data_9INS
# 
_entry.id   9INS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   9INS         
WWPDB D_1000180064 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        9INS 
_pdbx_database_status.recvd_initial_deposition_date   1991-10-23 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Badger, J.'   1 
'Dodson, G.G.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Monovalent cation binding to cubic insulin crystals'                      Biophys.J.                 61  604 611 1992 
BIOJAU US 0006-3495 0030 ? 1504238 ? 
1       'Structure of the Pig Insulin Dimer in the Cubic Crystal'                  'Acta Crystallogr.,Sect.B' 47  127 ?   1991 
ASBSDK DK 0108-7681 0622 ? ?       ? 
2       'Water Structure in Cubic Insulin Crystals'                                Proc.Natl.Acad.Sci.USA     88  622 ?   1991 
PNASA6 US 0027-8424 0040 ? ?       ? 
3       'Zinc-Free Cubic Pig Insulin: Crystallization and Structure Determination' J.Mol.Biol.                125 387 ?   1978 
JMOBAK UK 0022-2836 0070 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gursky, O.'     1  
primary 'Li, Y.'         2  
primary 'Badger, J.'     3  
primary 'Caspar, D.L.D.' 4  
1       'Badger, J.'     5  
1       'Harris, M.R.'   6  
1       'Reynolds, C.D.' 7  
1       'Evans, A.C.'    8  
1       'Dodson, E.J.'   9  
1       'Dodson, G.G.'   10 
1       'North, A.C.T.'  11 
2       'Badger, J.'     12 
2       'Caspar, D.L.D.' 13 
3       'Dodson, E.J.'   14 
3       'Dodson, G.G.'   15 
3       'Lewitova, A.'   16 
3       'Sabesan, M.'    17 
# 
_cell.entry_id           9INS 
_cell.length_a           78.900 
_cell.length_b           78.900 
_cell.length_c           78.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         9INS 
_symmetry.space_group_name_H-M             'I 21 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                199 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'INSULIN (CHAIN A)' 2383.698 1  ? ? ? ? 
2 polymer man 'INSULIN (CHAIN B)' 3403.927 1  ? ? ? ? 
3 water   nat water               18.015   81 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN          GIVEQCCTSICSLYQLENYCN          A ? 
2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFFYTPKA B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ILE n 
1 3  VAL n 
1 4  GLU n 
1 5  GLN n 
1 6  CYS n 
1 7  CYS n 
1 8  THR n 
1 9  SER n 
1 10 ILE n 
1 11 CYS n 
1 12 SER n 
1 13 LEU n 
1 14 TYR n 
1 15 GLN n 
1 16 LEU n 
1 17 GLU n 
1 18 ASN n 
1 19 TYR n 
1 20 CYS n 
1 21 ASN n 
2 1  PHE n 
2 2  VAL n 
2 3  ASN n 
2 4  GLN n 
2 5  HIS n 
2 6  LEU n 
2 7  CYS n 
2 8  GLY n 
2 9  SER n 
2 10 HIS n 
2 11 LEU n 
2 12 VAL n 
2 13 GLU n 
2 14 ALA n 
2 15 LEU n 
2 16 TYR n 
2 17 LEU n 
2 18 VAL n 
2 19 CYS n 
2 20 GLY n 
2 21 GLU n 
2 22 ARG n 
2 23 GLY n 
2 24 PHE n 
2 25 PHE n 
2 26 TYR n 
2 27 THR n 
2 28 PRO n 
2 29 LYS n 
2 30 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? pig Sus ? ? ? ? ? ? ? 'Sus scrofa' 9823 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? pig Sus ? ? ? ? ? ? ? 'Sus scrofa' 9823 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP INS_PIG P01315 1 88 ? ? 
2 UNP INS_PIG P01315 2 25 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 9INS A 1 ? 21 ? P01315 88 ? 108 ? 1 21 
2 2 9INS B 1 ? 30 ? P01315 25 ? 54  ? 1 30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          9INS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.54 
_exptl_crystal.density_percent_sol   65.21 
_exptl_crystal.description           ? 
# 
_refine.entry_id                                 9INS 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10 
_refine.ls_d_res_high                            1.7 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.178 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;BY COMPARISON WITH MULTIPLE DATA SETS FROM BOVINE CUBIC
INSULIN COLLECTED IN THE PH RANGE 7 TO 11 (REFERENCE 1 AND
UNPUBLISHED RESULTS) IT HAS BEEN POSSIBLE TO RELIABLY
IDENTIFY ADDITIONAL CONFORMATIONS FOR SEVERAL SIDE CHAINS
THAT WERE NOT INCLUDED IN THE PUBLISHED (ACTA CRYSTALLOGR.)
REPORT.  THESE HAVE BEEN MODELED, THE ORDERED SOLVENT
RATIONALIZED AND THE STRUCTURE REFINED FURTHER.  THE
R-FACTOR AND STEREOCHEMICAL PARAMETERS IN THIS ENTRY ARE
FOR THIS NEW MODEL.  IN THE ACTA CRYSTALLOGRAPHICA 1991
PUBLICATION (REFERENCE 2 ABOVE) REFERENCE IS MADE TO
PROTEIN DATA BANK ENTRY 5INS.  THE COORDINATES IN THIS
ENTRY SUPERSEDE 5INS.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        451 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             81 
_refine_hist.number_atoms_total               532 
_refine_hist.d_res_high                       1.7 
_refine_hist.d_res_low                        10 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.013 0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.036 0.040 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.046 0.050 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.010 0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.143 0.150 ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.167 0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.260 0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        2.1   3.0   ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  9INS 
_struct.title                     'MONOVALENT CATION BINDING IN CUBIC INSULIN CRYSTALS' 
_struct.pdbx_descriptor           INSULIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        9INS 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            HORMONE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 A11 GLY A 1  ? ILE A 10 ? GLY A 1  ILE A 10 1 ? 10 
HELX_P HELX_P2 A12 SER A 12 ? GLU A 17 ? SER A 12 GLU A 17 5 ? 6  
HELX_P HELX_P3 B11 SER B 9  ? GLY B 20 ? SER B 9  GLY B 20 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6  A CYS 11 1_555 ? ? ? ? ? ? ? 1.984 ? 
disulf2 disulf ? ? A CYS 7  SG ? ? ? 1_555 B CYS 7  SG ? ? A CYS 7  B CYS 7  1_555 ? ? ? ? ? ? ? 2.010 ? 
disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.051 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          9INS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    9INS 
_atom_sites.fract_transf_matrix[1][1]   0.012674 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012674 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012674 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 
;WATER 24 IS PROBABLY A PARTIALLY OCCUPIED SODIUM ION. ANOTHER SODIUM SITE WITH VERY LOW OCCUPANCY OVERLAPS THE MAJOR CONFORMATION OF HIS B10 (SEE REF 3).
;
2 'SEE REMARK 5.' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLY A 1 1  ? 13.749 47.133 32.172 1.00 29.44 ? 1  GLY A N   1 
ATOM   2   C CA  . GLY A 1 1  ? 13.950 46.145 31.092 1.00 27.61 ? 1  GLY A CA  1 
ATOM   3   C C   . GLY A 1 1  ? 15.306 45.457 31.262 1.00 38.42 ? 1  GLY A C   1 
ATOM   4   O O   . GLY A 1 1  ? 15.914 45.566 32.339 1.00 24.76 ? 1  GLY A O   1 
