125 241.24771 82.04710  1.000 129.30353 ?  109 VAL C CG2   1 
ATOM   7454  N N     . GLU C 1 110 ? 147.53658 244.46207 82.08288  1.000 138.99035 ?  110 GLU C N     1 
ATOM   7455  C CA    . GLU C 1 110 ? 147.22175 245.60653 81.21443  1.000 137.27798 ?  110 GLU C CA    1 
ATOM   7456  C C     . GLU C 1 110 ? 148.38070 245.90843 80.25246  1.000 135.88532 ?  110 GLU C C     1 
ATOM   7457  O O     . GLU C 1 110 ? 148.99565 246.97778 80.29873  1.000 132.80193 ?  110 GLU C O     1 
ATOM   7458  C CB    . GLU C 1 110 ? 146.86744 246.81511 82.09416  1.000 138.45532 ?  110 GLU C CB    1 
ATOM   7459  C CG    . GLU C 1 110 ? 145.39216 246.88205 82.52433  1.000 137.76836 ?  110 GLU C CG    1 
ATOM   7460  C CD    . GLU C 1 110 ? 145.08682 248.10025 83.38089  1.000 141.01586 ?  110 GLU C CD    1 
ATOM   7461  O OE1   . GLU C 1 110 ? 146.03534 248.84219 83.71881  1.000 140.28887 ?  110 GLU C OE1   1 
ATOM   7462  O OE2   . GLU C 1 110 ? 143.90796 248.29529 83.74376  1.000 138.79843 ?  110 GLU C OE2   1 
ATOM   7463  N N     . ILE C 1 111 ? 148.65137 244.93511 79.36030  1.000 135.66656 ?  111 ILE C N     1 
ATOM   7464  C CA    . ILE C 1 111 ? 149.76628 245.03016 78.40003  1.000 138.86297 ?  111 ILE C CA    1 
ATOM   7465  C C     . ILE C 1 111 ? 149.55795 246.22811 77.47040  1.000 142.26366 ?  111 ILE C C     1 
ATOM   7466  O O     . ILE C 1 111 ? 148.45302 246.45378 76.95875  1.000 141.50884 ?  111 ILE C O     1 
ATOM   7467  C CB    . ILE C 1 111 ? 149.94074 243.69457 77.63527  1.000 135.74434 ?  111 ILE C CB    1 
ATOM   7468  C CG1   . ILE C 1 111 ? 151.39422 243.46604 77.20670  1.000 128.49359 ?  111 ILE C CG1   1 
ATOM   7469  C CG2   . ILE C 1 111 ? 149.06059 243.57577 76.39977  1.000 137.54643 ?  111 ILE C CG2   1 
ATOM   7470  C CD1   . ILE C 1 111 ? 152.31726 243.30146 78.36504  1.000 123.17795 ?  111 ILE C CD1   1 
ATOM   7471  N N     . LYS C 1 112 ? 150.60253 247.04746 77.31197  1.000 136.67688 ?  112 LYS C N     1 
ATOM   7472  C CA    . LYS C 1 112 ? 150.56305 248.25136 76.47940  1.000 133.58371 ?  112 LYS C CA    1 
ATOM   7473  C C     . LYS C 1 112 ? 151.21330 248.01239 75.11910  1.000 134.30879 ?  112 LYS C C     1 
ATOM   7474  O O     . LYS C 1 112 ? 152.37563 247.59740 75.04931  1.000 130.38065 ?  112 LYS C O     1 
ATOM   7475  C CB    . LYS C 1 112 ? 151.24853 249.43194 77.17657  1.000 129.89959 ?  112 LYS C CB    1 
ATOM   7476  C CG    . LYS C 1 112 ? 151.19222 250.72532 76.37154  1.000 132.54103 ?  112 LYS C CG    1 
ATOM   7477  C CD    . LYS C 1 112 ? 151.64332 251.95942 77.14811  1.000 133.06987 ?  112 LYS C CD    1 
ATOM   7478  C CE    . LYS C 1 112 ? 153.12220 251.93653 77.50725  1.000 129.28039 ?  112 LYS C CE    1 
ATOM   7479  N NZ    . LYS C 1 112 ? 153.40251 251.35072 78.85264  1.000 119.78555 ?  112 LYS C NZ    1 
ATOM   7480  N N     . ARG C 1 113 ? 150.44798 248.25774 74.05045  1.000 134.17625 ?  113 ARG C N     1 
ATOM   7481  C CA    . ARG C 1 113 ? 150.87010 248.07000 72.66553  1.000 133.74589 ?  113 ARG C CA    1 
ATOM   7482  C C     . ARG C 1 113 ? 151.23744 249.42290 72.04821  1.000 133.99408 ?  113 ARG C C     1 
ATOM   7483  O O     . ARG C 1 113 ? 150.50442 250.40983 72.22406  1.000 126.79402 ?  113 ARG C O     1 
ATOM   7484  C CB    . ARG C 1 113 ? 149.74724 247.41451 71.84753  1.000 127.77617 ?  113 ARG C CB    1 
ATOM   7485  C CG    . ARG C 1 113 ? 150.06774 246.03649 71.33135  1.000 117.89876 ?  113 ARG C CG    1 
ATOM   7486  C CD    . ARG C 1 113 ? 150.07970 245.04836 72.47190  1.000 121.05962 ?  113 ARG C CD    1 
ATOM   7487  N NE    . ARG C 1 113 ? 150.13152 243.67531 71.98713  1.000 125.86969 ?  113 ARG C NE    1 
ATOM   7488  C CZ    . ARG C 1 113 ? 151.24600 242.96414 71.85989  1.000 128.01624 ?  113 ARG C CZ    1 
ATOM   7489  N NH1   . ARG C 1 113 ? 152.42830 243.46628 72.18011  1.000 127.71286 ?  113 ARG C NH1   1 
ATOM   7490  N NH2   . ARG C 1 113 ? 151.17379 241.72071 71.38934  1.000 124.49261 ?  113 ARG C NH2   1 
ATOM   7491  N N     . THR C 1 114 ? 152.38696 249.47392 71.35170  1.000 134.55129 ?  114 THR C N     1 
ATOM   7492  C CA    . THR C 1 114 ? 152.87037 250.65063 70.62478  1.000 131.70303 ?  114 THR C CA    1 
ATOM   7493  C C     . THR C 1 114 ? 152.45943 250.53425 69.15763  1.000 128.58278 ?  114 THR C C     1 
ATOM   7494  O O     . THR C 1 114 ? 152.00700 249.48333 68.69432  1.000 126.69348 ?  114 THR C O     1 
ATOM   7495  C CB    . THR C 1 114 ? 154.40641 250.82148 70.69030  1.000 130.42569 ?  114 THR C CB    1 
ATOM   7496  O OG1   . THR C 1 114 ? 155.06495 249.70525 70.07976  1.000 128.53024 ?  114 THR C OG1   1 
ATOM   7497  C CG2   . THR C 1 114 ? 154.90588 250.97272 72.13045  1.000 124.27394 ?  114 THR C CG2   1 
ATOM   7498  N N     . ASP C 1 115 ? 152.52431 251.65360 68.43900  1.000 130.71511 ?  115 ASP C N     1 
ATOM   7499  C CA    . ASP C 1 115 ? 152.20833 251.58244 67.01558  1.000 131.11340 ?  115 ASP C CA    1 
ATOM   7500  C C     . ASP C 1 115 ? 153.35739 251.03878 66.16933  1.000 125.84300 ?  115 ASP C C     1 
ATOM   7501  O O     . ASP C 1 115 ? 153.19177 250.91528 64.95066  1.000 127.49548 ?  115 ASP C O     1 
ATOM   7502  C CB    . ASP C 1 115 ? 151.79841 252.97102 66.50657  1.000 136.07572 ?  115 ASP C CB    1 
ATOM   7503  C CG    . ASP C 1 115 ? 150.44723 253.42260 67.06565  1.000 141.31107 ?  115 ASP C CG    1 
ATOM   7504  O OD1   . ASP C 1 115 ? 149.79433 252.63138 67.77922  1.000 144.55112 ?  115 ASP C OD1   1 
ATOM   7505  O OD2   . ASP C 1 115 ? 150.03917 254.57616 66.79842  1.000 139.75609 ?  115 ASP C OD2   1 
ATOM   7506  N N     . VAL C 1 116 ? 154.51308 250.71400 66.76156  1.000 127.11417 ?  116 VAL C N     1 
ATOM   7507  C CA    . VAL C 1 116 ? 155.63361 250.20028 65.98021  1.000 127.75574 ?  116 VAL C CA    1 
ATOM   7508  C C     . VAL C 1 116 ? 155.52674 248.68077 65.93390  1.000 126.25619 ?  116 VAL C C     1 
ATOM   7509  O O     . VAL C 1 116 ? 155.43365 248.00719 66.97435  1.000 123.11503 ?  116 VAL C O     1 
ATOM   7510  C CB    . VAL C 1 116 ? 156.98476 250.64183 66.56390  1.000 123.14852 ?  116 VAL C CB    1 
ATOM   7511  C CG1   . VAL C 1 116 ? 158.13323 250.11970 65.66307  1.000 107.14552 ?  116 VAL C CG1   1 
ATOM   7512  C CG2   . VAL C 1 116 ? 157.02234 252.17488 66.78424  1.000 115.60031 ?  116 VAL C CG2   1 
ATOM   7513  N N     . GLU C 1 117 ? 155.57785 248.13623 64.73174  1.000 121.16628 ?  117 GLU C N     1 
ATOM   7514  C CA    . GLU C 1 117 ? 155.44805 246.70464 64.53806  1.000 120.23076 ?  117 GLU C CA    1 
ATOM   7515  C C     . GLU C 1 117 ? 156.83845 246.07144 64.59386  1.000 119.87167 ?  117 GLU C C     1 
ATOM   7516  O O     . GLU C 1 117 ? 157.86817 246.74518 64.43408  1.000 109.52071 ?  117 GLU C O     1 
ATOM   7517  C CB    . GLU C 1 117 ? 154.72771 246.39801 63.22279  1.000 121.40292 ?  117 GLU C CB    1 
ATOM   7518  C CG    . GLU C 1 117 ? 155.57254 246.58549 61.95995  1.000 135.43308 ?  117 GLU C CG    1 
ATOM   7519  C CD    . GLU C 1 117 ? 155.69730 248.03863 61.49140  1.000 144.24067 ?  117 GLU C CD    1 
ATOM   7520  O OE1   . GLU C 1 117 ? 154.88663 248.89639 61.90974  1.000 144.20373 ?  117 GLU C OE1   1 
ATOM   7521  O OE2   . GLU C 1 117 ? 156.60243 248.31754 60.66756  1.000 140.80611 ?  117 GLU C OE2   1 
ATOM   7522  N N     . GLY C 1 118 ? 156.85498 244.77311 64.89652  1.000 120.16166 ?  118 GLY C N     1 
ATOM   7523  C CA    . GLY C 1 118 ? 158.10053 244.04577 64.97715  1.000 115.47610 ?  118 GLY C CA    1 
ATOM   7524  C C     . GLY C 1 118 ? 158.54371 243.50878 63.63550  1.000 116.82042 ?  118 GLY C C     1 
ATOM   7525  O O     . GLY C 1 118 ? 157.75383 243.36697 62.70225  1.000 119.57016 ?  118 GLY C O     1 
ATOM   7526  N N     . ASN C 1 119 ? 159.83608 243.18899 63.55832  1.000 120.20252 ?  119 ASN C N     1 
ATOM   7527  C CA    . ASN C 1 119 ? 160.43146 242.74734 62.29910  1.000 117.86650 ?  119 ASN C CA    1 
ATOM   7528  C C     . ASN C 1 119 ? 159.89398 241.39339 61.85295  1.000 115.60214 ?  119 ASN C C     1 
ATOM   7529  O O     . ASN C 1 119 ? 159.80557 241.15742 60.64342  1.000 120.76591 ?  119 ASN C O     1 
ATOM   7530  C CB    . ASN C 1 119 ? 161.95546 242.63978 62.44496  1.000 112.70285 ?  119 ASN C CB    1 
ATOM   7531  C CG    . ASN C 1 119 ? 162.60920 243.95235 62.84891  1.000 119.23869 ?  119 ASN C CG    1 
ATOM   7532  O OD1   . ASN C 1 119 ? 161.96531 244.99608 62.85175  1.000 118.00444 ?  119 ASN C OD1   1 
ATOM   7533  N ND2   . ASN C 1 119 ? 163.90710 243.90914 63.15799  1.000 121.68967 ?  119 ASN C ND2   1 
ATOM   7534  N N     . TRP C 1 120 ? 159.43779 240.56090 62.79462  1.000 111.20518 ?  120 TRP C N     1 
ATOM   7535  C CA    . TRP C 1 120 ? 158.90843 239.21173 62.54123  1.000 105.35669 ?  120 TRP C CA    1 
ATOM   7536  C C     . TRP C 1 120 ? 159.48033 238.61362 61.25556  1.000 105.89561 ?  120 TRP C C     1 
ATOM   7537  O O     . TRP C 1 120 ? 158.76580 238.35743 60.29145  1.000 106.73091 ?  120 TRP C O     1 
ATOM   7538  C CB    . TRP C 1 120 ? 157.37609 239.25789 62.49143  1.000 104.87320 ?  120 TRP C CB    1 
ATOM   7539  C CG    . TRP C 1 120 ? 156.72963 239.75469 63.76690  1.000 120.93069 ?  120 TRP C CG    1 
ATOM   7540  C CD1   . TRP C 1 120 ? 156.99973 239.33227 65.03500  1.000 121.15170 ?  120 TRP C CD1   1 
ATOM   7541  C CD2   . TRP C 1 120 ? 155.76742 240.82119 63.89383  1.000 122.68490 ?  120 TRP C CD2   1 
ATOM   7542  N NE1   . TRP C 1 120 ? 156.23275 240.03299 65.93884  1.000 117.23777 ?  120 TRP C NE1   1 
ATOM   7543  C CE2   . TRP C 1 120 ? 155.47483 240.95747 65.26496  1.000 121.66584 ?  120 TRP C CE2   1 
ATOM   7544  C CE3   . TRP C 1 120 ? 155.11556 241.65858 62.97810  1.000 119.49878 ?  120 TRP C CE3   1 
ATOM   7545  C CZ2   . TRP C 1 120 ? 154.57031 241.90702 65.74440  1.000 123.77706 ?  120 TRP C CZ2   1 
ATOM   7546  C CZ3   . TRP C 1 120 ? 154.20613 242.59737 63.46081  1.000 117.50691 ?  120 TRP C CZ3   1 
ATOM   7547  C CH2   . TRP C 1 120 ? 153.94433 242.71211 64.82535  1.000 116.46088 ?  120 TRP C CH2   1 
ATOM   7548  N N     . ALA C 1 121 ? 160.78882 238.34480 61.28145  1.000 104.40351 ?  121 ALA C N     1 
ATOM   7549  C CA    . ALA C 1 121 ? 161.51060 237.87623 60.10061  1.000 98.37975  ?  121 ALA C CA    1 
ATOM   7550  C C     . ALA C 1 121 ? 161.65822 236.35998 60.10834  1.000 96.83258  ?  121 ALA C C     1 
ATOM   7551  O O     . ALA C 1 121 ? 161.68848 235.72261 61.16473  1.000 94.98598  ?  121 ALA C O     1 
ATOM   7552  C CB    . ALA C 1 121 ? 162.89920 238.52890 60.00751  1.000 100.20985 ?  121 ALA C CB    1 
ATOM   7553  N N     . LEU C 1 122 ? 161.74117 235.78300 58.91499  1.000 96.20189  ?  122 LEU C N     1 
ATOM   7554  C CA    . LEU C 1 122 ? 161.76012 234.33497 58.75668  1.000 101.02746 ?  122 LEU C CA    1 
ATOM   7555  C C     . LEU C 1 122 ? 163.19197 233.85913 58.55499  1.000 102.53598 ?  122 LEU C C     1 
ATOM   7556  O O     . LEU C 1 122 ? 163.82766 234.20651 57.55364  1.000 108.89926 ?  122 LEU C O     1 
ATOM   7557  C CB    . LEU C 1 122 ? 160.88829 233.92764 57.57052  1.000 97.52942  ?  122 LEU C CB    1 
ATOM   7558  C CG    . LEU C 1 122 ? 160.01167 232.67881 57.71521  1.000 106.66677 ?  122 LEU C CG    1 
ATOM   7559  C CD1   . LEU C 1 122 ? 158.87143 232.85086 58.76569  1.000 118.83474 ?  122 LEU C CD1   1 
ATOM   7560  C CD2   . LEU C 1 122 ? 159.52438 232.16111 56.32783  1.000 89.46488  ?  122 LEU C CD2   1 
ATOM   7561  N N     . THR C 1 123 ? 163.70060 233.06377 59.49438  1.000 100.15458 ?  123 THR C N     1 
ATOM   7562  C CA    . THR C 1 123 ? 165.10149 232.67730 59.43058  1.000 105.43839 ?  123 THR C CA    1 
ATOM   7563  C C     . THR C 1 123 ? 165.32402 231.17932 59.33886  1.000 107.88797 ?  123 THR C C     1 
ATOM   7564  O O     . THR C 1 123 ? 166.01455 230.71136 58.43166  1.000 109.12657 ?  123 THR C O     1 
ATOM   7565  C CB    . THR C 1 123 ? 165.78715 233.21073 60.68858  1.000 112.12850 ?  123 THR C CB    1 
ATOM   7566  O OG1   . THR C 1 123 ? 165.37741 234.56685 60.88969  1.000 107.88380 ?  123 THR C OG1   1 
ATOM   7567  C CG2   . THR C 1 123 ? 167.31027 233.11847 60.56030  1.000 115.65239 ?  123 THR C CG2   1 
ATOM   7568  N N     . GLY C 1 124 ? 164.70544 230.41076 60.22033  1.000 113.07238 ?  124 GLY C N     1 
ATOM   7569  C CA    . GLY C 1 124 ? 164.97694 228.99831 60.31747  1.000 115.25364 ?  124 GLY C CA    1 
ATOM   7570  C C     . GLY C 1 124 ? 163.78683 228.15902 59.96128  1.000 116.85807 ?  124 GLY C C     1 
ATOM   7571  O O     . GLY C 1 124 ? 162.68157 228.64724 59.73972  1.000 112.79573 ?  124 GLY C O     1 
ATOM   7572  N N     . GLY C 1 125 ? 163.99588 226.85724 60.00938  1.000 113.80208 ?  125 GLY C N     1 
ATOM   7573  C CA    . GLY C 1 125 ? 163.07162 225.96258 59.34492  1.000 120.94618 ?  125 GLY C CA    1 
ATOM   7574  C C     . GLY C 1 125 ? 161.63197 225.95014 59.82445  1.000 120.56382 ?  125 GLY C C     1 
ATOM   7575  O O     . GLY C 1 125 ? 161.35647 225.45404 60.91815  1.000 122.47588 ?  125 GLY C O     1 
ATOM   7576  N N     . MET C 1 126 ? 160.72854 226.61025 59.08921  1.000 120.31364 ?  126 MET C N     1 
ATOM   7577  C CA    . MET C 1 126 ? 159.29585 226.56111 59.36350  1.000 113.21311 ?  126 MET C CA    1 
ATOM   7578  C C     . MET C 1 126 ? 158.60558 225.91464 58.15628  1.000 115.76058 ?  126 MET C C     1 
ATOM   7579  O O     . MET C 1 126 ? 158.59044 226.51132 57.07160  1.000 111.72769 ?  126 MET C O     1 
ATOM   7580  C CB    . MET C 1 126 ? 158.76092 227.97772 59.57444  1.000 101.88848 ?  126 MET C CB    1 
ATOM   7581  C CG    . MET C 1 126 ? 157.34647 228.05128 60.10667  1.000 98.72209  ?  126 MET C CG    1 
ATOM   7582  S SD    . MET C 1 126 ? 156.05996 228.15715 58.85462  1.000 115.04642 ?  126 MET C SD    1 
ATOM   7583  C CE    . MET C 1 126 ? 156.61584 229.48099 57.78999  1.000 112.43846 ?  126 MET C CE    1 
ATOM   7584  N N     . GLU C 1 127 ? 157.99087 224.73392 58.34817  1.000 114.63447 ?  127 GLU C N     1 
ATOM   7585  C CA    . GLU C 1 127 ? 157.35207 223.94621 57.28039  1.000 116.48176 ?  127 GLU C CA    1 
ATOM   7586  C C     . GLU C 1 127 ? 155.82029 224.00735 57.28433  1.000 114.31704 ?  127 GLU C C     1 
ATOM   7587  O O     . GLU C 1 127 ? 155.17163 223.33940 56.45820  1.000 109.91559 ?  127 GLU C O     1 
ATOM   7588  C CB    . GLU C 1 127 ? 157.86361 222.49569 57.30505  1.000 117.08151 ?  127 GLU C CB    1 
ATOM   7589  C CG    . GLU C 1 127 ? 159.37058 222.40576 56.97420  1.000 118.59087 ?  127 GLU C CG    1 
ATOM   7590  C CD    . GLU C 1 127 ? 159.89192 220.98502 56.81122  1.000 125.41963 ?  127 GLU C CD    1 
ATOM   7591  O OE1   . GLU C 1 127 ? 159.08788 220.03791 56.92501  1.000 136.11329 ?  127 GLU C OE1   1 
ATOM   7592  O OE2   . GLU C 1 127 ? 161.10241 220.81792 56.53648  1.000 119.44476 ?  127 GLU C OE2   1 
ATOM   7593  N N     . LEU C 1 128 ? 155.22554 224.78877 58.18796  1.000 116.22015 ?  128 LEU C N     1 
ATOM   7594  C CA    . LEU C 1 128 ? 153.77288 224.86040 58.31168  1.000 116.36599 ?  128 LEU C CA    1 
ATOM   7595  C C     . LEU C 1 128 ? 153.19903 225.59330 57.11082  1.000 116.56075 ?  128 LEU C C     1 
ATOM   7596  O O     . LEU C 1 128 ? 153.41999 226.80102 56.94755  1.000 112.61075 ?  128 LEU C O     1 
ATOM   7597  C CB    . LEU C 1 128 ? 153.38111 225.58419 59.60382  1.000 109.00889 ?  128 LEU C CB    1 
ATOM   7598  C CG    . LEU C 1 128 ? 151.99945 225.29632 60.19855  1.000 104.43234 ?  128 LEU C CG    1 
ATOM   7599  C CD1   . LEU C 1 128 ? 151.82302 223.82607 60.48962  1.000 103.52054 ?  128 LEU C CD1   1 
ATOM   7600  C CD2   . LEU C 1 128 ? 151.76682 226.11809 61.45373  1.000 105.85225 ?  128 LEU C CD2   1 
ATOM   7601  N N     . THR C 1 129 ? 152.43423 224.87285 56.29759  1.000 116.44804 ?  129 THR C N     1 
ATOM   7602  C CA    . THR C 1 129 ? 151.75760 225.44342 55.14428  1.000 119.65126 ?  129 THR C CA    1 
ATOM   7603  C C     . THR C 1 129 ? 150.34238 225.88019 55.48027  1.000 115.10944 ?  129 THR C C     1 
ATOM   7604  O O     . THR C 1 129 ? 149.66366 226.45625 54.62883  1.000 119.80885 ?  129 THR C O     1 
ATOM   7605  C CB    . THR C 1 129 ? 151.76072 224.45706 53.96378  1.000 118.47865 ?  129 THR C CB    1 
ATOM   7606  O OG1   . THR C 1 129 ? 150.98791 223.29417 54.29624  1.000 127.95572 ?  129 THR C OG1   1 
ATOM   7607  C CG2   . THR C 1 129 ? 153.17959 224.05282 53.56603  1.000 104.11307 ?  129 THR C CG2   1 
ATOM   7608  N N     . ARG C 1 130 ? 149.87240 225.59141 56.68641  1.000 110.83787 ?  130 ARG C N     1 
ATOM   7609  C CA    . ARG C 1 130 ? 148.53010 225.93303 57.12589  1.000 117.51523 ?  130 ARG C CA    1 
ATOM   7610  C C     . ARG C 1 130 ? 148.57960 226.91778 58.29278  1.000 118.63045 ?  130 ARG C C     1 
ATOM   7611  O O     . ARG C 1 130 ? 149.63664 227.15205 58.89291  1.000 116.52709 ?  130 ARG C O     1 
ATOM   7612  C CB    . ARG C 1 130 ? 147.75923 224.65711 57.49608  1.000 118.78670 ?  130 ARG C CB    1 
ATOM   7613  C CG    . ARG C 1 130 ? 148.44815 223.82304 58.54580  1.000 120.66345 ?  130 ARG C CG    1 
ATOM   7614  C CD    . ARG C 1 130 ? 147.50106 222.89506 59.28382  1.000 119.70384 ?  130 ARG C CD    1 
ATOM   7615  N NE    . ARG C 1 130 ? 148.24943 222.11090 60.25605  1.000 117.38108 ?  130 ARG C NE    1 
ATOM   7616  C CZ    . ARG C 1 130 ? 148.46162 222.49602 61.50338  1.000 121.50103 ?  130 ARG C CZ    1 
ATOM   7617  N NH1   . ARG C 1 130 ? 147.99510 223.65082 61.95887  1.000 126.47749 ?  130 ARG C NH1   1 
ATOM   7618  N NH2   . ARG C 1 130 ? 149.16980 221.71232 62.30922  1.000 120.52747 ?  130 ARG C NH2   1 
ATOM   7619  N N     . ASP C 1 131 ? 147.43412 227.54844 58.56473  1.000 121.19211 ?  131 ASP C N     1 
ATOM   7620  C CA    . ASP C 1 131 ? 147.33378 228.41052 59.73400  1.000 127.24741 ?  131 ASP C CA    1 
ATOM   7621  C C     . ASP C 1 131 ? 147.48904 227.55474 60.99891  1.000 128.02279 ?  131 ASP C C     1 
ATOM   7622  O O     . ASP C 1 131 ? 146.98139 226.42317 61.05027  1.000 122.07892 ?  131 ASP C O     1 
ATOM   7623  C CB    . ASP C 1 131 ? 146.00438 229.20491 59.73823  1.000 125.63868 ?  131 ASP C CB    1 
ATOM   7624  C CG    . ASP C 1 131 ? 144.76008 228.31124 59.74992  1.000 131.89639 ?  131 ASP C CG    1 
ATOM   7625  O OD1   . ASP C 1 131 ? 144.74079 227.26739 59.06388  1.000 127.61983 ?  131 ASP C OD1   1 
ATOM   7626  O OD2   . ASP C 1 131 ? 143.78309 228.66412 60.45039  1.000 144.41849 ?  131 ASP C OD2   1 
ATOM   7627  N N     . PRO C 1 132 ? 148.24444 228.03039 62.00013  1.000 129.86256 ?  132 PRO C N     1 
