data_8RXN
# 
_entry.id   8RXN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   8RXN         
WWPDB D_1000180020 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        8RXN 
_pdbx_database_status.recvd_initial_deposition_date   1991-08-26 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dauter, Z.' 1 
'Sieker, L.' 2 
'Wilson, K.' 3 
# 
_citation.id                        primary 
_citation.title                     'Refinement of rubredoxin from Desulfovibrio vulgaris at 1.0 A with and without restraints.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.B' 
_citation.journal_volume            48 
_citation.page_first                42 
_citation.page_last                 59 
_citation.year                      1992 
_citation.journal_id_ASTM           ASBSDK 
_citation.country                   DK 
_citation.journal_id_ISSN           0108-7681 
_citation.journal_id_CSD            0622 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   1616692 
_citation.pdbx_database_id_DOI      10.1107/S0108768191010613 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dauter, Z.'   1 
primary 'Sieker, L.C.' 2 
primary 'Wilson, K.S.' 3 
# 
_cell.entry_id           8RXN 
_cell.length_a           19.970 
_cell.length_b           41.450 
_cell.length_c           24.410 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.30 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         8RXN 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man RUBREDOXIN     5578.174 1   ? ? ? ? 
2 non-polymer syn 'FE (III) ION' 55.845   1   ? ? ? ? 
3 non-polymer syn 'SULFATE ION'  96.063   1   ? ? ? ? 
4 water       nat water          18.015   102 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MKKYVCTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEFEAA 
_entity_poly.pdbx_seq_one_letter_code_can   MKKYVCTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEFEAA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LYS n 
1 3  LYS n 
1 4  TYR n 
1 5  VAL n 
1 6  CYS n 
1 7  THR n 
1 8  VAL n 
1 9  CYS n 
1 10 GLY n 
1 11 TYR n 
1 12 GLU n 
1 13 TYR n 
1 14 ASP n 
1 15 PRO n 
1 16 ALA n 
1 17 GLU n 
1 18 GLY n 
1 19 ASP n 
1 20 PRO n 
1 21 ASP n 
1 22 ASN n 
1 23 GLY n 
1 24 VAL n 
1 25 LYS n 
1 26 PRO n 
1 27 GLY n 
1 28 THR n 
1 29 SER n 
1 30 PHE n 
1 31 ASP n 
1 32 ASP n 
1 33 LEU n 
1 34 PRO n 
1 35 ALA n 
1 36 ASP n 
1 37 TRP n 
1 38 VAL n 
1 39 CYS n 
1 40 PRO n 
1 41 VAL n 
1 42 CYS n 
1 43 GLY n 
1 44 ALA n 
1 45 PRO n 
1 46 LYS n 
1 47 SER n 
1 48 GLU n 
1 49 PHE n 
1 50 GLU n 
1 51 ALA n 
1 52 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Desulfovibrio 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Desulfovibrio vulgaris' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     881 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RUBR_DESVH 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00269 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   MKKYVCTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEFEAA 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              8RXN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 52 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00269 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  52 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       52 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          8RXN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.72 
_exptl_crystal.density_percent_sol   28.47 
_exptl_crystal.description           ? 
# 
_refine.entry_id                                 8RXN 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            1.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1470000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        397 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             102 
_refine_hist.number_atoms_total               505 
_refine_hist.d_res_high                       1.0 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.035 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  8RXN 
_struct.title                     
'REFINEMENT OF RUBREDOXIN FROM DESULFOVIBRIO VULGARIS AT 1.0 ANGSTROMS WITH AND WITHOUT RESTRAINTS' 
_struct.pdbx_descriptor           RUBREDOXIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        8RXN 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT(IRON)' 
_struct_keywords.text            'ELECTRON TRANSPORT(IRON)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 20 ? GLY A 23 ? PRO A 20 GLY A 23 5 ? 4 
HELX_P HELX_P2 2 SER A 29 ? LEU A 33 ? SER A 29 LEU A 33 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 6  SG ? ? A FE 55 A CYS 6  1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc2 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 9  SG ? ? A FE 55 A CYS 9  1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc3 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 39 SG ? ? A FE 55 A CYS 39 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc4 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 42 SG ? ? A FE 55 A CYS 42 1_555 ? ? ? ? ? ? ? 2.261 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 12 ? TYR A 13 ? GLU A 12 TYR A 13 
A 2 TYR A 4  ? CYS A 6  ? TYR A 4  CYS A 6  
A 3 PHE A 49 ? ALA A 51 ? PHE A 49 ALA A 51 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 13 ? N TYR A 13 O TYR A 4  ? O TYR A 4  
A 2 3 N VAL A 5  ? N VAL A 5  O GLU A 50 ? O GLU A 50 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE FE A 55'  
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SO4 A 56' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS A 6  ? CYS A 6   . ? 1_555 ? 
2  AC1 4  CYS A 9  ? CYS A 9   . ? 1_555 ? 
3  AC1 4  CYS A 39 ? CYS A 39  . ? 1_555 ? 
4  AC1 4  CYS A 42 ? CYS A 42  . ? 1_555 ? 
5  AC2 11 LYS A 3  ? LYS A 3   . ? 1_556 ? 
6  AC2 11 TRP A 37 ? TRP A 37  . ? 1_555 ? 
7  AC2 11 PRO A 45 ? PRO A 45  . ? 1_555 ? 
8  AC2 11 LYS A 46 ? LYS A 46  . ? 1_555 ? 
9  AC2 11 SER A 47 ? SER A 47  . ? 1_555 ? 
10 AC2 11 HOH D .  ? HOH A 80  . ? 1_555 ? 
11 AC2 11 HOH D .  ? HOH A 92  . ? 1_455 ? 
12 AC2 11 HOH D .  ? HOH A 96  . ? 1_556 ? 
13 AC2 11 HOH D .  ? HOH A 118 . ? 1_455 ? 
14 AC2 11 HOH D .  ? HOH A 126 . ? 1_455 ? 
15 AC2 11 HOH D .  ? HOH A 127 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          8RXN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    8RXN 
_atom_sites.fract_transf_matrix[1][1]   0.050075 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.016561 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024125 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.043149 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . MET A 1 1  ? -3.355  -14.918 -2.855 1.00 29.52 ? 1   MET A N   1 
ATOM   2   C  CA  . MET A 1 1  ? -2.048  -14.148 -2.715 1.00 15.66 ? 1   MET A CA  1 
ATOM   3   C  C   . MET A 1 1  ? -2.260  -12.585 -2.797 1.00 17.06 ? 1   MET A C   1 
ATOM   4   O  O   . MET A 1 1  ? -1.293  -11.859 -3.165 1.00 21.56 ? 1   MET A O   1 
ATOM   5   C  CB  . MET A 1 1  ? -1.193  -14.601 -3.918 1.00 15.62 ? 1   MET A CB  1 
ATOM   6   C  CG  . MET A 1 1  ? -0.752  -15.988 -3.611 1.00 17.49 ? 1   MET A CG  1 
ATOM   7   S  SD  . MET A 1 1  ? 0.794   -15.907 -2.656 1.00 17.28 ? 1   MET A SD  1 
ATOM   8   C  CE  . MET A 1 1  ? 0.549   -17.448 -1.718 1.00 20.05 ? 1   MET A CE  1 
ATOM   9   N  N   . LYS A 1 2  ? -3.466  -12.172 -2.488 1.00 11.84 ? 2   LYS A N   1 