ATOM   5   N N   . ILE A 1 2  ? 15.821 44.792 30.234 1.00 25.40 ? 2  ILE A N   1 
ATOM   6   C CA  . ILE A 1 2  ? 17.092 44.090 30.368 1.00 22.63 ? 2  ILE A CA  1 
ATOM   7   C C   . ILE A 1 2  ? 18.287 44.950 30.698 1.00 17.77 ? 2  ILE A C   1 
ATOM   8   O O   . ILE A 1 2  ? 19.159 44.428 31.454 1.00 16.88 ? 2  ILE A O   1 
ATOM   9   C CB  . ILE A 1 2  ? 17.332 43.163 29.105 1.00 21.57 ? 2  ILE A CB  1 
ATOM   10  C CG1 . ILE A 1 2  ? 18.352 42.098 29.531 1.00 17.73 ? 2  ILE A CG1 1 
ATOM   11  C CG2 . ILE A 1 2  ? 17.630 44.018 27.856 1.00 21.71 ? 2  ILE A CG2 1 
ATOM   12  C CD1 . ILE A 1 2  ? 18.669 41.039 28.447 1.00 26.80 ? 2  ILE A CD1 1 
ATOM   13  N N   . VAL A 1 3  ? 18.431 46.163 30.180 1.00 18.98 ? 3  VAL A N   1 
ATOM   14  C CA  . VAL A 1 3  ? 19.622 46.984 30.495 1.00 20.46 ? 3  VAL A CA  1 
ATOM   15  C C   . VAL A 1 3  ? 19.776 47.295 32.002 1.00 18.64 ? 3  VAL A C   1 
ATOM   16  O O   . VAL A 1 3  ? 20.857 47.216 32.612 1.00 23.25 ? 3  VAL A O   1 
ATOM   17  C CB  . VAL A 1 3  ? 19.598 48.234 29.602 1.00 24.83 ? 3  VAL A CB  1 
ATOM   18  C CG1 . VAL A 1 3  ? 20.735 49.179 29.945 1.00 25.87 ? 3  VAL A CG1 1 
ATOM   19  C CG2 . VAL A 1 3  ? 19.741 47.857 28.134 1.00 19.66 ? 3  VAL A CG2 1 
ATOM   20  N N   . GLU A 1 4  ? 18.637 47.686 32.591 1.00 24.91 ? 4  GLU A N   1 
ATOM   21  C CA  . GLU A 1 4  ? 18.519 48.062 34.005 1.00 32.67 ? 4  GLU A CA  1 
ATOM   22  C C   . GLU A 1 4  ? 18.841 46.878 34.907 1.00 24.34 ? 4  GLU A C   1 
ATOM   23  O O   . GLU A 1 4  ? 19.521 47.051 35.927 1.00 30.10 ? 4  GLU A O   1 
ATOM   24  C CB  . GLU A 1 4  ? 17.139 48.612 34.410 1.00 31.13 ? 4  GLU A CB  1 
ATOM   25  C CG  . GLU A 1 4  ? 16.610 49.795 33.590 1.00 56.80 ? 4  GLU A CG  1 
ATOM   26  C CD  . GLU A 1 4  ? 16.333 49.643 32.114 1.00 71.14 ? 4  GLU A CD  1 
ATOM   27  O OE1 . GLU A 1 4  ? 15.680 48.769 31.542 1.00 40.03 ? 4  GLU A OE1 1 
ATOM   28  O OE2 . GLU A 1 4  ? 16.863 50.563 31.424 1.00 79.25 ? 4  GLU A OE2 1 
ATOM   29  N N   . GLN A 1 5  ? 18.328 45.717 34.507 1.00 19.84 ? 5  GLN A N   1 
ATOM   30  C CA  . GLN A 1 5  ? 18.566 44.485 35.274 1.00 16.33 ? 5  GLN A CA  1 
ATOM   31  C C   . GLN A 1 5  ? 19.913 43.796 35.013 1.00 25.19 ? 5  GLN A C   1 
ATOM   32  O O   . GLN A 1 5  ? 20.387 43.106 35.962 1.00 19.34 ? 5  GLN A O   1 
ATOM   33  C CB  . GLN A 1 5  ? 17.440 43.446 35.064 1.00 25.22 ? 5  GLN A CB  1 
ATOM   34  C CG  . GLN A 1 5  ? 16.034 43.974 35.326 1.00 33.04 ? 5  GLN A CG  1 
ATOM   35  C CD  . GLN A 1 5  ? 15.898 44.642 36.687 1.00 51.89 ? 5  GLN A CD  1 
ATOM   36  O OE1 . GLN A 1 5  ? 16.534 44.256 37.681 1.00 32.48 ? 5  GLN A OE1 1 
ATOM   37  N NE2 . GLN A 1 5  ? 15.072 45.700 36.768 1.00 39.38 ? 5  GLN A NE2 1 
ATOM   38  N N   . CYS A 1 6  ? 20.510 43.939 33.830 1.00 19.79 ? 6  CYS A N   1 
ATOM   39  C CA  . CYS A 1 6  ? 21.763 43.212 33.547 1.00 11.41 ? 6  CYS A CA  1 
ATOM   40  C C   . CYS A 1 6  ? 22.966 44.054 33.241 1.00 15.05 ? 6  CYS A C   1 
ATOM   41  O O   . CYS A 1 6  ? 24.084 43.479 33.359 1.00 18.32 ? 6  CYS A O   1 
ATOM   42  C CB  . CYS A 1 6  ? 21.475 42.243 32.371 1.00 13.87 ? 6  CYS A CB  1 
ATOM   43  S SG  . CYS A 1 6  ? 20.548 40.757 32.950 1.00 16.55 ? 6  CYS A SG  1 
ATOM   44  N N   . CYS A 1 7  ? 22.710 45.285 32.911 1.00 10.92 ? 7  CYS A N   1 
ATOM   45  C CA  . CYS A 1 7  ? 23.854 46.177 32.576 1.00 16.52 ? 7  CYS A CA  1 
ATOM   46  C C   . CYS A 1 7  ? 24.131 47.098 33.755 1.00 19.01 ? 7  CYS A C   1 
ATOM   47  O O   . CYS A 1 7  ? 25.231 47.087 34.344 1.00 16.64 ? 7  CYS A O   1 
ATOM   48  C CB  . CYS A 1 7  ? 23.496 46.902 31.272 1.00 15.72 ? 7  CYS A CB  1 
ATOM   49  S SG  . CYS A 1 7  ? 24.688 48.248 30.927 1.00 22.23 ? 7  CYS A SG  1 
ATOM   50  N N   . THR A 1 8  ? 23.076 47.827 34.106 1.00 20.59 ? 8  THR A N   1 
ATOM   51  C CA  . THR A 1 8  ? 23.120 48.784 35.236 1.00 19.70 ? 8  THR A CA  1 
ATOM   52  C C   . THR A 1 8  ? 23.241 48.071 36.573 1.00 25.99 ? 8  THR A C   1 
ATOM   53  O O   . THR A 1 8  ? 23.883 48.631 37.509 1.00 30.27 ? 8  THR A O   1 
ATOM   54  C CB  . THR A 1 8  ? 21.849 49.709 35.071 1.00 19.42 ? 8  THR A CB  1 
ATOM   55  O OG1 . THR A 1 8  ? 22.255 50.574 33.959 1.00 36.66 ? 8  THR A OG1 1 
ATOM   56  C CG2 . THR A 1 8  ? 21.412 50.458 36.307 1.00 53.40 ? 8  THR A CG2 1 
ATOM   57  N N   . SER A 1 9  ? 22.674 46.879 36.671 1.00 21.11 ? 9  SER A N   1 
ATOM   58  C CA  . SER A 1 9  ? 22.821 46.098 37.943 1.00 18.40 ? 9  SER A CA  1 
ATOM   59  C C   . SER A 1 9  ? 23.305 44.717 37.502 1.00 25.44 ? 9  SER A C   1 
ATOM   60  O O   . SER A 1 9  ? 23.415 44.476 36.282 1.00 16.52 ? 9  SER A O   1 
ATOM   61  C CB  . SER A 1 9  ? 21.618 46.215 38.833 1.00 26.27 ? 9  SER A CB  1 
ATOM   62  O OG  . SER A 1 9  ? 20.528 45.576 38.240 1.00 37.14 ? 9  SER A OG  1 
ATOM   63  N N   . ILE A 1 10 ? 23.633 43.844 38.440 1.00 16.29 ? 10 ILE A N   1 
ATOM   64  C CA  . ILE A 1 10 ? 24.160 42.547 38.067 1.00 18.18 ? 10 ILE A CA  1 
ATOM   65  C C   . ILE A 1 10 ? 23.114 41.602 37.510 1.00 13.63 ? 10 ILE A C   1 
ATOM   66  O O   . ILE A 1 10 ? 22.036 41.453 38.094 1.00 21.22 ? 10 ILE A O   1 
ATOM   67  C CB  . ILE A 1 10 ? 24.881 41.943 39.309 1.00 19.66 ? 10 ILE A CB  1 
ATOM   68  C CG1 . ILE A 1 10 ? 26.018 42.931 39.721 1.00 19.98 ? 10 ILE A CG1 1 
ATOM   69  C CG2 . ILE A 1 10 ? 25.421 40.498 39.122 1.00 13.27 ? 10 ILE A CG2 1 
ATOM   70  C CD1 . ILE A 1 10 ? 26.772 42.406 40.988 1.00 27.36 ? 10 ILE A CD1 1 
ATOM   71  N N   . CYS A 1 11 ? 23.470 41.015 36.368 1.00 14.78 ? 11 CYS A N   1 
ATOM   72  C CA  . CYS A 1 11 ? 22.544 40.072 35.721 1.00 14.03 ? 11 CYS A CA  1 
ATOM   73  C C   . CYS A 1 11 ? 22.430 38.748 36.507 1.00 17.58 ? 11 CYS A C   1 
ATOM   74  O O   . CYS A 1 11 ? 23.109 38.397 37.488 1.00 16.01 ? 11 CYS A O   1 
ATOM   75  C CB  . CYS A 1 11 ? 23.148 39.875 34.314 1.00 16.63 ? 11 CYS A CB  1 
ATOM   76  S SG  . CYS A 1 11 ? 21.939 39.346 33.043 1.00 17.77 ? 11 CYS A SG  1 
ATOM   77  N N   . SER A 1 12 ? 21.530 37.912 36.031 1.00 17.47 ? 12 SER A N   1 
ATOM   78  C CA  . SER A 1 12 ? 21.294 36.557 36.615 1.00 14.37 ? 12 SER A CA  1 
ATOM   79  C C   . SER A 1 12 ? 20.796 35.646 35.494 1.00 20.55 ? 12 SER A C   1 
ATOM   80  O O   . SER A 1 12 ? 20.196 36.158 34.521 1.00 13.95 ? 12 SER A O   1 
ATOM   81  C CB  . SER A 1 12 ? 20.312 36.694 37.775 1.00 12.26 ? 12 SER A CB  1 
ATOM   82  O OG  . SER A 1 12 ? 18.960 36.788 37.295 1.00 17.98 ? 12 SER A OG  1 
ATOM   83  N N   . LEU A 1 13 ? 20.945 34.336 35.604 1.00 12.55 ? 13 LEU A N   1 
ATOM   84  C CA  . LEU A 1 13 ? 20.464 33.388 34.583 1.00 9.36  ? 13 LEU A CA  1 
ATOM   85  C C   . LEU A 1 13 ? 18.960 33.442 34.461 1.00 13.26 ? 13 LEU A C   1 
ATOM   86  O O   . LEU A 1 13 ? 18.359 33.404 33.369 1.00 14.23 ? 13 LEU A O   1 
ATOM   87  C CB  . LEU A 1 13 ? 21.017 31.981 34.858 1.00 8.43  ? 13 LEU A CB  1 
ATOM   88  C CG  . LEU A 1 13 ? 20.592 30.926 33.860 1.00 11.62 ? 13 LEU A CG  1 
ATOM   89  C CD1 . LEU A 1 13 ? 21.204 31.343 32.512 1.00 12.27 ? 13 LEU A CD1 1 
