data_8I1B
# 
_entry.id   8I1B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   8I1B         
WWPDB D_1000179978 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        8I1B 
_pdbx_database_status.recvd_initial_deposition_date   1991-01-29 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ohlendorf, D.H.' 1 
'Weber, P.C.'     2 
'Salemme, F.R.'   3 
# 
_citation.id                        primary 
_citation.title                     'A Comparison of the High Resolution Structures of Human and Murine Interleukin-1B' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ohlendorf, D.H.'  1 
primary 'Treharne, A.C.'   2 
primary 'Weber, P.C.'      3 
primary 'Wendoloski, J.J.' 4 
primary 'Salemme, F.R.'    5 
# 
_cell.entry_id           8I1B 
_cell.length_a           55.710 
_cell.length_b           55.710 
_cell.length_c           79.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         8I1B 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'INTERLEUKIN-1 BETA' 17415.877 1  ? ? ? ? 
2 water   nat water                18.015    86 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTL
QLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTL
QLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   PRO n 
1 3   ILE n 
1 4   ARG n 
1 5   GLN n 
1 6   LEU n 
1 7   HIS n 
1 8   TYR n 
1 9   ARG n 
1 10  LEU n 
1 11  ARG n 
1 12  ASP n 
1 13  GLU n 
1 14  GLN n 
1 15  GLN n 
1 16  LYS n 
1 17  SER n 
1 18  LEU n 
1 19  VAL n 
1 20  LEU n 
1 21  SER n 
1 22  ASP n 
1 23  PRO n 
1 24  TYR n 
1 25  GLU n 
1 26  LEU n 
1 27  LYS n 
1 28  ALA n 
1 29  LEU n 
1 30  HIS n 
1 31  LEU n 
1 32  ASN n 
1 33  GLY n 
1 34  GLN n 
1 35  ASN n 
1 36  ILE n 
1 37  ASN n 
1 38  GLN n 
1 39  GLN n 
1 40  VAL n 
1 41  ILE n 
1 42  PHE n 
1 43  SER n 
1 44  MET n 
1 45  SER n 
1 46  PHE n 
1 47  VAL n 
1 48  GLN n 
1 49  GLY n 
1 50  GLU n 
1 51  PRO n 
1 52  SER n 
1 53  ASN n 
1 54  ASP n 
1 55  LYS n 
1 56  ILE n 
1 57  PRO n 
1 58  VAL n 
1 59  ALA n 
1 60  LEU n 
1 61  GLY n 
1 62  LEU n 
1 63  LYS n 
1 64  GLY n 
1 65  LYS n 
1 66  ASN n 
1 67  LEU n 
1 68  TYR n 
1 69  LEU n 
1 70  SER n 
1 71  CYS n 
1 72  VAL n 
1 73  MET n 
1 74  LYS n 
1 75  ASP n 
1 76  GLY n 
1 77  THR n 
1 78  PRO n 
1 79  THR n 
1 80  LEU n 
1 81  GLN n 
1 82  LEU n 
1 83  GLU n 
1 84  SER n 
1 85  VAL n 
1 86  ASP n 
1 87  PRO n 
1 88  LYS n 
1 89  GLN n 
1 90  TYR n 
1 91  PRO n 
1 92  LYS n 
1 93  LYS n 
1 94  LYS n 
1 95  MET n 
1 96  GLU n 
1 97  LYS n 
1 98  ARG n 
1 99  PHE n 
1 100 VAL n 
1 101 PHE n 
1 102 ASN n 
1 103 LYS n 
1 104 ILE n 
1 105 GLU n 
1 106 VAL n 
1 107 LYS n 
1 108 SER n 
1 109 LYS n 
1 110 VAL n 
1 111 GLU n 
1 112 PHE n 
1 113 GLU n 
1 114 SER n 
1 115 ALA n 
1 116 GLU n 
1 117 PHE n 
1 118 PRO n 
1 119 ASN n 
1 120 TRP n 
1 121 TYR n 
1 122 ILE n 
1 123 SER n 
1 124 THR n 
1 125 SER n 
1 126 GLN n 
1 127 ALA n 
1 128 GLU n 
1 129 HIS n 
1 130 LYS n 
1 131 PRO n 
1 132 VAL n 
1 133 PHE n 
1 134 LEU n 
1 135 GLY n 
1 136 ASN n 
1 137 ASN n 
1 138 SER n 
1 139 GLY n 
1 140 GLN n 
1 141 ASP n 
1 142 ILE n 
1 143 ILE n 
1 144 ASP n 
1 145 PHE n 
1 146 THR n 
1 147 MET n 
1 148 GLU n 
1 149 SER n 
1 150 VAL n 
1 151 SER n 
1 152 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IL1B_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P10749 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MATVPELNCEMPPFDSDENDLFFEVDGPQKMKGCFQTFDLGCPDESIQLQISQQHINKSFRQAVSLIVAVEKLWQLPVSF
PWTFQDEDMSTFFSFIFEEEPILCDSWDDDDNLLVCDVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFS
MSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYIS
TSQAEHKPVFLGNNSGQDIIDFTMESVSS
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              8I1B 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 152 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P10749 
_struct_ref_seq.db_align_beg                  118 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  269 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       153 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          8I1B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.52 
_exptl_crystal.density_percent_sol   65.03 
_exptl_crystal.description           ? 
# 
_refine.entry_id                                 8I1B 
_refine.ls_number_reflns_obs                     6771 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             5.0 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1590000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1190 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             86 
_refine_hist.number_atoms_total               1276 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        5.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.021 0.030 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.038 0.040 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.038 0.050 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         1.047 1.000 ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        1.917 2.000 ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         1.521 1.500 ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        2.551 3.000 ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.015 0.030 ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.260 0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.217 0.500 ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.253 0.500 ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      0.220 0.500 ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.454410 -0.688380 0.565370  0.227770  0.523790 0.820830 -0.861180 0.501770 -0.081230 29.25200 7.63800  -1.70600  
2 given ? -0.454410 0.227770  -0.861180 -0.688380 0.523790 0.501770 0.565370  0.820830 -0.082130 10.08300 16.99200 -22.94600 
# 
_struct.entry_id                  8I1B 
_struct.title                     'A COMPARISON OF THE HIGH RESOLUTION STRUCTURES OF HUMAN AND MURINE INTERLEUKIN-1B' 
_struct.pdbx_descriptor           'INTERLEUKIN 1-BETA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        8I1B 
_struct_keywords.pdbx_keywords   CYTOKINE 
_struct_keywords.text            CYTOKINE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       HA 
_struct_conf.beg_label_comp_id       GLY 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        33 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        38 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLY 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         33 
_struct_conf.end_auth_comp_id        GLN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         38 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 'MOTIF A LOOP 3 (KINKED)' 
_struct_conf.pdbx_PDB_helix_length   6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           90 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            90 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    91 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     91 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.29 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
SA1 ? 1 ? 
SA2 ? 1 ? 
SA3 ? 1 ? 
SA4 ? 1 ? 
SB1 ? 1 ? 
SB2 ? 1 ? 
SB3 ? 1 ? 
SB4 ? 1 ? 
SC1 ? 1 ? 
SC2 ? 1 ? 
SC3 ? 1 ? 
SC4 ? 1 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
SA1 1 LEU A 6   ? ASP A 12  ? LEU A 6   ASP A 12  
SA2 1 SER A 17  ? SER A 21  ? SER A 17  SER A 21  
SA3 1 GLU A 25  ? LEU A 29  ? GLU A 25  LEU A 29  
SA4 1 PHE A 42  ? PHE A 46  ? PHE A 42  PHE A 46  
SB1 1 LYS A 55  ? LEU A 62  ? LYS A 55  LEU A 62  
SB2 1 LEU A 67  ? LYS A 74  ? LEU A 67  LYS A 74  
SB3 1 THR A 77  ? SER A 84  ? THR A 77  SER A 84  
SB4 1 VAL A 100 ? VAL A 106 ? VAL A 100 VAL A 106 
SC1 1 LYS A 109 ? SER A 114 ? LYS A 109 SER A 114 
SC2 1 TYR A 121 ? SER A 123 ? TYR A 121 SER A 123 
SC3 1 LYS A 130 ? GLY A 135 ? LYS A 130 GLY A 135 
SC4 1 PHE A 145 ? SER A 149 ? PHE A 146 SER A 150 
# 
_database_PDB_matrix.entry_id          8I1B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    8I1B 
_atom_sites.fract_transf_matrix[1][1]   0.017950 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017950 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012658 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'PRO 91 IS A CIS PROLINE.'                                                                                           
2 'SOLVENT MOLECULES 201, 202 AND 204 COORDINATE THE INTERSECTIONS OF THREE BETA STRANDS.'                             
3 'GLN 14, ILE 36, LYS 93 AND VAL 110 SIDECHAINS HAVE BEEN MODELED IN TWO ALTERNATE CONFORMATIONS OF EQUAL OCCUPANCY.' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 5   ? 11.266  21.347 12.809  1.00 29.76 ? 5   GLN A N   1 
ATOM   2    C CA  . GLN A 1 5   ? 10.621  20.458 11.793  1.00 29.92 ? 5   GLN A CA  1 
ATOM   3    C C   . GLN A 1 5   ? 9.198   20.875 11.434  1.00 29.22 ? 5   GLN A C   1 
ATOM   4    O O   . GLN A 1 5   ? 8.316   20.795 12.268  1.00 29.59 ? 5   GLN A O   1 
ATOM   5    C CB  . GLN A 1 5   ? 10.742  18.979 12.060  1.00 31.02 ? 5   GLN A CB  1 
ATOM   6    C CG  . GLN A 1 5   ? 12.173  18.444 11.964  1.00 32.03 ? 5   GLN A CG  1 
ATOM   7    C CD  . GLN A 1 5   ? 12.222  16.933 12.056  1.00 33.27 ? 5   GLN A CD  1 
ATOM   8    O OE1 . GLN A 1 5   ? 11.763  16.308 13.026  1.00 34.30 ? 5   GLN A OE1 1 
ATOM   9    N NE2 . GLN A 1 5   ? 12.821  16.359 10.988  1.00 32.46 ? 5   GLN A NE2 1 
ATOM   10   N N   . LEU A 1 6   ? 9.031   21.387 10.224  1.00 28.17 ? 6   LEU A N   1 
ATOM   11   C CA  . LEU A 1 6   ? 7.749   21.815 9.676   1.00 27.76 ? 6   LEU A CA  1 
ATOM   12   C C   . LEU A 1 6   ? 7.283   20.616 8.793   1.00 27.09 ? 6   LEU A C   1 
ATOM   13   O O   . LEU A 1 6   ? 8.164   20.020 8.184   1.00 26.38 ? 6   LEU A O   1 
ATOM   14   C CB  . LEU A 1 6   ? 7.913   23.120 8.911   1.00 27.84 ? 6   LEU A CB  1 
ATOM   15   C CG  . LEU A 1 6   ? 8.516   24.308 9.626   1.00 28.30 ? 6   LEU A CG  1 
ATOM   16   C CD1 . LEU A 1 6   ? 8.457   25.498 8.597   1.00 28.94 ? 6   LEU A CD1 1 
ATOM   17   C CD2 . LEU A 1 6   ? 7.640   24.713 10.812  1.00 27.15 ? 6   LEU A CD2 1 
ATOM   18   N N   . HIS A 1 7   ? 6.010   20.325 8.805   1.00 26.49 ? 7   HIS A N   1 
ATOM   19   C CA  . HIS A 1 7   ? 5.439   19.210 8.056   1.00 25.75 ? 7   HIS A CA  1 
ATOM   20   C C   . HIS A 1 7   ? 4.622   19.689 6.858   1.00 24.66 ? 7   HIS A C   1 
ATOM   21   O O   . HIS A 1 7   ? 3.945   20.684 6.987   1.00 23.88 ? 7   HIS A O   1 
ATOM   22   C CB  . HIS A 1 7   ? 4.561   18.273 8.971   1.00 26.45 ? 7   HIS A CB  1 
ATOM   23   C CG  . HIS A 1 7   ? 5.500   17.682 9.972   1.00 28.41 ? 7   HIS A CG  1 
ATOM   24   N ND1 . HIS A 1 7   ? 5.524   17.948 11.316  1.00 29.04 ? 7   HIS A ND1 1 
ATOM   25   C CD2 . HIS A 1 7   ? 6.607   16.928 9.740   1.00 29.39 ? 7   HIS A CD2 1 
ATOM   26   C CE1 . HIS A 1 7   ? 6.539   17.399 11.883  1.00 28.47 ? 7   HIS A CE1 1 
ATOM   27   N NE2 . HIS A 1 7   ? 7.212   16.757 10.975  1.00 29.10 ? 7   HIS A NE2 1 
ATOM   28   N N   . TYR A 1 8   ? 4.817   18.993 5.718   1.00 24.00 ? 8   TYR A N   1 
ATOM   29   C CA  . TYR A 1 8   ? 4.100   19.352 4.518   1.00 24.04 ? 8   TYR A CA  1 
ATOM   30   C C   . TYR A 1 8   ? 3.908   18.211 3.527   1.00 23.42 ? 8   TYR A C   1 
ATOM   31   O O   . TYR A 1 8   ? 4.589   17.186 3.637   1.00 23.69 ? 8   TYR A O   1 
ATOM   32   C CB  . TYR A 1 8   ? 4.789   20.449 3.735   1.00 27.10 ? 8   TYR A CB  1 
ATOM   33   C CG  . TYR A 1 8   ? 5.246   21.676 4.425   1.00 28.80 ? 8   TYR A CG  1 
ATOM   34   C CD1 . TYR A 1 8   ? 6.496   21.719 5.020   1.00 28.95 ? 8   TYR A CD1 1 
ATOM   35   C CD2 . TYR A 1 8   ? 4.455   22.842 4.400   1.00 30.88 ? 8   TYR A CD2 1 
ATOM   36   C CE1 . TYR A 1 8   ? 6.963   22.871 5.636   1.00 30.23 ? 8   TYR A CE1 1 
ATOM   37   C CE2 . TYR A 1 8   ? 4.937   24.043 4.987   1.00 31.42 ? 8   TYR A CE2 1 
ATOM   38   C CZ  . TYR A 1 8   ? 6.188   24.022 5.595   1.00 31.04 ? 8   TYR A CZ  1 
ATOM   39   O OH  . TYR A 1 8   ? 6.626   25.144 6.212   1.00 32.27 ? 8   TYR A OH  1 
ATOM   40   N N   . ARG A 1 9   ? 2.970   18.415 2.645   1.00 22.99 ? 9   ARG A N   1 
ATOM   41   C CA  . ARG A 1 9   ? 2.652   17.505 1.528   1.00 22.58 ? 9   ARG A CA  1 
ATOM   42   C C   . ARG A 1 9   ? 3.037   18.374 0.307   1.00 22.09 ? 9   ARG A C   1 
ATOM   43   O O   . ARG A 1 9   ? 2.970   19.623 0.374   1.00 21.93 ? 9   ARG A O   1 
ATOM   44   C CB  . ARG A 1 9   ? 1.269   17.055 1.432   1.00 25.33 ? 9   ARG A CB  1 
ATOM   45   C CG  . ARG A 1 9   ? 0.512   16.462 2.591   1.00 29.63 ? 9   ARG A CG  1 
ATOM   46   C CD  . ARG A 1 9   ? -0.724  15.672 2.123   1.00 32.25 ? 9   ARG A CD  1 
ATOM   47   N NE  . ARG A 1 9   ? -1.351  15.011 3.255   1.00 34.68 ? 9   ARG A NE  1 
ATOM   48   C CZ  . ARG A 1 9   ? -2.067  15.542 4.257   1.00 35.56 ? 9   ARG A CZ  1 
ATOM   49   N NH1 . ARG A 1 9   ? -2.397  16.831 4.366   1.00 34.66 ? 9   ARG A NH1 1 
ATOM   50   N NH2 . ARG A 1 9   ? -2.293  14.704 5.324   1.00 35.37 ? 9   ARG A NH2 1 
ATOM   51   N N   . LEU A 1 10  ? 3.522   17.730 -0.712  1.00 21.78 ? 10  LEU A N   1 
ATOM   52   C CA  . LEU A 1 10  ? 3.951   18.443 -1.933  1.00 20.72 ? 10  LEU A CA  1 
ATOM   53   C C   . LEU A 1 10  ? 3.093   17.988 -3.099  1.00 19.88 ? 10  LEU A C   1 
ATOM   54   O O   . LEU A 1 10  ? 2.720   16.805 -3.087  1.00 20.54 ? 10  LEU A O   1 
ATOM   55   C CB  . LEU A 1 10  ? 5.421   18.041 -2.190  1.00 20.82 ? 10  LEU A CB  1 
ATOM   56   C CG  . LEU A 1 10  ? 6.480   18.610 -1.247  1.00 21.53 ? 10  LEU A CG  1 
ATOM   57   C CD1 . LEU A 1 10  ? 7.851   18.108 -1.784  1.00 22.04 ? 10  LEU A CD1 1 
ATOM   58   C CD2 . LEU A 1 10  ? 6.435   20.132 -1.415  1.00 21.48 ? 10  LEU A CD2 1 
ATOM   59   N N   . ARG A 1 11  ? 2.875   18.897 -3.995  1.00 19.42 ? 11  ARG A N   1 
ATOM   60   C CA  . ARG A 1 11  ? 2.124   18.668 -5.237  1.00 19.48 ? 11  ARG A CA  1 
ATOM   61   C C   . ARG A 1 11  ? 2.882   19.401 -6.346  1.00 19.17 ? 11  ARG A C   1 
ATOM   62   O O   . ARG A 1 11  ? 3.376   20.523 -5.980  1.00 19.36 ? 11  ARG A O   1 
ATOM   63   C CB  . ARG A 1 11  ? 0.649   18.956 -5.289  1.00 19.30 ? 11  ARG A CB  1 
ATOM   64   C CG  . ARG A 1 11  ? -0.185  17.987 -4.515  1.00 21.95 ? 11  ARG A CG  1 
ATOM   65   C CD  . ARG A 1 11  ? -1.618  17.862 -4.951  1.00 24.99 ? 11  ARG A CD  1 
ATOM   66   N NE  . ARG A 1 11  ? -2.390  18.717 -4.053  1.00 27.56 ? 11  ARG A NE  1 
ATOM   67   C CZ  . ARG A 1 11  ? -2.615  18.397 -2.776  1.00 28.42 ? 11  ARG A CZ  1 
ATOM   68   N NH1 . ARG A 1 11  ? -2.275  17.257 -2.232  1.00 29.03 ? 11  ARG A NH1 1 
ATOM   69   N NH2 . ARG A 1 11  ? -3.011  19.420 -2.006  1.00 29.22 ? 11  ARG A NH2 1 
ATOM   70   N N   . ASP A 1 12  ? 2.944   18.791 -7.491  1.00 18.69 ? 12  ASP A N   1 
ATOM   71   C CA  . ASP A 1 12  ? 3.640   19.379 -8.637  1.00 19.90 ? 12  ASP A CA  1 
ATOM   72   C C   . ASP A 1 12  ? 2.755   20.399 -9.318  1.00 21.12 ? 12  ASP A C   1 
ATOM   73   O O   . ASP A 1 12  ? 1.542   20.555 -8.952  1.00 21.71 ? 12  ASP A O   1 
ATOM   74   C CB  . ASP A 1 12  ? 4.430   18.384 -9.488  1.00 19.59 ? 12  ASP A CB  1 
ATOM   75   C CG  . ASP A 1 12  ? 3.507   17.685 -10.510 1.00 20.44 ? 12  ASP A CG  1 
ATOM   76   O OD1 . ASP A 1 12  ? 2.372   18.165 -10.741 1.00 20.03 ? 12  ASP A OD1 1 
ATOM   77   O OD2 . ASP A 1 12  ? 3.972   16.666 -11.065 1.00 20.38 ? 12  ASP A OD2 1 
ATOM   78   N N   . GLU A 1 13  ? 3.306   21.184 -10.246 1.00 21.91 ? 13  GLU A N   1 
ATOM   79   C CA  . GLU A 1 13  ? 2.552   22.242 -10.921 1.00 22.88 ? 13  GLU A CA  1 
ATOM   80   C C   . GLU A 1 13  ? 1.325   21.705 -11.629 1.00 22.34 ? 13  GLU A C   1 
ATOM   81   O O   . GLU A 1 13  ? 0.292   22.411 -11.696 1.00 22.49 ? 13  GLU A O   1 
ATOM   82   C CB  . GLU A 1 13  ? 3.289   23.202 -11.762 1.00 26.35 ? 13  GLU A CB  1 
ATOM   83   C CG  . GLU A 1 13  ? 3.882   22.832 -13.105 1.00 31.04 ? 13  GLU A CG  1 
ATOM   84   C CD  . GLU A 1 13  ? 4.628   23.990 -13.727 1.00 35.34 ? 13  GLU A CD  1 