ATOM   10  C  CA  . LYS A 1 2  ? -3.914  -10.773 -2.455 1.00 14.05 ? 2   LYS A CA  1 
ATOM   11  C  C   . LYS A 1 2  ? -3.066  -10.040 -1.311 1.00 10.52 ? 2   LYS A C   1 
ATOM   12  O  O   . LYS A 1 2  ? -2.981  -10.450 -0.176 1.00 10.73 ? 2   LYS A O   1 
ATOM   13  C  CB  . LYS A 1 2  ? -5.356  -10.618 -2.081 1.00 16.02 ? 2   LYS A CB  1 
ATOM   14  C  CG  . LYS A 1 2  ? -5.780  -9.056  -2.229 1.00 30.55 ? 2   LYS A CG  1 
ATOM   15  C  CD  . LYS A 1 2  ? -7.196  -8.986  -2.671 0.00 99.00 ? 2   LYS A CD  1 
ATOM   16  C  CE  . LYS A 1 2  ? -7.213  -8.355  -4.069 0.00 99.00 ? 2   LYS A CE  1 
ATOM   17  N  NZ  . LYS A 1 2  ? -7.406  -9.340  -5.145 0.00 99.00 ? 2   LYS A NZ  1 
ATOM   18  N  N   . LYS A 1 3  ? -2.389  -8.971  -1.725 1.00 11.27 ? 3   LYS A N   1 
ATOM   19  C  CA  . LYS A 1 3  ? -1.525  -8.171  -0.874 1.00 9.31  ? 3   LYS A CA  1 
ATOM   20  C  C   . LYS A 1 3  ? -2.417  -7.058  -0.278 1.00 7.99  ? 3   LYS A C   1 
ATOM   21  O  O   . LYS A 1 3  ? -3.349  -6.623  -0.763 1.00 8.85  ? 3   LYS A O   1 
ATOM   22  C  CB  . LYS A 1 3  ? -0.396  -7.528  -1.664 1.00 10.66 ? 3   LYS A CB  1 
ATOM   23  C  CG  . LYS A 1 3  ? 0.501   -8.558  -2.386 1.00 15.44 ? 3   LYS A CG  1 
ATOM   24  C  CD  . LYS A 1 3  ? 1.652   -7.918  -3.132 1.00 31.58 ? 3   LYS A CD  1 
ATOM   25  C  CE  . LYS A 1 3  ? 1.179   -7.088  -4.318 1.00 29.39 ? 3   LYS A CE  1 
ATOM   26  N  NZ  . LYS A 1 3  ? 0.349   -7.799  -5.276 1.00 21.72 ? 3   LYS A NZ  1 
ATOM   27  N  N   . TYR A 1 4  ? -1.956  -6.716  0.964  1.00 6.67  ? 4   TYR A N   1 
ATOM   28  C  CA  . TYR A 1 4  ? -2.675  -5.652  1.740  1.00 6.62  ? 4   TYR A CA  1 
ATOM   29  C  C   . TYR A 1 4  ? -1.658  -4.658  2.206  1.00 6.37  ? 4   TYR A C   1 
ATOM   30  O  O   . TYR A 1 4  ? -0.535  -5.009  2.576  1.00 8.70  ? 4   TYR A O   1 
ATOM   31  C  CB  . TYR A 1 4  ? -3.446  -6.263  2.931  1.00 6.69  ? 4   TYR A CB  1 
ATOM   32  C  CG  . TYR A 1 4  ? -4.705  -6.886  2.589  1.00 7.77  ? 4   TYR A CG  1 
ATOM   33  C  CD1 . TYR A 1 4  ? -4.701  -8.142  1.947  1.00 7.82  ? 4   TYR A CD1 1 
ATOM   34  C  CD2 . TYR A 1 4  ? -5.905  -6.277  2.900  1.00 9.85  ? 4   TYR A CD2 1 
ATOM   35  C  CE1 . TYR A 1 4  ? -5.918  -8.731  1.612  1.00 10.56 ? 4   TYR A CE1 1 
ATOM   36  C  CE2 . TYR A 1 4  ? -7.140  -6.878  2.564  1.00 13.81 ? 4   TYR A CE2 1 
ATOM   37  C  CZ  . TYR A 1 4  ? -7.057  -8.128  1.876  1.00 11.23 ? 4   TYR A CZ  1 
ATOM   38  O  OH  . TYR A 1 4  ? -8.276  -8.715  1.555  1.00 22.37 ? 4   TYR A OH  1 
ATOM   39  N  N   . VAL A 1 5  ? -2.032  -3.381  2.225  1.00 5.63  ? 5   VAL A N   1 
ATOM   40  C  CA  . VAL A 1 5  ? -1.114  -2.331  2.624  1.00 5.35  ? 5   VAL A CA  1 
ATOM   41  C  C   . VAL A 1 5  ? -1.607  -1.608  3.852  1.00 5.23  ? 5   VAL A C   1 
ATOM   42  O  O   . VAL A 1 5  ? -2.742  -1.309  4.000  1.00 6.08  ? 5   VAL A O   1 
ATOM   43  C  CB  . VAL A 1 5  ? -0.919  -1.337  1.406  1.00 8.57  ? 5   VAL A CB  1 
ATOM   44  C  CG1 . VAL A 1 5  ? -2.136  -0.671  1.056  1.00 13.23 ? 5   VAL A CG1 1 
ATOM   45  C  CG2 . VAL A 1 5  ? 0.167   -0.332  1.681  1.00 11.73 ? 5   VAL A CG2 1 
ATOM   46  N  N   . CYS A 1 6  ? -0.615  -1.359  4.710  1.00 5.10  ? 6   CYS A N   1 
ATOM   47  C  CA  . CYS A 1 6  ? -0.864  -0.608  5.982  1.00 4.42  ? 6   CYS A CA  1 
ATOM   48  C  C   . CYS A 1 6  ? -1.072  0.855   5.644  1.00 4.72  ? 6   CYS A C   1 
ATOM   49  O  O   . CYS A 1 6  ? -0.163  1.474   5.028  1.00 5.90  ? 6   CYS A O   1 
ATOM   50  C  CB  . CYS A 1 6  ? 0.351   -0.776  6.844  1.00 5.46  ? 6   CYS A CB  1 
ATOM   51  S  SG  . CYS A 1 6  ? 0.217   0.120   8.404  1.00 5.21  ? 6   CYS A SG  1 
ATOM   52  N  N   . THR A 1 7  ? -2.208  1.392   5.966  1.00 4.42  ? 7   THR A N   1 
ATOM   53  C  CA  . THR A 1 7  ? -2.523  2.818   5.652  1.00 4.88  ? 7   THR A CA  1 
ATOM   54  C  C   . THR A 1 7  ? -1.866  3.770   6.650  1.00 5.07  ? 7   THR A C   1 
ATOM   55  O  O   . THR A 1 7  ? -2.040  5.018   6.475  1.00 5.76  ? 7   THR A O   1 
ATOM   56  C  CB  . THR A 1 7  ? -4.022  3.052   5.504  1.00 6.31  ? 7   THR A CB  1 
ATOM   57  O  OG1 . THR A 1 7  ? -4.657  2.926   6.813  1.00 7.05  ? 7   THR A OG1 1 
ATOM   58  C  CG2 . THR A 1 7  ? -4.631  2.206   4.416  1.00 8.23  ? 7   THR A CG2 1 
ATOM   59  N  N   . VAL A 1 8  ? -1.151  3.287   7.604  1.00 5.01  ? 8   VAL A N   1 
ATOM   60  C  CA  . VAL A 1 8  ? -0.380  4.103   8.532  1.00 5.04  ? 8   VAL A CA  1 
ATOM   61  C  C   . VAL A 1 8  ? 1.009   4.276   7.895  1.00 5.83  ? 8   VAL A C   1 
ATOM   62  O  O   . VAL A 1 8  ? 1.465   5.447   7.748  1.00 7.51  ? 8   VAL A O   1 
ATOM   63  C  CB  . VAL A 1 8  ? -0.351  3.506   9.939  1.00 5.39  ? 8   VAL A CB  1 
ATOM   64  C  CG1 . VAL A 1 8  ? 0.564   4.291   10.887 1.00 7.77  ? 8   VAL A CG1 1 
ATOM   65  C  CG2 . VAL A 1 8  ? -1.749  3.445   10.486 1.00 7.83  ? 8   VAL A CG2 1 
ATOM   66  N  N   . CYS A 1 9  ? 1.746   3.220   7.585  1.00 5.27  ? 9   CYS A N   1 
ATOM   67  C  CA  . CYS A 1 9  ? 3.106   3.302   7.153  1.00 5.98  ? 9   CYS A CA  1 
ATOM   68  C  C   . CYS A 1 9  ? 3.465   2.815   5.796  1.00 6.08  ? 9   CYS A C   1 
ATOM   69  O  O   . CYS A 1 9  ? 4.603   3.058   5.394  1.00 8.32  ? 9   CYS A O   1 
ATOM   70  C  CB  . CYS A 1 9  ? 4.055   2.565   8.144  1.00 6.20  ? 9   CYS A CB  1 
ATOM   71  S  SG  . CYS A 1 9  ? 3.982   0.766   8.019  1.00 6.22  ? 9   CYS A SG  1 
ATOM   72  N  N   . GLY A 1 10 ? 2.560   2.173   5.118  1.00 5.88  ? 10  GLY A N   1 
ATOM   73  C  CA  . GLY A 1 10 ? 2.856   1.682   3.785  1.00 6.73  ? 10  GLY A CA  1 
ATOM   74  C  C   . GLY A 1 10 ? 3.432   0.281   3.758  1.00 8.02  ? 10  GLY A C   1 
ATOM   75  O  O   . GLY A 1 10 ? 3.684   -0.180  2.565  1.00 9.55  ? 10  GLY A O   1 
ATOM   76  N  N   . TYR A 1 11 ? 3.678   -0.385  4.810  1.00 5.99  ? 11  TYR A N   1 
ATOM   77  C  CA  . TYR A 1 11 ? 4.159   -1.801  4.696  1.00 6.33  ? 11  TYR A CA  1 
ATOM   78  C  C   . TYR A 1 11 ? 3.111   -2.575  3.995  1.00 5.73  ? 11  TYR A C   1 
ATOM   79  O  O   . TYR A 1 11 ? 1.902   -2.424  4.166  1.00 7.54  ? 11  TYR A O   1 
ATOM   80  C  CB  . TYR A 1 11 ? 4.269   -2.305  6.122  1.00 7.57  ? 11  TYR A CB  1 
ATOM   81  C  CG  . TYR A 1 11 ? 4.369   -3.847  6.205  1.00 6.45  ? 11  TYR A CG  1 
ATOM   82  C  CD1 . TYR A 1 11 ? 5.626   -4.434  6.100  1.00 8.73  ? 11  TYR A CD1 1 
ATOM   83  C  CD2 . TYR A 1 11 ? 3.305   -4.593  6.476  1.00 7.49  ? 11  TYR A CD2 1 
ATOM   84  C  CE1 . TYR A 1 11 ? 5.725   -5.884  6.192  1.00 8.84  ? 11  TYR A CE1 1 
ATOM   85  C  CE2 . TYR A 1 11 ? 3.359   -6.000  6.558  1.00 8.42  ? 11  TYR A CE2 1 
ATOM   86  C  CZ  . TYR A 1 11 ? 4.526   -6.567  6.434  1.00 10.17 ? 11  TYR A CZ  1 
ATOM   87  O  OH  . TYR A 1 11 ? 4.651   -7.969  6.553  1.00 11.99 ? 11  TYR A OH  1 
ATOM   88  N  N   . GLU A 1 12 ? 3.604   -3.522  3.148  1.00 6.88  ? 12  GLU A N   1 
ATOM   89  C  CA  . GLU A 1 12 ? 2.716   -4.408  2.413  1.00 6.91  ? 12  GLU A CA  1 
ATOM   90  C  C   . GLU A 1 12 ? 2.871   -5.848  2.920  1.00 7.47  ? 12  GLU A C   1 
ATOM   91  O  O   . GLU A 1 12 ? 3.980   -6.371  3.017  1.00 8.92  ? 12  GLU A O   1 
ATOM   92  C  CB  . GLU A 1 12 ? 3.060   -4.435  0.921  1.00 12.51 ? 12  GLU A CB  1 
ATOM   93  C  CG  A GLU A 1 12 ? 2.405   -3.167  0.125  0.50 21.56 ? 12  GLU A CG  1 
ATOM   94  C  CG  B GLU A 1 12 ? 1.975   -5.024  -0.019 0.50 14.47 ? 12  GLU A CG  1 
ATOM   95  C  CD  A GLU A 1 12 ? 2.392   -3.692  -1.357 0.50 21.42 ? 12  GLU A CD  1 