ATOM   90  C CD2 . LEU A 1 13 ? 21.070 29.539 34.239 1.00 10.55 ? 13 LEU A CD2 1 
ATOM   91  N N   . TYR A 1 14 ? 18.303 33.598 35.624 1.00 15.74 ? 14 TYR A N   1 
ATOM   92  C CA  . TYR A 1 14 ? 16.840 33.687 35.708 1.00 24.55 ? 14 TYR A CA  1 
ATOM   93  C C   . TYR A 1 14 ? 16.353 34.808 34.807 1.00 18.12 ? 14 TYR A C   1 
ATOM   94  O O   . TYR A 1 14 ? 15.430 34.659 33.979 1.00 20.98 ? 14 TYR A O   1 
ATOM   95  C CB  A TYR A 1 14 ? 16.476 33.812 37.212 0.50 22.22 ? 14 TYR A CB  1 
ATOM   96  C CB  B TYR A 1 14 ? 16.502 33.908 37.229 0.50 19.09 ? 14 TYR A CB  1 
ATOM   97  C CG  A TYR A 1 14 ? 14.984 33.642 37.390 0.50 19.75 ? 14 TYR A CG  1 
ATOM   98  C CG  B TYR A 1 14 ? 15.058 34.376 37.251 0.50 20.43 ? 14 TYR A CG  1 
ATOM   99  C CD1 A TYR A 1 14 ? 14.363 32.605 38.093 0.50 22.83 ? 14 TYR A CD1 1 
ATOM   100 C CD1 B TYR A 1 14 ? 14.003 33.586 37.708 0.50 25.20 ? 14 TYR A CD1 1 
ATOM   101 C CD2 A TYR A 1 14 ? 14.185 34.625 36.790 0.50 11.18 ? 14 TYR A CD2 1 
ATOM   102 C CD2 B TYR A 1 14 ? 14.777 35.643 36.734 0.50 20.13 ? 14 TYR A CD2 1 
ATOM   103 C CE1 A TYR A 1 14 ? 12.974 32.564 38.172 0.50 23.60 ? 14 TYR A CE1 1 
ATOM   104 C CE1 B TYR A 1 14 ? 12.697 34.060 37.674 0.50 23.84 ? 14 TYR A CE1 1 
ATOM   105 C CE2 A TYR A 1 14 ? 12.803 34.582 36.841 0.50 24.91 ? 14 TYR A CE2 1 
ATOM   106 C CE2 B TYR A 1 14 ? 13.469 36.122 36.678 0.50 26.66 ? 14 TYR A CE2 1 
ATOM   107 C CZ  A TYR A 1 14 ? 12.200 33.548 37.554 0.50 34.99 ? 14 TYR A CZ  1 
ATOM   108 C CZ  B TYR A 1 14 ? 12.434 35.325 37.143 0.50 27.31 ? 14 TYR A CZ  1 
ATOM   109 O OH  A TYR A 1 14 ? 10.828 33.573 37.590 0.50 38.30 ? 14 TYR A OH  1 
ATOM   110 O OH  B TYR A 1 14 ? 11.168 35.839 37.082 0.50 31.40 ? 14 TYR A OH  1 
ATOM   111 N N   . GLN A 1 15 ? 16.993 35.977 34.886 1.00 15.44 ? 15 GLN A N   1 
ATOM   112 C CA  . GLN A 1 15 ? 16.599 37.131 34.066 1.00 16.53 ? 15 GLN A CA  1 
ATOM   113 C C   . GLN A 1 15 ? 16.921 36.965 32.590 1.00 15.05 ? 15 GLN A C   1 
ATOM   114 O O   . GLN A 1 15 ? 16.027 37.283 31.773 1.00 18.65 ? 15 GLN A O   1 
ATOM   115 C CB  A GLN A 1 15 ? 17.295 38.413 34.529 0.50 22.40 ? 15 GLN A CB  1 
ATOM   116 C CB  B GLN A 1 15 ? 17.314 38.327 34.706 0.50 12.79 ? 15 GLN A CB  1 
ATOM   117 C CG  A GLN A 1 15 ? 16.373 39.581 34.843 0.50 38.55 ? 15 GLN A CG  1 
ATOM   118 C CG  B GLN A 1 15 ? 16.678 38.680 36.048 0.50 10.60 ? 15 GLN A CG  1 
ATOM   119 C CD  A GLN A 1 15 ? 16.324 39.864 36.329 0.50 41.49 ? 15 GLN A CD  1 
ATOM   120 C CD  B GLN A 1 15 ? 15.275 39.228 35.898 0.50 28.73 ? 15 GLN A CD  1 
ATOM   121 O OE1 A GLN A 1 15 ? 15.296 39.660 36.973 0.50 54.99 ? 15 GLN A OE1 1 
ATOM   122 O OE1 B GLN A 1 15 ? 14.902 39.873 34.911 0.50 33.75 ? 15 GLN A OE1 1 
ATOM   123 N NE2 A GLN A 1 15 ? 17.465 40.313 36.856 0.50 31.33 ? 15 GLN A NE2 1 
ATOM   124 N NE2 B GLN A 1 15 ? 14.486 38.945 36.944 0.50 29.50 ? 15 GLN A NE2 1 
ATOM   125 N N   . LEU A 1 16 ? 18.114 36.498 32.249 1.00 10.85 ? 16 LEU A N   1 
ATOM   126 C CA  . LEU A 1 16 ? 18.450 36.296 30.839 1.00 11.66 ? 16 LEU A CA  1 
ATOM   127 C C   . LEU A 1 16 ? 17.443 35.365 30.169 1.00 14.50 ? 16 LEU A C   1 
ATOM   128 O O   . LEU A 1 16 ? 16.945 35.637 29.057 1.00 14.66 ? 16 LEU A O   1 
ATOM   129 C CB  . LEU A 1 16 ? 19.872 35.728 30.653 1.00 12.95 ? 16 LEU A CB  1 
ATOM   130 C CG  . LEU A 1 16 ? 21.037 36.682 30.851 1.00 17.56 ? 16 LEU A CG  1 
ATOM   131 C CD1 . LEU A 1 16 ? 22.294 35.819 30.782 1.00 20.27 ? 16 LEU A CD1 1 
ATOM   132 C CD2 . LEU A 1 16 ? 20.995 37.789 29.799 1.00 16.61 ? 16 LEU A CD2 1 
ATOM   133 N N   . GLU A 1 17 ? 17.125 34.245 30.847 1.00 10.94 ? 17 GLU A N   1 
ATOM   134 C CA  . GLU A 1 17 ? 16.205 33.262 30.266 1.00 11.66 ? 17 GLU A CA  1 
ATOM   135 C C   . GLU A 1 17 ? 14.820 33.825 29.986 1.00 16.20 ? 17 GLU A C   1 
ATOM   136 O O   . GLU A 1 17 ? 14.144 33.248 29.101 1.00 21.03 ? 17 GLU A O   1 
ATOM   137 C CB  . GLU A 1 17 ? 16.140 31.954 31.042 1.00 10.65 ? 17 GLU A CB  1 
ATOM   138 C CG  . GLU A 1 17 ? 17.340 31.036 30.714 1.00 16.40 ? 17 GLU A CG  1 
ATOM   139 C CD  . GLU A 1 17 ? 17.054 29.655 31.256 1.00 26.78 ? 17 GLU A CD  1 
ATOM   140 O OE1 . GLU A 1 17 ? 16.284 29.456 32.182 1.00 22.22 ? 17 GLU A OE1 1 
ATOM   141 O OE2 . GLU A 1 17 ? 17.683 28.776 30.651 1.00 18.33 ? 17 GLU A OE2 1 
ATOM   142 N N   . ASN A 1 18 ? 14.450 34.930 30.661 1.00 16.77 ? 18 ASN A N   1 
ATOM   143 C CA  . ASN A 1 18 ? 13.160 35.559 30.370 1.00 17.10 ? 18 ASN A CA  1 
ATOM   144 C C   . ASN A 1 18 ? 13.222 36.184 28.961 1.00 25.72 ? 18 ASN A C   1 
ATOM   145 O O   . ASN A 1 18 ? 12.109 36.492 28.500 1.00 23.66 ? 18 ASN A O   1 
ATOM   146 C CB  . ASN A 1 18 ? 12.803 36.650 31.368 1.00 19.81 ? 18 ASN A CB  1 
ATOM   147 C CG  . ASN A 1 18 ? 12.480 36.126 32.767 1.00 41.28 ? 18 ASN A CG  1 
ATOM   148 O OD1 . ASN A 1 18 ? 11.904 35.029 32.914 1.00 32.14 ? 18 ASN A OD1 1 
ATOM   149 N ND2 . ASN A 1 18 ? 12.861 36.859 33.801 1.00 34.57 ? 18 ASN A ND2 1 
ATOM   150 N N   . TYR A 1 19 ? 14.388 36.369 28.384 1.00 14.32 ? 19 TYR A N   1 
ATOM   151 C CA  . TYR A 1 19 ? 14.425 36.988 27.048 1.00 14.51 ? 19 TYR A CA  1 
ATOM   152 C C   . TYR A 1 19 ? 14.624 35.941 25.961 1.00 20.96 ? 19 TYR A C   1 
ATOM   153 O O   . TYR A 1 19 ? 14.663 36.331 24.766 1.00 24.78 ? 19 TYR A O   1 
ATOM   154 C CB  . TYR A 1 19 ? 15.398 38.169 26.982 1.00 11.92 ? 19 TYR A CB  1 
ATOM   155 C CG  . TYR A 1 19 ? 14.988 39.199 28.014 1.00 19.31 ? 19 TYR A CG  1 
ATOM   156 C CD1 . TYR A 1 19 ? 15.493 39.176 29.318 1.00 19.03 ? 19 TYR A CD1 1 
ATOM   157 C CD2 . TYR A 1 19 ? 14.090 40.206 27.652 1.00 22.00 ? 19 TYR A CD2 1 
ATOM   158 C CE1 . TYR A 1 19 ? 15.079 40.162 30.207 1.00 24.84 ? 19 TYR A CE1 1 
ATOM   159 C CE2 . TYR A 1 19 ? 13.664 41.174 28.545 1.00 29.60 ? 19 TYR A CE2 1 
ATOM   160 C CZ  . TYR A 1 19 ? 14.176 41.154 29.829 1.00 27.84 ? 19 TYR A CZ  1 
ATOM   161 O OH  . TYR A 1 19 ? 13.767 42.133 30.712 1.00 45.76 ? 19 TYR A OH  1 
ATOM   162 N N   . CYS A 1 20 ? 14.721 34.674 26.332 1.00 17.28 ? 20 CYS A N   1 
ATOM   163 C CA  . CYS A 1 20 ? 14.847 33.642 25.250 1.00 10.48 ? 20 CYS A CA  1 
ATOM   164 C C   . CYS A 1 20 ? 13.458 33.485 24.655 1.00 25.18 ? 20 CYS A C   1 
ATOM   165 O O   . CYS A 1 20 ? 12.476 33.704 25.387 1.00 25.34 ? 20 CYS A O   1 
ATOM   166 C CB  . CYS A 1 20 ? 15.293 32.294 25.767 1.00 12.75 ? 20 CYS A CB  1 
ATOM   167 S SG  . CYS A 1 20 ? 16.861 32.284 26.609 1.00 15.38 ? 20 CYS A SG  1 
ATOM   168 N N   . ASN A 1 21 ? 13.422 33.146 23.383 1.00 23.07 ? 21 ASN A N   1 
ATOM   169 C CA  . ASN A 1 21 ? 12.125 32.938 22.690 1.00 43.94 ? 21 ASN A CA  1 
ATOM   170 C C   . ASN A 1 21 ? 11.524 31.575 23.112 1.00 43.87 ? 21 ASN A C   1 
ATOM   171 O O   . ASN A 1 21 ? 12.220 30.761 23.765 1.00 36.86 ? 21 ASN A O   1 
ATOM   172 C CB  . ASN A 1 21 ? 12.142 33.051 21.164 1.00 37.10 ? 21 ASN A CB  1 
ATOM   173 C CG  . ASN A 1 21 ? 12.512 34.441 20.685 1.00 44.52 ? 21 ASN A CG  1 
ATOM   174 O OD1 . ASN A 1 21 ? 13.450 34.598 19.871 1.00 52.24 ? 21 ASN A OD1 1 