ATOM   7628  C CA    . PRO C 1 132 ? 148.56560 227.19048 63.16813  1.000 123.19887 ?  132 PRO C CA    1 
ATOM   7629  C C     . PRO C 1 132 ? 147.37756 226.97693 64.09698  1.000 121.99070 ?  132 PRO C C     1 
ATOM   7630  O O     . PRO C 1 132 ? 146.54319 227.86776 64.29460  1.000 117.78744 ?  132 PRO C O     1 
ATOM   7631  C CB    . PRO C 1 132 ? 149.65040 227.99398 63.89307  1.000 120.86376 ?  132 PRO C CB    1 
ATOM   7632  C CG    . PRO C 1 132 ? 149.41856 229.39789 63.46685  1.000 121.86094 ?  132 PRO C CG    1 
ATOM   7633  C CD    . PRO C 1 132 ? 148.90701 229.34579 62.06370  1.000 127.05012 ?  132 PRO C CD    1 
ATOM   7634  N N     . THR C 1 133 ? 147.35638 225.80338 64.73789  1.000 122.19615 ?  133 THR C N     1 
ATOM   7635  C CA    . THR C 1 133 ? 146.32004 225.52699 65.72129  1.000 122.34178 ?  133 THR C CA    1 
ATOM   7636  C C     . THR C 1 133 ? 146.71800 226.12687 67.06750  1.000 122.38549 ?  133 THR C C     1 
ATOM   7637  O O     . THR C 1 133 ? 147.88229 226.45586 67.31611  1.000 122.64964 ?  133 THR C O     1 
ATOM   7638  C CB    . THR C 1 133 ? 146.09989 224.00337 65.84891  1.000 119.03095 ?  133 THR C CB    1 
ATOM   7639  O OG1   . THR C 1 133 ? 145.23886 223.70721 66.95309  1.000 118.23529 ?  133 THR C OG1   1 
ATOM   7640  C CG2   . THR C 1 133 ? 147.42000 223.28473 66.12117  1.000 113.46252 ?  133 THR C CG2   1 
ATOM   7641  N N     . VAL C 1 134 ? 145.74055 226.30013 67.94122  1.000 123.13726 ?  134 VAL C N     1 
ATOM   7642  C CA    . VAL C 1 134 ? 146.03427 226.83460 69.27144  1.000 127.07542 ?  134 VAL C CA    1 
ATOM   7643  C C     . VAL C 1 134 ? 147.04219 225.96149 70.04625  1.000 125.86497 ?  134 VAL C C     1 
ATOM   7644  O O     . VAL C 1 134 ? 147.97944 226.52951 70.62462  1.000 123.99914 ?  134 VAL C O     1 
ATOM   7645  C CB    . VAL C 1 134 ? 144.73867 227.17499 70.02950  1.000 127.09988 ?  134 VAL C CB    1 
ATOM   7646  C CG1   . VAL C 1 134 ? 144.14303 228.47919 69.45108  1.000 127.74260 ?  134 VAL C CG1   1 
ATOM   7647  C CG2   . VAL C 1 134 ? 143.66576 226.10753 69.89968  1.000 129.82965 ?  134 VAL C CG2   1 
ATOM   7648  N N     . PRO C 1 135 ? 146.91100 224.60309 70.16059  1.000 126.13267 ?  135 PRO C N     1 
ATOM   7649  C CA    . PRO C 1 135 ? 148.02458 223.80748 70.80682  1.000 122.66517 ?  135 PRO C CA    1 
ATOM   7650  C C     . PRO C 1 135 ? 149.44165 224.09790 70.31035  1.000 118.33990 ?  135 PRO C C     1 
ATOM   7651  O O     . PRO C 1 135 ? 150.38082 224.15963 71.10829  1.000 116.27627 ?  135 PRO C O     1 
ATOM   7652  C CB    . PRO C 1 135 ? 147.61960 222.33397 70.55698  1.000 121.79785 ?  135 PRO C CB    1 
ATOM   7653  C CG    . PRO C 1 135 ? 145.98758 222.40788 70.59603  1.000 118.02296 ?  135 PRO C CG    1 
ATOM   7654  C CD    . PRO C 1 135 ? 145.65892 223.81957 69.96917  1.000 124.27366 ?  135 PRO C CD    1 
ATOM   7655  N N     . GLU C 1 136 ? 149.64525 224.15955 68.99643  1.000 113.28226 ?  136 GLU C N     1 
ATOM   7656  C CA    . GLU C 1 136 ? 150.92843 224.53832 68.41833  1.000 116.15450 ?  136 GLU C CA    1 
ATOM   7657  C C     . GLU C 1 136 ? 151.41295 225.87321 68.98691  1.000 115.99651 ?  136 GLU C C     1 
ATOM   7658  O O     . GLU C 1 136 ? 152.62502 226.09690 69.18902  1.000 110.56898 ?  136 GLU C O     1 
ATOM   7659  C CB    . GLU C 1 136 ? 150.76116 224.60251 66.89547  1.000 121.78986 ?  136 GLU C CB    1 
ATOM   7660  C CG    . GLU C 1 136 ? 151.15814 223.33427 66.17925  1.000 118.81790 ?  136 GLU C CG    1 
ATOM   7661  C CD    . GLU C 1 136 ? 150.66758 223.32826 64.75666  1.000 118.62503 ?  136 GLU C CD    1 
ATOM   7662  O OE1   . GLU C 1 136 ? 149.94090 224.27541 64.37150  1.000 113.51153 ?  136 GLU C OE1   1 
ATOM   7663  O OE2   . GLU C 1 136 ? 151.06076 222.41034 64.01794  1.000 121.82749 ?  136 GLU C OE2   1 
ATOM   7664  N N     . HIS C 1 137 ? 150.46863 226.83658 69.11046  1.000 116.42800 ?  137 HIS C N     1 
ATOM   7665  C CA    . HIS C 1 137 ? 150.72703 228.12469 69.76618  1.000 119.65821 ?  137 HIS C CA    1 
ATOM   7666  C C     . HIS C 1 137 ? 151.16289 227.92302 71.22100  1.000 121.85907 ?  137 HIS C C     1 
ATOM   7667  O O     . HIS C 1 137 ? 152.13496 228.54302 71.68174  1.000 119.66064 ?  137 HIS C O     1 
ATOM   7668  C CB    . HIS C 1 137 ? 149.47753 229.02723 69.69232  1.000 118.59622 ?  137 HIS C CB    1 
ATOM   7669  C CG    . HIS C 1 137 ? 149.36082 229.85617 68.43751  1.000 119.97286 ?  137 HIS C CG    1 
ATOM   7670  N ND1   . HIS C 1 137 ? 149.72434 231.18907 68.37743  1.000 121.44956 ?  137 HIS C ND1   1 
ATOM   7671  C CD2   . HIS C 1 137 ? 148.87471 229.55017 67.20954  1.000 121.85350 ?  137 HIS C CD2   1 
ATOM   7672  C CE1   . HIS C 1 137 ? 149.48015 231.66530 67.16979  1.000 121.71894 ?  137 HIS C CE1   1 
ATOM   7673  N NE2   . HIS C 1 137 ? 148.96829 230.68958 66.43923  1.000 125.71901 ?  137 HIS C NE2   1 
ATOM   7674  N N     . ALA C 1 138 ? 150.44921 227.06460 71.96488  1.000 123.92165 ?  138 ALA C N     1 
ATOM   7675  C CA    . ALA C 1 138 ? 150.79436 226.82159 73.36354  1.000 115.10823 ?  138 ALA C CA    1 
ATOM   7676  C C     . ALA C 1 138 ? 152.14666 226.11902 73.48984  1.000 111.89067 ?  138 ALA C C     1 
ATOM   7677  O O     . ALA C 1 138 ? 152.93232 226.45074 74.38752  1.000 111.49877 ?  138 ALA C O     1 
ATOM   7678  C CB    . ALA C 1 138 ? 149.67598 226.04388 74.05207  1.000 112.78882 ?  138 ALA C CB    1 
ATOM   7679  N N     . SER C 1 139 ? 152.43764 225.14062 72.61056  1.000 108.34405 ?  139 SER C N     1 
ATOM   7680  C CA    . SER C 1 139 ? 153.75519 224.48985 72.63374  1.000 111.45843 ?  139 SER C CA    1 
ATOM   7681  C C     . SER C 1 139 ? 154.87636 225.49490 72.36893  1.000 111.38089 ?  139 SER C C     1 
ATOM   7682  O O     . SER C 1 139 ? 155.96224 225.39535 72.95919  1.000 107.37837 ?  139 SER C O     1 
ATOM   7683  C CB    . SER C 1 139 ? 153.83603 223.32291 71.64063  1.000 109.73511 ?  139 SER C CB    1 
ATOM   7684  O OG    . SER C 1 139 ? 152.66289 222.52975 71.64410  1.000 108.67288 ?  139 SER C OG    1 
ATOM   7685  N N     . LEU C 1 140 ? 154.67017 226.41697 71.41950  1.000 111.41741 ?  140 LEU C N     1 
ATOM   7686  C CA    . LEU C 1 140 ? 155.68495 227.44165 71.18637  1.000 112.27073 ?  140 LEU C CA    1 
ATOM   7687  C C     . LEU C 1 140 ? 155.80153 228.37725 72.39209  1.000 110.50594 ?  140 LEU C C     1 
ATOM   7688  O O     . LEU C 1 140 ? 156.91464 228.72243 72.80670  1.000 112.32119 ?  140 LEU C O     1 
ATOM   7689  C CB    . LEU C 1 140 ? 155.37641 228.25264 69.92320  1.000 106.95654 ?  140 LEU C CB    1 
ATOM   7690  C CG    . LEU C 1 140 ? 156.53347 229.01271 69.25615  1.000 98.83376  ?  140 LEU C CG    1 
ATOM   7691  C CD1   . LEU C 1 140 ? 157.82513 228.19831 69.29540  1.000 99.38149  ?  140 LEU C CD1   1 
ATOM   7692  C CD2   . LEU C 1 140 ? 156.20219 229.34811 67.85444  1.000 101.57829 ?  140 LEU C CD2   1 
ATOM   7693  N N     . VAL C 1 141 ? 154.66430 228.79314 72.97476  1.000 107.78503 ?  141 VAL C N     1 
ATOM   7694  C CA    . VAL C 1 141 ? 154.70943 229.69817 74.12790  1.000 108.67522 ?  141 VAL C CA    1 
ATOM   7695  C C     . VAL C 1 141 ? 155.47006 229.04093 75.27014  1.000 106.99234 ?  141 VAL C C     1 
ATOM   7696  O O     . VAL C 1 141 ? 156.28423 229.68430 75.94791  1.000 106.98069 ?  141 VAL C O     1 
ATOM   7697  C CB    . VAL C 1 141 ? 153.29091 230.13027 74.57149  1.000 109.51349 ?  141 VAL C CB    1 
ATOM   7698  C CG1   . VAL C 1 141 ? 153.29564 230.70542 76.01706  1.000 102.19138 ?  141 VAL C CG1   1 
ATOM   7699  C CG2   . VAL C 1 141 ? 152.69645 231.13567 73.60279  1.000 110.86375 ?  141 VAL C CG2   1 
ATOM   7700  N N     . GLY C 1 142 ? 155.20631 227.75366 75.50987  1.000 104.09042 ?  142 GLY C N     1 
ATOM   7701  C CA    . GLY C 1 142 ? 155.90772 227.05710 76.57012  1.000 106.14159 ?  142 GLY C CA    1 
ATOM   7702  C C     . GLY C 1 142 ? 157.39251 226.92865 76.30651  1.000 103.60933 ?  142 GLY C C     1 
ATOM   7703  O O     . GLY C 1 142 ? 158.21299 227.16514 77.19872  1.000 106.92893 ?  142 GLY C O     1 
ATOM   7704  N N     . LEU C 1 143 ? 157.75736 226.58532 75.07103  1.000 99.04473  ?  143 LEU C N     1 
ATOM   7705  C CA    . LEU C 1 143 ? 159.16776 226.42298 74.71820  1.000 102.32481 ?  143 LEU C CA    1 
ATOM   7706  C C     . LEU C 1 143 ? 159.93766 227.73428 74.86523  1.000 105.22265 ?  143 LEU C C     1 
ATOM   7707  O O     . LEU C 1 143 ? 161.11488 227.73171 75.26133  1.000 102.95119 ?  143 LEU C O     1 
ATOM   7708  C CB    . LEU C 1 143 ? 159.26349 225.85666 73.30527  1.000 99.37699  ?  143 LEU C CB    1 
ATOM   7709  C CG    . LEU C 1 143 ? 158.90212 224.38323 73.20663  1.000 95.79832  ?  143 LEU C CG    1 
ATOM   7710  C CD1   . LEU C 1 143 ? 158.49266 224.13224 71.79956  1.000 96.85987  ?  143 LEU C CD1   1 
ATOM   7711  C CD2   . LEU C 1 143 ? 160.16373 223.57368 73.50415  1.000 88.16245  ?  143 LEU C CD2   1 
ATOM   7712  N N     . LEU C 1 144 ? 159.30563 228.85766 74.49115  1.000 108.04542 ?  144 LEU C N     1 
ATOM   7713  C CA    . LEU C 1 144 ? 159.91981 230.17493 74.66317  1.000 107.77441 ?  144 LEU C CA    1 
ATOM   7714  C C     . LEU C 1 144 ? 160.09115 230.50961 76.14836  1.000 106.43758 ?  144 LEU C C     1 
ATOM   7715  O O     . LEU C 1 144 ? 161.16155 230.96776 76.57254  1.000 103.72448 ?  144 LEU C O     1 
ATOM   7716  C CB    . LEU C 1 144 ? 159.07825 231.23863 73.92641  1.000 102.34374 ?  144 LEU C CB    1 
ATOM   7717  C CG    . LEU C 1 144 ? 159.07939 231.26819 72.37535  1.000 102.88011 ?  144 LEU C CG    1 
ATOM   7718  C CD1   . LEU C 1 144 ? 158.04061 232.22781 71.76279  1.000 104.29205 ?  144 LEU C CD1   1 
ATOM   7719  C CD2   . LEU C 1 144 ? 160.46949 231.61214 71.80417  1.000 100.34142 ?  144 LEU C CD2   1 
ATOM   7720  N N     . LEU C 1 145 ? 159.05210 230.25893 76.95503  1.000 104.40090 ?  145 LEU C N     1 
ATOM   7721  C CA    . LEU C 1 145 ? 159.11552 230.50018 78.39571  1.000 99.56035  ?  145 LEU C CA    1 
ATOM   7722  C C     . LEU C 1 145 ? 160.13378 229.58718 79.08118  1.000 95.99879  ?  145 LEU C C     1 
ATOM   7723  O O     . LEU C 1 145 ? 160.77747 230.00126 80.05465  1.000 95.90430  ?  145 LEU C O     1 
ATOM   7724  C CB    . LEU C 1 145 ? 157.69968 230.37750 78.97765  1.000 96.04421  ?  145 LEU C CB    1 
ATOM   7725  C CG    . LEU C 1 145 ? 156.74679 231.52360 78.57641  1.000 94.99262  ?  145 LEU C CG    1 
ATOM   7726  C CD1   . LEU C 1 145 ? 155.35908 231.28363 79.08458  1.000 96.17826  ?  145 LEU C CD1   1 
ATOM   7727  C CD2   . LEU C 1 145 ? 157.20587 232.86743 79.16585  1.000 89.13810  ?  145 LEU C CD2   1 
ATOM   7728  N N     . SER C 1 146 ? 160.31128 228.36195 78.58251  1.000 91.88100  ?  146 SER C N     1 
ATOM   7729  C CA    . SER C 1 146 ? 161.31138 227.46719 79.15918  1.000 95.99640  ?  146 SER C CA    1 
ATOM   7730  C C     . SER C 1 146 ? 162.72196 228.02591 79.01029  1.000 100.82887 ?  146 SER C C     1 
ATOM   7731  O O     . SER C 1 146 ? 163.65056 227.57836 79.70290  1.000 100.36527 ?  146 SER C O     1 
ATOM   7732  C CB    . SER C 1 146 ? 161.24213 226.08143 78.52456  1.000 103.98434 ?  146 SER C CB    1 
ATOM   7733  O OG    . SER C 1 146 ? 162.03642 226.00472 77.35139  1.000 105.71676 ?  146 SER C OG    1 
ATOM   7734  N N     . LEU C 1 147 ? 162.93751 228.92297 78.05029  1.000 103.27861 ?  147 LEU C N     1 
ATOM   7735  C CA    . LEU C 1 147 ? 164.26136 229.52211 77.95660  1.000 105.93055 ?  147 LEU C CA    1 
ATOM   7736  C C     . LEU C 1 147 ? 164.61360 230.28658 79.22611  1.000 103.94683 ?  147 LEU C C     1 
ATOM   7737  O O     . LEU C 1 147 ? 165.77679 230.28102 79.65050  1.000 103.38338 ?  147 LEU C O     1 
ATOM   7738  C CB    . LEU C 1 147 ? 164.33738 230.42371 76.72494  1.000 100.17024 ?  147 LEU C CB    1 
ATOM   7739  C CG    . LEU C 1 147 ? 164.26425 229.62561 75.42527  1.000 102.23976 ?  147 LEU C CG    1 
ATOM   7740  C CD1   . LEU C 1 147 ? 164.14908 230.59906 74.29071  1.000 112.83456 ?  147 LEU C CD1   1 
ATOM   7741  C CD2   . LEU C 1 147 ? 165.47531 228.69308 75.23050  1.000 100.48159 ?  147 LEU C CD2   1 
ATOM   7742  N N     . TYR C 1 148 ? 163.61302 230.89504 79.87069  1.000 100.00916 ?  148 TYR C N     1 
ATOM   7743  C CA    . TYR C 1 148 ? 163.87163 231.71172 81.05184  1.000 96.43481  ?  148 TYR C CA    1 
ATOM   7744  C C     . TYR C 1 148 ? 164.45853 230.87823 82.18980  1.000 94.10820  ?  148 TYR C C     1 
ATOM   7745  O O     . TYR C 1 148 ? 165.44491 231.27273 82.82046  1.000 94.31384  ?  148 TYR C O     1 
ATOM   7746  C CB    . TYR C 1 148 ? 162.58682 232.41099 81.49949  1.000 97.11855  ?  148 TYR C CB    1 
ATOM   7747  C CG    . TYR C 1 148 ? 162.79663 233.33158 82.68922  1.000 100.71126 ?  148 TYR C CG    1 
ATOM   7748  C CD1   . TYR C 1 148 ? 163.36952 234.58828 82.51660  1.000 103.92112 ?  148 TYR C CD1   1 
ATOM   7749  C CD2   . TYR C 1 148 ? 162.48611 232.93258 83.98224  1.000 99.02198  ?  148 TYR C CD2   1 
ATOM   7750  C CE1   . TYR C 1 148 ? 163.58481 235.43657 83.58584  1.000 101.42637 ?  148 TYR C CE1   1 
ATOM   7751  C CE2   . TYR C 1 148 ? 162.70734 233.78029 85.06800  1.000 103.79652 ?  148 TYR C CE2   1 
ATOM   7752  C CZ    . TYR C 1 148 ? 163.25896 235.03128 84.86313  1.000 105.56644 ?  148 TYR C CZ    1 
ATOM   7753  O OH    . TYR C 1 148 ? 163.48545 235.88252 85.92964  1.000 112.26189 ?  148 TYR C OH    1 
ATOM   7754  N N     . ARG C 1 149 ? 163.85632 229.72952 82.47788  1.000 93.08590  ?  149 ARG C N     1 
ATOM   7755  C CA    . ARG C 1 149 ? 164.42385 228.85770 83.49597  1.000 96.14229  ?  149 ARG C CA    1 
ATOM   7756  C C     . ARG C 1 149 ? 165.81630 228.37177 83.11916  1.000 95.85358  ?  149 ARG C C     1 
ATOM   7757  O O     . ARG C 1 149 ? 166.69063 228.24452 83.98163  1.000 98.71593  ?  149 ARG C O     1 
ATOM   7758  C CB    . ARG C 1 149 ? 163.51527 227.67090 83.74534  1.000 97.17322  ?  149 ARG C CB    1 
ATOM   7759  C CG    . ARG C 1 149 ? 164.11047 226.71840 84.73754  1.000 99.28993  ?  149 ARG C CG    1 
ATOM   7760  C CD    . ARG C 1 149 ? 163.11658 225.68630 85.05497  1.000 98.71672  ?  149 ARG C CD    1 
ATOM   7761  N NE    . ARG C 1 149 ? 163.55879 224.80282 86.11300  1.000 99.11391  ?  149 ARG C NE    1 
ATOM   7762  C CZ    . ARG C 1 149 ? 162.80815 223.82194 86.58321  1.000 104.44676 ?  149 ARG C CZ    1 
ATOM   7763  N NH1   . ARG C 1 149 ? 161.58182 223.62946 86.13539  1.000 107.81687 ?  149 ARG C NH1   1 
ATOM   7764  N NH2   . ARG C 1 149 ? 163.32895 222.96141 87.45555  1.000 105.87730 ?  149 ARG C NH2   1 
ATOM   7765  N N     . LEU C 1 150 ? 166.02171 228.03655 81.85163  1.000 95.39629  ?  150 LEU C N     1 
ATOM   7766  C CA    . LEU C 1 150 ? 167.32779 227.55846 81.41420  1.000 100.59128 ?  150 LEU C CA    1 
ATOM   7767  C C     . LEU C 1 150 ? 168.40804 228.63061 81.56962  1.000 102.60788 ?  150 LEU C C     1 
ATOM   7768  O O     . LEU C 1 150 ? 169.54937 228.32285 81.95306  1.000 102.29247 ?  150 LEU C O     1 
ATOM   7769  C CB    . LEU C 1 150 ? 167.20827 227.09052 79.96655  1.000 103.91569 ?  150 LEU C CB    1 
ATOM   7770  C CG    . LEU C 1 150 ? 166.34366 225.84702 79.74572  1.000 102.77115 ?  150 LEU C CG    1 
ATOM   7771  C CD1   . LEU C 1 150 ? 166.12398 225.66882 78.28636  1.000 104.63343 ?  150 LEU C CD1   1 
ATOM   7772  C CD2   . LEU C 1 150 ? 167.05728 224.60930 80.24949  1.000 98.85143  ?  150 LEU C CD2   1 
ATOM   7773  N N     . SER C 1 151 ? 168.06627 229.89329 81.25655  1.000 100.76062 ?  151 SER C N     1 
ATOM   7774  C CA    . SER C 1 151 ? 169.01149 230.99988 81.39815  1.000 102.35058 ?  151 SER C CA    1 
ATOM   7775  C C     . SER C 1 151 ? 169.40651 231.19834 82.84103  1.000 104.76046 ?  151 SER C C     1 
ATOM   7776  O O     . SER C 1 151 ? 170.57876 231.46038 83.13894  1.000 108.28131 ?  151 SER C O     1 
ATOM   7777  C CB    . SER C 1 151 ? 168.40292 232.29779 80.87278  1.000 102.73423 ?  151 SER C CB    1 
ATOM   7778  O OG    . SER C 1 151 ? 169.21473 233.41089 81.22092  1.000 102.21042 ?  151 SER C OG    1 
ATOM   7779  N N     . LYS C 1 152 ? 168.42939 231.10226 83.74827  1.000 101.49303 ?  152 LYS C N     1 
ATOM   7780  C CA    . LYS C 1 152 ? 168.71885 231.28254 85.16183  1.000 94.20289  ?  152 LYS C CA    1 
ATOM   7781  C C     . LYS C 1 152 ? 169.64812 230.18653 85.66741  1.000 97.34739  ?  152 LYS C C     1 
ATOM   7782  O O     . LYS C 1 152 ? 170.62477 230.47885 86.36261  1.000 104.63276 ?  152 LYS C O     1 
ATOM   7783  C CB    . LYS C 1 152 ? 167.41245 231.29153 85.97610  1.000 92.25996  ?  152 LYS C CB    1 
ATOM   7784  C CG    . LYS C 1 152 ? 166.57042 232.59746 85.95109  1.000 98.81353  ?  152 LYS C CG    1 
ATOM   7785  C CD    . LYS C 1 152 ? 165.40655 232.64174 86.99059  1.000 110.40960 ?  152 LYS C CD    1 
ATOM   7786  C CE    . LYS C 1 152 ? 165.83343 232.48832 88.46205  1.000 114.56780 ?  152 LYS C CE    1 
ATOM   7787  N NZ    . LYS C 1 152 ? 166.68112 233.60362 88.98095  1.000 114.45415 ?  152 LYS C NZ    1 
ATOM   7788  N N     . ILE C 1 153 ? 169.42159 228.93289 85.26281  1.000 98.17682  ?  153 ILE C N     1 
ATOM   7789  C CA    . ILE C 1 153 ? 170.16328 227.81580 85.85158  1.000 99.63983  ?  153 ILE C CA    1 
ATOM   7790  C C     . ILE C 1 153 ? 171.56398 227.66649 85.27670  1.000 102.02659 ?  153 ILE C C     1 
ATOM   7791  O O     . ILE C 1 153 ? 171.93704 226.57237 84.83381  1.000 100.05394 ?  153 ILE C O     1 
ATOM   7792  C CB    . ILE C 1 153 ? 169.39273 226.47889 85.73133  1.000 100.67543 ?  153 ILE C CB    1 
ATOM   7793  C CG1   . ILE C 1 153 ? 168.98883 226.15965 84.29589  1.000 104.66846 ?  153 ILE C CG1   1 
ATOM   7794  C CG2   . ILE C 1 153 ? 168.13487 226.47772 86.64626  1.000 103.84857 ?  153 ILE C CG2   1 
ATOM   7795  C CD1   . ILE C 1 153 ? 168.15405 224.92488 84.22083  1.000 106.14702 ?  153 ILE C CD1   1 
ATOM   7796  N N     . SER C 1 154 ? 172.36170 228.73930 85.32082  1.000 106.54183 ?  154 SER C N     1 
ATOM   7797  C CA    . SER C 1 154 ? 173.72908 228.71625 84.81121  1.000 115.30804 ?  154 SER C CA    1 
ATOM   7798  C C     . SER C 1 154 ? 174.70619 228.85054 85.97785  1.000 117.18584 ?  154 SER C C     1 
ATOM   7799  O O     . SER C 1 154 ? 174.45641 229.61578 86.91522  1.000 114.90192 ?  154 SER C O     1 
ATOM   7800  C CB    . SER C 1 154 ? 173.93452 229.82134 83.73824  1.000 119.16032 ?  154 SER C CB    1 
ATOM   7801  O OG    . SER C 1 154 ? 173.04947 229.65294 82.62163  1.000 115.46079 ?  154 SER C OG    1 
ATOM   7802  N N     . GLY C 1 155 ? 175.80631 228.09626 85.91515  1.000 116.25550 ?  155 GLY C N     1 