ATOM   85   O OE1 . GLU A 1 13  ? 4.523   25.137 -13.256 1.00 37.89 ? 13  GLU A OE1 1 
ATOM   86   O OE2 . GLU A 1 13  ? 5.344   23.681 -14.716 1.00 36.52 ? 13  GLU A OE2 1 
ATOM   87   N N   . GLN A 1 14  ? 1.398   20.491 -12.084 1.00 21.97 ? 14  GLN A N   1 
ATOM   88   C CA  . GLN A 1 14  ? 0.311   19.803 -12.746 1.00 22.06 ? 14  GLN A CA  1 
ATOM   89   C C   . GLN A 1 14  ? -0.612  19.128 -11.751 1.00 22.03 ? 14  GLN A C   1 
ATOM   90   O O   . GLN A 1 14  ? -1.389  18.296 -12.236 1.00 21.97 ? 14  GLN A O   1 
ATOM   91   C CB  . GLN A 1 14  ? 0.757   18.782 -13.809 1.00 22.80 ? 14  GLN A CB  1 
ATOM   92   C CG  A GLN A 1 14  ? 1.721   19.481 -14.784 0.50 25.37 ? 14  GLN A CG  1 
ATOM   93   C CG  B GLN A 1 14  ? 1.605   19.460 -14.885 0.50 22.27 ? 14  GLN A CG  1 
ATOM   94   C CD  A GLN A 1 14  ? 1.358   19.087 -16.204 0.50 27.04 ? 14  GLN A CD  1 
ATOM   95   C CD  B GLN A 1 14  ? 0.790   20.402 -15.738 0.50 21.63 ? 14  GLN A CD  1 
ATOM   96   O OE1 A GLN A 1 14  ? 0.170   18.933 -16.483 0.50 27.68 ? 14  GLN A OE1 1 
ATOM   97   O OE1 B GLN A 1 14  ? -0.418  20.220 -15.880 0.50 21.91 ? 14  GLN A OE1 1 
ATOM   98   N NE2 A GLN A 1 14  ? 2.373   18.930 -17.029 0.50 28.48 ? 14  GLN A NE2 1 
ATOM   99   N NE2 B GLN A 1 14  ? 1.433   21.408 -16.297 0.50 21.42 ? 14  GLN A NE2 1 
ATOM   100  N N   . GLN A 1 15  ? -0.518  19.409 -10.485 1.00 22.18 ? 15  GLN A N   1 
ATOM   101  C CA  . GLN A 1 15  ? -1.358  18.817 -9.463  1.00 22.74 ? 15  GLN A CA  1 
ATOM   102  C C   . GLN A 1 15  ? -1.177  17.333 -9.206  1.00 22.31 ? 15  GLN A C   1 
ATOM   103  O O   . GLN A 1 15  ? -2.134  16.689 -8.709  1.00 21.66 ? 15  GLN A O   1 
ATOM   104  C CB  . GLN A 1 15  ? -2.832  19.172 -9.708  1.00 26.09 ? 15  GLN A CB  1 
ATOM   105  C CG  . GLN A 1 15  ? -3.137  20.648 -9.766  1.00 29.41 ? 15  GLN A CG  1 
ATOM   106  C CD  . GLN A 1 15  ? -3.224  21.346 -8.427  1.00 32.03 ? 15  GLN A CD  1 
ATOM   107  O OE1 . GLN A 1 15  ? -2.748  20.897 -7.340  1.00 32.76 ? 15  GLN A OE1 1 
ATOM   108  N NE2 . GLN A 1 15  ? -3.891  22.509 -8.502  1.00 32.45 ? 15  GLN A NE2 1 
ATOM   109  N N   . LYS A 1 16  ? -0.031  16.766 -9.479  1.00 22.27 ? 16  LYS A N   1 
ATOM   110  C CA  . LYS A 1 16  ? 0.246   15.330 -9.150  1.00 22.88 ? 16  LYS A CA  1 
ATOM   111  C C   . LYS A 1 16  ? 0.702   15.313 -7.666  1.00 22.86 ? 16  LYS A C   1 
ATOM   112  O O   . LYS A 1 16  ? 1.286   16.303 -7.209  1.00 22.57 ? 16  LYS A O   1 
ATOM   113  C CB  . LYS A 1 16  ? 1.302   14.619 -10.010 1.00 21.85 ? 16  LYS A CB  1 
ATOM   114  C CG  . LYS A 1 16  ? 0.794   14.626 -11.508 1.00 21.64 ? 16  LYS A CG  1 
ATOM   115  C CD  . LYS A 1 16  ? 1.424   13.536 -12.305 1.00 22.99 ? 16  LYS A CD  1 
ATOM   116  C CE  . LYS A 1 16  ? 2.936   13.665 -12.542 1.00 22.65 ? 16  LYS A CE  1 
ATOM   117  N NZ  . LYS A 1 16  ? 3.292   14.986 -13.089 1.00 21.40 ? 16  LYS A NZ  1 
ATOM   118  N N   . SER A 1 17  ? 0.366   14.273 -6.951  1.00 22.88 ? 17  SER A N   1 
ATOM   119  C CA  . SER A 1 17  ? 0.698   14.114 -5.527  1.00 23.11 ? 17  SER A CA  1 
ATOM   120  C C   . SER A 1 17  ? 1.809   13.080 -5.408  1.00 23.63 ? 17  SER A C   1 
ATOM   121  O O   . SER A 1 17  ? 1.944   12.172 -6.274  1.00 23.42 ? 17  SER A O   1 
ATOM   122  C CB  . SER A 1 17  ? -0.530  13.691 -4.767  1.00 23.21 ? 17  SER A CB  1 
ATOM   123  O OG  . SER A 1 17  ? -1.550  14.684 -4.829  1.00 23.99 ? 17  SER A OG  1 
ATOM   124  N N   . LEU A 1 18  ? 2.539   13.201 -4.300  1.00 24.12 ? 18  LEU A N   1 
ATOM   125  C CA  . LEU A 1 18  ? 3.702   12.315 -4.050  1.00 24.50 ? 18  LEU A CA  1 
ATOM   126  C C   . LEU A 1 18  ? 3.368   11.166 -3.145  1.00 25.71 ? 18  LEU A C   1 
ATOM   127  O O   . LEU A 1 18  ? 2.743   11.348 -2.113  1.00 25.83 ? 18  LEU A O   1 
ATOM   128  C CB  . LEU A 1 18  ? 4.910   13.174 -3.694  1.00 22.53 ? 18  LEU A CB  1 
ATOM   129  C CG  . LEU A 1 18  ? 5.875   13.708 -4.706  1.00 21.04 ? 18  LEU A CG  1 
ATOM   130  C CD1 . LEU A 1 18  ? 5.298   14.355 -5.924  1.00 19.85 ? 18  LEU A CD1 1 
ATOM   131  C CD2 . LEU A 1 18  ? 6.784   14.794 -4.035  1.00 20.71 ? 18  LEU A CD2 1 
ATOM   132  N N   . VAL A 1 19  ? 3.801   9.975  -3.533  1.00 27.43 ? 19  VAL A N   1 
ATOM   133  C CA  . VAL A 1 19  ? 3.589   8.754  -2.733  1.00 29.57 ? 19  VAL A CA  1 
ATOM   134  C C   . VAL A 1 19  ? 4.887   7.943  -2.641  1.00 31.17 ? 19  VAL A C   1 
ATOM   135  O O   . VAL A 1 19  ? 5.787   8.051  -3.492  1.00 30.95 ? 19  VAL A O   1 
ATOM   136  C CB  . VAL A 1 19  ? 2.368   7.984  -3.298  1.00 29.03 ? 19  VAL A CB  1 
ATOM   137  C CG1 . VAL A 1 19  ? 1.101   8.795  -3.358  1.00 28.18 ? 19  VAL A CG1 1 
ATOM   138  C CG2 . VAL A 1 19  ? 2.650   7.343  -4.628  1.00 29.53 ? 19  VAL A CG2 1 
ATOM   139  N N   . LEU A 1 20  ? 4.983   7.111  -1.632  1.00 32.93 ? 20  LEU A N   1 
ATOM   140  C CA  . LEU A 1 20  ? 6.128   6.223  -1.385  1.00 34.88 ? 20  LEU A CA  1 
ATOM   141  C C   . LEU A 1 20  ? 5.838   4.850  -1.993  1.00 36.89 ? 20  LEU A C   1 
ATOM   142  O O   . LEU A 1 20  ? 4.764   4.289  -1.720  1.00 37.54 ? 20  LEU A O   1 
ATOM   143  C CB  . LEU A 1 20  ? 6.418   6.244  0.140   1.00 33.39 ? 20  LEU A CB  1 
ATOM   144  C CG  . LEU A 1 20  ? 7.631   5.508  0.692   1.00 33.03 ? 20  LEU A CG  1 
ATOM   145  C CD1 . LEU A 1 20  ? 8.957   5.936  0.055   1.00 31.82 ? 20  LEU A CD1 1 
ATOM   146  C CD2 . LEU A 1 20  ? 7.749   5.624  2.198   1.00 31.76 ? 20  LEU A CD2 1 
ATOM   147  N N   . SER A 1 21  ? 6.717   4.303  -2.783  1.00 38.88 ? 21  SER A N   1 
ATOM   148  C CA  . SER A 1 21  ? 6.610   2.963  -3.387  1.00 41.55 ? 21  SER A CA  1 
ATOM   149  C C   . SER A 1 21  ? 7.800   2.083  -2.946  1.00 43.04 ? 21  SER A C   1 
ATOM   150  O O   . SER A 1 21  ? 8.982   2.503  -2.964  1.00 42.94 ? 21  SER A O   1 
ATOM   151  C CB  . SER A 1 21  ? 6.487   3.035  -4.895  1.00 42.92 ? 21  SER A CB  1 
ATOM   152  O OG  . SER A 1 21  ? 7.368   4.091  -5.377  1.00 43.81 ? 21  SER A OG  1 
ATOM   153  N N   . ASP A 1 22  ? 7.482   0.892  -2.503  1.00 44.45 ? 22  ASP A N   1 
ATOM   154  C CA  . ASP A 1 22  ? 8.223   -0.201 -1.970  1.00 45.66 ? 22  ASP A CA  1 
ATOM   155  C C   . ASP A 1 22  ? 9.736   -0.118 -1.919  1.00 45.66 ? 22  ASP A C   1 
ATOM   156  O O   . ASP A 1 22  ? 10.367  -0.189 -0.836  1.00 45.26 ? 22  ASP A O   1 
ATOM   157  C CB  . ASP A 1 22  ? 7.745   -1.576 -2.437  1.00 48.74 ? 22  ASP A CB  1 
ATOM   158  C CG  . ASP A 1 22  ? 7.105   -2.449 -1.387  1.00 50.62 ? 22  ASP A CG  1 
ATOM   159  O OD1 . ASP A 1 22  ? 6.421   -1.977 -0.463  1.00 51.44 ? 22  ASP A OD1 1 
ATOM   160  O OD2 . ASP A 1 22  ? 7.337   -3.707 -1.462  1.00 51.51 ? 22  ASP A OD2 1 
ATOM   161  N N   . PRO A 1 23  ? 10.327  -0.034 -3.098  1.00 45.69 ? 23  PRO A N   1 
ATOM   162  C CA  . PRO A 1 23  ? 11.782  0.076  -3.235  1.00 45.49 ? 23  PRO A CA  1 
ATOM   163  C C   . PRO A 1 23  ? 12.373  1.401  -2.788  1.00 45.13 ? 23  PRO A C   1 
ATOM   164  O O   . PRO A 1 23  ? 13.349  1.847  -3.482  1.00 45.41 ? 23  PRO A O   1 
ATOM   165  C CB  . PRO A 1 23  ? 12.006  -0.170 -4.737  1.00 45.70 ? 23  PRO A CB  1 
ATOM   166  C CG  . PRO A 1 23  ? 10.751  0.392  -5.369  1.00 45.85 ? 23  PRO A CG  1 
ATOM   167  C CD  . PRO A 1 23  ? 9.611   0.020  -4.401  1.00 45.80 ? 23  PRO A CD  1 
ATOM   168  N N   . TYR A 1 24  ? 11.877  2.032  -1.704  1.00 43.79 ? 24  TYR A N   1 
ATOM   169  C CA  . TYR A 1 24  ? 12.503  3.313  -1.255  1.00 41.67 ? 24  TYR A CA  1 
ATOM   170  C C   . TYR A 1 24  ? 12.425  4.326  -2.414  1.00 40.30 ? 24  TYR A C   1 
ATOM   171  O O   . TYR A 1 24  ? 13.443  4.983  -2.758  1.00 39.58 ? 24  TYR A O   1 
ATOM   172  C CB  . TYR A 1 24  ? 14.025  2.995  -1.142  1.00 42.24 ? 24  TYR A CB  1 
ATOM   173  C CG  . TYR A 1 24  ? 14.459  2.433  0.172   1.00 43.18 ? 24  TYR A CG  1 
ATOM   174  C CD1 . TYR A 1 24  ? 14.557  3.298  1.269   1.00 43.41 ? 24  TYR A CD1 1 
ATOM   175  C CD2 . TYR A 1 24  ? 14.780  1.082  0.367   1.00 42.91 ? 24  TYR A CD2 1 
ATOM   176  C CE1 . TYR A 1 24  ? 14.949  2.843  2.525   1.00 42.97 ? 24  TYR A CE1 1 
ATOM   177  C CE2 . TYR A 1 24  ? 15.184  0.618  1.605   1.00 42.45 ? 24  TYR A CE2 1 
ATOM   178  C CZ  . TYR A 1 24  ? 15.260  1.490  2.688   1.00 41.79 ? 24  TYR A CZ  1 
ATOM   179  O OH  . TYR A 1 24  ? 15.618  1.105  3.955   1.00 37.83 ? 24  TYR A OH  1 
ATOM   180  N N   . GLU A 1 25  ? 11.265  4.377  -3.009  1.00 39.13 ? 25  GLU A N   1 
ATOM   181  C CA  . GLU A 1 25  ? 11.042  5.269  -4.168  1.00 37.12 ? 25  GLU A CA  1 
ATOM   182  C C   . GLU A 1 25  ? 9.787   6.116  -4.043  1.00 35.01 ? 25  GLU A C   1 
ATOM   183  O O   . GLU A 1 25  ? 8.768   5.653  -3.497  1.00 35.89 ? 25  GLU A O   1 
ATOM   184  C CB  . GLU A 1 25  ? 10.849  4.329  -5.367  1.00 38.36 ? 25  GLU A CB  1 
ATOM   185  C CG  . GLU A 1 25  ? 10.803  4.930  -6.722  1.00 40.68 ? 25  GLU A CG  1 
ATOM   186  C CD  . GLU A 1 25  ? 11.022  3.966  -7.866  1.00 42.30 ? 25  GLU A CD  1 
ATOM   187  O OE1 . GLU A 1 25  ? 10.127  3.219  -8.244  1.00 42.25 ? 25  GLU A OE1 1 
ATOM   188  O OE2 . GLU A 1 25  ? 12.176  4.093  -8.338  1.00 42.41 ? 25  GLU A OE2 1 
ATOM   189  N N   . LEU A 1 26  ? 9.892   7.369  -4.493  1.00 31.84 ? 26  LEU A N   1 
ATOM   190  C CA  . LEU A 1 26  ? 8.824   8.328  -4.500  1.00 28.95 ? 26  LEU A CA  1 
ATOM   191  C C   . LEU A 1 26  ? 8.344   8.378  -5.975  1.00 27.34 ? 26  LEU A C   1 
ATOM   192  O O   . LEU A 1 26  ? 9.195   8.281  -6.821  1.00 26.00 ? 26  LEU A O   1 
ATOM   193  C CB  . LEU A 1 26  ? 9.143   9.682  -3.961  1.00 27.88 ? 26  LEU A CB  1 
ATOM   194  C CG  . LEU A 1 26  ? 9.640   10.020 -2.598  1.00 27.22 ? 26  LEU A CG  1 
ATOM   195  C CD1 . LEU A 1 26  ? 10.441  11.356 -2.619  1.00 25.66 ? 26  LEU A CD1 1 
ATOM   196  C CD2 . LEU A 1 26  ? 8.487   10.097 -1.608  1.00 26.82 ? 26  LEU A CD2 1 
ATOM   197  N N   . LYS A 1 27  ? 7.043   8.450  -6.111  1.00 27.31 ? 27  LYS A N   1 
ATOM   198  C CA  . LYS A 1 27  ? 6.378   8.537  -7.405  1.00 27.32 ? 27  LYS A CA  1 
ATOM   199  C C   . LYS A 1 27  ? 5.317   9.683  -7.242  1.00 25.93 ? 27  LYS A C   1 
ATOM   200  O O   . LYS A 1 27  ? 4.885   9.958  -6.136  1.00 25.79 ? 27  LYS A O   1 
ATOM   201  C CB  . LYS A 1 27  ? 5.612   7.394  -7.997  1.00 30.17 ? 27  LYS A CB  1 
ATOM   202  C CG  . LYS A 1 27  ? 6.005   5.961  -7.803  1.00 32.47 ? 27  LYS A CG  1 
ATOM   203  C CD  . LYS A 1 27  ? 6.102   5.210  -9.138  1.00 34.39 ? 27  LYS A CD  1 
ATOM   204  C CE  . LYS A 1 27  ? 7.199   4.110  -8.960  1.00 36.54 ? 27  LYS A CE  1 
ATOM   205  N NZ  . LYS A 1 27  ? 7.831   3.866  -10.334 1.00 37.62 ? 27  LYS A NZ  1 
ATOM   206  N N   . ALA A 1 28  ? 4.980   10.189 -8.378  1.00 24.90 ? 28  ALA A N   1 
ATOM   207  C CA  . ALA A 1 28  ? 3.977   11.284 -8.432  1.00 24.29 ? 28  ALA A CA  1 
ATOM   208  C C   . ALA A 1 28  ? 2.817   10.725 -9.290  1.00 24.44 ? 28  ALA A C   1 
ATOM   209  O O   . ALA A 1 28  ? 3.122   10.183 -10.390 1.00 24.92 ? 28  ALA A O   1 
ATOM   210  C CB  . ALA A 1 28  ? 4.596   12.531 -9.056  1.00 21.19 ? 28  ALA A CB  1 
ATOM   211  N N   . LEU A 1 29  ? 1.623   10.847 -8.765  1.00 23.97 ? 29  LEU A N   1 
ATOM   212  C CA  . LEU A 1 29  ? 0.449   10.398 -9.519  1.00 24.79 ? 29  LEU A CA  1 
ATOM   213  C C   . LEU A 1 29  ? -0.750  11.328 -9.294  1.00 24.30 ? 29  LEU A C   1 
ATOM   214  O O   . LEU A 1 29  ? -0.722  12.135 -8.379  1.00 24.15 ? 29  LEU A O   1 
ATOM   215  C CB  . LEU A 1 29  ? 0.229   8.919  -9.279  1.00 26.54 ? 29  LEU A CB  1 
ATOM   216  C CG  . LEU A 1 29  ? -0.242  8.291  -8.003  1.00 26.73 ? 29  LEU A CG  1 
ATOM   217  C CD1 . LEU A 1 29  ? 0.475   6.924  -7.843  1.00 27.07 ? 29  LEU A CD1 1 
ATOM   218  C CD2 . LEU A 1 29  ? 0.231   9.097  -6.805  1.00 27.52 ? 29  LEU A CD2 1 
ATOM   219  N N   . HIS A 1 30  ? -1.763  11.165 -10.148 1.00 23.87 ? 30  HIS A N   1 
ATOM   220  C CA  . HIS A 1 30  ? -2.971  11.964 -10.040 1.00 23.29 ? 30  HIS A CA  1 
ATOM   221  C C   . HIS A 1 30  ? -3.858  11.342 -8.989  1.00 23.52 ? 30  HIS A C   1 
ATOM   222  O O   . HIS A 1 30  ? -4.216  10.184 -9.227  1.00 24.16 ? 30  HIS A O   1 
ATOM   223  C CB  . HIS A 1 30  ? -3.740  12.309 -11.310 1.00 20.81 ? 30  HIS A CB  1 
ATOM   224  C CG  . HIS A 1 30  ? -3.113  13.445 -12.075 1.00 19.25 ? 30  HIS A CG  1 
ATOM   225  N ND1 . HIS A 1 30  ? -2.398  13.221 -13.225 1.00 19.19 ? 30  HIS A ND1 1 
ATOM   226  C CD2 . HIS A 1 30  ? -3.136  14.776 -11.887 1.00 18.91 ? 30  HIS A CD2 1 
ATOM   227  C CE1 . HIS A 1 30  ? -1.994  14.395 -13.729 1.00 19.48 ? 30  HIS A CE1 1 
ATOM   228  N NE2 . HIS A 1 30  ? -2.436  15.356 -12.962 1.00 20.60 ? 30  HIS A NE2 1 
ATOM   229  N N   . LEU A 1 31  ? -4.101  12.016 -7.912  1.00 23.68 ? 31  LEU A N   1 
ATOM   230  C CA  . LEU A 1 31  ? -4.937  11.575 -6.812  1.00 24.78 ? 31  LEU A CA  1 
ATOM   231  C C   . LEU A 1 31  ? -6.035  12.601 -6.590  1.00 26.13 ? 31  LEU A C   1 
ATOM   232  O O   . LEU A 1 31  ? -5.858  13.805 -6.881  1.00 26.29 ? 31  LEU A O   1 
ATOM   233  C CB  . LEU A 1 31  ? -4.117  11.286 -5.561  1.00 24.67 ? 31  LEU A CB  1 
ATOM   234  C CG  . LEU A 1 31  ? -3.065  10.194 -5.602  1.00 24.20 ? 31  LEU A CG  1 
ATOM   235  C CD1 . LEU A 1 31  ? -2.401  10.025 -4.224  1.00 22.94 ? 31  LEU A CD1 1 
ATOM   236  C CD2 . LEU A 1 31  ? -3.654  8.905  -6.141  1.00 22.61 ? 31  LEU A CD2 1 
ATOM   237  N N   . ASN A 1 32  ? -7.174  12.145 -6.149  1.00 28.06 ? 32  ASN A N   1 
ATOM   238  C CA  . ASN A 1 32  ? -8.336  13.056 -5.919  1.00 30.17 ? 32  ASN A CA  1 
ATOM   239  C C   . ASN A 1 32  ? -8.429  13.341 -4.441  1.00 31.32 ? 32  ASN A C   1 
ATOM   240  O O   . ASN A 1 32  ? -7.630  12.846 -3.643  1.00 31.54 ? 32  ASN A O   1 
ATOM   241  C CB  . ASN A 1 32  ? -9.515  12.549 -6.683  1.00 32.16 ? 32  ASN A CB  1 
ATOM   242  C CG  . ASN A 1 32  ? -10.274 11.374 -6.099  1.00 34.33 ? 32  ASN A CG  1 
ATOM   243  O OD1 . ASN A 1 32  ? -9.887  10.705 -5.136  1.00 35.85 ? 32  ASN A OD1 1 
ATOM   244  N ND2 . ASN A 1 32  ? -11.469 11.109 -6.672  1.00 35.12 ? 32  ASN A ND2 1 
ATOM   245  N N   . GLY A 1 33  ? -9.389  14.147 -4.060  1.00 32.93 ? 33  GLY A N   1 
ATOM   246  C CA  . GLY A 1 33  ? -9.651  14.545 -2.682  1.00 34.54 ? 33  GLY A CA  1 
ATOM   247  C C   . GLY A 1 33  ? -9.843  13.384 -1.753  1.00 36.25 ? 33  GLY A C   1 
ATOM   248  O O   . GLY A 1 33  ? -9.518  13.501 -0.561  1.00 37.10 ? 33  GLY A O   1 
ATOM   249  N N   . GLN A 1 34  ? -10.312 12.255 -2.206  1.00 37.57 ? 34  GLN A N   1 
ATOM   250  C CA  . GLN A 1 34  ? -10.569 11.031 -1.451  1.00 39.27 ? 34  GLN A CA  1 
ATOM   251  C C   . GLN A 1 34  ? -9.289  10.268 -1.161  1.00 40.31 ? 34  GLN A C   1 
ATOM   252  O O   . GLN A 1 34  ? -9.109  9.654  -0.079  1.00 41.29 ? 34  GLN A O   1 
ATOM   253  C CB  . GLN A 1 34  ? -11.500 10.079 -2.275  1.00 40.66 ? 34  GLN A CB  1 
ATOM   254  C CG  . GLN A 1 34  ? -12.891 10.640 -2.462  1.00 42.94 ? 34  GLN A CG  1 
ATOM   255  C CD  . GLN A 1 34  ? -13.624 10.134 -3.694  1.00 44.44 ? 34  GLN A CD  1 
ATOM   256  O OE1 . GLN A 1 34  ? -14.633 10.743 -4.101  1.00 44.44 ? 34  GLN A OE1 1 
ATOM   257  N NE2 . GLN A 1 34  ? -13.172 9.041  -4.323  1.00 43.79 ? 34  GLN A NE2 1 
ATOM   258  N N   . ASN A 1 35  ? -8.404  10.249 -2.156  1.00 40.49 ? 35  ASN A N   1 
ATOM   259  C CA  . ASN A 1 35  ? -7.133  9.498  -1.960  1.00 41.78 ? 35  ASN A CA  1 
ATOM   260  C C   . ASN A 1 35  ? -6.003  10.312 -1.458  1.00 41.62 ? 35  ASN A C   1 
ATOM   261  O O   . ASN A 1 35  ? -4.864  10.198 -1.920  1.00 42.30 ? 35  ASN A O   1 
ATOM   262  C CB  . ASN A 1 35  ? -6.934  8.654  -3.251  1.00 44.58 ? 35  ASN A CB  1 
ATOM   263  C CG  . ASN A 1 35  ? -7.817  7.413  -3.010  1.00 46.64 ? 35  ASN A CG  1 
ATOM   264  O OD1 . ASN A 1 35  ? -8.301  6.807  -3.936  1.00 48.59 ? 35  ASN A OD1 1 
ATOM   265  N ND2 . ASN A 1 35  ? -8.051  7.122  -1.705  1.00 46.86 ? 35  ASN A ND2 1 
ATOM   266  N N   . ILE A 1 36  ? -6.230  11.148 -0.497  1.00 41.52 ? 36  ILE A N   1 
ATOM   267  C CA  . ILE A 1 36  ? -5.207  12.074 0.051   1.00 41.09 ? 36  ILE A CA  1 