ATOM   175 N ND2 . ASN A 1 21 ? 11.786 35.424 21.223 1.00 53.09 ? 21 ASN A ND2 1 
ATOM   176 O OXT . ASN A 1 21 ? 10.341 31.413 22.759 1.00 65.26 ? 21 ASN A OXT 1 
ATOM   177 N N   . PHE B 2 1  ? 29.083 32.811 34.185 1.00 38.05 ? 1  PHE B N   1 
ATOM   178 C CA  . PHE B 2 1  ? 29.567 33.905 33.300 1.00 38.03 ? 1  PHE B CA  1 
ATOM   179 C C   . PHE B 2 1  ? 28.492 34.992 33.189 1.00 27.52 ? 1  PHE B C   1 
ATOM   180 O O   . PHE B 2 1  ? 28.774 36.128 32.767 1.00 43.73 ? 1  PHE B O   1 
ATOM   181 C CB  . PHE B 2 1  ? 30.051 33.360 31.954 1.00 40.26 ? 1  PHE B CB  1 
ATOM   182 C CG  . PHE B 2 1  ? 29.034 32.820 30.985 1.00 21.59 ? 1  PHE B CG  1 
ATOM   183 C CD1 . PHE B 2 1  ? 28.483 33.700 30.039 1.00 28.25 ? 1  PHE B CD1 1 
ATOM   184 C CD2 . PHE B 2 1  ? 28.610 31.512 30.999 1.00 23.81 ? 1  PHE B CD2 1 
ATOM   185 C CE1 . PHE B 2 1  ? 27.530 33.242 29.149 1.00 29.72 ? 1  PHE B CE1 1 
ATOM   186 C CE2 . PHE B 2 1  ? 27.660 31.007 30.108 1.00 26.28 ? 1  PHE B CE2 1 
ATOM   187 C CZ  . PHE B 2 1  ? 27.110 31.910 29.192 1.00 28.89 ? 1  PHE B CZ  1 
ATOM   188 N N   . VAL B 2 2  ? 27.264 34.635 33.576 1.00 23.34 ? 2  VAL B N   1 
ATOM   189 C CA  . VAL B 2 2  ? 26.138 35.577 33.509 1.00 22.14 ? 2  VAL B CA  1 
ATOM   190 C C   . VAL B 2 2  ? 25.952 36.409 34.761 1.00 19.79 ? 2  VAL B C   1 
ATOM   191 O O   . VAL B 2 2  ? 25.181 37.373 34.670 1.00 18.96 ? 2  VAL B O   1 
ATOM   192 C CB  . VAL B 2 2  ? 24.839 34.834 33.123 1.00 29.05 ? 2  VAL B CB  1 
ATOM   193 C CG1 . VAL B 2 2  ? 25.042 34.017 31.854 1.00 28.97 ? 2  VAL B CG1 1 
ATOM   194 C CG2 . VAL B 2 2  ? 24.323 33.944 34.222 1.00 24.99 ? 2  VAL B CG2 1 
ATOM   195 N N   . ASN B 2 3  ? 26.597 36.101 35.874 1.00 23.20 ? 3  ASN B N   1 
ATOM   196 C CA  . ASN B 2 3  ? 26.333 36.942 37.085 1.00 18.10 ? 3  ASN B CA  1 
ATOM   197 C C   . ASN B 2 3  ? 27.307 38.107 37.160 1.00 17.10 ? 3  ASN B C   1 
ATOM   198 O O   . ASN B 2 3  ? 28.221 38.148 38.017 1.00 22.88 ? 3  ASN B O   1 
ATOM   199 C CB  . ASN B 2 3  ? 26.330 36.064 38.317 1.00 22.60 ? 3  ASN B CB  1 
ATOM   200 C CG  . ASN B 2 3  ? 25.390 34.884 38.252 1.00 17.56 ? 3  ASN B CG  1 
ATOM   201 O OD1 . ASN B 2 3  ? 25.879 33.732 38.049 1.00 35.67 ? 3  ASN B OD1 1 
ATOM   202 N ND2 . ASN B 2 3  ? 24.114 35.151 38.441 1.00 18.44 ? 3  ASN B ND2 1 
ATOM   203 N N   . GLN B 2 4  ? 27.094 39.065 36.270 1.00 20.12 ? 4  GLN B N   1 
ATOM   204 C CA  . GLN B 2 4  ? 27.951 40.287 36.205 1.00 20.18 ? 4  GLN B CA  1 
ATOM   205 C C   . GLN B 2 4  ? 27.170 41.341 35.457 1.00 14.82 ? 4  GLN B C   1 
ATOM   206 O O   . GLN B 2 4  ? 26.025 41.099 34.982 1.00 19.45 ? 4  GLN B O   1 
ATOM   207 C CB  A GLN B 2 4  ? 29.333 40.003 35.609 0.50 22.61 ? 4  GLN B CB  1 
ATOM   208 C CB  B GLN B 2 4  ? 29.379 39.926 35.725 0.50 16.27 ? 4  GLN B CB  1 
ATOM   209 C CG  A GLN B 2 4  ? 29.319 39.328 34.264 0.50 28.56 ? 4  GLN B CG  1 
ATOM   210 C CG  B GLN B 2 4  ? 29.386 39.227 34.377 0.50 26.99 ? 4  GLN B CG  1 
ATOM   211 C CD  A GLN B 2 4  ? 30.654 39.081 33.613 0.50 39.48 ? 4  GLN B CD  1 
ATOM   212 C CD  B GLN B 2 4  ? 30.772 38.661 34.111 0.50 45.38 ? 4  GLN B CD  1 
ATOM   213 O OE1 A GLN B 2 4  ? 31.527 39.928 33.429 0.50 26.93 ? 4  GLN B OE1 1 
ATOM   214 O OE1 B GLN B 2 4  ? 31.604 38.600 35.022 0.50 41.00 ? 4  GLN B OE1 1 
ATOM   215 N NE2 A GLN B 2 4  ? 30.846 37.820 33.200 0.50 44.00 ? 4  GLN B NE2 1 
ATOM   216 N NE2 B GLN B 2 4  ? 30.985 38.266 32.855 0.50 40.95 ? 4  GLN B NE2 1 
ATOM   217 N N   . HIS B 2 5  ? 27.806 42.514 35.368 1.00 16.78 ? 5  HIS B N   1 
ATOM   218 C CA  . HIS B 2 5  ? 27.199 43.633 34.613 1.00 17.54 ? 5  HIS B CA  1 
ATOM   219 C C   . HIS B 2 5  ? 27.501 43.219 33.143 1.00 23.58 ? 5  HIS B C   1 
ATOM   220 O O   . HIS B 2 5  ? 28.693 43.011 32.863 1.00 23.84 ? 5  HIS B O   1 
ATOM   221 C CB  . HIS B 2 5  ? 27.789 45.021 34.863 1.00 16.44 ? 5  HIS B CB  1 
ATOM   222 C CG  . HIS B 2 5  ? 27.596 45.478 36.286 1.00 14.96 ? 5  HIS B CG  1 
ATOM   223 N ND1 . HIS B 2 5  ? 26.451 46.108 36.723 1.00 30.81 ? 5  HIS B ND1 1 
ATOM   224 C CD2 . HIS B 2 5  ? 28.421 45.360 37.343 1.00 22.55 ? 5  HIS B CD2 1 
ATOM   225 C CE1 . HIS B 2 5  ? 26.559 46.370 38.011 1.00 26.41 ? 5  HIS B CE1 1 
ATOM   226 N NE2 . HIS B 2 5  ? 27.728 45.928 38.404 1.00 26.57 ? 5  HIS B NE2 1 
ATOM   227 N N   . LEU B 2 6  ? 26.479 43.061 32.344 1.00 16.64 ? 6  LEU B N   1 
ATOM   228 C CA  . LEU B 2 6  ? 26.588 42.659 30.920 1.00 18.11 ? 6  LEU B CA  1 
ATOM   229 C C   . LEU B 2 6  ? 25.967 43.828 30.166 1.00 15.27 ? 6  LEU B C   1 
ATOM   230 O O   . LEU B 2 6  ? 24.756 44.086 30.289 1.00 18.92 ? 6  LEU B O   1 
ATOM   231 C CB  . LEU B 2 6  ? 25.904 41.317 30.679 1.00 13.87 ? 6  LEU B CB  1 
ATOM   232 C CG  . LEU B 2 6  ? 26.479 40.136 31.459 1.00 15.05 ? 6  LEU B CG  1 
ATOM   233 C CD1 . LEU B 2 6  ? 25.622 38.930 31.169 1.00 21.55 ? 6  LEU B CD1 1 
ATOM   234 C CD2 . LEU B 2 6  ? 27.882 39.865 30.941 1.00 20.18 ? 6  LEU B CD2 1 
ATOM   235 N N   . CYS B 2 7  ? 26.821 44.564 29.409 1.00 17.40 ? 7  CYS B N   1 
ATOM   236 C CA  . CYS B 2 7  ? 26.299 45.710 28.680 1.00 11.65 ? 7  CYS B CA  1 
ATOM   237 C C   . CYS B 2 7  ? 26.715 45.632 27.192 1.00 18.39 ? 7  CYS B C   1 
ATOM   238 O O   . CYS B 2 7  ? 27.788 45.081 26.881 1.00 20.52 ? 7  CYS B O   1 
ATOM   239 C CB  . CYS B 2 7  ? 26.887 47.024 29.243 1.00 18.11 ? 7  CYS B CB  1 
ATOM   240 S SG  . CYS B 2 7  ? 26.521 47.425 30.972 1.00 18.58 ? 7  CYS B SG  1 
ATOM   241 N N   . GLY B 2 8  ? 25.858 46.186 26.377 1.00 16.76 ? 8  GLY B N   1 
ATOM   242 C CA  . GLY B 2 8  ? 26.103 46.302 24.941 1.00 18.50 ? 8  GLY B CA  1 
ATOM   243 C C   . GLY B 2 8  ? 26.285 44.972 24.262 1.00 16.49 ? 8  GLY B C   1 
ATOM   244 O O   . GLY B 2 8  ? 25.451 44.063 24.442 1.00 14.13 ? 8  GLY B O   1 
ATOM   245 N N   . SER B 2 9  ? 27.339 44.853 23.457 1.00 12.32 ? 9  SER B N   1 
ATOM   246 C CA  . SER B 2 9  ? 27.600 43.614 22.697 1.00 15.10 ? 9  SER B CA  1 
ATOM   247 C C   . SER B 2 9  ? 27.822 42.487 23.699 1.00 17.23 ? 9  SER B C   1 
ATOM   248 O O   . SER B 2 9  ? 27.523 41.317 23.383 1.00 16.15 ? 9  SER B O   1 
ATOM   249 C CB  . SER B 2 9  ? 28.773 43.803 21.724 1.00 10.18 ? 9  SER B CB  1 
ATOM   250 O OG  . SER B 2 9  ? 29.964 43.937 22.521 1.00 16.49 ? 9  SER B OG  1 
ATOM   251 N N   . HIS B 2 10 ? 28.337 42.786 24.869 1.00 14.07 ? 10 HIS B N   1 
ATOM   252 C CA  . HIS B 2 10 ? 28.568 41.782 25.940 1.00 13.96 ? 10 HIS B CA  1 
ATOM   253 C C   . HIS B 2 10 ? 27.246 41.118 26.353 1.00 15.18 ? 10 HIS B C   1 
ATOM   254 O O   . HIS B 2 10 ? 27.168 39.887 26.625 1.00 15.27 ? 10 HIS B O   1 
ATOM   255 C CB  A HIS B 2 10 ? 29.246 42.534 27.123 0.60 18.93 ? 10 HIS B CB  1 
ATOM   256 C CB  B HIS B 2 10 ? 29.296 42.183 27.227 0.40 11.36 ? 10 HIS B CB  1 
ATOM   257 C CG  A HIS B 2 10 ? 30.504 43.293 26.787 0.60 14.71 ? 10 HIS B CG  1 
ATOM   258 C CG  B HIS B 2 10 ? 30.014 41.168 28.055 0.40 10.59 ? 10 HIS B CG  1 