ATOM   7803  C CA    . GLY C 1 155 ? 176.79162 228.02691 87.00012  1.000 104.40057 ?  155 GLY C CA    1 
ATOM   7804  C C     . GLY C 1 155 ? 177.73269 226.87270 86.72940  1.000 106.36509 ?  155 GLY C C     1 
ATOM   7805  O O     . GLY C 1 155 ? 177.58448 226.13753 85.74774  1.000 107.47053 ?  155 GLY C O     1 
ATOM   7806  N N     . GLN C 1 156 ? 178.65362 226.64985 87.66769  1.000 108.17149 ?  156 GLN C N     1 
ATOM   7807  C CA    . GLN C 1 156 ? 179.62899 225.56383 87.48169  1.000 106.97073 ?  156 GLN C CA    1 
ATOM   7808  C C     . GLN C 1 156 ? 178.94197 224.21166 87.67578  1.000 107.85526 ?  156 GLN C C     1 
ATOM   7809  O O     . GLN C 1 156 ? 178.10635 224.04085 88.56397  1.000 109.48359 ?  156 GLN C O     1 
ATOM   7810  C CB    . GLN C 1 156 ? 180.74547 225.71055 88.52222  1.000 109.96264 ?  156 GLN C CB    1 
ATOM   7811  C CG    . GLN C 1 156 ? 181.02880 227.17949 88.85507  1.000 112.88187 ?  156 GLN C CG    1 
ATOM   7812  C CD    . GLN C 1 156 ? 182.01836 227.32842 89.97904  1.000 122.74918 ?  156 GLN C CD    1 
ATOM   7813  O OE1   . GLN C 1 156 ? 182.52962 226.32955 90.48486  1.000 117.03940 ?  156 GLN C OE1   1 
ATOM   7814  N NE2   . GLN C 1 156 ? 182.21725 228.55959 90.45144  1.000 122.80550 ?  156 GLN C NE2   1 
ATOM   7815  N N     . ASN C 1 157 ? 179.34009 223.20838 86.88706  1.000 111.95895 ?  157 ASN C N     1 
ATOM   7816  C CA    . ASN C 1 157 ? 178.80591 221.83812 86.93893  1.000 111.64854 ?  157 ASN C CA    1 
ATOM   7817  C C     . ASN C 1 157 ? 177.28593 221.77056 86.81603  1.000 110.49382 ?  157 ASN C C     1 
ATOM   7818  O O     . ASN C 1 157 ? 176.68436 220.71222 87.07447  1.000 109.14700 ?  157 ASN C O     1 
ATOM   7819  C CB    . ASN C 1 157 ? 179.21828 221.09374 88.22133  1.000 97.43189  ?  157 ASN C CB    1 
ATOM   7820  C CG    . ASN C 1 157 ? 180.76230 221.15362 88.47635  1.000 97.03989  ?  157 ASN C CG    1 
ATOM   7821  O OD1   . ASN C 1 157 ? 181.23306 221.74569 89.54774  1.000 102.70556 ?  157 ASN C OD1   1 
ATOM   7822  N ND2   . ASN C 1 157 ? 181.59216 220.56152 87.47831  1.000 101.47169 ?  157 ASN C ND2   1 
ATOM   7823  N N     . THR C 1 158 ? 176.63532 222.86026 86.45159  1.000 107.78830 ?  158 THR C N     1 
ATOM   7824  C CA    . THR C 1 158 ? 175.20155 222.79518 86.24203  1.000 105.90058 ?  158 THR C CA    1 
ATOM   7825  C C     . THR C 1 158 ? 174.86440 222.44449 84.79891  1.000 111.33401 ?  158 THR C C     1 
ATOM   7826  O O     . THR C 1 158 ? 173.69474 222.51488 84.38744  1.000 109.82927 ?  158 THR C O     1 
ATOM   7827  C CB    . THR C 1 158 ? 174.55545 224.13558 86.59286  1.000 105.05567 ?  158 THR C CB    1 
ATOM   7828  O OG1   . THR C 1 158 ? 174.94860 225.12467 85.63820  1.000 107.71343 ?  158 THR C OG1   1 
ATOM   7829  C CG2   . THR C 1 158 ? 175.05960 224.61145 87.94474  1.000 107.03454 ?  158 THR C CG2   1 
ATOM   7830  N N     . GLY C 1 159 ? 175.86438 221.97950 84.05059  1.000 111.85775 ?  159 GLY C N     1 
ATOM   7831  C CA    . GLY C 1 159 ? 175.66526 221.64310 82.66360  1.000 107.69753 ?  159 GLY C CA    1 
ATOM   7832  C C     . GLY C 1 159 ? 174.77955 220.42493 82.55849  1.000 106.96631 ?  159 GLY C C     1 
ATOM   7833  O O     . GLY C 1 159 ? 173.66215 220.49545 82.03402  1.000 102.98562 ?  159 GLY C O     1 
ATOM   7834  N N     . ASN C 1 160 ? 175.26943 219.30993 83.11565  1.000 105.05450 ?  160 ASN C N     1 
ATOM   7835  C CA    . ASN C 1 160 ? 174.52029 218.06027 83.07074  1.000 105.24572 ?  160 ASN C CA    1 
ATOM   7836  C C     . ASN C 1 160 ? 173.12900 218.22237 83.67547  1.000 102.80653 ?  160 ASN C C     1 
ATOM   7837  O O     . ASN C 1 160 ? 172.15912 217.61122 83.20437  1.000 102.10850 ?  160 ASN C O     1 
ATOM   7838  C CB    . ASN C 1 160 ? 175.30459 216.96086 83.79189  1.000 105.20338 ?  160 ASN C CB    1 
ATOM   7839  C CG    . ASN C 1 160 ? 174.88387 215.57109 83.34162  1.000 114.84562 ?  160 ASN C CG    1 
ATOM   7840  O OD1   . ASN C 1 160 ? 174.33148 215.40333 82.24609  1.000 109.94902 ?  160 ASN C OD1   1 
ATOM   7841  N ND2   . ASN C 1 160 ? 175.11316 214.57469 84.18707  1.000 123.31152 ?  160 ASN C ND2   1 
ATOM   7842  N N     . TYR C 1 161 ? 173.00803 219.07159 84.69606  1.000 101.93441 ?  161 TYR C N     1 
ATOM   7843  C CA    . TYR C 1 161 ? 171.70285 219.34807 85.28420  1.000 101.24974 ?  161 TYR C CA    1 
ATOM   7844  C C     . TYR C 1 161 ? 170.84654 220.14723 84.29629  1.000 100.62606 ?  161 TYR C C     1 
ATOM   7845  O O     . TYR C 1 161 ? 169.63471 219.91720 84.18041  1.000 95.52691  ?  161 TYR C O     1 
ATOM   7846  C CB    . TYR C 1 161 ? 171.89755 220.07407 86.62575  1.000 99.28694  ?  161 TYR C CB    1 
ATOM   7847  C CG    . TYR C 1 161 ? 170.72628 220.86547 87.14411  1.000 98.45811  ?  161 TYR C CG    1 
ATOM   7848  C CD1   . TYR C 1 161 ? 169.69826 220.25528 87.84998  1.000 99.66554  ?  161 TYR C CD1   1 
ATOM   7849  C CD2   . TYR C 1 161 ? 170.62514 222.22221 86.89013  1.000 101.31892 ?  161 TYR C CD2   1 
ATOM   7850  C CE1   . TYR C 1 161 ? 168.61275 220.99034 88.32015  1.000 100.29334 ?  161 TYR C CE1   1 
ATOM   7851  C CE2   . TYR C 1 161 ? 169.55185 222.96005 87.34231  1.000 97.86750  ?  161 TYR C CE2   1 
ATOM   7852  C CZ    . TYR C 1 161 ? 168.54681 222.34569 88.05839  1.000 96.36615  ?  161 TYR C CZ    1 
ATOM   7853  O OH    . TYR C 1 161 ? 167.47938 223.08938 88.50942  1.000 92.50596  ?  161 TYR C OH    1 
ATOM   7854  N N     . LYS C 1 162 ? 171.47473 221.09089 83.57482  1.000 104.89054 ?  162 LYS C N     1 
ATOM   7855  C CA    . LYS C 1 162 ? 170.77605 221.86769 82.55061  1.000 102.66238 ?  162 LYS C CA    1 
ATOM   7856  C C     . LYS C 1 162 ? 170.26069 220.96687 81.43976  1.000 103.48420 ?  162 LYS C C     1 
ATOM   7857  O O     . LYS C 1 162 ? 169.12016 221.12565 80.97905  1.000 101.96917 ?  162 LYS C O     1 
ATOM   7858  C CB    . LYS C 1 162 ? 171.69428 222.95854 81.98768  1.000 96.29915  ?  162 LYS C CB    1 
ATOM   7859  C CG    . LYS C 1 162 ? 170.91138 224.16785 81.49127  1.000 95.16322  ?  162 LYS C CG    1 
ATOM   7860  C CD    . LYS C 1 162 ? 171.76679 225.23717 80.88417  1.000 98.28326  ?  162 LYS C CD    1 
ATOM   7861  C CE    . LYS C 1 162 ? 172.98896 225.48126 81.71992  1.000 104.60145 ?  162 LYS C CE    1 
ATOM   7862  N NZ    . LYS C 1 162 ? 173.76506 226.64191 81.22674  1.000 111.10007 ?  162 LYS C NZ    1 
ATOM   7863  N N     . THR C 1 163 ? 171.08867 220.00279 81.01242  1.000 105.31779 ?  163 THR C N     1 
ATOM   7864  C CA    . THR C 1 163 ? 170.68901 219.07174 79.96070  1.000 106.68345 ?  163 THR C CA    1 
ATOM   7865  C C     . THR C 1 163 ? 169.49457 218.22232 80.39445  1.000 105.52349 ?  163 THR C C     1 
ATOM   7866  O O     . THR C 1 163 ? 168.55888 218.02009 79.61333  1.000 107.52475 ?  163 THR C O     1 
ATOM   7867  C CB    . THR C 1 163 ? 171.88316 218.18979 79.54829  1.000 102.56321 ?  163 THR C CB    1 
ATOM   7868  O OG1   . THR C 1 163 ? 172.26993 217.33176 80.63422  1.000 106.88486 ?  163 THR C OG1   1 
ATOM   7869  C CG2   . THR C 1 163 ? 173.08952 219.06551 79.12649  1.000 91.17091  ?  163 THR C CG2   1 
ATOM   7870  N N     . ASN C 1 164 ? 169.48770 217.74123 81.64161  1.000 101.62498 ?  164 ASN C N     1 
ATOM   7871  C CA    . ASN C 1 164 ? 168.36477 216.93287 82.10720  1.000 101.12538 ?  164 ASN C CA    1 
ATOM   7872  C C     . ASN C 1 164 ? 167.08486 217.75961 82.15110  1.000 102.54046 ?  164 ASN C C     1 
ATOM   7873  O O     . ASN C 1 164 ? 165.99485 217.23447 81.88629  1.000 99.96832  ?  164 ASN C O     1 
ATOM   7874  C CB    . ASN C 1 164 ? 168.69379 216.31863 83.45770  1.000 101.75349 ?  164 ASN C CB    1 
ATOM   7875  C CG    . ASN C 1 164 ? 169.93735 215.45960 83.38922  1.000 106.28335 ?  164 ASN C CG    1 
ATOM   7876  O OD1   . ASN C 1 164 ? 170.41527 215.13197 82.30148  1.000 102.47317 ?  164 ASN C OD1   1 
ATOM   7877  N ND2   . ASN C 1 164 ? 170.49245 215.11839 84.54536  1.000 112.89981 ?  164 ASN C ND2   1 
ATOM   7878  N N     . ILE C 1 165 ? 167.19417 219.03633 82.56396  1.000 104.40628 ?  165 ILE C N     1 
ATOM   7879  C CA    . ILE C 1 165 ? 166.03286 219.92891 82.64158  1.000 102.66355 ?  165 ILE C CA    1 
ATOM   7880  C C     . ILE C 1 165 ? 165.48355 220.23340 81.25110  1.000 102.40022 ?  165 ILE C C     1 
ATOM   7881  O O     . ILE C 1 165 ? 164.26131 220.28128 81.04594  1.000 103.78559 ?  165 ILE C O     1 
ATOM   7882  C CB    . ILE C 1 165 ? 166.39922 221.22952 83.39167  1.000 97.88762  ?  165 ILE C CB    1 
ATOM   7883  C CG1   . ILE C 1 165 ? 166.73569 220.96870 84.85842  1.000 107.11176 ?  165 ILE C CG1   1 
ATOM   7884  C CG2   . ILE C 1 165 ? 165.22930 222.20863 83.35973  1.000 93.88196  ?  165 ILE C CG2   1 
ATOM   7885  C CD1   . ILE C 1 165 ? 165.56231 220.45615 85.72254  1.000 111.91516 ?  165 ILE C CD1   1 
ATOM   7886  N N     . ALA C 1 166 ? 166.37207 220.47673 80.28127  1.000 100.51190 ?  166 ALA C N     1 
ATOM   7887  C CA    . ALA C 1 166 ? 165.89494 220.76365 78.93447  1.000 104.08749 ?  166 ALA C CA    1 
ATOM   7888  C C     . ALA C 1 166 ? 165.19525 219.54350 78.34025  1.000 106.09363 ?  166 ALA C C     1 
ATOM   7889  O O     . ALA C 1 166 ? 164.09620 219.66454 77.77768  1.000 103.79199 ?  166 ALA C O     1 
ATOM   7890  C CB    . ALA C 1 166 ? 167.04952 221.23455 78.05016  1.000 108.07686 ?  166 ALA C CB    1 
ATOM   7891  N N     . ASP C 1 167 ? 165.77143 218.34501 78.54727  1.000 103.50346 ?  167 ASP C N     1 
ATOM   7892  C CA    . ASP C 1 167 ? 165.15464 217.12568 78.03329  1.000 100.12152 ?  167 ASP C CA    1 
ATOM   7893  C C     . ASP C 1 167 ? 163.75190 216.95561 78.59243  1.000 99.88819  ?  167 ASP C C     1 
ATOM   7894  O O     . ASP C 1 167 ? 162.81432 216.67907 77.83512  1.000 105.20247 ?  167 ASP C O     1 
ATOM   7895  C CB    . ASP C 1 167 ? 166.00900 215.89270 78.37093  1.000 98.02663  ?  167 ASP C CB    1 
ATOM   7896  C CG    . ASP C 1 167 ? 167.37654 215.89512 77.68316  1.000 108.13210 ?  167 ASP C CG    1 
ATOM   7897  O OD1   . ASP C 1 167 ? 167.57692 216.73430 76.77744  1.000 115.65264 ?  167 ASP C OD1   1 
ATOM   7898  O OD2   . ASP C 1 167 ? 168.25520 215.07234 78.05813  1.000 108.81476 ?  167 ASP C OD2   1 
ATOM   7899  N N     . ARG C 1 168 ? 163.57683 217.19550 79.89518  1.000 96.20855  ?  168 ARG C N     1 
ATOM   7900  C CA    . ARG C 1 168 ? 162.25071 217.11528 80.50814  1.000 100.89401 ?  168 ARG C CA    1 
ATOM   7901  C C     . ARG C 1 168 ? 161.28655 218.11388 79.88989  1.000 105.50294 ?  168 ARG C C     1 
ATOM   7902  O O     . ARG C 1 168 ? 160.08751 217.83401 79.76435  1.000 107.55053 ?  168 ARG C O     1 
ATOM   7903  C CB    . ARG C 1 168 ? 162.33173 217.34903 82.01728  1.000 99.85794  ?  168 ARG C CB    1 
ATOM   7904  C CG    . ARG C 1 168 ? 162.95283 216.21334 82.82230  1.000 107.61546 ?  168 ARG C CG    1 
ATOM   7905  C CD    . ARG C 1 168 ? 162.86224 216.47287 84.32197  1.000 111.71478 ?  168 ARG C CD    1 
ATOM   7906  N NE    . ARG C 1 168 ? 163.51364 215.40925 85.07820  1.000 119.70928 ?  168 ARG C NE    1 
ATOM   7907  C CZ    . ARG C 1 168 ? 164.77574 215.45997 85.48532  1.000 127.74201 ?  168 ARG C CZ    1 
ATOM   7908  N NH1   . ARG C 1 168 ? 165.54938 216.49814 85.20520  1.000 125.35984 ?  168 ARG C NH1   1 
ATOM   7909  N NH2   . ARG C 1 168 ? 165.27355 214.44688 86.19052  1.000 129.85305 ?  168 ARG C NH2   1 
ATOM   7910  N N     . ILE C 1 169 ? 161.76549 219.32519 79.60409  1.000 105.40937 ?  169 ILE C N     1 
ATOM   7911  C CA    . ILE C 1 169 ? 160.90151 220.33030 78.99023  1.000 106.11908 ?  169 ILE C CA    1 
ATOM   7912  C C     . ILE C 1 169 ? 160.46900 219.87855 77.60137  1.000 107.19890 ?  169 ILE C C     1 
ATOM   7913  O O     . ILE C 1 169 ? 159.30972 220.06772 77.19545  1.000 105.69797 ?  169 ILE C O     1 
ATOM   7914  C CB    . ILE C 1 169 ? 161.61102 221.69224 78.93897  1.000 102.97211 ?  169 ILE C CB    1 
ATOM   7915  C CG1   . ILE C 1 169 ? 161.91317 222.19523 80.33326  1.000 100.08637 ?  169 ILE C CG1   1 
ATOM   7916  C CG2   . ILE C 1 169 ? 160.73067 222.72572 78.28696  1.000 103.51925 ?  169 ILE C CG2   1 
ATOM   7917  C CD1   . ILE C 1 169 ? 162.76288 223.39818 80.27241  1.000 101.70272 ?  169 ILE C CD1   1 
ATOM   7918  N N     . GLU C 1 170 ? 161.40777 219.31779 76.82907  1.000 107.31279 ?  170 GLU C N     1 
ATOM   7919  C CA    . GLU C 1 170 ? 161.06062 218.86026 75.49018  1.000 107.29369 ?  170 GLU C CA    1 
ATOM   7920  C C     . GLU C 1 170 ? 160.02409 217.75783 75.54257  1.000 107.40178 ?  170 GLU C C     1 
ATOM   7921  O O     . GLU C 1 170 ? 159.04198 217.78802 74.78803  1.000 106.19910 ?  170 GLU C O     1 
ATOM   7922  C CB    . GLU C 1 170 ? 162.31389 218.42417 74.74206  1.000 103.99837 ?  170 GLU C CB    1 
ATOM   7923  C CG    . GLU C 1 170 ? 163.03913 219.63186 74.15209  1.000 106.58519 ?  170 GLU C CG    1 
ATOM   7924  C CD    . GLU C 1 170 ? 164.25161 219.24328 73.34975  1.000 116.54388 ?  170 GLU C CD    1 
ATOM   7925  O OE1   . GLU C 1 170 ? 164.84173 218.17439 73.63650  1.000 118.73370 ?  170 GLU C OE1   1 
ATOM   7926  O OE2   . GLU C 1 170 ? 164.55502 219.96462 72.37772  1.000 113.49676 ?  170 GLU C OE2   1 
ATOM   7927  N N     . GLN C 1 171 ? 160.17854 216.83606 76.49847  1.000 107.33010 ?  171 GLN C N     1 
ATOM   7928  C CA    . GLN C 1 171 ? 159.25653 215.71344 76.63150  1.000 109.12201 ?  171 GLN C CA    1 
ATOM   7929  C C     . GLN C 1 171 ? 157.83773 216.19562 76.94061  1.000 111.37143 ?  171 GLN C C     1 
ATOM   7930  O O     . GLN C 1 171 ? 156.85503 215.55936 76.53377  1.000 111.09933 ?  171 GLN C O     1 
ATOM   7931  C CB    . GLN C 1 171 ? 159.73753 214.76439 77.73203  1.000 105.51378 ?  171 GLN C CB    1 
ATOM   7932  C CG    . GLN C 1 171 ? 161.17615 214.21518 77.59779  1.000 104.96328 ?  171 GLN C CG    1 
ATOM   7933  C CD    . GLN C 1 171 ? 161.65382 213.94677 76.16661  1.000 115.18688 ?  171 GLN C CD    1 
ATOM   7934  O OE1   . GLN C 1 171 ? 160.86783 213.80360 75.23460  1.000 116.04525 ?  171 GLN C OE1   1 
ATOM   7935  N NE2   . GLN C 1 171 ? 162.97355 213.86323 76.00292  1.000 116.32790 ?  171 GLN C NE2   1 
ATOM   7936  N N     . ILE C 1 172 ? 157.72427 217.26952 77.74144  1.000 109.42963 ?  172 ILE C N     1 
ATOM   7937  C CA    . ILE C 1 172 ? 156.43272 217.86904 78.10219  1.000 111.16718 ?  172 ILE C CA    1 
ATOM   7938  C C     . ILE C 1 172 ? 155.72365 218.38550 76.85926  1.000 112.88926 ?  172 ILE C C     1 
ATOM   7939  O O     . ILE C 1 172 ? 154.50970 218.20690 76.69296  1.000 116.01403 ?  172 ILE C O     1 
ATOM   7940  C CB    . ILE C 1 172 ? 156.60634 218.98799 79.16495  1.000 107.95962 ?  172 ILE C CB    1 
ATOM   7941  C CG1   . ILE C 1 172 ? 157.23891 218.48191 80.46846  1.000 105.54938 ?  172 ILE C CG1   1 
ATOM   7942  C CG2   . ILE C 1 172 ? 155.27735 219.73477 79.48224  1.000 98.61511  ?  172 ILE C CG2   1 
ATOM   7943  C CD1   . ILE C 1 172 ? 156.59008 217.23402 81.05093  1.000 112.06176 ?  172 ILE C CD1   1 
ATOM   7944  N N     . PHE C 1 173 ? 156.43555 219.15580 76.05035  1.000 108.07288 ?  173 PHE C N     1 
ATOM   7945  C CA    . PHE C 1 173 ? 155.83054 219.79985 74.89946  1.000 110.88402 ?  173 PHE C CA    1 
ATOM   7946  C C     . PHE C 1 173 ? 155.79095 218.93321 73.63501  1.000 114.83940 ?  173 PHE C C     1 
ATOM   7947  O O     . PHE C 1 173 ? 155.23906 219.38230 72.62473  1.000 115.38510 ?  173 PHE C O     1 
ATOM   7948  C CB    . PHE C 1 173 ? 156.52610 221.14270 74.69247  1.000 108.71331 ?  173 PHE C CB    1 
ATOM   7949  C CG    . PHE C 1 173 ? 156.40819 222.05564 75.90030  1.000 108.26354 ?  173 PHE C CG    1 
ATOM   7950  C CD1   . PHE C 1 173 ? 155.15974 222.35927 76.43078  1.000 108.01080 ?  173 PHE C CD1   1 
ATOM   7951  C CD2   . PHE C 1 173 ? 157.52814 222.61870 76.49763  1.000 106.54562 ?  173 PHE C CD2   1 
ATOM   7952  C CE1   . PHE C 1 173 ? 155.03688 223.19032 77.53828  1.000 104.28881 ?  173 PHE C CE1   1 
ATOM   7953  C CE2   . PHE C 1 173 ? 157.40219 223.45291 77.60005  1.000 99.65632  ?  173 PHE C CE2   1 
ATOM   7954  C CZ    . PHE C 1 173 ? 156.15794 223.73571 78.11480  1.000 97.67594  ?  173 PHE C CZ    1 
ATOM   7955  N N     . GLU C 1 174 ? 156.36979 217.73056 73.63532  1.000 112.88825 ?  174 GLU C N     1 
ATOM   7956  C CA    . GLU C 1 174 ? 156.22086 216.85396 72.47865  1.000 112.12571 ?  174 GLU C CA    1 
ATOM   7957  C C     . GLU C 1 174 ? 155.08746 215.83459 72.64374  1.000 115.32255 ?  174 GLU C C     1 
ATOM   7958  O O     . GLU C 1 174 ? 154.83315 215.06326 71.71443  1.000 116.54849 ?  174 GLU C O     1 
ATOM   7959  C CB    . GLU C 1 174 ? 157.53697 216.11180 72.17620  1.000 104.80977 ?  174 GLU C CB    1 
ATOM   7960  C CG    . GLU C 1 174 ? 157.78583 214.91044 73.06396  1.000 109.85579 ?  174 GLU C CG    1 
ATOM   7961  C CD    . GLU C 1 174 ? 159.08795 214.21734 72.73397  1.000 112.11827 ?  174 GLU C CD    1 
ATOM   7962  O OE1   . GLU C 1 174 ? 159.80139 214.72302 71.84441  1.000 108.35166 ?  174 GLU C OE1   1 
ATOM   7963  O OE2   . GLU C 1 174 ? 159.34588 213.12238 73.28537  1.000 116.45727 ?  174 GLU C OE2   1 
ATOM   7964  N N     . THR C 1 175 ? 154.48603 215.73099 73.83458  1.000 115.92266 ?  175 THR C N     1 
ATOM   7965  C CA    . THR C 1 175 ? 153.38404 214.83164 74.18923  1.000 115.45384 ?  175 THR C CA    1 
ATOM   7966  C C     . THR C 1 175 ? 152.29893 215.66260 74.87260  1.000 113.94941 ?  175 THR C C     1 
ATOM   7967  O O     . THR C 1 175 ? 152.44291 216.88028 75.00619  1.000 115.20379 ?  175 THR C O     1 
ATOM   7968  C CB    . THR C 1 175 ? 153.86170 213.67290 75.10305  1.000 121.35334 ?  175 THR C CB    1 
ATOM   7969  O OG1   . THR C 1 175 ? 155.15291 213.20120 74.67086  1.000 117.87386 ?  175 THR C OG1   1 
ATOM   7970  C CG2   . THR C 1 175 ? 152.85896 212.49608 75.12838  1.000 113.79990 ?  175 THR C CG2   1 
ATOM   7971  N N     . ALA C 1 176 ? 151.16327 215.02415 75.25269  1.000 109.17590 ?  176 ALA C N     1 
ATOM   7972  C CA    . ALA C 1 176 ? 150.07274 215.73760 75.93497  1.000 103.69109 ?  176 ALA C CA    1 
ATOM   7973  C C     . ALA C 1 176 ? 149.41705 216.71412 74.94961  1.000 107.98408 ?  176 ALA C C     1 
ATOM   7974  O O     . ALA C 1 176 ? 149.71436 216.60747 73.74920  1.000 110.98437 ?  176 ALA C O     1 
ATOM   7975  C CB    . ALA C 1 176 ? 150.62404 216.41429 77.19520  1.000 100.89964 ?  176 ALA C CB    1 
ATOM   7976  N N     . PRO C 1 177 ? 148.52233 217.64552 75.35682  1.000 109.99375 ?  177 PRO C N     1 