ATOM   268  C C   . ILE A 1 36  ? -4.423  11.408 1.118   1.00 40.67 ? 36  ILE A C   1 
ATOM   269  O O   . ILE A 1 36  ? -3.248  11.742 1.430   1.00 40.34 ? 36  ILE A O   1 
ATOM   270  C CB  . ILE A 1 36  ? -5.952  13.437 0.212   1.00 42.17 ? 36  ILE A CB  1 
ATOM   271  C CG1 . ILE A 1 36  ? -5.494  14.474 -0.866  1.00 42.21 ? 36  ILE A CG1 1 
ATOM   272  C CG2 . ILE A 1 36  ? -6.006  14.027 1.621   1.00 42.29 ? 36  ILE A CG2 1 
ATOM   273  C CD1 A ILE A 1 36  ? -6.025  15.913 -0.632  0.50 41.79 ? 36  ILE A CD1 1 
ATOM   274  C CD1 B ILE A 1 36  ? -5.109  13.895 -2.249  0.50 41.46 ? 36  ILE A CD1 1 
ATOM   275  N N   . ASN A 1 37  ? -4.922  10.341 1.675   1.00 40.47 ? 37  ASN A N   1 
ATOM   276  C CA  . ASN A 1 37  ? -4.344  9.521  2.732   1.00 40.29 ? 37  ASN A CA  1 
ATOM   277  C C   . ASN A 1 37  ? -2.980  8.961  2.415   1.00 39.33 ? 37  ASN A C   1 
ATOM   278  O O   . ASN A 1 37  ? -2.087  8.904  3.290   1.00 39.03 ? 37  ASN A O   1 
ATOM   279  C CB  . ASN A 1 37  ? -5.415  8.482  3.172   1.00 42.84 ? 37  ASN A CB  1 
ATOM   280  C CG  . ASN A 1 37  ? -6.458  8.237  2.076   1.00 44.72 ? 37  ASN A CG  1 
ATOM   281  O OD1 . ASN A 1 37  ? -6.439  7.170  1.393   1.00 46.39 ? 37  ASN A OD1 1 
ATOM   282  N ND2 . ASN A 1 37  ? -7.369  9.209  1.851   1.00 43.75 ? 37  ASN A ND2 1 
ATOM   283  N N   . GLN A 1 38  ? -2.754  8.494  1.208   1.00 38.54 ? 38  GLN A N   1 
ATOM   284  C CA  . GLN A 1 38  ? -1.554  7.896  0.695   1.00 37.31 ? 38  GLN A CA  1 
ATOM   285  C C   . GLN A 1 38  ? -0.311  8.760  0.459   1.00 35.33 ? 38  GLN A C   1 
ATOM   286  O O   . GLN A 1 38  ? 0.792   8.189  0.249   1.00 34.59 ? 38  GLN A O   1 
ATOM   287  C CB  . GLN A 1 38  ? -1.835  7.290  -0.718  1.00 39.47 ? 38  GLN A CB  1 
ATOM   288  C CG  . GLN A 1 38  ? -3.248  6.886  -0.927  1.00 42.17 ? 38  GLN A CG  1 
ATOM   289  C CD  . GLN A 1 38  ? -3.372  5.948  -2.110  1.00 44.40 ? 38  GLN A CD  1 
ATOM   290  O OE1 . GLN A 1 38  ? -4.333  5.177  -2.192  1.00 46.05 ? 38  GLN A OE1 1 
ATOM   291  N NE2 . GLN A 1 38  ? -2.361  6.007  -2.992  1.00 44.95 ? 38  GLN A NE2 1 
ATOM   292  N N   . GLN A 1 39  ? -0.477  10.046 0.318   1.00 33.95 ? 39  GLN A N   1 
ATOM   293  C CA  . GLN A 1 39  ? 0.601   11.003 0.064   1.00 31.70 ? 39  GLN A CA  1 
ATOM   294  C C   . GLN A 1 39  ? 1.655   11.003 1.184   1.00 29.91 ? 39  GLN A C   1 
ATOM   295  O O   . GLN A 1 39  ? 1.275   10.985 2.358   1.00 30.22 ? 39  GLN A O   1 
ATOM   296  C CB  . GLN A 1 39  ? -0.014  12.442 0.183   1.00 31.90 ? 39  GLN A CB  1 
ATOM   297  C CG  . GLN A 1 39  ? -0.836  12.777 -1.039  1.00 32.49 ? 39  GLN A CG  1 
ATOM   298  C CD  . GLN A 1 39  ? -0.732  14.292 -1.288  1.00 32.36 ? 39  GLN A CD  1 
ATOM   299  O OE1 . GLN A 1 39  ? -1.747  14.940 -1.224  1.00 32.56 ? 39  GLN A OE1 1 
ATOM   300  N NE2 . GLN A 1 39  ? 0.493   14.777 -1.608  1.00 30.39 ? 39  GLN A NE2 1 
ATOM   301  N N   . VAL A 1 40  ? 2.879   11.171 0.832   1.00 28.29 ? 40  VAL A N   1 
ATOM   302  C CA  . VAL A 1 40  ? 4.006   11.310 1.750   1.00 27.18 ? 40  VAL A CA  1 
ATOM   303  C C   . VAL A 1 40  ? 3.977   12.703 2.421   1.00 25.83 ? 40  VAL A C   1 
ATOM   304  O O   . VAL A 1 40  ? 3.784   13.760 1.794   1.00 25.44 ? 40  VAL A O   1 
ATOM   305  C CB  . VAL A 1 40  ? 5.351   11.222 0.930   1.00 27.75 ? 40  VAL A CB  1 
ATOM   306  C CG1 . VAL A 1 40  ? 6.563   11.116 1.872   1.00 28.70 ? 40  VAL A CG1 1 
ATOM   307  C CG2 . VAL A 1 40  ? 5.339   9.914  0.149   1.00 29.74 ? 40  VAL A CG2 1 
ATOM   308  N N   . ILE A 1 41  ? 4.185   12.668 3.720   1.00 24.61 ? 41  ILE A N   1 
ATOM   309  C CA  . ILE A 1 41  ? 4.338   13.890 4.499   1.00 23.56 ? 41  ILE A CA  1 
ATOM   310  C C   . ILE A 1 41  ? 5.879   14.002 4.744   1.00 23.14 ? 41  ILE A C   1 
ATOM   311  O O   . ILE A 1 41  ? 6.537   13.071 5.234   1.00 22.95 ? 41  ILE A O   1 
ATOM   312  C CB  . ILE A 1 41  ? 3.566   13.957 5.831   1.00 22.77 ? 41  ILE A CB  1 
ATOM   313  C CG1 . ILE A 1 41  ? 2.039   13.796 5.530   1.00 23.10 ? 41  ILE A CG1 1 
ATOM   314  C CG2 . ILE A 1 41  ? 3.860   15.243 6.640   1.00 21.87 ? 41  ILE A CG2 1 
ATOM   315  C CD1 . ILE A 1 41  ? 1.209   13.356 6.765   1.00 22.68 ? 41  ILE A CD1 1 
ATOM   316  N N   . PHE A 1 42  ? 6.344   15.179 4.426   1.00 22.33 ? 42  PHE A N   1 
ATOM   317  C CA  . PHE A 1 42  ? 7.739   15.571 4.583   1.00 21.44 ? 42  PHE A CA  1 
ATOM   318  C C   . PHE A 1 42  ? 7.888   16.531 5.792   1.00 21.42 ? 42  PHE A C   1 
ATOM   319  O O   . PHE A 1 42  ? 6.984   17.321 6.120   1.00 21.34 ? 42  PHE A O   1 
ATOM   320  C CB  . PHE A 1 42  ? 8.183   16.305 3.300   1.00 19.93 ? 42  PHE A CB  1 
ATOM   321  C CG  . PHE A 1 42  ? 8.100   15.618 1.987   1.00 17.81 ? 42  PHE A CG  1 
ATOM   322  C CD1 . PHE A 1 42  ? 9.187   14.869 1.519   1.00 17.40 ? 42  PHE A CD1 1 
ATOM   323  C CD2 . PHE A 1 42  ? 7.007   15.745 1.165   1.00 17.13 ? 42  PHE A CD2 1 
ATOM   324  C CE1 . PHE A 1 42  ? 9.168   14.293 0.243   1.00 16.28 ? 42  PHE A CE1 1 
ATOM   325  C CE2 . PHE A 1 42  ? 6.941   15.150 -0.080  1.00 16.01 ? 42  PHE A CE2 1 
ATOM   326  C CZ  . PHE A 1 42  ? 8.032   14.453 -0.558  1.00 15.39 ? 42  PHE A CZ  1 
ATOM   327  N N   . SER A 1 43  ? 9.057   16.433 6.388   1.00 21.48 ? 43  SER A N   1 
ATOM   328  C CA  . SER A 1 43  ? 9.540   17.202 7.487   1.00 21.90 ? 43  SER A CA  1 
ATOM   329  C C   . SER A 1 43  ? 10.659  18.109 6.950   1.00 21.84 ? 43  SER A C   1 
ATOM   330  O O   . SER A 1 43  ? 11.663  17.510 6.602   1.00 22.11 ? 43  SER A O   1 
ATOM   331  C CB  . SER A 1 43  ? 10.096  16.539 8.733   1.00 22.57 ? 43  SER A CB  1 
ATOM   332  O OG  . SER A 1 43  ? 9.100   15.598 9.155   1.00 25.71 ? 43  SER A OG  1 
ATOM   333  N N   . MET A 1 44  ? 10.404  19.399 6.971   1.00 21.85 ? 44  MET A N   1 
ATOM   334  C CA  . MET A 1 44  ? 11.403  20.365 6.483   1.00 21.83 ? 44  MET A CA  1 
ATOM   335  C C   . MET A 1 44  ? 12.092  20.986 7.672   1.00 21.86 ? 44  MET A C   1 
ATOM   336  O O   . MET A 1 44  ? 11.446  21.184 8.736   1.00 22.79 ? 44  MET A O   1 
ATOM   337  C CB  . MET A 1 44  ? 10.713  21.262 5.517   1.00 22.88 ? 44  MET A CB  1 
ATOM   338  C CG  . MET A 1 44  ? 11.674  22.166 4.812   1.00 25.47 ? 44  MET A CG  1 
ATOM   339  S SD  . MET A 1 44  ? 10.739  23.525 4.046   1.00 28.61 ? 44  MET A SD  1 
ATOM   340  C CE  . MET A 1 44  ? 9.786   22.655 2.794   1.00 28.52 ? 44  MET A CE  1 
ATOM   341  N N   . SER A 1 45  ? 13.367  21.232 7.605   1.00 21.13 ? 45  SER A N   1 
ATOM   342  C CA  . SER A 1 45  ? 14.156  21.832 8.682   1.00 21.03 ? 45  SER A CA  1 
ATOM   343  C C   . SER A 1 45  ? 15.269  22.656 8.046   1.00 22.07 ? 45  SER A C   1 
ATOM   344  O O   . SER A 1 45  ? 15.809  22.264 7.007   1.00 22.65 ? 45  SER A O   1 
ATOM   345  C CB  . SER A 1 45  ? 14.643  20.859 9.702   1.00 19.84 ? 45  SER A CB  1 
ATOM   346  O OG  . SER A 1 45  ? 15.666  20.008 9.334   1.00 20.48 ? 45  SER A OG  1 
ATOM   347  N N   . PHE A 1 46  ? 15.578  23.768 8.631   1.00 22.59 ? 46  PHE A N   1 
ATOM   348  C CA  . PHE A 1 46  ? 16.607  24.723 8.241   1.00 22.53 ? 46  PHE A CA  1 
ATOM   349  C C   . PHE A 1 46  ? 17.965  24.088 8.559   1.00 23.17 ? 46  PHE A C   1 
ATOM   350  O O   . PHE A 1 46  ? 18.145  23.498 9.596   1.00 23.18 ? 46  PHE A O   1 
ATOM   351  C CB  . PHE A 1 46  ? 16.384  26.051 9.000   1.00 20.41 ? 46  PHE A CB  1 
ATOM   352  C CG  . PHE A 1 46  ? 17.495  27.058 8.901   1.00 19.40 ? 46  PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 46  ? 18.613  27.007 9.713   1.00 18.61 ? 46  PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 46  ? 17.411  28.083 7.945   1.00 19.07 ? 46  PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 46  ? 19.653  27.934 9.581   1.00 17.62 ? 46  PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 46  ? 18.411  29.023 7.784   1.00 18.80 ? 46  PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 46  ? 19.515  28.954 8.638   1.00 17.92 ? 46  PHE A CZ  1 
ATOM   358  N N   . VAL A 1 47  ? 18.899  24.236 7.689   1.00 24.70 ? 47  VAL A N   1 
ATOM   359  C CA  . VAL A 1 47  ? 20.247  23.844 7.644   1.00 27.25 ? 47  VAL A CA  1 
ATOM   360  C C   . VAL A 1 47  ? 21.219  25.017 7.566   1.00 30.27 ? 47  VAL A C   1 
ATOM   361  O O   . VAL A 1 47  ? 21.009  25.963 6.795   1.00 30.73 ? 47  VAL A O   1 
ATOM   362  C CB  . VAL A 1 47  ? 20.496  22.913 6.387   1.00 25.73 ? 47  VAL A CB  1 
ATOM   363  C CG1 . VAL A 1 47  ? 22.031  22.580 6.339   1.00 26.00 ? 47  VAL A CG1 1 
ATOM   364  C CG2 . VAL A 1 47  ? 19.736  21.637 6.610   1.00 24.85 ? 47  VAL A CG2 1 
ATOM   365  N N   . GLN A 1 48  ? 22.292  24.918 8.357   1.00 33.96 ? 48  GLN A N   1 
ATOM   366  C CA  . GLN A 1 48  ? 23.305  26.045 8.235   1.00 37.93 ? 48  GLN A CA  1 
ATOM   367  C C   . GLN A 1 48  ? 23.761  25.985 6.773   1.00 41.05 ? 48  GLN A C   1 
ATOM   368  O O   . GLN A 1 48  ? 24.218  24.881 6.321   1.00 41.87 ? 48  GLN A O   1 
ATOM   369  C CB  . GLN A 1 48  ? 24.363  25.951 9.279   1.00 38.86 ? 48  GLN A CB  1 
ATOM   370  C CG  . GLN A 1 48  ? 23.813  25.804 10.706  1.00 40.73 ? 48  GLN A CG  1 
ATOM   371  C CD  . GLN A 1 48  ? 24.828  26.109 11.789  1.00 42.22 ? 48  GLN A CD  1 
ATOM   372  O OE1 . GLN A 1 48  ? 26.008  26.406 11.538  1.00 43.14 ? 48  GLN A OE1 1 
ATOM   373  N NE2 . GLN A 1 48  ? 24.379  26.056 13.066  1.00 41.69 ? 48  GLN A NE2 1 
ATOM   374  N N   . GLY A 1 49  ? 23.513  27.024 5.985   1.00 43.05 ? 49  GLY A N   1 
ATOM   375  C CA  . GLY A 1 49  ? 23.961  26.980 4.531   1.00 46.22 ? 49  GLY A CA  1 
ATOM   376  C C   . GLY A 1 49  ? 24.452  28.346 4.112   1.00 48.23 ? 49  GLY A C   1 
ATOM   377  O O   . GLY A 1 49  ? 24.879  29.082 5.049   1.00 49.43 ? 49  GLY A O   1 
ATOM   378  N N   . GLU A 1 50  ? 24.393  28.771 2.864   1.00 49.71 ? 50  GLU A N   1 
ATOM   379  C CA  . GLU A 1 50  ? 24.906  30.151 2.563   1.00 51.59 ? 50  GLU A CA  1 
ATOM   380  C C   . GLU A 1 50  ? 24.034  30.981 1.689   1.00 52.87 ? 50  GLU A C   1 
ATOM   381  O O   . GLU A 1 50  ? 22.852  30.608 1.405   1.00 53.17 ? 50  GLU A O   1 
ATOM   382  C CB  . GLU A 1 50  ? 26.358  30.134 2.200   1.00 52.24 ? 50  GLU A CB  1 
ATOM   383  C CG  . GLU A 1 50  ? 26.804  29.160 1.138   1.00 52.96 ? 50  GLU A CG  1 
ATOM   384  C CD  . GLU A 1 50  ? 26.517  27.697 1.352   1.00 53.20 ? 50  GLU A CD  1 
ATOM   385  O OE1 . GLU A 1 50  ? 26.145  27.403 2.519   1.00 52.57 ? 50  GLU A OE1 1 
ATOM   386  O OE2 . GLU A 1 50  ? 26.627  26.897 0.396   1.00 52.21 ? 50  GLU A OE2 1 
ATOM   387  N N   . PRO A 1 51  ? 24.516  32.160 1.283   1.00 53.66 ? 51  PRO A N   1 
ATOM   388  C CA  . PRO A 1 51  ? 23.871  33.171 0.493   1.00 53.76 ? 51  PRO A CA  1 
ATOM   389  C C   . PRO A 1 51  ? 22.630  32.934 -0.320  1.00 53.56 ? 51  PRO A C   1 
ATOM   390  O O   . PRO A 1 51  ? 22.411  31.967 -1.060  1.00 53.40 ? 51  PRO A O   1 
ATOM   391  C CB  . PRO A 1 51  ? 24.979  33.885 -0.284  1.00 53.86 ? 51  PRO A CB  1 
ATOM   392  C CG  . PRO A 1 51  ? 26.245  33.601 0.459   1.00 53.90 ? 51  PRO A CG  1 
ATOM   393  C CD  . PRO A 1 51  ? 25.871  32.684 1.625   1.00 54.07 ? 51  PRO A CD  1 
ATOM   394  N N   . SER A 1 52  ? 21.761  33.939 -0.185  1.00 53.11 ? 52  SER A N   1 
ATOM   395  C CA  . SER A 1 52  ? 20.495  34.152 -0.775  1.00 52.57 ? 52  SER A CA  1 
ATOM   396  C C   . SER A 1 52  ? 20.508  34.080 -2.305  1.00 52.60 ? 52  SER A C   1 
ATOM   397  O O   . SER A 1 52  ? 21.466  33.681 -2.971  1.00 52.97 ? 52  SER A O   1 
ATOM   398  C CB  . SER A 1 52  ? 19.771  35.410 -0.325  1.00 52.38 ? 52  SER A CB  1 
ATOM   399  O OG  . SER A 1 52  ? 20.583  36.475 0.147   1.00 50.84 ? 52  SER A OG  1 
ATOM   400  N N   . ASN A 1 53  ? 19.383  34.521 -2.814  1.00 52.20 ? 53  ASN A N   1 
ATOM   401  C CA  . ASN A 1 53  ? 19.047  34.507 -4.267  1.00 51.77 ? 53  ASN A CA  1 
ATOM   402  C C   . ASN A 1 53  ? 17.530  34.054 -4.146  1.00 51.07 ? 53  ASN A C   1 
ATOM   403  O O   . ASN A 1 53  ? 16.928  33.417 -5.005  1.00 51.45 ? 53  ASN A O   1 
ATOM   404  C CB  . ASN A 1 53  ? 19.784  33.373 -4.964  1.00 52.05 ? 53  ASN A CB  1 
ATOM   405  C CG  . ASN A 1 53  ? 21.027  33.743 -5.688  1.00 52.87 ? 53  ASN A CG  1 
ATOM   406  O OD1 . ASN A 1 53  ? 21.421  34.933 -5.689  1.00 54.25 ? 53  ASN A OD1 1 
ATOM   407  N ND2 . ASN A 1 53  ? 21.657  32.750 -6.305  1.00 52.08 ? 53  ASN A ND2 1 
ATOM   408  N N   . ASP A 1 54  ? 17.154  34.391 -2.903  1.00 49.62 ? 54  ASP A N   1 
ATOM   409  C CA  . ASP A 1 54  ? 15.801  34.028 -2.477  1.00 48.23 ? 54  ASP A CA  1 
ATOM   410  C C   . ASP A 1 54  ? 15.888  32.490 -2.187  1.00 45.39 ? 54  ASP A C   1 
ATOM   411  O O   . ASP A 1 54  ? 14.827  31.906 -2.546  1.00 46.01 ? 54  ASP A O   1 
ATOM   412  C CB  . ASP A 1 54  ? 14.719  34.211 -3.550  1.00 51.34 ? 54  ASP A CB  1 
ATOM   413  C CG  . ASP A 1 54  ? 14.963  35.217 -4.636  1.00 53.87 ? 54  ASP A CG  1 
ATOM   414  O OD1 . ASP A 1 54  ? 15.464  36.347 -4.443  1.00 54.28 ? 54  ASP A OD1 1 
ATOM   415  O OD2 . ASP A 1 54  ? 14.649  34.800 -5.810  1.00 54.84 ? 54  ASP A OD2 1 
ATOM   416  N N   . LYS A 1 55  ? 16.999  32.030 -1.635  1.00 41.48 ? 55  LYS A N   1 
ATOM   417  C CA  . LYS A 1 55  ? 17.051  30.569 -1.343  1.00 37.30 ? 55  LYS A CA  1 
ATOM   418  C C   . LYS A 1 55  ? 17.384  30.266 0.134   1.00 33.56 ? 55  LYS A C   1 
ATOM   419  O O   . LYS A 1 55  ? 18.403  30.764 0.617   1.00 33.26 ? 55  LYS A O   1 
ATOM   420  C CB  . LYS A 1 55  ? 18.089  29.843 -2.130  1.00 37.74 ? 55  LYS A CB  1 
ATOM   421  C CG  . LYS A 1 55  ? 18.422  30.262 -3.558  1.00 38.43 ? 55  LYS A CG  1 
ATOM   422  C CD  . LYS A 1 55  ? 19.599  29.447 -4.001  1.00 38.53 ? 55  LYS A CD  1 
ATOM   423  C CE  . LYS A 1 55  ? 20.154  29.707 -5.357  1.00 39.49 ? 55  LYS A CE  1 
ATOM   424  N NZ  . LYS A 1 55  ? 21.656  29.413 -5.199  1.00 42.16 ? 55  LYS A NZ  1 
ATOM   425  N N   . ILE A 1 56  ? 16.616  29.414 0.749   1.00 29.55 ? 56  ILE A N   1 
ATOM   426  C CA  . ILE A 1 56  ? 16.766  28.946 2.124   1.00 26.34 ? 56  ILE A CA  1 
ATOM   427  C C   . ILE A 1 56  ? 17.119  27.441 2.093   1.00 25.08 ? 56  ILE A C   1 
ATOM   428  O O   . ILE A 1 56  ? 16.432  26.575 1.503   1.00 24.19 ? 56  ILE A O   1 
ATOM   429  C CB  . ILE A 1 56  ? 15.430  29.261 2.900   1.00 24.43 ? 56  ILE A CB  1 
ATOM   430  C CG1 . ILE A 1 56  ? 15.088  30.782 2.783   1.00 22.51 ? 56  ILE A CG1 1 
ATOM   431  C CG2 . ILE A 1 56  ? 15.385  28.826 4.384   1.00 22.88 ? 56  ILE A CG2 1 
ATOM   432  C CD1 . ILE A 1 56  ? 13.700  31.144 3.391   1.00 21.24 ? 56  ILE A CD1 1 
ATOM   433  N N   . PRO A 1 57  ? 18.252  27.109 2.719   1.00 24.09 ? 57  PRO A N   1 
ATOM   434  C CA  . PRO A 1 57  ? 18.752  25.738 2.805   1.00 22.73 ? 57  PRO A CA  1 
ATOM   435  C C   . PRO A 1 57  ? 17.941  24.949 3.829   1.00 20.55 ? 57  PRO A C   1 
ATOM   436  O O   . PRO A 1 57  ? 17.842  25.344 4.999   1.00 20.14 ? 57  PRO A O   1 
ATOM   437  C CB  . PRO A 1 57  ? 20.221  25.843 3.287   1.00 22.93 ? 57  PRO A CB  1 
ATOM   438  C CG  . PRO A 1 57  ? 20.291  27.148 3.975   1.00 23.32 ? 57  PRO A CG  1 
ATOM   439  C CD  . PRO A 1 57  ? 19.156  28.038 3.450   1.00 23.90 ? 57  PRO A CD  1 
ATOM   440  N N   . VAL A 1 58  ? 17.498  23.810 3.343   1.00 18.89 ? 58  VAL A N   1 
ATOM   441  C CA  . VAL A 1 58  ? 16.701  22.900 4.180   1.00 17.44 ? 58  VAL A CA  1 
ATOM   442  C C   . VAL A 1 58  ? 17.024  21.459 3.858   1.00 16.95 ? 58  VAL A C   1 
ATOM   443  O O   . VAL A 1 58  ? 17.581  21.125 2.804   1.00 17.49 ? 58  VAL A O   1 
ATOM   444  C CB  . VAL A 1 58  ? 15.154  23.228 3.963   1.00 15.85 ? 58  VAL A CB  1 
ATOM   445  C CG1 . VAL A 1 58  ? 14.776  24.624 4.408   1.00 14.12 ? 58  VAL A CG1 1 
ATOM   446  C CG2 . VAL A 1 58  ? 14.740  22.974 2.531   1.00 14.06 ? 58  VAL A CG2 1 
ATOM   447  N N   . ALA A 1 59  ? 16.631  20.590 4.753   1.00 16.81 ? 59  ALA A N   1 
ATOM   448  C CA  . ALA A 1 59  ? 16.731  19.122 4.565   1.00 16.04 ? 59  ALA A CA  1 
ATOM   449  C C   . ALA A 1 59  ? 15.267  18.641 4.507   1.00 15.82 ? 59  ALA A C   1 