ATOM   96  C  CD  B GLU A 1 12 ? 2.207   -4.751  -1.500 0.50 23.91 ? 12  GLU A CD  1 
ATOM   97  O  OE1 A GLU A 1 12 ? 1.494   -4.396  -1.760 0.50 35.70 ? 12  GLU A OE1 1 
ATOM   98  O  OE1 B GLU A 1 12 ? 3.297   -5.137  -1.915 0.50 18.81 ? 12  GLU A OE1 1 
ATOM   99  O  OE2 A GLU A 1 12 ? 3.430   -3.301  -1.879 0.50 31.38 ? 12  GLU A OE2 1 
ATOM   100 O  OE2 B GLU A 1 12 ? 1.348   -4.193  -2.193 0.50 40.11 ? 12  GLU A OE2 1 
ATOM   101 N  N   . TYR A 1 13 ? 1.724   -6.371  3.339  1.00 6.45  ? 13  TYR A N   1 
ATOM   102 C  CA  . TYR A 1 13 ? 1.670   -7.812  3.753  1.00 6.62  ? 13  TYR A CA  1 
ATOM   103 C  C   . TYR A 1 13 ? 1.567   -8.594  2.374  1.00 6.21  ? 13  TYR A C   1 
ATOM   104 O  O   . TYR A 1 13 ? 0.706   -8.402  1.647  1.00 7.79  ? 13  TYR A O   1 
ATOM   105 C  CB  . TYR A 1 13 ? 0.475   -8.150  4.655  1.00 7.34  ? 13  TYR A CB  1 
ATOM   106 C  CG  . TYR A 1 13 ? 0.503   -9.639  4.922  1.00 6.29  ? 13  TYR A CG  1 
ATOM   107 C  CD1 . TYR A 1 13 ? 1.426   -10.140 5.807  1.00 6.46  ? 13  TYR A CD1 1 
ATOM   108 C  CD2 . TYR A 1 13 ? -0.300  -10.499 4.264  1.00 5.91  ? 13  TYR A CD2 1 
ATOM   109 C  CE1 . TYR A 1 13 ? 1.540   -11.512 6.017  1.00 7.35  ? 13  TYR A CE1 1 
ATOM   110 C  CE2 . TYR A 1 13 ? -0.229  -11.893 4.501  1.00 6.46  ? 13  TYR A CE2 1 
ATOM   111 C  CZ  . TYR A 1 13 ? 0.698   -12.375 5.336  1.00 6.61  ? 13  TYR A CZ  1 
ATOM   112 O  OH  . TYR A 1 13 ? 0.865   -13.704 5.576  1.00 7.69  ? 13  TYR A OH  1 
ATOM   113 N  N   . ASP A 1 14 ? 2.536   -9.487  2.264  1.00 6.37  ? 14  ASP A N   1 
ATOM   114 C  CA  . ASP A 1 14 ? 2.644   -10.339 1.048  1.00 6.00  ? 14  ASP A CA  1 
ATOM   115 C  C   . ASP A 1 14 ? 2.478   -11.810 1.493  1.00 6.08  ? 14  ASP A C   1 
ATOM   116 O  O   . ASP A 1 14 ? 3.387   -12.350 2.092  1.00 6.35  ? 14  ASP A O   1 
ATOM   117 C  CB  . ASP A 1 14 ? 4.024   -10.114 0.460  1.00 8.41  ? 14  ASP A CB  1 
ATOM   118 C  CG  . ASP A 1 14 ? 4.274   -11.031 -0.748 1.00 8.43  ? 14  ASP A CG  1 
ATOM   119 O  OD1 . ASP A 1 14 ? 3.401   -11.747 -1.174 1.00 9.68  ? 14  ASP A OD1 1 
ATOM   120 O  OD2 . ASP A 1 14 ? 5.471   -10.911 -1.175 1.00 10.18 ? 14  ASP A OD2 1 
ATOM   121 N  N   . PRO A 1 15 ? 1.338   -12.368 1.129  1.00 6.92  ? 15  PRO A N   1 
ATOM   122 C  CA  . PRO A 1 15 ? 1.094   -13.778 1.550  1.00 6.55  ? 15  PRO A CA  1 
ATOM   123 C  C   . PRO A 1 15 ? 2.152   -14.696 1.100  1.00 7.39  ? 15  PRO A C   1 
ATOM   124 O  O   . PRO A 1 15 ? 2.405   -15.703 1.813  1.00 9.58  ? 15  PRO A O   1 
ATOM   125 C  CB  . PRO A 1 15 ? -0.226  -14.104 0.943  1.00 9.40  ? 15  PRO A CB  1 
ATOM   126 C  CG  A PRO A 1 15 ? -0.953  -12.833 0.678  0.75 9.63  ? 15  PRO A CG  1 
ATOM   127 C  CG  B PRO A 1 15 ? -0.417  -13.111 -0.209 0.25 13.68 ? 15  PRO A CG  1 
ATOM   128 C  CD  . PRO A 1 15 ? 0.209   -11.859 0.421  1.00 8.22  ? 15  PRO A CD  1 
ATOM   129 N  N   . ALA A 1 16 ? 2.839   -14.506 -0.001 1.00 6.78  ? 16  ALA A N   1 
ATOM   130 C  CA  . ALA A 1 16 ? 3.893   -15.422 -0.429 1.00 7.16  ? 16  ALA A CA  1 
ATOM   131 C  C   . ALA A 1 16 ? 5.026   -15.445 0.475  1.00 8.12  ? 16  ALA A C   1 
ATOM   132 O  O   . ALA A 1 16 ? 5.747   -16.468 0.651  1.00 9.10  ? 16  ALA A O   1 
ATOM   133 C  CB  . ALA A 1 16 ? 4.412   -15.113 -1.839 1.00 8.38  ? 16  ALA A CB  1 
ATOM   134 N  N   . GLU A 1 17 ? 5.302   -14.363 1.253  1.00 7.76  ? 17  GLU A N   1 
ATOM   135 C  CA  . GLU A 1 17 ? 6.386   -14.265 2.185  1.00 7.50  ? 17  GLU A CA  1 
ATOM   136 C  C   . GLU A 1 17 ? 5.964   -14.529 3.608  1.00 7.81  ? 17  GLU A C   1 
ATOM   137 O  O   . GLU A 1 17 ? 6.764   -14.966 4.395  1.00 9.28  ? 17  GLU A O   1 
ATOM   138 C  CB  . GLU A 1 17 ? 7.012   -12.876 2.186  1.00 10.95 ? 17  GLU A CB  1 
ATOM   139 C  CG  . GLU A 1 17 ? 7.957   -12.672 0.980  1.00 15.82 ? 17  GLU A CG  1 
ATOM   140 C  CD  . GLU A 1 17 ? 8.386   -11.227 0.860  1.00 54.77 ? 17  GLU A CD  1 
ATOM   141 O  OE1 . GLU A 1 17 ? 8.175   -10.537 1.883  1.00 43.62 ? 17  GLU A OE1 1 
ATOM   142 O  OE2 . GLU A 1 17 ? 8.887   -10.876 -0.199 1.00 67.20 ? 17  GLU A OE2 1 
ATOM   143 N  N   . GLY A 1 18 ? 4.678   -14.257 3.893  1.00 7.33  ? 18  GLY A N   1 
ATOM   144 C  CA  . GLY A 1 18 ? 4.250   -14.442 5.308  1.00 7.87  ? 18  GLY A CA  1 
ATOM   145 C  C   . GLY A 1 18 ? 4.933   -13.442 6.173  1.00 6.26  ? 18  GLY A C   1 
ATOM   146 O  O   . GLY A 1 18 ? 5.304   -12.324 5.791  1.00 8.38  ? 18  GLY A O   1 
ATOM   147 N  N   . ASP A 1 19 ? 5.155   -13.815 7.436  1.00 5.96  ? 19  ASP A N   1 
ATOM   148 C  CA  . ASP A 1 19 ? 5.843   -12.945 8.414  1.00 6.16  ? 19  ASP A CA  1 
ATOM   149 C  C   . ASP A 1 19 ? 6.401   -13.914 9.505  1.00 6.02  ? 19  ASP A C   1 
ATOM   150 O  O   . ASP A 1 19 ? 5.852   -14.023 10.571 1.00 6.18  ? 19  ASP A O   1 
ATOM   151 C  CB  . ASP A 1 19 ? 4.844   -11.963 9.022  1.00 6.26  ? 19  ASP A CB  1 
ATOM   152 C  CG  . ASP A 1 19 ? 5.509   -11.009 9.948  1.00 7.46  ? 19  ASP A CG  1 
ATOM   153 O  OD1 . ASP A 1 19 ? 6.673   -10.766 9.863  1.00 12.76 ? 19  ASP A OD1 1 
ATOM   154 O  OD2 . ASP A 1 19 ? 4.757   -10.478 10.798 1.00 9.14  ? 19  ASP A OD2 1 
ATOM   155 N  N   . PRO A 1 20 ? 7.493   -14.574 9.129  1.00 6.42  ? 20  PRO A N   1 
ATOM   156 C  CA  . PRO A 1 20 ? 8.058   -15.619 10.008 1.00 5.89  ? 20  PRO A CA  1 
ATOM   157 C  C   . PRO A 1 20 ? 8.283   -15.231 11.411 1.00 6.75  ? 20  PRO A C   1 
ATOM   158 O  O   . PRO A 1 20 ? 8.005   -15.995 12.353 1.00 7.11  ? 20  PRO A O   1 
ATOM   159 C  CB  . PRO A 1 20 ? 9.260   -16.135 9.249  1.00 6.86  ? 20  PRO A CB  1 
ATOM   160 C  CG  . PRO A 1 20 ? 8.888   -15.902 7.809  1.00 7.52  ? 20  PRO A CG  1 
ATOM   161 C  CD  . PRO A 1 20 ? 8.187   -14.552 7.823  1.00 7.10  ? 20  PRO A CD  1 
ATOM   162 N  N   . ASP A 1 21 ? 8.842   -14.016 11.631 1.00 6.65  ? 21  ASP A N   1 
ATOM   163 C  CA  . ASP A 1 21 ? 9.160   -13.622 13.013 1.00 9.13  ? 21  ASP A CA  1 
ATOM   164 C  C   . ASP A 1 21 ? 7.936   -13.433 13.851 1.00 9.24  ? 21  ASP A C   1 
ATOM   165 O  O   . ASP A 1 21 ? 8.144   -13.318 15.069 1.00 14.03 ? 21  ASP A O   1 
ATOM   166 C  CB  . ASP A 1 21 ? 10.113  -12.554 13.148 1.00 19.60 ? 21  ASP A CB  1 
ATOM   167 C  CG  A ASP A 1 21 ? 11.340  -12.321 12.459 0.50 15.47 ? 21  ASP A CG  1 
ATOM   168 C  CG  B ASP A 1 21 ? 9.979   -11.250 12.642 0.50 11.76 ? 21  ASP A CG  1 
ATOM   169 O  OD1 A ASP A 1 21 ? 12.050  -13.303 12.228 0.50 18.04 ? 21  ASP A OD1 1 
ATOM   170 O  OD1 B ASP A 1 21 ? 8.877   -10.839 12.283 0.50 19.11 ? 21  ASP A OD1 1 
ATOM   171 O  OD2 A ASP A 1 21 ? 11.701  -11.132 12.164 0.50 30.87 ? 21  ASP A OD2 1 
ATOM   172 O  OD2 B ASP A 1 21 ? 11.050  -10.624 12.662 0.50 19.16 ? 21  ASP A OD2 1 
ATOM   173 N  N   . ASN A 1 22 ? 6.769   -13.359 13.302 1.00 6.94  ? 22  ASN A N   1 
ATOM   174 C  CA  . ASN A 1 22 ? 5.583   -13.255 14.061 1.00 8.41  ? 22  ASN A CA  1 
ATOM   175 C  C   . ASN A 1 22 ? 4.768   -14.536 13.979 1.00 8.61  ? 22  ASN A C   1 
ATOM   176 O  O   . ASN A 1 22 ? 3.577   -14.531 14.237 1.00 11.22 ? 22  ASN A O   1 
ATOM   177 C  CB  . ASN A 1 22 ? 4.731   -11.997 13.783 1.00 10.61 ? 22  ASN A CB  1 
ATOM   178 C  CG  . ASN A 1 22 ? 5.445   -10.742 14.200 1.00 14.24 ? 22  ASN A CG  1 
ATOM   179 O  OD1 . ASN A 1 22 ? 5.683   -10.591 15.451 1.00 17.92 ? 22  ASN A OD1 1 
ATOM   180 N  ND2 . ASN A 1 22 ? 5.802   -9.930  13.256 1.00 16.11 ? 22  ASN A ND2 1 
ATOM   181 N  N   . GLY A 1 23 ? 5.375   -15.655 13.616 1.00 7.01  ? 23  GLY A N   1 
ATOM   182 C  CA  . GLY A 1 23 ? 4.717   -16.919 13.556 1.00 7.31  ? 23  GLY A CA  1 