ATOM   7977  C CA    . PRO C 1 177 ? 147.95701 218.57216 74.34812  1.000 115.95300 ?  177 PRO C CA    1 
ATOM   7978  C C     . PRO C 1 177 ? 148.99646 219.28529 73.50763  1.000 114.27912 ?  177 PRO C C     1 
ATOM   7979  O O     . PRO C 1 177 ? 148.70696 219.62665 72.35051  1.000 115.60354 ?  177 PRO C O     1 
ATOM   7980  C CB    . PRO C 1 177 ? 147.12737 219.56600 75.18897  1.000 116.81217 ?  177 PRO C CB    1 
ATOM   7981  C CG    . PRO C 1 177 ? 147.51952 219.31573 76.61142  1.000 115.10356 ?  177 PRO C CG    1 
ATOM   7982  C CD    . PRO C 1 177 ? 147.82541 217.84691 76.64625  1.000 105.86187 ?  177 PRO C CD    1 
ATOM   7983  N N     . PHE C 1 178 ? 150.21459 219.45777 74.02226  1.000 115.80191 ?  178 PHE C N     1 
ATOM   7984  C CA    . PHE C 1 178 ? 151.24625 220.12958 73.24598  1.000 123.04481 ?  178 PHE C CA    1 
ATOM   7985  C C     . PHE C 1 178 ? 151.68915 219.20690 72.11956  1.000 123.20407 ?  178 PHE C C     1 
ATOM   7986  O O     . PHE C 1 178 ? 151.77932 217.98647 72.30132  1.000 121.76579 ?  178 PHE C O     1 
ATOM   7987  C CB    . PHE C 1 178 ? 152.42941 220.47758 74.15114  1.000 115.75924 ?  178 PHE C CB    1 
ATOM   7988  C CG    . PHE C 1 178 ? 152.00858 221.17628 75.38120  1.000 113.62927 ?  178 PHE C CG    1 
ATOM   7989  C CD1   . PHE C 1 178 ? 151.64356 222.50906 75.31939  1.000 114.95622 ?  178 PHE C CD1   1 
ATOM   7990  C CD2   . PHE C 1 178 ? 151.97670 220.51839 76.59847  1.000 114.27094 ?  178 PHE C CD2   1 
ATOM   7991  C CE1   . PHE C 1 178 ? 151.21580 223.17725 76.43886  1.000 115.71532 ?  178 PHE C CE1   1 
ATOM   7992  C CE2   . PHE C 1 178 ? 151.56067 221.19063 77.74498  1.000 120.97470 ?  178 PHE C CE2   1 
ATOM   7993  C CZ    . PHE C 1 178 ? 151.18242 222.52507 77.65968  1.000 118.52517 ?  178 PHE C CZ    1 
ATOM   7994  N N     . VAL C 1 179 ? 152.02612 219.79986 70.97254  1.000 115.02610 ?  179 VAL C N     1 
ATOM   7995  C CA    . VAL C 1 179 ? 152.39462 219.04142 69.78518  1.000 110.19562 ?  179 VAL C CA    1 
ATOM   7996  C C     . VAL C 1 179 ? 153.84630 219.34402 69.44506  1.000 109.66217 ?  179 VAL C C     1 
ATOM   7997  O O     . VAL C 1 179 ? 154.29924 220.48682 69.57269  1.000 112.75118 ?  179 VAL C O     1 
ATOM   7998  C CB    . VAL C 1 179 ? 151.43497 219.39268 68.63029  1.000 105.76562 ?  179 VAL C CB    1 
ATOM   7999  C CG1   . VAL C 1 179 ? 150.03252 218.96971 68.99357  1.000 102.85304 ?  179 VAL C CG1   1 
ATOM   8000  C CG2   . VAL C 1 179 ? 151.40673 220.87640 68.41839  1.000 109.41854 ?  179 VAL C CG2   1 
ATOM   8001  N N     . LYS C 1 180 ? 154.56615 218.32229 68.96653  1.000 104.62912 ?  180 LYS C N     1 
ATOM   8002  C CA    . LYS C 1 180 ? 155.98807 218.47615 68.68032  1.000 107.66131 ?  180 LYS C CA    1 
ATOM   8003  C C     . LYS C 1 180 ? 156.17006 219.45575 67.53582  1.000 108.94796 ?  180 LYS C C     1 
ATOM   8004  O O     . LYS C 1 180 ? 155.71258 219.19629 66.41800  1.000 117.16660 ?  180 LYS C O     1 
ATOM   8005  C CB    . LYS C 1 180 ? 156.61047 217.13051 68.30688  1.000 102.95677 ?  180 LYS C CB    1 
ATOM   8006  C CG    . LYS C 1 180 ? 158.12836 217.09738 68.32057  1.000 102.65528 ?  180 LYS C CG    1 
ATOM   8007  C CD    . LYS C 1 180 ? 158.66021 215.75343 67.88586  1.000 95.43646  ?  180 LYS C CD    1 
ATOM   8008  C CE    . LYS C 1 180 ? 160.05607 215.57299 68.42556  1.000 102.79509 ?  180 LYS C CE    1 
ATOM   8009  N NZ    . LYS C 1 180 ? 160.65401 214.31366 67.95713  1.000 100.11513 ?  180 LYS C NZ    1 
ATOM   8010  N N     . ILE C 1 181 ? 156.79898 220.59741 67.80134  1.000 107.79020 ?  181 ILE C N     1 
ATOM   8011  C CA    . ILE C 1 181 ? 157.01919 221.57240 66.74461  1.000 106.35503 ?  181 ILE C CA    1 
ATOM   8012  C C     . ILE C 1 181 ? 158.49215 221.84586 66.49978  1.000 109.26203 ?  181 ILE C C     1 
ATOM   8013  O O     . ILE C 1 181 ? 158.84800 222.35044 65.42086  1.000 116.43867 ?  181 ILE C O     1 
ATOM   8014  C CB    . ILE C 1 181 ? 156.24023 222.88168 67.00748  1.000 104.37837 ?  181 ILE C CB    1 
ATOM   8015  C CG1   . ILE C 1 181 ? 156.42186 223.39882 68.42242  1.000 107.77710 ?  181 ILE C CG1   1 
ATOM   8016  C CG2   . ILE C 1 181 ? 154.72895 222.63328 66.91031  1.000 101.85765 ?  181 ILE C CG2   1 
ATOM   8017  C CD1   . ILE C 1 181 ? 155.63796 224.67235 68.64262  1.000 101.82875 ?  181 ILE C CD1   1 
ATOM   8018  N N     . VAL C 1 182 ? 159.37409 221.50681 67.43430  1.000 105.93556 ?  182 VAL C N     1 
ATOM   8019  C CA    . VAL C 1 182 ? 160.77558 221.87539 67.28837  1.000 112.83408 ?  182 VAL C CA    1 
ATOM   8020  C C     . VAL C 1 182 ? 161.70264 220.65940 67.27375  1.000 111.78888 ?  182 VAL C C     1 
ATOM   8021  O O     . VAL C 1 182 ? 162.91163 220.81826 67.41683  1.000 112.71451 ?  182 VAL C O     1 
ATOM   8022  C CB    . VAL C 1 182 ? 161.17506 222.87117 68.39636  1.000 113.83274 ?  182 VAL C CB    1 
ATOM   8023  C CG1   . VAL C 1 182 ? 160.40507 224.18354 68.20697  1.000 105.08150 ?  182 VAL C CG1   1 
ATOM   8024  C CG2   . VAL C 1 182 ? 160.92257 222.23956 69.77191  1.000 111.22540 ?  182 VAL C CG2   1 
ATOM   8025  N N     . GLU C 1 183 ? 161.18203 219.47277 66.97762  1.000 108.79738 ?  183 GLU C N     1 
ATOM   8026  C CA    . GLU C 1 183 ? 162.00925 218.27806 67.05888  1.000 115.02858 ?  183 GLU C CA    1 
ATOM   8027  C C     . GLU C 1 183 ? 162.84255 218.27847 68.33674  1.000 120.27005 ?  183 GLU C C     1 
ATOM   8028  O O     . GLU C 1 183 ? 162.40323 218.81551 69.35763  1.000 121.65255 ?  183 GLU C O     1 
ATOM   8029  C CB    . GLU C 1 183 ? 162.92830 218.17547 65.84324  1.000 115.43377 ?  183 GLU C CB    1 
ATOM   8030  C CG    . GLU C 1 183 ? 163.18537 216.76396 65.46622  1.000 115.93600 ?  183 GLU C CG    1 
ATOM   8031  C CD    . GLU C 1 183 ? 161.90998 216.07474 65.02209  1.000 127.03378 ?  183 GLU C CD    1 
ATOM   8032  O OE1   . GLU C 1 183 ? 161.04109 216.77271 64.44996  1.000 132.66986 ?  183 GLU C OE1   1 
ATOM   8033  O OE2   . GLU C 1 183 ? 161.75291 214.85667 65.24598  1.000 129.36976 ?  183 GLU C OE2   1 
ATOM   8034  N N     . HIS C 1 184 ? 164.03193 217.67053 68.31307  1.000 118.94588 ?  184 HIS C N     1 
ATOM   8035  C CA    . HIS C 1 184 ? 164.80967 217.54954 69.53549  1.000 119.76408 ?  184 HIS C CA    1 
ATOM   8036  C C     . HIS C 1 184 ? 166.10150 218.33905 69.41451  1.000 119.80854 ?  184 HIS C C     1 
ATOM   8037  O O     . HIS C 1 184 ? 166.51069 218.72776 68.31027  1.000 114.98753 ?  184 HIS C O     1 
ATOM   8038  C CB    . HIS C 1 184 ? 165.06707 216.07779 69.87365  1.000 121.08360 ?  184 HIS C CB    1 
ATOM   8039  C CG    . HIS C 1 184 ? 164.07396 215.53298 70.86143  1.000 124.52800 ?  184 HIS C CG    1 
ATOM   8040  N ND1   . HIS C 1 184 ? 164.20017 215.70477 72.22364  1.000 130.48497 ?  184 HIS C ND1   1 
ATOM   8041  C CD2   . HIS C 1 184 ? 162.91357 214.85356 70.67665  1.000 121.59986 ?  184 HIS C CD2   1 
ATOM   8042  C CE1   . HIS C 1 184 ? 163.17143 215.14282 72.83718  1.000 127.24017 ?  184 HIS C CE1   1 
ATOM   8043  N NE2   . HIS C 1 184 ? 162.37757 214.61675 71.92056  1.000 123.21162 ?  184 HIS C NE2   1 
ATOM   8044  N N     . HIS C 1 185 ? 166.68304 218.63074 70.58739  1.000 116.83833 ?  185 HIS C N     1 
ATOM   8045  C CA    . HIS C 1 185 ? 167.96407 219.31803 70.82137  1.000 115.40366 ?  185 HIS C CA    1 
ATOM   8046  C C     . HIS C 1 185 ? 167.98275 220.76088 70.36022  1.000 114.82611 ?  185 HIS C C     1 
ATOM   8047  O O     . HIS C 1 185 ? 169.03331 221.40746 70.47684  1.000 112.58939 ?  185 HIS C O     1 
ATOM   8048  C CB    . HIS C 1 185 ? 169.15178 218.57710 70.17658  1.000 114.85099 ?  185 HIS C CB    1 
ATOM   8049  C CG    . HIS C 1 185 ? 169.43023 217.25484 70.79997  1.000 119.46731 ?  185 HIS C CG    1 
ATOM   8050  N ND1   . HIS C 1 185 ? 170.26359 217.10763 71.88911  1.000 123.34419 ?  185 HIS C ND1   1 
ATOM   8051  C CD2   . HIS C 1 185 ? 168.96415 216.02267 70.50429  1.000 120.88588 ?  185 HIS C CD2   1 
ATOM   8052  C CE1   . HIS C 1 185 ? 170.31425 215.83433 72.22600  1.000 124.97440 ?  185 HIS C CE1   1 
ATOM   8053  N NE2   . HIS C 1 185 ? 169.53315 215.15708 71.40261  1.000 128.06930 ?  185 HIS C NE2   1 
ATOM   8054  N N     . THR C 1 186 ? 166.88609 221.25596 69.78107  1.000 115.35739 ?  186 THR C N     1 
ATOM   8055  C CA    . THR C 1 186 ? 166.77269 222.66244 69.41906  1.000 113.27541 ?  186 THR C CA    1 
ATOM   8056  C C     . THR C 1 186 ? 166.75103 223.57223 70.65293  1.000 110.79273 ?  186 THR C C     1 
ATOM   8057  O O     . THR C 1 186 ? 167.28074 224.69570 70.61901  1.000 110.08250 ?  186 THR C O     1 
ATOM   8058  C CB    . THR C 1 186 ? 165.52589 222.86809 68.54578  1.000 113.40492 ?  186 THR C CB    1 
ATOM   8059  O OG1   . THR C 1 186 ? 164.39582 222.25802 69.19323  1.000 113.56589 ?  186 THR C OG1   1 
ATOM   8060  C CG2   . THR C 1 186 ? 165.70390 222.29848 67.10738  1.000 107.99565 ?  186 THR C CG2   1 
ATOM   8061  N N     . LEU C 1 187 ? 166.11482 223.12104 71.73830  1.000 109.71855 ?  187 LEU C N     1 
ATOM   8062  C CA    . LEU C 1 187 ? 165.98820 223.94650 72.93925  1.000 110.45755 ?  187 LEU C CA    1 
ATOM   8063  C C     . LEU C 1 187 ? 167.36018 224.23854 73.54544  1.000 112.28184 ?  187 LEU C C     1 
ATOM   8064  O O     . LEU C 1 187 ? 167.60258 225.33531 74.07055  1.000 109.90387 ?  187 LEU C O     1 
ATOM   8065  C CB    . LEU C 1 187 ? 165.06800 223.25233 73.94342  1.000 102.65122 ?  187 LEU C CB    1 
ATOM   8066  C CG    . LEU C 1 187 ? 164.55958 224.10543 75.10440  1.000 98.72015  ?  187 LEU C CG    1 
ATOM   8067  C CD1   . LEU C 1 187 ? 163.71697 225.28432 74.59966  1.000 85.90262  ?  187 LEU C CD1   1 
ATOM   8068  C CD2   . LEU C 1 187 ? 163.79443 223.25666 76.10125  1.000 110.41652 ?  187 LEU C CD2   1 
ATOM   8069  N N     . MET C 1 188 ? 168.24717 223.23916 73.53659  1.000 111.10608 ?  188 MET C N     1 
ATOM   8070  C CA    . MET C 1 188 ? 169.59553 223.43593 74.04869  1.000 110.05698 ?  188 MET C CA    1 
ATOM   8071  C C     . MET C 1 188 ? 170.37838 224.43299 73.20353  1.000 112.87052 ?  188 MET C C     1 
ATOM   8072  O O     . MET C 1 188 ? 171.05127 225.32556 73.74059  1.000 110.73336 ?  188 MET C O     1 
ATOM   8073  C CB    . MET C 1 188 ? 170.31965 222.09557 74.13302  1.000 106.57183 ?  188 MET C CB    1 
ATOM   8074  C CG    . MET C 1 188 ? 170.26383 221.59432 75.54473  1.000 110.38839 ?  188 MET C CG    1 
ATOM   8075  S SD    . MET C 1 188 ? 171.20602 222.78197 76.54808  1.000 105.00397 ?  188 MET C SD    1 
ATOM   8076  C CE    . MET C 1 188 ? 171.27694 222.02254 78.13870  1.000 95.58181  ?  188 MET C CE    1 
ATOM   8077  N N     . THR C 1 189 ? 170.28883 224.30965 71.88052  1.000 110.67921 ?  189 THR C N     1 
ATOM   8078  C CA    . THR C 1 189 ? 171.02810 225.21280 71.00885  1.000 108.76170 ?  189 THR C CA    1 
ATOM   8079  C C     . THR C 1 189 ? 170.50331 226.65000 71.10910  1.000 111.80846 ?  189 THR C C     1 
ATOM   8080  O O     . THR C 1 189 ? 171.30157 227.59684 71.14236  1.000 111.94032 ?  189 THR C O     1 
ATOM   8081  C CB    . THR C 1 189 ? 170.98407 224.68790 69.57828  1.000 106.17565 ?  189 THR C CB    1 
ATOM   8082  O OG1   . THR C 1 189 ? 169.62432 224.62970 69.15023  1.000 112.56529 ?  189 THR C OG1   1 
ATOM   8083  C CG2   . THR C 1 189 ? 171.57360 223.28028 69.51793  1.000 103.11562 ?  189 THR C CG2   1 
ATOM   8084  N N     . THR C 1 190 ? 169.17300 226.84154 71.18251  1.000 110.69703 ?  190 THR C N     1 
ATOM   8085  C CA    . THR C 1 190 ? 168.64295 228.19883 71.35887  1.000 112.28728 ?  190 THR C CA    1 
ATOM   8086  C C     . THR C 1 190 ? 169.07959 228.78546 72.70153  1.000 113.35592 ?  190 THR C C     1 
ATOM   8087  O O     . THR C 1 190 ? 169.29143 230.00013 72.81116  1.000 113.27434 ?  190 THR C O     1 
ATOM   8088  C CB    . THR C 1 190 ? 167.10721 228.24431 71.26619  1.000 110.10251 ?  190 THR C CB    1 
ATOM   8089  O OG1   . THR C 1 190 ? 166.54411 227.29105 72.17034  1.000 115.15670 ?  190 THR C OG1   1 
ATOM   8090  C CG2   . THR C 1 190 ? 166.59662 227.93862 69.85904  1.000 105.76067 ?  190 THR C CG2   1 
ATOM   8091  N N     . HIS C 1 191 ? 169.18246 227.94308 73.74605  1.000 110.71109 ?  191 HIS C N     1 
ATOM   8092  C CA    . HIS C 1 191 ? 169.62655 228.43321 75.05037  1.000 110.69083 ?  191 HIS C CA    1 
ATOM   8093  C C     . HIS C 1 191 ? 171.05261 228.97198 74.97463  1.000 110.90864 ?  191 HIS C C     1 
ATOM   8094  O O     . HIS C 1 191 ? 171.36419 229.98775 75.60455  1.000 108.63148 ?  191 HIS C O     1 
ATOM   8095  C CB    . HIS C 1 191 ? 169.52731 227.33705 76.12137  1.000 107.25434 ?  191 HIS C CB    1 
ATOM   8096  C CG    . HIS C 1 191 ? 170.33603 227.61646 77.36243  1.000 105.49685 ?  191 HIS C CG    1 
ATOM   8097  N ND1   . HIS C 1 191 ? 170.00974 228.60318 78.27281  1.000 103.98546 ?  191 HIS C ND1   1 
ATOM   8098  C CD2   . HIS C 1 191 ? 171.49057 227.06304 77.81192  1.000 106.43395 ?  191 HIS C CD2   1 
ATOM   8099  C CE1   . HIS C 1 191 ? 170.90989 228.62270 79.24358  1.000 107.73971 ?  191 HIS C CE1   1 
ATOM   8100  N NE2   . HIS C 1 191 ? 171.82336 227.70452 78.98273  1.000 111.33738 ?  191 HIS C NE2   1 
ATOM   8101  N N     . LYS C 1 192 ? 171.93111 228.32436 74.19388  1.000 107.16096 ?  192 LYS C N     1 
ATOM   8102  C CA    . LYS C 1 192 ? 173.30744 228.80935 74.08427  1.000 106.00729 ?  192 LYS C CA    1 
ATOM   8103  C C     . LYS C 1 192 ? 173.36308 230.23766 73.55433  1.000 110.56727 ?  192 LYS C C     1 
ATOM   8104  O O     . LYS C 1 192 ? 174.17113 231.04923 74.02908  1.000 109.87128 ?  192 LYS C O     1 
ATOM   8105  C CB    . LYS C 1 192 ? 174.13307 227.89123 73.19503  1.000 101.47816 ?  192 LYS C CB    1 
ATOM   8106  C CG    . LYS C 1 192 ? 174.22520 226.45777 73.63685  1.000 97.68554  ?  192 LYS C CG    1 
ATOM   8107  C CD    . LYS C 1 192 ? 174.70959 226.34230 75.04945  1.000 85.55516  ?  192 LYS C CD    1 
ATOM   8108  C CE    . LYS C 1 192 ? 174.94832 224.89649 75.35105  1.000 98.50178  ?  192 LYS C CE    1 
ATOM   8109  N NZ    . LYS C 1 192 ? 173.77680 224.07139 74.95580  1.000 110.64382 ?  192 LYS C NZ    1 
ATOM   8110  N N     . MET C 1 193 ? 172.51614 230.55994 72.56289  1.000 110.78431 ?  193 MET C N     1 
ATOM   8111  C CA    . MET C 1 193 ? 172.38241 231.92852 72.05653  1.000 110.88705 ?  193 MET C CA    1 
ATOM   8112  C C     . MET C 1 193 ? 171.56105 232.83238 72.97231  1.000 112.78149 ?  193 MET C C     1 
ATOM   8113  O O     . MET C 1 193 ? 171.73514 234.05623 72.93016  1.000 113.40127 ?  193 MET C O     1 
ATOM   8114  C CB    . MET C 1 193 ? 171.75057 231.92590 70.65484  1.000 104.64324 ?  193 MET C CB    1 
ATOM   8115  C CG    . MET C 1 193 ? 172.71387 231.67749 69.48377  1.000 110.84463 ?  193 MET C CG    1 
ATOM   8116  S SD    . MET C 1 193 ? 173.56748 230.09068 69.56209  1.000 140.00514 ?  193 MET C SD    1 
ATOM   8117  C CE    . MET C 1 193 ? 174.58189 230.14030 68.08512  1.000 110.40249 ?  193 MET C CE    1 
ATOM   8118  N N     . CYS C 1 194 ? 170.67227 232.26954 73.79360  1.000 111.41650 ?  194 CYS C N     1 
ATOM   8119  C CA    . CYS C 1 194 ? 169.80747 233.05235 74.67322  1.000 111.71328 ?  194 CYS C CA    1 
ATOM   8120  C C     . CYS C 1 194 ? 170.11193 232.77697 76.14977  1.000 109.65964 ?  194 CYS C C     1 
ATOM   8121  O O     . CYS C 1 194 ? 169.22007 232.75595 77.00399  1.000 106.54409 ?  194 CYS C O     1 
ATOM   8122  C CB    . CYS C 1 194 ? 168.33508 232.78316 74.34519  1.000 110.90027 ?  194 CYS C CB    1 
ATOM   8123  S SG    . CYS C 1 194 ? 167.89635 233.03099 72.58001  1.000 110.26285 ?  194 CYS C SG    1 
ATOM   8124  N N     . ALA C 1 195 ? 171.40509 232.67281 76.47136  1.000 108.76803 ?  195 ALA C N     1 
ATOM   8125  C CA    . ALA C 1 195 ? 171.82127 232.27687 77.80909  1.000 107.72668 ?  195 ALA C CA    1 
ATOM   8126  C C     . ALA C 1 195 ? 171.54598 233.36225 78.83511  1.000 103.87124 ?  195 ALA C C     1 
ATOM   8127  O O     . ALA C 1 195 ? 171.27186 233.04866 80.00434  1.000 106.44952 ?  195 ALA C O     1 
ATOM   8128  C CB    . ALA C 1 195 ? 173.30655 231.92509 77.79740  1.000 107.69425 ?  195 ALA C CB    1 
ATOM   8129  N N     . ASN C 1 196 ? 171.60006 234.62525 78.42588  1.000 100.78097 ?  196 ASN C N     1 
ATOM   8130  C CA    . ASN C 1 196 ? 171.36426 235.73459 79.33561  1.000 111.05669 ?  196 ASN C CA    1 
ATOM   8131  C C     . ASN C 1 196 ? 169.97570 236.33818 79.11784  1.000 108.55417 ?  196 ASN C C     1 
ATOM   8132  O O     . ASN C 1 196 ? 169.70628 237.45005 79.59003  1.000 104.85367 ?  196 ASN C O     1 
ATOM   8133  C CB    . ASN C 1 196 ? 172.44846 236.81609 79.14481  1.000 117.74028 ?  196 ASN C CB    1 
ATOM   8134  C CG    . ASN C 1 196 ? 173.88600 236.33259 79.45523  1.000 117.05784 ?  196 ASN C CG    1 
ATOM   8135  O OD1   . ASN C 1 196 ? 174.10732 235.25509 80.01424  1.000 118.06375 ?  196 ASN C OD1   1 
ATOM   8136  N ND2   . ASN C 1 196 ? 174.86871 237.14250 79.05543  1.000 109.82657 ?  196 ASN C ND2   1 
ATOM   8137  N N     . TRP C 1 197 ? 169.05640 235.58375 78.48635  1.000 104.43735 ?  197 TRP C N     1 
ATOM   8138  C CA    . TRP C 1 197 ? 167.72920 236.12703 78.17735  1.000 102.97546 ?  197 TRP C CA    1 
ATOM   8139  C C     . TRP C 1 197 ? 166.92045 236.40804 79.42935  1.000 104.48072 ?  197 TRP C C     1 
ATOM   8140  O O     . TRP C 1 197 ? 165.89708 237.09342 79.35569  1.000 102.06178 ?  197 TRP C O     1 
ATOM   8141  C CB    . TRP C 1 197 ? 166.93294 235.18386 77.27877  1.000 105.77283 ?  197 TRP C CB    1 
ATOM   8142  C CG    . TRP C 1 197 ? 166.96569 235.56518 75.84199  1.000 106.35014 ?  197 TRP C CG    1 
ATOM   8143  C CD1   . TRP C 1 197 ? 168.03730 236.02032 75.14830  1.000 107.44534 ?  197 TRP C CD1   1 
ATOM   8144  C CD2   . TRP C 1 197 ? 165.85792 235.57530 74.92985  1.000 109.17029 ?  197 TRP C CD2   1 
ATOM   8145  N NE1   . TRP C 1 197 ? 167.68029 236.28443 73.84745  1.000 112.74076 ?  197 TRP C NE1   1 
ATOM   8146  C CE2   . TRP C 1 197 ? 166.34496 236.02421 73.68990  1.000 112.76149 ?  197 TRP C CE2   1 
ATOM   8147  C CE3   . TRP C 1 197 ? 164.50347 235.23863 75.03939  1.000 110.07968 ?  197 TRP C CE3   1 
ATOM   8148  C CZ2   . TRP C 1 197 ? 165.52790 236.14725 72.56067  1.000 114.80673 ?  197 TRP C CZ2   1 
ATOM   8149  C CZ3   . TRP C 1 197 ? 163.68866 235.36242 73.91153  1.000 108.32771 ?  197 TRP C CZ3   1 
ATOM   8150  C CH2   . TRP C 1 197 ? 164.20493 235.81051 72.69338  1.000 111.75761 ?  197 TRP C CH2   1 
ATOM   8151  N N     . SER C 1 198 ? 167.33445 235.83364 80.55860  1.000 107.36792 ?  198 SER C N     1 
