PDB Full entry for 1R4L
HEADER    HYDROLASE                               07-OCT-03   1R4L              
TITLE     INHIBITOR BOUND HUMAN ANGIOTENSIN CONVERTING ENZYME-RELATED           
TITLE    2 CARBOXYPEPTIDASE (ACE2)                                              
CAVEAT     1R4L    NAG A 800 HAS WRONG CHIRALITY AT ATOM C1                     
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: ANGIOTENSIN I CONVERTING ENZYME 2;                         
COMPND   3 CHAIN: A;                                                            
COMPND   4 FRAGMENT: EXTRACELLULAR DOMAINS;                                     
COMPND   5 SYNONYM: ANGIOTENSIN CONVERTING ENZYME-LIKE PROTEIN, ANGIOTENSIN     
COMPND   6 CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE;                          
COMPND   7 ENGINEERED: YES;                                                     
COMPND   8 MOL_ID: 2;                                                           
COMPND   9 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  10 CHAIN: B;                                                            
COMPND  11 ENGINEERED: YES;                                                     
COMPND  12 MOL_ID: 3;                                                           
COMPND  13 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  14 CHAIN: C;                                                            
COMPND  15 ENGINEERED: YES;                                                     
COMPND  16 MOL_ID: 4;                                                           
COMPND  17 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  18 CHAIN: D;                                                            
COMPND  19 ENGINEERED: YES;                                                     
COMPND  20 MOL_ID: 5;                                                           
COMPND  21 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  22 CHAIN: E;                                                            
COMPND  23 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 GENE: ACE2;                                                          
SOURCE   6 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE   7 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE   8 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE   9 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  10 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  11 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  12 MOL_ID: 2;                                                           
SOURCE  13 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  14 ORGANISM_COMMON: HUMAN;                                              
SOURCE  15 ORGANISM_TAXID: 9606;                                                
SOURCE  16 GENE: ACE2;                                                          
SOURCE  17 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  18 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  19 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  20 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  21 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  22 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  23 MOL_ID: 3;                                                           
SOURCE  24 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  25 ORGANISM_COMMON: HUMAN;                                              
SOURCE  26 ORGANISM_TAXID: 9606;                                                
SOURCE  27 GENE: ACE2;                                                          
SOURCE  28 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  29 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  30 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  31 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  32 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  33 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  34 MOL_ID: 4;                                                           
SOURCE  35 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  36 ORGANISM_COMMON: HUMAN;                                              
SOURCE  37 ORGANISM_TAXID: 9606;                                                
SOURCE  38 GENE: ACE2;                                                          
SOURCE  39 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  40 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  41 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  42 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  43 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  44 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  45 MOL_ID: 5;                                                           
SOURCE  46 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  47 ORGANISM_COMMON: HUMAN;                                              
SOURCE  48 ORGANISM_TAXID: 9606;                                                
SOURCE  49 GENE: ACE2;                                                          
SOURCE  50 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  51 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  52 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  53 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  54 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  55 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9                                  
KEYWDS    ZINC METALLOPEPTIDASE DOMAIN, COLLECTRIN HOMOLOGY DOMAIN, INHIBITOR   
KEYWDS   2 BOUND CONFORMATION, CHLORIDE ION BINDING SITE, ZINC ION BINDING      
KEYWDS   3 SITE, HYDROLASE                                                      
EXPDTA    X-RAY DIFFRACTION                                                     
AUTHOR    P.TOWLER,B.STAKER,S.G.PRASAD,S.MENON,D.RYAN,J.TANG,T.PARSONS,         
AUTHOR   2 M.FISHER,D.WILLIAMS,N.A.DALES,M.A.PATANE,M.W.PANTOLIANO              
REVDAT   6   29-JUL-20 1R4L    1       CAVEAT COMPND REMARK HETNAM              
REVDAT   6 2                   1       LINK   SITE                              
REVDAT   5   13-JUL-11 1R4L    1       VERSN                                    
REVDAT   4   24-FEB-09 1R4L    1       VERSN                                    
REVDAT   3   04-MAY-04 1R4L    1       AUTHOR                                   
REVDAT   2   27-APR-04 1R4L    1       JRNL                                     
REVDAT   1   03-FEB-04 1R4L    0                                                
JRNL        AUTH   P.TOWLER,B.STAKER,S.G.PRASAD,S.MENON,J.TANG,T.PARSONS,       
JRNL        AUTH 2 D.RYAN,M.FISHER,D.WILLIAMS,N.A.DALES,M.A.PATANE,             
JRNL        AUTH 3 M.W.PANTOLIANO                                               
JRNL        TITL   ACE2 X-RAY STRUCTURES REVEAL A LARGE HINGE-BENDING MOTION    
JRNL        TITL 2 IMPORTANT FOR INHIBITOR BINDING AND CATALYSIS.               
JRNL        REF    J.BIOL.CHEM.                  V. 279 17996 2004              
JRNL        REFN                   ISSN 0021-9258                               
JRNL        PMID   14754895                                                     
JRNL        DOI    10.1074/JBC.M311191200                                       
REMARK   1                                                                      
REMARK   1 REFERENCE 1                                                          
REMARK   1  AUTH   N.DALES,A.E.GOULD,J.A.BROWN,E.F.CALDERWOOD,B.GUAN,C.A.MINOR, 
REMARK   1  AUTH 2 J.M.GAVIN,P.HALES,V.K.KAUSHIK,M.STEWART,P.J.TUMMINO,         
REMARK   1  AUTH 3 C.S.VICKERS,T.D.OCAIN,M.A.PATANE                             
REMARK   1  TITL   SUBSTRATE BASED DESIGN OF THE FIRST CLASS OF                 
REMARK   1  TITL 2 ANGIOTENSIN-CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE       
REMARK   1  TITL 3 (ACE2) INHIBITORS                                            
REMARK   1  REF    J.AM.CHEM.SOC.                V. 124 11852 2002              
REMARK   1  REFN                   ISSN 0002-7863                               
REMARK   1  DOI    10.1021/JA0277226                                            
REMARK   1 REFERENCE 2                                                          
REMARK   1  AUTH   C.VICKERS,P.HALES,V.KAUSHIK,L.DICK,J.GAVIN,J.TANG,K.GODBOUT, 
REMARK   1  AUTH 2 T.PARSONS,E.BARONAS,F.HSIEH,S.ACTON,M.PATANE,A.NICHOLS,      
REMARK   1  AUTH 3 P.TUMMINO                                                    
REMARK   1  TITL   HYDROLYSIS OF BIOLOGICAL PEPTIDES BY HUMAN                   
REMARK   1  TITL 2 ANGIOTENSIN-CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE       
REMARK   1  REF    J.BIOL.CHEM.                  V. 277 14838 2002              
REMARK   1  REFN                   ISSN 0021-9258                               
REMARK   1  DOI    10.1074/JBC.M200581200                                       
REMARK   2                                                                      
REMARK   2 RESOLUTION.    3.00 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   PROGRAM     : CNX 2002                                             
REMARK   3   AUTHORS     : BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-              
REMARK   3               : KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,              
REMARK   3               : READ,RICE,SIMONSON,WARREN,ACCELRYS                   
REMARK   3               : SOFTWARE INC.(BADGER,BERARD,KUMAR,SZALMA,            
REMARK   3               : YIP,DZAKULA)                                         
REMARK   3                                                                      
REMARK   3  DATA USED IN REFINEMENT.                                            
REMARK   3   RESOLUTION RANGE HIGH (ANGSTROMS) : 3.00                           
REMARK   3   RESOLUTION RANGE LOW  (ANGSTROMS) : 43.26                          
REMARK   3   DATA CUTOFF            (SIGMA(F)) : 0.000                          
REMARK   3   DATA CUTOFF HIGH         (ABS(F)) : 2938880.390                    
REMARK   3   DATA CUTOFF LOW          (ABS(F)) : 0.0000                         
REMARK   3   COMPLETENESS (WORKING+TEST)   (%) : 96.8                           
REMARK   3   NUMBER OF REFLECTIONS             : 17228                          
REMARK   3                                                                      
REMARK   3  FIT TO DATA USED IN REFINEMENT.                                     
REMARK   3   CROSS-VALIDATION METHOD          : THROUGHOUT                      
REMARK   3   FREE R VALUE TEST SET SELECTION  : RANDOM                          
REMARK   3   R VALUE     (WORKING + TEST SET) : 0.253                           
REMARK   3   R VALUE            (WORKING SET) : 0.253                           
REMARK   3   FREE R VALUE                     : 0.337                           
REMARK   3   FREE R VALUE TEST SET SIZE   (%) : 10.000                          
REMARK   3   FREE R VALUE TEST SET COUNT      : 1730                            
REMARK   3   ESTIMATED ERROR OF FREE R VALUE  : 0.008                           
REMARK   3                                                                      
REMARK   3  FIT/AGREEMENT OF MODEL WITH ALL DATA.                               
REMARK   3   R VALUE     (WORKING + TEST SET, NO CUTOFF) : NULL                 
REMARK   3   R VALUE            (WORKING SET, NO CUTOFF) : NULL                 
REMARK   3   FREE R VALUE                    (NO CUTOFF) : NULL                 
REMARK   3   FREE R VALUE TEST SET SIZE   (%, NO CUTOFF) : NULL                 
REMARK   3   FREE R VALUE TEST SET COUNT     (NO CUTOFF) : NULL                 
REMARK   3   ESTIMATED ERROR OF FREE R VALUE (NO CUTOFF) : NULL                 
REMARK   3   TOTAL NUMBER OF REFLECTIONS     (NO CUTOFF) : NULL                 
REMARK   3                                                                      
REMARK   3  FIT IN THE HIGHEST RESOLUTION BIN.                                  
REMARK   3   TOTAL NUMBER OF BINS USED           : 6                            
REMARK   3   BIN RESOLUTION RANGE HIGH       (A) : 3.00                         
REMARK   3   BIN RESOLUTION RANGE LOW        (A) : 3.19                         
REMARK   3   BIN COMPLETENESS (WORKING+TEST) (%) : 85.10                        
REMARK   3   REFLECTIONS IN BIN    (WORKING SET) : 2250                         
REMARK   3   BIN R VALUE           (WORKING SET) : 0.3790                       
REMARK   3   BIN FREE R VALUE                    : 0.4600                       
REMARK   3   BIN FREE R VALUE TEST SET SIZE  (%) : 9.90                         
REMARK   3   BIN FREE R VALUE TEST SET COUNT     : 247                          
REMARK   3   ESTIMATED ERROR OF BIN FREE R VALUE : 0.029                        
REMARK   3                                                                      
REMARK   3  NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT.                    
REMARK   3   PROTEIN ATOMS            : 5147                                    
REMARK   3   NUCLEIC ACID ATOMS       : 0                                       
REMARK   3   HETEROGEN ATOMS          : 58                                      
REMARK   3   SOLVENT ATOMS            : 13                                      
REMARK   3                                                                      
REMARK   3  B VALUES.                                                           
REMARK   3   FROM WILSON PLOT           (A**2) : 63.00                          
REMARK   3   MEAN B VALUE      (OVERALL, A**2) : 74.50                          
REMARK   3   OVERALL ANISOTROPIC B VALUE.                                       
REMARK   3    B11 (A**2) : 20.07000                                             
REMARK   3    B22 (A**2) : 15.00000                                             
REMARK   3    B33 (A**2) : -35.07000                                            
REMARK   3    B12 (A**2) : 0.00000                                              
REMARK   3    B13 (A**2) : 20.30000                                             
REMARK   3    B23 (A**2) : 0.00000                                              
REMARK   3                                                                      
REMARK   3  ESTIMATED COORDINATE ERROR.                                         
REMARK   3   ESD FROM LUZZATI PLOT        (A) : 0.39                            
REMARK   3   ESD FROM SIGMAA              (A) : 0.62                            
REMARK   3   LOW RESOLUTION CUTOFF        (A) : 5.00                            
REMARK   3                                                                      
REMARK   3  CROSS-VALIDATED ESTIMATED COORDINATE ERROR.                         
REMARK   3   ESD FROM C-V LUZZATI PLOT    (A) : 0.56                            
REMARK   3   ESD FROM C-V SIGMAA          (A) : 0.74                            
REMARK   3                                                                      
REMARK   3  RMS DEVIATIONS FROM IDEAL VALUES.                                   