ATOM   183 C  C   . GLY A 1 23 ? 3.809   -17.210 12.436 1.00 7.41  ? 23  GLY A C   1 
ATOM   184 O  O   . GLY A 1 23 ? 2.868   -18.018 12.497 1.00 7.86  ? 23  GLY A O   1 
ATOM   185 N  N   . VAL A 1 24 ? 4.063   -16.497 11.301 1.00 6.09  ? 24  VAL A N   1 
ATOM   186 C  CA  . VAL A 1 24 ? 3.221   -16.605 10.141 1.00 6.15  ? 24  VAL A CA  1 
ATOM   187 C  C   . VAL A 1 24 ? 4.038   -17.134 8.981  1.00 5.97  ? 24  VAL A C   1 
ATOM   188 O  O   . VAL A 1 24 ? 4.922   -16.475 8.453  1.00 6.87  ? 24  VAL A O   1 
ATOM   189 C  CB  . VAL A 1 24 ? 2.597   -15.235 9.790  1.00 6.86  ? 24  VAL A CB  1 
ATOM   190 C  CG1 . VAL A 1 24 ? 1.758   -15.367 8.532  1.00 8.37  ? 24  VAL A CG1 1 
ATOM   191 C  CG2 . VAL A 1 24 ? 1.763   -14.650 10.935 1.00 8.72  ? 24  VAL A CG2 1 
ATOM   192 N  N   . LYS A 1 25 ? 3.780   -18.412 8.648  1.00 6.61  ? 25  LYS A N   1 
ATOM   193 C  CA  . LYS A 1 25 ? 4.568   -19.021 7.576  1.00 6.48  ? 25  LYS A CA  1 
ATOM   194 C  C   . LYS A 1 25 ? 4.222   -18.547 6.202  1.00 6.32  ? 25  LYS A C   1 
ATOM   195 O  O   . LYS A 1 25 ? 3.109   -18.104 5.923  1.00 7.30  ? 25  LYS A O   1 
ATOM   196 C  CB  . LYS A 1 25 ? 4.528   -20.570 7.665  1.00 7.63  ? 25  LYS A CB  1 
ATOM   197 C  CG  . LYS A 1 25 ? 3.232   -21.178 7.375  1.00 7.40  ? 25  LYS A CG  1 
ATOM   198 C  CD  . LYS A 1 25 ? 3.274   -22.698 7.625  1.00 9.33  ? 25  LYS A CD  1 
ATOM   199 C  CE  . LYS A 1 25 ? 2.118   -23.539 7.253  1.00 15.07 ? 25  LYS A CE  1 
ATOM   200 N  NZ  . LYS A 1 25 ? 0.831   -23.090 7.683  1.00 13.95 ? 25  LYS A NZ  1 
ATOM   201 N  N   . PRO A 1 26 ? 5.162   -18.652 5.286  1.00 7.55  ? 26  PRO A N   1 
ATOM   202 C  CA  . PRO A 1 26 ? 4.900   -18.266 3.919  1.00 8.43  ? 26  PRO A CA  1 
ATOM   203 C  C   . PRO A 1 26 ? 3.705   -18.970 3.433  1.00 7.70  ? 26  PRO A C   1 
ATOM   204 O  O   . PRO A 1 26 ? 3.431   -20.186 3.644  1.00 9.10  ? 26  PRO A O   1 
ATOM   205 C  CB  . PRO A 1 26 ? 6.229   -18.716 3.190  1.00 9.55  ? 26  PRO A CB  1 
ATOM   206 C  CG  . PRO A 1 26 ? 7.264   -18.640 4.190  1.00 12.51 ? 26  PRO A CG  1 
ATOM   207 C  CD  . PRO A 1 26 ? 6.569   -19.105 5.486  1.00 10.06 ? 26  PRO A CD  1 
ATOM   208 N  N   . GLY A 1 27 ? 2.850   -18.275 2.644  1.00 7.84  ? 27  GLY A N   1 
ATOM   209 C  CA  . GLY A 1 27 ? 1.677   -18.725 2.055  1.00 8.73  ? 27  GLY A CA  1 
ATOM   210 C  C   . GLY A 1 27 ? 0.412   -18.439 2.791  1.00 10.07 ? 27  GLY A C   1 
ATOM   211 O  O   . GLY A 1 27 ? -0.695  -18.764 2.372  1.00 14.81 ? 27  GLY A O   1 
ATOM   212 N  N   . THR A 1 28 ? 0.497   -17.797 3.945  1.00 8.32  ? 28  THR A N   1 
ATOM   213 C  CA  . THR A 1 28 ? -0.672  -17.493 4.771  1.00 7.62  ? 28  THR A CA  1 
ATOM   214 C  C   . THR A 1 28 ? -1.435  -16.238 4.234  1.00 6.30  ? 28  THR A C   1 
ATOM   215 O  O   . THR A 1 28 ? -0.773  -15.157 4.153  1.00 7.51  ? 28  THR A O   1 
ATOM   216 C  CB  . THR A 1 28 ? -0.234  -17.265 6.253  1.00 8.16  ? 28  THR A CB  1 
ATOM   217 O  OG1 . THR A 1 28 ? 0.522   -18.422 6.664  1.00 8.24  ? 28  THR A OG1 1 
ATOM   218 C  CG2 . THR A 1 28 ? -1.444  -16.977 7.115  1.00 8.46  ? 28  THR A CG2 1 
ATOM   219 N  N   . SER A 1 29 ? -2.647  -16.363 3.982  1.00 6.74  ? 29  SER A N   1 
ATOM   220 C  CA  . SER A 1 29 ? -3.421  -15.187 3.490  1.00 6.72  ? 29  SER A CA  1 
ATOM   221 C  C   . SER A 1 29 ? -3.586  -14.179 4.648  1.00 6.20  ? 29  SER A C   1 
ATOM   222 O  O   . SER A 1 29 ? -3.567  -14.498 5.814  1.00 6.75  ? 29  SER A O   1 
ATOM   223 C  CB  . SER A 1 29 ? -4.772  -15.704 3.090  1.00 10.97 ? 29  SER A CB  1 
ATOM   224 O  OG  . SER A 1 29 ? -5.548  -15.934 4.212  1.00 16.17 ? 29  SER A OG  1 
ATOM   225 N  N   . PHE A 1 30 ? -3.826  -12.925 4.213  1.00 6.25  ? 30  PHE A N   1 
ATOM   226 C  CA  . PHE A 1 30 ? -4.054  -11.857 5.163  1.00 5.85  ? 30  PHE A CA  1 
ATOM   227 C  C   . PHE A 1 30 ? -5.263  -12.183 6.082  1.00 5.99  ? 30  PHE A C   1 
ATOM   228 O  O   . PHE A 1 30 ? -5.220  -11.873 7.283  1.00 6.86  ? 30  PHE A O   1 
ATOM   229 C  CB  . PHE A 1 30 ? -4.362  -10.570 4.394  1.00 6.49  ? 30  PHE A CB  1 
ATOM   230 C  CG  . PHE A 1 30 ? -4.543  -9.354  5.308  1.00 7.65  ? 30  PHE A CG  1 
ATOM   231 C  CD1 . PHE A 1 30 ? -3.450  -8.738  5.850  1.00 8.74  ? 30  PHE A CD1 1 
ATOM   232 C  CD2 . PHE A 1 30 ? -5.837  -8.925  5.612  1.00 10.95 ? 30  PHE A CD2 1 
ATOM   233 C  CE1 . PHE A 1 30 ? -3.538  -7.614  6.724  1.00 10.48 ? 30  PHE A CE1 1 
ATOM   234 C  CE2 . PHE A 1 30 ? -5.962  -7.776  6.458  1.00 12.40 ? 30  PHE A CE2 1 
ATOM   235 C  CZ  . PHE A 1 30 ? -4.785  -7.232  6.933  1.00 10.49 ? 30  PHE A CZ  1 
ATOM   236 N  N   . ASP A 1 31 ? -6.233  -12.790 5.519  1.00 6.59  ? 31  ASP A N   1 
ATOM   237 C  CA  . ASP A 1 31 ? -7.446  -13.102 6.293  1.00 9.15  ? 31  ASP A CA  1 
ATOM   238 C  C   . ASP A 1 31 ? -7.163  -14.156 7.409  1.00 8.40  ? 31  ASP A C   1 
ATOM   239 O  O   . ASP A 1 31 ? -8.027  -14.220 8.320  1.00 10.07 ? 31  ASP A O   1 
ATOM   240 C  CB  . ASP A 1 31 ? -8.571  -13.565 5.458  1.00 11.37 ? 31  ASP A CB  1 
ATOM   241 C  CG  . ASP A 1 31 ? -9.255  -12.534 4.534  1.00 23.01 ? 31  ASP A CG  1 
ATOM   242 O  OD1 . ASP A 1 31 ? -9.235  -11.379 4.971  1.00 28.56 ? 31  ASP A OD1 1 
ATOM   243 O  OD2 . ASP A 1 31 ? -9.763  -12.912 3.522  1.00 40.32 ? 31  ASP A OD2 1 
ATOM   244 N  N   . ASP A 1 32 ? -6.132  -14.900 7.248  1.00 6.03  ? 32  ASP A N   1 
ATOM   245 C  CA  . ASP A 1 32 ? -5.784  -15.937 8.241  1.00 6.83  ? 32  ASP A CA  1 
ATOM   246 C  C   . ASP A 1 32 ? -4.711  -15.524 9.176  1.00 6.18  ? 32  ASP A C   1 
ATOM   247 O  O   . ASP A 1 32 ? -4.164  -16.364 9.906  1.00 7.51  ? 32  ASP A O   1 
ATOM   248 C  CB  . ASP A 1 32 ? -5.432  -17.244 7.535  1.00 6.62  ? 32  ASP A CB  1 
ATOM   249 C  CG  . ASP A 1 32 ? -6.628  -17.906 7.037  1.00 11.02 ? 32  ASP A CG  1 
ATOM   250 O  OD1 . ASP A 1 32 ? -7.725  -17.883 7.528  1.00 13.72 ? 32  ASP A OD1 1 
ATOM   251 O  OD2 . ASP A 1 32 ? -6.409  -18.557 5.991  1.00 18.25 ? 32  ASP A OD2 1 
ATOM   252 N  N   . LEU A 1 33 ? -4.369  -14.213 9.269  1.00 6.31  ? 33  LEU A N   1 
ATOM   253 C  CA  . LEU A 1 33 ? -3.385  -13.794 10.229 1.00 5.72  ? 33  LEU A CA  1 
ATOM   254 C  C   . LEU A 1 33 ? -4.002  -13.912 11.659 1.00 6.59  ? 33  LEU A C   1 
ATOM   255 O  O   . LEU A 1 33 ? -5.186  -13.786 11.821 1.00 7.40  ? 33  LEU A O   1 
ATOM   256 C  CB  . LEU A 1 33 ? -2.989  -12.311 9.999  1.00 6.99  ? 33  LEU A CB  1 
ATOM   257 C  CG  . LEU A 1 33 ? -2.164  -12.116 8.709  1.00 6.47  ? 33  LEU A CG  1 
ATOM   258 C  CD1 . LEU A 1 33 ? -2.064  -10.628 8.389  1.00 8.01  ? 33  LEU A CD1 1 
ATOM   259 C  CD2 . LEU A 1 33 ? -0.806  -12.743 9.003  1.00 11.02 ? 33  LEU A CD2 1 
ATOM   260 N  N   . PRO A 1 34 ? -3.119  -14.162 12.620 1.00 6.55  ? 34  PRO A N   1 
ATOM   261 C  CA  . PRO A 1 34 ? -3.612  -14.224 14.029 1.00 8.29  ? 34  PRO A CA  1 
ATOM   262 C  C   . PRO A 1 34 ? -4.373  -12.980 14.398 1.00 6.48  ? 34  PRO A C   1 
ATOM   263 O  O   . PRO A 1 34 ? -4.109  -11.812 13.952 1.00 7.69  ? 34  PRO A O   1 
ATOM   264 C  CB  . PRO A 1 34 ? -2.339  -14.402 14.821 1.00 8.33  ? 34  PRO A CB  1 
ATOM   265 C  CG  . PRO A 1 34 ? -1.375  -15.052 13.890 1.00 9.14  ? 34  PRO A CG  1 
ATOM   266 C  CD  . PRO A 1 34 ? -1.703  -14.365 12.530 1.00 7.53  ? 34  PRO A CD  1 
ATOM   267 N  N   . ALA A 1 35 ? -5.361  -13.115 15.259 1.00 6.93  ? 35  ALA A N   1 
ATOM   268 C  CA  . ALA A 1 35 ? -6.186  -12.005 15.680 1.00 7.89  ? 35  ALA A CA  1 