ATOM   450  O O   . ALA A 1 59  ? 14.384  19.224 5.169   1.00 16.36 ? 59  ALA A O   1 
ATOM   451  C CB  . ALA A 1 59  ? 17.464  18.474 5.689   1.00 16.11 ? 59  ALA A CB  1 
ATOM   452  N N   . LEU A 1 60  ? 15.043  17.600 3.767   1.00 16.10 ? 60  LEU A N   1 
ATOM   453  C CA  . LEU A 1 60  ? 13.675  17.007 3.655   1.00 16.44 ? 60  LEU A CA  1 
ATOM   454  C C   . LEU A 1 60  ? 13.673  15.579 4.121   1.00 17.26 ? 60  LEU A C   1 
ATOM   455  O O   . LEU A 1 60  ? 14.330  14.747 3.482   1.00 17.97 ? 60  LEU A O   1 
ATOM   456  C CB  . LEU A 1 60  ? 13.242  17.192 2.193   1.00 13.99 ? 60  LEU A CB  1 
ATOM   457  C CG  . LEU A 1 60  ? 13.127  18.622 1.714   1.00 12.52 ? 60  LEU A CG  1 
ATOM   458  C CD1 . LEU A 1 60  ? 13.058  18.709 0.206   1.00 12.27 ? 60  LEU A CD1 1 
ATOM   459  C CD2 . LEU A 1 60  ? 11.909  19.219 2.383   1.00 12.61 ? 60  LEU A CD2 1 
ATOM   460  N N   . GLY A 1 61  ? 12.968  15.250 5.170   1.00 18.20 ? 61  GLY A N   1 
ATOM   461  C CA  . GLY A 1 61  ? 12.832  13.899 5.689   1.00 18.54 ? 61  GLY A CA  1 
ATOM   462  C C   . GLY A 1 61  ? 11.370  13.492 5.498   1.00 19.79 ? 61  GLY A C   1 
ATOM   463  O O   . GLY A 1 61  ? 10.501  14.254 5.030   1.00 19.09 ? 61  GLY A O   1 
ATOM   464  N N   . LEU A 1 62  ? 11.192  12.177 5.809   1.00 20.79 ? 62  LEU A N   1 
ATOM   465  C CA  . LEU A 1 62  ? 9.813   11.599 5.767   1.00 21.02 ? 62  LEU A CA  1 
ATOM   466  C C   . LEU A 1 62  ? 9.344   11.663 7.249   1.00 21.36 ? 62  LEU A C   1 
ATOM   467  O O   . LEU A 1 62  ? 10.030  11.131 8.118   1.00 22.13 ? 62  LEU A O   1 
ATOM   468  C CB  . LEU A 1 62  ? 9.868   10.172 5.287   1.00 20.39 ? 62  LEU A CB  1 
ATOM   469  C CG  . LEU A 1 62  ? 9.474   9.884  3.878   1.00 21.06 ? 62  LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 62  ? 10.493  10.275 2.881   1.00 21.22 ? 62  LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 62  ? 9.207   8.382  3.751   1.00 21.16 ? 62  LEU A CD2 1 
ATOM   472  N N   . LYS A 1 63  ? 8.203   12.262 7.468   1.00 21.80 ? 63  LYS A N   1 
ATOM   473  C CA  . LYS A 1 63  ? 7.646   12.382 8.810   1.00 22.07 ? 63  LYS A CA  1 
ATOM   474  C C   . LYS A 1 63  ? 7.646   11.019 9.507   1.00 22.33 ? 63  LYS A C   1 
ATOM   475  O O   . LYS A 1 63  ? 7.220   9.993  8.994   1.00 22.24 ? 63  LYS A O   1 
ATOM   476  C CB  . LYS A 1 63  ? 6.235   12.934 8.651   1.00 22.30 ? 63  LYS A CB  1 
ATOM   477  C CG  . LYS A 1 63  ? 5.441   12.829 9.921   1.00 24.63 ? 63  LYS A CG  1 
ATOM   478  C CD  . LYS A 1 63  ? 4.798   14.056 10.398  1.00 28.83 ? 63  LYS A CD  1 
ATOM   479  C CE  . LYS A 1 63  ? 3.787   13.837 11.520  1.00 31.80 ? 63  LYS A CE  1 
ATOM   480  N NZ  . LYS A 1 63  ? 2.757   12.879 10.937  1.00 35.15 ? 63  LYS A NZ  1 
ATOM   481  N N   . GLY A 1 64  ? 8.082   10.959 10.734  1.00 22.91 ? 64  GLY A N   1 
ATOM   482  C CA  . GLY A 1 64  ? 8.121   9.775  11.576  1.00 23.13 ? 64  GLY A CA  1 
ATOM   483  C C   . GLY A 1 64  ? 9.192   8.800  11.173  1.00 23.58 ? 64  GLY A C   1 
ATOM   484  O O   . GLY A 1 64  ? 9.216   7.733  11.793  1.00 24.27 ? 64  GLY A O   1 
ATOM   485  N N   . LYS A 1 65  ? 10.079  9.166  10.253  1.00 23.35 ? 65  LYS A N   1 
ATOM   486  C CA  . LYS A 1 65  ? 11.134  8.249  9.819   1.00 22.97 ? 65  LYS A CA  1 
ATOM   487  C C   . LYS A 1 65  ? 12.540  8.809  9.723   1.00 23.04 ? 65  LYS A C   1 
ATOM   488  O O   . LYS A 1 65  ? 12.765  10.029 9.522   1.00 24.11 ? 65  LYS A O   1 
ATOM   489  C CB  . LYS A 1 65  ? 10.815  7.743  8.410   1.00 21.99 ? 65  LYS A CB  1 
ATOM   490  C CG  . LYS A 1 65  ? 9.418   7.231  8.310   1.00 21.66 ? 65  LYS A CG  1 
ATOM   491  C CD  . LYS A 1 65  ? 9.176   6.559  6.938   1.00 22.51 ? 65  LYS A CD  1 
ATOM   492  C CE  . LYS A 1 65  ? 7.957   5.695  7.198   1.00 25.14 ? 65  LYS A CE  1 
ATOM   493  N NZ  . LYS A 1 65  ? 8.038   4.421  6.476   1.00 28.21 ? 65  LYS A NZ  1 
ATOM   494  N N   . ASN A 1 66  ? 13.472  7.890  9.801   1.00 21.79 ? 66  ASN A N   1 
ATOM   495  C CA  . ASN A 1 66  ? 14.912  8.179  9.682   1.00 21.23 ? 66  ASN A CA  1 
ATOM   496  C C   . ASN A 1 66  ? 15.268  7.995  8.195   1.00 20.64 ? 66  ASN A C   1 
ATOM   497  O O   . ASN A 1 66  ? 16.199  7.243  7.919   1.00 20.72 ? 66  ASN A O   1 
ATOM   498  C CB  . ASN A 1 66  ? 15.752  7.280  10.591  1.00 21.61 ? 66  ASN A CB  1 
ATOM   499  C CG  . ASN A 1 66  ? 15.701  5.775  10.333  1.00 20.16 ? 66  ASN A CG  1 
ATOM   500  O OD1 . ASN A 1 66  ? 14.740  5.118  10.065  1.00 19.27 ? 66  ASN A OD1 1 
ATOM   501  N ND2 . ASN A 1 66  ? 16.888  5.160  10.447  1.00 21.51 ? 66  ASN A ND2 1 
ATOM   502  N N   . LEU A 1 67  ? 14.475  8.596  7.342   1.00 20.19 ? 67  LEU A N   1 
ATOM   503  C CA  . LEU A 1 67  ? 14.631  8.555  5.889   1.00 19.02 ? 67  LEU A CA  1 
ATOM   504  C C   . LEU A 1 67  ? 14.686  10.012 5.404   1.00 19.25 ? 67  LEU A C   1 
ATOM   505  O O   . LEU A 1 67  ? 13.678  10.736 5.723   1.00 19.83 ? 67  LEU A O   1 
ATOM   506  C CB  . LEU A 1 67  ? 13.479  7.786  5.256   1.00 17.55 ? 67  LEU A CB  1 
ATOM   507  C CG  . LEU A 1 67  ? 13.395  6.279  5.318   1.00 18.03 ? 67  LEU A CG  1 
ATOM   508  C CD1 . LEU A 1 67  ? 12.305  5.670  4.435   1.00 16.70 ? 67  LEU A CD1 1 
ATOM   509  C CD2 . LEU A 1 67  ? 14.744  5.658  4.890   1.00 17.74 ? 67  LEU A CD2 1 
ATOM   510  N N   . TYR A 1 68  ? 15.735  10.380 4.692   1.00 18.43 ? 68  TYR A N   1 
ATOM   511  C CA  . TYR A 1 68  ? 15.922  11.711 4.157   1.00 18.26 ? 68  TYR A CA  1 
ATOM   512  C C   . TYR A 1 68  ? 16.352  11.641 2.674   1.00 18.28 ? 68  TYR A C   1 
ATOM   513  O O   . TYR A 1 68  ? 17.151  10.750 2.331   1.00 18.37 ? 68  TYR A O   1 
ATOM   514  C CB  . TYR A 1 68  ? 17.161  12.463 4.830   1.00 18.35 ? 68  TYR A CB  1 
ATOM   515  C CG  . TYR A 1 68  ? 16.800  12.951 6.179   1.00 19.63 ? 68  TYR A CG  1 
ATOM   516  C CD1 . TYR A 1 68  ? 16.814  12.114 7.292   1.00 21.05 ? 68  TYR A CD1 1 
ATOM   517  C CD2 . TYR A 1 68  ? 16.349  14.275 6.357   1.00 21.14 ? 68  TYR A CD2 1 
ATOM   518  C CE1 . TYR A 1 68  ? 16.475  12.581 8.566   1.00 22.37 ? 68  TYR A CE1 1 
ATOM   519  C CE2 . TYR A 1 68  ? 15.960  14.774 7.611   1.00 21.94 ? 68  TYR A CE2 1 
ATOM   520  C CZ  . TYR A 1 68  ? 16.044  13.897 8.684   1.00 24.00 ? 68  TYR A CZ  1 
ATOM   521  O OH  . TYR A 1 68  ? 15.629  14.292 9.937   1.00 28.40 ? 68  TYR A OH  1 
ATOM   522  N N   . LEU A 1 69  ? 15.870  12.632 1.939   1.00 17.83 ? 69  LEU A N   1 
ATOM   523  C CA  . LEU A 1 69  ? 16.226  12.811 0.518   1.00 17.49 ? 69  LEU A CA  1 
ATOM   524  C C   . LEU A 1 69  ? 17.708  13.142 0.396   1.00 18.26 ? 69  LEU A C   1 
ATOM   525  O O   . LEU A 1 69  ? 18.293  13.988 1.134   1.00 18.24 ? 69  LEU A O   1 
ATOM   526  C CB  . LEU A 1 69  ? 15.273  13.888 -0.033  1.00 16.05 ? 69  LEU A CB  1 
ATOM   527  C CG  . LEU A 1 69  ? 13.876  13.390 -0.390  1.00 16.33 ? 69  LEU A CG  1 
ATOM   528  C CD1 . LEU A 1 69  ? 13.195  14.272 -1.424  1.00 16.02 ? 69  LEU A CD1 1 
ATOM   529  C CD2 . LEU A 1 69  ? 14.091  11.971 -1.047  1.00 17.80 ? 69  LEU A CD2 1 
ATOM   530  N N   . SER A 1 70  ? 18.350  12.577 -0.597  1.00 19.24 ? 70  SER A N   1 
ATOM   531  C CA  . SER A 1 70  ? 19.837  12.787 -0.782  1.00 19.90 ? 70  SER A CA  1 
ATOM   532  C C   . SER A 1 70  ? 20.165  12.866 -2.259  1.00 19.76 ? 70  SER A C   1 
ATOM   533  O O   . SER A 1 70  ? 19.433  12.332 -3.090  1.00 19.87 ? 70  SER A O   1 
ATOM   534  C CB  . SER A 1 70  ? 20.348  11.334 -0.337  1.00 21.35 ? 70  SER A CB  1 
ATOM   535  O OG  . SER A 1 70  ? 21.328  11.555 0.606   1.00 23.46 ? 70  SER A OG  1 
ATOM   536  N N   . CYS A 1 71  ? 21.281  13.394 -2.603  1.00 20.16 ? 71  CYS A N   1 
ATOM   537  C CA  . CYS A 1 71  ? 21.765  13.557 -3.983  1.00 20.72 ? 71  CYS A CA  1 
ATOM   538  C C   . CYS A 1 71  ? 23.243  13.096 -3.968  1.00 21.11 ? 71  CYS A C   1 
ATOM   539  O O   . CYS A 1 71  ? 23.959  13.593 -3.122  1.00 20.16 ? 71  CYS A O   1 
ATOM   540  C CB  . CYS A 1 71  ? 21.799  15.060 -4.315  1.00 21.12 ? 71  CYS A CB  1 
ATOM   541  S SG  . CYS A 1 71  ? 20.217  15.841 -4.211  1.00 21.63 ? 71  CYS A SG  1 
ATOM   542  N N   . VAL A 1 72  ? 23.483  12.211 -4.885  1.00 22.27 ? 72  VAL A N   1 
ATOM   543  C CA  . VAL A 1 72  ? 24.825  11.602 -5.034  1.00 23.32 ? 72  VAL A CA  1 
ATOM   544  C C   . VAL A 1 72  ? 25.037  11.390 -6.523  1.00 25.08 ? 72  VAL A C   1 
ATOM   545  O O   . VAL A 1 72  ? 24.068  11.554 -7.279  1.00 24.89 ? 72  VAL A O   1 
ATOM   546  C CB  . VAL A 1 72  ? 24.842  10.315 -4.189  1.00 22.36 ? 72  VAL A CB  1 
ATOM   547  C CG1 . VAL A 1 72  ? 24.537  10.607 -2.716  1.00 22.18 ? 72  VAL A CG1 1 
ATOM   548  C CG2 . VAL A 1 72  ? 23.888  9.280  -4.710  1.00 21.49 ? 72  VAL A CG2 1 
ATOM   549  N N   . MET A 1 73  ? 26.308  11.236 -6.886  1.00 27.20 ? 73  MET A N   1 
ATOM   550  C CA  . MET A 1 73  ? 26.722  10.949 -8.288  1.00 28.79 ? 73  MET A CA  1 
ATOM   551  C C   . MET A 1 73  ? 26.579  9.397  -8.389  1.00 29.89 ? 73  MET A C   1 
ATOM   552  O O   . MET A 1 73  ? 27.325  8.752  -7.629  1.00 30.32 ? 73  MET A O   1 
ATOM   553  C CB  . MET A 1 73  ? 28.199  11.260 -8.490  1.00 28.86 ? 73  MET A CB  1 
ATOM   554  C CG  . MET A 1 73  ? 28.512  12.549 -9.097  1.00 29.16 ? 73  MET A CG  1 
ATOM   555  S SD  . MET A 1 73  ? 27.809  12.728 -10.747 1.00 31.38 ? 73  MET A SD  1 
ATOM   556  C CE  . MET A 1 73  ? 29.256  12.465 -11.799 1.00 31.59 ? 73  MET A CE  1 
ATOM   557  N N   . LYS A 1 74  ? 25.733  8.919  -9.219  1.00 30.62 ? 74  LYS A N   1 
ATOM   558  C CA  . LYS A 1 74  ? 25.558  7.434  -9.350  1.00 31.86 ? 74  LYS A CA  1 
ATOM   559  C C   . LYS A 1 74  ? 25.373  7.182  -10.852 1.00 32.37 ? 74  LYS A C   1 
ATOM   560  O O   . LYS A 1 74  ? 24.584  7.882  -11.515 1.00 32.09 ? 74  LYS A O   1 
ATOM   561  C CB  . LYS A 1 74  ? 24.381  6.923  -8.536  1.00 32.66 ? 74  LYS A CB  1 
ATOM   562  C CG  . LYS A 1 74  ? 24.300  5.467  -8.222  1.00 33.95 ? 74  LYS A CG  1 
ATOM   563  C CD  . LYS A 1 74  ? 23.584  5.054  -6.953  1.00 35.39 ? 74  LYS A CD  1 
ATOM   564  C CE  . LYS A 1 74  ? 24.344  5.347  -5.652  1.00 36.10 ? 74  LYS A CE  1 
ATOM   565  N NZ  . LYS A 1 74  ? 23.363  5.364  -4.484  1.00 35.15 ? 74  LYS A NZ  1 
ATOM   566  N N   . ASP A 1 75  ? 26.183  6.271  -11.379 1.00 33.00 ? 75  ASP A N   1 
ATOM   567  C CA  . ASP A 1 75  ? 26.108  5.963  -12.821 1.00 33.37 ? 75  ASP A CA  1 
ATOM   568  C C   . ASP A 1 75  ? 26.464  7.195  -13.626 1.00 32.51 ? 75  ASP A C   1 
ATOM   569  O O   . ASP A 1 75  ? 25.800  7.469  -14.647 1.00 32.83 ? 75  ASP A O   1 
ATOM   570  C CB  . ASP A 1 75  ? 24.734  5.358  -13.151 1.00 36.52 ? 75  ASP A CB  1 
ATOM   571  C CG  . ASP A 1 75  ? 24.699  3.881  -12.756 1.00 40.20 ? 75  ASP A CG  1 
ATOM   572  O OD1 . ASP A 1 75  ? 25.672  3.316  -12.163 1.00 41.13 ? 75  ASP A OD1 1 
ATOM   573  O OD2 . ASP A 1 75  ? 23.660  3.246  -13.085 1.00 41.80 ? 75  ASP A OD2 1 
ATOM   574  N N   . GLY A 1 76  ? 27.407  7.954  -13.176 1.00 31.78 ? 76  GLY A N   1 
ATOM   575  C CA  . GLY A 1 76  ? 27.878  9.160  -13.825 1.00 31.46 ? 76  GLY A CA  1 
ATOM   576  C C   . GLY A 1 76  ? 26.832  10.208 -14.053 1.00 31.60 ? 76  GLY A C   1 
ATOM   577  O O   . GLY A 1 76  ? 26.899  10.968 -15.038 1.00 31.54 ? 76  GLY A O   1 
ATOM   578  N N   . THR A 1 77  ? 25.828  10.278 -13.191 1.00 31.49 ? 77  THR A N   1 
ATOM   579  C CA  . THR A 1 77  ? 24.743  11.279 -13.234 1.00 30.41 ? 77  THR A CA  1 
ATOM   580  C C   . THR A 1 77  ? 24.314  11.597 -11.799 1.00 28.79 ? 77  THR A C   1 
ATOM   581  O O   . THR A 1 77  ? 24.309  10.709 -10.941 1.00 28.72 ? 77  THR A O   1 
ATOM   582  C CB  . THR A 1 77  ? 23.472  10.783 -14.051 1.00 32.18 ? 77  THR A CB  1 
ATOM   583  O OG1 . THR A 1 77  ? 22.640  12.009 -14.190 1.00 32.97 ? 77  THR A OG1 1 
ATOM   584  C CG2 . THR A 1 77  ? 22.607  9.742  -13.316 1.00 32.34 ? 77  THR A CG2 1 
ATOM   585  N N   . PRO A 1 78  ? 24.029  12.825 -11.564 1.00 28.25 ? 78  PRO A N   1 
ATOM   586  C CA  . PRO A 1 78  ? 23.524  13.306 -10.209 1.00 27.33 ? 78  PRO A CA  1 
ATOM   587  C C   . PRO A 1 78  ? 22.137  12.626 -10.033 1.00 26.36 ? 78  PRO A C   1 
ATOM   588  O O   . PRO A 1 78  ? 21.266  12.709 -10.936 1.00 26.35 ? 78  PRO A O   1 
ATOM   589  C CB  . PRO A 1 78  ? 23.423  14.806 -10.413 1.00 27.25 ? 78  PRO A CB  1 
ATOM   590  C CG  . PRO A 1 78  ? 24.405  15.108 -11.526 1.00 27.34 ? 78  PRO A CG  1 
ATOM   591  C CD  . PRO A 1 78  ? 24.100  13.966 -12.529 1.00 28.05 ? 78  PRO A CD  1 
ATOM   592  N N   . THR A 1 79  ? 21.943  11.941 -8.947  1.00 25.01 ? 79  THR A N   1 
ATOM   593  C CA  . THR A 1 79  ? 20.770  11.165 -8.620  1.00 24.52 ? 79  THR A CA  1 
ATOM   594  C C   . THR A 1 79  ? 20.167  11.479 -7.249  1.00 23.54 ? 79  THR A C   1 
ATOM   595  O O   . THR A 1 79  ? 20.923  11.767 -6.300  1.00 23.05 ? 79  THR A O   1 
ATOM   596  C CB  . THR A 1 79  ? 21.190  9.598  -8.560  1.00 25.35 ? 79  THR A CB  1 
ATOM   597  O OG1 . THR A 1 79  ? 21.929  9.340  -9.803  1.00 27.51 ? 79  THR A OG1 1 
ATOM   598  C CG2 . THR A 1 79  ? 20.053  8.645  -8.381  1.00 23.90 ? 79  THR A CG2 1 
ATOM   599  N N   . LEU A 1 80  ? 18.826  11.366 -7.210  1.00 22.53 ? 80  LEU A N   1 
ATOM   600  C CA  . LEU A 1 80  ? 18.087  11.616 -5.958  1.00 21.68 ? 80  LEU A CA  1 
ATOM   601  C C   . LEU A 1 80  ? 17.807  10.234 -5.333  1.00 22.11 ? 80  LEU A C   1 
ATOM   602  O O   . LEU A 1 80  ? 17.383  9.306  -6.067  1.00 22.71 ? 80  LEU A O   1 
ATOM   603  C CB  . LEU A 1 80  ? 16.714  12.250 -6.328  1.00 20.46 ? 80  LEU A CB  1 
ATOM   604  C CG  . LEU A 1 80  ? 15.795  12.559 -5.153  1.00 19.70 ? 80  LEU A CG  1 
ATOM   605  C CD1 . LEU A 1 80  ? 16.486  13.588 -4.226  1.00 19.05 ? 80  LEU A CD1 1 
ATOM   606  C CD2 . LEU A 1 80  ? 14.420  13.014 -5.551  1.00 17.85 ? 80  LEU A CD2 1 
ATOM   607  N N   . GLN A 1 81  ? 17.966  10.125 -4.050  1.00 22.00 ? 81  GLN A N   1 
ATOM   608  C CA  . GLN A 1 81  ? 17.692  8.916  -3.307  1.00 22.30 ? 81  GLN A CA  1 
ATOM   609  C C   . GLN A 1 81  ? 17.093  9.285  -1.948  1.00 21.40 ? 81  GLN A C   1 
ATOM   610  O O   . GLN A 1 81  ? 16.940  10.456 -1.611  1.00 20.86 ? 81  GLN A O   1 
ATOM   611  C CB  . GLN A 1 81  ? 18.874  7.988  -3.079  1.00 25.66 ? 81  GLN A CB  1 
ATOM   612  C CG  . GLN A 1 81  ? 20.029  8.619  -2.367  1.00 28.35 ? 81  GLN A CG  1 
ATOM   613  C CD  . GLN A 1 81  ? 21.276  7.773  -2.482  1.00 31.33 ? 81  GLN A CD  1 
ATOM   614  O OE1 . GLN A 1 81  ? 21.371  6.813  -3.258  1.00 32.98 ? 81  GLN A OE1 1 
ATOM   615  N NE2 . GLN A 1 81  ? 22.247  8.168  -1.653  1.00 32.31 ? 81  GLN A NE2 1 
ATOM   616  N N   . LEU A 1 82  ? 16.750  8.183  -1.322  1.00 21.14 ? 82  LEU A N   1 
ATOM   617  C CA  . LEU A 1 82  ? 16.151  8.202  0.038   1.00 20.61 ? 82  LEU A CA  1 
ATOM   618  C C   . LEU A 1 82  ? 17.191  7.467  0.918   1.00 19.76 ? 82  LEU A C   1 
ATOM   619  O O   . LEU A 1 82  ? 17.256  6.284  0.740   1.00 19.84 ? 82  LEU A O   1 
ATOM   620  C CB  . LEU A 1 82  ? 14.797  7.468  0.041   1.00 19.09 ? 82  LEU A CB  1 
ATOM   621  C CG  . LEU A 1 82  ? 13.494  8.190  -0.259  1.00 17.67 ? 82  LEU A CG  1 
ATOM   622  C CD1 . LEU A 1 82  ? 12.312  7.246  0.009   1.00 17.17 ? 82  LEU A CD1 1 
ATOM   623  C CD2 . LEU A 1 82  ? 13.333  9.396  0.644   1.00 18.21 ? 82  LEU A CD2 1 
ATOM   624  N N   . GLU A 1 83  ? 17.833  8.125  1.785   1.00 19.91 ? 83  GLU A N   1 
ATOM   625  C CA  . GLU A 1 83  ? 18.891  7.528  2.618   1.00 20.50 ? 83  GLU A CA  1 
ATOM   626  C C   . GLU A 1 83  ? 18.465  7.372  4.044   1.00 20.46 ? 83  GLU A C   1 
ATOM   627  O O   . GLU A 1 83  ? 17.808  8.240  4.619   1.00 20.29 ? 83  GLU A O   1 
ATOM   628  C CB  . GLU A 1 83  ? 20.159  8.391  2.475   1.00 21.13 ? 83  GLU A CB  1 
ATOM   629  C CG  . GLU A 1 83  ? 21.463  8.032  3.126   1.00 23.39 ? 83  GLU A CG  1 
ATOM   630  C CD  . GLU A 1 83  ? 22.668  8.918  2.990   1.00 24.15 ? 83  GLU A CD  1 
ATOM   631  O OE1 . GLU A 1 83  ? 22.882  9.710  2.069   1.00 24.75 ? 83  GLU A OE1 1 
ATOM   632  O OE2 . GLU A 1 83  ? 23.526  8.715  3.902   1.00 23.53 ? 83  GLU A OE2 1 