ATOM   259 N ND1 A HIS B 2 10 ? 31.430 43.661 27.726 0.60 14.48 ? 10 HIS B ND1 1 
ATOM   260 N ND1 B HIS B 2 10 ? 30.539 41.482 29.287 0.40 11.92 ? 10 HIS B ND1 1 
ATOM   261 C CD2 A HIS B 2 10 ? 30.982 43.757 25.604 0.60 10.94 ? 10 HIS B CD2 1 
ATOM   262 C CD2 B HIS B 2 10 ? 30.330 39.856 27.858 0.40 15.24 ? 10 HIS B CD2 1 
ATOM   263 C CE1 A HIS B 2 10 ? 32.436 44.312 27.142 0.60 13.18 ? 10 HIS B CE1 1 
ATOM   264 C CE1 B HIS B 2 10 ? 31.124 40.422 29.813 0.40 8.29  ? 10 HIS B CE1 1 
ATOM   265 N NE2 A HIS B 2 10 ? 32.187 44.377 25.852 0.60 14.21 ? 10 HIS B NE2 1 
ATOM   266 N NE2 B HIS B 2 10 ? 31.015 39.413 28.970 0.40 12.37 ? 10 HIS B NE2 1 
ATOM   267 N N   . LEU B 2 11 ? 26.155 41.854 26.471 1.00 12.98 ? 11 LEU B N   1 
ATOM   268 C CA  . LEU B 2 11 ? 24.827 41.345 26.849 1.00 9.40  ? 11 LEU B CA  1 
ATOM   269 C C   . LEU B 2 11 ? 24.220 40.502 25.752 1.00 13.89 ? 11 LEU B C   1 
ATOM   270 O O   . LEU B 2 11 ? 23.633 39.418 25.977 1.00 12.30 ? 11 LEU B O   1 
ATOM   271 C CB  . LEU B 2 11 ? 23.954 42.580 27.228 1.00 11.44 ? 11 LEU B CB  1 
ATOM   272 C CG  . LEU B 2 11 ? 22.515 42.246 27.635 1.00 14.97 ? 11 LEU B CG  1 
ATOM   273 C CD1 . LEU B 2 11 ? 22.577 41.243 28.780 1.00 14.41 ? 11 LEU B CD1 1 
ATOM   274 C CD2 . LEU B 2 11 ? 21.814 43.527 28.098 1.00 18.43 ? 11 LEU B CD2 1 
ATOM   275 N N   . VAL B 2 12 ? 24.349 40.964 24.492 1.00 12.29 ? 12 VAL B N   1 
ATOM   276 C CA  . VAL B 2 12 ? 23.834 40.279 23.299 1.00 11.11 ? 12 VAL B CA  1 
ATOM   277 C C   . VAL B 2 12 ? 24.502 38.922 23.197 1.00 13.58 ? 12 VAL B C   1 
ATOM   278 O O   . VAL B 2 12 ? 23.908 37.869 22.933 1.00 15.78 ? 12 VAL B O   1 
ATOM   279 C CB  . VAL B 2 12 ? 24.056 41.222 22.080 1.00 18.55 ? 12 VAL B CB  1 
ATOM   280 C CG1 . VAL B 2 12 ? 24.032 40.402 20.820 1.00 25.50 ? 12 VAL B CG1 1 
ATOM   281 C CG2 . VAL B 2 12 ? 23.024 42.339 22.140 1.00 23.72 ? 12 VAL B CG2 1 
ATOM   282 N N   . GLU B 2 13 ? 25.835 38.937 23.386 1.00 9.73  ? 13 GLU B N   1 
ATOM   283 C CA  . GLU B 2 13 ? 26.586 37.676 23.338 1.00 14.38 ? 13 GLU B CA  1 
ATOM   284 C C   . GLU B 2 13 ? 26.114 36.724 24.457 1.00 14.20 ? 13 GLU B C   1 
ATOM   285 O O   . GLU B 2 13 ? 26.019 35.505 24.142 1.00 14.39 ? 13 GLU B O   1 
ATOM   286 C CB  . GLU B 2 13 ? 28.063 37.979 23.459 1.00 17.78 ? 13 GLU B CB  1 
ATOM   287 C CG  . GLU B 2 13 ? 29.099 36.878 23.588 1.00 33.01 ? 13 GLU B CG  1 
ATOM   288 C CD  . GLU B 2 13 ? 30.496 37.515 23.523 1.00 41.75 ? 13 GLU B CD  1 
ATOM   289 O OE1 . GLU B 2 13 ? 30.804 38.103 22.482 1.00 26.11 ? 13 GLU B OE1 1 
ATOM   290 O OE2 . GLU B 2 13 ? 31.057 37.365 24.644 1.00 29.78 ? 13 GLU B OE2 1 
ATOM   291 N N   . ALA B 2 14 ? 25.846 37.189 25.655 1.00 14.81 ? 14 ALA B N   1 
ATOM   292 C CA  . ALA B 2 14 ? 25.351 36.315 26.757 1.00 10.70 ? 14 ALA B CA  1 
ATOM   293 C C   . ALA B 2 14 ? 24.003 35.760 26.356 1.00 15.91 ? 14 ALA B C   1 
ATOM   294 O O   . ALA B 2 14 ? 23.834 34.518 26.530 1.00 11.98 ? 14 ALA B O   1 
ATOM   295 C CB  . ALA B 2 14 ? 25.328 37.168 28.029 1.00 8.76  ? 14 ALA B CB  1 
ATOM   296 N N   . LEU B 2 15 ? 23.077 36.579 25.834 1.00 10.98 ? 15 LEU B N   1 
ATOM   297 C CA  . LEU B 2 15 ? 21.782 36.039 25.398 1.00 6.46  ? 15 LEU B CA  1 
ATOM   298 C C   . LEU B 2 15 ? 21.974 34.971 24.327 1.00 12.51 ? 15 LEU B C   1 
ATOM   299 O O   . LEU B 2 15 ? 21.329 33.891 24.295 1.00 13.62 ? 15 LEU B O   1 
ATOM   300 C CB  . LEU B 2 15 ? 20.954 37.210 24.893 1.00 9.24  ? 15 LEU B CB  1 
ATOM   301 C CG  . LEU B 2 15 ? 20.251 38.009 26.003 1.00 16.04 ? 15 LEU B CG  1 
ATOM   302 C CD1 . LEU B 2 15 ? 19.685 39.221 25.321 1.00 14.92 ? 15 LEU B CD1 1 
ATOM   303 C CD2 . LEU B 2 15 ? 19.085 37.239 26.610 1.00 13.74 ? 15 LEU B CD2 1 
ATOM   304 N N   . TYR B 2 16 ? 22.869 35.198 23.379 1.00 12.62 ? 16 TYR B N   1 
ATOM   305 C CA  . TYR B 2 16 ? 23.147 34.257 22.293 1.00 9.38  ? 16 TYR B CA  1 
ATOM   306 C C   . TYR B 2 16 ? 23.615 32.932 22.883 1.00 10.78 ? 16 TYR B C   1 
ATOM   307 O O   . TYR B 2 16 ? 23.111 31.849 22.440 1.00 16.71 ? 16 TYR B O   1 
ATOM   308 C CB  . TYR B 2 16 ? 24.232 34.888 21.410 1.00 7.73  ? 16 TYR B CB  1 
ATOM   309 C CG  . TYR B 2 16 ? 24.723 33.918 20.358 1.00 11.24 ? 16 TYR B CG  1 
ATOM   310 C CD1 . TYR B 2 16 ? 23.948 33.584 19.246 1.00 14.96 ? 16 TYR B CD1 1 
ATOM   311 C CD2 . TYR B 2 16 ? 25.971 33.326 20.518 1.00 10.03 ? 16 TYR B CD2 1 
ATOM   312 C CE1 . TYR B 2 16 ? 24.414 32.680 18.277 1.00 14.10 ? 16 TYR B CE1 1 
ATOM   313 C CE2 . TYR B 2 16 ? 26.505 32.450 19.571 1.00 12.25 ? 16 TYR B CE2 1 
ATOM   314 C CZ  . TYR B 2 16 ? 25.702 32.148 18.458 1.00 18.54 ? 16 TYR B CZ  1 
ATOM   315 O OH  . TYR B 2 16 ? 26.207 31.252 17.567 1.00 15.46 ? 16 TYR B OH  1 
ATOM   316 N N   . LEU B 2 17 ? 24.554 32.978 23.797 1.00 14.55 ? 17 LEU B N   1 
ATOM   317 C CA  . LEU B 2 17 ? 25.102 31.736 24.426 1.00 13.79 ? 17 LEU B CA  1 
ATOM   318 C C   . LEU B 2 17 ? 24.085 30.986 25.281 1.00 15.80 ? 17 LEU B C   1 
ATOM   319 O O   . LEU B 2 17 ? 23.922 29.738 25.228 1.00 17.98 ? 17 LEU B O   1 
ATOM   320 C CB  . LEU B 2 17 ? 26.385 32.127 25.197 1.00 13.33 ? 17 LEU B CB  1 
ATOM   321 C CG  . LEU B 2 17 ? 27.597 32.468 24.318 1.00 19.04 ? 17 LEU B CG  1 
ATOM   322 C CD1 . LEU B 2 17 ? 28.791 32.849 25.207 1.00 15.87 ? 17 LEU B CD1 1 
ATOM   323 C CD2 . LEU B 2 17 ? 27.965 31.265 23.443 1.00 20.09 ? 17 LEU B CD2 1 
ATOM   324 N N   . VAL B 2 18 ? 23.356 31.706 26.089 1.00 10.40 ? 18 VAL B N   1 
ATOM   325 C CA  . VAL B 2 18 ? 22.348 31.081 26.959 1.00 13.42 ? 18 VAL B CA  1 
ATOM   326 C C   . VAL B 2 18 ? 21.142 30.620 26.159 1.00 15.80 ? 18 VAL B C   1 
ATOM   327 O O   . VAL B 2 18 ? 20.762 29.470 26.444 1.00 15.86 ? 18 VAL B O   1 
ATOM   328 C CB  . VAL B 2 18 ? 22.002 32.068 28.092 1.00 11.59 ? 18 VAL B CB  1 
ATOM   329 C CG1 . VAL B 2 18 ? 20.766 31.663 28.888 1.00 21.84 ? 18 VAL B CG1 1 
ATOM   330 C CG2 . VAL B 2 18 ? 23.224 32.287 28.994 1.00 15.22 ? 18 VAL B CG2 1 
ATOM   331 N N   . CYS B 2 19 ? 20.514 31.391 25.297 1.00 15.16 ? 19 CYS B N   1 
ATOM   332 C CA  . CYS B 2 19 ? 19.298 30.980 24.596 1.00 16.87 ? 19 CYS B CA  1 
ATOM   333 C C   . CYS B 2 19 ? 19.538 29.916 23.542 1.00 21.35 ? 19 CYS B C   1 
ATOM   334 O O   . CYS B 2 19 ? 18.538 29.191 23.303 1.00 18.24 ? 19 CYS B O   1 
ATOM   335 C CB  . CYS B 2 19 ? 18.508 32.192 24.118 1.00 14.04 ? 19 CYS B CB  1 
ATOM   336 S SG  . CYS B 2 19 ? 18.132 33.372 25.422 1.00 15.26 ? 19 CYS B SG  1 
ATOM   337 N N   . GLY B 2 20 ? 20.717 29.783 22.977 1.00 20.73 ? 20 GLY B N   1 
ATOM   338 C CA  . GLY B 2 20 ? 20.905 28.690 21.968 1.00 33.13 ? 20 GLY B CA  1 
ATOM   339 C C   . GLY B 2 20 ? 19.961 28.774 20.788 1.00 30.18 ? 20 GLY B C   1 
ATOM   340 O O   . GLY B 2 20 ? 19.596 29.863 20.301 1.00 23.16 ? 20 GLY B O   1 
ATOM   341 N N   . GLU B 2 21 ? 19.454 27.626 20.331 1.00 32.11 ? 21 GLU B N   1 
ATOM   342 C CA  . GLU B 2 21 ? 18.533 27.530 19.195 1.00 18.60 ? 21 GLU B CA  1 
ATOM   343 C C   . GLU B 2 21 ? 17.143 28.115 19.381 1.00 30.33 ? 21 GLU B C   1 