ATOM   269 C  C   . ALA A 1 35 ? -5.307  -10.900 16.336 1.00 7.21  ? 35  ALA A C   1 
ATOM   270 O  O   . ALA A 1 35 ? -5.790  -9.715  16.188 1.00 9.62  ? 35  ALA A O   1 
ATOM   271 C  CB  . ALA A 1 35 ? -7.277  -12.455 16.637 1.00 8.87  ? 35  ALA A CB  1 
ATOM   272 N  N   . ASP A 1 36 ? -4.237  -11.160 16.952 1.00 6.60  ? 36  ASP A N   1 
ATOM   273 C  CA  . ASP A 1 36 ? -3.469  -10.104 17.555 1.00 7.23  ? 36  ASP A CA  1 
ATOM   274 C  C   . ASP A 1 36 ? -2.328  -9.609  16.689 1.00 7.45  ? 36  ASP A C   1 
ATOM   275 O  O   . ASP A 1 36 ? -1.480  -8.856  17.169 1.00 8.94  ? 36  ASP A O   1 
ATOM   276 C  CB  . ASP A 1 36 ? -2.942  -10.601 18.905 1.00 7.58  ? 36  ASP A CB  1 
ATOM   277 C  CG  . ASP A 1 36 ? -1.997  -11.680 18.855 1.00 8.69  ? 36  ASP A CG  1 
ATOM   278 O  OD1 . ASP A 1 36 ? -1.617  -12.215 17.779 1.00 10.35 ? 36  ASP A OD1 1 
ATOM   279 O  OD2 . ASP A 1 36 ? -1.481  -12.096 19.957 1.00 10.41 ? 36  ASP A OD2 1 
ATOM   280 N  N   . TRP A 1 37 ? -2.227  -10.052 15.434 1.00 6.66  ? 37  TRP A N   1 
ATOM   281 C  CA  . TRP A 1 37 ? -1.111  -9.580  14.601 1.00 7.16  ? 37  TRP A CA  1 
ATOM   282 C  C   . TRP A 1 37 ? -1.340  -8.069  14.269 1.00 5.34  ? 37  TRP A C   1 
ATOM   283 O  O   . TRP A 1 37 ? -2.415  -7.658  14.041 1.00 6.94  ? 37  TRP A O   1 
ATOM   284 C  CB  . TRP A 1 37 ? -1.113  -10.396 13.331 1.00 6.21  ? 37  TRP A CB  1 
ATOM   285 C  CG  . TRP A 1 37 ? -0.042  -10.143 12.358 1.00 6.18  ? 37  TRP A CG  1 
ATOM   286 C  CD1 . TRP A 1 37 ? 1.097   -10.811 12.226 1.00 7.50  ? 37  TRP A CD1 1 
ATOM   287 C  CD2 . TRP A 1 37 ? -0.029  -9.120  11.314 1.00 5.81  ? 37  TRP A CD2 1 
ATOM   288 N  NE1 . TRP A 1 37 ? 1.866   -10.338 11.173 1.00 7.15  ? 37  TRP A NE1 1 
ATOM   289 C  CE2 . TRP A 1 37 ? 1.171   -9.323  10.598 1.00 7.91  ? 37  TRP A CE2 1 
ATOM   290 C  CE3 . TRP A 1 37 ? -0.884  -8.128  10.938 1.00 6.84  ? 37  TRP A CE3 1 
ATOM   291 C  CZ2 . TRP A 1 37 ? 1.472   -8.509  9.479  1.00 8.01  ? 37  TRP A CZ2 1 
ATOM   292 C  CZ3 . TRP A 1 37 ? -0.576  -7.328  9.817  1.00 8.33  ? 37  TRP A CZ3 1 
ATOM   293 C  CH2 . TRP A 1 37 ? 0.595   -7.542  9.144  1.00 8.26  ? 37  TRP A CH2 1 
ATOM   294 N  N   . VAL A 1 38 ? -0.179  -7.390  14.265 1.00 5.34  ? 38  VAL A N   1 
ATOM   295 C  CA  . VAL A 1 38 ? -0.170  -5.969  13.926 1.00 5.70  ? 38  VAL A CA  1 
ATOM   296 C  C   . VAL A 1 38 ? 0.935   -5.785  12.894 1.00 5.74  ? 38  VAL A C   1 
ATOM   297 O  O   . VAL A 1 38 ? 1.841   -6.571  12.658 1.00 6.28  ? 38  VAL A O   1 
ATOM   298 C  CB  . VAL A 1 38 ? 0.044   -5.062  15.202 1.00 8.45  ? 38  VAL A CB  1 
ATOM   299 C  CG1 . VAL A 1 38 ? -1.084  -5.226  16.164 1.00 8.79  ? 38  VAL A CG1 1 
ATOM   300 C  CG2 . VAL A 1 38 ? 1.395   -5.346  15.792 1.00 9.77  ? 38  VAL A CG2 1 
ATOM   301 N  N   . CYS A 1 39 ? 0.869   -4.564  12.242 1.00 5.84  ? 39  CYS A N   1 
ATOM   302 C  CA  . CYS A 1 39 ? 1.874   -4.240  11.240 1.00 4.99  ? 39  CYS A CA  1 
ATOM   303 C  C   . CYS A 1 39 ? 3.261   -4.343  11.907 1.00 6.28  ? 39  CYS A C   1 
ATOM   304 O  O   . CYS A 1 39 ? 3.527   -3.695  12.899 1.00 6.51  ? 39  CYS A O   1 
ATOM   305 C  CB  . CYS A 1 39 ? 1.617   -2.810  10.827 1.00 4.53  ? 39  CYS A CB  1 
ATOM   306 S  SG  . CYS A 1 39 ? 2.881   -2.301  9.553  1.00 5.36  ? 39  CYS A SG  1 
ATOM   307 N  N   . PRO A 1 40 ? 4.180   -5.102  11.312 1.00 6.24  ? 40  PRO A N   1 
ATOM   308 C  CA  . PRO A 1 40 ? 5.506   -5.271  11.924 1.00 7.29  ? 40  PRO A CA  1 
ATOM   309 C  C   . PRO A 1 40 ? 6.389   -4.047  11.806 1.00 7.54  ? 40  PRO A C   1 
ATOM   310 O  O   . PRO A 1 40 ? 7.375   -3.939  12.519 1.00 10.63 ? 40  PRO A O   1 
ATOM   311 C  CB  . PRO A 1 40 ? 6.093   -6.487  11.265 1.00 9.72  ? 40  PRO A CB  1 
ATOM   312 C  CG  . PRO A 1 40 ? 5.375   -6.610  10.005 1.00 12.20 ? 40  PRO A CG  1 
ATOM   313 C  CD  . PRO A 1 40 ? 3.984   -5.983  10.134 1.00 8.02  ? 40  PRO A CD  1 
ATOM   314 N  N   . VAL A 1 41 ? 6.078   -3.149  10.905 1.00 6.20  ? 41  VAL A N   1 
ATOM   315 C  CA  . VAL A 1 41 ? 6.881   -1.932  10.753 1.00 6.86  ? 41  VAL A CA  1 
ATOM   316 C  C   . VAL A 1 41 ? 6.418   -0.858  11.681 1.00 7.28  ? 41  VAL A C   1 
ATOM   317 O  O   . VAL A 1 41 ? 7.275   -0.087  12.155 1.00 9.26  ? 41  VAL A O   1 
ATOM   318 C  CB  . VAL A 1 41 ? 6.874   -1.475  9.289  1.00 6.71  ? 41  VAL A CB  1 
ATOM   319 C  CG1 . VAL A 1 41 ? 7.522   -0.106  9.148  1.00 8.36  ? 41  VAL A CG1 1 
ATOM   320 C  CG2 . VAL A 1 41 ? 7.492   -2.512  8.368  1.00 10.54 ? 41  VAL A CG2 1 
ATOM   321 N  N   . CYS A 1 42 ? 5.108   -0.691  11.910 1.00 6.27  ? 42  CYS A N   1 
ATOM   322 C  CA  . CYS A 1 42 ? 4.643   0.411   12.734 1.00 5.82  ? 42  CYS A CA  1 
ATOM   323 C  C   . CYS A 1 42 ? 3.745   0.103   13.893 1.00 7.34  ? 42  CYS A C   1 
ATOM   324 O  O   . CYS A 1 42 ? 3.464   1.040   14.687 1.00 8.35  ? 42  CYS A O   1 
ATOM   325 C  CB  . CYS A 1 42 ? 3.930   1.467   11.802 1.00 6.49  ? 42  CYS A CB  1 
ATOM   326 S  SG  . CYS A 1 42 ? 2.256   0.995   11.274 1.00 6.36  ? 42  CYS A SG  1 
ATOM   327 N  N   . GLY A 1 43 ? 3.207   -1.102  13.994 1.00 6.57  ? 43  GLY A N   1 
ATOM   328 C  CA  . GLY A 1 43 ? 2.287   -1.449  15.089 1.00 6.78  ? 43  GLY A CA  1 
ATOM   329 C  C   . GLY A 1 43 ? 0.863   -1.235  14.822 1.00 7.10  ? 43  GLY A C   1 
ATOM   330 O  O   . GLY A 1 43 ? 0.070   -1.557  15.730 1.00 8.67  ? 43  GLY A O   1 
ATOM   331 N  N   . ALA A 1 44 ? 0.419   -0.727  13.699 1.00 6.07  ? 44  ALA A N   1 
ATOM   332 C  CA  . ALA A 1 44 ? -0.970  -0.446  13.407 1.00 6.49  ? 44  ALA A CA  1 
ATOM   333 C  C   . ALA A 1 44 ? -1.789  -1.727  13.289 1.00 6.59  ? 44  ALA A C   1 
ATOM   334 O  O   . ALA A 1 44 ? -1.307  -2.800  12.935 1.00 7.20  ? 44  ALA A O   1 
ATOM   335 C  CB  . ALA A 1 44 ? -1.053  0.290   12.087 1.00 9.79  ? 44  ALA A CB  1 
ATOM   336 N  N   . PRO A 1 45 ? -3.095  -1.636  13.570 1.00 6.99  ? 45  PRO A N   1 
ATOM   337 C  CA  . PRO A 1 45 ? -3.953  -2.763  13.517 1.00 6.30  ? 45  PRO A CA  1 
ATOM   338 C  C   . PRO A 1 45 ? -4.290  -3.161  12.119 1.00 6.65  ? 45  PRO A C   1 
ATOM   339 O  O   . PRO A 1 45 ? -4.271  -2.398  11.178 1.00 6.62  ? 45  PRO A O   1 
ATOM   340 C  CB  . PRO A 1 45 ? -5.202  -2.259  14.284 1.00 10.76 ? 45  PRO A CB  1 
ATOM   341 C  CG  . PRO A 1 45 ? -5.195  -0.767  14.015 1.00 14.25 ? 45  PRO A CG  1 
ATOM   342 C  CD  . PRO A 1 45 ? -3.771  -0.355  13.991 1.00 8.74  ? 45  PRO A CD  1 
ATOM   343 N  N   . LYS A 1 46 ? -4.762  -4.440  12.010 1.00 6.35  ? 46  LYS A N   1 
ATOM   344 C  CA  . LYS A 1 46 ? -5.215  -4.995  10.720 1.00 7.00  ? 46  LYS A CA  1 
ATOM   345 C  C   . LYS A 1 46 ? -6.372  -4.248  10.166 1.00 7.17  ? 46  LYS A C   1 
ATOM   346 O  O   . LYS A 1 46 ? -6.529  -4.189  8.943  1.00 8.21  ? 46  LYS A O   1 
ATOM   347 C  CB  . LYS A 1 46 ? -5.587  -6.481  10.835 1.00 7.23  ? 46  LYS A CB  1 
ATOM   348 C  CG  . LYS A 1 46 ? -4.372  -7.282  11.133 1.00 8.01  ? 46  LYS A CG  1 
ATOM   349 C  CD  . LYS A 1 46 ? -4.694  -8.775  11.225 1.00 9.48  ? 46  LYS A CD  1 
ATOM   350 C  CE  . LYS A 1 46 ? -5.567  -9.179  12.344 1.00 10.69 ? 46  LYS A CE  1 
ATOM   351 N  NZ  . LYS A 1 46 ? -5.064  -8.610  13.703 1.00 12.72 ? 46  LYS A NZ  1 
ATOM   352 N  N   . SER A 1 47 ? -7.228  -3.635  11.010 1.00 6.61  ? 47  SER A N   1 
ATOM   353 C  CA  . SER A 1 47 ? -8.374  -2.855  10.535 1.00 7.18  ? 47  SER A CA  1 
ATOM   354 C  C   . SER A 1 47 ? -7.940  -1.641  9.705  1.00 6.86  ? 47  SER A C   1 