ATOM   633  N N   . SER A 1 84  ? 18.861  6.280  4.627   1.00 21.13 ? 84  SER A N   1 
ATOM   634  C CA  . SER A 1 84  ? 18.661  5.891  6.024   1.00 21.83 ? 84  SER A CA  1 
ATOM   635  C C   . SER A 1 84  ? 19.818  6.587  6.803   1.00 22.25 ? 84  SER A C   1 
ATOM   636  O O   . SER A 1 84  ? 20.930  6.663  6.242   1.00 21.65 ? 84  SER A O   1 
ATOM   637  C CB  . SER A 1 84  ? 19.020  4.391  6.233   1.00 22.90 ? 84  SER A CB  1 
ATOM   638  O OG  . SER A 1 84  ? 17.875  3.661  5.890   1.00 25.17 ? 84  SER A OG  1 
ATOM   639  N N   . VAL A 1 85  ? 19.442  6.982  8.013   1.00 22.58 ? 85  VAL A N   1 
ATOM   640  C CA  . VAL A 1 85  ? 20.473  7.647  8.861   1.00 23.22 ? 85  VAL A CA  1 
ATOM   641  C C   . VAL A 1 85  ? 20.142  7.136  10.288  1.00 24.86 ? 85  VAL A C   1 
ATOM   642  O O   . VAL A 1 85  ? 19.006  6.645  10.483  1.00 24.58 ? 85  VAL A O   1 
ATOM   643  C CB  . VAL A 1 85  ? 20.375  9.183  8.738   1.00 21.24 ? 85  VAL A CB  1 
ATOM   644  C CG1 . VAL A 1 85  ? 20.365  9.663  7.308   1.00 19.43 ? 85  VAL A CG1 1 
ATOM   645  C CG2 . VAL A 1 85  ? 19.172  9.721  9.537   1.00 20.39 ? 85  VAL A CG2 1 
ATOM   646  N N   . ASP A 1 86  ? 21.146  7.298  11.132  1.00 25.90 ? 86  ASP A N   1 
ATOM   647  C CA  . ASP A 1 86  ? 21.031  6.924  12.543  1.00 27.79 ? 86  ASP A CA  1 
ATOM   648  C C   . ASP A 1 86  ? 20.013  7.873  13.216  1.00 29.10 ? 86  ASP A C   1 
ATOM   649  O O   . ASP A 1 86  ? 20.311  9.077  13.362  1.00 29.69 ? 86  ASP A O   1 
ATOM   650  C CB  . ASP A 1 86  ? 22.426  7.066  13.107  1.00 29.38 ? 86  ASP A CB  1 
ATOM   651  C CG  . ASP A 1 86  ? 22.652  6.673  14.544  1.00 30.31 ? 86  ASP A CG  1 
ATOM   652  O OD1 . ASP A 1 86  ? 21.687  6.337  15.242  1.00 31.27 ? 86  ASP A OD1 1 
ATOM   653  O OD2 . ASP A 1 86  ? 23.858  6.695  14.909  1.00 31.52 ? 86  ASP A OD2 1 
ATOM   654  N N   . PRO A 1 87  ? 18.904  7.315  13.685  1.00 29.86 ? 87  PRO A N   1 
ATOM   655  C CA  . PRO A 1 87  ? 17.830  7.989  14.339  1.00 30.84 ? 87  PRO A CA  1 
ATOM   656  C C   . PRO A 1 87  ? 18.120  8.795  15.591  1.00 32.09 ? 87  PRO A C   1 
ATOM   657  O O   . PRO A 1 87  ? 17.292  9.606  16.007  1.00 31.55 ? 87  PRO A O   1 
ATOM   658  C CB  . PRO A 1 87  ? 16.766  6.907  14.587  1.00 30.60 ? 87  PRO A CB  1 
ATOM   659  C CG  . PRO A 1 87  ? 17.536  5.634  14.626  1.00 30.31 ? 87  PRO A CG  1 
ATOM   660  C CD  . PRO A 1 87  ? 18.608  5.851  13.568  1.00 30.39 ? 87  PRO A CD  1 
ATOM   661  N N   . LYS A 1 88  ? 19.268  8.553  16.222  1.00 33.66 ? 88  LYS A N   1 
ATOM   662  C CA  . LYS A 1 88  ? 19.663  9.306  17.417  1.00 35.24 ? 88  LYS A CA  1 
ATOM   663  C C   . LYS A 1 88  ? 20.409  10.570 17.029  1.00 35.36 ? 88  LYS A C   1 
ATOM   664  O O   . LYS A 1 88  ? 20.297  11.523 17.814  1.00 35.82 ? 88  LYS A O   1 
ATOM   665  C CB  . LYS A 1 88  ? 20.318  8.526  18.523  1.00 37.62 ? 88  LYS A CB  1 
ATOM   666  C CG  . LYS A 1 88  ? 19.369  8.152  19.680  1.00 39.74 ? 88  LYS A CG  1 
ATOM   667  C CD  . LYS A 1 88  ? 19.763  6.863  20.376  1.00 41.65 ? 88  LYS A CD  1 
ATOM   668  C CE  . LYS A 1 88  ? 19.405  6.824  21.848  1.00 42.59 ? 88  LYS A CE  1 
ATOM   669  N NZ  . LYS A 1 88  ? 17.943  6.793  22.107  1.00 42.94 ? 88  LYS A NZ  1 
ATOM   670  N N   . GLN A 1 89  ? 21.072  10.649 15.891  1.00 34.93 ? 89  GLN A N   1 
ATOM   671  C CA  . GLN A 1 89  ? 21.790  11.846 15.461  1.00 34.73 ? 89  GLN A CA  1 
ATOM   672  C C   . GLN A 1 89  ? 21.026  12.813 14.550  1.00 33.69 ? 89  GLN A C   1 
ATOM   673  O O   . GLN A 1 89  ? 21.556  13.913 14.283  1.00 34.24 ? 89  GLN A O   1 
ATOM   674  C CB  . GLN A 1 89  ? 23.033  11.480 14.576  1.00 36.06 ? 89  GLN A CB  1 
ATOM   675  C CG  . GLN A 1 89  ? 24.186  10.864 15.333  1.00 39.03 ? 89  GLN A CG  1 
ATOM   676  C CD  . GLN A 1 89  ? 25.271  10.476 14.340  1.00 41.63 ? 89  GLN A CD  1 
ATOM   677  O OE1 . GLN A 1 89  ? 25.609  11.296 13.447  1.00 42.92 ? 89  GLN A OE1 1 
ATOM   678  N NE2 . GLN A 1 89  ? 25.736  9.220  14.425  1.00 41.16 ? 89  GLN A NE2 1 
ATOM   679  N N   . TYR A 1 90  ? 19.958  12.418 13.947  1.00 32.49 ? 90  TYR A N   1 
ATOM   680  C CA  . TYR A 1 90  ? 19.194  13.151 12.965  1.00 31.07 ? 90  TYR A CA  1 
ATOM   681  C C   . TYR A 1 90  ? 17.849  13.587 13.456  1.00 31.41 ? 90  TYR A C   1 
ATOM   682  O O   . TYR A 1 90  ? 17.255  12.854 14.260  1.00 31.96 ? 90  TYR A O   1 
ATOM   683  C CB  . TYR A 1 90  ? 19.170  12.392 11.629  1.00 27.73 ? 90  TYR A CB  1 
ATOM   684  C CG  . TYR A 1 90  ? 20.473  12.473 10.884  1.00 25.94 ? 90  TYR A CG  1 
ATOM   685  C CD1 . TYR A 1 90  ? 21.555  11.641 11.231  1.00 26.10 ? 90  TYR A CD1 1 
ATOM   686  C CD2 . TYR A 1 90  ? 20.665  13.354 9.817   1.00 25.02 ? 90  TYR A CD2 1 
ATOM   687  C CE1 . TYR A 1 90  ? 22.775  11.721 10.570  1.00 25.70 ? 90  TYR A CE1 1 
ATOM   688  C CE2 . TYR A 1 90  ? 21.883  13.466 9.170   1.00 24.29 ? 90  TYR A CE2 1 
ATOM   689  C CZ  . TYR A 1 90  ? 22.937  12.661 9.553   1.00 25.51 ? 90  TYR A CZ  1 
ATOM   690  O OH  . TYR A 1 90  ? 24.162  12.698 8.899   1.00 26.80 ? 90  TYR A OH  1 
ATOM   691  N N   . PRO A 1 91  ? 17.369  14.757 13.049  1.00 31.45 ? 91  PRO A N   1 
ATOM   692  C CA  . PRO A 1 91  ? 18.060  15.681 12.130  1.00 31.57 ? 91  PRO A CA  1 
ATOM   693  C C   . PRO A 1 91  ? 19.060  16.458 12.972  1.00 31.75 ? 91  PRO A C   1 
ATOM   694  O O   . PRO A 1 91  ? 19.059  16.320 14.212  1.00 32.21 ? 91  PRO A O   1 
ATOM   695  C CB  . PRO A 1 91  ? 16.913  16.542 11.605  1.00 31.72 ? 91  PRO A CB  1 
ATOM   696  C CG  . PRO A 1 91  ? 15.892  16.575 12.726  1.00 31.36 ? 91  PRO A CG  1 
ATOM   697  C CD  . PRO A 1 91  ? 16.104  15.313 13.516  1.00 31.39 ? 91  PRO A CD  1 
ATOM   698  N N   . LYS A 1 92  ? 19.852  17.253 12.331  1.00 31.98 ? 92  LYS A N   1 
ATOM   699  C CA  . LYS A 1 92  ? 20.875  18.107 12.962  1.00 31.78 ? 92  LYS A CA  1 
ATOM   700  C C   . LYS A 1 92  ? 20.815  19.469 12.223  1.00 31.78 ? 92  LYS A C   1 
ATOM   701  O O   . LYS A 1 92  ? 20.245  19.506 11.140  1.00 32.02 ? 92  LYS A O   1 
ATOM   702  C CB  . LYS A 1 92  ? 22.247  17.634 12.668  1.00 32.57 ? 92  LYS A CB  1 
ATOM   703  C CG  . LYS A 1 92  ? 22.706  16.256 12.435  1.00 33.39 ? 92  LYS A CG  1 
ATOM   704  C CD  . LYS A 1 92  ? 23.986  16.355 11.580  1.00 33.71 ? 92  LYS A CD  1 
ATOM   705  C CE  . LYS A 1 92  ? 24.714  15.017 11.603  1.00 34.26 ? 92  LYS A CE  1 
ATOM   706  N NZ  . LYS A 1 92  ? 26.145  15.308 11.234  1.00 35.01 ? 92  LYS A NZ  1 
ATOM   707  N N   . LYS A 1 93  ? 21.467  20.456 12.773  1.00 32.13 ? 93  LYS A N   1 
ATOM   708  C CA  . LYS A 1 93  ? 21.517  21.775 12.126  1.00 32.90 ? 93  LYS A CA  1 
ATOM   709  C C   . LYS A 1 93  ? 22.524  21.785 11.013  1.00 33.45 ? 93  LYS A C   1 
ATOM   710  O O   . LYS A 1 93  ? 22.285  22.401 9.929   1.00 33.93 ? 93  LYS A O   1 
ATOM   711  C CB  . LYS A 1 93  ? 21.702  22.895 13.161  1.00 33.16 ? 93  LYS A CB  1 
ATOM   712  C CG  A LYS A 1 93  ? 20.318  23.091 13.831  0.50 33.63 ? 93  LYS A CG  1 
ATOM   713  C CG  B LYS A 1 93  ? 21.344  22.498 14.601  0.50 33.40 ? 93  LYS A CG  1 
ATOM   714  C CD  A LYS A 1 93  ? 20.330  23.471 15.291  0.50 34.10 ? 93  LYS A CD  1 
ATOM   715  C CD  B LYS A 1 93  ? 21.903  23.514 15.597  0.50 33.46 ? 93  LYS A CD  1 
ATOM   716  C CE  A LYS A 1 93  ? 18.924  23.311 15.881  0.50 34.22 ? 93  LYS A CE  1 
ATOM   717  C CE  B LYS A 1 93  ? 21.328  23.388 16.978  0.50 33.42 ? 93  LYS A CE  1 
ATOM   718  N NZ  A LYS A 1 93  ? 18.690  24.261 16.983  0.50 34.79 ? 93  LYS A NZ  1 
ATOM   719  N NZ  B LYS A 1 93  ? 21.585  22.042 17.550  0.50 33.60 ? 93  LYS A NZ  1 
ATOM   720  N N   . LYS A 1 94  ? 23.664  21.176 11.205  1.00 33.66 ? 94  LYS A N   1 
ATOM   721  C CA  . LYS A 1 94  ? 24.733  21.081 10.226  1.00 34.19 ? 94  LYS A CA  1 
ATOM   722  C C   . LYS A 1 94  ? 24.615  19.697 9.570   1.00 33.72 ? 94  LYS A C   1 
ATOM   723  O O   . LYS A 1 94  ? 25.302  18.716 9.925   1.00 34.56 ? 94  LYS A O   1 
ATOM   724  C CB  . LYS A 1 94  ? 26.124  21.270 10.818  1.00 36.74 ? 94  LYS A CB  1 
ATOM   725  C CG  . LYS A 1 94  ? 26.506  22.741 10.937  1.00 40.01 ? 94  LYS A CG  1 
ATOM   726  C CD  . LYS A 1 94  ? 26.415  23.249 12.370  1.00 42.00 ? 94  LYS A CD  1 
ATOM   727  C CE  . LYS A 1 94  ? 27.773  23.149 13.052  1.00 43.61 ? 94  LYS A CE  1 
ATOM   728  N NZ  . LYS A 1 94  ? 27.603  23.416 14.524  1.00 45.61 ? 94  LYS A NZ  1 
ATOM   729  N N   . MET A 1 95  ? 23.778  19.652 8.602   1.00 32.54 ? 95  MET A N   1 
ATOM   730  C CA  . MET A 1 95  ? 23.440  18.452 7.781   1.00 31.03 ? 95  MET A CA  1 
ATOM   731  C C   . MET A 1 95  ? 24.552  18.301 6.747   1.00 30.06 ? 95  MET A C   1 
ATOM   732  O O   . MET A 1 95  ? 25.065  19.338 6.286   1.00 30.69 ? 95  MET A O   1 
ATOM   733  C CB  . MET A 1 95  ? 22.128  18.842 7.157   1.00 30.20 ? 95  MET A CB  1 
ATOM   734  C CG  . MET A 1 95  ? 20.930  18.159 7.256   1.00 30.68 ? 95  MET A CG  1 
ATOM   735  S SD  . MET A 1 95  ? 20.572  16.909 8.491   1.00 30.24 ? 95  MET A SD  1 
ATOM   736  C CE  . MET A 1 95  ? 19.669  15.721 7.400   1.00 28.16 ? 95  MET A CE  1 
ATOM   737  N N   . GLU A 1 96  ? 24.943  17.100 6.402   1.00 28.70 ? 96  GLU A N   1 
ATOM   738  C CA  . GLU A 1 96  ? 25.974  16.908 5.370   1.00 27.79 ? 96  GLU A CA  1 
ATOM   739  C C   . GLU A 1 96  ? 25.350  17.457 4.074   1.00 27.15 ? 96  GLU A C   1 
ATOM   740  O O   . GLU A 1 96  ? 24.138  17.323 3.848   1.00 26.39 ? 96  GLU A O   1 
ATOM   741  C CB  . GLU A 1 96  ? 26.471  15.527 5.248   1.00 28.08 ? 96  GLU A CB  1 
ATOM   742  C CG  . GLU A 1 96  ? 27.055  14.868 6.498   1.00 28.02 ? 96  GLU A CG  1 
ATOM   743  C CD  . GLU A 1 96  ? 26.159  14.499 7.600   1.00 28.92 ? 96  GLU A CD  1 
ATOM   744  O OE1 . GLU A 1 96  ? 24.915  14.514 7.457   1.00 27.93 ? 96  GLU A OE1 1 
ATOM   745  O OE2 . GLU A 1 96  ? 26.635  14.164 8.683   1.00 30.64 ? 96  GLU A OE2 1 
ATOM   746  N N   . LYS A 1 97  ? 26.194  18.080 3.269   1.00 26.49 ? 97  LYS A N   1 
ATOM   747  C CA  . LYS A 1 97  ? 25.809  18.735 2.050   1.00 25.18 ? 97  LYS A CA  1 
ATOM   748  C C   . LYS A 1 97  ? 24.899  18.024 1.101   1.00 24.08 ? 97  LYS A C   1 
ATOM   749  O O   . LYS A 1 97  ? 24.201  18.701 0.281   1.00 24.11 ? 97  LYS A O   1 
ATOM   750  C CB  . LYS A 1 97  ? 27.030  19.170 1.238   1.00 27.02 ? 97  LYS A CB  1 
ATOM   751  C CG  . LYS A 1 97  ? 26.623  19.879 -0.040  1.00 29.13 ? 97  LYS A CG  1 
ATOM   752  C CD  . LYS A 1 97  ? 26.670  21.374 0.151   1.00 32.02 ? 97  LYS A CD  1 
ATOM   753  C CE  . LYS A 1 97  ? 28.122  21.857 -0.018  1.00 34.56 ? 97  LYS A CE  1 
ATOM   754  N NZ  . LYS A 1 97  ? 28.502  21.515 -1.468  1.00 36.29 ? 97  LYS A NZ  1 
ATOM   755  N N   . ARG A 1 98  ? 24.910  16.725 1.058   1.00 22.72 ? 98  ARG A N   1 
ATOM   756  C CA  . ARG A 1 98  ? 24.153  15.883 0.153   1.00 20.90 ? 98  ARG A CA  1 
ATOM   757  C C   . ARG A 1 98  ? 22.661  15.900 0.497   1.00 19.80 ? 98  ARG A C   1 
ATOM   758  O O   . ARG A 1 98  ? 21.874  15.747 -0.439  1.00 19.55 ? 98  ARG A O   1 
ATOM   759  C CB  . ARG A 1 98  ? 24.705  14.491 -0.005  1.00 19.15 ? 98  ARG A CB  1 
ATOM   760  C CG  . ARG A 1 98  ? 24.836  13.702 1.284   1.00 17.83 ? 98  ARG A CG  1 
ATOM   761  C CD  . ARG A 1 98  ? 24.979  12.266 0.980   1.00 18.64 ? 98  ARG A CD  1 
ATOM   762  N NE  . ARG A 1 98  ? 24.897  11.368 2.103   1.00 19.62 ? 98  ARG A NE  1 
ATOM   763  C CZ  . ARG A 1 98  ? 25.779  11.452 3.110   1.00 20.23 ? 98  ARG A CZ  1 
ATOM   764  N NH1 . ARG A 1 98  ? 26.745  12.395 3.107   1.00 20.08 ? 98  ARG A NH1 1 
ATOM   765  N NH2 . ARG A 1 98  ? 25.651  10.601 4.122   1.00 20.92 ? 98  ARG A NH2 1 
ATOM   766  N N   . PHE A 1 99  ? 22.324  16.209 1.715   1.00 19.10 ? 99  PHE A N   1 
ATOM   767  C CA  . PHE A 1 99  ? 20.950  16.289 2.158   1.00 18.28 ? 99  PHE A CA  1 
ATOM   768  C C   . PHE A 1 99  ? 20.377  17.712 2.045   1.00 18.33 ? 99  PHE A C   1 
ATOM   769  O O   . PHE A 1 99  ? 19.153  17.899 2.356   1.00 18.85 ? 99  PHE A O   1 
ATOM   770  C CB  . PHE A 1 99  ? 20.764  15.805 3.583   1.00 17.44 ? 99  PHE A CB  1 
ATOM   771  C CG  . PHE A 1 99  ? 21.237  14.467 3.995   1.00 15.95 ? 99  PHE A CG  1 
ATOM   772  C CD1 . PHE A 1 99  ? 20.496  13.326 3.774   1.00 15.04 ? 99  PHE A CD1 1 
ATOM   773  C CD2 . PHE A 1 99  ? 22.494  14.375 4.673   1.00 15.47 ? 99  PHE A CD2 1 
ATOM   774  C CE1 . PHE A 1 99  ? 20.899  12.058 4.250   1.00 14.30 ? 99  PHE A CE1 1 
ATOM   775  C CE2 . PHE A 1 99  ? 22.928  13.159 5.127   1.00 15.15 ? 99  PHE A CE2 1 
ATOM   776  C CZ  . PHE A 1 99  ? 22.099  12.015 4.938   1.00 15.35 ? 99  PHE A CZ  1 
ATOM   777  N N   . VAL A 1 100 ? 21.138  18.634 1.593   1.00 17.96 ? 100 VAL A N   1 
ATOM   778  C CA  . VAL A 1 100 ? 20.803  20.042 1.476   1.00 17.22 ? 100 VAL A CA  1 
ATOM   779  C C   . VAL A 1 100 ? 20.209  20.467 0.136   1.00 16.89 ? 100 VAL A C   1 
ATOM   780  O O   . VAL A 1 100 ? 20.730  20.272 -0.956  1.00 16.91 ? 100 VAL A O   1 
ATOM   781  C CB  . VAL A 1 100 ? 21.992  20.930 1.965   1.00 15.23 ? 100 VAL A CB  1 
ATOM   782  C CG1 . VAL A 1 100 ? 21.519  22.376 2.085   1.00 15.29 ? 100 VAL A CG1 1 
ATOM   783  C CG2 . VAL A 1 100 ? 22.526  20.482 3.319   1.00 12.46 ? 100 VAL A CG2 1 
ATOM   784  N N   . PHE A 1 101 ? 19.034  21.091 0.296   1.00 16.16 ? 101 PHE A N   1 
ATOM   785  C CA  . PHE A 1 101 ? 18.264  21.609 -0.811  1.00 16.30 ? 101 PHE A CA  1 
ATOM   786  C C   . PHE A 1 101 ? 18.046  23.133 -0.588  1.00 16.59 ? 101 PHE A C   1 
ATOM   787  O O   . PHE A 1 101 ? 17.760  23.519 0.572   1.00 16.59 ? 101 PHE A O   1 
ATOM   788  C CB  . PHE A 1 101 ? 16.930  20.854 -1.057  1.00 14.09 ? 101 PHE A CB  1 
ATOM   789  C CG  . PHE A 1 101 ? 17.069  19.457 -1.571  1.00 13.42 ? 101 PHE A CG  1 
ATOM   790  C CD1 . PHE A 1 101 ? 17.159  18.373 -0.684  1.00 13.17 ? 101 PHE A CD1 1 
ATOM   791  C CD2 . PHE A 1 101 ? 17.092  19.197 -2.937  1.00 13.52 ? 101 PHE A CD2 1 
ATOM   792  C CE1 . PHE A 1 101 ? 17.303  17.069 -1.136  1.00 14.20 ? 101 PHE A CE1 1 
ATOM   793  C CE2 . PHE A 1 101 ? 17.127  17.881 -3.441  1.00 13.83 ? 101 PHE A CE2 1 
ATOM   794  C CZ  . PHE A 1 101 ? 17.241  16.799 -2.527  1.00 14.49 ? 101 PHE A CZ  1 
ATOM   795  N N   . ASN A 1 102 ? 18.199  23.876 -1.662  1.00 16.47 ? 102 ASN A N   1 
ATOM   796  C CA  . ASN A 1 102 ? 17.973  25.305 -1.616  1.00 17.73 ? 102 ASN A CA  1 
ATOM   797  C C   . ASN A 1 102 ? 16.484  25.498 -2.028  1.00 18.24 ? 102 ASN A C   1 
ATOM   798  O O   . ASN A 1 102 ? 16.171  25.266 -3.211  1.00 18.19 ? 102 ASN A O   1 
ATOM   799  C CB  . ASN A 1 102 ? 18.866  26.163 -2.490  1.00 19.23 ? 102 ASN A CB  1 
ATOM   800  C CG  . ASN A 1 102 ? 20.330  26.141 -2.172  1.00 21.19 ? 102 ASN A CG  1 
ATOM   801  O OD1 . ASN A 1 102 ? 20.750  26.293 -1.019  1.00 23.49 ? 102 ASN A OD1 1 
ATOM   802  N ND2 . ASN A 1 102 ? 21.147  25.874 -3.202  1.00 22.07 ? 102 ASN A ND2 1 
ATOM   803  N N   . LYS A 1 103 ? 15.707  25.885 -1.046  1.00 18.90 ? 103 LYS A N   1 
ATOM   804  C CA  . LYS A 1 103 ? 14.290  26.161 -1.272  1.00 20.15 ? 103 LYS A CA  1 
ATOM   805  C C   . LYS A 1 103 ? 14.136  27.540 -1.952  1.00 21.83 ? 103 LYS A C   1 
ATOM   806  O O   . LYS A 1 103 ? 14.661  28.580 -1.423  1.00 22.66 ? 103 LYS A O   1 
ATOM   807  C CB  . LYS A 1 103 ? 13.531  26.226 0.052   1.00 18.86 ? 103 LYS A CB  1 
ATOM   808  C CG  . LYS A 1 103 ? 12.036  26.380 -0.211  1.00 18.64 ? 103 LYS A CG  1 
ATOM   809  C CD  . LYS A 1 103 ? 11.218  26.084 0.992   1.00 20.20 ? 103 LYS A CD  1 
ATOM   810  C CE  . LYS A 1 103 ? 11.545  27.014 2.155   1.00 21.12 ? 103 LYS A CE  1 
ATOM   811  N NZ  . LYS A 1 103 ? 11.254  28.387 1.639   1.00 24.46 ? 103 LYS A NZ  1 
ATOM   812  N N   . ILE A 1 104 ? 13.475  27.538 -3.101  1.00 22.22 ? 104 ILE A N   1 
ATOM   813  C CA  . ILE A 1 104 ? 13.239  28.768 -3.849  1.00 23.85 ? 104 ILE A CA  1 
ATOM   814  C C   . ILE A 1 104 ? 11.726  28.998 -4.094  1.00 25.70 ? 104 ILE A C   1 
ATOM   815  O O   . ILE A 1 104 ? 11.060  28.082 -4.572  1.00 25.61 ? 104 ILE A O   1 