ATOM   344 O O   . GLU B 2 21 ? 16.312 28.219 18.460 1.00 28.89 ? 21 GLU B O   1 
ATOM   345 C CB  A GLU B 2 21 ? 18.374 26.101 18.662 0.50 34.61 ? 21 GLU B CB  1 
ATOM   346 C CB  B GLU B 2 21 ? 18.627 26.149 18.487 0.50 22.21 ? 21 GLU B CB  1 
ATOM   347 C CG  A GLU B 2 21 ? 17.982 24.980 19.603 0.50 31.38 ? 21 GLU B CG  1 
ATOM   348 C CG  B GLU B 2 21 ? 20.058 25.789 18.143 0.50 25.53 ? 21 GLU B CG  1 
ATOM   349 C CD  A GLU B 2 21 ? 17.801 23.607 19.021 0.50 44.47 ? 21 GLU B CD  1 
ATOM   350 C CD  B GLU B 2 21 ? 20.359 24.451 17.534 0.50 35.66 ? 21 GLU B CD  1 
ATOM   351 O OE1 A GLU B 2 21 ? 17.648 22.603 19.704 0.50 54.04 ? 21 GLU B OE1 1 
ATOM   352 O OE1 B GLU B 2 21 ? 21.491 24.112 17.152 0.50 31.29 ? 21 GLU B OE1 1 
ATOM   353 O OE2 A GLU B 2 21 ? 17.807 23.583 17.767 0.50 39.59 ? 21 GLU B OE2 1 
ATOM   354 O OE2 B GLU B 2 21 ? 19.341 23.710 17.471 0.50 27.01 ? 21 GLU B OE2 1 
ATOM   355 N N   . ARG B 2 22 ? 16.828 28.529 20.594 1.00 23.20 ? 22 ARG B N   1 
ATOM   356 C CA  . ARG B 2 22 ? 15.556 29.150 20.929 1.00 15.74 ? 22 ARG B CA  1 
ATOM   357 C C   . ARG B 2 22 ? 15.547 30.591 20.415 1.00 26.28 ? 22 ARG B C   1 
ATOM   358 O O   . ARG B 2 22 ? 14.475 31.131 20.048 1.00 33.91 ? 22 ARG B O   1 
ATOM   359 C CB  A ARG B 2 22 ? 15.343 29.151 22.456 0.50 19.29 ? 22 ARG B CB  1 
ATOM   360 C CB  B ARG B 2 22 ? 15.250 29.491 22.405 0.50 12.64 ? 22 ARG B CB  1 
ATOM   361 C CG  A ARG B 2 22 ? 15.471 27.824 23.186 0.50 21.33 ? 22 ARG B CG  1 
ATOM   362 C CG  B ARG B 2 22 ? 14.462 28.356 23.052 0.50 19.42 ? 22 ARG B CG  1 
ATOM   363 C CD  A ARG B 2 22 ? 16.275 27.835 24.433 0.50 21.28 ? 22 ARG B CD  1 
ATOM   364 C CD  B ARG B 2 22 ? 14.821 28.191 24.491 0.50 19.45 ? 22 ARG B CD  1 
ATOM   365 N NE  A ARG B 2 22 ? 15.701 28.356 25.653 0.50 18.99 ? 22 ARG B NE  1 
ATOM   366 N NE  B ARG B 2 22 ? 13.947 28.983 25.326 0.50 18.02 ? 22 ARG B NE  1 
ATOM   367 C CZ  A ARG B 2 22 ? 16.277 28.393 26.865 0.50 20.18 ? 22 ARG B CZ  1 
ATOM   368 C CZ  B ARG B 2 22 ? 14.153 29.217 26.623 0.50 26.07 ? 22 ARG B CZ  1 
ATOM   369 N NH1 A ARG B 2 22 ? 15.605 28.841 27.928 0.50 37.66 ? 22 ARG B NH1 1 
ATOM   370 N NH1 B ARG B 2 22 ? 13.303 29.945 27.340 0.50 23.00 ? 22 ARG B NH1 1 
ATOM   371 N NH2 A ARG B 2 22 ? 17.539 28.042 27.104 0.50 19.10 ? 22 ARG B NH2 1 
ATOM   372 N NH2 B ARG B 2 22 ? 15.241 28.719 27.211 0.50 33.80 ? 22 ARG B NH2 1 
ATOM   373 N N   . GLY B 2 23 ? 16.730 31.197 20.400 1.00 19.06 ? 23 GLY B N   1 
ATOM   374 C CA  . GLY B 2 23 ? 16.833 32.626 19.963 1.00 19.19 ? 23 GLY B CA  1 
ATOM   375 C C   . GLY B 2 23 ? 16.382 33.479 21.144 1.00 15.66 ? 23 GLY B C   1 
ATOM   376 O O   . GLY B 2 23 ? 15.981 33.027 22.254 1.00 20.52 ? 23 GLY B O   1 
ATOM   377 N N   . PHE B 2 24 ? 16.356 34.793 20.928 1.00 12.93 ? 24 PHE B N   1 
ATOM   378 C CA  . PHE B 2 24 ? 15.964 35.715 22.009 1.00 12.43 ? 24 PHE B CA  1 
ATOM   379 C C   . PHE B 2 24 ? 15.480 37.023 21.423 1.00 13.91 ? 24 PHE B C   1 
ATOM   380 O O   . PHE B 2 24 ? 15.558 37.231 20.200 1.00 18.37 ? 24 PHE B O   1 
ATOM   381 C CB  . PHE B 2 24 ? 17.239 35.940 22.866 1.00 15.80 ? 24 PHE B CB  1 
ATOM   382 C CG  . PHE B 2 24 ? 18.431 36.518 22.114 1.00 21.91 ? 24 PHE B CG  1 
ATOM   383 C CD1 . PHE B 2 24 ? 19.387 35.690 21.520 1.00 18.28 ? 24 PHE B CD1 1 
ATOM   384 C CD2 . PHE B 2 24 ? 18.607 37.905 21.984 1.00 15.80 ? 24 PHE B CD2 1 
ATOM   385 C CE1 . PHE B 2 24 ? 20.469 36.182 20.796 1.00 17.12 ? 24 PHE B CE1 1 
ATOM   386 C CE2 . PHE B 2 24 ? 19.689 38.453 21.264 1.00 12.10 ? 24 PHE B CE2 1 
ATOM   387 C CZ  . PHE B 2 24 ? 20.637 37.569 20.657 1.00 11.86 ? 24 PHE B CZ  1 
ATOM   388 N N   . PHE B 2 25 ? 15.088 37.892 22.305 1.00 14.63 ? 25 PHE B N   1 
ATOM   389 C CA  . PHE B 2 25 ? 14.692 39.252 21.806 1.00 18.18 ? 25 PHE B CA  1 
ATOM   390 C C   . PHE B 2 25 ? 15.473 40.230 22.663 1.00 18.42 ? 25 PHE B C   1 
ATOM   391 O O   . PHE B 2 25 ? 15.631 40.012 23.889 1.00 20.78 ? 25 PHE B O   1 
ATOM   392 C CB  A PHE B 2 25 ? 13.188 39.381 21.700 0.50 23.69 ? 25 PHE B CB  1 
ATOM   393 C CB  B PHE B 2 25 ? 13.181 39.469 21.670 0.50 18.59 ? 25 PHE B CB  1 
ATOM   394 C CG  A PHE B 2 25 ? 12.475 38.901 22.923 0.50 39.44 ? 25 PHE B CG  1 
ATOM   395 C CG  B PHE B 2 25 ? 12.588 39.796 23.000 0.50 27.78 ? 25 PHE B CG  1 
ATOM   396 C CD1 A PHE B 2 25 ? 12.128 37.558 23.080 0.50 22.66 ? 25 PHE B CD1 1 
ATOM   397 C CD1 B PHE B 2 25 ? 12.083 38.758 23.797 0.50 46.20 ? 25 PHE B CD1 1 
ATOM   398 C CD2 A PHE B 2 25 ? 12.172 39.828 23.925 0.50 52.34 ? 25 PHE B CD2 1 
ATOM   399 C CD2 B PHE B 2 25 ? 12.526 41.104 23.455 0.50 27.91 ? 25 PHE B CD2 1 
ATOM   400 C CE1 A PHE B 2 25 ? 11.476 37.139 24.230 0.50 40.37 ? 25 PHE B CE1 1 
ATOM   401 C CE1 B PHE B 2 25 ? 11.507 39.029 25.038 0.50 44.33 ? 25 PHE B CE1 1 
ATOM   402 C CE2 A PHE B 2 25 ? 11.504 39.424 25.094 0.50 51.59 ? 25 PHE B CE2 1 
ATOM   403 C CE2 B PHE B 2 25 ? 11.943 41.396 24.705 0.50 32.72 ? 25 PHE B CE2 1 
ATOM   404 C CZ  A PHE B 2 25 ? 11.165 38.065 25.236 0.50 43.95 ? 25 PHE B CZ  1 
ATOM   405 C CZ  B PHE B 2 25 ? 11.426 40.352 25.490 0.50 23.01 ? 25 PHE B CZ  1 
ATOM   406 N N   . TYR B 2 26 ? 16.053 41.256 22.084 1.00 16.75 ? 26 TYR B N   1 
ATOM   407 C CA  . TYR B 2 26 ? 16.828 42.273 22.820 1.00 20.72 ? 26 TYR B CA  1 
ATOM   408 C C   . TYR B 2 26 ? 16.169 43.627 22.572 1.00 26.99 ? 26 TYR B C   1 
ATOM   409 O O   . TYR B 2 26 ? 16.139 44.197 21.446 1.00 21.12 ? 26 TYR B O   1 
ATOM   410 C CB  . TYR B 2 26 ? 18.241 42.269 22.241 1.00 15.78 ? 26 TYR B CB  1 
ATOM   411 C CG  . TYR B 2 26 ? 19.081 43.389 22.754 1.00 16.13 ? 26 TYR B CG  1 
ATOM   412 C CD1 . TYR B 2 26 ? 19.548 44.408 21.889 1.00 15.35 ? 26 TYR B CD1 1 
ATOM   413 C CD2 . TYR B 2 26 ? 19.462 43.440 24.085 1.00 21.17 ? 26 TYR B CD2 1 
ATOM   414 C CE1 . TYR B 2 26 ? 20.350 45.448 22.353 1.00 19.40 ? 26 TYR B CE1 1 
ATOM   415 C CE2 . TYR B 2 26 ? 20.277 44.461 24.551 1.00 22.10 ? 26 TYR B CE2 1 
ATOM   416 C CZ  . TYR B 2 26 ? 20.712 45.468 23.688 1.00 26.67 ? 26 TYR B CZ  1 
ATOM   417 O OH  . TYR B 2 26 ? 21.509 46.466 24.199 1.00 31.58 ? 26 TYR B OH  1 
ATOM   418 N N   . THR B 2 27 ? 15.646 44.145 23.674 1.00 22.59 ? 27 THR B N   1 
ATOM   419 C CA  . THR B 2 27 ? 14.919 45.457 23.643 1.00 27.14 ? 27 THR B CA  1 
ATOM   420 C C   . THR B 2 27 ? 15.501 46.349 24.715 1.00 27.20 ? 27 THR B C   1 
ATOM   421 O O   . THR B 2 27 ? 15.058 46.301 25.863 1.00 31.25 ? 27 THR B O   1 
ATOM   422 C CB  . THR B 2 27 ? 13.405 45.137 23.919 1.00 39.57 ? 27 THR B CB  1 
ATOM   423 O OG1 . THR B 2 27 ? 13.435 44.171 25.033 1.00 59.03 ? 27 THR B OG1 1 
ATOM   424 C CG2 . THR B 2 27 ? 12.696 44.449 22.769 1.00 28.81 ? 27 THR B CG2 1 
ATOM   425 N N   . PRO B 2 28 ? 16.507 47.092 24.300 1.00 27.80 ? 28 PRO B N   1 
ATOM   426 C CA  . PRO B 2 28 ? 17.236 47.970 25.189 1.00 28.62 ? 28 PRO B CA  1 
ATOM   427 C C   . PRO B 2 28 ? 16.432 49.114 25.785 1.00 50.41 ? 28 PRO B C   1 
ATOM   428 O O   . PRO B 2 28 ? 16.502 49.423 26.978 1.00 44.94 ? 28 PRO B O   1 