ATOM   355 O  O   . SER A 1 47 ? -8.827  -1.081  9.075  1.00 9.67  ? 47  SER A O   1 
ATOM   356 C  CB  . SER A 1 47 ? -9.242  -2.484  11.747 1.00 8.79  ? 47  SER A CB  1 
ATOM   357 O  OG  . SER A 1 47 ? -8.544  -1.645  12.621 1.00 8.68  ? 47  SER A OG  1 
ATOM   358 N  N   . GLU A 1 48 ? -6.689  -1.267  9.774  1.00 6.09  ? 48  GLU A N   1 
ATOM   359 C  CA  . GLU A 1 48 ? -6.154  -0.156  9.027  1.00 5.79  ? 48  GLU A CA  1 
ATOM   360 C  C   . GLU A 1 48 ? -5.342  -0.543  7.848  1.00 5.39  ? 48  GLU A C   1 
ATOM   361 O  O   . GLU A 1 48 ? -4.590  0.264   7.278  1.00 7.68  ? 48  GLU A O   1 
ATOM   362 C  CB  . GLU A 1 48 ? -5.449  0.854   9.926  1.00 7.03  ? 48  GLU A CB  1 
ATOM   363 C  CG  . GLU A 1 48 ? -6.506  1.509   10.870 1.00 7.72  ? 48  GLU A CG  1 
ATOM   364 C  CD  . GLU A 1 48 ? -5.907  2.516   11.764 1.00 9.05  ? 48  GLU A CD  1 
ATOM   365 O  OE1 . GLU A 1 48 ? -4.685  2.614   11.842 1.00 11.17 ? 48  GLU A OE1 1 
ATOM   366 O  OE2 . GLU A 1 48 ? -6.687  3.236   12.442 1.00 13.38 ? 48  GLU A OE2 1 
ATOM   367 N  N   . PHE A 1 49 ? -5.475  -1.792  7.424  1.00 5.72  ? 49  PHE A N   1 
ATOM   368 C  CA  . PHE A 1 49 ? -4.882  -2.226  6.137  1.00 5.74  ? 49  PHE A CA  1 
ATOM   369 C  C   . PHE A 1 49 ? -6.013  -2.205  5.076  1.00 7.04  ? 49  PHE A C   1 
ATOM   370 O  O   . PHE A 1 49 ? -7.173  -2.406  5.361  1.00 9.87  ? 49  PHE A O   1 
ATOM   371 C  CB  . PHE A 1 49 ? -4.317  -3.650  6.246  1.00 6.69  ? 49  PHE A CB  1 
ATOM   372 C  CG  . PHE A 1 49 ? -3.016  -3.781  6.880  1.00 5.25  ? 49  PHE A CG  1 
ATOM   373 C  CD1 . PHE A 1 49 ? -2.843  -3.418  8.248  1.00 6.49  ? 49  PHE A CD1 1 
ATOM   374 C  CD2 . PHE A 1 49 ? -1.924  -4.266  6.199  1.00 6.43  ? 49  PHE A CD2 1 
ATOM   375 C  CE1 . PHE A 1 49 ? -1.578  -3.603  8.791  1.00 7.19  ? 49  PHE A CE1 1 
ATOM   376 C  CE2 . PHE A 1 49 ? -0.706  -4.434  6.727  1.00 6.22  ? 49  PHE A CE2 1 
ATOM   377 C  CZ  . PHE A 1 49 ? -0.514  -4.124  8.055  1.00 6.81  ? 49  PHE A CZ  1 
ATOM   378 N  N   . GLU A 1 50 ? -5.575  -2.001  3.840  1.00 6.32  ? 50  GLU A N   1 
ATOM   379 C  CA  . GLU A 1 50 ? -6.504  -2.038  2.705  1.00 8.04  ? 50  GLU A CA  1 
ATOM   380 C  C   . GLU A 1 50 ? -5.847  -2.958  1.633  1.00 5.39  ? 50  GLU A C   1 
ATOM   381 O  O   . GLU A 1 50 ? -4.726  -3.128  1.535  1.00 6.75  ? 50  GLU A O   1 
ATOM   382 C  CB  . GLU A 1 50 ? -6.738  -0.646  2.110  1.00 9.30  ? 50  GLU A CB  1 
ATOM   383 C  CG  . GLU A 1 50 ? -5.603  -0.023  1.436  1.00 8.43  ? 50  GLU A CG  1 
ATOM   384 C  CD  . GLU A 1 50 ? -5.910  1.442   0.862  1.00 12.13 ? 50  GLU A CD  1 
ATOM   385 O  OE1 . GLU A 1 50 ? -7.037  1.834   0.881  1.00 20.07 ? 50  GLU A OE1 1 
ATOM   386 O  OE2 . GLU A 1 50 ? -4.932  1.931   0.508  1.00 13.33 ? 50  GLU A OE2 1 
ATOM   387 N  N   . ALA A 1 51 ? -6.781  -3.476  0.823  1.00 8.20  ? 51  ALA A N   1 
ATOM   388 C  CA  . ALA A 1 51 ? -6.336  -4.347  -0.265 1.00 9.10  ? 51  ALA A CA  1 
ATOM   389 C  C   . ALA A 1 51 ? -5.431  -3.519  -1.247 1.00 9.16  ? 51  ALA A C   1 
ATOM   390 O  O   . ALA A 1 51 ? -5.848  -2.400  -1.523 1.00 12.32 ? 51  ALA A O   1 
ATOM   391 C  CB  . ALA A 1 51 ? -7.486  -4.940  -0.999 1.00 14.13 ? 51  ALA A CB  1 
ATOM   392 N  N   . ALA A 1 52 ? -4.384  -4.077  -1.661 1.00 11.54 ? 52  ALA A N   1 
ATOM   393 C  CA  . ALA A 1 52 ? -3.362  -3.405  -2.562 1.00 14.36 ? 52  ALA A CA  1 
ATOM   394 C  C   . ALA A 1 52 ? -2.976  -4.302  -3.736 1.00 31.89 ? 52  ALA A C   1 
ATOM   395 O  O   . ALA A 1 52 ? -3.736  -5.279  -4.015 1.00 39.13 ? 52  ALA A O   1 
ATOM   396 C  CB  . ALA A 1 52 ? -2.037  -3.213  -1.744 1.00 26.75 ? 52  ALA A CB  1 
ATOM   397 O  OXT . ALA A 1 52 ? -1.860  -3.427  -4.363 1.00 65.19 ? 52  ALA A OXT 1 
HETATM 398 FE FE  . FE  B 2 .  ? 2.322   -0.095  9.294  1.00 5.14  ? 55  FE  A FE  1 
HETATM 399 S  S   . SO4 C 3 .  ? -7.081  -5.657  14.565 1.00 12.46 ? 56  SO4 A S   1 
HETATM 400 O  O1  . SO4 C 3 .  ? -7.724  -4.762  13.610 1.00 10.58 ? 56  SO4 A O1  1 
HETATM 401 O  O2  . SO4 C 3 .  ? -7.721  -7.022  14.495 1.00 22.88 ? 56  SO4 A O2  1 
HETATM 402 O  O3  . SO4 C 3 .  ? -5.557  -5.805  14.326 1.00 13.02 ? 56  SO4 A O3  1 
HETATM 403 O  O4  . SO4 C 3 .  ? -7.187  -5.048  15.971 1.00 22.42 ? 56  SO4 A O4  1 
HETATM 404 O  O   . HOH D 4 .  ? 4.699   -9.924  4.277  1.00 10.27 ? 57  HOH A O   1 
HETATM 405 O  O   . HOH D 4 .  ? 2.488   -20.166 10.817 1.00 10.91 ? 58  HOH A O   1 
HETATM 406 O  O   . HOH D 4 .  ? 3.363   -13.859 -4.973 1.00 11.15 ? 59  HOH A O   1 
HETATM 407 O  O   . HOH D 4 .  ? -4.241  -12.351 1.395  1.00 10.61 ? 60  HOH A O   1 
HETATM 408 O  O   . HOH D 4 .  ? -0.325  -20.977 6.090  1.00 15.20 ? 61  HOH A O   1 
HETATM 409 O  O   . HOH D 4 .  ? -9.334  1.909   8.325  1.00 16.45 ? 62  HOH A O   1 
HETATM 410 O  O   . HOH D 4 .  ? -4.042  -18.910 4.312  1.00 14.23 ? 63  HOH A O   1 
HETATM 411 O  O   . HOH D 4 .  ? -10.288 1.742   -6.406 1.00 12.94 ? 64  HOH A O   1 
HETATM 412 O  O   . HOH D 4 .  ? -5.117  -1.471  -4.339 1.00 16.05 ? 65  HOH A O   1 
HETATM 413 O  O   . HOH D 4 .  ? -10.036 -12.316 9.596  1.00 18.77 ? 66  HOH A O   1 
HETATM 414 O  O   . HOH D 4 .  ? 6.493   -3.669  2.474  1.00 23.03 ? 67  HOH A O   1 
HETATM 415 O  O   . HOH D 4 .  ? -6.773  -12.547 2.701  1.00 25.18 ? 68  HOH A O   1 
HETATM 416 O  O   . HOH D 4 .  ? -6.865  -10.398 9.031  1.00 18.52 ? 69  HOH A O   1 
HETATM 417 O  O   . HOH D 4 .  ? 1.647   -12.214 -3.096 1.00 17.43 ? 70  HOH A O   1 
HETATM 418 O  O   . HOH D 4 .  ? 8.275   -9.105  10.983 1.00 21.64 ? 71  HOH A O   1 
HETATM 419 O  O   . HOH D 4 .  ? -7.495  -2.230  -5.860 1.00 27.24 ? 72  HOH A O   1 
HETATM 420 O  O   . HOH D 4 .  ? 2.281   -9.256  15.320 1.00 37.50 ? 73  HOH A O   1 
HETATM 421 O  O   . HOH D 4 .  ? 0.460   -12.134 16.303 1.00 38.78 ? 74  HOH A O   1 
HETATM 422 O  O   . HOH D 4 .  ? -8.229  -1.214  -1.660 1.00 21.82 ? 75  HOH A O   1 
HETATM 423 O  O   . HOH D 4 .  ? 7.757   -11.079 5.542  1.00 25.59 ? 76  HOH A O   1 
HETATM 424 O  O   . HOH D 4 .  ? 6.999   -8.895  7.359  1.00 24.86 ? 77  HOH A O   1 
HETATM 425 O  O   . HOH D 4 .  ? -9.682  -3.261  1.545  1.00 22.95 ? 78  HOH A O   1 
HETATM 426 O  O   . HOH D 4 .  ? -7.147  -3.941  -7.914 1.00 21.81 ? 79  HOH A O   1 
HETATM 427 O  O   . HOH D 4 .  ? -4.059  -6.696  16.504 1.00 28.09 ? 80  HOH A O   1 
HETATM 428 O  O   . HOH D 4 .  ? -8.849  3.884   -0.485 1.00 32.89 ? 81  HOH A O   1 
HETATM 429 O  O   . HOH D 4 .  ? -5.041  -22.616 6.138  1.00 26.80 ? 82  HOH A O   1 
HETATM 430 O  O   . HOH D 4 .  ? 6.409   -14.912 -4.862 1.00 26.45 ? 83  HOH A O   1 
HETATM 431 O  O   . HOH D 4 .  ? -7.490  3.628   6.688  1.00 23.33 ? 84  HOH A O   1 
HETATM 432 O  O   . HOH D 4 .  ? 0.955   -21.663 4.212  1.00 22.45 ? 85  HOH A O   1 
HETATM 433 O  O   . HOH D 4 .  ? -9.337  5.508   -3.493 1.00 27.07 ? 86  HOH A O   1 
HETATM 434 O  O   . HOH D 4 .  ? -8.730  1.363   13.672 1.00 38.75 ? 87  HOH A O   1 
HETATM 435 O  O   . HOH D 4 .  ? 12.976  -12.717 10.600 1.00 22.51 ? 88  HOH A O   1 
HETATM 436 O  O   . HOH D 4 .  ? -1.376  -7.084  19.324 1.00 32.49 ? 89  HOH A O   1 
HETATM 437 O  O   . HOH D 4 .  ? -2.826  -21.176 5.359  1.00 29.22 ? 90  HOH A O   1 
HETATM 438 O  O   . HOH D 4 .  ? -9.467  -1.261  6.285  1.00 46.80 ? 91  HOH A O   1 
HETATM 439 O  O   . HOH D 4 .  ? 9.944   -5.777  11.848 1.00 29.67 ? 92  HOH A O   1 
HETATM 440 O  O   . HOH D 4 .  ? 8.054   -7.912  14.147 1.00 29.27 ? 93  HOH A O   1 