REMARK   3   BOND LENGTHS                 (A) : 0.008                           
REMARK   3   BOND ANGLES            (DEGREES) : 1.500                           
REMARK   3   DIHEDRAL ANGLES        (DEGREES) : 22.20                           
REMARK   3   IMPROPER ANGLES        (DEGREES) : 0.970                           
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL MODEL : RESTRAINED                                
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL FACTOR RESTRAINTS.    RMS    SIGMA                
REMARK   3   MAIN-CHAIN BOND              (A**2) : 2.020 ; 1.500                
REMARK   3   MAIN-CHAIN ANGLE             (A**2) : 3.420 ; 2.000                
REMARK   3   SIDE-CHAIN BOND              (A**2) : 2.750 ; 2.000                
REMARK   3   SIDE-CHAIN ANGLE             (A**2) : 4.270 ; 2.500                
REMARK   3                                                                      
REMARK   3  BULK SOLVENT MODELING.                                              
REMARK   3   METHOD USED : FLAT MODEL                                           
REMARK   3   KSOL        : 0.30                                                 
REMARK   3   BSOL        : 56.63                                                
REMARK   3                                                                      
REMARK   3  NCS MODEL : NULL                                                    
REMARK   3                                                                      
REMARK   3  NCS RESTRAINTS.                         RMS   SIGMA/WEIGHT          
REMARK   3   GROUP  1  POSITIONAL            (A) : NULL  ; NULL                 
REMARK   3   GROUP  1  B-FACTOR           (A**2) : NULL  ; NULL                 
REMARK   3                                                                      
REMARK   3  PARAMETER FILE  1  : PROTEIN_REP.PARAM                              
REMARK   3  PARAMETER FILE  2  : XX5_PAR.PARAM                                  
REMARK   3  PARAMETER FILE  3  : WATER_REP.PARAM                                
REMARK   3  PARAMETER FILE  4  : ION.PARAM                                      
REMARK   3  PARAMETER FILE  5  : CARBOHYDRATE.PARAM                             
REMARK   3  PARAMETER FILE  6  : NULL                                           
REMARK   3  TOPOLOGY FILE  1   : PROTEIN.TOP                                    
REMARK   3  TOPOLOGY FILE  2   : XX5_TOP.TOP                                    
REMARK   3  TOPOLOGY FILE  3   : WATER.TOP                                      
REMARK   3  TOPOLOGY FILE  4   : ION.TOP                                        
REMARK   3  TOPOLOGY FILE  5   : CARBOHYDRATE.TOP                               
REMARK   3  TOPOLOGY FILE  6   : NULL                                           
REMARK   3                                                                      
REMARK   3  OTHER REFINEMENT REMARKS: NULL                                      
REMARK   4                                                                      
REMARK   4 1R4L COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 30-OCT-03.                  
REMARK 100 THE DEPOSITION ID IS D_1000020429.                                   
REMARK 200                                                                      
REMARK 200 EXPERIMENTAL DETAILS                                                 
REMARK 200  EXPERIMENT TYPE                : X-RAY DIFFRACTION                  
REMARK 200  DATE OF DATA COLLECTION        : NULL                               
REMARK 200  TEMPERATURE           (KELVIN) : NULL                               
REMARK 200  PH                             : 7.5                                
REMARK 200  NUMBER OF CRYSTALS USED        : 1                                  
REMARK 200                                                                      
REMARK 200  SYNCHROTRON              (Y/N) : Y                                  
REMARK 200  RADIATION SOURCE               : NSLS                               
REMARK 200  BEAMLINE                       : X25                                
REMARK 200  X-RAY GENERATOR MODEL          : NULL                               
REMARK 200  MONOCHROMATIC OR LAUE    (M/L) : M                                  
REMARK 200  WAVELENGTH OR RANGE        (A) : NULL                               
REMARK 200  MONOCHROMATOR                  : NULL                               
REMARK 200  OPTICS                         : NULL                               
REMARK 200                                                                      
REMARK 200  DETECTOR TYPE                  : AREA DETECTOR                      
REMARK 200  DETECTOR MANUFACTURER          : NULL                               
REMARK 200  INTENSITY-INTEGRATION SOFTWARE : NULL                               
REMARK 200  DATA SCALING SOFTWARE          : SCALEPACK                          
REMARK 200                                                                      
REMARK 200  NUMBER OF UNIQUE REFLECTIONS   : 17526                              
REMARK 200  RESOLUTION RANGE HIGH      (A) : 3.000                              
REMARK 200  RESOLUTION RANGE LOW       (A) : 50.000                             
REMARK 200  REJECTION CRITERIA  (SIGMA(I)) : 0.000                              
REMARK 200                                                                      
REMARK 200 OVERALL.                                                             
REMARK 200  COMPLETENESS FOR RANGE     (%) : 95.9                               
REMARK 200  DATA REDUNDANCY                : NULL                               
REMARK 200  R MERGE                    (I) : NULL                               
REMARK 200  R SYM                      (I) : 0.07000                            
REMARK 200  <I/SIGMA(I)> FOR THE DATA SET  : 13.2000                            
REMARK 200                                                                      
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.                                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 3.00                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE LOW  (A) : 3.08                     
REMARK 200  COMPLETENESS FOR SHELL     (%) : 74.5                               
REMARK 200  DATA REDUNDANCY IN SHELL       : NULL                               
REMARK 200  R MERGE FOR SHELL          (I) : NULL                               
REMARK 200  R SYM FOR SHELL            (I) : 0.23000                            
REMARK 200  <I/SIGMA(I)> FOR SHELL         : 2.000                              
REMARK 200                                                                      
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH                              
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: MOLECULAR REPLACEMENT        
REMARK 200 SOFTWARE USED: AMORE                                                 
REMARK 200 STARTING MODEL: PDB ENTRY 1R42                                       
REMARK 200                                                                      
REMARK 200 REMARK: NULL                                                         
REMARK 280                                                                      
REMARK 280 CRYSTAL                                                              
REMARK 280 SOLVENT CONTENT, VS   (%): 58.18                                     
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 2.94                     
REMARK 280                                                                      
REMARK 280 CRYSTALLIZATION CONDITIONS: 19% PEG 3000, 100MM TRIS-HCL, 600MM      
REMARK 280  NACL, PH 7.5, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 291K       
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY                                            
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: C 1 2 1                          
REMARK 290                                                                      
REMARK 290      SYMOP   SYMMETRY                                                
REMARK 290     NNNMMM   OPERATOR                                                
REMARK 290       1555   X,Y,Z                                                   
REMARK 290       2555   -X,Y,-Z                                                 
REMARK 290       3555   X+1/2,Y+1/2,Z                                           
REMARK 290       4555   -X+1/2,Y+1/2,-Z                                         
REMARK 290                                                                      
REMARK 290     WHERE NNN -> OPERATOR NUMBER                                     
REMARK 290           MMM -> TRANSLATION VECTOR                                  
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS                            
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM             
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY                
REMARK 290 RELATED MOLECULES.                                                   
REMARK 290   SMTRY1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   2 -1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   2  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   2  0.000000  0.000000 -1.000000        0.00000            
REMARK 290   SMTRY1   3  1.000000  0.000000  0.000000       50.26550            
REMARK 290   SMTRY2   3  0.000000  1.000000  0.000000       43.25450            
REMARK 290   SMTRY3   3  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   4 -1.000000  0.000000  0.000000       50.26550            
REMARK 290   SMTRY2   4  0.000000  1.000000  0.000000       43.25450            
REMARK 290   SMTRY3   4  0.000000  0.000000 -1.000000        0.00000            
REMARK 290                                                                      
REMARK 290 REMARK: NULL                                                         
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: PENTAMERIC                        
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, C, D, E                         
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     MET A     1                                                      
REMARK 465     SER A     2                                                      
REMARK 465     SER A     3                                                      
REMARK 465     SER A     4                                                      
REMARK 465     SER A     5                                                      
REMARK 465     TRP A     6                                                      
REMARK 465     LEU A     7                                                      
REMARK 465     LEU A     8                                                      
REMARK 465     LEU A     9                                                      
REMARK 465     SER A    10                                                      
REMARK 465     LEU A    11                                                      
REMARK 465     VAL A    12                                                      
REMARK 465     ALA A    13                                                      
REMARK 465     VAL A    14                                                      
REMARK 465     THR A    15                                                      
REMARK 465     ALA A    16                                                      
REMARK 465     ALA A    17                                                      
REMARK 465     GLN A    18                                                      
REMARK 470                                                                      
REMARK 470 MISSING ATOM                                                         
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 470 I=INSERTION CODE):                                                   
REMARK 470   M RES CSSEQI  ATOMS                                                
REMARK 470     GLU A 150    CG   CD   OE1  OE2                                  
REMARK 470     PHE A 428    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     GLN A 429    CG   CD   OE1  NE2                                  
REMARK 470     GLU A 430    CG   CD   OE1  OE2                                  
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   O    HIS A   505     O    ASP A   509              2.14            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS                                             
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS THAT ARE RELATED BY CRYSTALLOGRAPHIC             
REMARK 500 SYMMETRY ARE IN CLOSE CONTACT.  AN ATOM LOCATED WITHIN 0.15          
REMARK 500 ANGSTROMS OF A SYMMETRY RELATED ATOM IS ASSUMED TO BE ON A           
REMARK 500 SPECIAL POSITION AND IS, THEREFORE, LISTED IN REMARK 375             
REMARK 500 INSTEAD OF REMARK 500.  ATOMS WITH NON-BLANK ALTERNATE               
REMARK 500 LOCATION INDICATORS ARE NOT INCLUDED IN THE CALCULATIONS.            
REMARK 500                                                                      
REMARK 500 DISTANCE CUTOFF:                                                     
REMARK 500 2.2 ANGSTROMS FOR CONTACTS NOT INVOLVING HYDROGEN ATOMS              
REMARK 500 1.6 ANGSTROMS FOR CONTACTS INVOLVING HYDROGEN ATOMS                  
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI  SSYMOP   DISTANCE          
REMARK 500   NH1  ARG A   582     NH1  ARG A   582     2655     2.02            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    THR A  20      162.60    -44.26                                   
REMARK 500    GLU A  22       36.52    -82.55                                   
REMARK 500    LYS A  26       -2.37    -56.76                                   
REMARK 500    ASN A  51        3.29    -58.40                                   
REMARK 500    ASN A  53       96.52   -167.11                                   
REMARK 500    THR A  55      -93.07    -58.40                                   
REMARK 500    GLU A  56      -48.81    169.65                                   
REMARK 500    ASN A  63       31.84    -72.03                                   
REMARK 500    GLN A  76        3.21    -64.09                                   
REMARK 500    LEU A  79        5.92    -67.46                                   
REMARK 500    GLN A  81        1.28    -66.44                                   
REMARK 500    LEU A  85      -92.77    -40.32                                   
REMARK 500    GLN A  86     -122.77    -62.04                                   
REMARK 500    GLN A  89     -134.02   -101.76                                   
REMARK 500    ASN A  90       62.33     21.25                                   
REMARK 500    LEU A  91      -48.92     -5.94                                   
REMARK 500    VAL A  93      -26.41    -38.82                                   
REMARK 500    SER A 109       66.05    -60.86                                   
REMARK 500    GLU A 110      -87.34     22.86                                   
REMARK 500    ASP A 111       28.52    -70.82                                   
REMARK 500    MET A 123      -46.87    -28.90                                   
REMARK 500    THR A 129      -29.93    174.82                                   
REMARK 500    ASN A 134      131.71    -37.87                                   
REMARK 500    ASN A 137       79.77   -177.76                                   
REMARK 500    PRO A 138      -11.01    -40.21                                   
REMARK 500    MET A 152       -8.17    -56.96                                   
REMARK 500    ASN A 154      -53.54   -124.39                                   
REMARK 500    SER A 155      142.81    -37.98                                   
REMARK 500    TYR A 158      -24.38    -34.16                                   
REMARK 500    GLU A 171      -72.32    -63.05                                   
REMARK 500    ARG A 177      -76.73    -28.67                                   
REMARK 500    VAL A 185      -71.83    -54.41                                   
REMARK 500    ALA A 191      -73.35    -59.65                                   
REMARK 500    HIS A 195       31.04     77.28                                   
REMARK 500    ASP A 198     -168.76   -177.71                                   
REMARK 500    ASP A 206      -46.34    -24.32                                   
REMARK 500    ASN A 210      -84.66   -120.53                                   
REMARK 500    LEU A 222      -42.87    -27.80                                   
REMARK 500    ILE A 223      -83.13    -60.32                                   
REMARK 500    GLU A 224       -9.69    -49.21                                   
REMARK 500    GLU A 227      -70.65    -48.48                                   
REMARK 500    ALA A 246      -89.41    -74.38                                   
REMARK 500    LYS A 247       -5.97    -43.74                                   
REMARK 500    TYR A 252       45.69   -161.95                                   
REMARK 500    SER A 254        0.76     84.68                                   
REMARK 500    PRO A 258       26.64    -68.49                                   
REMARK 500    ILE A 259       12.87   -154.38                                   
REMARK 500    CYS A 261      111.55     14.10                                   
REMARK 500    LEU A 262      158.15    -44.22                                   
REMARK 500    MET A 270      -30.62    -26.22                                   
REMARK 500                                                                      
REMARK 500 THIS ENTRY HAS     138 RAMACHANDRAN OUTLIERS.                        