ATOM   8152  C CA    . SER C 1 198 ? 166.73350 236.12718 81.85410  1.000 102.24968 ?  198 SER C CA    1 
ATOM   8153  C C     . SER C 1 198 ? 166.89207 237.59638 82.24074  1.000 103.80074 ?  198 SER C C     1 
ATOM   8154  O O     . SER C 1 198 ? 166.07761 238.12149 83.01118  1.000 104.57810 ?  198 SER C O     1 
ATOM   8155  C CB    . SER C 1 198 ? 167.34739 235.20152 82.89086  1.000 95.98749  ?  198 SER C CB    1 
ATOM   8156  O OG    . SER C 1 198 ? 168.74495 235.40114 82.94095  1.000 96.70441  ?  198 SER C OG    1 
ATOM   8157  N N     . THR C 1 199 ? 167.97332 238.24672 81.78170  1.000 107.32507 ?  199 THR C N     1 
ATOM   8158  C CA    . THR C 1 199 ? 168.22168 239.65631 82.10528  1.000 107.88949 ?  199 THR C CA    1 
ATOM   8159  C C     . THR C 1 199 ? 167.16664 240.58826 81.49402  1.000 105.82113 ?  199 THR C C     1 
ATOM   8160  O O     . THR C 1 199 ? 166.92876 241.68561 82.02581  1.000 102.36243 ?  199 THR C O     1 
ATOM   8161  C CB    . THR C 1 199 ? 169.63440 240.08351 81.64611  1.000 110.55051 ?  199 THR C CB    1 
ATOM   8162  O OG1   . THR C 1 199 ? 169.69575 240.12310 80.21549  1.000 108.55835 ?  199 THR C OG1   1 
ATOM   8163  C CG2   . THR C 1 199 ? 170.73474 239.12109 82.16765  1.000 106.85376 ?  199 THR C CG2   1 
ATOM   8164  N N     . ILE C 1 200 ? 166.59643 240.22196 80.34347  1.000 104.83192 ?  200 ILE C N     1 
ATOM   8165  C CA    . ILE C 1 200 ? 165.59943 241.04351 79.64401  1.000 106.24882 ?  200 ILE C CA    1 
ATOM   8166  C C     . ILE C 1 200 ? 164.32170 241.23272 80.45654  1.000 105.18284 ?  200 ILE C C     1 
ATOM   8167  O O     . ILE C 1 200 ? 163.55328 240.27580 80.60102  1.000 96.03086  ?  200 ILE C O     1 
ATOM   8168  C CB    . ILE C 1 200 ? 165.24212 240.43199 78.27984  1.000 103.29952 ?  200 ILE C CB    1 
ATOM   8169  C CG1   . ILE C 1 200 ? 166.50606 240.17183 77.45829  1.000 98.97991  ?  200 ILE C CG1   1 
ATOM   8170  C CG2   . ILE C 1 200 ? 164.20242 241.28231 77.55146  1.000 104.76849 ?  200 ILE C CG2   1 
ATOM   8171  C CD1   . ILE C 1 200 ? 166.24596 239.40599 76.21556  1.000 101.10261 ?  200 ILE C CD1   1 
ATOM   8172  N N     . PRO C 1 201 ? 163.95200 242.47043 80.80211  1.000 111.36757 ?  201 PRO C N     1 
ATOM   8173  C CA    . PRO C 1 201 ? 162.84159 242.66544 81.75358  1.000 112.98330 ?  201 PRO C CA    1 
ATOM   8174  C C     . PRO C 1 201 ? 161.48652 242.22948 81.22874  1.000 116.87956 ?  201 PRO C C     1 
ATOM   8175  O O     . PRO C 1 201 ? 160.68918 241.68878 82.00452  1.000 114.77012 ?  201 PRO C O     1 
ATOM   8176  C CB    . PRO C 1 201 ? 162.87791 244.17975 82.02536  1.000 110.81526 ?  201 PRO C CB    1 
ATOM   8177  C CG    . PRO C 1 201 ? 164.24179 244.63132 81.59141  1.000 113.21054 ?  201 PRO C CG    1 
ATOM   8178  C CD    . PRO C 1 201 ? 164.58340 243.74719 80.42496  1.000 115.53414 ?  201 PRO C CD    1 
ATOM   8179  N N     . ASN C 1 202 ? 161.16731 242.51235 79.95599  1.000 116.83319 ?  202 ASN C N     1 
ATOM   8180  C CA    . ASN C 1 202 ? 159.84393 242.16996 79.42079  1.000 118.78676 ?  202 ASN C CA    1 
ATOM   8181  C C     . ASN C 1 202 ? 159.63635 240.65840 79.38435  1.000 114.93014 ?  202 ASN C C     1 
ATOM   8182  O O     . ASN C 1 202 ? 158.52537 240.16680 79.62596  1.000 114.50187 ?  202 ASN C O     1 
ATOM   8183  C CB    . ASN C 1 202 ? 159.65966 242.77511 78.02195  1.000 121.51279 ?  202 ASN C CB    1 
ATOM   8184  C CG    . ASN C 1 202 ? 159.76706 244.29652 78.00482  1.000 115.41763 ?  202 ASN C CG    1 
ATOM   8185  O OD1   . ASN C 1 202 ? 159.98663 244.92809 79.03020  1.000 114.83668 ?  202 ASN C OD1   1 
ATOM   8186  N ND2   . ASN C 1 202 ? 159.62182 244.88344 76.82605  1.000 116.26408 ?  202 ASN C ND2   1 
ATOM   8187  N N     . PHE C 1 203 ? 160.69794 239.91232 79.06365  1.000 108.36931 ?  203 PHE C N     1 
ATOM   8188  C CA    . PHE C 1 203 ? 160.63211 238.45668 79.05465  1.000 103.74271 ?  203 PHE C CA    1 
ATOM   8189  C C     . PHE C 1 203 ? 160.30861 237.91947 80.44759  1.000 110.77230 ?  203 PHE C C     1 
ATOM   8190  O O     . PHE C 1 203 ? 159.43544 237.05454 80.61594  1.000 110.00527 ?  203 PHE C O     1 
ATOM   8191  C CB    . PHE C 1 203 ? 161.97371 237.94478 78.54072  1.000 93.14985  ?  203 PHE C CB    1 
ATOM   8192  C CG    . PHE C 1 203 ? 162.01963 236.49555 78.30546  1.000 87.18877  ?  203 PHE C CG    1 
ATOM   8193  C CD1   . PHE C 1 203 ? 160.94906 235.86652 77.71541  1.000 90.75200  ?  203 PHE C CD1   1 
ATOM   8194  C CD2   . PHE C 1 203 ? 163.15903 235.77288 78.57982  1.000 90.10316  ?  203 PHE C CD2   1 
ATOM   8195  C CE1   . PHE C 1 203 ? 160.98575 234.52875 77.46389  1.000 97.11726  ?  203 PHE C CE1   1 
ATOM   8196  C CE2   . PHE C 1 203 ? 163.20900 234.42514 78.32380  1.000 95.79584  ?  203 PHE C CE2   1 
ATOM   8197  C CZ    . PHE C 1 203 ? 162.12245 233.80055 77.76410  1.000 98.91213  ?  203 PHE C CZ    1 
ATOM   8198  N N     . ARG C 1 204 ? 160.98746 238.46413 81.46076  1.000 111.86013 ?  204 ARG C N     1 
ATOM   8199  C CA    . ARG C 1 204 ? 160.73034 238.11838 82.85266  1.000 110.94394 ?  204 ARG C CA    1 
ATOM   8200  C C     . ARG C 1 204 ? 159.31908 238.50988 83.26518  1.000 114.48383 ?  204 ARG C C     1 
ATOM   8201  O O     . ARG C 1 204 ? 158.63609 237.74648 83.96036  1.000 119.97560 ?  204 ARG C O     1 
ATOM   8202  C CB    . ARG C 1 204 ? 161.75551 238.82932 83.73785  1.000 113.92509 ?  204 ARG C CB    1 
ATOM   8203  C CG    . ARG C 1 204 ? 161.70709 238.54178 85.23512  1.000 113.82564 ?  204 ARG C CG    1 
ATOM   8204  C CD    . ARG C 1 204 ? 162.65282 239.50257 85.96053  1.000 113.19984 ?  204 ARG C CD    1 
ATOM   8205  N NE    . ARG C 1 204 ? 162.70517 239.33940 87.41243  1.000 114.28654 ?  204 ARG C NE    1 
ATOM   8206  C CZ    . ARG C 1 204 ? 163.66027 238.67737 88.05015  1.000 111.61870 ?  204 ARG C CZ    1 
ATOM   8207  N NH1   . ARG C 1 204 ? 164.66636 238.12111 87.39435  1.000 109.09424 ?  204 ARG C NH1   1 
ATOM   8208  N NH2   . ARG C 1 204 ? 163.61692 238.59198 89.37683  1.000 107.39388 ?  204 ARG C NH2   1 
ATOM   8209  N N     . PHE C 1 205 ? 158.87142 239.70858 82.86451  1.000 112.52845 ?  205 PHE C N     1 
ATOM   8210  C CA    . PHE C 1 205 ? 157.53061 240.15077 83.24426  1.000 117.79655 ?  205 PHE C CA    1 
ATOM   8211  C C     . PHE C 1 205 ? 156.47883 239.21174 82.67496  1.000 116.25810 ?  205 PHE C C     1 
ATOM   8212  O O     . PHE C 1 205 ? 155.52916 238.82511 83.37062  1.000 119.88983 ?  205 PHE C O     1 
ATOM   8213  C CB    . PHE C 1 205 ? 157.26313 241.58553 82.76745  1.000 118.39885 ?  205 PHE C CB    1 
ATOM   8214  C CG    . PHE C 1 205 ? 155.92465 242.17068 83.24457  1.000 122.03407 ?  205 PHE C CG    1 
ATOM   8215  C CD1   . PHE C 1 205 ? 154.75400 241.99240 82.50284  1.000 125.65989 ?  205 PHE C CD1   1 
ATOM   8216  C CD2   . PHE C 1 205 ? 155.85879 242.97297 84.38763  1.000 115.62734 ?  205 PHE C CD2   1 
ATOM   8217  C CE1   . PHE C 1 205 ? 153.53157 242.54685 82.92965  1.000 125.17552 ?  205 PHE C CE1   1 
ATOM   8218  C CE2   . PHE C 1 205 ? 154.63886 243.53658 84.81088  1.000 122.93762 ?  205 PHE C CE2   1 
ATOM   8219  C CZ    . PHE C 1 205 ? 153.47863 243.32028 84.07757  1.000 124.52972 ?  205 PHE C CZ    1 
ATOM   8220  N N     . LEU C 1 206 ? 156.63498 238.83522 81.40971  1.000 111.69550 ?  206 LEU C N     1 
ATOM   8221  C CA    . LEU C 1 206 ? 155.65367 237.96308 80.77961  1.000 117.74275 ?  206 LEU C CA    1 
ATOM   8222  C C     . LEU C 1 206 ? 155.64641 236.58508 81.42666  1.000 118.10144 ?  206 LEU C C     1 
ATOM   8223  O O     . LEU C 1 206 ? 154.57332 236.04769 81.74272  1.000 116.36143 ?  206 LEU C O     1 
ATOM   8224  C CB    . LEU C 1 206 ? 155.97388 237.86379 79.28868  1.000 119.16864 ?  206 LEU C CB    1 
ATOM   8225  C CG    . LEU C 1 206 ? 155.76773 239.19779 78.56434  1.000 121.24216 ?  206 LEU C CG    1 
ATOM   8226  C CD1   . LEU C 1 206 ? 156.41392 239.13459 77.21312  1.000 113.40514 ?  206 LEU C CD1   1 
ATOM   8227  C CD2   . LEU C 1 206 ? 154.29711 239.54027 78.40903  1.000 117.23073 ?  206 LEU C CD2   1 
ATOM   8228  N N     . ALA C 1 207 ? 156.84048 236.04445 81.70659  1.000 112.82155 ?  207 ALA C N     1 
ATOM   8229  C CA    . ALA C 1 207 ? 156.93403 234.72060 82.30696  1.000 110.76821 ?  207 ALA C CA    1 
ATOM   8230  C C     . ALA C 1 207 ? 156.25490 234.69201 83.66764  1.000 115.46217 ?  207 ALA C C     1 
ATOM   8231  O O     . ALA C 1 207 ? 155.54350 233.73207 83.99440  1.000 116.48668 ?  207 ALA C O     1 
ATOM   8232  C CB    . ALA C 1 207 ? 158.39460 234.29762 82.41450  1.000 105.01235 ?  207 ALA C CB    1 
ATOM   8233  N N     . GLY C 1 208 ? 156.45927 235.74382 84.47090  1.000 117.09262 ?  208 GLY C N     1 
ATOM   8234  C CA    . GLY C 1 208 ? 155.77418 235.83570 85.74817  1.000 113.02653 ?  208 GLY C CA    1 
ATOM   8235  C C     . GLY C 1 208 ? 154.27092 235.91512 85.57138  1.000 115.89150 ?  208 GLY C C     1 
ATOM   8236  O O     . GLY C 1 208 ? 153.50915 235.32277 86.34983  1.000 114.43459 ?  208 GLY C O     1 
ATOM   8237  N N     . THR C 1 209 ? 153.82342 236.65397 84.54404  1.000 116.91132 ?  209 THR C N     1 
ATOM   8238  C CA    . THR C 1 209 ? 152.39155 236.78786 84.28880  1.000 121.29209 ?  209 THR C CA    1 
ATOM   8239  C C     . THR C 1 209 ? 151.77582 235.41896 84.03086  1.000 122.09230 ?  209 THR C C     1 
ATOM   8240  O O     . THR C 1 209 ? 150.69155 235.09928 84.54525  1.000 121.53530 ?  209 THR C O     1 
ATOM   8241  C CB    . THR C 1 209 ? 152.13231 237.70590 83.08404  1.000 120.85142 ?  209 THR C CB    1 
ATOM   8242  O OG1   . THR C 1 209 ? 152.72086 238.99932 83.28145  1.000 120.82186 ?  209 THR C OG1   1 
ATOM   8243  C CG2   . THR C 1 209 ? 150.63105 237.87524 82.86766  1.000 122.91556 ?  209 THR C CG2   1 
ATOM   8244  N N     . TYR C 1 210 ? 152.46302 234.60033 83.21906  1.000 120.19142 ?  210 TYR C N     1 
ATOM   8245  C CA    . TYR C 1 210 ? 151.96309 233.26703 82.89904  1.000 123.32424 ?  210 TYR C CA    1 
ATOM   8246  C C     . TYR C 1 210 ? 151.90205 232.36201 84.13322  1.000 122.52615 ?  210 TYR C C     1 
ATOM   8247  O O     . TYR C 1 210 ? 150.91404 231.63988 84.32955  1.000 124.77351 ?  210 TYR C O     1 
ATOM   8248  C CB    . TYR C 1 210 ? 152.82847 232.62175 81.81162  1.000 118.62436 ?  210 TYR C CB    1 
ATOM   8249  C CG    . TYR C 1 210 ? 152.44195 232.95909 80.37866  1.000 121.68160 ?  210 TYR C CG    1 
ATOM   8250  C CD1   . TYR C 1 210 ? 151.35665 232.34706 79.75191  1.000 124.29330 ?  210 TYR C CD1   1 
ATOM   8251  C CD2   . TYR C 1 210 ? 153.19948 233.85838 79.62965  1.000 122.23274 ?  210 TYR C CD2   1 
ATOM   8252  C CE1   . TYR C 1 210 ? 151.01440 232.65156 78.42682  1.000 125.58258 ?  210 TYR C CE1   1 
ATOM   8253  C CE2   . TYR C 1 210 ? 152.87007 234.16459 78.29558  1.000 123.19703 ?  210 TYR C CE2   1 
ATOM   8254  C CZ    . TYR C 1 210 ? 151.77529 233.55712 77.70039  1.000 123.12530 ?  210 TYR C CZ    1 
ATOM   8255  O OH    . TYR C 1 210 ? 151.44246 233.85027 76.39150  1.000 115.43409 ?  210 TYR C OH    1 
ATOM   8256  N N     . ASP C 1 211 ? 152.94359 232.37880 84.97516  1.000 118.68070 ?  211 ASP C N     1 
ATOM   8257  C CA    . ASP C 1 211 ? 152.95329 231.48144 86.12646  1.000 116.78631 ?  211 ASP C CA    1 
ATOM   8258  C C     . ASP C 1 211 ? 151.81829 231.82898 87.08429  1.000 118.45835 ?  211 ASP C C     1 
ATOM   8259  O O     . ASP C 1 211 ? 151.11073 230.93667 87.57238  1.000 118.06735 ?  211 ASP C O     1 
ATOM   8260  C CB    . ASP C 1 211 ? 154.29675 231.54273 86.86437  1.000 115.64746 ?  211 ASP C CB    1 
ATOM   8261  C CG    . ASP C 1 211 ? 154.56383 230.28637 87.71789  1.000 117.04146 ?  211 ASP C CG    1 
ATOM   8262  O OD1   . ASP C 1 211 ? 153.99448 229.21440 87.39609  1.000 116.18392 ?  211 ASP C OD1   1 
ATOM   8263  O OD2   . ASP C 1 211 ? 155.31477 230.36860 88.72108  1.000 110.82857 ?  211 ASP C OD2   1 
ATOM   8264  N N     . MET C 1 212 ? 151.58681 233.12685 87.31729  1.000 114.87274 ?  212 MET C N     1 
ATOM   8265  C CA    . MET C 1 212 ? 150.58593 233.52522 88.30386  1.000 118.00402 ?  212 MET C CA    1 
ATOM   8266  C C     . MET C 1 212 ? 149.19891 233.01103 87.94235  1.000 124.34284 ?  212 MET C C     1 
ATOM   8267  O O     . MET C 1 212 ? 148.49197 232.43873 88.78882  1.000 124.02982 ?  212 MET C O     1 
ATOM   8268  C CB    . MET C 1 212 ? 150.56171 235.04456 88.42030  1.000 108.81296 ?  212 MET C CB    1 
ATOM   8269  C CG    . MET C 1 212 ? 149.72359 235.52351 89.57315  1.000 111.27060 ?  212 MET C CG    1 
ATOM   8270  S SD    . MET C 1 212 ? 149.78210 237.30910 89.73278  1.000 121.25136 ?  212 MET C SD    1 
ATOM   8271  C CE    . MET C 1 212 ? 148.57353 237.61533 91.02964  1.000 131.06828 ?  212 MET C CE    1 
ATOM   8272  N N     . PHE C 1 213 ? 148.79994 233.23224 86.68411  1.000 123.99248 ?  213 PHE C N     1 
ATOM   8273  C CA    . PHE C 1 213 ? 147.49834 232.80443 86.19320  1.000 128.27813 ?  213 PHE C CA    1 
ATOM   8274  C C     . PHE C 1 213 ? 147.39847 231.27593 86.14955  1.000 125.19546 ?  213 PHE C C     1 
ATOM   8275  O O     . PHE C 1 213 ? 146.39120 230.69622 86.58435  1.000 125.21782 ?  213 PHE C O     1 
ATOM   8276  C CB    . PHE C 1 213 ? 147.20842 233.46839 84.83857  1.000 128.84863 ?  213 PHE C CB    1 
ATOM   8277  C CG    . PHE C 1 213 ? 146.41938 234.77099 84.97039  1.000 138.80145 ?  213 PHE C CG    1 
ATOM   8278  C CD1   . PHE C 1 213 ? 147.05608 235.96594 85.30427  1.000 135.97241 ?  213 PHE C CD1   1 
ATOM   8279  C CD2   . PHE C 1 213 ? 145.03508 234.78860 84.80415  1.000 145.10852 ?  213 PHE C CD2   1 
ATOM   8280  C CE1   . PHE C 1 213 ? 146.32820 237.15871 85.44594  1.000 141.47679 ?  213 PHE C CE1   1 
ATOM   8281  C CE2   . PHE C 1 213 ? 144.30069 235.97910 84.94926  1.000 146.93622 ?  213 PHE C CE2   1 
ATOM   8282  C CZ    . PHE C 1 213 ? 144.95026 237.16301 85.27037  1.000 145.91638 ?  213 PHE C CZ    1 
ATOM   8283  N N     . PHE C 1 214 ? 148.43838 230.60457 85.64152  1.000 120.27253 ?  214 PHE C N     1 
ATOM   8284  C CA    . PHE C 1 214 ? 148.39635 229.14498 85.53172  1.000 122.87366 ?  214 PHE C CA    1 
ATOM   8285  C C     . PHE C 1 214 ? 148.35147 228.46461 86.89315  1.000 124.83835 ?  214 PHE C C     1 
ATOM   8286  O O     . PHE C 1 214 ? 147.85213 227.33610 87.00605  1.000 127.05371 ?  214 PHE C O     1 
ATOM   8287  C CB    . PHE C 1 214 ? 149.60325 228.61876 84.75644  1.000 119.00076 ?  214 PHE C CB    1 
ATOM   8288  C CG    . PHE C 1 214 ? 149.39312 228.54436 83.29397  1.000 122.11539 ?  214 PHE C CG    1 
ATOM   8289  C CD1   . PHE C 1 214 ? 148.35106 227.80214 82.77730  1.000 121.65322 ?  214 PHE C CD1   1 
ATOM   8290  C CD2   . PHE C 1 214 ? 150.24075 229.21056 82.43096  1.000 126.59386 ?  214 PHE C CD2   1 
ATOM   8291  C CE1   . PHE C 1 214 ? 148.15566 227.73343 81.42600  1.000 125.23681 ?  214 PHE C CE1   1 
ATOM   8292  C CE2   . PHE C 1 214 ? 150.05108 229.14801 81.08047  1.000 124.54946 ?  214 PHE C CE2   1 
ATOM   8293  C CZ    . PHE C 1 214 ? 149.00566 228.40692 80.57373  1.000 124.16107 ?  214 PHE C CZ    1 
ATOM   8294  N N     . SER C 1 215 ? 148.96202 229.08138 87.90772  1.000 121.49852 ?  215 SER C N     1 
ATOM   8295  C CA    . SER C 1 215 ? 148.97414 228.48649 89.24464  1.000 125.88221 ?  215 SER C CA    1 
ATOM   8296  C C     . SER C 1 215 ? 147.57848 228.43702 89.87891  1.000 133.99971 ?  215 SER C C     1 
ATOM   8297  O O     . SER C 1 215 ? 147.25311 227.46598 90.58229  1.000 131.67353 ?  215 SER C O     1 
ATOM   8298  C CB    . SER C 1 215 ? 149.97257 229.22184 90.14513  1.000 125.24984 ?  215 SER C CB    1 
ATOM   8299  O OG    . SER C 1 215 ? 151.29434 229.17613 89.62216  1.000 121.05938 ?  215 SER C OG    1 
ATOM   8300  N N     . ARG C 1 216 ? 146.76760 229.50313 89.70435  1.000 134.86662 ?  216 ARG C N     1 
ATOM   8301  C CA    . ARG C 1 216 ? 145.43264 229.57689 90.32020  1.000 128.56551 ?  216 ARG C CA    1 
ATOM   8302  C C     . ARG C 1 216 ? 144.39320 228.68686 89.62186  1.000 128.60731 ?  216 ARG C C     1 
ATOM   8303  O O     . ARG C 1 216 ? 143.53415 228.08338 90.28855  1.000 124.73865 ?  216 ARG C O     1 
ATOM   8304  C CB    . ARG C 1 216 ? 144.93145 231.01941 90.33925  1.000 124.19486 ?  216 ARG C CB    1 
ATOM   8305  C CG    . ARG C 1 216 ? 143.49315 231.11366 90.84031  1.000 126.63461 ?  216 ARG C CG    1 
ATOM   8306  C CD    . ARG C 1 216 ? 143.39431 230.57937 92.27438  1.000 124.89737 ?  216 ARG C CD    1 
ATOM   8307  N NE    . ARG C 1 216 ? 142.04162 230.66795 92.80243  1.000 124.82712 ?  216 ARG C NE    1 
ATOM   8308  C CZ    . ARG C 1 216 ? 141.68446 230.37671 94.04799  1.000 126.81512 ?  216 ARG C CZ    1 
ATOM   8309  N NH1   . ARG C 1 216 ? 142.56225 229.95359 94.94246  1.000 122.32838 ?  216 ARG C NH1   1 
ATOM   8310  N NH2   . ARG C 1 216 ? 140.40743 230.50605 94.40328  1.000 134.83909 ?  216 ARG C NH2   1 
ATOM   8311  N N     . ILE C 1 217 ? 144.37795 228.67707 88.28574  1.000 128.65349 ?  217 ILE C N     1 
ATOM   8312  C CA    . ILE C 1 217 ? 143.38491 227.94217 87.50044  1.000 129.08422 ?  217 ILE C CA    1 
ATOM   8313  C C     . ILE C 1 217 ? 144.06287 226.81247 86.74254  1.000 132.12632 ?  217 ILE C C     1 
ATOM   8314  O O     . ILE C 1 217 ? 144.92184 227.07076 85.88990  1.000 132.44650 ?  217 ILE C O     1 
ATOM   8315  C CB    . ILE C 1 217 ? 142.65686 228.86979 86.52275  1.000 124.09244 ?  217 ILE C CB    1 
ATOM   8316  C CG1   . ILE C 1 217 ? 142.51644 230.24003 87.18132  1.000 125.46299 ?  217 ILE C CG1   1 
ATOM   8317  C CG2   . ILE C 1 217 ? 141.33304 228.23950 86.13566  1.000 120.47616 ?  217 ILE C CG2   1 
ATOM   8318  C CD1   . ILE C 1 217 ? 142.09392 231.34703 86.28338  1.000 121.61351 ?  217 ILE C CD1   1 
ATOM   8319  N N     . GLU C 1 218 ? 143.60992 225.57762 86.97853  1.000 133.76842 ?  218 GLU C N     1 
ATOM   8320  C CA    . GLU C 1 218 ? 144.10823 224.43511 86.21647  1.000 130.65246 ?  218 GLU C CA    1 
ATOM   8321  C C     . GLU C 1 218 ? 143.64546 224.55807 84.76812  1.000 128.80200 ?  218 GLU C C     1 
ATOM   8322  O O     . GLU C 1 218 ? 142.50698 224.94901 84.49604  1.000 127.69536 ?  218 GLU C O     1 
ATOM   8323  C CB    . GLU C 1 218 ? 143.62913 223.10867 86.83457  1.000 125.09328 ?  218 GLU C CB    1 
ATOM   8324  C CG    . GLU C 1 218 ? 143.98678 221.83166 86.02406  1.000 126.54700 ?  218 GLU C CG    1 
ATOM   8325  C CD    . GLU C 1 218 ? 145.48370 221.58318 85.88892  1.000 124.12295 ?  218 GLU C CD    1 
ATOM   8326  O OE1   . GLU C 1 218 ? 146.22435 221.98291 86.80601  1.000 127.59931 ?  218 GLU C OE1   1 