HETATM 441 O  O   . HOH D 4 .  ? 5.610   -16.065 16.936 1.00 27.19 ? 94  HOH A O   1 
HETATM 442 O  O   . HOH D 4 .  ? -12.172 -2.169  4.599  1.00 45.39 ? 95  HOH A O   1 
HETATM 443 O  O   . HOH D 4 .  ? 3.197   -4.330  -5.924 1.00 34.63 ? 96  HOH A O   1 
HETATM 444 O  O   . HOH D 4 .  ? -10.490 2.972   -4.389 1.00 46.64 ? 97  HOH A O   1 
HETATM 445 O  O   . HOH D 4 .  ? -13.412 1.207   5.516  1.00 51.55 ? 98  HOH A O   1 
HETATM 446 O  O   . HOH D 4 .  ? 4.769   -7.092  15.302 1.00 42.02 ? 99  HOH A O   1 
HETATM 447 O  O   . HOH D 4 .  ? 8.653   -19.378 -4.391 1.00 57.47 ? 100 HOH A O   1 
HETATM 448 O  O   . HOH D 4 .  ? -9.503  -9.976  7.735  1.00 34.79 ? 101 HOH A O   1 
HETATM 449 O  O   . HOH D 4 .  ? -4.452  -5.145  -8.210 1.00 37.22 ? 102 HOH A O   1 
HETATM 450 O  O   . HOH D 4 .  ? -5.057  -14.526 -5.132 1.00 39.77 ? 103 HOH A O   1 
HETATM 451 O  O   . HOH D 4 .  ? -6.200  -13.994 -1.075 1.00 38.91 ? 104 HOH A O   1 
HETATM 452 O  O   . HOH D 4 .  ? 4.405   -6.463  -4.365 1.00 39.11 ? 105 HOH A O   1 
HETATM 453 O  O   . HOH D 4 .  ? 3.301   -8.088  13.808 1.00 38.90 ? 106 HOH A O   1 
HETATM 454 O  O   . HOH D 4 .  ? 2.213   -10.639 16.684 1.00 51.54 ? 107 HOH A O   1 
HETATM 455 O  O   . HOH D 4 .  ? -11.487 3.947   -3.536 1.00 42.13 ? 108 HOH A O   1 
HETATM 456 O  O   . HOH D 4 .  ? -1.636  -6.505  24.092 1.00 48.52 ? 109 HOH A O   1 
HETATM 457 O  O   . HOH D 4 .  ? 3.389   2.478   -0.961 1.00 59.36 ? 110 HOH A O   1 
HETATM 458 O  O   . HOH D 4 .  ? 1.182   0.177   18.538 1.00 34.52 ? 111 HOH A O   1 
HETATM 459 O  O   . HOH D 4 .  ? -8.814  -4.931  7.257  1.00 55.58 ? 112 HOH A O   1 
HETATM 460 O  O   . HOH D 4 .  ? 6.995   -8.960  3.100  1.00 43.58 ? 113 HOH A O   1 
HETATM 461 O  O   . HOH D 4 .  ? -11.039 2.833   6.202  1.00 47.25 ? 114 HOH A O   1 
HETATM 462 O  O   . HOH D 4 .  ? 1.062   -13.479 20.461 1.00 40.37 ? 115 HOH A O   1 
HETATM 463 O  O   . HOH D 4 .  ? 1.068   -8.946  18.170 1.00 34.74 ? 116 HOH A O   1 
HETATM 464 O  O   . HOH D 4 .  ? 6.730   -6.807  2.623  1.00 31.95 ? 117 HOH A O   1 
HETATM 465 O  O   . HOH D 4 .  ? 10.725  -9.032  14.895 1.00 33.04 ? 118 HOH A O   1 
HETATM 466 O  O   . HOH D 4 .  ? -10.697 -22.065 4.239  1.00 35.58 ? 119 HOH A O   1 
HETATM 467 O  O   . HOH D 4 .  ? -10.303 -4.679  5.467  1.00 54.65 ? 120 HOH A O   1 
HETATM 468 O  O   . HOH D 4 .  ? -9.365  5.703   6.946  1.00 30.61 ? 121 HOH A O   1 
HETATM 469 O  O   . HOH D 4 .  ? -8.271  -23.075 5.045  1.00 43.82 ? 122 HOH A O   1 
HETATM 470 O  O   . HOH D 4 .  ? 7.054   -8.449  -1.402 1.00 43.62 ? 123 HOH A O   1 
HETATM 471 O  O   . HOH D 4 .  ? -2.473  -6.199  -6.663 1.00 37.97 ? 124 HOH A O   1 
HETATM 472 O  O   . HOH D 4 .  ? -7.979  -15.299 0.844  1.00 38.27 ? 125 HOH A O   1 
HETATM 473 O  O   . HOH D 4 .  ? 10.520  -7.878  12.152 1.00 43.98 ? 126 HOH A O   1 
HETATM 474 O  O   . HOH D 4 .  ? -6.398  -3.544  18.502 1.00 32.64 ? 127 HOH A O   1 
HETATM 475 O  O   . HOH D 4 .  ? 9.228   -5.581  -3.377 1.00 45.54 ? 128 HOH A O   1 
HETATM 476 O  O   . HOH D 4 .  ? -9.345  1.346   -0.952 1.00 49.31 ? 129 HOH A O   1 
HETATM 477 O  O   . HOH D 4 .  ? -3.223  -15.726 -0.739 1.00 39.46 ? 130 HOH A O   1 
HETATM 478 O  O   . HOH D 4 .  ? -10.974 -6.552  4.022  1.00 56.67 ? 131 HOH A O   1 
HETATM 479 O  O   . HOH D 4 .  ? 1.569   3.424   -0.281 1.00 56.01 ? 132 HOH A O   1 
HETATM 480 O  O   . HOH D 4 .  ? -4.204  -14.364 0.533  1.00 63.26 ? 133 HOH A O   1 
HETATM 481 O  O   . HOH D 4 .  ? 3.063   -13.315 17.516 1.00 72.09 ? 134 HOH A O   1 
HETATM 482 O  O   . HOH D 4 .  ? 4.803   -12.312 17.748 1.00 48.86 ? 135 HOH A O   1 
HETATM 483 O  O   . HOH D 4 .  ? -7.319  -17.470 1.759  1.00 55.04 ? 136 HOH A O   1 
HETATM 484 O  O   . HOH D 4 .  ? -9.981  -8.860  3.828  1.00 42.22 ? 137 HOH A O   1 
HETATM 485 O  O   . HOH D 4 .  ? -3.270  -10.437 -6.609 1.00 38.87 ? 138 HOH A O   1 
HETATM 486 O  O   . HOH D 4 .  ? 8.389   -16.432 -2.269 1.00 54.30 ? 139 HOH A O   1 
HETATM 487 O  O   . HOH D 4 .  ? -4.861  -3.704  -4.238 1.00 46.19 ? 140 HOH A O   1 
HETATM 488 O  O   . HOH D 4 .  ? -2.453  -8.197  -4.561 1.00 28.90 ? 141 HOH A O   1 
HETATM 489 O  O   . HOH D 4 .  ? -3.468  -13.399 -5.663 1.00 55.46 ? 142 HOH A O   1 
HETATM 490 O  O   . HOH D 4 .  ? -7.152  -12.182 0.838  1.00 66.84 ? 143 HOH A O   1 
HETATM 491 O  O   . HOH D 4 .  ? -8.977  -11.395 1.612  1.00 66.25 ? 144 HOH A O   1 
HETATM 492 O  O   . HOH D 4 .  ? -5.876  -14.770 3.046  1.00 39.27 ? 145 HOH A O   1 
HETATM 493 O  O   . HOH D 4 .  ? 3.920   0.504   -0.235 1.00 65.57 ? 146 HOH A O   1 
HETATM 494 O  O   . HOH D 4 .  ? 1.341   -1.254  -2.163 1.00 56.56 ? 147 HOH A O   1 
HETATM 495 O  O   . HOH D 4 .  ? 7.650   -0.548  4.962  1.00 63.00 ? 148 HOH A O   1 
HETATM 496 O  O   . HOH D 4 .  ? 9.062   -15.977 4.866  1.00 55.91 ? 149 HOH A O   1 
HETATM 497 O  O   . HOH D 4 .  ? 9.644   -14.361 0.837  1.00 44.90 ? 150 HOH A O   1 
HETATM 498 O  O   . HOH D 4 .  ? 9.222   -6.554  1.336  1.00 40.91 ? 151 HOH A O   1 
HETATM 499 O  O   . HOH D 4 .  ? 8.809   -11.183 8.640  1.00 66.93 ? 152 HOH A O   1 
HETATM 500 O  O   . HOH D 4 .  ? 10.992  -7.963  9.647  1.00 60.56 ? 153 HOH A O   1 
HETATM 501 O  O   . HOH D 4 .  ? 9.265   -5.982  9.357  1.00 49.73 ? 154 HOH A O   1 
HETATM 502 O  O   . HOH D 4 .  ? 8.977   -5.664  13.621 1.00 41.99 ? 155 HOH A O   1 
HETATM 503 O  O   . HOH D 4 .  ? 10.643  -7.537  -4.097 1.00 68.14 ? 156 HOH A O   1 
HETATM 504 O  O   . HOH D 4 .  ? 11.992  -5.060  -4.775 1.00 52.50 ? 157 HOH A O   1 
HETATM 505 O  O   . HOH D 4 .  ? 1.458   -12.959 14.755 1.00 68.14 ? 158 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  LYS 2  2  2  LYS LYS A . n 
A 1 3  LYS 3  3  3  LYS LYS A . n 
A 1 4  TYR 4  4  4  TYR TYR A . n 
A 1 5  VAL 5  5  5  VAL VAL A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  THR 7  7  7  THR THR A . n 
A 1 8  VAL 8  8  8  VAL VAL A . n 
A 1 9  CYS 9  9  9  CYS CYS A . n 
A 1 10 GLY 10 10 10 GLY GLY A . n 
A 1 11 TYR 11 11 11 TYR TYR A . n 
A 1 12 GLU 12 12 12 GLU GLU A . n 
A 1 13 TYR 13 13 13 TYR TYR A . n 
A 1 14 ASP 14 14 14 ASP ASP A . n 
A 1 15 PRO 15 15 15 PRO PRO A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 GLY 18 18 18 GLY GLY A . n 
A 1 19 ASP 19 19 19 ASP ASP A . n 
A 1 20 PRO 20 20 20 PRO PRO A . n 
A 1 21 ASP 21 21 21 ASP ASP A . n 
A 1 22 ASN 22 22 22 ASN ASN A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 LYS 25 25 25 LYS LYS A . n 
A 1 26 PRO 26 26 26 PRO PRO A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 THR 28 28 28 THR THR A . n 
A 1 29 SER 29 29 29 SER SER A . n 
A 1 30 PHE 30 30 30 PHE PHE A . n 
A 1 31 ASP 31 31 31 ASP ASP A . n 
A 1 32 ASP 32 32 32 ASP ASP A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 PRO 34 34 34 PRO PRO A . n 
A 1 35 ALA 35 35 35 ALA ALA A . n 
A 1 36 ASP 36 36 36 ASP ASP A . n 
A 1 37 TRP 37 37 37 TRP TRP A . n 
A 1 38 VAL 38 38 38 VAL VAL A . n 
A 1 39 CYS 39 39 39 CYS CYS A . n 
A 1 40 PRO 40 40 40 PRO PRO A . n 
A 1 41 VAL 41 41 41 VAL VAL A . n 
A 1 42 CYS 42 42 42 CYS CYS A . n 
A 1 43 GLY 43 43 43 GLY GLY A . n 
A 1 44 ALA 44 44 44 ALA ALA A . n 
A 1 45 PRO 45 45 45 PRO PRO A . n 
A 1 46 LYS 46 46 46 LYS LYS A . n 
A 1 47 SER 47 47 47 SER SER A . n 
A 1 48 GLU 48 48 48 GLU GLU A . n 
A 1 49 PHE 49 49 49 PHE PHE A . n 
A 1 50 GLU 50 50 50 GLU GLU A . n 
A 1 51 ALA 51 51 51 ALA ALA A . n 
A 1 52 ALA 52 52 52 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FE  1   55  55  FE  FE  A . 