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: PLANAR GROUPS                                              
REMARK 500                                                                      
REMARK 500 PLANAR GROUPS IN THE FOLLOWING RESIDUES HAVE A TOTAL                 
REMARK 500 RMS DISTANCE OF ALL ATOMS FROM THE BEST-FIT PLANE                    
REMARK 500 BY MORE THAN AN EXPECTED VALUE OF 6*RMSD, WITH AN                    
REMARK 500 RMSD 0.02 ANGSTROMS, OR AT LEAST ONE ATOM HAS                        
REMARK 500 AN RMSD GREATER THAN THIS VALUE                                      
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        RMS     TYPE                                    
REMARK 500    TYR A 510         0.09    SIDE CHAIN                              
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 620                                                                      
REMARK 620 METAL COORDINATION                                                   
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):                             
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              ZN A 803  ZN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HIS A 374   NE2                                                    
REMARK 620 2 HIS A 378   NE2 106.4                                              
REMARK 620 3 GLU A 402   OE1  97.4  95.8                                        
REMARK 620 4 XX5 A 804   O3  114.2  87.0 146.2                                  
REMARK 620 5 XX5 A 804   O1  140.9 108.8  95.5  52.3                            
REMARK 620 N                    1     2     3     4                             
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: 1R42   RELATED DB: PDB                                   
REMARK 900 NATIVE HUMAN ANGIOTENSIN CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE  
REMARK 900 (ACE2)                                                               
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 THE COMPLETE SEQUENCE CRYSTALLIZED BY THE AUTHORS                    
REMARK 999 (RESIDUES 1-740 OF REFERENCE SEQUENCE GB 11225609)                   
REMARK 999 IS AS FOLLOWS:                                                       
REMARK 999 MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNY                   
REMARK 999 NTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ                  
REMARK 999 QNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIM                  
REMARK 999 ANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYW                  
REMARK 999 RGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPS                  
REMARK 999 YISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQ                  
REMARK 999 RIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDF                  
REMARK 999 RILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEI                  
REMARK 999 MSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEK                  
REMARK 999 WRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSND                  
REMARK 999 YSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRL                  
REMARK 999 GKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWS                  
REMARK 999 PYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQ                   
REMARK 999 MILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRIN                  
REMARK 999 DAFRLNDNSLEFLGIQPTLGPPNQPPVS                                         
REMARK 999 THE ELECTRON DENSITY MAP FOR MUCH OF THE COLLECTRIN                  
REMARK 999 HOMOLOGY DOMAIN (RESIDUES 616-740) IS WEAK.  ONLY                    
REMARK 999 ABOUT HALF OF THIS DOMAIN WAS VISIBLE IN THE ELECTRON                
REMARK 999 DENSITY MAP, AND WHAT CAN BE SEEN IS AMBIGUOUS DUE TO                
REMARK 999 TOPOLOGY AND CONNECTIVITY ISSUES.  FOR THIS REASON,                  
REMARK 999 RESIDUES BEGINNING AT 901 ARE LABELED AS UNKNOWN (UNK).              
REMARK 999 EACH SEGMENT OF UNKNOWN RESIDUES HAS BEEN ASSIGNED                   
REMARK 999 A UNIQUE CHAIN ID. HOWEVER, IT SHOULD BE UNDERSTOOD                  
REMARK 999 THAT ONLY ONE SEQUENCE (RESIDUES 1-740) WAS CRYSTALLIZED.            
DBREF  1R4L A    1   615  UNP    Q9BYF1   ACE2_HUMAN       1    615             
DBREF  1R4L B  901   906  PDB    1R4L     1R4L           901    906             
DBREF  1R4L C  907   926  PDB    1R4L     1R4L           907    926             
DBREF  1R4L D  927   944  PDB    1R4L     1R4L           927    944             
DBREF  1R4L E  945   958  PDB    1R4L     1R4L           945    958             
SEQRES   1 A  615  MET SER SER SER SER TRP LEU LEU LEU SER LEU VAL ALA          
SEQRES   2 A  615  VAL THR ALA ALA GLN SER THR ILE GLU GLU GLN ALA LYS          
SEQRES   3 A  615  THR PHE LEU ASP LYS PHE ASN HIS GLU ALA GLU ASP LEU          
SEQRES   4 A  615  PHE TYR GLN SER SER LEU ALA SER TRP ASN TYR ASN THR          
SEQRES   5 A  615  ASN ILE THR GLU GLU ASN VAL GLN ASN MET ASN ASN ALA          
SEQRES   6 A  615  GLY ASP LYS TRP SER ALA PHE LEU LYS GLU GLN SER THR          
SEQRES   7 A  615  LEU ALA GLN MET TYR PRO LEU GLN GLU ILE GLN ASN LEU          
SEQRES   8 A  615  THR VAL LYS LEU GLN LEU GLN ALA LEU GLN GLN ASN GLY          
SEQRES   9 A  615  SER SER VAL LEU SER GLU ASP LYS SER LYS ARG LEU ASN          
SEQRES  10 A  615  THR ILE LEU ASN THR MET SER THR ILE TYR SER THR GLY          
SEQRES  11 A  615  LYS VAL CYS ASN PRO ASP ASN PRO GLN GLU CYS LEU LEU          
SEQRES  12 A  615  LEU GLU PRO GLY LEU ASN GLU ILE MET ALA ASN SER LEU          
SEQRES  13 A  615  ASP TYR ASN GLU ARG LEU TRP ALA TRP GLU SER TRP ARG          
SEQRES  14 A  615  SER GLU VAL GLY LYS GLN LEU ARG PRO LEU TYR GLU GLU          
SEQRES  15 A  615  TYR VAL VAL LEU LYS ASN GLU MET ALA ARG ALA ASN HIS          
SEQRES  16 A  615  TYR GLU ASP TYR GLY ASP TYR TRP ARG GLY ASP TYR GLU          
SEQRES  17 A  615  VAL ASN GLY VAL ASP GLY TYR ASP TYR SER ARG GLY GLN          
SEQRES  18 A  615  LEU ILE GLU ASP VAL GLU HIS THR PHE GLU GLU ILE LYS          
SEQRES  19 A  615  PRO LEU TYR GLU HIS LEU HIS ALA TYR VAL ARG ALA LYS          
SEQRES  20 A  615  LEU MET ASN ALA TYR PRO SER TYR ILE SER PRO ILE GLY          
SEQRES  21 A  615  CYS LEU PRO ALA HIS LEU LEU GLY ASP MET TRP GLY ARG          
SEQRES  22 A  615  PHE TRP THR ASN LEU TYR SER LEU THR VAL PRO PHE GLY          
SEQRES  23 A  615  GLN LYS PRO ASN ILE ASP VAL THR ASP ALA MET VAL ASP          
SEQRES  24 A  615  GLN ALA TRP ASP ALA GLN ARG ILE PHE LYS GLU ALA GLU          
SEQRES  25 A  615  LYS PHE PHE VAL SER VAL GLY LEU PRO ASN MET THR GLN          
SEQRES  26 A  615  GLY PHE TRP GLU ASN SER MET LEU THR ASP PRO GLY ASN          
SEQRES  27 A  615  VAL GLN LYS ALA VAL CYS HIS PRO THR ALA TRP ASP LEU          
SEQRES  28 A  615  GLY LYS GLY ASP PHE ARG ILE LEU MET CYS THR LYS VAL          
SEQRES  29 A  615  THR MET ASP ASP PHE LEU THR ALA HIS HIS GLU MET GLY          
SEQRES  30 A  615  HIS ILE GLN TYR ASP MET ALA TYR ALA ALA GLN PRO PHE          
SEQRES  31 A  615  LEU LEU ARG ASN GLY ALA ASN GLU GLY PHE HIS GLU ALA          
SEQRES  32 A  615  VAL GLY GLU ILE MET SER LEU SER ALA ALA THR PRO LYS          
SEQRES  33 A  615  HIS LEU LYS SER ILE GLY LEU LEU SER PRO ASP PHE GLN          
SEQRES  34 A  615  GLU ASP ASN GLU THR GLU ILE ASN PHE LEU LEU LYS GLN          
SEQRES  35 A  615  ALA LEU THR ILE VAL GLY THR LEU PRO PHE THR TYR MET          
SEQRES  36 A  615  LEU GLU LYS TRP ARG TRP MET VAL PHE LYS GLY GLU ILE          
SEQRES  37 A  615  PRO LYS ASP GLN TRP MET LYS LYS TRP TRP GLU MET LYS          
SEQRES  38 A  615  ARG GLU ILE VAL GLY VAL VAL GLU PRO VAL PRO HIS ASP          
SEQRES  39 A  615  GLU THR TYR CYS ASP PRO ALA SER LEU PHE HIS VAL SER          
SEQRES  40 A  615  ASN ASP TYR SER PHE ILE ARG TYR TYR THR ARG THR LEU          
SEQRES  41 A  615  TYR GLN PHE GLN PHE GLN GLU ALA LEU CYS GLN ALA ALA          
SEQRES  42 A  615  LYS HIS GLU GLY PRO LEU HIS LYS CYS ASP ILE SER ASN          
SEQRES  43 A  615  SER THR GLU ALA GLY GLN LYS LEU PHE ASN MET LEU ARG          
SEQRES  44 A  615  LEU GLY LYS SER GLU PRO TRP THR LEU ALA LEU GLU ASN          
SEQRES  45 A  615  VAL VAL GLY ALA LYS ASN MET ASN VAL ARG PRO LEU LEU          
SEQRES  46 A  615  ASN TYR PHE GLU PRO LEU PHE THR TRP LEU LYS ASP GLN          
SEQRES  47 A  615  ASN LYS ASN SER PHE VAL GLY TRP SER THR ASP TRP SER          
SEQRES  48 A  615  PRO TYR ALA ASP                                              
SEQRES   1 B    6  UNK UNK UNK UNK UNK UNK                                      
SEQRES   1 C   20  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 C   20  UNK UNK UNK UNK UNK UNK UNK                                  
SEQRES   1 D   18  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 D   18  UNK UNK UNK UNK UNK                                          
SEQRES   1 E   14  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 E   14  UNK                                                          
MODRES 1R4L ASN A   90  ASN  GLYCOSYLATION SITE                                 
MODRES 1R4L ASN A  103  ASN  GLYCOSYLATION SITE                                 
HET    NAG  A 800      14                                                       
HET    NAG  A 801      14                                                       
HET     CL  A 802       1                                                       
HET     ZN  A 803       1                                                       
HET    XX5  A 804      28                                                       
HETNAM     NAG 2-ACETAMIDO-2-DEOXY-BETA-D-GLUCOPYRANOSE                         
HETNAM      CL CHLORIDE ION                                                     
HETNAM      ZN ZINC ION                                                         
HETNAM     XX5 (S,S)-2-{1-CARBOXY-2-[3-(3,5-DICHLORO-BENZYL)-3H-                
HETNAM   2 XX5  IMIDAZOL-4-YL]-ETHYLAMINO}-4-METHYL-PENTANOIC ACID              
HETSYN     XX5 MLN-4760                                                         
FORMUL   6  NAG    2(C8 H15 N O6)                                               
FORMUL   8   CL    CL 1-                                                        
FORMUL   9   ZN    ZN 2+                                                        
FORMUL  10  XX5    C19 H23 CL2 N3 O4                                            
FORMUL  11  HOH   *13(H2 O)                                                     
HELIX    1   1 GLN A   24  LEU A   29  1                                   6    