ATOM   8327  O OE2   . GLU C 1 218 ? 145.91887 221.00159 84.86462  1.000 119.88637 ?  218 GLU C OE2   1 
ATOM   8328  N N     . HIS C 1 219 ? 144.54807 224.26380 83.83333  1.000 127.92900 ?  219 HIS C N     1 
ATOM   8329  C CA    . HIS C 1 219 ? 144.27961 224.46976 82.41651  1.000 127.15881 ?  219 HIS C CA    1 
ATOM   8330  C C     . HIS C 1 219 ? 144.84183 223.27890 81.65112  1.000 123.09082 ?  219 HIS C C     1 
ATOM   8331  O O     . HIS C 1 219 ? 145.53924 222.42918 82.21408  1.000 118.88059 ?  219 HIS C O     1 
ATOM   8332  C CB    . HIS C 1 219 ? 144.89746 225.80775 81.94128  1.000 126.95267 ?  219 HIS C CB    1 
ATOM   8333  C CG    . HIS C 1 219 ? 144.40837 226.31026 80.60552  1.000 128.79889 ?  219 HIS C CG    1 
ATOM   8334  N ND1   . HIS C 1 219 ? 145.20456 226.34296 79.47826  1.000 130.05047 ?  219 HIS C ND1   1 
ATOM   8335  C CD2   . HIS C 1 219 ? 143.23869 226.89884 80.24913  1.000 126.41977 ?  219 HIS C CD2   1 
ATOM   8336  C CE1   . HIS C 1 219 ? 144.53273 226.88953 78.47807  1.000 129.40941 ?  219 HIS C CE1   1 
ATOM   8337  N NE2   . HIS C 1 219 ? 143.33706 227.23545 78.91973  1.000 127.74225 ?  219 HIS C NE2   1 
ATOM   8338  N N     . LEU C 1 220 ? 144.42512 223.15874 80.38928  1.000 123.12572 ?  220 LEU C N     1 
ATOM   8339  C CA    . LEU C 1 220 ? 144.99106 222.12943 79.52160  1.000 129.72258 ?  220 LEU C CA    1 
ATOM   8340  C C     . LEU C 1 220 ? 146.48133 222.35855 79.29665  1.000 131.02196 ?  220 LEU C C     1 
ATOM   8341  O O     . LEU C 1 220 ? 147.26815 221.39921 79.21675  1.000 124.24200 ?  220 LEU C O     1 
ATOM   8342  C CB    . LEU C 1 220 ? 144.23731 222.09662 78.19229  1.000 126.03698 ?  220 LEU C CB    1 
ATOM   8343  C CG    . LEU C 1 220 ? 144.50416 220.88624 77.28971  1.000 124.04516 ?  220 LEU C CG    1 
ATOM   8344  C CD1   . LEU C 1 220 ? 144.20725 219.54264 77.95597  1.000 116.69907 ?  220 LEU C CD1   1 
ATOM   8345  C CD2   . LEU C 1 220 ? 143.69576 221.03131 76.01456  1.000 130.59968 ?  220 LEU C CD2   1 
ATOM   8346  N N     . TYR C 1 221 ? 146.88237 223.62849 79.17204  1.000 133.40424 ?  221 TYR C N     1 
ATOM   8347  C CA    . TYR C 1 221 ? 148.27249 224.00387 78.94266  1.000 135.64481 ?  221 TYR C CA    1 
ATOM   8348  C C     . TYR C 1 221 ? 148.93898 224.52753 80.23137  1.000 129.30639 ?  221 TYR C C     1 
ATOM   8349  O O     . TYR C 1 221 ? 149.81514 225.40501 80.17121  1.000 124.06561 ?  221 TYR C O     1 
ATOM   8350  C CB    . TYR C 1 221 ? 148.35640 225.03666 77.80083  1.000 127.30542 ?  221 TYR C CB    1 
ATOM   8351  C CG    . TYR C 1 221 ? 147.53943 224.66362 76.55702  1.000 124.07990 ?  221 TYR C CG    1 
ATOM   8352  C CD1   . TYR C 1 221 ? 147.81935 223.51678 75.80848  1.000 122.62262 ?  221 TYR C CD1   1 
ATOM   8353  C CD2   . TYR C 1 221 ? 146.46720 225.45748 76.15351  1.000 124.88622 ?  221 TYR C CD2   1 
ATOM   8354  C CE1   . TYR C 1 221 ? 147.03894 223.17455 74.68756  1.000 121.13877 ?  221 TYR C CE1   1 
ATOM   8355  C CE2   . TYR C 1 221 ? 145.69333 225.12508 75.04567  1.000 127.66819 ?  221 TYR C CE2   1 
ATOM   8356  C CZ    . TYR C 1 221 ? 145.98268 223.98629 74.31599  1.000 123.06139 ?  221 TYR C CZ    1 
ATOM   8357  O OH    . TYR C 1 221 ? 145.20446 223.67123 73.22738  1.000 115.06341 ?  221 TYR C OH    1 
ATOM   8358  N N     . SER C 1 222 ? 148.51036 224.03501 81.41256  1.000 124.47686 ?  222 SER C N     1 
ATOM   8359  C CA    . SER C 1 222 ? 149.13285 224.46914 82.66407  1.000 121.28332 ?  222 SER C CA    1 
ATOM   8360  C C     . SER C 1 222 ? 150.56836 223.97136 82.78001  1.000 116.55590 ?  222 SER C C     1 
ATOM   8361  O O     . SER C 1 222 ? 151.33570 224.55158 83.55226  1.000 113.56202 ?  222 SER C O     1 
ATOM   8362  C CB    . SER C 1 222 ? 148.30678 224.03259 83.89840  1.000 120.13679 ?  222 SER C CB    1 
ATOM   8363  O OG    . SER C 1 222 ? 148.18439 222.61718 84.04523  1.000 120.24999 ?  222 SER C OG    1 
ATOM   8364  N N     . ALA C 1 223 ? 150.94919 222.93938 82.00073  1.000 111.37436 ?  223 ALA C N     1 
ATOM   8365  C CA    . ALA C 1 223 ? 152.29510 222.35768 81.98196  1.000 102.84329 ?  223 ALA C CA    1 
ATOM   8366  C C     . ALA C 1 223 ? 153.33612 223.33046 81.45396  1.000 105.77250 ?  223 ALA C C     1 
ATOM   8367  O O     . ALA C 1 223 ? 154.53867 223.03792 81.52492  1.000 101.17051 ?  223 ALA C O     1 
ATOM   8368  C CB    . ALA C 1 223 ? 152.32119 221.07736 81.14590  1.000 99.04094  ?  223 ALA C CB    1 
ATOM   8369  N N     . ILE C 1 224 ? 152.88480 224.44873 80.87816  1.000 111.35064 ?  224 ILE C N     1 
ATOM   8370  C CA    . ILE C 1 224 ? 153.75580 225.54023 80.47449  1.000 110.67402 ?  224 ILE C CA    1 
ATOM   8371  C C     . ILE C 1 224 ? 154.50895 226.08806 81.67221  1.000 109.67554 ?  224 ILE C C     1 
ATOM   8372  O O     . ILE C 1 224 ? 155.59227 226.66403 81.51890  1.000 110.68212 ?  224 ILE C O     1 
ATOM   8373  C CB    . ILE C 1 224 ? 152.89582 226.63826 79.80184  1.000 110.61895 ?  224 ILE C CB    1 
ATOM   8374  C CG1   . ILE C 1 224 ? 152.54295 226.23832 78.36688  1.000 113.11686 ?  224 ILE C CG1   1 
ATOM   8375  C CG2   . ILE C 1 224 ? 153.54084 228.02538 79.91093  1.000 107.92082 ?  224 ILE C CG2   1 
ATOM   8376  C CD1   . ILE C 1 224 ? 151.70089 227.25175 77.63993  1.000 117.53091 ?  224 ILE C CD1   1 
ATOM   8377  N N     . ARG C 1 225 ? 153.98155 225.86812 82.88149  1.000 109.61934 ?  225 ARG C N     1 
ATOM   8378  C CA    . ARG C 1 225 ? 154.59193 226.41438 84.08791  1.000 107.75708 ?  225 ARG C CA    1 
ATOM   8379  C C     . ARG C 1 225 ? 156.00960 225.91268 84.30645  1.000 102.90477 ?  225 ARG C C     1 
ATOM   8380  O O     . ARG C 1 225 ? 156.74028 226.53155 85.08173  1.000 103.34972 ?  225 ARG C O     1 
ATOM   8381  C CB    . ARG C 1 225 ? 153.74187 226.08046 85.30568  1.000 110.91137 ?  225 ARG C CB    1 
ATOM   8382  C CG    . ARG C 1 225 ? 152.48859 226.92389 85.48057  1.000 114.44510 ?  225 ARG C CG    1 
ATOM   8383  C CD    . ARG C 1 225 ? 151.88551 226.53816 86.79978  1.000 120.28829 ?  225 ARG C CD    1 
ATOM   8384  N NE    . ARG C 1 225 ? 152.86169 226.72059 87.86617  1.000 118.92456 ?  225 ARG C NE    1 
ATOM   8385  C CZ    . ARG C 1 225 ? 152.70341 226.25425 89.09115  1.000 121.93624 ?  225 ARG C CZ    1 
ATOM   8386  N NH1   . ARG C 1 225 ? 151.63654 225.53876 89.41966  1.000 126.90735 ?  225 ARG C NH1   1 
ATOM   8387  N NH2   . ARG C 1 225 ? 153.63557 226.50845 90.00305  1.000 118.28965 ?  225 ARG C NH2   1 
ATOM   8388  N N     . VAL C 1 226 ? 156.41719 224.81663 83.64973  1.000 97.59414  ?  226 VAL C N     1 
ATOM   8389  C CA    . VAL C 1 226 ? 157.76062 224.28272 83.87700  1.000 95.06669  ?  226 VAL C CA    1 
ATOM   8390  C C     . VAL C 1 226 ? 158.81635 225.34016 83.58528  1.000 94.66020  ?  226 VAL C C     1 
ATOM   8391  O O     . VAL C 1 226 ? 159.84140 225.42537 84.27465  1.000 94.82987  ?  226 VAL C O     1 
ATOM   8392  C CB    . VAL C 1 226 ? 157.99641 223.00475 83.03765  1.000 92.36691  ?  226 VAL C CB    1 
ATOM   8393  C CG1   . VAL C 1 226 ? 157.67864 223.19982 81.56133  1.000 98.10509  ?  226 VAL C CG1   1 
ATOM   8394  C CG2   . VAL C 1 226 ? 159.44351 222.64946 83.09119  1.000 93.29752  ?  226 VAL C CG2   1 
ATOM   8395  N N     . GLY C 1 227 ? 158.57487 226.17021 82.57063  1.000 96.07908  ?  227 GLY C N     1 
ATOM   8396  C CA    . GLY C 1 227 ? 159.45103 227.29751 82.30833  1.000 96.91873  ?  227 GLY C CA    1 
ATOM   8397  C C     . GLY C 1 227 ? 159.32875 228.39914 83.34245  1.000 94.90755  ?  227 GLY C C     1 
ATOM   8398  O O     . GLY C 1 227 ? 160.32812 229.01853 83.71675  1.000 96.45585  ?  227 GLY C O     1 
ATOM   8399  N N     . THR C 1 228 ? 158.10166 228.67124 83.80306  1.000 95.63612  ?  228 THR C N     1 
ATOM   8400  C CA    . THR C 1 228 ? 157.80466 229.81902 84.65907  1.000 102.36497 ?  228 THR C CA    1 
ATOM   8401  C C     . THR C 1 228 ? 157.81046 229.51683 86.15385  1.000 101.91706 ?  228 THR C C     1 
ATOM   8402  O O     . THR C 1 228 ? 157.56811 230.42888 86.94947  1.000 103.30386 ?  228 THR C O     1 
ATOM   8403  C CB    . THR C 1 228 ? 156.43881 230.42015 84.30943  1.000 104.90763 ?  228 THR C CB    1 
ATOM   8404  O OG1   . THR C 1 228 ? 155.40943 229.49194 84.67851  1.000 104.71024 ?  228 THR C OG1   1 
ATOM   8405  C CG2   . THR C 1 228 ? 156.34342 230.78056 82.84018  1.000 101.30807 ?  228 THR C CG2   1 
ATOM   8406  N N     . VAL C 1 229 ? 158.07591 228.27721 86.56286  1.000 103.43761 ?  229 VAL C N     1 
ATOM   8407  C CA    . VAL C 1 229 ? 158.00826 227.95042 87.98470  1.000 102.44873 ?  229 VAL C CA    1 
ATOM   8408  C C     . VAL C 1 229 ? 159.01330 228.78301 88.76613  1.000 98.87668  ?  229 VAL C C     1 
ATOM   8409  O O     . VAL C 1 229 ? 158.70646 229.26524 89.86641  1.000 98.46520  ?  229 VAL C O     1 
ATOM   8410  C CB    . VAL C 1 229 ? 158.20971 226.42177 88.17014  1.000 104.84397 ?  229 VAL C CB    1 
ATOM   8411  C CG1   . VAL C 1 229 ? 159.66311 225.95894 87.83195  1.000 99.99714  ?  229 VAL C CG1   1 
ATOM   8412  C CG2   . VAL C 1 229 ? 157.79575 225.98717 89.54371  1.000 106.64479 ?  229 VAL C CG2   1 
ATOM   8413  N N     . VAL C 1 230 ? 160.17385 229.06325 88.15638  1.000 96.45527  ?  230 VAL C N     1 
ATOM   8414  C CA    . VAL C 1 230 ? 161.27150 229.78410 88.80257  1.000 98.00770  ?  230 VAL C CA    1 
ATOM   8415  C C     . VAL C 1 230 ? 160.88221 231.22732 89.14525  1.000 98.80713  ?  230 VAL C C     1 
ATOM   8416  O O     . VAL C 1 230 ? 161.50205 231.85298 90.02025  1.000 99.32114  ?  230 VAL C O     1 
ATOM   8417  C CB    . VAL C 1 230 ? 162.55378 229.71261 87.93306  1.000 95.66085  ?  230 VAL C CB    1 
ATOM   8418  C CG1   . VAL C 1 230 ? 163.23345 228.33765 88.04407  1.000 91.82231  ?  230 VAL C CG1   1 
ATOM   8419  C CG2   . VAL C 1 230 ? 162.26004 230.05540 86.49276  1.000 101.00484 ?  230 VAL C CG2   1 
ATOM   8420  N N     . THR C 1 231 ? 159.94418 231.81375 88.39751  1.000 93.54650  ?  231 THR C N     1 
ATOM   8421  C CA    . THR C 1 231 ? 159.51803 233.17787 88.69464  1.000 102.49089 ?  231 THR C CA    1 
ATOM   8422  C C     . THR C 1 231 ? 158.84633 233.26585 90.06043  1.000 106.45249 ?  231 THR C C     1 
ATOM   8423  O O     . THR C 1 231 ? 158.90725 234.31520 90.72437  1.000 103.76869 ?  231 THR C O     1 
ATOM   8424  C CB    . THR C 1 231 ? 158.57367 233.68168 87.60504  1.000 104.18772 ?  231 THR C CB    1 
ATOM   8425  O OG1   . THR C 1 231 ? 157.32824 232.97119 87.67793  1.000 108.20511 ?  231 THR C OG1   1 
ATOM   8426  C CG2   . THR C 1 231 ? 159.19499 233.44991 86.25420  1.000 106.73773 ?  231 THR C CG2   1 
ATOM   8427  N N     . ALA C 1 232 ? 158.15615 232.20152 90.46790  1.000 107.16005 ?  232 ALA C N     1 
ATOM   8428  C CA    . ALA C 1 232 ? 157.46564 232.20058 91.74957  1.000 108.29480 ?  232 ALA C CA    1 
ATOM   8429  C C     . ALA C 1 232 ? 158.46283 232.21745 92.90246  1.000 107.63513 ?  232 ALA C C     1 
ATOM   8430  O O     . ALA C 1 232 ? 159.35986 231.36379 92.97891  1.000 102.05024 ?  232 ALA C O     1 
ATOM   8431  C CB    . ALA C 1 232 ? 156.54770 230.98944 91.85688  1.000 112.19251 ?  232 ALA C CB    1 
ATOM   8432  N N     . TYR C 1 233 ? 158.24321 233.15402 93.83417  1.000 109.12746 ?  233 TYR C N     1 
ATOM   8433  C CA    . TYR C 1 233 ? 159.12360 233.39120 94.98241  1.000 103.79624 ?  233 TYR C CA    1 
ATOM   8434  C C     . TYR C 1 233 ? 160.56948 233.62850 94.55145  1.000 105.09637 ?  233 TYR C C     1 
ATOM   8435  O O     . TYR C 1 233 ? 161.51218 233.21849 95.22831  1.000 106.20135 ?  233 TYR C O     1 
ATOM   8436  C CB    . TYR C 1 233 ? 159.04461 232.22512 95.97516  1.000 103.84472 ?  233 TYR C CB    1 
ATOM   8437  C CG    . TYR C 1 233 ? 157.67766 231.98337 96.60965  1.000 105.75452 ?  233 TYR C CG    1 
ATOM   8438  C CD1   . TYR C 1 233 ? 157.19604 232.83397 97.60501  1.000 101.20586 ?  233 TYR C CD1   1 
ATOM   8439  C CD2   . TYR C 1 233 ? 156.88118 230.89515 96.23780  1.000 105.63946 ?  233 TYR C CD2   1 
ATOM   8440  C CE1   . TYR C 1 233 ? 155.95990 232.62535 98.19765  1.000 101.62915 ?  233 TYR C CE1   1 
ATOM   8441  C CE2   . TYR C 1 233 ? 155.62640 230.67531 96.83928  1.000 105.25290 ?  233 TYR C CE2   1 
ATOM   8442  C CZ    . TYR C 1 233 ? 155.17390 231.54956 97.81937  1.000 107.21270 ?  233 TYR C CZ    1 
ATOM   8443  O OH    . TYR C 1 233 ? 153.94130 231.37591 98.42962  1.000 110.02885 ?  233 TYR C OH    1 
ATOM   8444  N N     . GLU C 1 234 ? 160.74939 234.32229 93.42633  1.000 109.32507 ?  234 GLU C N     1 
ATOM   8445  C CA    . GLU C 1 234 ? 162.09125 234.55937 92.91209  1.000 109.28409 ?  234 GLU C CA    1 
ATOM   8446  C C     . GLU C 1 234 ? 162.78570 235.60611 93.77661  1.000 107.63255 ?  234 GLU C C     1 
ATOM   8447  O O     . GLU C 1 234 ? 162.18949 236.62167 94.13597  1.000 107.00107 ?  234 GLU C O     1 
ATOM   8448  C CB    . GLU C 1 234 ? 162.03373 235.02117 91.45074  1.000 108.00567 ?  234 GLU C CB    1 
ATOM   8449  C CG    . GLU C 1 234 ? 163.33953 234.83369 90.67624  1.000 112.10273 ?  234 GLU C CG    1 
ATOM   8450  C CD    . GLU C 1 234 ? 163.23842 235.28456 89.22266  1.000 111.52020 ?  234 GLU C CD    1 
ATOM   8451  O OE1   . GLU C 1 234 ? 162.10971 235.53050 88.74058  1.000 110.39387 ?  234 GLU C OE1   1 
ATOM   8452  O OE2   . GLU C 1 234 ? 164.29104 235.34625 88.54846  1.000 106.72449 ?  234 GLU C OE2   1 
ATOM   8453  N N     . ASP C 1 235 ? 164.05337 235.35189 94.11439  1.000 108.00569 ?  235 ASP C N     1 
ATOM   8454  C CA    . ASP C 1 235 ? 164.87643 236.27805 94.90438  1.000 107.14252 ?  235 ASP C CA    1 
ATOM   8455  C C     . ASP C 1 235 ? 164.32745 236.50241 96.31495  1.000 105.91911 ?  235 ASP C C     1 
ATOM   8456  O O     . ASP C 1 235 ? 164.60604 237.52416 96.94939  1.000 102.09832 ?  235 ASP C O     1 
ATOM   8457  C CB    . ASP C 1 235 ? 165.03867 237.60963 94.16888  1.000 107.41797 ?  235 ASP C CB    1 
ATOM   8458  C CG    . ASP C 1 235 ? 165.49760 237.42474 92.71933  1.000 111.95802 ?  235 ASP C CG    1 
ATOM   8459  O OD1   . ASP C 1 235 ? 165.93979 236.30333 92.35537  1.000 108.17642 ?  235 ASP C OD1   1 
ATOM   8460  O OD2   . ASP C 1 235 ? 165.39898 238.39767 91.93752  1.000 113.38563 ?  235 ASP C OD2   1 
ATOM   8461  N N     . CYS C 1 236 ? 163.59872 235.51026 96.83280  1.000 108.74860 ?  236 CYS C N     1 
ATOM   8462  C CA    . CYS C 1 236 ? 163.02302 235.54919 98.16920  1.000 107.28540 ?  236 CYS C CA    1 
ATOM   8463  C C     . CYS C 1 236 ? 163.45129 234.32431 98.97498  1.000 108.51826 ?  236 CYS C C     1 
ATOM   8464  O O     . CYS C 1 236 ? 162.72910 233.88905 99.88374  1.000 107.65071 ?  236 CYS C O     1 
ATOM   8465  C CB    . CYS C 1 236 ? 161.50171 235.62365 98.07669  1.000 103.09898 ?  236 CYS C CB    1 
ATOM   8466  S SG    . CYS C 1 236 ? 160.95370 237.07339 97.17630  1.000 107.10988 ?  236 CYS C SG    1 
ATOM   8467  N N     . SER C 1 237 ? 164.63504 233.76408 98.66244  1.000 103.86702 ?  237 SER C N     1 
ATOM   8468  C CA    . SER C 1 237 ? 165.07123 232.52226 99.30610  1.000 103.50749 ?  237 SER C CA    1 
ATOM   8469  C C     . SER C 1 237 ? 165.16917 232.67678 100.81555 1.000 101.21106 ?  237 SER C C     1 
ATOM   8470  O O     . SER C 1 237 ? 164.93736 231.70613 101.54928 1.000 95.80856  ?  237 SER C O     1 
ATOM   8471  C CB    . SER C 1 237 ? 166.40966 232.03252 98.73452  1.000 101.62354 ?  237 SER C CB    1 
ATOM   8472  O OG    . SER C 1 237 ? 166.27715 231.44679 97.44820  1.000 105.34415 ?  237 SER C OG    1 
ATOM   8473  N N     . GLY C 1 238 ? 165.51130 233.86927 101.30450 1.000 99.71490  ?  238 GLY C N     1 
ATOM   8474  C CA    . GLY C 1 238 ? 165.56742 234.03980 102.74286 1.000 92.20441  ?  238 GLY C CA    1 
ATOM   8475  C C     . GLY C 1 238 ? 164.22185 233.77326 103.38863 1.000 93.62603  ?  238 GLY C C     1 
ATOM   8476  O O     . GLY C 1 238 ? 164.11059 232.96858 104.31361 1.000 96.42375  ?  238 GLY C O     1 
ATOM   8477  N N     . LEU C 1 239 ? 163.16306 234.35870 102.83595 1.000 92.78834  ?  239 LEU C N     1 
ATOM   8478  C CA    . LEU C 1 239 ? 161.83998 234.12117 103.39123 1.000 94.11278  ?  239 LEU C CA    1 
ATOM   8479  C C     . LEU C 1 239 ? 161.43912 232.65322 103.27392 1.000 98.57302  ?  239 LEU C C     1 
ATOM   8480  O O     . LEU C 1 239 ? 160.82664 232.09581 104.19706 1.000 101.25466 ?  239 LEU C O     1 
ATOM   8481  C CB    . LEU C 1 239 ? 160.83426 235.03898 102.71660 1.000 92.20703  ?  239 LEU C CB    1 
ATOM   8482  C CG    . LEU C 1 239 ? 159.41389 234.80099 103.18429 1.000 93.58380  ?  239 LEU C CG    1 
ATOM   8483  C CD1   . LEU C 1 239 ? 159.21767 235.21649 104.63613 1.000 89.23139  ?  239 LEU C CD1   1 
ATOM   8484  C CD2   . LEU C 1 239 ? 158.60035 235.66440 102.27807 1.000 95.74454  ?  239 LEU C CD2   1 
ATOM   8485  N N     . VAL C 1 240 ? 161.74748 232.02457 102.13252 1.000 96.34737  ?  240 VAL C N     1 
ATOM   8486  C CA    . VAL C 1 240 ? 161.39815 230.61782 101.91638 1.000 98.22888  ?  240 VAL C CA    1 
ATOM   8487  C C     . VAL C 1 240 ? 162.16771 229.70938 102.87016 1.000 98.56386  ?  240 VAL C C     1 
ATOM   8488  O O     . VAL C 1 240 ? 161.63650 228.69899 103.35317 1.000 102.97298 ?  240 VAL C O     1 
ATOM   8489  C CB    . VAL C 1 240 ? 161.65375 230.21146 100.45233 1.000 97.40011  ?  240 VAL C CB    1 
ATOM   8490  C CG1   . VAL C 1 240 ? 161.47601 228.69447 100.26573 1.000 94.32903  ?  240 VAL C CG1   1 
ATOM   8491  C CG2   . VAL C 1 240 ? 160.79621 231.01915 99.49829  1.000 100.37619 ?  240 VAL C CG2   1 
ATOM   8492  N N     . SER C 1 241 ? 163.45895 229.99309 103.08011 1.000 96.69937  ?  241 SER C N     1 
ATOM   8493  C CA    . SER C 1 241 ? 164.22536 229.16536 104.00559 1.000 93.74220  ?  241 SER C CA    1 
ATOM   8494  C C     . SER C 1 241 ? 163.65658 229.26911 105.39772 1.000 88.49981  ?  241 SER C C     1 
ATOM   8495  O O     . SER C 1 241 ? 163.55539 228.26644 106.10887 1.000 89.15890  ?  241 SER C O     1 
ATOM   8496  C CB    . SER C 1 241 ? 165.69517 229.56168 104.02147 1.000 90.99212  ?  241 SER C CB    1 
ATOM   8497  O OG    . SER C 1 241 ? 166.29160 229.38969 102.75884 1.000 92.94857  ?  241 SER C OG    1 
ATOM   8498  N N     . PHE C 1 242 ? 163.24212 230.47307 105.78783 1.000 86.27380  ?  242 PHE C N     1 
ATOM   8499  C CA    . PHE C 1 242 ? 162.66999 230.64044 107.10817 1.000 85.90505  ?  242 PHE C CA    1 
ATOM   8500  C C     . PHE C 1 242 ? 161.40046 229.83105 107.28965 1.000 89.41024  ?  242 PHE C C     1 