C 3 SO4 1   56  56  SO4 SO4 A . 
D 4 HOH 1   57  1   HOH HOH A . 
D 4 HOH 2   58  2   HOH HOH A . 
D 4 HOH 3   59  3   HOH HOH A . 
D 4 HOH 4   60  4   HOH HOH A . 
D 4 HOH 5   61  5   HOH HOH A . 
D 4 HOH 6   62  6   HOH HOH A . 
D 4 HOH 7   63  7   HOH HOH A . 
D 4 HOH 8   64  8   HOH HOH A . 
D 4 HOH 9   65  9   HOH HOH A . 
D 4 HOH 10  66  10  HOH HOH A . 
D 4 HOH 11  67  11  HOH HOH A . 
D 4 HOH 12  68  12  HOH HOH A . 
D 4 HOH 13  69  13  HOH HOH A . 
D 4 HOH 14  70  14  HOH HOH A . 
D 4 HOH 15  71  15  HOH HOH A . 
D 4 HOH 16  72  16  HOH HOH A . 
D 4 HOH 17  73  17  HOH HOH A . 
D 4 HOH 18  74  18  HOH HOH A . 
D 4 HOH 19  75  19  HOH HOH A . 
D 4 HOH 20  76  20  HOH HOH A . 
D 4 HOH 21  77  21  HOH HOH A . 
D 4 HOH 22  78  22  HOH HOH A . 
D 4 HOH 23  79  23  HOH HOH A . 
D 4 HOH 24  80  24  HOH HOH A . 
D 4 HOH 25  81  25  HOH HOH A . 
D 4 HOH 26  82  26  HOH HOH A . 
D 4 HOH 27  83  27  HOH HOH A . 
D 4 HOH 28  84  28  HOH HOH A . 
D 4 HOH 29  85  29  HOH HOH A . 
D 4 HOH 30  86  30  HOH HOH A . 
D 4 HOH 31  87  31  HOH HOH A . 
D 4 HOH 32  88  32  HOH HOH A . 
D 4 HOH 33  89  33  HOH HOH A . 
D 4 HOH 34  90  34  HOH HOH A . 
D 4 HOH 35  91  35  HOH HOH A . 
D 4 HOH 36  92  36  HOH HOH A . 
D 4 HOH 37  93  37  HOH HOH A . 
D 4 HOH 38  94  38  HOH HOH A . 
D 4 HOH 39  95  39  HOH HOH A . 
D 4 HOH 40  96  40  HOH HOH A . 
D 4 HOH 41  97  41  HOH HOH A . 
D 4 HOH 42  98  42  HOH HOH A . 
D 4 HOH 43  99  43  HOH HOH A . 
D 4 HOH 44  100 44  HOH HOH A . 
D 4 HOH 45  101 45  HOH HOH A . 
D 4 HOH 46  102 46  HOH HOH A . 
D 4 HOH 47  103 47  HOH HOH A . 
D 4 HOH 48  104 48  HOH HOH A . 
D 4 HOH 49  105 49  HOH HOH A . 
D 4 HOH 50  106 50  HOH HOH A . 
D 4 HOH 51  107 51  HOH HOH A . 
D 4 HOH 52  108 52  HOH HOH A . 
D 4 HOH 53  109 53  HOH HOH A . 
D 4 HOH 54  110 54  HOH HOH A . 
D 4 HOH 55  111 55  HOH HOH A . 
D 4 HOH 56  112 56  HOH HOH A . 
D 4 HOH 57  113 57  HOH HOH A . 
D 4 HOH 58  114 58  HOH HOH A . 
D 4 HOH 59  115 59  HOH HOH A . 
D 4 HOH 60  116 60  HOH HOH A . 
D 4 HOH 61  117 61  HOH HOH A . 
D 4 HOH 62  118 62  HOH HOH A . 
D 4 HOH 63  119 63  HOH HOH A . 
D 4 HOH 64  120 64  HOH HOH A . 
D 4 HOH 65  121 65  HOH HOH A . 
D 4 HOH 66  122 66  HOH HOH A . 
D 4 HOH 67  123 67  HOH HOH A . 
D 4 HOH 68  124 68  HOH HOH A . 
D 4 HOH 69  125 69  HOH HOH A . 
D 4 HOH 70  126 70  HOH HOH A . 
D 4 HOH 71  127 71  HOH HOH A . 
D 4 HOH 72  128 72  HOH HOH A . 
D 4 HOH 73  129 73  HOH HOH A . 
D 4 HOH 74  130 74  HOH HOH A . 
D 4 HOH 75  131 75  HOH HOH A . 
D 4 HOH 76  132 76  HOH HOH A . 
D 4 HOH 77  133 77  HOH HOH A . 
D 4 HOH 78  134 78  HOH HOH A . 
D 4 HOH 79  135 79  HOH HOH A . 
D 4 HOH 80  136 80  HOH HOH A . 
D 4 HOH 81  137 81  HOH HOH A . 
D 4 HOH 82  138 82  HOH HOH A . 
D 4 HOH 83  139 83  HOH HOH A . 
D 4 HOH 84  140 84  HOH HOH A . 
D 4 HOH 85  141 85  HOH HOH A . 
D 4 HOH 86  142 86  HOH HOH A . 
D 4 HOH 87  143 87  HOH HOH A . 
D 4 HOH 88  144 88  HOH HOH A . 
D 4 HOH 89  145 89  HOH HOH A . 
D 4 HOH 90  146 90  HOH HOH A . 
D 4 HOH 91  147 91  HOH HOH A . 
D 4 HOH 92  148 92  HOH HOH A . 
D 4 HOH 93  149 93  HOH HOH A . 
D 4 HOH 94  150 94  HOH HOH A . 
D 4 HOH 95  151 95  HOH HOH A . 
D 4 HOH 96  152 96  HOH HOH A . 
D 4 HOH 97  153 97  HOH HOH A . 
D 4 HOH 98  154 98  HOH HOH A . 
D 4 HOH 99  155 99  HOH HOH A . 
D 4 HOH 100 156 100 HOH HOH A . 
D 4 HOH 101 157 101 HOH HOH A . 
D 4 HOH 102 158 102 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 6  ? A CYS 6  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 9  ? A CYS 9  ? 1_555 114.7 ? 
2 SG ? A CYS 6  ? A CYS 6  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 111.0 ? 
3 SG ? A CYS 9  ? A CYS 9  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 104.5 ? 
4 SG ? A CYS 6  ? A CYS 6  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 105.5 ? 
5 SG ? A CYS 9  ? A CYS 9  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 109.3 ? 
6 SG ? A CYS 39 ? A CYS 39 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 111.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1993-10-31 
2 'Structure model' 1 1 2008-03-25 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             PROLSQ 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 CB  A SER 29  ? ? O A HOH 145 ? ? 1.45 
2  1 O   A HOH 97  ? ? O A HOH 108 ? ? 1.63 
3  1 OG  A SER 29  ? ? O A HOH 145 ? ? 1.68 
4  1 O   A HOH 68  ? ? O A HOH 143 ? ? 1.94 
5  1 O   A HOH 73  ? ? O A HOH 107 ? ? 1.94 
6  1 O   A ALA 52  ? ? O A HOH 140 ? ? 1.95 
7  1 OD1 A ASP 21  ? A O A HOH 88  ? ? 1.96 
8  1 O   A HOH 74  ? ? O A HOH 158 ? ? 2.02 
9  1 O   A HOH 103 ? ? O A HOH 142 ? ? 2.02 
10 1 O   A HOH 134 ? ? O A HOH 135 ? ? 2.02 
11 1 O   A HOH 92  ? ? O A HOH 155 ? ? 2.02 
12 1 C   A ALA 52  ? ? O A HOH 140 ? ? 2.04 
13 1 O   A HOH 130 ? ? O A HOH 133 ? ? 2.11 
14 1 O   A HOH 143 ? ? O A HOH 144 ? ? 2.13 
15 1 O   A HOH 110 ? ? O A HOH 132 ? ? 2.16 
16 1 O   A HOH 73  ? ? O A HOH 106 ? ? 2.17 
17 1 O   A HOH 110 ? ? O A HOH 146 ? ? 2.17 
18 1 O   A HOH 60  ? ? O A HOH 133 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 86  ? ? 1_555 O A HOH 149 ? ? 2_555 1.59 
2 1 O A HOH 95  ? ? 1_555 O A HOH 148 ? ? 1_455 1.67 
3 1 O A HOH 102 ? ? 1_555 O A HOH 155 ? ? 1_454 1.83 
4 1 O A HOH 66  ? ? 1_555 O A HOH 152 ? ? 1_455 1.86 
5 1 O A HOH 109 ? ? 1_555 O A HOH 117 ? ? 1_556 1.87 
6 1 O A HOH 89  ? ? 1_555 O A HOH 105 ? ? 1_556 2.05 
7 1 O A HOH 58  ? ? 1_555 O A HOH 87  ? ? 2_546 2.10 
8 1 O A HOH 98  ? ? 1_555 O A HOH 148 ? ? 1_455 2.14 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A GLU 12 ? ? CG  A GLU 12 ? A 1.634 1.517 0.117  0.019 N 
2 1 CD A GLU 50 ? ? OE2 A GLU 50 ? ? 1.149 1.252 -0.103 0.011 N 
3 1 C  A ALA 52 ? ? OXT A ALA 52 ? ? 1.551 1.229 0.322  0.019 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 OE1 A GLU 12 ? A CD  A GLU 12 ? A OE2 A GLU 12 ? A 132.23 123.30 8.93  1.20 N 
2 1 CB  A ASP 14 ? ? CG  A ASP 14 ? ? OD2 A ASP 14 ? ? 111.06 118.30 -7.24 0.90 N 
3 1 CA  A ASP 21 ? ? CB  A ASP 21 ? ? CG  A ASP 21 ? A 130.25 113.40 16.85 2.20 N 
4 1 CB  A ASP 21 ? ? CG  A ASP 21 ? B OD2 A ASP 21 ? B 112.34 118.30 -5.96 0.90 N 
5 1 CD1 A PHE 30 ? ? CE1 A PHE 30 ? ? CZ  A PHE 30 ? ? 112.52 120.10 -7.58 1.20 N 
6 1 CB  A ASP 32 ? ? CG  A ASP 32 ? ? OD1 A ASP 32 ? ? 126.99 118.30 8.69  0.90 N 
7 1 CB  A ASP 32 ? ? CG  A ASP 32 ? ? OD2 A ASP 32 ? ? 112.27 118.30 -6.03 0.90 N 
8 1 OE1 A GLU 50 ? ? CD  A GLU 50 ? ? OE2 A GLU 50 ? ? 131.97 123.30 8.67  1.20 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     19 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -157.55 
_pdbx_validate_torsion.psi             76.70 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 0 A LYS 2 ? CD ? A LYS 2 CD 
2 1 Y 0 A LYS 2 ? CE ? A LYS 2 CE 
3 1 Y 0 A LYS 2 ? NZ ? A LYS 2 NZ 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION' FE  
3 'SULFATE ION'  SO4 
4 water          HOH 
#