HELIX    2   2 LEU A   29  ASN A   51  1                                  23    
HELIX    3   3 GLU A   56  MET A   82  1                                  27    
HELIX    4   4 ASN A   90  GLN A  102  1                                  13    
HELIX    5   5 GLY A  104  LEU A  108  5                                   5    
HELIX    6   6 LYS A  112  SER A  128  1                                  17    
HELIX    7   7 GLY A  147  SER A  155  1                                   9    
HELIX    8   8 ASP A  157  ALA A  193  1                                  37    
HELIX    9   9 ASP A  198  ARG A  204  1                                   7    
HELIX   10  10 GLY A  205  GLU A  208  5                                   4    
HELIX   11  11 SER A  218  GLU A  232  1                                  15    
HELIX   12  12 ILE A  233  ALA A  242  1                                  10    
HELIX   13  13 ARG A  245  ASN A  250  1                                   6    
HELIX   14  14 PHE A  274  LEU A  278  5                                   5    
HELIX   15  15 MET A  297  ALA A  301  5                                   5    
HELIX   16  16 ASP A  303  VAL A  316  1                                  14    
HELIX   17  17 SER A  317  GLY A  319  5                                   3    
HELIX   18  18 MET A  366  TYR A  385  1                                  20    
HELIX   19  19 PRO A  389  ARG A  393  5                                   5    
HELIX   20  20 ASN A  397  LEU A  410  1                                  14    
HELIX   21  21 THR A  414  GLY A  422  1                                   9    
HELIX   22  22 ASP A  431  GLY A  466  1                                  36    
HELIX   23  23 PRO A  469  ASP A  471  5                                   3    
HELIX   24  24 GLN A  472  ILE A  484  1                                  13    
HELIX   25  25 CYS A  498  SER A  502  5                                   5    
HELIX   26  26 ILE A  513  CYS A  530  1                                  18    
HELIX   27  27 GLN A  531  ALA A  533  5                                   3    
HELIX   28  28 PRO A  538  CYS A  542  5                                   5    
HELIX   29  29 SER A  547  ARG A  559  1                                  13    
HELIX   30  30 PRO A  565  VAL A  574  1                                  10    
HELIX   31  31 VAL A  581  PHE A  588  1                                   8    
HELIX   32  32 PHE A  588  LYS A  600  1                                  13    
HELIX   33  33 UNK D  927  UNK D  942  1                                  16    
HELIX   34  34 UNK E  949  UNK E  953  5                                   5    
SHEET    1   A 2 VAL A 132  CYS A 133  0                                        
SHEET    2   A 2 CYS A 141  LEU A 142 -1  O  LEU A 142   N  VAL A 132           
SHEET    1   B 2 THR A 347  GLY A 352  0                                        
SHEET    2   B 2 ASP A 355  LEU A 359 -1  O  ASP A 355   N  GLY A 352           
SSBOND   1 CYS A  133    CYS A  141                          1555   1555  2.05  
SSBOND   2 CYS A  344    CYS A  361                          1555   1555  2.04  
SSBOND   3 CYS A  530    CYS A  542                          1555   1555  2.03  
LINK         ND2 ASN A  90                 C1  NAG A 800     1555   1555  1.45  
LINK         ND2 ASN A 103                 C1  NAG A 801     1555   1555  1.46  
LINK         NE2 HIS A 374                ZN    ZN A 803     1555   1555  2.05  
LINK         NE2 HIS A 378                ZN    ZN A 803     1555   1555  2.32  
LINK         OE1 GLU A 402                ZN    ZN A 803     1555   1555  2.05  
LINK        ZN    ZN A 803                 O3  XX5 A 804     1555   1555  2.62  
LINK        ZN    ZN A 803                 O1  XX5 A 804     1555   1555  2.04  
CISPEP   1 GLU A  145    PRO A  146          0        -0.65                     
CRYST1  100.531   86.509  105.858  90.00 103.65  90.00 C 1 2 1       4          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.009947  0.000000  0.002416        0.00000                         
SCALE2      0.000000  0.011559  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.009721        0.00000                         
ATOM      1  N   SER A  19       1.704  20.560   1.207  1.00133.82           N  
ATOM      2  CA  SER A  19       3.168  20.573   0.906  1.00133.96           C  
ATOM      3  C   SER A  19       3.733  19.157   0.798  1.00133.18           C  
ATOM      4  O   SER A  19       3.156  18.206   1.330  1.00133.51           O  
ATOM      5  CB  SER A  19       3.925  21.347   1.994  1.00134.47           C  
ATOM      6  OG  SER A  19       3.555  22.717   2.004  1.00134.64           O  
ATOM      7  N   THR A  20       4.863  19.028   0.107  1.00131.57           N  
ATOM      8  CA  THR A  20       5.520  17.737  -0.086  1.00129.62           C  
ATOM      9  C   THR A  20       5.559  16.935   1.216  1.00128.93           C  
ATOM     10  O   THR A  20       5.371  17.485   2.301  1.00128.28           O  
ATOM     11  CB  THR A  20       6.972  17.922  -0.583  1.00128.63           C  
ATOM     12  OG1 THR A  20       7.004  18.912  -1.617  1.00127.83           O  
ATOM     13  CG2 THR A  20       7.515  16.617  -1.136  1.00126.94           C  
ATOM     14  N   ILE A  21       5.797  15.633   1.102  1.00128.34           N  
ATOM     15  CA  ILE A  21       5.880  14.763   2.273  1.00127.42           C  
ATOM     16  C   ILE A  21       7.329  14.742   2.757  1.00125.81           C  
ATOM     17  O   ILE A  21       7.613  14.399   3.905  1.00125.22           O  
ATOM     18  CB  ILE A  21       5.402  13.329   1.944  1.00127.81           C  
ATOM     19  CG1 ILE A  21       3.874  13.303   1.837  1.00127.46           C  
ATOM     20  CG2 ILE A  21       5.859  12.362   3.023  1.00128.21           C  
ATOM     21  CD1 ILE A  21       3.298  14.276   0.831  1.00125.56           C  
ATOM     22  N   GLU A  22       8.241  15.116   1.865  1.00124.15           N  
ATOM     23  CA  GLU A  22       9.653  15.200   2.203  1.00123.24           C  
ATOM     24  C   GLU A  22       9.758  16.561   2.862  1.00123.69           C  
ATOM     25  O   GLU A  22      10.728  17.294   2.681  1.00124.43           O  
ATOM     26  CB  GLU A  22      10.522  15.182   0.948  1.00123.24           C  
ATOM     27  CG  GLU A  22      12.012  15.366   1.208  1.00121.40           C  
ATOM     28  CD  GLU A  22      12.752  15.851  -0.024  1.00121.79           C  
ATOM     29  OE1 GLU A  22      12.624  15.200  -1.078  1.00122.06           O  
ATOM     30  OE2 GLU A  22      13.457  16.881   0.053  1.00121.28           O  
ATOM     31  N   GLU A  23       8.718  16.906   3.606  1.00123.38           N  
ATOM     32  CA  GLU A  23       8.676  18.172   4.302  1.00123.13           C  
ATOM     33  C   GLU A  23       8.070  17.984   5.683  1.00124.09           C  
ATOM     34  O   GLU A  23       8.356  18.749   6.606  1.00124.15           O  
ATOM     35  CB  GLU A  23       7.862  19.188   3.507  1.00122.86           C  
ATOM     36  CG  GLU A  23       7.759  20.497   4.228  1.00122.66           C  
ATOM     37  CD  GLU A  23       9.100  20.915   4.769  1.00122.13           C  
ATOM     38  OE1 GLU A  23       9.134  21.663   5.771  1.00122.76           O  
ATOM     39  OE2 GLU A  23      10.121  20.492   4.185  1.00120.18           O  
ATOM     40  N   GLN A  24       7.224  16.965   5.819  1.00124.72           N  
ATOM     41  CA  GLN A  24       6.595  16.664   7.101  1.00125.14           C  
ATOM     42  C   GLN A  24       7.700  16.128   8.001  1.00124.33           C  
ATOM     43  O   GLN A  24       7.527  15.978   9.210  1.00124.41           O  
ATOM     44  CB  GLN A  24       5.515  15.591   6.939  1.00126.17           C  
ATOM     45  CG  GLN A  24       4.395  15.939   5.979  1.00127.53           C  
ATOM     46  CD  GLN A  24       3.410  14.796   5.818  1.00128.55           C  
ATOM     47  OE1 GLN A  24       2.720  14.414   6.766  1.00128.71           O  
ATOM     48  NE2 GLN A  24       3.347  14.236   4.614  1.00128.26           N  
ATOM     49  N   ALA A  25       8.837  15.830   7.381  1.00122.50           N  
ATOM     50  CA  ALA A  25       9.998  15.309   8.083  1.00119.21           C  
ATOM     51  C   ALA A  25      11.065  16.391   8.206  1.00117.34           C  
ATOM     52  O   ALA A  25      11.722  16.502   9.240  1.00117.23           O  
ATOM     53  CB  ALA A  25      10.553  14.106   7.340  1.00119.18           C  
ATOM     54  N   LYS A  26      11.237  17.191   7.155  1.00115.02           N  
ATOM     55  CA  LYS A  26      12.225  18.264   7.178  1.00113.82           C  
ATOM     56  C   LYS A  26      11.957  19.196   8.352  1.00113.53           C  
ATOM     57  O   LYS A  26      12.685  20.160   8.581  1.00113.37           O  
ATOM     58  CB  LYS A  26      12.207  19.045   5.863  1.00113.98           C  
ATOM     59  CG  LYS A  26      12.859  18.302   4.712  1.00115.30           C  
ATOM     60  CD  LYS A  26      12.990  19.175   3.479  1.00117.07           C  
ATOM     61  CE  LYS A  26      13.887  18.518   2.438  1.00118.34           C  
ATOM     62  NZ  LYS A  26      14.107  19.373   1.230  1.00119.53           N  
ATOM     63  N   THR A  27      10.884  18.896   9.076  1.00113.46           N  
ATOM     64  CA  THR A  27      10.485  19.638  10.263  1.00112.81           C  
ATOM     65  C   THR A  27      10.508  18.641  11.409  1.00112.16           C  
ATOM     66  O   THR A  27      11.176  18.855  12.419  1.00113.34           O  
ATOM     67  CB  THR A  27       9.058  20.195  10.151  1.00113.76           C  
ATOM     68  OG1 THR A  27       8.553  20.467  11.468  1.00112.34           O  
ATOM     69  CG2 THR A  27       8.145  19.198   9.446  1.00112.62           C  
ATOM     70  N   PHE A  28       9.774  17.544  11.231  1.00109.88           N  
ATOM     71  CA  PHE A  28       9.702  16.481  12.225  1.00106.82           C  
ATOM     72  C   PHE A  28      11.081  16.203  12.802  1.00105.98           C  
ATOM     73  O   PHE A  28      11.222  15.847  13.973  1.00106.35           O  
ATOM     74  CB  PHE A  28       9.156  15.204  11.595  1.00104.49           C  
ATOM     75  CG  PHE A  28       9.386  13.990  12.425  1.00101.39           C  
ATOM     76  CD1 PHE A  28       9.009  13.971  13.752  1.00101.66           C  
ATOM     77  CD2 PHE A  28      10.006  12.882  11.892  1.00100.74           C  
ATOM     78  CE1 PHE A  28       9.249  12.872  14.533  1.00102.69           C  
ATOM     79  CE2 PHE A  28      10.248  11.780  12.666  1.00101.51           C  