ATOM   816  C CB  . ILE A 1 104 ? 13.948  28.792 -5.202  1.00 23.23 ? 104 ILE A CB  1 
ATOM   817  C CG1 . ILE A 1 104 ? 15.454  28.506 -5.056  1.00 22.96 ? 104 ILE A CG1 1 
ATOM   818  C CG2 . ILE A 1 104 ? 13.775  30.204 -5.899  1.00 24.23 ? 104 ILE A CG2 1 
ATOM   819  C CD1 . ILE A 1 104 ? 15.989  27.852 -6.381  1.00 22.64 ? 104 ILE A CD1 1 
ATOM   820  N N   . GLU A 1 105 ? 11.260  30.172 -3.744  1.00 27.58 ? 105 GLU A N   1 
ATOM   821  C CA  . GLU A 1 105 ? 9.891   30.578 -3.939  1.00 30.64 ? 105 GLU A CA  1 
ATOM   822  C C   . GLU A 1 105 ? 9.774   31.423 -5.196  1.00 32.16 ? 105 GLU A C   1 
ATOM   823  O O   . GLU A 1 105 ? 10.459  32.448 -5.371  1.00 32.15 ? 105 GLU A O   1 
ATOM   824  C CB  . GLU A 1 105 ? 9.207   31.238 -2.790  1.00 33.61 ? 105 GLU A CB  1 
ATOM   825  C CG  . GLU A 1 105 ? 9.296   30.407 -1.451  1.00 36.83 ? 105 GLU A CG  1 
ATOM   826  C CD  . GLU A 1 105 ? 8.434   31.093 -0.400  1.00 39.27 ? 105 GLU A CD  1 
ATOM   827  O OE1 . GLU A 1 105 ? 8.566   32.313 -0.195  1.00 39.09 ? 105 GLU A OE1 1 
ATOM   828  O OE2 . GLU A 1 105 ? 7.607   30.267 0.105   1.00 40.07 ? 105 GLU A OE2 1 
ATOM   829  N N   . VAL A 1 106 ? 8.950   30.905 -6.091  1.00 33.77 ? 106 VAL A N   1 
ATOM   830  C CA  . VAL A 1 106 ? 8.701   31.598 -7.377  1.00 35.87 ? 106 VAL A CA  1 
ATOM   831  C C   . VAL A 1 106 ? 7.209   31.685 -7.618  1.00 36.97 ? 106 VAL A C   1 
ATOM   832  O O   . VAL A 1 106 ? 6.519   30.688 -7.973  1.00 37.26 ? 106 VAL A O   1 
ATOM   833  C CB  . VAL A 1 106 ? 9.607   31.089 -8.471  1.00 37.52 ? 106 VAL A CB  1 
ATOM   834  C CG1 . VAL A 1 106 ? 9.632   32.022 -9.702  1.00 38.35 ? 106 VAL A CG1 1 
ATOM   835  C CG2 . VAL A 1 106 ? 11.042  30.958 -7.952  1.00 37.86 ? 106 VAL A CG2 1 
ATOM   836  N N   . LYS A 1 107 ? 6.714   32.887 -7.292  1.00 37.54 ? 107 LYS A N   1 
ATOM   837  C CA  . LYS A 1 107 ? 5.293   33.218 -7.480  1.00 38.05 ? 107 LYS A CA  1 
ATOM   838  C C   . LYS A 1 107 ? 4.386   32.231 -6.775  1.00 37.69 ? 107 LYS A C   1 
ATOM   839  O O   . LYS A 1 107 ? 3.564   31.648 -7.550  1.00 38.24 ? 107 LYS A O   1 
ATOM   840  C CB  . LYS A 1 107 ? 5.000   33.085 -9.009  1.00 39.93 ? 107 LYS A CB  1 
ATOM   841  C CG  . LYS A 1 107 ? 5.209   34.359 -9.849  1.00 42.56 ? 107 LYS A CG  1 
ATOM   842  C CD  . LYS A 1 107 ? 5.965   35.431 -9.108  1.00 44.78 ? 107 LYS A CD  1 
ATOM   843  C CE  . LYS A 1 107 ? 6.114   36.773 -9.811  1.00 45.93 ? 107 LYS A CE  1 
ATOM   844  N NZ  . LYS A 1 107 ? 4.811   37.139 -10.434 1.00 47.14 ? 107 LYS A NZ  1 
ATOM   845  N N   . SER A 1 108 ? 4.470   32.009 -5.471  1.00 36.44 ? 108 SER A N   1 
ATOM   846  C CA  . SER A 1 108 ? 3.503   31.030 -4.917  1.00 35.82 ? 108 SER A CA  1 
ATOM   847  C C   . SER A 1 108 ? 3.849   29.568 -5.119  1.00 34.23 ? 108 SER A C   1 
ATOM   848  O O   . SER A 1 108 ? 3.264   28.716 -4.427  1.00 33.79 ? 108 SER A O   1 
ATOM   849  C CB  . SER A 1 108 ? 2.132   31.330 -5.553  1.00 38.64 ? 108 SER A CB  1 
ATOM   850  O OG  . SER A 1 108 ? 1.780   32.698 -5.136  1.00 41.01 ? 108 SER A OG  1 
ATOM   851  N N   . LYS A 1 109 ? 4.765   29.238 -5.983  1.00 33.10 ? 109 LYS A N   1 
ATOM   852  C CA  . LYS A 1 109 ? 5.274   27.900 -6.260  1.00 30.72 ? 109 LYS A CA  1 
ATOM   853  C C   . LYS A 1 109 ? 6.677   27.864 -5.593  1.00 28.57 ? 109 LYS A C   1 
ATOM   854  O O   . LYS A 1 109 ? 7.290   28.911 -5.354  1.00 27.77 ? 109 LYS A O   1 
ATOM   855  C CB  . LYS A 1 109 ? 5.421   27.590 -7.739  1.00 31.63 ? 109 LYS A CB  1 
ATOM   856  C CG  . LYS A 1 109 ? 4.159   27.669 -8.548  1.00 34.30 ? 109 LYS A CG  1 
ATOM   857  C CD  . LYS A 1 109 ? 4.336   27.639 -10.067 1.00 36.74 ? 109 LYS A CD  1 
ATOM   858  C CE  . LYS A 1 109 ? 4.944   28.863 -10.727 1.00 37.64 ? 109 LYS A CE  1 
ATOM   859  N NZ  . LYS A 1 109 ? 6.396   29.120 -10.416 1.00 36.27 ? 109 LYS A NZ  1 
ATOM   860  N N   . VAL A 1 110 ? 7.121   26.651 -5.347  1.00 26.89 ? 110 VAL A N   1 
ATOM   861  C CA  . VAL A 1 110 ? 8.429   26.362 -4.707  1.00 25.12 ? 110 VAL A CA  1 
ATOM   862  C C   . VAL A 1 110 ? 9.317   25.493 -5.580  1.00 23.68 ? 110 VAL A C   1 
ATOM   863  O O   . VAL A 1 110 ? 8.841   24.632 -6.319  1.00 23.48 ? 110 VAL A O   1 
ATOM   864  C CB  . VAL A 1 110 ? 8.064   25.646 -3.371  1.00 24.97 ? 110 VAL A CB  1 
ATOM   865  C CG1 A VAL A 1 110 ? 7.659   24.201 -3.628  0.50 24.41 ? 110 VAL A CG1 1 
ATOM   866  C CG1 B VAL A 1 110 ? 9.086   24.642 -2.924  0.50 24.64 ? 110 VAL A CG1 1 
ATOM   867  C CG2 A VAL A 1 110 ? 9.179   25.748 -2.357  0.50 25.06 ? 110 VAL A CG2 1 
ATOM   868  C CG2 B VAL A 1 110 ? 7.744   26.687 -2.294  0.50 24.44 ? 110 VAL A CG2 1 
ATOM   869  N N   . GLU A 1 111 ? 10.626  25.711 -5.520  1.00 22.43 ? 111 GLU A N   1 
ATOM   870  C CA  . GLU A 1 111 ? 11.596  24.889 -6.296  1.00 20.41 ? 111 GLU A CA  1 
ATOM   871  C C   . GLU A 1 111 ? 12.651  24.413 -5.323  1.00 19.00 ? 111 GLU A C   1 
ATOM   872  O O   . GLU A 1 111 ? 12.878  25.114 -4.361  1.00 18.19 ? 111 GLU A O   1 
ATOM   873  C CB  . GLU A 1 111 ? 12.111  25.610 -7.504  1.00 19.59 ? 111 GLU A CB  1 
ATOM   874  C CG  . GLU A 1 111 ? 11.070  26.013 -8.523  1.00 21.48 ? 111 GLU A CG  1 
ATOM   875  C CD  . GLU A 1 111 ? 11.557  26.862 -9.659  1.00 23.57 ? 111 GLU A CD  1 
ATOM   876  O OE1 . GLU A 1 111 ? 12.686  27.365 -9.656  1.00 24.57 ? 111 GLU A OE1 1 
ATOM   877  O OE2 . GLU A 1 111 ? 10.708  26.988 -10.577 1.00 23.79 ? 111 GLU A OE2 1 
ATOM   878  N N   . PHE A 1 112 ? 13.187  23.191 -5.524  1.00 18.57 ? 112 PHE A N   1 
ATOM   879  C CA  . PHE A 1 112 ? 14.192  22.604 -4.620  1.00 17.16 ? 112 PHE A CA  1 
ATOM   880  C C   . PHE A 1 112 ? 15.451  22.204 -5.398  1.00 17.81 ? 112 PHE A C   1 
ATOM   881  O O   . PHE A 1 112 ? 15.555  21.120 -6.051  1.00 18.01 ? 112 PHE A O   1 
ATOM   882  C CB  . PHE A 1 112 ? 13.665  21.495 -3.797  1.00 14.71 ? 112 PHE A CB  1 
ATOM   883  C CG  . PHE A 1 112 ? 12.610  21.793 -2.810  1.00 14.05 ? 112 PHE A CG  1 
ATOM   884  C CD1 . PHE A 1 112 ? 12.928  22.311 -1.554  1.00 13.85 ? 112 PHE A CD1 1 
ATOM   885  C CD2 . PHE A 1 112 ? 11.251  21.577 -3.197  1.00 13.84 ? 112 PHE A CD2 1 
ATOM   886  C CE1 . PHE A 1 112 ? 11.854  22.577 -0.624  1.00 14.72 ? 112 PHE A CE1 1 
ATOM   887  C CE2 . PHE A 1 112 ? 10.212  21.893 -2.306  1.00 14.19 ? 112 PHE A CE2 1 
ATOM   888  C CZ  . PHE A 1 112 ? 10.523  22.358 -1.012  1.00 14.12 ? 112 PHE A CZ  1 
ATOM   889  N N   . GLU A 1 113 ? 16.413  23.127 -5.320  1.00 17.59 ? 113 GLU A N   1 
ATOM   890  C CA  . GLU A 1 113 ? 17.689  22.936 -6.023  1.00 18.09 ? 113 GLU A CA  1 
ATOM   891  C C   . GLU A 1 113 ? 18.674  22.189 -5.121  1.00 17.80 ? 113 GLU A C   1 
ATOM   892  O O   . GLU A 1 113 ? 18.763  22.524 -3.952  1.00 17.32 ? 113 GLU A O   1 
ATOM   893  C CB  . GLU A 1 113 ? 18.324  24.292 -6.354  1.00 19.38 ? 113 GLU A CB  1 
ATOM   894  C CG  . GLU A 1 113 ? 19.281  24.303 -7.522  1.00 21.59 ? 113 GLU A CG  1 
ATOM   895  C CD  . GLU A 1 113 ? 20.286  25.373 -7.610  1.00 23.91 ? 113 GLU A CD  1 
ATOM   896  O OE1 . GLU A 1 113 ? 20.455  26.055 -6.551  1.00 25.14 ? 113 GLU A OE1 1 
ATOM   897  O OE2 . GLU A 1 113 ? 20.956  25.572 -8.614  1.00 25.55 ? 113 GLU A OE2 1 
ATOM   898  N N   . SER A 1 114 ? 19.344  21.216 -5.669  1.00 18.49 ? 114 SER A N   1 
ATOM   899  C CA  . SER A 1 114 ? 20.356  20.463 -4.837  1.00 19.88 ? 114 SER A CA  1 
ATOM   900  C C   . SER A 1 114 ? 21.529  21.374 -4.509  1.00 20.45 ? 114 SER A C   1 
ATOM   901  O O   . SER A 1 114 ? 22.048  22.064 -5.455  1.00 21.00 ? 114 SER A O   1 
ATOM   902  C CB  . SER A 1 114 ? 20.766  19.270 -5.726  1.00 20.21 ? 114 SER A CB  1 
ATOM   903  O OG  . SER A 1 114 ? 21.909  18.673 -5.166  1.00 21.79 ? 114 SER A OG  1 
ATOM   904  N N   . ALA A 1 115 ? 21.946  21.490 -3.251  1.00 20.50 ? 115 ALA A N   1 
ATOM   905  C CA  . ALA A 1 115 ? 23.100  22.308 -2.869  1.00 21.46 ? 115 ALA A CA  1 
ATOM   906  C C   . ALA A 1 115 ? 24.400  21.652 -3.351  1.00 22.80 ? 115 ALA A C   1 
ATOM   907  O O   . ALA A 1 115 ? 25.406  22.329 -3.676  1.00 24.12 ? 115 ALA A O   1 
ATOM   908  C CB  . ALA A 1 115 ? 23.210  22.753 -1.437  1.00 20.68 ? 115 ALA A CB  1 
ATOM   909  N N   . GLU A 1 116 ? 24.390  20.345 -3.468  1.00 23.05 ? 116 GLU A N   1 
ATOM   910  C CA  . GLU A 1 116 ? 25.534  19.576 -3.969  1.00 23.79 ? 116 GLU A CA  1 
ATOM   911  C C   . GLU A 1 116 ? 25.636  19.692 -5.473  1.00 23.77 ? 116 GLU A C   1 
ATOM   912  O O   . GLU A 1 116 ? 26.758  19.594 -6.023  1.00 23.98 ? 116 GLU A O   1 
ATOM   913  C CB  . GLU A 1 116 ? 25.418  18.109 -3.584  1.00 26.11 ? 116 GLU A CB  1 
ATOM   914  C CG  . GLU A 1 116 ? 26.666  17.277 -3.655  1.00 30.42 ? 116 GLU A CG  1 
ATOM   915  C CD  . GLU A 1 116 ? 27.700  17.519 -2.592  1.00 33.72 ? 116 GLU A CD  1 
ATOM   916  O OE1 . GLU A 1 116 ? 28.116  18.625 -2.249  1.00 35.19 ? 116 GLU A OE1 1 
ATOM   917  O OE2 . GLU A 1 116 ? 28.071  16.437 -2.072  1.00 35.44 ? 116 GLU A OE2 1 
ATOM   918  N N   . PHE A 1 117 ? 24.519  19.822 -6.196  1.00 23.43 ? 117 PHE A N   1 
ATOM   919  C CA  . PHE A 1 117 ? 24.534  19.923 -7.668  1.00 23.02 ? 117 PHE A CA  1 
ATOM   920  C C   . PHE A 1 117 ? 23.698  21.117 -8.148  1.00 23.01 ? 117 PHE A C   1 
ATOM   921  O O   . PHE A 1 117 ? 22.551  20.881 -8.536  1.00 22.61 ? 117 PHE A O   1 
ATOM   922  C CB  . PHE A 1 117 ? 23.955  18.668 -8.312  1.00 24.07 ? 117 PHE A CB  1 
ATOM   923  C CG  . PHE A 1 117 ? 24.660  17.408 -7.933  1.00 24.32 ? 117 PHE A CG  1 
ATOM   924  C CD1 . PHE A 1 117 ? 25.911  17.120 -8.489  1.00 24.33 ? 117 PHE A CD1 1 
ATOM   925  C CD2 . PHE A 1 117 ? 24.090  16.573 -6.975  1.00 25.69 ? 117 PHE A CD2 1 
ATOM   926  C CE1 . PHE A 1 117 ? 26.596  15.992 -8.073  1.00 25.11 ? 117 PHE A CE1 1 
ATOM   927  C CE2 . PHE A 1 117 ? 24.779  15.434 -6.525  1.00 26.00 ? 117 PHE A CE2 1 
ATOM   928  C CZ  . PHE A 1 117 ? 26.023  15.162 -7.091  1.00 25.24 ? 117 PHE A CZ  1 
ATOM   929  N N   . PRO A 1 118 ? 24.321  22.274 -8.116  1.00 22.99 ? 118 PRO A N   1 
ATOM   930  C CA  . PRO A 1 118 ? 23.646  23.526 -8.515  1.00 23.14 ? 118 PRO A CA  1 
ATOM   931  C C   . PRO A 1 118 ? 23.018  23.334 -9.860  1.00 23.91 ? 118 PRO A C   1 
ATOM   932  O O   . PRO A 1 118 ? 23.629  22.572 -10.678 1.00 24.33 ? 118 PRO A O   1 
ATOM   933  C CB  . PRO A 1 118 ? 24.717  24.585 -8.424  1.00 22.73 ? 118 PRO A CB  1 
ATOM   934  C CG  . PRO A 1 118 ? 25.701  24.048 -7.406  1.00 22.49 ? 118 PRO A CG  1 
ATOM   935  C CD  . PRO A 1 118 ? 25.692  22.524 -7.609  1.00 22.70 ? 118 PRO A CD  1 
ATOM   936  N N   . ASN A 1 119 ? 21.816  23.863 -10.060 1.00 23.91 ? 119 ASN A N   1 
ATOM   937  C CA  . ASN A 1 119 ? 21.081  23.769 -11.299 1.00 24.12 ? 119 ASN A CA  1 
ATOM   938  C C   . ASN A 1 119 ? 20.386  22.456 -11.534 1.00 23.62 ? 119 ASN A C   1 
ATOM   939  O O   . ASN A 1 119 ? 19.926  22.145 -12.674 1.00 23.70 ? 119 ASN A O   1 
ATOM   940  C CB  . ASN A 1 119 ? 22.006  24.184 -12.480 1.00 26.62 ? 119 ASN A CB  1 
ATOM   941  C CG  . ASN A 1 119 ? 22.499  25.601 -12.210 1.00 28.41 ? 119 ASN A CG  1 
ATOM   942  O OD1 . ASN A 1 119 ? 23.730  25.801 -12.078 1.00 31.45 ? 119 ASN A OD1 1 
ATOM   943  N ND2 . ASN A 1 119 ? 21.603  26.550 -12.084 1.00 28.49 ? 119 ASN A ND2 1 
ATOM   944  N N   . TRP A 1 120 ? 20.396  21.662 -10.488 1.00 23.05 ? 120 TRP A N   1 
ATOM   945  C CA  . TRP A 1 120 ? 19.748  20.318 -10.485 1.00 22.09 ? 120 TRP A CA  1 
ATOM   946  C C   . TRP A 1 120 ? 18.653  20.436 -9.433  1.00 20.86 ? 120 TRP A C   1 
ATOM   947  O O   . TRP A 1 120 ? 18.930  20.823 -8.288  1.00 19.86 ? 120 TRP A O   1 
ATOM   948  C CB  . TRP A 1 120 ? 20.717  19.152 -10.276 1.00 23.55 ? 120 TRP A CB  1 
ATOM   949  C CG  . TRP A 1 120 ? 21.566  18.922 -11.491 1.00 25.15 ? 120 TRP A CG  1 
ATOM   950  C CD1 . TRP A 1 120 ? 22.612  19.737 -11.876 1.00 25.93 ? 120 TRP A CD1 1 
ATOM   951  C CD2 . TRP A 1 120 ? 21.470  17.899 -12.471 1.00 25.33 ? 120 TRP A CD2 1 
ATOM   952  N NE1 . TRP A 1 120 ? 23.121  19.281 -13.071 1.00 26.03 ? 120 TRP A NE1 1 
ATOM   953  C CE2 . TRP A 1 120 ? 22.464  18.153 -13.437 1.00 26.01 ? 120 TRP A CE2 1 
ATOM   954  C CE3 . TRP A 1 120 ? 20.636  16.804 -12.638 1.00 25.80 ? 120 TRP A CE3 1 
ATOM   955  C CZ2 . TRP A 1 120 ? 22.673  17.330 -14.568 1.00 26.61 ? 120 TRP A CZ2 1 
ATOM   956  C CZ3 . TRP A 1 120 ? 20.818  15.998 -13.763 1.00 26.19 ? 120 TRP A CZ3 1 
ATOM   957  C CH2 . TRP A 1 120 ? 21.829  16.249 -14.713 1.00 26.13 ? 120 TRP A CH2 1 
ATOM   958  N N   . TYR A 1 121 ? 17.437  20.147 -9.904  1.00 21.10 ? 121 TYR A N   1 
ATOM   959  C CA  . TYR A 1 121 ? 16.249  20.212 -9.049  1.00 20.07 ? 121 TYR A CA  1 
ATOM   960  C C   . TYR A 1 121 ? 15.494  18.913 -8.908  1.00 19.83 ? 121 TYR A C   1 
ATOM   961  O O   . TYR A 1 121 ? 15.495  17.971 -9.701  1.00 19.52 ? 121 TYR A O   1 
ATOM   962  C CB  . TYR A 1 121 ? 15.326  21.248 -9.712  1.00 20.36 ? 121 TYR A CB  1 
ATOM   963  C CG  . TYR A 1 121 ? 15.872  22.606 -9.946  1.00 21.34 ? 121 TYR A CG  1 
ATOM   964  C CD1 . TYR A 1 121 ? 16.654  22.914 -11.090 1.00 22.04 ? 121 TYR A CD1 1 
ATOM   965  C CD2 . TYR A 1 121 ? 15.639  23.655 -9.043  1.00 21.37 ? 121 TYR A CD2 1 
ATOM   966  C CE1 . TYR A 1 121 ? 17.115  24.205 -11.328 1.00 21.43 ? 121 TYR A CE1 1 
ATOM   967  C CE2 . TYR A 1 121 ? 16.114  24.934 -9.247  1.00 20.69 ? 121 TYR A CE2 1 
ATOM   968  C CZ  . TYR A 1 121 ? 16.829  25.182 -10.397 1.00 21.98 ? 121 TYR A CZ  1 
ATOM   969  O OH  . TYR A 1 121 ? 17.258  26.487 -10.582 1.00 25.73 ? 121 TYR A OH  1 
ATOM   970  N N   . ILE A 1 122 ? 14.720  18.924 -7.812  1.00 20.08 ? 122 ILE A N   1 
ATOM   971  C CA  . ILE A 1 122 ? 13.792  17.799 -7.491  1.00 19.74 ? 122 ILE A CA  1 
ATOM   972  C C   . ILE A 1 122 ? 12.736  17.939 -8.627  1.00 20.27 ? 122 ILE A C   1 
ATOM   973  O O   . ILE A 1 122 ? 12.207  19.048 -8.811  1.00 19.87 ? 122 ILE A O   1 
ATOM   974  C CB  . ILE A 1 122 ? 13.201  17.915 -6.086  1.00 18.71 ? 122 ILE A CB  1 
ATOM   975  C CG1 . ILE A 1 122 ? 14.296  17.609 -5.034  1.00 18.70 ? 122 ILE A CG1 1 
ATOM   976  C CG2 . ILE A 1 122 ? 11.953  17.024 -5.810  1.00 19.48 ? 122 ILE A CG2 1 
ATOM   977  C CD1 . ILE A 1 122 ? 13.820  17.529 -3.569  1.00 18.45 ? 122 ILE A CD1 1 
ATOM   978  N N   . SER A 1 123 ? 12.555  16.820 -9.355  1.00 20.44 ? 123 SER A N   1 
ATOM   979  C CA  . SER A 1 123 ? 11.678  16.746 -10.483 1.00 20.03 ? 123 SER A CA  1 
ATOM   980  C C   . SER A 1 123 ? 10.666  15.603 -10.539 1.00 19.61 ? 123 SER A C   1 
ATOM   981  O O   . SER A 1 123 ? 10.848  14.514 -9.985  1.00 19.11 ? 123 SER A O   1 
ATOM   982  C CB  . SER A 1 123 ? 12.515  16.565 -11.784 1.00 19.85 ? 123 SER A CB  1 
ATOM   983  O OG  . SER A 1 123 ? 13.429  17.603 -11.911 1.00 22.58 ? 123 SER A OG  1 
ATOM   984  N N   . THR A 1 124 ? 9.649   15.934 -11.340 1.00 19.75 ? 124 THR A N   1 
ATOM   985  C CA  . THR A 1 124 ? 8.581   15.022 -11.702 1.00 20.91 ? 124 THR A CA  1 
ATOM   986  C C   . THR A 1 124 ? 8.439   15.061 -13.257 1.00 22.05 ? 124 THR A C   1 
ATOM   987  O O   . THR A 1 124 ? 8.712   16.062 -13.943 1.00 21.54 ? 124 THR A O   1 
ATOM   988  C CB  . THR A 1 124 ? 7.195   15.141 -11.002 1.00 20.49 ? 124 THR A CB  1 
ATOM   989  O OG1 . THR A 1 124 ? 6.529   16.333 -11.581 1.00 20.99 ? 124 THR A OG1 1 
ATOM   990  C CG2 . THR A 1 124 ? 7.162   15.082 -9.487  1.00 18.63 ? 124 THR A CG2 1 
ATOM   991  N N   . SER A 1 125 ? 8.000   13.904 -13.741 1.00 23.57 ? 125 SER A N   1 
ATOM   992  C CA  . SER A 1 125 ? 7.711   13.734 -15.188 1.00 25.01 ? 125 SER A CA  1 
ATOM   993  C C   . SER A 1 125 ? 6.260   14.159 -15.483 1.00 25.98 ? 125 SER A C   1 
ATOM   994  O O   . SER A 1 125 ? 5.398   14.409 -14.613 1.00 25.37 ? 125 SER A O   1 
ATOM   995  C CB  . SER A 1 125 ? 7.841   12.240 -15.570 1.00 25.58 ? 125 SER A CB  1 
ATOM   996  O OG  . SER A 1 125 ? 9.273   11.948 -15.492 1.00 27.48 ? 125 SER A OG  1 
ATOM   997  N N   . GLN A 1 126 ? 5.980   14.120 -16.789 1.00 27.38 ? 126 GLN A N   1 
ATOM   998  C CA  . GLN A 1 126 ? 4.600   14.472 -17.257 1.00 28.25 ? 126 GLN A CA  1 