ATOM   8501  O O     . PHE C 1 242 ? 161.20852 229.19379 108.33297 1.000 92.94264  ?  242 PHE C O     1 
ATOM   8502  C CB    . PHE C 1 242 ? 162.38489 232.09935 107.39784 1.000 84.47143  ?  242 PHE C CB    1 
ATOM   8503  C CG    . PHE C 1 242 ? 161.98244 232.30418 108.80590 1.000 92.36556  ?  242 PHE C CG    1 
ATOM   8504  C CD1   . PHE C 1 242 ? 162.78868 231.81894 109.81212 1.000 91.04567  ?  242 PHE C CD1   1 
ATOM   8505  C CD2   . PHE C 1 242 ? 160.81761 232.96881 109.14111 1.000 94.64391  ?  242 PHE C CD2   1 
ATOM   8506  C CE1   . PHE C 1 242 ? 162.44418 231.96382 111.11610 1.000 87.90652  ?  242 PHE C CE1   1 
ATOM   8507  C CE2   . PHE C 1 242 ? 160.47737 233.13633 110.46362 1.000 93.56537  ?  242 PHE C CE2   1 
ATOM   8508  C CZ    . PHE C 1 242 ? 161.28905 232.63262 111.44614 1.000 93.79404  ?  242 PHE C CZ    1 
ATOM   8509  N N     . THR C 1 243 ? 160.50945 229.85512 106.30696 1.000 86.66183  ?  243 THR C N     1 
ATOM   8510  C CA    . THR C 1 243 ? 159.29419 229.06896 106.44444 1.000 84.13145  ?  243 THR C CA    1 
ATOM   8511  C C     . THR C 1 243 ? 159.61060 227.57901 106.48798 1.000 82.68909  ?  243 THR C C     1 
ATOM   8512  O O     . THR C 1 243 ? 158.97337 226.82398 107.22463 1.000 88.71634  ?  243 THR C O     1 
ATOM   8513  C CB    . THR C 1 243 ? 158.33634 229.40738 105.32060 1.000 80.27498  ?  243 THR C CB    1 
ATOM   8514  O OG1   . THR C 1 243 ? 158.94236 229.02746 104.09060 1.000 101.92054 ?  243 THR C OG1   1 
ATOM   8515  C CG2   . THR C 1 243 ? 158.15234 230.88865 105.28680 1.000 86.17596  ?  243 THR C CG2   1 
ATOM   8516  N N     . GLY C 1 244 ? 160.54844 227.13160 105.66291 1.000 80.66132  ?  244 GLY C N     1 
ATOM   8517  C CA    . GLY C 1 244 ? 160.95406 225.74395 105.71473 1.000 82.42540  ?  244 GLY C CA    1 
ATOM   8518  C C     . GLY C 1 244 ? 161.58236 225.39904 107.04515 1.000 86.03675  ?  244 GLY C C     1 
ATOM   8519  O O     . GLY C 1 244 ? 161.39218 224.29685 107.57393 1.000 91.74193  ?  244 GLY C O     1 
ATOM   8520  N N     . PHE C 1 245 ? 162.36592 226.33027 107.58978 1.000 84.29057  ?  245 PHE C N     1 
ATOM   8521  C CA    . PHE C 1 245 ? 163.00167 226.10575 108.88414 1.000 88.13145  ?  245 PHE C CA    1 
ATOM   8522  C C     . PHE C 1 245 ? 161.94393 225.88704 109.96524 1.000 90.91060  ?  245 PHE C C     1 
ATOM   8523  O O     . PHE C 1 245 ? 161.96986 224.87559 110.67827 1.000 88.94088  ?  245 PHE C O     1 
ATOM   8524  C CB    . PHE C 1 245 ? 163.91992 227.30495 109.19093 1.000 82.95472  ?  245 PHE C CB    1 
ATOM   8525  C CG    . PHE C 1 245 ? 164.53381 227.28210 110.53578 1.000 83.09026  ?  245 PHE C CG    1 
ATOM   8526  C CD1   . PHE C 1 245 ? 165.58886 226.43772 110.83314 1.000 82.98852  ?  245 PHE C CD1   1 
ATOM   8527  C CD2   . PHE C 1 245 ? 164.02037 228.07955 111.53805 1.000 88.91703  ?  245 PHE C CD2   1 
ATOM   8528  C CE1   . PHE C 1 245 ? 166.13107 226.41859 112.10457 1.000 84.10432  ?  245 PHE C CE1   1 
ATOM   8529  C CE2   . PHE C 1 245 ? 164.55025 228.06145 112.80152 1.000 80.60452  ?  245 PHE C CE2   1 
ATOM   8530  C CZ    . PHE C 1 245 ? 165.60483 227.23016 113.08574 1.000 81.97634  ?  245 PHE C CZ    1 
ATOM   8531  N N     . ILE C 1 246 ? 160.90699 226.72867 109.95764 1.000 90.98473  ?  246 ILE C N     1 
ATOM   8532  C CA    . ILE C 1 246 ? 159.83024 226.66848 110.94402 1.000 85.58404  ?  246 ILE C CA    1 
ATOM   8533  C C     . ILE C 1 246 ? 159.16854 225.29343 110.95287 1.000 89.27071  ?  246 ILE C C     1 
ATOM   8534  O O     . ILE C 1 246 ? 158.84154 224.76212 112.02100 1.000 95.00526  ?  246 ILE C O     1 
ATOM   8535  C CB    . ILE C 1 246 ? 158.80727 227.77947 110.65042 1.000 88.33497  ?  246 ILE C CB    1 
ATOM   8536  C CG1   . ILE C 1 246 ? 159.32776 229.13270 111.12298 1.000 92.05336  ?  246 ILE C CG1   1 
ATOM   8537  C CG2   . ILE C 1 246 ? 157.40255 227.42631 111.14743 1.000 94.49412  ?  246 ILE C CG2   1 
ATOM   8538  C CD1   . ILE C 1 246 ? 158.62916 230.26052 110.45260 1.000 97.13937  ?  246 ILE C CD1   1 
ATOM   8539  N N     . LYS C 1 247 ? 158.86225 224.74442 109.76519 1.000 86.74968  ?  247 LYS C N     1 
ATOM   8540  C CA    . LYS C 1 247 ? 158.17757 223.44786 109.69080 1.000 86.78385  ?  247 LYS C CA    1 
ATOM   8541  C C     . LYS C 1 247 ? 159.09065 222.28221 110.05239 1.000 91.19118  ?  247 LYS C C     1 
ATOM   8542  O O     . LYS C 1 247 ? 158.62222 221.29273 110.62613 1.000 103.27040 ?  247 LYS C O     1 
ATOM   8543  C CB    . LYS C 1 247 ? 157.52858 223.21207 108.31991 1.000 91.15898  ?  247 LYS C CB    1 
ATOM   8544  C CG    . LYS C 1 247 ? 156.14931 222.42505 108.42532 1.000 99.75800  ?  247 LYS C CG    1 
ATOM   8545  C CD    . LYS C 1 247 ? 155.36387 222.19268 107.08836 1.000 109.58309 ?  247 LYS C CD    1 
ATOM   8546  C CE    . LYS C 1 247 ? 154.05140 221.36153 107.27088 1.000 93.04290  ?  247 LYS C CE    1 
ATOM   8547  N NZ    . LYS C 1 247 ? 153.35201 221.08973 105.95569 1.000 85.92471  ?  247 LYS C NZ    1 
ATOM   8548  N N     . GLN C 1 248 ? 160.34818 222.30505 109.60164 1.000 91.46739  ?  248 GLN C N     1 
ATOM   8549  C CA    . GLN C 1 248 ? 161.26851 221.21849 109.93932 1.000 95.34303  ?  248 GLN C CA    1 
ATOM   8550  C C     . GLN C 1 248 ? 161.59526 221.22597 111.41994 1.000 99.28831  ?  248 GLN C C     1 
ATOM   8551  O O     . GLN C 1 248 ? 161.69344 220.16270 112.04588 1.000 102.74312 ?  248 GLN C O     1 
ATOM   8552  C CB    . GLN C 1 248 ? 162.53759 221.32020 109.10537 1.000 93.08728  ?  248 GLN C CB    1 
ATOM   8553  C CG    . GLN C 1 248 ? 162.28153 220.99828 107.67407 1.000 97.83207  ?  248 GLN C CG    1 
ATOM   8554  C CD    . GLN C 1 248 ? 163.48416 221.21136 106.81128 1.000 102.26053 ?  248 GLN C CD    1 
ATOM   8555  O OE1   . GLN C 1 248 ? 164.47825 221.80631 107.23057 1.000 103.21071 ?  248 GLN C OE1   1 
ATOM   8556  N NE2   . GLN C 1 248 ? 163.43236 220.67173 105.60794 1.000 105.63522 ?  248 GLN C NE2   1 
ATOM   8557  N N     . ILE C 1 249 ? 161.76139 222.42454 111.99093 1.000 95.49933  ?  249 ILE C N     1 
ATOM   8558  C CA    . ILE C 1 249 ? 162.16816 222.57277 113.38389 1.000 97.96572  ?  249 ILE C CA    1 
ATOM   8559  C C     . ILE C 1 249 ? 160.99170 222.30518 114.30406 1.000 101.86911 ?  249 ILE C C     1 
ATOM   8560  O O     . ILE C 1 249 ? 161.16126 222.08997 115.51513 1.000 103.36760 ?  249 ILE C O     1 
ATOM   8561  C CB    . ILE C 1 249 ? 162.71258 224.00214 113.60803 1.000 101.57511 ?  249 ILE C CB    1 
ATOM   8562  C CG1   . ILE C 1 249 ? 163.76564 223.95723 114.68281 1.000 99.05596  ?  249 ILE C CG1   1 
ATOM   8563  C CG2   . ILE C 1 249 ? 161.60329 224.99853 114.07174 1.000 105.20209 ?  249 ILE C CG2   1 
ATOM   8564  C CD1   . ILE C 1 249 ? 164.99222 223.33780 114.03985 1.000 96.21023  ?  249 ILE C CD1   1 
ATOM   8565  N N     . ASN C 1 250 ? 159.80149 222.30962 113.70794 1.000 98.59679  ?  250 ASN C N     1 
ATOM   8566  C CA    . ASN C 1 250 ? 158.52115 222.02941 114.33486 1.000 97.53779  ?  250 ASN C CA    1 
ATOM   8567  C C     . ASN C 1 250 ? 158.18630 223.06161 115.41751 1.000 106.10282 ?  250 ASN C C     1 
ATOM   8568  O O     . ASN C 1 250 ? 157.68476 222.71987 116.49391 1.000 113.14327 ?  250 ASN C O     1 
ATOM   8569  C CB    . ASN C 1 250 ? 158.51040 220.60726 114.88270 1.000 101.41863 ?  250 ASN C CB    1 
ATOM   8570  C CG    . ASN C 1 250 ? 157.17045 219.95660 114.72114 1.000 104.05546 ?  250 ASN C CG    1 
ATOM   8571  O OD1   . ASN C 1 250 ? 156.15270 220.64061 114.62223 1.000 100.28628 ?  250 ASN C OD1   1 
ATOM   8572  N ND2   . ASN C 1 250 ? 157.15396 218.62431 114.68064 1.000 102.13006 ?  250 ASN C ND2   1 
ATOM   8573  N N     . LEU C 1 251 ? 158.46488 224.34409 115.12544 1.000 103.91379 ?  251 LEU C N     1 
ATOM   8574  C CA    . LEU C 1 251 ? 158.13829 225.46348 116.00365 1.000 104.82161 ?  251 LEU C CA    1 
ATOM   8575  C C     . LEU C 1 251 ? 157.28875 226.48607 115.25743 1.000 106.83805 ?  251 LEU C C     1 
ATOM   8576  O O     . LEU C 1 251 ? 157.27844 226.53740 114.02337 1.000 98.74718  ?  251 LEU C O     1 
ATOM   8577  C CB    . LEU C 1 251 ? 159.40552 226.14323 116.54139 1.000 104.56680 ?  251 LEU C CB    1 
ATOM   8578  C CG    . LEU C 1 251 ? 159.93672 225.57827 117.85868 1.000 113.14580 ?  251 LEU C CG    1 
ATOM   8579  C CD1   . LEU C 1 251 ? 161.05113 226.50368 118.36643 1.000 109.44803 ?  251 LEU C CD1   1 
ATOM   8580  C CD2   . LEU C 1 251 ? 158.81622 225.33543 118.92115 1.000 111.04237 ?  251 LEU C CD2   1 
ATOM   8581  N N     . THR C 1 252 ? 156.58754 227.31505 116.03479 1.000 114.67879 ?  252 THR C N     1 
ATOM   8582  C CA    . THR C 1 252 ? 155.79884 228.40547 115.48098 1.000 114.43466 ?  252 THR C CA    1 
ATOM   8583  C C     . THR C 1 252 ? 156.73336 229.56107 115.14358 1.000 111.49189 ?  252 THR C C     1 
ATOM   8584  O O     . THR C 1 252 ? 157.76246 229.75314 115.79740 1.000 113.37062 ?  252 THR C O     1 
ATOM   8585  C CB    . THR C 1 252 ? 154.72235 228.92266 116.45989 1.000 115.92680 ?  252 THR C CB    1 
ATOM   8586  O OG1   . THR C 1 252 ? 155.30085 229.85078 117.38404 1.000 114.50608 ?  252 THR C OG1   1 
ATOM   8587  C CG2   . THR C 1 252 ? 154.08450 227.78080 117.27948 1.000 110.88452 ?  252 THR C CG2   1 
ATOM   8588  N N     . ALA C 1 253 ? 156.41877 230.26047 114.05443 1.000 106.78397 ?  253 ALA C N     1 
ATOM   8589  C CA    . ALA C 1 253 ? 157.20842 231.40993 113.61735 1.000 106.84570 ?  253 ALA C CA    1 
ATOM   8590  C C     . ALA C 1 253 ? 157.68138 232.29048 114.77754 1.000 109.87525 ?  253 ALA C C     1 
ATOM   8591  O O     . ALA C 1 253 ? 158.85241 232.68449 114.83091 1.000 107.30071 ?  253 ALA C O     1 
ATOM   8592  C CB    . ALA C 1 253 ? 156.39352 232.23628 112.62684 1.000 105.87473 ?  253 ALA C CB    1 
ATOM   8593  N N     . ARG C 1 254 ? 156.77644 232.62401 115.70981 1.000 109.96754 ?  254 ARG C N     1 
ATOM   8594  C CA    . ARG C 1 254 ? 157.15213 233.49446 116.82163 1.000 111.51269 ?  254 ARG C CA    1 
ATOM   8595  C C     . ARG C 1 254 ? 158.18956 232.81614 117.70603 1.000 112.82104 ?  254 ARG C C     1 
ATOM   8596  O O     . ARG C 1 254 ? 159.23298 233.40486 118.02135 1.000 109.88531 ?  254 ARG C O     1 
ATOM   8597  C CB    . ARG C 1 254 ? 155.92806 233.91576 117.64583 1.000 114.51140 ?  254 ARG C CB    1 
ATOM   8598  C CG    . ARG C 1 254 ? 156.29041 234.81330 118.83933 1.000 118.96970 ?  254 ARG C CG    1 
ATOM   8599  C CD    . ARG C 1 254 ? 155.14422 235.02772 119.79633 1.000 117.92478 ?  254 ARG C CD    1 
ATOM   8600  N NE    . ARG C 1 254 ? 154.86325 233.80458 120.52933 1.000 119.93289 ?  254 ARG C NE    1 
ATOM   8601  C CZ    . ARG C 1 254 ? 153.95352 233.70824 121.48246 1.000 128.01575 ?  254 ARG C CZ    1 
ATOM   8602  N NH1   . ARG C 1 254 ? 153.21878 234.75005 121.83881 1.000 128.86514 ?  254 ARG C NH1   1 
ATOM   8603  N NH2   . ARG C 1 254 ? 153.78566 232.54300 122.09844 1.000 128.28741 ?  254 ARG C NH2   1 
ATOM   8604  N N     . GLU C 1 255 ? 157.88185 231.59074 118.16215 1.000 111.36867 ?  255 GLU C N     1 
ATOM   8605  C CA    . GLU C 1 255 ? 158.78773 230.83034 119.02571 1.000 109.66679 ?  255 GLU C CA    1 
ATOM   8606  C C     . GLU C 1 255 ? 160.17031 230.68638 118.41252 1.000 110.71149 ?  255 GLU C C     1 
ATOM   8607  O O     . GLU C 1 255 ? 161.18501 230.77975 119.11636 1.000 111.06500 ?  255 GLU C O     1 
ATOM   8608  C CB    . GLU C 1 255 ? 158.19188 229.45111 119.31024 1.000 110.21068 ?  255 GLU C CB    1 
ATOM   8609  C CG    . GLU C 1 255 ? 156.89613 229.54434 120.06243 1.000 118.68065 ?  255 GLU C CG    1 
ATOM   8610  C CD    . GLU C 1 255 ? 157.04987 230.14821 121.45528 1.000 133.19088 ?  255 GLU C CD    1 
ATOM   8611  O OE1   . GLU C 1 255 ? 157.94363 229.70369 122.21646 1.000 138.02826 ?  255 GLU C OE1   1 
ATOM   8612  O OE2   . GLU C 1 255 ? 156.29640 231.09732 121.76667 1.000 130.21129 ?  255 GLU C OE2   1 
ATOM   8613  N N     . ALA C 1 256 ? 160.22909 230.46697 117.09717 1.000 106.54588 ?  256 ALA C N     1 
ATOM   8614  C CA    . ALA C 1 256 ? 161.51585 230.29391 116.44938 1.000 97.32379  ?  256 ALA C CA    1 
ATOM   8615  C C     . ALA C 1 256 ? 162.35575 231.56141 116.56327 1.000 98.28495  ?  256 ALA C C     1 
ATOM   8616  O O     . ALA C 1 256 ? 163.52019 231.49827 116.97408 1.000 97.58451  ?  256 ALA C O     1 
ATOM   8617  C CB    . ALA C 1 256 ? 161.31570 229.89468 114.99453 1.000 92.36647  ?  256 ALA C CB    1 
ATOM   8618  N N     . ILE C 1 257 ? 161.76288 232.73393 116.31708 1.000 94.88350  ?  257 ILE C N     1 
ATOM   8619  C CA    . ILE C 1 257 ? 162.56758 233.95159 116.40161 1.000 96.19910  ?  257 ILE C CA    1 
ATOM   8620  C C     . ILE C 1 257 ? 163.08530 234.17078 117.83112 1.000 102.53962 ?  257 ILE C C     1 
ATOM   8621  O O     . ILE C 1 257 ? 164.14241 234.78647 118.02202 1.000 102.54767 ?  257 ILE C O     1 
ATOM   8622  C CB    . ILE C 1 257 ? 161.78129 235.15178 115.83236 1.000 98.12500  ?  257 ILE C CB    1 
ATOM   8623  C CG1   . ILE C 1 257 ? 161.09100 234.72950 114.54562 1.000 100.21823 ?  257 ILE C CG1   1 
ATOM   8624  C CG2   . ILE C 1 257 ? 162.69076 236.31059 115.46281 1.000 97.46103  ?  257 ILE C CG2   1 
ATOM   8625  C CD1   . ILE C 1 257 ? 160.29776 235.81811 113.88983 1.000 102.18202 ?  257 ILE C CD1   1 
ATOM   8626  N N     . LEU C 1 258 ? 162.38209 233.64698 118.85079 1.000 106.38585 ?  258 LEU C N     1 
ATOM   8627  C CA    . LEU C 1 258 ? 162.84622 233.79082 120.23357 1.000 103.92050 ?  258 LEU C CA    1 
ATOM   8628  C C     . LEU C 1 258 ? 164.23886 233.22306 120.41032 1.000 99.13137  ?  258 LEU C C     1 
ATOM   8629  O O     . LEU C 1 258 ? 165.00129 233.68730 121.26917 1.000 98.03004  ?  258 LEU C O     1 
ATOM   8630  C CB    . LEU C 1 258 ? 161.90176 233.08912 121.20542 1.000 100.49891 ?  258 LEU C CB    1 
ATOM   8631  C CG    . LEU C 1 258 ? 160.48913 233.63494 121.24922 1.000 101.66094 ?  258 LEU C CG    1 
ATOM   8632  C CD1   . LEU C 1 258 ? 159.63339 232.76729 122.13492 1.000 104.96506 ?  258 LEU C CD1   1 
ATOM   8633  C CD2   . LEU C 1 258 ? 160.53995 235.05083 121.73628 1.000 95.67411  ?  258 LEU C CD2   1 
ATOM   8634  N N     . TYR C 1 259 ? 164.53543 232.14340 119.68739 1.000 96.43470  ?  259 TYR C N     1 
ATOM   8635  C CA    . TYR C 1 259 ? 165.83146 231.48355 119.71512 1.000 97.32857  ?  259 TYR C CA    1 
ATOM   8636  C C     . TYR C 1 259 ? 166.91864 232.25161 118.96199 1.000 94.50293  ?  259 TYR C C     1 
ATOM   8637  O O     . TYR C 1 259 ? 168.07191 231.80545 118.97431 1.000 92.82649  ?  259 TYR C O     1 
ATOM   8638  C CB    . TYR C 1 259 ? 165.70298 230.06498 119.15941 1.000 96.60907  ?  259 TYR C CB    1 
ATOM   8639  C CG    . TYR C 1 259 ? 164.98095 229.10341 120.09117 1.000 98.96188  ?  259 TYR C CG    1 
ATOM   8640  C CD1   . TYR C 1 259 ? 163.59515 229.10739 120.16948 1.000 100.57102 ?  259 TYR C CD1   1 
ATOM   8641  C CD2   . TYR C 1 259 ? 165.67638 228.19462 120.88851 1.000 96.25367  ?  259 TYR C CD2   1 
ATOM   8642  C CE1   . TYR C 1 259 ? 162.91596 228.24124 121.00820 1.000 103.23974 ?  259 TYR C CE1   1 
ATOM   8643  C CE2   . TYR C 1 259 ? 164.99861 227.31710 121.73148 1.000 98.34696  ?  259 TYR C CE2   1 
ATOM   8644  C CZ    . TYR C 1 259 ? 163.61755 227.34752 121.78728 1.000 103.65176 ?  259 TYR C CZ    1 
ATOM   8645  O OH    . TYR C 1 259 ? 162.92179 226.49393 122.61892 1.000 107.23719 ?  259 TYR C OH    1 
ATOM   8646  N N     . PHE C 1 260 ? 166.58258 233.32271 118.23177 1.000 91.64901  ?  260 PHE C N     1 
ATOM   8647  C CA    . PHE C 1 260 ? 167.58763 234.10620 117.49242 1.000 87.55068  ?  260 PHE C CA    1 
ATOM   8648  C C     . PHE C 1 260 ? 168.26849 235.07833 118.45707 1.000 85.05214  ?  260 PHE C C     1 
ATOM   8649  O O     . PHE C 1 260 ? 167.90783 236.25175 118.53683 1.000 85.24762  ?  260 PHE C O     1 
ATOM   8650  C CB    . PHE C 1 260 ? 166.94905 234.87054 116.32650 1.000 86.74442  ?  260 PHE C CB    1 
ATOM   8651  C CG    . PHE C 1 260 ? 166.47340 234.01042 115.17262 1.000 86.06096  ?  260 PHE C CG    1 
ATOM   8652  C CD1   . PHE C 1 260 ? 166.38239 232.63733 115.28686 1.000 91.92337  ?  260 PHE C CD1   1 
ATOM   8653  C CD2   . PHE C 1 260 ? 166.09718 234.59597 113.97661 1.000 88.49903  ?  260 PHE C CD2   1 
ATOM   8654  C CE1   . PHE C 1 260 ? 165.95618 231.85572 114.22626 1.000 85.32730  ?  260 PHE C CE1   1 
ATOM   8655  C CE2   . PHE C 1 260 ? 165.65954 233.82755 112.91570 1.000 92.48405  ?  260 PHE C CE2   1 
ATOM   8656  C CZ    . PHE C 1 260 ? 165.59108 232.44875 113.04318 1.000 89.48135  ?  260 PHE C CZ    1 
ATOM   8657  N N     . PHE C 1 261 ? 169.32900 234.63502 119.13349 1.000 83.93038  ?  261 PHE C N     1 
ATOM   8658  C CA    . PHE C 1 261 ? 169.91586 235.45932 120.19500 1.000 87.29801  ?  261 PHE C CA    1 
ATOM   8659  C C     . PHE C 1 261 ? 171.05367 236.31765 119.64746 1.000 83.20420  ?  261 PHE C C     1 
ATOM   8660  O O     . PHE C 1 261 ? 172.22441 236.09755 119.94825 1.000 84.60389  ?  261 PHE C O     1 
ATOM   8661  C CB    . PHE C 1 261 ? 170.41830 234.61244 121.36685 1.000 89.23827  ?  261 PHE C CB    1 
ATOM   8662  C CG    . PHE C 1 261 ? 169.46447 233.54087 121.82333 1.000 93.10591  ?  261 PHE C CG    1 
ATOM   8663  C CD1   . PHE C 1 261 ? 168.22343 233.85873 122.34143 1.000 97.75353  ?  261 PHE C CD1   1 
ATOM   8664  C CD2   . PHE C 1 261 ? 169.87905 232.21718 121.87941 1.000 91.46245  ?  261 PHE C CD2   1 
ATOM   8665  C CE1   . PHE C 1 261 ? 167.36289 232.85714 122.77335 1.000 99.55698  ?  261 PHE C CE1   1 
ATOM   8666  C CE2   . PHE C 1 261 ? 169.02792 231.21394 122.33665 1.000 93.30181  ?  261 PHE C CE2   1 
ATOM   8667  C CZ    . PHE C 1 261 ? 167.77111 231.53792 122.77777 1.000 96.68384  ?  261 PHE C CZ    1 
ATOM   8668  N N     . HIS C 1 262 ? 170.71040 237.29949 118.81632 1.000 81.86000  ?  262 HIS C N     1 
ATOM   8669  C CA    . HIS C 1 262 ? 171.76759 238.21848 118.40771 1.000 93.30618  ?  262 HIS C CA    1 
ATOM   8670  C C     . HIS C 1 262 ? 171.22561 239.56730 117.96169 1.000 96.16030  ?  262 HIS C C     1 
ATOM   8671  O O     . HIS C 1 262 ? 170.15057 239.65978 117.36487 1.000 97.11438  ?  262 HIS C O     1 
ATOM   8672  C CB    . HIS C 1 262 ? 172.63302 237.62594 117.29892 1.000 97.81448  ?  262 HIS C CB    1 
ATOM   8673  C CG    . HIS C 1 262 ? 174.02560 238.16965 117.29169 1.000 96.31289  ?  262 HIS C CG    1 
ATOM   8674  N ND1   . HIS C 1 262 ? 174.36740 239.32644 116.62476 1.000 95.36770  ?  262 HIS C ND1   1 
ATOM   8675  C CD2   . HIS C 1 262 ? 175.14742 237.75330 117.92492 1.000 94.30421  ?  262 HIS C CD2   1 