ATOM     80  CZ  PHE A  28       9.870  11.774  13.992  1.00102.40           C  
ATOM     81  N   LEU A  29      12.097  16.361  11.963  1.00103.57           N  
ATOM     82  CA  LEU A  29      13.472  16.152  12.381  1.00101.05           C  
ATOM     83  C   LEU A  29      13.927  17.333  13.222  1.00100.23           C  
ATOM     84  O   LEU A  29      14.431  17.156  14.332  1.00100.46           O  
ATOM     85  CB  LEU A  29      14.377  16.004  11.158  1.00 98.28           C  
ATOM     86  CG  LEU A  29      14.399  14.613  10.526  1.00 95.03           C  
ATOM     87  CD1 LEU A  29      13.073  13.919  10.730  1.00 94.57           C  
ATOM     88  CD2 LEU A  29      14.733  14.742   9.055  1.00 95.30           C  
ATOM     89  N   ASP A  30      13.734  18.539  12.693  1.00 98.17           N  
ATOM     90  CA  ASP A  30      14.133  19.753  13.394  1.00 96.39           C  
ATOM     91  C   ASP A  30      13.350  19.981  14.682  1.00 93.11           C  
ATOM     92  O   ASP A  30      13.845  20.596  15.624  1.00 91.03           O  
ATOM     93  CB  ASP A  30      13.976  20.965  12.485  1.00 99.14           C  
ATOM     94  CG  ASP A  30      14.417  22.245  13.158  1.00102.24           C  
ATOM     95  OD1 ASP A  30      15.588  22.307  13.590  1.00104.72           O  
ATOM     96  OD2 ASP A  30      13.598  23.184  13.262  1.00104.48           O  
ATOM     97  N   LYS A  31      12.118  19.495  14.717  1.00 91.10           N  
ATOM     98  CA  LYS A  31      11.294  19.635  15.906  1.00 90.43           C  
ATOM     99  C   LYS A  31      11.904  18.653  16.902  1.00 89.63           C  
ATOM    100  O   LYS A  31      11.659  18.722  18.103  1.00 90.41           O  
ATOM    101  CB  LYS A  31       9.840  19.250  15.586  1.00 89.38           C  
ATOM    102  CG  LYS A  31       8.784  20.263  16.029  1.00 87.01           C  
ATOM    103  CD  LYS A  31       8.180  19.915  17.377  1.00 83.66           C  
ATOM    104  CE  LYS A  31       7.321  18.679  17.282  1.00 80.10           C  
ATOM    105  NZ  LYS A  31       6.744  18.307  18.600  1.00 82.01           N  
ATOM    106  N   PHE A  32      12.716  17.743  16.371  1.00 88.09           N  
ATOM    107  CA  PHE A  32      13.389  16.722  17.161  1.00 85.40           C  
ATOM    108  C   PHE A  32      14.761  17.206  17.642  1.00 81.83           C  
ATOM    109  O   PHE A  32      15.080  17.115  18.824  1.00 81.92           O  
ATOM    110  CB  PHE A  32      13.511  15.444  16.322  1.00 87.52           C  
ATOM    111  CG  PHE A  32      14.410  14.402  16.918  1.00 90.82           C  
ATOM    112  CD1 PHE A  32      15.771  14.407  16.651  1.00 90.95           C  
ATOM    113  CD2 PHE A  32      13.898  13.420  17.751  1.00 91.05           C  
ATOM    114  CE1 PHE A  32      16.603  13.452  17.205  1.00 89.80           C  
ATOM    115  CE2 PHE A  32      14.728  12.460  18.309  1.00 90.94           C  
ATOM    116  CZ  PHE A  32      16.080  12.476  18.036  1.00 89.42           C  
ATOM    117  N   ASN A  33      15.567  17.728  16.727  1.00 77.21           N  
ATOM    118  CA  ASN A  33      16.893  18.234  17.075  1.00 76.34           C  
ATOM    119  C   ASN A  33      16.878  19.249  18.218  1.00 75.58           C  
ATOM    120  O   ASN A  33      17.916  19.549  18.813  1.00 76.33           O  
ATOM    121  CB  ASN A  33      17.529  18.916  15.868  1.00 76.25           C  
ATOM    122  CG  ASN A  33      17.669  17.996  14.695  1.00 79.79           C  
ATOM    123  OD1 ASN A  33      18.108  18.409  13.623  1.00 81.80           O  
ATOM    124  ND2 ASN A  33      17.297  16.733  14.883  1.00 80.91           N  
ATOM    125  N   HIS A  34      15.705  19.782  18.528  1.00 72.16           N  
ATOM    126  CA  HIS A  34      15.619  20.796  19.556  1.00 66.48           C  
ATOM    127  C   HIS A  34      15.178  20.337  20.911  1.00 66.30           C  
ATOM    128  O   HIS A  34      15.609  20.907  21.908  1.00 64.97           O  
ATOM    129  CB  HIS A  34      14.733  21.923  19.061  1.00 64.30           C  
ATOM    130  CG  HIS A  34      15.405  22.791  18.055  1.00 57.42           C  
ATOM    131  ND1 HIS A  34      16.182  23.871  18.411  1.00 58.81           N  
ATOM    132  CD2 HIS A  34      15.499  22.686  16.711  1.00 56.95           C  
ATOM    133  CE1 HIS A  34      16.727  24.395  17.330  1.00 58.03           C  
ATOM    134  NE2 HIS A  34      16.329  23.694  16.285  1.00 60.50           N  
ATOM    135  N   GLU A  35      14.310  19.334  20.965  1.00 66.72           N  
ATOM    136  CA  GLU A  35      13.887  18.828  22.262  1.00 71.49           C  
ATOM    137  C   GLU A  35      14.949  17.837  22.749  1.00 75.43           C  
ATOM    138  O   GLU A  35      15.335  17.831  23.930  1.00 74.34           O  
ATOM    139  CB  GLU A  35      12.523  18.136  22.186  1.00 69.09           C  
ATOM    140  CG  GLU A  35      12.185  17.392  23.482  1.00 73.38           C  
ATOM    141  CD  GLU A  35      10.718  17.040  23.623  1.00 74.72           C  
ATOM    142  OE1 GLU A  35      10.096  16.687  22.599  1.00 78.33           O  
ATOM    143  OE2 GLU A  35      10.193  17.099  24.759  1.00 71.62           O  
ATOM    144  N   ALA A  36      15.427  17.014  21.819  1.00 77.61           N  
ATOM    145  CA  ALA A  36      16.448  16.022  22.113  1.00 78.81           C  
ATOM    146  C   ALA A  36      17.684  16.660  22.768  1.00 79.97           C  
ATOM    147  O   ALA A  36      18.055  16.301  23.886  1.00 81.22           O  
ATOM    148  CB  ALA A  36      16.837  15.302  20.834  1.00 79.61           C  
ATOM    149  N   GLU A  37      18.316  17.604  22.080  1.00 78.45           N  
ATOM    150  CA  GLU A  37      19.495  18.264  22.624  1.00 78.69           C  
ATOM    151  C   GLU A  37      19.360  18.555  24.114  1.00 80.00           C  
ATOM    152  O   GLU A  37      20.232  18.205  24.901  1.00 78.37           O  
ATOM    153  CB  GLU A  37      19.759  19.564  21.868  1.00 78.52           C  
ATOM    154  CG  GLU A  37      20.672  20.535  22.597  1.00 78.61           C  
ATOM    155  CD  GLU A  37      21.010  21.760  21.761  1.00 78.79           C  
ATOM    156  OE1 GLU A  37      21.826  21.632  20.818  1.00 76.52           O  
ATOM    157  OE2 GLU A  37      20.452  22.848  22.050  1.00 77.27           O  
ATOM    158  N   ASP A  38      18.265  19.195  24.501  1.00 83.89           N  
ATOM    159  CA  ASP A  38      18.039  19.518  25.908  1.00 86.83           C  
ATOM    160  C   ASP A  38      17.742  18.265  26.704  1.00 84.91           C  
ATOM    161  O   ASP A  38      18.292  18.063  27.789  1.00 83.57           O  
ATOM    162  CB  ASP A  38      16.866  20.493  26.067  1.00 93.05           C  
ATOM    163  CG  ASP A  38      16.289  20.489  27.482  1.00 98.05           C  
ATOM    164  OD1 ASP A  38      17.091  20.520  28.445  1.00102.62           O  
ATOM    165  OD2 ASP A  38      15.043  20.461  27.634  1.00 98.28           O  
ATOM    166  N   LEU A  39      16.857  17.438  26.155  1.00 82.27           N  
ATOM    167  CA  LEU A  39      16.457  16.196  26.797  1.00 80.55           C  
ATOM    168  C   LEU A  39      17.689  15.324  26.989  1.00 78.01           C  
ATOM    169  O   LEU A  39      17.793  14.583  27.966  1.00 79.49           O  
ATOM    170  CB  LEU A  39      15.419  15.475  25.937  1.00 80.53           C  
ATOM    171  CG  LEU A  39      14.315  14.759  26.716  1.00 79.65           C  
ATOM    172  CD1 LEU A  39      14.902  13.615  27.519  1.00 81.45           C  
ATOM    173  CD2 LEU A  39      13.622  15.763  27.632  1.00 79.89           C  
ATOM    174  N   PHE A  40      18.616  15.421  26.044  1.00 74.12           N  
ATOM    175  CA  PHE A  40      19.865  14.680  26.101  1.00 70.66           C  
ATOM    176  C   PHE A  40      20.667  15.280  27.234  1.00 70.35           C  
ATOM    177  O   PHE A  40      20.902  14.633  28.247  1.00 71.25           O  
ATOM    178  CB  PHE A  40      20.631  14.855  24.804  1.00 68.19           C  
ATOM    179  CG  PHE A  40      21.971  14.196  24.800  1.00 63.75           C  
ATOM    180  CD1 PHE A  40      22.085  12.839  24.980  1.00 61.22           C  
ATOM    181  CD2 PHE A  40      23.116  14.930  24.561  1.00 64.52           C  
ATOM    182  CE1 PHE A  40      23.310  12.228  24.915  1.00 59.33           C  
ATOM    183  CE2 PHE A  40      24.341  14.318  24.495  1.00 62.40           C  
ATOM    184  CZ  PHE A  40      24.436  12.966  24.672  1.00 58.95           C  
ATOM    185  N   TYR A  41      21.075  16.531  27.042  1.00 69.19           N  
ATOM    186  CA  TYR A  41      21.839  17.291  28.028  1.00 66.92           C  
ATOM    187  C   TYR A  41      21.276  17.082  29.432  1.00 67.65           C  
ATOM    188  O   TYR A  41      21.982  17.203  30.424  1.00 65.30           O  
ATOM    189  CB  TYR A  41      21.775  18.770  27.673  1.00 64.12           C  
ATOM    190  CG  TYR A  41      22.595  19.673  28.557  1.00 62.32           C  
ATOM    191  CD1 TYR A  41      23.784  20.231  28.095  1.00 61.43           C  
ATOM    192  CD2 TYR A  41      22.171  19.997  29.844  1.00 58.27           C  
ATOM    193  CE1 TYR A  41      24.522  21.086  28.887  1.00 60.02           C  
ATOM    194  CE2 TYR A  41      22.903  20.844  30.640  1.00 55.67           C  
ATOM    195  CZ  TYR A  41      24.077  21.387  30.157  1.00 58.67           C  
ATOM    196  OH  TYR A  41      24.820  22.229  30.948  1.00 59.32           O  
ATOM    197  N   GLN A  42      19.990  16.779  29.518  1.00 71.23           N  
ATOM    198  CA  GLN A  42      19.375  16.556  30.815  1.00 76.03           C  
ATOM    199  C   GLN A  42      19.943  15.254  31.365  1.00 76.08           C  
ATOM    200  O   GLN A  42      20.129  15.110  32.569  1.00 77.89           O  
ATOM    201  CB  GLN A  42      17.850  16.447  30.675  1.00 80.59           C  
ATOM    202  CG  GLN A  42      17.036  17.344  31.621  1.00 82.26           C  
ATOM    203  CD  GLN A  42      16.857  18.768  31.099  1.00 84.42           C  
ATOM    204  OE1 GLN A  42      15.755  19.326  31.158  1.00 83.26           O  
ATOM    205  NE2 GLN A  42      17.941  19.363  30.593  1.00 82.94           N  
ATOM    206  N   SER A  43      20.210  14.307  30.471  1.00 75.23           N  
ATOM    207  CA  SER A  43      20.769  13.016  30.857  1.00 73.98           C  
ATOM    208  C   SER A  43      22.295  13.167  31.010  1.00 74.20           C  
ATOM    209  O   SER A  43      22.842  12.888  32.075  1.00 75.56           O  
ATOM    210  CB  SER A  43      20.430  11.958  29.797  1.00 71.96           C  