ATOM   999  C C   . GLN A 1 126 ? 3.739   13.232 -17.113 1.00 28.28 ? 126 GLN A C   1 
ATOM   1000 O O   . GLN A 1 126 ? 2.560   13.388 -16.733 1.00 28.96 ? 126 GLN A O   1 
ATOM   1001 C CB  . GLN A 1 126 ? 4.555   15.141 -18.611 1.00 29.52 ? 126 GLN A CB  1 
ATOM   1002 C CG  . GLN A 1 126 ? 5.559   16.303 -18.657 1.00 32.42 ? 126 GLN A CG  1 
ATOM   1003 C CD  . GLN A 1 126 ? 4.979   17.654 -18.515 1.00 34.21 ? 126 GLN A CD  1 
ATOM   1004 O OE1 . GLN A 1 126 ? 3.738   17.740 -18.535 1.00 36.29 ? 126 GLN A OE1 1 
ATOM   1005 N NE2 . GLN A 1 126 ? 5.765   18.731 -18.467 1.00 34.47 ? 126 GLN A NE2 1 
ATOM   1006 N N   . ALA A 1 127 ? 4.286   12.069 -17.409 1.00 27.85 ? 127 ALA A N   1 
ATOM   1007 C CA  . ALA A 1 127 ? 3.523   10.802 -17.305 1.00 27.47 ? 127 ALA A CA  1 
ATOM   1008 C C   . ALA A 1 127 ? 3.294   10.560 -15.807 1.00 27.95 ? 127 ALA A C   1 
ATOM   1009 O O   . ALA A 1 127 ? 3.954   11.170 -14.967 1.00 27.96 ? 127 ALA A O   1 
ATOM   1010 C CB  . ALA A 1 127 ? 4.221   9.609  -17.879 1.00 25.20 ? 127 ALA A CB  1 
ATOM   1011 N N   . GLU A 1 128 ? 2.373   9.669  -15.555 1.00 28.62 ? 128 GLU A N   1 
ATOM   1012 C CA  . GLU A 1 128 ? 1.988   9.352  -14.154 1.00 28.62 ? 128 GLU A CA  1 
ATOM   1013 C C   . GLU A 1 128 ? 2.760   8.120  -13.805 1.00 29.09 ? 128 GLU A C   1 
ATOM   1014 O O   . GLU A 1 128 ? 3.353   7.577  -14.779 1.00 29.81 ? 128 GLU A O   1 
ATOM   1015 C CB  . GLU A 1 128 ? 0.528   9.170  -14.079 1.00 29.62 ? 128 GLU A CB  1 
ATOM   1016 C CG  . GLU A 1 128 ? -0.171  8.625  -12.826 1.00 30.60 ? 128 GLU A CG  1 
ATOM   1017 C CD  . GLU A 1 128 ? -1.658  8.996  -12.925 1.00 29.82 ? 128 GLU A CD  1 
ATOM   1018 O OE1 . GLU A 1 128 ? -2.073  9.355  -14.009 1.00 30.02 ? 128 GLU A OE1 1 
ATOM   1019 O OE2 . GLU A 1 128 ? -2.220  8.936  -11.831 1.00 28.98 ? 128 GLU A OE2 1 
ATOM   1020 N N   . HIS A 1 129 ? 2.831   7.762  -12.562 1.00 29.02 ? 129 HIS A N   1 
ATOM   1021 C CA  . HIS A 1 129 ? 3.529   6.598  -12.076 1.00 29.16 ? 129 HIS A CA  1 
ATOM   1022 C C   . HIS A 1 129 ? 5.011   6.648  -12.291 1.00 29.36 ? 129 HIS A C   1 
ATOM   1023 O O   . HIS A 1 129 ? 5.676   5.596  -12.136 1.00 30.16 ? 129 HIS A O   1 
ATOM   1024 C CB  . HIS A 1 129 ? 2.947   5.252  -12.668 1.00 30.28 ? 129 HIS A CB  1 
ATOM   1025 C CG  . HIS A 1 129 ? 1.484   5.183  -12.380 1.00 31.14 ? 129 HIS A CG  1 
ATOM   1026 N ND1 . HIS A 1 129 ? 0.998   5.015  -11.105 1.00 32.04 ? 129 HIS A ND1 1 
ATOM   1027 C CD2 . HIS A 1 129 ? 0.420   5.350  -13.191 1.00 31.80 ? 129 HIS A CD2 1 
ATOM   1028 C CE1 . HIS A 1 129 ? -0.345  5.049  -11.154 1.00 32.41 ? 129 HIS A CE1 1 
ATOM   1029 N NE2 . HIS A 1 129 ? -0.709  5.269  -12.398 1.00 32.20 ? 129 HIS A NE2 1 
ATOM   1030 N N   . LYS A 1 130 ? 5.582   7.775  -12.650 1.00 29.33 ? 130 LYS A N   1 
ATOM   1031 C CA  . LYS A 1 130 ? 7.094   7.743  -12.815 1.00 29.48 ? 130 LYS A CA  1 
ATOM   1032 C C   . LYS A 1 130 ? 7.661   8.203  -11.475 1.00 28.36 ? 130 LYS A C   1 
ATOM   1033 O O   . LYS A 1 130 ? 6.944   8.839  -10.670 1.00 28.02 ? 130 LYS A O   1 
ATOM   1034 C CB  . LYS A 1 130 ? 7.551   8.465  -14.018 1.00 32.01 ? 130 LYS A CB  1 
ATOM   1035 C CG  . LYS A 1 130 ? 6.984   7.995  -15.370 1.00 33.60 ? 130 LYS A CG  1 
ATOM   1036 C CD  . LYS A 1 130 ? 7.804   6.815  -15.842 1.00 36.65 ? 130 LYS A CD  1 
ATOM   1037 C CE  . LYS A 1 130 ? 7.718   6.595  -17.361 1.00 38.70 ? 130 LYS A CE  1 
ATOM   1038 N NZ  . LYS A 1 130 ? 6.276   6.250  -17.713 1.00 39.94 ? 130 LYS A NZ  1 
ATOM   1039 N N   . PRO A 1 131 ? 8.907   7.839  -11.220 1.00 27.51 ? 131 PRO A N   1 
ATOM   1040 C CA  . PRO A 1 131 ? 9.595   8.209  -9.983  1.00 26.99 ? 131 PRO A CA  1 
ATOM   1041 C C   . PRO A 1 131 ? 10.018  9.673  -10.052 1.00 26.64 ? 131 PRO A C   1 
ATOM   1042 O O   . PRO A 1 131 ? 10.169  10.213 -11.152 1.00 27.32 ? 131 PRO A O   1 
ATOM   1043 C CB  . PRO A 1 131 ? 10.877  7.349  -9.976  1.00 27.12 ? 131 PRO A CB  1 
ATOM   1044 C CG  . PRO A 1 131 ? 11.146  7.059  -11.403 1.00 27.11 ? 131 PRO A CG  1 
ATOM   1045 C CD  . PRO A 1 131 ? 9.796   7.105  -12.121 1.00 27.37 ? 131 PRO A CD  1 
ATOM   1046 N N   . VAL A 1 132 ? 10.198  10.215 -8.865  1.00 25.62 ? 132 VAL A N   1 
ATOM   1047 C CA  . VAL A 1 132 ? 10.670  11.603 -8.698  1.00 24.30 ? 132 VAL A CA  1 
ATOM   1048 C C   . VAL A 1 132 ? 12.206  11.446 -8.837  1.00 23.90 ? 132 VAL A C   1 
ATOM   1049 O O   . VAL A 1 132 ? 12.712  10.459 -8.253  1.00 24.54 ? 132 VAL A O   1 
ATOM   1050 C CB  . VAL A 1 132 ? 10.217  12.096 -7.324  1.00 23.45 ? 132 VAL A CB  1 
ATOM   1051 C CG1 . VAL A 1 132 ? 10.758  13.521 -7.117  1.00 22.90 ? 132 VAL A CG1 1 
ATOM   1052 C CG2 . VAL A 1 132 ? 8.696   12.019 -7.143  1.00 23.10 ? 132 VAL A CG2 1 
ATOM   1053 N N   . PHE A 1 133 ? 12.850  12.346 -9.515  1.00 22.82 ? 133 PHE A N   1 
ATOM   1054 C CA  . PHE A 1 133 ? 14.290  12.278 -9.790  1.00 22.13 ? 133 PHE A CA  1 
ATOM   1055 C C   . PHE A 1 133 ? 14.978  13.638 -9.670  1.00 22.25 ? 133 PHE A C   1 
ATOM   1056 O O   . PHE A 1 133 ? 14.343  14.634 -9.315  1.00 21.64 ? 133 PHE A O   1 
ATOM   1057 C CB  . PHE A 1 133 ? 14.447  11.761 -11.272 1.00 19.78 ? 133 PHE A CB  1 
ATOM   1058 C CG  . PHE A 1 133 ? 13.767  12.610 -12.302 1.00 19.11 ? 133 PHE A CG  1 
ATOM   1059 C CD1 . PHE A 1 133 ? 12.347  12.686 -12.373 1.00 19.05 ? 133 PHE A CD1 1 
ATOM   1060 C CD2 . PHE A 1 133 ? 14.481  13.339 -13.234 1.00 19.28 ? 133 PHE A CD2 1 
ATOM   1061 C CE1 . PHE A 1 133 ? 11.702  13.448 -13.331 1.00 17.76 ? 133 PHE A CE1 1 
ATOM   1062 C CE2 . PHE A 1 133 ? 13.862  14.094 -14.221 1.00 19.34 ? 133 PHE A CE2 1 
ATOM   1063 C CZ  . PHE A 1 133 ? 12.451  14.146 -14.272 1.00 18.10 ? 133 PHE A CZ  1 
ATOM   1064 N N   . LEU A 1 134 ? 16.289  13.599 -9.951  1.00 22.76 ? 134 LEU A N   1 
ATOM   1065 C CA  . LEU A 1 134 ? 17.099  14.846 -9.950  1.00 23.69 ? 134 LEU A CA  1 
ATOM   1066 C C   . LEU A 1 134 ? 17.244  15.195 -11.436 1.00 24.53 ? 134 LEU A C   1 
ATOM   1067 O O   . LEU A 1 134 ? 17.758  14.350 -12.187 1.00 24.47 ? 134 LEU A O   1 
ATOM   1068 C CB  . LEU A 1 134 ? 18.400  14.583 -9.268  1.00 24.25 ? 134 LEU A CB  1 
ATOM   1069 C CG  . LEU A 1 134 ? 18.946  15.474 -8.191  1.00 25.38 ? 134 LEU A CG  1 
ATOM   1070 C CD1 . LEU A 1 134 ? 20.395  15.861 -8.508  1.00 25.77 ? 134 LEU A CD1 1 
ATOM   1071 C CD2 . LEU A 1 134 ? 18.056  16.680 -7.934  1.00 24.26 ? 134 LEU A CD2 1 
ATOM   1072 N N   . GLY A 1 135 ? 16.745  16.342 -11.822 1.00 25.68 ? 135 GLY A N   1 
ATOM   1073 C CA  . GLY A 1 135 ? 16.753  16.809 -13.190 1.00 27.76 ? 135 GLY A CA  1 
ATOM   1074 C C   . GLY A 1 135 ? 17.394  18.152 -13.353 1.00 30.01 ? 135 GLY A C   1 
ATOM   1075 O O   . GLY A 1 135 ? 17.585  18.938 -12.377 1.00 30.04 ? 135 GLY A O   1 
ATOM   1076 N N   . ASN A 1 136 ? 17.730  18.464 -14.594 1.00 32.32 ? 136 ASN A N   1 
ATOM   1077 C CA  . ASN A 1 136 ? 18.368  19.795 -14.839 1.00 34.95 ? 136 ASN A CA  1 
ATOM   1078 C C   . ASN A 1 136 ? 17.327  20.687 -15.477 1.00 36.20 ? 136 ASN A C   1 
ATOM   1079 O O   . ASN A 1 136 ? 17.679  21.560 -16.284 1.00 36.36 ? 136 ASN A O   1 
ATOM   1080 C CB  . ASN A 1 136 ? 19.711  19.710 -15.447 1.00 37.98 ? 136 ASN A CB  1 
ATOM   1081 C CG  . ASN A 1 136 ? 19.917  19.148 -16.795 1.00 40.57 ? 136 ASN A CG  1 
ATOM   1082 O OD1 . ASN A 1 136 ? 20.997  19.301 -17.423 1.00 42.20 ? 136 ASN A OD1 1 
ATOM   1083 N ND2 . ASN A 1 136 ? 18.938  18.396 -17.285 1.00 43.16 ? 136 ASN A ND2 1 
ATOM   1084 N N   . ASN A 1 137 ? 16.066  20.421 -15.083 1.00 36.96 ? 137 ASN A N   1 
ATOM   1085 C CA  . ASN A 1 137 ? 15.008  21.295 -15.719 1.00 38.37 ? 137 ASN A CA  1 
ATOM   1086 C C   . ASN A 1 137 ? 15.113  21.162 -17.249 1.00 39.17 ? 137 ASN A C   1 
ATOM   1087 O O   . ASN A 1 137 ? 15.304  22.124 -17.991 1.00 38.93 ? 137 ASN A O   1 
ATOM   1088 C CB  . ASN A 1 137 ? 15.340  22.702 -15.214 1.00 39.28 ? 137 ASN A CB  1 
ATOM   1089 C CG  . ASN A 1 137 ? 14.224  23.684 -15.620 1.00 40.41 ? 137 ASN A CG  1 
ATOM   1090 O OD1 . ASN A 1 137 ? 13.162  23.184 -16.071 1.00 40.74 ? 137 ASN A OD1 1 
ATOM   1091 N ND2 . ASN A 1 137 ? 14.499  24.957 -15.414 1.00 39.65 ? 137 ASN A ND2 1 
ATOM   1092 N N   . SER A 1 138 ? 15.004  19.914 -17.725 1.00 39.97 ? 138 SER A N   1 
ATOM   1093 C CA  . SER A 1 138 ? 15.057  19.611 -19.185 1.00 41.00 ? 138 SER A CA  1 
ATOM   1094 C C   . SER A 1 138 ? 13.538  19.379 -19.493 1.00 41.37 ? 138 SER A C   1 
ATOM   1095 O O   . SER A 1 138 ? 12.790  18.964 -18.625 1.00 40.62 ? 138 SER A O   1 
ATOM   1096 C CB  . SER A 1 138 ? 15.765  18.335 -19.571 1.00 41.81 ? 138 SER A CB  1 
ATOM   1097 O OG  . SER A 1 138 ? 14.796  17.244 -19.326 1.00 42.78 ? 138 SER A OG  1 
ATOM   1098 N N   . GLY A 1 139 ? 13.216  19.727 -20.704 1.00 42.13 ? 139 GLY A N   1 
ATOM   1099 C CA  . GLY A 1 139 ? 11.889  19.730 -21.274 1.00 41.82 ? 139 GLY A CA  1 
ATOM   1100 C C   . GLY A 1 139 ? 10.969  18.713 -20.642 1.00 41.86 ? 139 GLY A C   1 
ATOM   1101 O O   . GLY A 1 139 ? 11.328  17.525 -20.418 1.00 41.88 ? 139 GLY A O   1 
ATOM   1102 N N   . GLN A 1 140 ? 9.749   19.203 -20.436 1.00 41.20 ? 141 GLN A N   1 
ATOM   1103 C CA  . GLN A 1 140 ? 8.696   18.330 -19.869 1.00 40.10 ? 141 GLN A CA  1 
ATOM   1104 C C   . GLN A 1 140 ? 8.944   18.237 -18.372 1.00 38.14 ? 141 GLN A C   1 
ATOM   1105 O O   . GLN A 1 140 ? 7.908   18.180 -17.700 1.00 37.86 ? 141 GLN A O   1 
ATOM   1106 C CB  . GLN A 1 140 ? 8.667   16.915 -20.412 1.00 42.74 ? 141 GLN A CB  1 
ATOM   1107 C CG  . GLN A 1 140 ? 8.702   16.866 -21.947 1.00 45.53 ? 141 GLN A CG  1 
ATOM   1108 C CD  . GLN A 1 140 ? 7.854   15.681 -22.407 1.00 47.71 ? 141 GLN A CD  1 
ATOM   1109 O OE1 . GLN A 1 140 ? 7.559   14.760 -21.625 1.00 47.99 ? 141 GLN A OE1 1 
ATOM   1110 N NE2 . GLN A 1 140 ? 7.468   15.776 -23.688 1.00 48.76 ? 141 GLN A NE2 1 
ATOM   1111 N N   . ASP A 1 141 ? 10.204  18.212 -17.977 1.00 36.19 ? 142 ASP A N   1 
ATOM   1112 C CA  . ASP A 1 141 ? 10.458  18.107 -16.529 1.00 33.59 ? 142 ASP A CA  1 
ATOM   1113 C C   . ASP A 1 141 ? 9.587   19.211 -15.848 1.00 30.47 ? 142 ASP A C   1 
ATOM   1114 O O   . ASP A 1 141 ? 9.430   20.273 -16.449 1.00 30.75 ? 142 ASP A O   1 
ATOM   1115 C CB  . ASP A 1 141 ? 11.931  18.308 -16.143 1.00 36.09 ? 142 ASP A CB  1 
ATOM   1116 C CG  . ASP A 1 141 ? 12.884  17.244 -16.672 1.00 37.65 ? 142 ASP A CG  1 
ATOM   1117 O OD1 . ASP A 1 141 ? 12.302  16.291 -17.244 1.00 38.51 ? 142 ASP A OD1 1 
ATOM   1118 O OD2 . ASP A 1 141 ? 14.135  17.392 -16.589 1.00 37.95 ? 142 ASP A OD2 1 
ATOM   1119 N N   . ILE A 1 142 ? 9.112   18.892 -14.681 1.00 26.91 ? 143 ILE A N   1 
ATOM   1120 C CA  . ILE A 1 142 ? 8.367   19.743 -13.790 1.00 23.45 ? 143 ILE A CA  1 
ATOM   1121 C C   . ILE A 1 142 ? 9.214   19.954 -12.541 1.00 22.20 ? 143 ILE A C   1 
ATOM   1122 O O   . ILE A 1 142 ? 9.659   19.006 -11.880 1.00 22.09 ? 143 ILE A O   1 
ATOM   1123 C CB  . ILE A 1 142 ? 6.938   19.201 -13.464 1.00 21.16 ? 143 ILE A CB  1 
ATOM   1124 C CG1 . ILE A 1 142 ? 6.153   19.186 -14.828 1.00 20.48 ? 143 ILE A CG1 1 
ATOM   1125 C CG2 . ILE A 1 142 ? 6.194   19.917 -12.347 1.00 18.90 ? 143 ILE A CG2 1 
ATOM   1126 C CD1 . ILE A 1 142 ? 5.039   18.082 -14.836 1.00 20.49 ? 143 ILE A CD1 1 
ATOM   1127 N N   . ILE A 1 143 ? 9.473   21.182 -12.201 1.00 21.66 ? 144 ILE A N   1 
ATOM   1128 C CA  . ILE A 1 143 ? 10.302  21.525 -11.046 1.00 21.16 ? 144 ILE A CA  1 
ATOM   1129 C C   . ILE A 1 143 ? 9.609   22.438 -10.064 1.00 20.92 ? 144 ILE A C   1 
ATOM   1130 O O   . ILE A 1 143 ? 10.332  22.805 -9.153  1.00 20.59 ? 144 ILE A O   1 
ATOM   1131 C CB  . ILE A 1 143 ? 11.666  22.204 -11.492 1.00 20.84 ? 144 ILE A CB  1 
ATOM   1132 C CG1 . ILE A 1 143 ? 11.429  23.660 -11.946 1.00 19.28 ? 144 ILE A CG1 1 
ATOM   1133 C CG2 . ILE A 1 143 ? 12.437  21.346 -12.528 1.00 20.49 ? 144 ILE A CG2 1 
ATOM   1134 C CD1 . ILE A 1 143 ? 12.709  24.382 -12.479 1.00 17.74 ? 144 ILE A CD1 1 
ATOM   1135 N N   . ASP A 1 144 ? 8.357   22.754 -10.308 1.00 21.15 ? 145 ASP A N   1 
ATOM   1136 C CA  . ASP A 1 144 ? 7.616   23.675 -9.427  1.00 21.14 ? 145 ASP A CA  1 
ATOM   1137 C C   . ASP A 1 144 ? 6.574   22.844 -8.669  1.00 20.60 ? 145 ASP A C   1 
ATOM   1138 O O   . ASP A 1 144 ? 5.942   21.961 -9.246  1.00 20.14 ? 145 ASP A O   1 
ATOM   1139 C CB  . ASP A 1 144 ? 6.984   24.847 -10.212 1.00 22.83 ? 145 ASP A CB  1 
ATOM   1140 C CG  . ASP A 1 144 ? 8.011   25.789 -10.786 1.00 23.11 ? 145 ASP A CG  1 
ATOM   1141 O OD1 . ASP A 1 144 ? 8.619   26.564 -10.090 1.00 24.13 ? 145 ASP A OD1 1 
ATOM   1142 O OD2 . ASP A 1 144 ? 8.332   25.668 -11.984 1.00 24.63 ? 145 ASP A OD2 1 
ATOM   1143 N N   . PHE A 1 145 ? 6.467   23.208 -7.412  1.00 20.37 ? 146 PHE A N   1 
ATOM   1144 C CA  . PHE A 1 145 ? 5.599   22.541 -6.461  1.00 20.26 ? 146 PHE A CA  1 
ATOM   1145 C C   . PHE A 1 145 ? 4.891   23.613 -5.615  1.00 20.98 ? 146 PHE A C   1 
ATOM   1146 O O   . PHE A 1 145 ? 5.314   24.730 -5.503  1.00 21.17 ? 146 PHE A O   1 
ATOM   1147 C CB  . PHE A 1 145 ? 6.376   21.532 -5.598  1.00 17.48 ? 146 PHE A CB  1 
ATOM   1148 C CG  . PHE A 1 145 ? 7.051   20.410 -6.298  1.00 16.41 ? 146 PHE A CG  1 
ATOM   1149 C CD1 . PHE A 1 145 ? 8.380   20.563 -6.769  1.00 15.77 ? 146 PHE A CD1 1 
ATOM   1150 C CD2 . PHE A 1 145 ? 6.466   19.146 -6.384  1.00 14.93 ? 146 PHE A CD2 1 
ATOM   1151 C CE1 . PHE A 1 145 ? 9.060   19.536 -7.424  1.00 13.85 ? 146 PHE A CE1 1 
ATOM   1152 C CE2 . PHE A 1 145 ? 7.163   18.085 -6.995  1.00 14.93 ? 146 PHE A CE2 1 
ATOM   1153 C CZ  . PHE A 1 145 ? 8.472   18.278 -7.510  1.00 14.23 ? 146 PHE A CZ  1 
ATOM   1154 N N   . THR A 1 146 ? 3.824   23.144 -4.995  1.00 21.63 ? 147 THR A N   1 
ATOM   1155 C CA  . THR A 1 146 ? 2.927   23.885 -4.089  1.00 22.11 ? 147 THR A CA  1 
ATOM   1156 C C   . THR A 1 146 ? 3.177   23.237 -2.753  1.00 22.33 ? 147 THR A C   1 
ATOM   1157 O O   . THR A 1 146 ? 3.395   22.018 -2.787  1.00 21.37 ? 147 THR A O   1 
ATOM   1158 C CB  . THR A 1 146 ? 1.451   23.680 -4.665  1.00 23.30 ? 147 THR A CB  1 
ATOM   1159 O OG1 . THR A 1 146 ? 1.107   25.008 -5.231  1.00 26.07 ? 147 THR A OG1 1 
ATOM   1160 C CG2 . THR A 1 146 ? 0.352   23.112 -3.900  1.00 23.42 ? 147 THR A CG2 1 
ATOM   1161 N N   . MET A 1 147 ? 3.263   23.979 -1.666  1.00 23.85 ? 148 MET A N   1 
ATOM   1162 C CA  . MET A 1 147 ? 3.509   23.247 -0.356  1.00 25.16 ? 148 MET A CA  1 
ATOM   1163 C C   . MET A 1 147 ? 2.236   23.447 0.486   1.00 25.84 ? 148 MET A C   1 
ATOM   1164 O O   . MET A 1 147 ? 1.818   24.618 0.564   1.00 26.34 ? 148 MET A O   1 
ATOM   1165 C CB  . MET A 1 147 ? 4.712   23.853 0.302   1.00 25.83 ? 148 MET A CB  1 
ATOM   1166 C CG  . MET A 1 147 ? 6.020   23.643 -0.346  1.00 26.66 ? 148 MET A CG  1 
ATOM   1167 S SD  . MET A 1 147 ? 7.297   24.019 0.956   1.00 28.19 ? 148 MET A SD  1 
ATOM   1168 C CE  . MET A 1 147 ? 6.623   25.537 1.572   1.00 27.24 ? 148 MET A CE  1 
ATOM   1169 N N   . GLU A 1 148 ? 1.724   22.461 1.109   1.00 26.44 ? 149 GLU A N   1 
ATOM   1170 C CA  . GLU A 1 148 ? 0.516   22.503 1.968   1.00 27.49 ? 149 GLU A CA  1 
ATOM   1171 C C   . GLU A 1 148 ? 0.895   22.088 3.367   1.00 27.49 ? 149 GLU A C   1 
ATOM   1172 O O   . GLU A 1 148 ? 1.307   20.919 3.518   1.00 27.35 ? 149 GLU A O   1 
ATOM   1173 C CB  . GLU A 1 148 ? -0.467  21.418 1.475   1.00 30.52 ? 149 GLU A CB  1 
ATOM   1174 C CG  . GLU A 1 148 ? -1.568  20.895 2.378   1.00 33.90 ? 149 GLU A CG  1 
ATOM   1175 C CD  . GLU A 1 148 ? -2.419  19.784 1.824   1.00 35.61 ? 149 GLU A CD  1 
ATOM   1176 O OE1 . GLU A 1 148 ? -2.788  20.019 0.640   1.00 35.34 ? 149 GLU A OE1 1 
ATOM   1177 O OE2 . GLU A 1 148 ? -2.707  18.731 2.398   1.00 36.80 ? 149 GLU A OE2 1 
ATOM   1178 N N   . SER A 1 149 ? 0.761   22.913 4.339   1.00 28.39 ? 150 SER A N   1 
ATOM   1179 C CA  . SER A 1 149 ? 1.070   22.633 5.744   1.00 29.37 ? 150 SER A CA  1 
ATOM   1180 C C   . SER A 1 149 ? 0.184   21.534 6.326   1.00 29.89 ? 150 SER A C   1 
ATOM   1181 O O   . SER A 1 149 ? -1.047  21.478 5.997   1.00 31.06 ? 150 SER A O   1 