ATOM   429 C CB  . PRO B 2 28 ? 18.332 48.574 24.300 1.00 39.40 ? 28 PRO B CB  1 
ATOM   430 C CG  . PRO B 2 28 ? 17.910 48.351 22.865 1.00 24.83 ? 28 PRO B CG  1 
ATOM   431 C CD  . PRO B 2 28 ? 17.063 47.107 22.930 1.00 23.45 ? 28 PRO B CD  1 
ATOM   432 N N   . LYS B 2 29 ? 15.668 49.766 24.933 1.00 51.80 ? 29 LYS B N   1 
ATOM   433 C CA  . LYS B 2 29 ? 14.854 50.940 25.268 1.00 67.18 ? 29 LYS B CA  1 
ATOM   434 C C   . LYS B 2 29 ? 13.545 50.606 25.960 1.00 78.07 ? 29 LYS B C   1 
ATOM   435 O O   . LYS B 2 29 ? 12.781 51.552 26.227 1.00 91.12 ? 29 LYS B O   1 
ATOM   436 C CB  A LYS B 2 29 ? 14.609 51.870 24.085 0.50 67.09 ? 29 LYS B CB  1 
ATOM   437 C CB  B LYS B 2 29 ? 14.032 51.358 24.011 0.50 43.16 ? 29 LYS B CB  1 
ATOM   438 C CG  A LYS B 2 29 ? 15.685 52.920 23.805 0.50 52.95 ? 29 LYS B CG  1 
ATOM   439 C CG  B LYS B 2 29 ? 14.574 52.641 23.372 0.50 51.23 ? 29 LYS B CG  1 
ATOM   440 C CD  A LYS B 2 29 ? 16.747 52.465 22.813 0.50 49.08 ? 29 LYS B CD  1 
ATOM   441 C CD  B LYS B 2 29 ? 13.867 53.043 22.089 0.50 57.72 ? 29 LYS B CD  1 
ATOM   442 C CE  A LYS B 2 29 ? 18.107 52.242 23.441 0.50 45.12 ? 29 LYS B CE  1 
ATOM   443 C CE  B LYS B 2 29 ? 14.742 53.133 20.859 0.50 63.63 ? 29 LYS B CE  1 
ATOM   444 N NZ  A LYS B 2 29 ? 18.533 53.503 24.119 0.50 45.87 ? 29 LYS B NZ  1 
ATOM   445 N NZ  B LYS B 2 29 ? 15.304 54.488 20.604 0.50 48.31 ? 29 LYS B NZ  1 
ATOM   446 N N   . ALA B 2 30 ? 13.338 49.342 26.240 1.00 84.08 ? 30 ALA B N   1 
ATOM   447 C CA  . ALA B 2 30 ? 12.125 48.841 26.909 1.00 95.63 ? 30 ALA B CA  1 
ATOM   448 C C   . ALA B 2 30 ? 12.355 47.584 27.758 1.00 93.87 ? 30 ALA B C   1 
ATOM   449 O O   . ALA B 2 30 ? 11.645 46.552 27.566 1.00 89.91 ? 30 ALA B O   1 
ATOM   450 C CB  . ALA B 2 30 ? 11.048 48.647 25.833 1.00 97.34 ? 30 ALA B CB  1 
ATOM   451 O OXT . ALA B 2 30 ? 13.247 47.637 28.631 1.00 83.48 ? 30 ALA B OXT 1 
HETATM 452 O O   . HOH C 3 .  ? 18.609 42.636 38.414 0.50 6.39  ? 22 HOH A O   1 
HETATM 453 O O   . HOH C 3 .  ? 16.371 37.140 39.085 1.00 24.88 ? 23 HOH A O   1 
HETATM 454 O O   . HOH C 3 .  ? 19.182 33.102 38.223 1.00 37.75 ? 24 HOH A O   1 
HETATM 455 O O   . HOH C 3 .  ? 27.594 48.913 34.215 1.00 47.95 ? 25 HOH A O   1 
HETATM 456 O O   . HOH C 3 .  ? 19.735 51.626 33.301 1.00 56.16 ? 26 HOH A O   1 
HETATM 457 O O   . HOH C 3 .  ? 28.552 50.466 29.322 1.00 48.84 ? 27 HOH A O   1 
HETATM 458 O O   . HOH C 3 .  ? 11.544 31.316 31.052 0.50 30.74 ? 28 HOH A O   1 
HETATM 459 O O   . HOH C 3 .  ? 11.846 32.131 28.536 0.50 24.43 ? 29 HOH A O   1 
HETATM 460 O O   . HOH C 3 .  ? 20.305 42.836 38.239 0.50 7.87  ? 30 HOH A O   1 
HETATM 461 O O   . HOH C 3 .  ? 9.892  35.492 26.732 1.00 75.32 ? 31 HOH A O   1 
HETATM 462 O O   . HOH C 3 .  ? 24.878 47.827 40.289 1.00 69.41 ? 32 HOH A O   1 
HETATM 463 O O   . HOH C 3 .  ? 19.160 48.679 37.892 0.50 28.23 ? 33 HOH A O   1 
HETATM 464 O O   . HOH C 3 .  ? 10.534 46.456 31.588 1.00 62.13 ? 34 HOH A O   1 
HETATM 465 O O   . HOH C 3 .  ? 11.434 43.500 29.199 1.00 64.88 ? 35 HOH A O   1 
HETATM 466 O O   . HOH C 3 .  ? 13.537 47.052 34.981 1.00 66.27 ? 36 HOH A O   1 
HETATM 467 O O   . HOH C 3 .  ? 10.879 40.312 31.431 1.00 76.78 ? 37 HOH A O   1 
HETATM 468 O O   . HOH C 3 .  ? 18.486 51.687 37.629 1.00 71.56 ? 38 HOH A O   1 
HETATM 469 O O   . HOH C 3 .  ? 12.234 44.314 33.822 1.00 71.21 ? 39 HOH A O   1 
HETATM 470 O O   . HOH C 3 .  ? 10.275 39.138 28.735 1.00 67.35 ? 40 HOH A O   1 
HETATM 471 O O   . HOH C 3 .  ? 12.033 49.421 31.907 1.00 75.54 ? 41 HOH A O   1 
HETATM 472 O O   . HOH C 3 .  ? 11.619 39.285 36.626 0.50 32.90 ? 42 HOH A O   1 
HETATM 473 O O   . HOH C 3 .  ? 9.395  35.622 30.093 1.00 75.84 ? 43 HOH A O   1 
HETATM 474 O O   . HOH C 3 .  ? 15.550 50.493 36.824 0.50 45.09 ? 44 HOH A O   1 
HETATM 475 O O   . HOH C 3 .  ? 8.770  31.451 25.461 0.50 39.07 ? 45 HOH A O   1 
HETATM 476 O O   . HOH C 3 .  ? 29.898 47.475 33.052 1.00 67.98 ? 46 HOH A O   1 
HETATM 477 O O   . HOH C 3 .  ? 17.097 49.023 38.112 0.50 33.04 ? 47 HOH A O   1 
HETATM 478 O O   . HOH C 3 .  ? 9.168  37.554 33.520 0.50 42.35 ? 48 HOH A O   1 
HETATM 479 O O   . HOH C 3 .  ? 11.801 41.260 34.325 1.00 95.10 ? 49 HOH A O   1 
HETATM 480 O O   . HOH C 3 .  ? 26.984 51.020 32.416 1.00 89.60 ? 50 HOH A O   1 
HETATM 481 O O   . HOH C 3 .  ? 9.457  35.033 36.204 0.50 44.24 ? 51 HOH A O   1 
HETATM 482 O O   . HOH C 3 .  ? 9.835  37.730 36.070 0.50 41.52 ? 52 HOH A O   1 
HETATM 483 O O   . HOH C 3 .  ? 14.372 41.905 33.831 0.50 35.86 ? 53 HOH A O   1 
HETATM 484 O O   . HOH C 3 .  ? 19.046 39.710 38.557 0.50 39.85 ? 54 HOH A O   1 
HETATM 485 O O   . HOH D 3 .  ? 22.104 33.473 37.983 1.00 16.56 ? 31 HOH B O   1 
HETATM 486 O O   . HOH D 3 .  ? 20.803 32.207 20.533 1.00 28.10 ? 32 HOH B O   1 
HETATM 487 O O   . HOH D 3 .  ? 15.612 42.276 25.745 1.00 32.02 ? 33 HOH B O   1 
HETATM 488 O O   . HOH D 3 .  ? 23.218 47.233 26.959 1.00 33.04 ? 34 HOH B O   1 
HETATM 489 O O   . HOH D 3 .  ? 29.574 38.478 27.496 0.50 10.92 ? 35 HOH B O   1 
HETATM 490 O O   . HOH D 3 .  ? 29.649 44.605 30.070 1.00 36.77 ? 36 HOH B O   1 
HETATM 491 O O   . HOH D 3 .  ? 29.559 47.039 26.004 0.50 15.75 ? 37 HOH B O   1 
HETATM 492 O O   . HOH D 3 .  ? 14.076 44.438 27.895 1.00 32.90 ? 38 HOH B O   1 
HETATM 493 O O   . HOH D 3 .  ? 24.302 29.500 20.593 1.00 57.72 ? 39 HOH B O   1 
HETATM 494 O O   . HOH D 3 .  ? 21.921 48.629 22.321 1.00 48.76 ? 40 HOH B O   1 
HETATM 495 O O   . HOH D 3 .  ? 16.312 47.557 28.848 1.00 37.96 ? 41 HOH B O   1 
HETATM 496 O O   . HOH D 3 .  ? 28.483 33.462 36.842 0.50 17.95 ? 42 HOH B O   1 
HETATM 497 O O   . HOH D 3 .  ? 29.951 40.823 19.884 1.00 51.63 ? 43 HOH B O   1 
HETATM 498 O O   . HOH D 3 .  ? 27.816 27.817 27.741 0.33 47.14 ? 44 HOH B O   1 
HETATM 499 O O   . HOH D 3 .  ? 19.680 25.495 22.427 0.50 35.34 ? 45 HOH B O   1 
HETATM 500 O O   . HOH D 3 .  ? 25.249 27.662 22.840 1.00 85.47 ? 46 HOH B O   1 
HETATM 501 O O   . HOH D 3 .  ? 27.042 41.159 20.344 1.00 97.53 ? 47 HOH B O   1 
HETATM 502 O O   . HOH D 3 .  ? 29.750 39.709 39.198 1.00 71.25 ? 48 HOH B O   1 
HETATM 503 O O   . HOH D 3 .  ? 30.474 36.790 29.903 1.00 70.16 ? 49 HOH B O   1 
HETATM 504 O O   . HOH D 3 .  ? 25.074 29.318 15.623 1.00 46.46 ? 50 HOH B O   1 
HETATM 505 O O   . HOH D 3 .  ? 20.515 27.541 28.771 0.50 36.13 ? 51 HOH B O   1 
HETATM 506 O O   . HOH D 3 .  ? 24.789 27.630 27.960 1.00 52.16 ? 52 HOH B O   1 
HETATM 507 O O   . HOH D 3 .  ? 13.238 26.852 29.049 0.50 22.48 ? 53 HOH B O   1 
HETATM 508 O O   . HOH D 3 .  ? 26.916 25.348 21.948 0.50 38.73 ? 54 HOH B O   1 
HETATM 509 O O   . HOH D 3 .  ? 33.503 38.657 30.705 1.00 77.63 ? 55 HOH B O   1 
HETATM 510 O O   . HOH D 3 .  ? 30.611 42.458 37.171 1.00 60.66 ? 56 HOH B O   1 
HETATM 511 O O   . HOH D 3 .  ? 26.501 25.355 19.989 0.50 32.33 ? 57 HOH B O   1 
HETATM 512 O O   . HOH D 3 .  ? 23.601 50.282 28.125 1.00 72.19 ? 58 HOH B O   1 