ATOM    211  OG  SER A  43      20.515  10.646  30.330  1.00 68.20           O  
ATOM    212  N   SER A  44      22.976  13.627  29.958  1.00 72.18           N  
ATOM    213  CA  SER A  44      24.427  13.828  30.007  1.00 70.33           C  
ATOM    214  C   SER A  44      24.865  14.502  31.312  1.00 70.58           C  
ATOM    215  O   SER A  44      25.893  14.154  31.890  1.00 72.72           O  
ATOM    216  CB  SER A  44      24.893  14.694  28.830  1.00 68.53           C  
ATOM    217  OG  SER A  44      24.616  14.084  27.586  1.00 70.69           O  
ATOM    218  N   LEU A  45      24.078  15.468  31.774  1.00 68.97           N  
ATOM    219  CA  LEU A  45      24.397  16.189  32.996  1.00 65.91           C  
ATOM    220  C   LEU A  45      24.276  15.318  34.224  1.00 63.27           C  
ATOM    221  O   LEU A  45      25.150  15.337  35.075  1.00 65.39           O  
ATOM    222  CB  LEU A  45      23.486  17.405  33.158  1.00 69.96           C  
ATOM    223  CG  LEU A  45      24.179  18.770  33.139  1.00 73.57           C  
ATOM    224  CD1 LEU A  45      23.201  19.837  33.632  1.00 71.61           C  
ATOM    225  CD2 LEU A  45      25.432  18.729  34.025  1.00 74.29           C  
ATOM    226  N   ALA A  46      23.183  14.570  34.328  1.00 58.57           N  
ATOM    227  CA  ALA A  46      22.974  13.699  35.473  1.00 56.64           C  
ATOM    228  C   ALA A  46      23.941  12.546  35.344  1.00 58.45           C  
ATOM    229  O   ALA A  46      24.566  12.120  36.312  1.00 59.70           O  
ATOM    230  CB  ALA A  46      21.566  13.185  35.480  1.00 55.84           C  
ATOM    231  N   SER A  47      24.050  12.053  34.118  1.00 59.74           N  
ATOM    232  CA  SER A  47      24.929  10.953  33.772  1.00 59.50           C  
ATOM    233  C   SER A  47      26.345  11.320  34.175  1.00 62.03           C  
ATOM    234  O   SER A  47      27.159  10.457  34.491  1.00 66.75           O  
ATOM    235  CB  SER A  47      24.859  10.712  32.267  1.00 58.29           C  
ATOM    236  OG  SER A  47      25.731   9.682  31.861  1.00 63.43           O  
ATOM    237  N   TRP A  48      26.638  12.613  34.168  1.00 60.71           N  
ATOM    238  CA  TRP A  48      27.959  13.081  34.538  1.00 59.71           C  
ATOM    239  C   TRP A  48      28.148  13.139  36.043  1.00 61.26           C  
ATOM    240  O   TRP A  48      29.238  12.880  36.537  1.00 62.54           O  
ATOM    241  CB  TRP A  48      28.212  14.448  33.912  1.00 57.40           C  
ATOM    242  CG  TRP A  48      29.330  15.224  34.521  1.00 53.63           C  
ATOM    243  CD1 TRP A  48      29.280  15.961  35.664  1.00 53.33           C  
ATOM    244  CD2 TRP A  48      30.637  15.423  33.973  1.00 49.11           C  
ATOM    245  NE1 TRP A  48      30.468  16.620  35.853  1.00 53.53           N  
ATOM    246  CE2 TRP A  48      31.318  16.306  34.827  1.00 48.58           C  
ATOM    247  CE3 TRP A  48      31.290  14.946  32.845  1.00 46.86           C  
ATOM    248  CZ2 TRP A  48      32.619  16.725  34.587  1.00 45.84           C  
ATOM    249  CZ3 TRP A  48      32.584  15.363  32.607  1.00 51.59           C  
ATOM    250  CH2 TRP A  48      33.235  16.246  33.474  1.00 48.08           C  
ATOM    251  N   ASN A  49      27.095  13.476  36.777  1.00 62.92           N  
ATOM    252  CA  ASN A  49      27.214  13.537  38.227  1.00 67.57           C  
ATOM    253  C   ASN A  49      27.616  12.166  38.749  1.00 68.41           C  
ATOM    254  O   ASN A  49      28.290  12.046  39.773  1.00 65.13           O  
ATOM    255  CB  ASN A  49      25.897  13.982  38.871  1.00 70.12           C  
ATOM    256  CG  ASN A  49      25.722  15.499  38.866  1.00 75.71           C  
ATOM    257  OD1 ASN A  49      24.762  16.020  39.434  1.00 79.40           O  
ATOM    258  ND2 ASN A  49      26.651  16.213  38.224  1.00 76.41           N  
ATOM    259  N   TYR A  50      27.204  11.131  38.025  1.00 71.81           N  
ATOM    260  CA  TYR A  50      27.526   9.760  38.399  1.00 73.49           C  
ATOM    261  C   TYR A  50      29.007   9.492  38.183  1.00 73.00           C  
ATOM    262  O   TYR A  50      29.748   9.243  39.126  1.00 74.17           O  
ATOM    263  CB  TYR A  50      26.730   8.768  37.559  1.00 72.44           C  
ATOM    264  CG  TYR A  50      27.117   7.336  37.822  1.00 73.67           C  
ATOM    265  CD1 TYR A  50      26.673   6.678  38.954  1.00 75.59           C  
ATOM    266  CD2 TYR A  50      27.913   6.637  36.930  1.00 73.37           C  
ATOM    267  CE1 TYR A  50      27.002   5.357  39.192  1.00 78.50           C  
ATOM    268  CE2 TYR A  50      28.252   5.318  37.158  1.00 77.06           C  
ATOM    269  CZ  TYR A  50      27.791   4.677  38.293  1.00 79.34           C  
ATOM    270  OH  TYR A  50      28.112   3.351  38.530  1.00 80.18           O  
ATOM    271  N   ASN A  51      29.436   9.550  36.930  1.00 71.45           N  
ATOM    272  CA  ASN A  51      30.827   9.293  36.609  1.00 70.20           C  
ATOM    273  C   ASN A  51      31.784  10.226  37.321  1.00 69.83           C  
ATOM    274  O   ASN A  51      32.987  10.165  37.097  1.00 71.68           O  
ATOM    275  CB  ASN A  51      31.045   9.378  35.101  1.00 67.06           C  
ATOM    276  CG  ASN A  51      30.307   8.304  34.359  1.00 65.83           C  
ATOM    277  OD1 ASN A  51      29.090   8.208  34.451  1.00 64.91           O  
ATOM    278  ND2 ASN A  51      31.038   7.478  33.623  1.00 68.62           N  
ATOM    279  N   THR A  52      31.261  11.092  38.177  1.00 69.38           N  
ATOM    280  CA  THR A  52      32.123  12.012  38.903  1.00 72.58           C  
ATOM    281  C   THR A  52      31.950  11.836  40.408  1.00 73.01           C  
ATOM    282  O   THR A  52      32.711  12.387  41.196  1.00 72.83           O  
ATOM    283  CB  THR A  52      31.839  13.482  38.510  1.00 74.71           C  
ATOM    284  OG1 THR A  52      32.215  13.701  37.144  1.00 75.15           O  
ATOM    285  CG2 THR A  52      32.634  14.426  39.385  1.00 76.84           C  
ATOM    286  N   ASN A  53      30.949  11.054  40.796  1.00 73.69           N  
ATOM    287  CA  ASN A  53      30.665  10.777  42.200  1.00 75.04           C  
ATOM    288  C   ASN A  53      29.687   9.621  42.247  1.00 76.28           C  
ATOM    289  O   ASN A  53      28.481   9.818  42.121  1.00 75.53           O  
ATOM    290  CB  ASN A  53      30.034  11.992  42.876  1.00 77.61           C  
ATOM    291  CG  ASN A  53      29.766  11.765  44.355  1.00 78.35           C  
ATOM    292  OD1 ASN A  53      29.139  12.596  45.017  1.00 78.83           O  
ATOM    293  ND2 ASN A  53      30.249  10.638  44.883  1.00 78.39           N  
ATOM    294  N   ILE A  54      30.204   8.415  42.432  1.00 79.00           N  
ATOM    295  CA  ILE A  54      29.349   7.244  42.457  1.00 83.78           C  
ATOM    296  C   ILE A  54      28.601   7.095  43.778  1.00 87.66           C  
ATOM    297  O   ILE A  54      28.639   6.046  44.418  1.00 89.67           O  
ATOM    298  CB  ILE A  54      30.161   5.961  42.147  1.00 83.49           C  
ATOM    299  CG1 ILE A  54      31.017   6.185  40.896  1.00 80.37           C  
ATOM    300  CG2 ILE A  54      29.218   4.784  41.895  1.00 82.91           C  
ATOM    301  CD1 ILE A  54      31.731   4.956  40.414  1.00 79.63           C  
ATOM    302  N   THR A  55      27.922   8.164  44.182  1.00 92.37           N  
ATOM    303  CA  THR A  55      27.129   8.159  45.407  1.00 95.47           C  
ATOM    304  C   THR A  55      26.111   7.040  45.236  1.00 98.18           C  
ATOM    305  O   THR A  55      26.373   5.871  45.530  1.00 98.53           O  
ATOM    306  CB  THR A  55      26.337   9.485  45.578  1.00 94.78           C  
ATOM    307  OG1 THR A  55      27.239  10.594  45.527  1.00 96.29           O  
ATOM    308  CG2 THR A  55      25.587   9.510  46.910  1.00 94.44           C  
ATOM    309  N   GLU A  56      24.948   7.434  44.735  1.00 99.88           N  
ATOM    310  CA  GLU A  56      23.834   6.541  44.480  1.00101.60           C  
ATOM    311  C   GLU A  56      22.700   7.496  44.177  1.00103.19           C  
ATOM    312  O   GLU A  56      21.983   7.342  43.193  1.00104.14           O  
ATOM    313  CB  GLU A  56      23.494   5.714  45.712  1.00101.12           C  
ATOM    314  CG  GLU A  56      22.704   4.471  45.372  1.00101.08           C  
ATOM    315  CD  GLU A  56      21.690   4.720  44.276  1.00100.90           C  
ATOM    316  OE1 GLU A  56      20.839   5.619  44.449  1.00102.12           O  
ATOM    317  OE2 GLU A  56      21.744   4.021  43.240  1.00 99.46           O  
ATOM    318  N   GLU A  57      22.542   8.488  45.043  1.00104.26           N  
ATOM    319  CA  GLU A  57      21.526   9.500  44.831  1.00105.69           C  
ATOM    320  C   GLU A  57      21.738   9.949  43.395  1.00105.51           C  
ATOM    321  O   GLU A  57      20.792  10.226  42.665  1.00105.73           O  
ATOM    322  CB  GLU A  57      21.761  10.681  45.767  1.00107.00           C  
ATOM    323  CG  GLU A  57      21.809  10.279  47.211  1.00110.97           C  
ATOM    324  CD  GLU A  57      20.546   9.567  47.629  1.00113.05           C  
ATOM    325  OE1 GLU A  57      19.508  10.243  47.805  1.00113.02           O  
ATOM    326  OE2 GLU A  57      20.587   8.327  47.763  1.00116.19           O  
ATOM    327  N   ASN A  58      23.008   9.996  43.006  1.00104.67           N  
ATOM    328  CA  ASN A  58      23.408  10.406  41.673  1.00103.05           C  
ATOM    329  C   ASN A  58      23.083   9.324  40.657  1.00101.83           C  
ATOM    330  O   ASN A  58      22.784   9.620  39.499  1.00102.04           O  
ATOM    331  CB  ASN A  58      24.900  10.709  41.669  1.00104.38           C  
ATOM    332  CG  ASN A  58      25.275  11.746  42.701  1.00106.50           C  
ATOM    333  OD1 ASN A  58      24.991  11.587  43.888  1.00108.69           O  
ATOM    334  ND2 ASN A  58      25.912  12.821  42.256  1.00108.69           N  
ATOM    335  N   VAL A  59      23.148   8.070  41.089  1.00 99.45           N  
ATOM    336  CA  VAL A  59      22.834   6.958  40.204  1.00 99.35           C  
ATOM    337  C   VAL A  59      21.418   7.127  39.678  1.00100.73           C  
ATOM    338  O   VAL A  59      21.207   7.259  38.470  1.00102.73           O  
ATOM    339  CB  VAL A  59      22.910   5.612  40.935  1.00 99.07           C  
ATOM    340  CG1 VAL A  59      22.062   4.579  40.209  1.00 97.37           C  
ATOM    341  CG2 VAL A  59      24.347   5.150  41.012  1.00 99.73           C  