ATOM   1182 C CB  . SER A 1 149 ? 0.825   23.882 6.605   1.00 30.70 ? 150 SER A CB  1 
ATOM   1183 O OG  . SER A 1 149 ? 1.873   24.777 6.225   1.00 33.57 ? 150 SER A OG  1 
ATOM   1184 N N   . VAL A 1 150 ? 0.752   20.732 7.174   1.00 28.93 ? 151 VAL A N   1 
ATOM   1185 C CA  . VAL A 1 150 ? 0.068   19.641 7.831   1.00 29.18 ? 151 VAL A CA  1 
ATOM   1186 C C   . VAL A 1 150 ? 0.109   19.958 9.344   1.00 30.07 ? 151 VAL A C   1 
ATOM   1187 O O   . VAL A 1 150 ? 1.246   20.254 9.844   1.00 30.79 ? 151 VAL A O   1 
ATOM   1188 C CB  . VAL A 1 150 ? 0.751   18.299 7.511   1.00 28.84 ? 151 VAL A CB  1 
ATOM   1189 C CG1 . VAL A 1 150 ? 0.103   17.185 8.301   1.00 28.40 ? 151 VAL A CG1 1 
ATOM   1190 C CG2 . VAL A 1 150 ? 0.714   17.936 6.051   1.00 29.11 ? 151 VAL A CG2 1 
HETATM 1191 O O   . HOH B 2 .   ? 3.782   15.096 -0.458  1.00 25.02 ? 201 HOH A O   1 
HETATM 1192 O O   . HOH B 2 .   ? 12.234  21.711 -7.621  1.00 18.39 ? 202 HOH A O   1 
HETATM 1193 O O   . HOH B 2 .   ? 17.455  11.007 -9.751  1.00 23.38 ? 203 HOH A O   1 
HETATM 1194 O O   . HOH B 2 .   ? 17.383  16.445 3.023   1.00 16.53 ? 204 HOH A O   1 
HETATM 1195 O O   . HOH B 2 .   ? 21.953  18.246 -2.546  1.00 20.05 ? 205 HOH A O   1 
HETATM 1196 O O   . HOH B 2 .   ? 4.758   10.434 -12.248 1.00 27.80 ? 206 HOH A O   1 
HETATM 1197 O O   . HOH B 2 .   ? -3.024  14.695 -7.195  1.00 20.73 ? 207 HOH A O   1 
HETATM 1198 O O   . HOH B 2 .   ? 7.566   11.569 -11.858 1.00 26.56 ? 208 HOH A O   1 
HETATM 1199 O O   . HOH B 2 .   ? 14.262  17.646 8.101   1.00 23.76 ? 211 HOH A O   1 
HETATM 1200 O O   . HOH B 2 .   ? 12.359  9.004  -6.028  1.00 28.87 ? 212 HOH A O   1 
HETATM 1201 O O   . HOH B 2 .   ? 1.510   15.489 -15.404 1.00 27.44 ? 213 HOH A O   1 
HETATM 1202 O O   . HOH B 2 .   ? 0.405   22.537 -7.351  0.80 24.63 ? 215 HOH A O   1 
HETATM 1203 O O   . HOH B 2 .   ? 14.278  18.771 -14.588 1.00 35.01 ? 216 HOH A O   1 
HETATM 1204 O O   . HOH B 2 .   ? 3.392   26.469 -2.350  1.00 28.50 ? 217 HOH A O   1 
HETATM 1205 O O   . HOH B 2 .   ? 11.818  12.471 9.709   1.00 28.18 ? 218 HOH A O   1 
HETATM 1206 O O   . HOH B 2 .   ? 12.391  29.889 0.314   0.80 24.78 ? 219 HOH A O   1 
HETATM 1207 O O   . HOH B 2 .   ? -1.321  10.460 5.248   0.60 35.54 ? 221 HOH A O   1 
HETATM 1208 O O   . HOH B 2 .   ? 3.121   7.296  0.432   1.00 31.86 ? 223 HOH A O   1 
HETATM 1209 O O   . HOH B 2 .   ? 16.180  5.972  -3.220  0.80 29.33 ? 224 HOH A O   1 
HETATM 1210 O O   . HOH B 2 .   ? 18.582  12.023 -11.988 0.60 24.18 ? 226 HOH A O   1 
HETATM 1211 O O   . HOH B 2 .   ? -2.792  20.936 -4.169  1.00 28.77 ? 227 HOH A O   1 
HETATM 1212 O O   . HOH B 2 .   ? 0.608   8.889  -18.009 0.80 37.77 ? 228 HOH A O   1 
HETATM 1213 O O   . HOH B 2 .   ? 20.287  4.574  2.672   0.60 23.48 ? 229 HOH A O   1 
HETATM 1214 O O   . HOH B 2 .   ? 11.783  9.142  -13.372 0.60 31.91 ? 232 HOH A O   1 
HETATM 1215 O O   . HOH B 2 .   ? 15.411  9.244  -9.347  0.80 26.60 ? 233 HOH A O   1 
HETATM 1216 O O   . HOH B 2 .   ? 19.273  23.956 -14.551 0.60 30.21 ? 234 HOH A O   1 
HETATM 1217 O O   . HOH B 2 .   ? 23.401  7.700  5.819   0.60 25.15 ? 235 HOH A O   1 
HETATM 1218 O O   . HOH B 2 .   ? 17.623  12.590 17.231  0.80 33.12 ? 240 HOH A O   1 
HETATM 1219 O O   . HOH B 2 .   ? 24.128  8.269  9.772   1.00 27.54 ? 242 HOH A O   1 
HETATM 1220 O O   . HOH B 2 .   ? 7.600   23.392 -13.505 1.00 25.50 ? 248 HOH A O   1 
HETATM 1221 O O   . HOH B 2 .   ? 27.502  14.764 1.754   0.80 19.33 ? 249 HOH A O   1 
HETATM 1222 O O   . HOH B 2 .   ? 4.939   28.482 -0.241  0.80 34.29 ? 250 HOH A O   1 
HETATM 1223 O O   . HOH B 2 .   ? 4.963   10.235 5.222   0.60 24.40 ? 257 HOH A O   1 
HETATM 1224 O O   . HOH B 2 .   ? 24.598  10.005 7.560   0.60 29.55 ? 259 HOH A O   1 
HETATM 1225 O O   . HOH B 2 .   ? 29.285  17.790 3.407   0.80 30.10 ? 260 HOH A O   1 
HETATM 1226 O O   . HOH B 2 .   ? 28.611  22.229 -4.268  1.00 36.81 ? 263 HOH A O   1 
HETATM 1227 O O   . HOH B 2 .   ? 24.894  20.581 -14.330 0.40 26.38 ? 266 HOH A O   1 
HETATM 1228 O O   . HOH B 2 .   ? -1.145  12.479 3.910   1.00 33.78 ? 270 HOH A O   1 
HETATM 1229 O O   . HOH B 2 .   ? 11.210  32.031 0.764   0.40 32.39 ? 301 HOH A O   1 
HETATM 1230 O O   . HOH B 2 .   ? 21.222  14.488 -18.620 1.00 47.07 ? 302 HOH A O   1 
HETATM 1231 O O   . HOH B 2 .   ? 20.618  16.840 -17.971 1.00 45.09 ? 303 HOH A O   1 
HETATM 1232 O O   . HOH B 2 .   ? 18.467  20.678 9.852   1.00 25.75 ? 305 HOH A O   1 
HETATM 1233 O O   . HOH B 2 .   ? 23.796  25.848 0.290   1.00 38.79 ? 308 HOH A O   1 
HETATM 1234 O O   . HOH B 2 .   ? 27.983  5.553  -9.349  0.60 33.90 ? 311 HOH A O   1 
HETATM 1235 O O   . HOH B 2 .   ? 14.494  8.476  -12.796 0.80 35.38 ? 314 HOH A O   1 
HETATM 1236 O O   . HOH B 2 .   ? 9.357   14.255 11.518  0.60 27.56 ? 319 HOH A O   1 
HETATM 1237 O O   . HOH B 2 .   ? 7.606   21.378 -17.468 0.60 33.16 ? 324 HOH A O   1 
HETATM 1238 O O   . HOH B 2 .   ? 24.772  24.315 3.695   1.00 42.16 ? 325 HOH A O   1 
HETATM 1239 O O   . HOH B 2 .   ? 30.774  15.186 -2.178  0.80 37.47 ? 326 HOH A O   1 
HETATM 1240 O O   . HOH B 2 .   ? 10.856  2.301  -10.755 1.00 38.78 ? 328 HOH A O   1 
HETATM 1241 O O   . HOH B 2 .   ? 2.747   4.100  0.877   1.00 37.34 ? 331 HOH A O   1 
HETATM 1242 O O   . HOH B 2 .   ? 14.949  28.661 -10.251 0.60 25.44 ? 334 HOH A O   1 
HETATM 1243 O O   . HOH B 2 .   ? 21.953  26.075 13.169  1.00 40.56 ? 343 HOH A O   1 
HETATM 1244 O O   . HOH B 2 .   ? 0.349   12.901 9.983   1.00 42.50 ? 352 HOH A O   1 
HETATM 1245 O O   . HOH B 2 .   ? 10.200  24.441 -15.696 0.80 36.56 ? 355 HOH A O   1 
HETATM 1246 O O   . HOH B 2 .   ? 14.564  8.060  -4.897  0.80 26.85 ? 357 HOH A O   1 
HETATM 1247 O O   . HOH B 2 .   ? 3.353   7.199  2.782   0.60 34.08 ? 359 HOH A O   1 
HETATM 1248 O O   . HOH B 2 .   ? 26.285  21.670 4.736   0.60 35.24 ? 363 HOH A O   1 
HETATM 1249 O O   . HOH B 2 .   ? 15.334  26.352 -14.282 0.60 44.19 ? 365 HOH A O   1 
HETATM 1250 O O   . HOH B 2 .   ? 10.289  27.056 -13.490 0.40 27.45 ? 366 HOH A O   1 
HETATM 1251 O O   . HOH B 2 .   ? 12.711  0.389  2.611   0.60 32.63 ? 372 HOH A O   1 
HETATM 1252 O O   . HOH B 2 .   ? 14.221  12.746 15.315  0.80 34.61 ? 373 HOH A O   1 
HETATM 1253 O O   . HOH B 2 .   ? 2.433   10.175 8.353   0.60 48.49 ? 374 HOH A O   1 
HETATM 1254 O O   . HOH B 2 .   ? 2.468   27.276 6.285   0.80 37.89 ? 378 HOH A O   1 
HETATM 1255 O O   . HOH B 2 .   ? -3.405  25.814 1.511   0.60 36.84 ? 379 HOH A O   1 
HETATM 1256 O O   . HOH B 2 .   ? -4.290  23.027 2.898   0.40 36.11 ? 381 HOH A O   1 
HETATM 1257 O O   . HOH B 2 .   ? 8.916   19.988 3.620   0.40 21.59 ? 400 HOH A O   1 
HETATM 1258 O O   . HOH B 2 .   ? -12.233 13.858 -8.184  0.80 30.12 ? 401 HOH A O   1 
HETATM 1259 O O   . HOH B 2 .   ? 15.775  10.734 12.510  0.60 30.74 ? 402 HOH A O   1 
HETATM 1260 O O   . HOH B 2 .   ? 17.680  12.626 -15.029 0.60 25.72 ? 406 HOH A O   1 
HETATM 1261 O O   . HOH B 2 .   ? -0.352  19.713 -1.560  0.80 31.06 ? 436 HOH A O   1 
HETATM 1262 O O   . HOH B 2 .   ? 21.969  4.627  0.914   0.40 25.09 ? 438 HOH A O   1 
HETATM 1263 O O   . HOH B 2 .   ? 18.361  14.825 17.348  0.80 37.29 ? 440 HOH A O   1 
HETATM 1264 O O   . HOH B 2 .   ? 10.559  12.455 -17.576 0.60 26.51 ? 441 HOH A O   1 
HETATM 1265 O O   . HOH B 2 .   ? 25.055  21.819 15.139  0.80 46.74 ? 451 HOH A O   1 
HETATM 1266 O O   . HOH B 2 .   ? 19.028  27.773 -9.940  0.60 28.13 ? 453 HOH A O   1 
HETATM 1267 O O   . HOH B 2 .   ? 25.145  8.121  0.222   0.60 29.96 ? 466 HOH A O   1 
HETATM 1268 O O   . HOH B 2 .   ? 25.240  6.172  -2.931  0.80 36.82 ? 467 HOH A O   1 
HETATM 1269 O O   . HOH B 2 .   ? -1.107  25.359 3.803   0.80 33.40 ? 474 HOH A O   1 
HETATM 1270 O O   . HOH B 2 .   ? 1.582   33.631 -3.119  0.80 41.96 ? 503 HOH A O   1 
HETATM 1271 O O   . HOH B 2 .   ? 33.640  15.191 -0.083  0.80 45.91 ? 506 HOH A O   1 
HETATM 1272 O O   . HOH B 2 .   ? 30.185  17.593 -0.400  0.80 36.24 ? 511 HOH A O   1 
HETATM 1273 O O   . HOH B 2 .   ? 3.823   21.916 10.558  0.60 28.43 ? 514 HOH A O   1 
HETATM 1274 O O   . HOH B 2 .   ? 15.691  3.266  -5.854  1.00 45.48 ? 526 HOH A O   1 
HETATM 1275 O O   . HOH B 2 .   ? 24.462  27.422 -5.531  0.80 43.36 ? 527 HOH A O   1 
HETATM 1276 O O   . HOH B 2 .   ? 18.567  5.326  -6.419  0.80 45.93 ? 550 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   ILE 3   3   ?   ?   ?   A . n 
A 1 4   ARG 4   4   ?   ?   ?   A . n 
A 1 5   GLN 5   5   5   GLN GLN A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   HIS 7   7   7   HIS HIS A . n 
A 1 8   TYR 8   8   8   TYR TYR A . n 
A 1 9   ARG 9   9   9   ARG ARG A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  ILE 41  41  41  ILE ILE A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  TYR 68  68  68  TYR TYR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  MET 73  73  73  MET MET A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  PRO 91  91  91  PRO PRO A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  MET 95  95  95  MET MET A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 GLU 113 113 113 GLU GLU A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 HIS 129 129 129 HIS HIS A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 GLN 140 141 141 GLN GLN A . n 
A 1 141 ASP 141 142 142 ASP ASP A . n 
A 1 142 ILE 142 143 143 ILE ILE A . n 
A 1 143 ILE 143 144 144 ILE ILE A . n 
A 1 144 ASP 144 145 145 ASP ASP A . n 
A 1 145 PHE 145 146 146 PHE PHE A . n 
A 1 146 THR 146 147 147 THR THR A . n 
A 1 147 MET 147 148 148 MET MET A . n 
A 1 148 GLU 148 149 149 GLU GLU A . n 
A 1 149 SER 149 150 150 SER SER A . n 
A 1 150 VAL 150 151 151 VAL VAL A . n 
A 1 151 SER 151 152 ?   ?   ?   A . n 
A 1 152 SER 152 153 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  201 201 HOH HOH A . 
B 2 HOH 2  202 202 HOH HOH A . 
B 2 HOH 3  203 203 HOH HOH A . 
B 2 HOH 4  204 204 HOH HOH A . 
B 2 HOH 5  205 205 HOH HOH A . 
B 2 HOH 6  206 206 HOH HOH A . 
B 2 HOH 7  207 207 HOH HOH A . 
B 2 HOH 8  208 208 HOH HOH A . 
B 2 HOH 9  211 211 HOH HOH A . 
B 2 HOH 10 212 212 HOH HOH A . 
B 2 HOH 11 213 213 HOH HOH A . 
B 2 HOH 12 215 215 HOH HOH A . 
B 2 HOH 13 216 216 HOH HOH A . 
B 2 HOH 14 217 217 HOH HOH A . 
B 2 HOH 15 218 218 HOH HOH A . 
B 2 HOH 16 219 219 HOH HOH A . 
B 2 HOH 17 221 221 HOH HOH A . 
B 2 HOH 18 223 223 HOH HOH A . 
B 2 HOH 19 224 224 HOH HOH A . 
B 2 HOH 20 226 226 HOH HOH A . 
B 2 HOH 21 227 227 HOH HOH A . 
B 2 HOH 22 228 228 HOH HOH A . 
B 2 HOH 23 229 229 HOH HOH A . 
B 2 HOH 24 232 232 HOH HOH A . 
B 2 HOH 25 233 233 HOH HOH A . 
B 2 HOH 26 234 234 HOH HOH A . 
B 2 HOH 27 235 235 HOH HOH A . 
B 2 HOH 28 240 240 HOH HOH A . 
B 2 HOH 29 242 242 HOH HOH A . 
B 2 HOH 30 248 248 HOH HOH A . 
B 2 HOH 31 249 249 HOH HOH A . 
B 2 HOH 32 250 250 HOH HOH A . 
B 2 HOH 33 257 257 HOH HOH A . 
B 2 HOH 34 259 259 HOH HOH A . 
B 2 HOH 35 260 260 HOH HOH A . 
B 2 HOH 36 263 263 HOH HOH A . 
B 2 HOH 37 266 266 HOH HOH A . 
B 2 HOH 38 270 270 HOH HOH A . 
B 2 HOH 39 301 301 HOH HOH A . 
B 2 HOH 40 302 302 HOH HOH A . 
B 2 HOH 41 303 303 HOH HOH A . 
B 2 HOH 42 305 305 HOH HOH A . 
B 2 HOH 43 308 308 HOH HOH A . 
B 2 HOH 44 311 311 HOH HOH A . 
B 2 HOH 45 314 314 HOH HOH A . 
B 2 HOH 46 319 319 HOH HOH A . 
B 2 HOH 47 324 324 HOH HOH A . 
B 2 HOH 48 325 325 HOH HOH A . 
B 2 HOH 49 326 326 HOH HOH A . 
B 2 HOH 50 328 328 HOH HOH A . 
B 2 HOH 51 331 331 HOH HOH A . 
B 2 HOH 52 334 334 HOH HOH A . 
B 2 HOH 53 343 343 HOH HOH A . 
B 2 HOH 54 352 352 HOH HOH A . 
B 2 HOH 55 355 355 HOH HOH A . 
B 2 HOH 56 357 357 HOH HOH A . 
B 2 HOH 57 359 359 HOH HOH A . 
B 2 HOH 58 363 363 HOH HOH A . 
B 2 HOH 59 365 365 HOH HOH A . 
B 2 HOH 60 366 366 HOH HOH A . 
B 2 HOH 61 372 372 HOH HOH A . 
B 2 HOH 62 373 373 HOH HOH A . 
B 2 HOH 63 374 374 HOH HOH A . 
B 2 HOH 64 378 378 HOH HOH A . 
B 2 HOH 65 379 379 HOH HOH A . 
B 2 HOH 66 381 381 HOH HOH A . 
B 2 HOH 67 400 400 HOH HOH A . 
B 2 HOH 68 401 401 HOH HOH A . 
B 2 HOH 69 402 402 HOH HOH A . 
B 2 HOH 70 406 406 HOH HOH A . 
B 2 HOH 71 436 436 HOH HOH A . 
B 2 HOH 72 438 438 HOH HOH A . 
B 2 HOH 73 440 440 HOH HOH A . 
B 2 HOH 74 441 441 HOH HOH A . 
B 2 HOH 75 451 451 HOH HOH A . 
B 2 HOH 76 453 453 HOH HOH A . 
B 2 HOH 77 466 466 HOH HOH A . 
B 2 HOH 78 467 467 HOH HOH A . 
B 2 HOH 79 474 474 HOH HOH A . 
B 2 HOH 80 503 503 HOH HOH A . 
B 2 HOH 81 506 506 HOH HOH A . 
B 2 HOH 82 511 511 HOH HOH A . 
B 2 HOH 83 514 514 HOH HOH A . 
B 2 HOH 84 526 526 HOH HOH A . 
B 2 HOH 85 527 527 HOH HOH A . 
B 2 HOH 86 550 550 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1992-07-15 
2 'Structure model' 1 1 2008-03-25 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
_software.name             PROLSQ 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;SHEET
THE ARRANGEMENT OF THE STRANDS IN IL-1 MAKES A SHEET
DESIGNATION MEANINGLESS.  THE 12 STRANDS HAVE BEEN
PRESENTED AS 12 SHEETS OF ONE STRAND EACH ON THE SHEET
RECORDS BELOW.  THE FIRST GROUP OF FOUR STRANDS ARE PART OF
MOTIF A.  THE SECOND GROUP OF FOUR STRANDS ARE PART OF
MOTIF B.  THE THIRD GROUP OF FOUR STRANDS ARE PART OF MOTIF
C.
;
# 
_pdbx_entry_details.entry_id             8I1B 
_pdbx_entry_details.compound_details     
;THE MOLECULE CAN BE DIVIDED INTO THREE SIMILAR MOTIFS,
(RESIDUES 1 - 55, RESIDUES 56 - 107, AND RESIDUES 108 -
153).  THESE MOTIFS ARE RELATED BY A LOCAL THREE-FOLD AXIS.
THE TRANSFORMATION PRESENTED IN MTRIX 1 PRODUCES MOTIFS BCA
FROM MOTIFS ABC.  THE TRANSFORMATION PRESENTED IN MTRIX 2
PRODUCES MOTIFS CAB FROM MOTIFS ABC.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;SOLVENT MOLECULES 201, 202 AND 204 COORDINATE THE 
INTERSECTIONS OF THREE BETA STRANDS.
;
_pdbx_entry_details.sequence_details     
;RESIDUES HAVE BEEN NUMBERED TO AGREE WITH HUMAN IL-1BETA.
THIS MEANS THERE IS NO RESIDUE 140.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    111 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OD1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ASP 
_pdbx_validate_close_contact.auth_seq_id_2    145 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 9   ? ? CZ A ARG 9   ? ? NH1 A ARG 9   ? ? 125.12 120.30 4.82   0.50 N 
2  1 NE  A ARG 9   ? ? CZ A ARG 9   ? ? NH2 A ARG 9   ? ? 115.22 120.30 -5.08  0.50 N 
3  1 NE  A ARG 11  ? ? CZ A ARG 11  ? ? NH1 A ARG 11  ? ? 124.24 120.30 3.94   0.50 N 
4  1 NE  A ARG 11  ? ? CZ A ARG 11  ? ? NH2 A ARG 11  ? ? 114.60 120.30 -5.70  0.50 N 
5  1 N   A LYS 27  ? ? CA A LYS 27  ? ? CB  A LYS 27  ? ? 122.59 110.60 11.99  1.80 N 
6  1 CB  A ILE 36  ? ? CA A ILE 36  ? ? C   A ILE 36  ? ? 124.77 111.60 13.17  2.00 N 
7  1 N   A SER 43  ? ? CA A SER 43  ? ? CB  A SER 43  ? ? 121.44 110.50 10.94  1.50 N 
8  1 C   A GLU 50  ? ? N  A PRO 51  ? ? CA  A PRO 51  ? ? 128.76 119.30 9.46   1.50 Y 
9  1 CB  A ASP 54  ? ? CG A ASP 54  ? ? OD1 A ASP 54  ? ? 123.99 118.30 5.69   0.90 N 
10 1 N   A SER 70  ? ? CA A SER 70  ? ? CB  A SER 70  ? ? 98.83  110.50 -11.67 1.50 N 
11 1 CA  A LYS 92  ? ? CB A LYS 92  ? ? CG  A LYS 92  ? ? 128.30 113.40 14.90  2.20 N 
12 1 CA  A MET 95  ? ? CB A MET 95  ? ? CG  A MET 95  ? ? 126.72 113.30 13.42  1.70 N 
13 1 OE1 A GLU 128 ? ? CD A GLU 128 ? ? OE2 A GLU 128 ? ? 130.63 123.30 7.33   1.20 N 
14 1 CA  A THR 147 ? ? CB A THR 147 ? ? CG2 A THR 147 ? ? 123.95 112.40 11.55  1.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 22  ? ? -4.02  -63.29  
2  1 PRO A 23  ? ? -70.25 37.89   
3  1 ASN A 35  ? ? -93.35 43.94   
4  1 PRO A 51  ? ? -16.18 136.79  
5  1 SER A 52  ? ? -54.18 -168.36 
6  1 ASN A 53  ? ? 138.79 22.66   
7  1 ASP A 54  ? ? 76.15  37.31   
8  1 ASN A 66  ? ? -92.56 48.73   
9  1 SER A 108 ? ? 79.58  -14.94  
10 1 GLN A 141 ? ? 78.43  -36.28  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A VAL 1   ? A VAL 1   
2 1 Y 1 A PRO 2   ? A PRO 2   
3 1 Y 1 A ILE 3   ? A ILE 3   
4 1 Y 1 A ARG 4   ? A ARG 4   
5 1 Y 1 A SER 152 ? A SER 151 
6 1 Y 1 A SER 153 ? A SER 152 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#