HETATM 513 O O   . HOH D 3 .  ? 30.891 35.150 27.147 1.00 71.24 ? 59 HOH B O   1 
HETATM 514 O O   . HOH D 3 .  ? 23.210 26.008 20.168 1.00 90.95 ? 60 HOH B O   1 
HETATM 515 O O   . HOH D 3 .  ? 20.698 21.790 15.455 0.50 63.96 ? 61 HOH B O   1 
HETATM 516 O O   . HOH D 3 .  ? 11.652 30.489 26.524 0.50 29.56 ? 62 HOH B O   1 
HETATM 517 O O   . HOH D 3 .  ? 17.667 26.805 24.913 0.50 33.95 ? 63 HOH B O   1 
HETATM 518 O O   . HOH D 3 .  ? 25.672 25.823 25.733 0.33 81.91 ? 64 HOH B O   1 
HETATM 519 O O   . HOH D 3 .  ? 20.952 51.022 25.993 1.00 66.21 ? 65 HOH B O   1 
HETATM 520 O O   . HOH D 3 .  ? 18.256 24.870 27.419 1.00 72.08 ? 66 HOH B O   1 
HETATM 521 O O   . HOH D 3 .  ? 13.726 48.412 22.472 1.00 67.73 ? 67 HOH B O   1 
HETATM 522 O O   . HOH D 3 .  ? 13.108 28.747 29.873 0.50 22.92 ? 68 HOH B O   1 
HETATM 523 O O   . HOH D 3 .  ? 29.639 35.684 36.554 0.50 42.43 ? 69 HOH B O   1 
HETATM 524 O O   . HOH D 3 .  ? 33.183 33.560 33.658 0.33 75.18 ? 70 HOH B O   1 
HETATM 525 O O   . HOH D 3 .  ? 32.535 33.602 35.920 1.00 79.51 ? 71 HOH B O   1 
HETATM 526 O O   . HOH D 3 .  ? 21.245 27.333 16.128 0.50 41.86 ? 72 HOH B O   1 
HETATM 527 O O   . HOH D 3 .  ? 14.607 24.718 26.585 0.50 40.01 ? 73 HOH B O   1 
HETATM 528 O O   . HOH D 3 .  ? 16.442 24.475 23.608 0.50 59.94 ? 74 HOH B O   1 
HETATM 529 O O   . HOH D 3 .  ? 16.572 53.844 25.699 0.50 41.86 ? 75 HOH B O   1 
HETATM 530 O O   . HOH D 3 .  ? 16.792 51.487 28.750 1.00 73.78 ? 76 HOH B O   1 
HETATM 531 O O   . HOH D 3 .  ? 10.855 42.747 25.767 0.50 45.39 ? 77 HOH B O   1 
HETATM 532 O O   . HOH D 3 .  ? 13.484 50.538 29.409 1.00 65.76 ? 78 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  ILE 2  2  2  ILE ILE A . n 
A 1 3  VAL 3  3  3  VAL VAL A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  GLN 5  5  5  GLN GLN A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 ILE 10 10 10 ILE ILE A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 LEU 16 16 16 LEU LEU A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 ASN 18 18 18 ASN ASN A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
B 2 1  PHE 1  1  1  PHE PHE B . n 
B 2 2  VAL 2  2  2  VAL VAL B . n 
B 2 3  ASN 3  3  3  ASN ASN B . n 
B 2 4  GLN 4  4  4  GLN GLN B . n 
B 2 5  HIS 5  5  5  HIS HIS B . n 
B 2 6  LEU 6  6  6  LEU LEU B . n 
B 2 7  CYS 7  7  7  CYS CYS B . n 
B 2 8  GLY 8  8  8  GLY GLY B . n 
B 2 9  SER 9  9  9  SER SER B . n 
B 2 10 HIS 10 10 10 HIS HIS B . n 
B 2 11 LEU 11 11 11 LEU LEU B . n 
B 2 12 VAL 12 12 12 VAL VAL B . n 
B 2 13 GLU 13 13 13 GLU GLU B . n 
B 2 14 ALA 14 14 14 ALA ALA B . n 
B 2 15 LEU 15 15 15 LEU LEU B . n 
B 2 16 TYR 16 16 16 TYR TYR B . n 
B 2 17 LEU 17 17 17 LEU LEU B . n 
B 2 18 VAL 18 18 18 VAL VAL B . n 
B 2 19 CYS 19 19 19 CYS CYS B . n 
B 2 20 GLY 20 20 20 GLY GLY B . n 
B 2 21 GLU 21 21 21 GLU GLU B . n 
B 2 22 ARG 22 22 22 ARG ARG B . n 
B 2 23 GLY 23 23 23 GLY GLY B . n 
B 2 24 PHE 24 24 24 PHE PHE B . n 
B 2 25 PHE 25 25 25 PHE PHE B . n 
B 2 26 TYR 26 26 26 TYR TYR B . n 
B 2 27 THR 27 27 27 THR THR B . n 
B 2 28 PRO 28 28 28 PRO PRO B . n 
B 2 29 LYS 29 29 29 LYS LYS B . n 
B 2 30 ALA 30 30 30 ALA ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  22 2  HOH HOH A . 
C 3 HOH 2  23 6  HOH HOH A . 
C 3 HOH 3  24 10 HOH HOH A . 
C 3 HOH 4  25 15 HOH HOH A . 
C 3 HOH 5  26 16 HOH HOH A . 
C 3 HOH 6  27 19 HOH HOH A . 
C 3 HOH 7  28 21 HOH HOH A . 
C 3 HOH 8  29 22 HOH HOH A . 
C 3 HOH 9  30 24 HOH HOH A . 
C 3 HOH 10 31 26 HOH HOH A . 
C 3 HOH 11 32 29 HOH HOH A . 
C 3 HOH 12 33 30 HOH HOH A . 
C 3 HOH 13 34 32 HOH HOH A . 
C 3 HOH 14 35 35 HOH HOH A . 
C 3 HOH 15 36 41 HOH HOH A . 
C 3 HOH 16 37 42 HOH HOH A . 
C 3 HOH 17 38 43 HOH HOH A . 
C 3 HOH 18 39 45 HOH HOH A . 
C 3 HOH 19 40 46 HOH HOH A . 
C 3 HOH 20 41 48 HOH HOH A . 
C 3 HOH 21 42 49 HOH HOH A . 
C 3 HOH 22 43 51 HOH HOH A . 
C 3 HOH 23 44 52 HOH HOH A . 
C 3 HOH 24 45 64 HOH HOH A . 
C 3 HOH 25 46 65 HOH HOH A . 
C 3 HOH 26 47 68 HOH HOH A . 
C 3 HOH 27 48 70 HOH HOH A . 
C 3 HOH 28 49 71 HOH HOH A . 
C 3 HOH 29 50 72 HOH HOH A . 
C 3 HOH 30 51 74 HOH HOH A . 
C 3 HOH 31 52 75 HOH HOH A . 
C 3 HOH 32 53 80 HOH HOH A . 
C 3 HOH 33 54 81 HOH HOH A . 
D 3 HOH 1  31 1  HOH HOH B . 
D 3 HOH 2  32 3  HOH HOH B . 
D 3 HOH 3  33 4  HOH HOH B . 
D 3 HOH 4  34 5  HOH HOH B . 
D 3 HOH 5  35 7  HOH HOH B . 
D 3 HOH 6  36 8  HOH HOH B . 
D 3 HOH 7  37 9  HOH HOH B . 
D 3 HOH 8  38 11 HOH HOH B . 
D 3 HOH 9  39 12 HOH HOH B . 
D 3 HOH 10 40 13 HOH HOH B . 
D 3 HOH 11 41 14 HOH HOH B . 
D 3 HOH 12 42 17 HOH HOH B . 
D 3 HOH 13 43 18 HOH HOH B . 
D 3 HOH 14 44 20 HOH HOH B . 
D 3 HOH 15 45 23 HOH HOH B . 
D 3 HOH 16 46 25 HOH HOH B . 
D 3 HOH 17 47 27 HOH HOH B . 
D 3 HOH 18 48 28 HOH HOH B . 
D 3 HOH 19 49 31 HOH HOH B . 
D 3 HOH 20 50 33 HOH HOH B . 
D 3 HOH 21 51 34 HOH HOH B . 
D 3 HOH 22 52 36 HOH HOH B . 
D 3 HOH 23 53 37 HOH HOH B . 
D 3 HOH 24 54 38 HOH HOH B . 
D 3 HOH 25 55 39 HOH HOH B . 
D 3 HOH 26 56 40 HOH HOH B . 
D 3 HOH 27 57 44 HOH HOH B . 
D 3 HOH 28 58 47 HOH HOH B . 
D 3 HOH 29 59 50 HOH HOH B . 
D 3 HOH 30 60 53 HOH HOH B . 
D 3 HOH 31 61 54 HOH HOH B . 
D 3 HOH 32 62 55 HOH HOH B . 
D 3 HOH 33 63 56 HOH HOH B . 
D 3 HOH 34 64 57 HOH HOH B . 
D 3 HOH 35 65 58 HOH HOH B . 
D 3 HOH 36 66 59 HOH HOH B . 
D 3 HOH 37 67 60 HOH HOH B . 
D 3 HOH 38 68 61 HOH HOH B . 
D 3 HOH 39 69 62 HOH HOH B . 
D 3 HOH 40 70 63 HOH HOH B . 
D 3 HOH 41 71 66 HOH HOH B . 
D 3 HOH 42 72 67 HOH HOH B . 
D 3 HOH 43 73 69 HOH HOH B . 
D 3 HOH 44 74 73 HOH HOH B . 
D 3 HOH 45 75 76 HOH HOH B . 
D 3 HOH 46 76 77 HOH HOH B . 
D 3 HOH 47 77 78 HOH HOH B . 
D 3 HOH 48 78 79 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D 
2 1,2 A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1550 ? 
1 MORE         -13  ? 
1 'SSA (A^2)'  3410 ? 
2 'ABSA (A^2)' 4350 ? 
2 MORE         -35  ? 
2 'SSA (A^2)'  5560 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z         1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 16_565 x,-y+1,-z+1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 78.9000000000 0.0000000000 0.0000000000 -1.0000000000 39.4500000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 B HOH 44 ? D HOH . 
2 1 B HOH 64 ? D HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1991-11-07 
2 'Structure model' 1 1 2008-03-25 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
_software.name             PROLSQ 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB  A TYR 14 ? A CG A TYR 14 ? A CD2 A TYR 14 ? A 115.67 121.00 -5.33  0.60 N 
2 1 CB  A TYR 14 ? A CG A TYR 14 ? A CD1 A TYR 14 ? A 125.50 121.00 4.50   0.60 N 
3 1 OE1 B GLU 13 ? ? CD B GLU 13 ? ? OE2 B GLU 13 ? ? 133.98 123.30 10.68  1.20 N 
4 1 CB  B ARG 22 ? B CA B ARG 22 ? ? C   B ARG 22 ? ? 96.42  110.40 -13.98 2.00 N 
5 1 NE  B ARG 22 ? A CZ B ARG 22 ? A NH2 B ARG 22 ? A 124.16 120.30 3.86   0.50 N 
6 1 CB  B LYS 29 ? B CA B LYS 29 ? ? C   B LYS 29 ? ? 88.39  110.40 -22.01 2.00 N 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#