ATOM    342  N   GLN A  60      20.452   7.127  40.596  1.00 99.68           N  
ATOM    343  CA  GLN A  60      19.044   7.277  40.246  1.00 96.99           C  
ATOM    344  C   GLN A  60      18.814   8.493  39.367  1.00 94.55           C  
ATOM    345  O   GLN A  60      18.293   8.368  38.262  1.00 94.40           O  
ATOM    346  CB  GLN A  60      18.195   7.383  41.512  1.00 99.16           C  
ATOM    347  CG  GLN A  60      18.236   6.132  42.357  1.00101.25           C  
ATOM    348  CD  GLN A  60      17.814   4.909  41.570  1.00104.04           C  
ATOM    349  OE1 GLN A  60      16.624   4.691  41.323  1.00104.58           O  
ATOM    350  NE2 GLN A  60      18.792   4.109  41.152  1.00104.73           N  
ATOM    351  N   ASN A  61      19.201   9.665  39.858  1.00 92.40           N  
ATOM    352  CA  ASN A  61      19.042  10.893  39.093  1.00 92.57           C  
ATOM    353  C   ASN A  61      19.425  10.602  37.650  1.00 92.23           C  
ATOM    354  O   ASN A  61      18.733  11.010  36.715  1.00 91.41           O  
ATOM    355  CB  ASN A  61      19.961  11.990  39.633  1.00 95.06           C  
ATOM    356  CG  ASN A  61      19.691  12.324  41.085  1.00 96.87           C  
ATOM    357  OD1 ASN A  61      20.323  13.219  41.656  1.00 96.92           O  
ATOM    358  ND2 ASN A  61      18.751  11.607  41.694  1.00 97.27           N  
ATOM    359  N   MET A  62      20.538   9.888  37.487  1.00 91.07           N  
ATOM    360  CA  MET A  62      21.046   9.527  36.174  1.00 89.70           C  
ATOM    361  C   MET A  62      20.105   8.579  35.447  1.00 91.18           C  
ATOM    362  O   MET A  62      19.541   8.942  34.417  1.00 93.59           O  
ATOM    363  CB  MET A  62      22.424   8.869  36.291  1.00 88.06           C  
ATOM    364  CG  MET A  62      23.024   8.439  34.944  1.00 83.82           C  
ATOM    365  SD  MET A  62      24.476   7.359  35.070  1.00 73.22           S  
ATOM    366  CE  MET A  62      23.710   5.783  35.099  1.00 71.97           C  
ATOM    367  N   ASN A  63      19.925   7.367  35.971  1.00 91.03           N  
ATOM    368  CA  ASN A  63      19.052   6.409  35.300  1.00 90.98           C  
ATOM    369  C   ASN A  63      17.577   6.775  35.422  1.00 88.51           C  
ATOM    370  O   ASN A  63      16.699   5.914  35.477  1.00 86.31           O  
ATOM    371  CB  ASN A  63      19.312   4.975  35.792  1.00 94.33           C  
ATOM    372  CG  ASN A  63      18.952   4.776  37.240  1.00 97.62           C  
ATOM    373  OD1 ASN A  63      17.838   5.091  37.662  1.00101.30           O  
ATOM    374  ND2 ASN A  63      19.888   4.236  38.013  1.00 97.24           N  
ATOM    375  N   ASN A  64      17.335   8.080  35.474  1.00 88.23           N  
ATOM    376  CA  ASN A  64      16.001   8.667  35.530  1.00 87.43           C  
ATOM    377  C   ASN A  64      16.021   9.638  34.354  1.00 87.41           C  
ATOM    378  O   ASN A  64      15.055   9.747  33.609  1.00 87.90           O  
ATOM    379  CB  ASN A  64      15.775   9.432  36.844  1.00 86.28           C  
ATOM    380  CG  ASN A  64      15.236   8.543  37.966  1.00 86.84           C  
ATOM    381  OD1 ASN A  64      15.638   7.386  38.107  1.00 87.84           O  
ATOM    382  ND2 ASN A  64      14.337   9.091  38.779  1.00 83.44           N  
ATOM    383  N   ALA A  65      17.152  10.315  34.183  1.00 87.34           N  
ATOM    384  CA  ALA A  65      17.337  11.274  33.100  1.00 89.01           C  
ATOM    385  C   ALA A  65      17.365  10.576  31.745  1.00 90.43           C  
ATOM    386  O   ALA A  65      16.803  11.073  30.765  1.00 91.63           O  
ATOM    387  CB  ALA A  65      18.636  12.053  33.304  1.00 87.78           C  
ATOM    388  N   GLY A  66      18.034   9.428  31.694  1.00 90.74           N  
ATOM    389  CA  GLY A  66      18.125   8.681  30.455  1.00 91.80           C  
ATOM    390  C   GLY A  66      16.948   7.742  30.282  1.00 93.28           C  
ATOM    391  O   GLY A  66      16.660   7.281  29.177  1.00 93.25           O  
ATOM    392  N   ASP A  67      16.264   7.451  31.383  1.00 94.09           N  
ATOM    393  CA  ASP A  67      15.116   6.565  31.341  1.00 94.29           C  
ATOM    394  C   ASP A  67      13.967   7.291  30.649  1.00 94.90           C  
ATOM    395  O   ASP A  67      13.099   6.663  30.043  1.00 96.71           O  
ATOM    396  CB  ASP A  67      14.715   6.162  32.753  1.00 95.28           C  
ATOM    397  CG  ASP A  67      13.964   4.852  32.788  1.00 98.47           C  
ATOM    398  OD1 ASP A  67      13.007   4.695  31.996  1.00 99.58           O  
ATOM    399  OD2 ASP A  67      14.327   3.980  33.610  1.00 99.60           O  
ATOM    400  N   LYS A  68      13.964   8.619  30.749  1.00 94.63           N  
ATOM    401  CA  LYS A  68      12.942   9.437  30.104  1.00 92.87           C  
ATOM    402  C   LYS A  68      13.385   9.677  28.682  1.00 90.56           C  
ATOM    403  O   LYS A  68      12.572   9.678  27.765  1.00 91.11           O  
ATOM    404  CB  LYS A  68      12.781  10.786  30.800  1.00 95.74           C  
ATOM    405  CG  LYS A  68      12.343  11.910  29.855  1.00100.91           C  
ATOM    406  CD  LYS A  68      11.061  11.578  29.058  1.00106.74           C  
ATOM    407  CE  LYS A  68       9.772  11.655  29.891  1.00108.16           C  
ATOM    408  NZ  LYS A  68       9.337  13.056  30.169  1.00106.73           N  
ATOM    409  N   TRP A  69      14.680   9.911  28.503  1.00 88.62           N  
ATOM    410  CA  TRP A  69      15.208  10.119  27.165  1.00 87.39           C  
ATOM    411  C   TRP A  69      14.946   8.811  26.435  1.00 86.88           C  
ATOM    412  O   TRP A  69      14.755   8.773  25.221  1.00 86.21           O  
ATOM    413  CB  TRP A  69      16.708  10.421  27.215  1.00 84.79           C  
ATOM    414  CG  TRP A  69      17.382  10.200  25.907  1.00 83.39           C  
ATOM    415  CD1 TRP A  69      17.752   9.005  25.377  1.00 83.16           C  
ATOM    416  CD2 TRP A  69      17.706  11.192  24.926  1.00 83.91           C  
ATOM    417  NE1 TRP A  69      18.280   9.185  24.126  1.00 84.62           N  
ATOM    418  CE2 TRP A  69      18.264  10.519  23.824  1.00 83.37           C  
ATOM    419  CE3 TRP A  69      17.576  12.581  24.871  1.00 83.57           C  
ATOM    420  CZ2 TRP A  69      18.693  11.186  22.679  1.00 82.02           C  
ATOM    421  CZ3 TRP A  69      18.002  13.240  23.734  1.00 82.86           C  
ATOM    422  CH2 TRP A  69      18.553  12.542  22.653  1.00 82.12           C  
ATOM    423  N   SER A  70      14.937   7.733  27.206  1.00 87.24           N  
ATOM    424  CA  SER A  70      14.670   6.408  26.676  1.00 87.09           C  
ATOM    425  C   SER A  70      13.248   6.500  26.124  1.00 85.37           C  
ATOM    426  O   SER A  70      13.021   6.368  24.921  1.00 82.59           O  
ATOM    427  CB  SER A  70      14.753   5.381  27.817  1.00 88.22           C  
ATOM    428  OG  SER A  70      14.676   4.045  27.353  1.00 89.96           O  
ATOM    429  N   ALA A  71      12.306   6.762  27.028  1.00 85.40           N  
ATOM    430  CA  ALA A  71      10.890   6.900  26.700  1.00 84.72           C  
ATOM    431  C   ALA A  71      10.643   7.964  25.619  1.00 83.86           C  
ATOM    432  O   ALA A  71       9.721   7.842  24.816  1.00 83.33           O  
ATOM    433  CB  ALA A  71      10.101   7.237  27.971  1.00 83.85           C  
ATOM    434  N   PHE A  72      11.461   9.009  25.606  1.00 83.16           N  
ATOM    435  CA  PHE A  72      11.328  10.061  24.609  1.00 82.22           C  
ATOM    436  C   PHE A  72      11.676   9.520  23.232  1.00 83.86           C  
ATOM    437  O   PHE A  72      10.869   9.551  22.310  1.00 84.39           O  
ATOM    438  CB  PHE A  72      12.275  11.215  24.920  1.00 79.49           C  
ATOM    439  CG  PHE A  72      12.645  12.029  23.711  1.00 78.52           C  
ATOM    440  CD1 PHE A  72      11.686  12.746  23.020  1.00 76.26           C  
ATOM    441  CD2 PHE A  72      13.954  12.073  23.260  1.00 79.72           C  
ATOM    442  CE1 PHE A  72      12.026  13.492  21.906  1.00 76.85           C  
ATOM    443  CE2 PHE A  72      14.298  12.822  22.140  1.00 78.66           C  
ATOM    444  CZ  PHE A  72      13.332  13.530  21.466  1.00 77.10           C  
ATOM    445  N   LEU A  73      12.901   9.025  23.110  1.00 86.68           N  
ATOM    446  CA  LEU A  73      13.402   8.492  21.855  1.00 87.85           C  
ATOM    447  C   LEU A  73      12.539   7.334  21.392  1.00 88.71           C  
ATOM    448  O   LEU A  73      12.244   7.204  20.208  1.00 88.31           O  
ATOM    449  CB  LEU A  73      14.854   8.043  22.035  1.00 87.43           C  
ATOM    450  CG  LEU A  73      15.740   8.190  20.799  1.00 88.23           C  
ATOM    451  CD1 LEU A  73      15.502   9.560  20.173  1.00 87.79           C  
ATOM    452  CD2 LEU A  73      17.203   8.005  21.182  1.00 86.88           C  
ATOM    453  N   LYS A  74      12.134   6.492  22.331  1.00 91.42           N  
ATOM    454  CA  LYS A  74      11.287   5.354  22.001  1.00 95.61           C  
ATOM    455  C   LYS A  74      10.043   5.863  21.288  1.00 96.87           C  
ATOM    456  O   LYS A  74       9.789   5.525  20.130  1.00 97.16           O  
ATOM    457  CB  LYS A  74      10.889   4.599  23.281  1.00 96.85           C  
ATOM    458  CG  LYS A  74       9.570   3.827  23.185  1.00 96.86           C  
ATOM    459  CD  LYS A  74       9.600   2.745  22.112  1.00 97.39           C  
ATOM    460  CE  LYS A  74       8.222   2.117  21.928  1.00 97.35           C  
ATOM    461  NZ  LYS A  74       7.661   1.571  23.203  1.00 95.57           N  
ATOM    462  N   GLU A  75       9.277   6.684  21.997  1.00 97.80           N  
ATOM    463  CA  GLU A  75       8.053   7.261  21.474  1.00 98.13           C  
ATOM    464  C   GLU A  75       8.299   7.907  20.113  1.00 97.40           C  
ATOM    465  O   GLU A  75       7.638   7.565  19.135  1.00 98.54           O  
ATOM    466  CB  GLU A  75       7.509   8.272  22.491  1.00101.06           C  
ATOM    467  CG  GLU A  75       6.352   9.143  22.033  1.00106.36           C  
ATOM    468  CD  GLU A  75       6.820  10.448  21.403  1.00110.24           C  
ATOM    469  OE1 GLU A  75       7.243  10.438  20.226  1.00111.84           O  
ATOM    470  OE2 GLU A  75       6.775  11.489  22.095  1.00112.42           O  
ATOM    471  N   GLN A  76       9.262   8.818  20.033  1.00 95.59           N  
ATOM    472  CA  GLN A  76       9.539   9.476  18.765  1.00 95.17           C  