ATOM   8676  C CE1   . HIS C 1 262 ? 175.64948 239.57654 116.81780 1.000 96.97776  ?  262 HIS C CE1   1 
ATOM   8677  N NE2   . HIS C 1 262 ? 176.14621 238.63864 117.60464 1.000 93.62372  ?  262 HIS C NE2   1 
ATOM   8678  N N     . LYS C 1 263 ? 172.03944 240.60581 118.17794 1.000 94.93683  ?  263 LYS C N     1 
ATOM   8679  C CA    . LYS C 1 263 ? 171.61837 241.94830 117.80639 1.000 98.53602  ?  263 LYS C CA    1 
ATOM   8680  C C     . LYS C 1 263 ? 171.41823 242.05132 116.29832 1.000 97.58104  ?  263 LYS C C     1 
ATOM   8681  O O     . LYS C 1 263 ? 170.49971 242.73501 115.82655 1.000 102.76544 ?  263 LYS C O     1 
ATOM   8682  C CB    . LYS C 1 263 ? 172.65678 242.97012 118.26021 1.000 99.12014  ?  263 LYS C CB    1 
ATOM   8683  C CG    . LYS C 1 263 ? 172.14208 244.40847 118.33440 1.000 100.98408 ?  263 LYS C CG    1 
ATOM   8684  C CD    . LYS C 1 263 ? 173.30089 245.41377 118.33022 1.000 105.41740 ?  263 LYS C CD    1 
ATOM   8685  C CE    . LYS C 1 263 ? 174.38901 245.07994 119.35103 1.000 118.21554 ?  263 LYS C CE    1 
ATOM   8686  N NZ    . LYS C 1 263 ? 173.99303 245.22557 120.77511 1.000 128.35622 ?  263 LYS C NZ    1 
ATOM   8687  N N     . ASN C 1 264 ? 172.26118 241.37962 115.52078 1.000 90.37540  ?  264 ASN C N     1 
ATOM   8688  C CA    . ASN C 1 264 ? 172.15539 241.54478 114.07672 1.000 97.89170  ?  264 ASN C CA    1 
ATOM   8689  C C     . ASN C 1 264 ? 170.80369 241.09010 113.54916 1.000 99.30333  ?  264 ASN C C     1 
ATOM   8690  O O     . ASN C 1 264 ? 170.28028 241.68497 112.59983 1.000 102.50249 ?  264 ASN C O     1 
ATOM   8691  C CB    . ASN C 1 264 ? 173.27896 240.79381 113.37895 1.000 101.86198 ?  264 ASN C CB    1 
ATOM   8692  C CG    . ASN C 1 264 ? 174.62392 241.33742 113.74177 1.000 106.39059 ?  264 ASN C CG    1 
ATOM   8693  O OD1   . ASN C 1 264 ? 174.74941 242.50116 114.11787 1.000 115.79233 ?  264 ASN C OD1   1 
ATOM   8694  N ND2   . ASN C 1 264 ? 175.63982 240.49697 113.66793 1.000 104.01044 ?  264 ASN C ND2   1 
ATOM   8695  N N     . PHE C 1 265 ? 170.20093 240.07586 114.17377 1.000 96.92048  ?  265 PHE C N     1 
ATOM   8696  C CA    . PHE C 1 265 ? 168.96222 239.52122 113.62663 1.000 99.46812  ?  265 PHE C CA    1 
ATOM   8697  C C     . PHE C 1 265 ? 167.85028 240.55410 113.54197 1.000 102.50856 ?  265 PHE C C     1 
ATOM   8698  O O     . PHE C 1 265 ? 166.99336 240.46601 112.65160 1.000 99.66566  ?  265 PHE C O     1 
ATOM   8699  C CB    . PHE C 1 265 ? 168.47060 238.34611 114.47422 1.000 98.28125  ?  265 PHE C CB    1 
ATOM   8700  C CG    . PHE C 1 265 ? 169.30444 237.11915 114.34954 1.000 93.19114  ?  265 PHE C CG    1 
ATOM   8701  C CD1   . PHE C 1 265 ? 169.55681 236.56601 113.10831 1.000 91.52474  ?  265 PHE C CD1   1 
ATOM   8702  C CD2   . PHE C 1 265 ? 169.83234 236.51344 115.46735 1.000 95.34565  ?  265 PHE C CD2   1 
ATOM   8703  C CE1   . PHE C 1 265 ? 170.32550 235.43606 112.98240 1.000 93.97974  ?  265 PHE C CE1   1 
ATOM   8704  C CE2   . PHE C 1 265 ? 170.60636 235.37353 115.35109 1.000 95.44722  ?  265 PHE C CE2   1 
ATOM   8705  C CZ    . PHE C 1 265 ? 170.85469 234.83518 114.10707 1.000 96.06659  ?  265 PHE C CZ    1 
ATOM   8706  N N     . GLU C 1 266 ? 167.86322 241.54721 114.43610 1.000 107.29052 ?  266 GLU C N     1 
ATOM   8707  C CA    . GLU C 1 266 ? 166.73515 242.46679 114.54872 1.000 108.36632 ?  266 GLU C CA    1 
ATOM   8708  C C     . GLU C 1 266 ? 166.46860 243.18251 113.22332 1.000 108.69565 ?  266 GLU C C     1 
ATOM   8709  O O     . GLU C 1 266 ? 165.34207 243.16068 112.71101 1.000 108.90259 ?  266 GLU C O     1 
ATOM   8710  C CB    . GLU C 1 266 ? 166.98904 243.45073 115.70276 1.000 98.71740  ?  266 GLU C CB    1 
ATOM   8711  C CG    . GLU C 1 266 ? 166.70720 242.83062 117.10649 1.000 109.81950 ?  266 GLU C CG    1 
ATOM   8712  C CD    . GLU C 1 266 ? 166.80270 243.82172 118.29635 1.000 125.60203 ?  266 GLU C CD    1 
ATOM   8713  O OE1   . GLU C 1 266 ? 167.59723 244.78451 118.21606 1.000 121.71376 ?  266 GLU C OE1   1 
ATOM   8714  O OE2   . GLU C 1 266 ? 166.09128 243.63965 119.31857 1.000 124.56174 ?  266 GLU C OE2   1 
ATOM   8715  N N     . GLU C 1 267 ? 167.50543 243.75181 112.61032 1.000 106.12967 ?  267 GLU C N     1 
ATOM   8716  C CA    . GLU C 1 267 ? 167.29775 244.53017 111.38928 1.000 107.43081 ?  267 GLU C CA    1 
ATOM   8717  C C     . GLU C 1 267 ? 166.70340 243.67689 110.28045 1.000 107.10154 ?  267 GLU C C     1 
ATOM   8718  O O     . GLU C 1 267 ? 165.85527 244.13407 109.49986 1.000 99.89375  ?  267 GLU C O     1 
ATOM   8719  C CB    . GLU C 1 267 ? 168.61660 245.12537 110.95390 1.000 113.41509 ?  267 GLU C CB    1 
ATOM   8720  C CG    . GLU C 1 267 ? 169.35655 245.67723 112.11691 1.000 121.36316 ?  267 GLU C CG    1 
ATOM   8721  C CD    . GLU C 1 267 ? 170.70315 246.13004 111.68875 1.000 136.82542 ?  267 GLU C CD    1 
ATOM   8722  O OE1   . GLU C 1 267 ? 170.98217 246.00321 110.47265 1.000 127.84382 ?  267 GLU C OE1   1 
ATOM   8723  O OE2   . GLU C 1 267 ? 171.46843 246.62104 112.54360 1.000 146.03897 ?  267 GLU C OE2   1 
ATOM   8724  N N     . GLU C 1 268 ? 167.20983 242.45041 110.15974 1.000 108.67576 ?  268 GLU C N     1 
ATOM   8725  C CA    . GLU C 1 268 ? 166.75508 241.50327 109.15112 1.000 103.44117 ?  268 GLU C CA    1 
ATOM   8726  C C     . GLU C 1 268 ? 165.32598 241.03060 109.42887 1.000 100.33840 ?  268 GLU C C     1 
ATOM   8727  O O     . GLU C 1 268 ? 164.49127 240.99262 108.51584 1.000 98.00557  ?  268 GLU C O     1 
ATOM   8728  C CB    . GLU C 1 268 ? 167.75113 240.34081 109.12163 1.000 99.83438  ?  268 GLU C CB    1 
ATOM   8729  C CG    . GLU C 1 268 ? 169.19642 240.78151 108.78860 1.000 97.55715  ?  268 GLU C CG    1 
ATOM   8730  C CD    . GLU C 1 268 ? 170.15962 239.60936 108.63878 1.000 95.53996  ?  268 GLU C CD    1 
ATOM   8731  O OE1   . GLU C 1 268 ? 169.81054 238.51374 109.11757 1.000 92.83352  ?  268 GLU C OE1   1 
ATOM   8732  O OE2   . GLU C 1 268 ? 171.24542 239.77062 108.03484 1.000 94.85082  ?  268 GLU C OE2   1 
ATOM   8733  N N     . ILE C 1 269 ? 165.01373 240.72743 110.69649 1.000 101.52181 ?  269 ILE C N     1 
ATOM   8734  C CA    . ILE C 1 269 ? 163.67017 240.27710 111.05592 1.000 102.98063 ?  269 ILE C CA    1 
ATOM   8735  C C     . ILE C 1 269 ? 162.65057 241.34491 110.68806 1.000 102.55394 ?  269 ILE C C     1 
ATOM   8736  O O     . ILE C 1 269 ? 161.61367 241.05705 110.07539 1.000 102.99385 ?  269 ILE C O     1 
ATOM   8737  C CB    . ILE C 1 269 ? 163.61343 239.93472 112.56315 1.000 103.94691 ?  269 ILE C CB    1 
ATOM   8738  C CG1   . ILE C 1 269 ? 164.35753 238.64286 112.88572 1.000 102.50323 ?  269 ILE C CG1   1 
ATOM   8739  C CG2   . ILE C 1 269 ? 162.19234 239.77319 113.03303 1.000 100.73350 ?  269 ILE C CG2   1 
ATOM   8740  C CD1   . ILE C 1 269 ? 163.79025 237.42252 112.18045 1.000 103.96949 ?  269 ILE C CD1   1 
ATOM   8741  N N     . ARG C 1 270 ? 162.95944 242.60273 111.01022 1.000 101.58220 ?  270 ARG C N     1 
ATOM   8742  C CA    . ARG C 1 270 ? 162.09323 243.70876 110.62587 1.000 102.45209 ?  270 ARG C CA    1 
ATOM   8743  C C     . ARG C 1 270 ? 161.99611 243.82154 109.10553 1.000 100.55689 ?  270 ARG C C     1 
ATOM   8744  O O     . ARG C 1 270 ? 160.91349 244.08247 108.56321 1.000 96.85530  ?  270 ARG C O     1 
ATOM   8745  C CB    . ARG C 1 270 ? 162.60711 245.00847 111.25661 1.000 104.29717 ?  270 ARG C CB    1 
ATOM   8746  C CG    . ARG C 1 270 ? 161.63090 246.18481 111.15688 1.000 112.24060 ?  270 ARG C CG    1 
ATOM   8747  C CD    . ARG C 1 270 ? 162.02031 247.40399 112.01272 1.000 116.75217 ?  270 ARG C CD    1 
ATOM   8748  N NE    . ARG C 1 270 ? 160.90561 248.34148 112.18893 1.000 134.12534 ?  270 ARG C NE    1 
ATOM   8749  C CZ    . ARG C 1 270 ? 160.02045 248.29417 113.18274 1.000 140.05212 ?  270 ARG C CZ    1 
ATOM   8750  N NH1   . ARG C 1 270 ? 160.08759 247.36579 114.12251 1.000 142.07824 ?  270 ARG C NH1   1 
ATOM   8751  N NH2   . ARG C 1 270 ? 159.05086 249.20983 113.24296 1.000 129.06209 ?  270 ARG C NH2   1 
ATOM   8752  N N     . ARG C 1 271 ? 163.11464 243.60265 108.40385 1.000 98.16798  ?  271 ARG C N     1 
ATOM   8753  C CA    . ARG C 1 271 ? 163.13205 243.75710 106.95123 1.000 100.77144 ?  271 ARG C CA    1 
ATOM   8754  C C     . ARG C 1 271 ? 162.22090 242.73724 106.27753 1.000 102.55103 ?  271 ARG C C     1 
ATOM   8755  O O     . ARG C 1 271 ? 161.41719 243.07973 105.40244 1.000 105.87126 ?  271 ARG C O     1 
ATOM   8756  C CB    . ARG C 1 271 ? 164.56105 243.61597 106.42795 1.000 99.12853  ?  271 ARG C CB    1 
ATOM   8757  C CG    . ARG C 1 271 ? 164.74204 243.91594 104.93879 1.000 97.26982  ?  271 ARG C CG    1 
ATOM   8758  C CD    . ARG C 1 271 ? 166.19678 243.77027 104.61240 1.000 99.46005  ?  271 ARG C CD    1 
ATOM   8759  N NE    . ARG C 1 271 ? 166.96425 244.59308 105.54180 1.000 102.44141 ?  271 ARG C NE    1 
ATOM   8760  C CZ    . ARG C 1 271 ? 168.28046 244.54000 105.68847 1.000 104.69946 ?  271 ARG C CZ    1 
ATOM   8761  N NH1   . ARG C 1 271 ? 169.02306 243.72225 104.96206 1.000 103.60473 ?  271 ARG C NH1   1 
ATOM   8762  N NH2   . ARG C 1 271 ? 168.86016 245.28706 106.62366 1.000 106.96649 ?  271 ARG C NH2   1 
ATOM   8763  N N     . MET C 1 272 ? 162.32180 241.47779 106.68057 1.000 100.19534 ?  272 MET C N     1 
ATOM   8764  C CA    . MET C 1 272 ? 161.54570 240.43977 106.02131 1.000 101.68416 ?  272 MET C CA    1 
ATOM   8765  C C     . MET C 1 272 ? 160.10253 240.39046 106.50394 1.000 104.87430 ?  272 MET C C     1 
ATOM   8766  O O     . MET C 1 272 ? 159.25239 239.78404 105.84489 1.000 103.65990 ?  272 MET C O     1 
ATOM   8767  C CB    . MET C 1 272 ? 162.24285 239.08685 106.20469 1.000 102.90297 ?  272 MET C CB    1 
ATOM   8768  C CG    . MET C 1 272 ? 162.38055 238.62399 107.62505 1.000 104.83309 ?  272 MET C CG    1 
ATOM   8769  S SD    . MET C 1 272 ? 163.17677 237.02349 107.63711 1.000 111.31044 ?  272 MET C SD    1 
ATOM   8770  C CE    . MET C 1 272 ? 162.04953 236.05043 106.64520 1.000 101.10007 ?  272 MET C CE    1 
ATOM   8771  N N     . PHE C 1 273 ? 159.79658 241.00017 107.64230 1.000 108.90762 ?  273 PHE C N     1 
ATOM   8772  C CA    . PHE C 1 273 ? 158.45022 240.88923 108.17301 1.000 113.47786 ?  273 PHE C CA    1 
ATOM   8773  C C     . PHE C 1 273 ? 157.69222 242.21129 108.09644 1.000 118.89124 ?  273 PHE C C     1 
ATOM   8774  O O     . PHE C 1 273 ? 156.80426 242.46746 108.92047 1.000 114.13318 ?  273 PHE C O     1 
ATOM   8775  C CB    . PHE C 1 273 ? 158.52368 240.35031 109.60095 1.000 110.46325 ?  273 PHE C CB    1 
ATOM   8776  C CG    . PHE C 1 273 ? 158.67576 238.85570 109.65881 1.000 112.75469 ?  273 PHE C CG    1 
ATOM   8777  C CD1   . PHE C 1 273 ? 157.66122 238.02368 109.21528 1.000 118.76229 ?  273 PHE C CD1   1 
ATOM   8778  C CD2   . PHE C 1 273 ? 159.84528 238.28406 110.13641 1.000 111.80912 ?  273 PHE C CD2   1 
ATOM   8779  C CE1   . PHE C 1 273 ? 157.81141 236.65198 109.25653 1.000 117.79478 ?  273 PHE C CE1   1 
ATOM   8780  C CE2   . PHE C 1 273 ? 159.99640 236.91184 110.18021 1.000 110.73035 ?  273 PHE C CE2   1 
ATOM   8781  C CZ    . PHE C 1 273 ? 158.97736 236.09832 109.74084 1.000 108.34249 ?  273 PHE C CZ    1 
ATOM   8782  N N     . GLU C 1 274 ? 158.03554 243.05330 107.12481 1.000 124.93550 ?  274 GLU C N     1 
ATOM   8783  C CA    . GLU C 1 274 ? 157.35469 244.32832 106.95993 1.000 129.13261 ?  274 GLU C CA    1 
ATOM   8784  C C     . GLU C 1 274 ? 155.87250 244.10306 106.66565 1.000 134.37012 ?  274 GLU C C     1 
ATOM   8785  O O     . GLU C 1 274 ? 155.52893 243.25149 105.81972 1.000 128.55179 ?  274 GLU C O     1 
ATOM   8786  C CB    . GLU C 1 274 ? 158.01442 245.13654 105.84126 1.000 120.48554 ?  274 GLU C CB    1 
ATOM   8787  C CG    . GLU C 1 274 ? 157.45219 246.52763 105.65793 1.000 118.69302 ?  274 GLU C CG    1 
ATOM   8788  C CD    . GLU C 1 274 ? 157.93283 247.48732 106.72324 1.000 124.18203 ?  274 GLU C CD    1 
ATOM   8789  O OE1   . GLU C 1 274 ? 158.90921 247.15351 107.42192 1.000 127.56118 ?  274 GLU C OE1   1 
ATOM   8790  O OE2   . GLU C 1 274 ? 157.33366 248.57329 106.86352 1.000 130.19863 ?  274 GLU C OE2   1 
ATOM   8791  N N     . PRO C 1 275 ? 154.97236 244.80082 107.36069 1.000 133.25093 ?  275 PRO C N     1 
ATOM   8792  C CA    . PRO C 1 275 ? 153.53567 244.59936 107.13885 1.000 128.38726 ?  275 PRO C CA    1 
ATOM   8793  C C     . PRO C 1 275 ? 153.08023 245.24339 105.83689 1.000 127.61247 ?  275 PRO C C     1 
ATOM   8794  O O     . PRO C 1 275 ? 153.75676 246.09620 105.26076 1.000 126.00205 ?  275 PRO C O     1 
ATOM   8795  C CB    . PRO C 1 275 ? 152.89438 245.26848 108.36075 1.000 125.20371 ?  275 PRO C CB    1 
ATOM   8796  C CG    . PRO C 1 275 ? 153.89086 246.32079 108.75971 1.000 133.43543 ?  275 PRO C CG    1 
ATOM   8797  C CD    . PRO C 1 275 ? 155.24431 245.73612 108.46517 1.000 127.99205 ?  275 PRO C CD    1 
ATOM   8798  N N     . GLY C 1 276 ? 151.89216 244.84948 105.38669 1.000 126.70066 ?  276 GLY C N     1 
ATOM   8799  C CA    . GLY C 1 276 ? 151.38523 245.35195 104.13145 1.000 123.58663 ?  276 GLY C CA    1 
ATOM   8800  C C     . GLY C 1 276 ? 151.72042 244.50236 102.92989 1.000 119.53051 ?  276 GLY C C     1 
ATOM   8801  O O     . GLY C 1 276 ? 151.29480 244.83209 101.81990 1.000 127.63191 ?  276 GLY C O     1 
ATOM   8802  N N     . GLN C 1 277 ? 152.56457 243.50113 103.08017 1.000 118.14279 ?  277 GLN C N     1 
ATOM   8803  C CA    . GLN C 1 277 ? 152.84967 242.57093 102.00000 1.000 123.88539 ?  277 GLN C CA    1 
ATOM   8804  C C     . GLN C 1 277 ? 152.02895 241.30126 102.16204 1.000 123.93173 ?  277 GLN C C     1 
ATOM   8805  O O     . GLN C 1 277 ? 151.95426 240.74427 103.26524 1.000 125.49143 ?  277 GLN C O     1 
ATOM   8806  C CB    . GLN C 1 277 ? 154.34052 242.28748 101.94968 1.000 126.57003 ?  277 GLN C CB    1 
ATOM   8807  C CG    . GLN C 1 277 ? 155.01880 243.31238 101.07741 1.000 122.41705 ?  277 GLN C CG    1 
ATOM   8808  C CD    . GLN C 1 277 ? 155.09648 244.67793 101.75363 1.000 127.74750 ?  277 GLN C CD    1 
ATOM   8809  O OE1   . GLN C 1 277 ? 155.42097 244.78325 102.94235 1.000 129.19299 ?  277 GLN C OE1   1 
ATOM   8810  N NE2   . GLN C 1 277 ? 154.82615 245.72799 100.98942 1.000 120.85774 ?  277 GLN C NE2   1 
ATOM   8811  N N     . GLU C 1 278 ? 151.35735 240.89678 101.08324 1.000 119.40772 ?  278 GLU C N     1 
ATOM   8812  C CA    . GLU C 1 278 ? 150.46788 239.73314 101.08939 1.000 122.78128 ?  278 GLU C CA    1 
ATOM   8813  C C     . GLU C 1 278 ? 151.25570 238.41762 101.08296 1.000 124.12031 ?  278 GLU C C     1 
ATOM   8814  O O     . GLU C 1 278 ? 151.13939 237.59165 100.17813 1.000 119.96920 ?  278 GLU C O     1 
ATOM   8815  C CB    . GLU C 1 278 ? 149.52370 239.78779 99.89609  1.000 126.63093 ?  278 GLU C CB    1 
ATOM   8816  C CG    . GLU C 1 278 ? 148.56005 240.94719 99.91158  1.000 127.52487 ?  278 GLU C CG    1 
ATOM   8817  C CD    . GLU C 1 278 ? 147.58545 240.91058 98.75915  1.000 133.07069 ?  278 GLU C CD    1 
ATOM   8818  O OE1   . GLU C 1 278 ? 147.99486 240.52133 97.64494  1.000 136.37725 ?  278 GLU C OE1   1 
ATOM   8819  O OE2   . GLU C 1 278 ? 146.41445 241.28893 98.97086  1.000 132.11551 ?  278 GLU C OE2   1 
ATOM   8820  N N     . THR C 1 279 ? 152.10596 238.25115 102.09648 1.000 130.39834 ?  279 THR C N     1 
ATOM   8821  C CA    . THR C 1 279 ? 152.81239 236.98324 102.26685 1.000 124.67889 ?  279 THR C CA    1 
ATOM   8822  C C     . THR C 1 279 ? 151.85096 235.85424 102.59382 1.000 128.98357 ?  279 THR C C     1 
ATOM   8823  O O     . THR C 1 279 ? 152.02057 234.72727 102.10969 1.000 129.77142 ?  279 THR C O     1 
ATOM   8824  C CB    . THR C 1 279 ? 153.84523 237.08691 103.38614 1.000 117.01895 ?  279 THR C CB    1 
ATOM   8825  O OG1   . THR C 1 279 ? 154.71503 238.19426 103.13821 1.000 117.98440 ?  279 THR C OG1   1 
ATOM   8826  C CG2   . THR C 1 279 ? 154.64898 235.79976 103.52684 1.000 114.78689 ?  279 THR C CG2   1 
ATOM   8827  N N     . ALA C 1 280 ? 150.83589 236.14029 103.41249 1.000 128.75876 ?  280 ALA C N     1 
ATOM   8828  C CA    . ALA C 1 280 ? 149.93198 235.08835 103.85702 1.000 129.39388 ?  280 ALA C CA    1 
ATOM   8829  C C     . ALA C 1 280 ? 148.95889 234.64912 102.75635 1.000 130.93552 ?  280 ALA C C     1 
ATOM   8830  O O     . ALA C 1 280 ? 148.51965 233.48961 102.76523 1.000 130.44130 ?  280 ALA C O     1 
ATOM   8831  C CB    . ALA C 1 280 ? 149.18199 235.55907 105.10498 1.000 119.54476 ?  280 ALA C CB    1 
ATOM   8832  N N     . VAL C 1 281 ? 148.62985 235.52599 101.80849 1.000 127.14233 ?  281 VAL C N     1 
ATOM   8833  C CA    . VAL C 1 281 ? 147.62758 235.19633 100.78222 1.000 124.73110 ?  281 VAL C CA    1 
ATOM   8834  C C     . VAL C 1 281 ? 148.17851 234.11618 99.86372  1.000 125.45320 ?  281 VAL C C     1 
ATOM   8835  O O     . VAL C 1 281 ? 149.27701 234.29205 99.31097  1.000 128.64245 ?  281 VAL C O     1 
ATOM   8836  C CB    . VAL C 1 281 ? 147.25979 236.43467 99.98004  1.000 128.03322 ?  281 VAL C CB    1 
ATOM   8837  C CG1   . VAL C 1 281 ? 146.13733 236.09820 99.00142  1.000 130.45238 ?  281 VAL C CG1   1 
ATOM   8838  C CG2   . VAL C 1 281 ? 146.84527 237.56145 100.90645 1.000 129.42359 ?  281 VAL C CG2   1 
ATOM   8839  N N     . PRO C 1 282 ? 147.42888 233.03858 99.59621  1.000 127.85067 ?  282 PRO C N     1 
ATOM   8840  C CA    . PRO C 1 282 ? 148.00927 231.93975 98.80467  1.000 131.08457 ?  282 PRO C CA    1 
ATOM   8841  C C     . PRO C 1 282 ? 148.37700 232.38160 97.40122  1.000 133.94174 ?  282 PRO C C     1 
ATOM   8842  O O     . PRO C 1 282 ? 149.47825 232.08753 96.91476  1.000 135.91472 ?  282 PRO C O     1 
ATOM   8843  C CB    . PRO C 1 282 ? 146.89310 230.88693 98.79388  1.000 126.71069 ?  282 PRO C CB    1 
ATOM   8844  C CG    . PRO C 1 282 ? 146.06110 231.20404 99.99847  1.000 128.82419 ?  282 PRO C CG    1 
ATOM   8845  C CD    . PRO C 1 282 ? 146.08849 232.70270 100.10885 1.000 127.65769 ?  282 PRO C CD    1 
ATOM   8846  N N     . HIS C 1 283 ? 147.48526 233.10822 96.73737  1.000 129.91195 ?  283 HIS C N     1 
ATOM   8847  C CA    . HIS C 1 283 ? 147.74434 233.60955 95.39816  1.000 126.51847 ?  283 HIS C CA    1 
ATOM   8848  C C     . HIS C 1 283 ? 147.70306 235.11560 95.51428  1.000 129.44348 ?  283 HIS C C     1 
ATOM   8849  O O     . HIS C 1 283 ? 146.70419 235.68053 95.96733  1.000 130.70670 ?  283 HIS C O     1 
ATOM   8850  C CB    . HIS C 1 283 ? 146.72912 233.09131 94.39335  1.000 12