ATOM    473  C   GLN A  76      10.038   8.533  17.682  1.00 95.99           C  
ATOM    474  O   GLN A  76      10.367   8.967  16.582  1.00 95.24           O  
ATOM    475  CB  GLN A  76      10.536  10.619  18.951  1.00 94.31           C  
ATOM    476  CG  GLN A  76       9.870  11.951  19.233  1.00 94.82           C  
ATOM    477  CD  GLN A  76      10.561  13.106  18.534  1.00 96.95           C  
ATOM    478  OE1 GLN A  76      10.800  13.057  17.327  1.00 97.99           O  
ATOM    479  NE2 GLN A  76      10.877  14.157  19.285  1.00 96.78           N  
ATOM    480  N   SER A  77      10.098   7.244  17.988  1.00 98.05           N  
ATOM    481  CA  SER A  77      10.546   6.272  17.001  1.00101.08           C  
ATOM    482  C   SER A  77       9.333   5.874  16.182  1.00103.02           C  
ATOM    483  O   SER A  77       9.412   5.720  14.966  1.00103.97           O  
ATOM    484  CB  SER A  77      11.137   5.035  17.681  1.00101.13           C  
ATOM    485  OG  SER A  77      11.579   4.090  16.721  1.00 99.16           O  
ATOM    486  N   THR A  78       8.205   5.711  16.862  1.00104.68           N  
ATOM    487  CA  THR A  78       6.968   5.341  16.197  1.00106.81           C  
ATOM    488  C   THR A  78       6.443   6.564  15.468  1.00107.54           C  
ATOM    489  O   THR A  78       6.042   6.479  14.313  1.00108.12           O  
ATOM    490  CB  THR A  78       5.907   4.883  17.205  1.00108.63           C  
ATOM    491  OG1 THR A  78       5.446   6.012  17.960  1.00109.79           O  
ATOM    492  CG2 THR A  78       6.497   3.850  18.157  1.00109.00           C  
ATOM    493  N   LEU A  79       6.458   7.704  16.151  1.00109.36           N  
ATOM    494  CA  LEU A  79       5.990   8.964  15.576  1.00111.57           C  
ATOM    495  C   LEU A  79       6.937   9.392  14.457  1.00114.16           C  
ATOM    496  O   LEU A  79       6.800  10.472  13.886  1.00113.88           O  
ATOM    497  CB  LEU A  79       5.929  10.041  16.670  1.00109.19           C  
ATOM    498  CG  LEU A  79       5.292  11.409  16.391  1.00107.77           C  
ATOM    499  CD1 LEU A  79       4.794  11.994  17.703  1.00107.92           C  
ATOM    500  CD2 LEU A  79       6.277  12.353  15.726  1.00105.16           C  
ATOM    501  N   ALA A  80       7.890   8.521  14.142  1.00118.30           N  
ATOM    502  CA  ALA A  80       8.881   8.790  13.106  1.00122.01           C  
ATOM    503  C   ALA A  80       8.707   7.890  11.893  1.00124.15           C  
ATOM    504  O   ALA A  80       8.714   8.359  10.757  1.00125.07           O  
ATOM    505  CB  ALA A  80      10.283   8.618  13.678  1.00122.05           C  
ATOM    506  N   GLN A  81       8.567   6.593  12.139  1.00126.78           N  
ATOM    507  CA  GLN A  81       8.391   5.621  11.069  1.00129.68           C  
ATOM    508  C   GLN A  81       7.055   5.831  10.356  1.00131.99           C  
ATOM    509  O   GLN A  81       6.709   5.091   9.432  1.00132.22           O  
ATOM    510  CB  GLN A  81       8.479   4.212  11.650  1.00129.16           C  
ATOM    511  CG  GLN A  81       7.710   4.065  12.941  1.00130.70           C  
ATOM    512  CD  GLN A  81       8.177   2.887  13.757  1.00132.39           C  
ATOM    513  OE1 GLN A  81       9.363   2.765  14.069  1.00133.51           O  
ATOM    514  NE2 GLN A  81       7.246   2.011  14.117  1.00133.35           N  
ATOM    515  N   MET A  82       6.311   6.846  10.794  1.00134.47           N  
ATOM    516  CA  MET A  82       5.023   7.189  10.194  1.00136.08           C  
ATOM    517  C   MET A  82       5.300   7.720   8.788  1.00136.75           C  
ATOM    518  O   MET A  82       4.383   7.911   7.990  1.00137.76           O  
ATOM    519  CB  MET A  82       4.309   8.256  11.042  1.00136.81           C  
ATOM    520  CG  MET A  82       2.927   8.700  10.534  1.00138.65           C  
ATOM    521  SD  MET A  82       2.927  10.036   9.285  1.00141.72           S  
ATOM    522  CE  MET A  82       2.370  11.459  10.254  1.00140.22           C  
ATOM    523  N   TYR A  83       6.577   7.953   8.495  1.00136.39           N  
ATOM    524  CA  TYR A  83       7.001   8.450   7.191  1.00136.14           C  
ATOM    525  C   TYR A  83       7.613   7.289   6.413  1.00137.86           C  
ATOM    526  O   TYR A  83       8.575   6.671   6.868  1.00137.38           O  
ATOM    527  CB  TYR A  83       8.053   9.553   7.349  1.00133.60           C  
ATOM    528  CG  TYR A  83       7.624  10.757   8.165  1.00130.76           C  
ATOM    529  CD1 TYR A  83       7.237  10.625   9.494  1.00129.77           C  
ATOM    530  CD2 TYR A  83       7.650  12.033   7.619  1.00128.82           C  
ATOM    531  CE1 TYR A  83       6.895  11.726  10.253  1.00127.82           C  
ATOM    532  CE2 TYR A  83       7.308  13.136   8.372  1.00127.04           C  
ATOM    533  CZ  TYR A  83       6.933  12.978   9.686  1.00126.91           C  
ATOM    534  OH  TYR A  83       6.595  14.074  10.440  1.00125.48           O  
ATOM    535  N   PRO A  84       7.068   6.980   5.224  1.00140.11           N  
ATOM    536  CA  PRO A  84       7.606   5.875   4.425  1.00141.73           C  
ATOM    537  C   PRO A  84       9.104   6.018   4.153  1.00143.04           C  
ATOM    538  O   PRO A  84       9.651   7.119   4.201  1.00142.88           O  
ATOM    539  CB  PRO A  84       6.758   5.923   3.151  1.00141.60           C  
ATOM    540  CG  PRO A  84       6.379   7.371   3.047  1.00141.28           C  
ATOM    541  CD  PRO A  84       6.035   7.715   4.473  1.00140.58           C  
ATOM    542  N   LEU A  85       9.757   4.894   3.881  1.00144.67           N  
ATOM    543  CA  LEU A  85      11.191   4.866   3.611  1.00146.78           C  
ATOM    544  C   LEU A  85      11.673   6.030   2.749  1.00148.20           C  
ATOM    545  O   LEU A  85      12.014   7.098   3.260  1.00148.06           O  
ATOM    546  CB  LEU A  85      11.574   3.537   2.942  1.00147.15           C  
ATOM    547  CG  LEU A  85      10.786   3.045   1.720  1.00146.67           C  
ATOM    548  CD1 LEU A  85      11.590   1.979   0.993  1.00145.79           C  
ATOM    549  CD2 LEU A  85       9.429   2.503   2.149  1.00146.71           C  
ATOM    550  N   GLN A  86      11.712   5.805   1.442  1.00150.28           N  
ATOM    551  CA  GLN A  86      12.143   6.816   0.485  1.00152.22           C  
ATOM    552  C   GLN A  86      11.228   8.036   0.513  1.00152.46           C  
ATOM    553  O   GLN A  86      11.048   8.667   1.557  1.00152.69           O  
ATOM    554  CB  GLN A  86      12.158   6.214  -0.923  1.00153.48           C  
ATOM    555  CG  GLN A  86      11.422   4.878  -1.041  1.00155.06           C  
ATOM    556  CD  GLN A  86       9.925   4.974  -0.762  1.00156.21           C  
ATOM    557  OE1 GLN A  86       9.233   3.958  -0.676  1.00156.93           O  
ATOM    558  NE2 GLN A  86       9.421   6.194  -0.628  1.00156.37           N  
ATOM    559  N   GLU A  87      10.655   8.362  -0.643  1.00151.94           N  
ATOM    560  CA  GLU A  87       9.750   9.499  -0.769  1.00151.25           C  
ATOM    561  C   GLU A  87      10.436  10.726  -0.185  1.00150.51           C  
ATOM    562  O   GLU A  87       9.779  11.656   0.286  1.00150.67           O  
ATOM    563  CB  GLU A  87       8.452   9.224  -0.003  1.00151.47           C  
ATOM    564  CG  GLU A  87       7.223   9.922  -0.562  1.00150.23           C  
ATOM    565  CD  GLU A  87       6.667   9.227  -1.795  1.00149.18           C  
ATOM    566  OE1 GLU A  87       7.384   9.142  -2.814  1.00148.93           O  
ATOM    567  OE2 GLU A  87       5.509   8.761  -1.740  1.00148.30           O  
ATOM    568  N   ILE A  88      11.766  10.711  -0.219  1.00149.16           N  
ATOM    569  CA  ILE A  88      12.568  11.800   0.318  1.00147.85           C  
ATOM    570  C   ILE A  88      13.845  12.019  -0.486  1.00147.02           C  
ATOM    571  O   ILE A  88      14.555  11.071  -0.822  1.00146.76           O  
ATOM    572  CB  ILE A  88      12.948  11.514   1.783  1.00147.88           C  
ATOM    573  CG1 ILE A  88      13.556  10.112   1.889  1.00147.77           C  
ATOM    574  CG2 ILE A  88      11.724  11.639   2.676  1.00147.19           C  
ATOM    575  CD1 ILE A  88      13.748   9.633   3.306  1.00147.58           C  
ATOM    576  N   GLN A  89      14.129  13.281  -0.791  1.00146.38           N  
ATOM    577  CA  GLN A  89      15.322  13.639  -1.545  1.00145.70           C  
ATOM    578  C   GLN A  89      16.400  14.179  -0.605  1.00144.65           C  
ATOM    579  O   GLN A  89      16.635  13.596   0.455  1.00144.63           O  
ATOM    580  CB  GLN A  89      14.977  14.666  -2.634  1.00146.98           C  
ATOM    581  CG  GLN A  89      13.967  14.141  -3.662  1.00148.63           C  
ATOM    582  CD  GLN A  89      13.695  15.113  -4.804  1.00149.42           C  
ATOM    583  OE1 GLN A  89      14.597  15.465  -5.565  1.00149.27           O  
ATOM    584  NE2 GLN A  89      12.443  15.546  -4.928  1.00149.51           N  
ATOM    585  N   ASN A  90      17.030  15.294  -0.981  1.00142.94           N  
ATOM    586  CA  ASN A  90      18.115  15.898  -0.196  1.00140.23           C  
ATOM    587  C   ASN A  90      18.741  14.863   0.733  1.00139.69           C  
ATOM    588  O   ASN A  90      18.684  14.993   1.955  1.00139.68           O  
ATOM    589  CB  ASN A  90      17.621  17.106   0.616  1.00137.98           C  
ATOM    590  CG  ASN A  90      18.764  18.020   1.047  1.00135.38           C  
ATOM    591  OD1 ASN A  90      19.797  18.051   0.386  1.00134.60           O  
ATOM    592  ND2 ASN A  90      18.582  18.782   2.124  1.00134.30           N  
ATOM    593  N   LEU A  91      19.316  13.829   0.116  1.00138.48           N  
ATOM    594  CA  LEU A  91      19.977  12.703   0.781  1.00136.17           C  
ATOM    595  C   LEU A  91      20.137  12.775   2.298  1.00134.78           C  
ATOM    596  O   LEU A  91      19.825  11.816   3.000  1.00134.44           O  
ATOM    597  CB  LEU A  91      21.339  12.447   0.122  1.00135.69           C  
ATOM    598  CG  LEU A  91      22.097  13.625  -0.507  1.00135.26           C  
ATOM    599  CD1 LEU A  91      21.352  14.136  -1.737  1.00134.17           C  
ATOM    600  CD2 LEU A  91      22.277  14.731   0.517  1.00134.93           C  
ATOM    601  N   THR A  92      20.636  13.898   2.801  1.00133.32           N  
ATOM    602  CA  THR A  92      20.808  14.079   4.239  1.00131.48           C  
ATOM    603  C   THR A  92      19.498  13.769   4.962  1.00130.17           C  
ATOM    604  O   THR A  92      19.399  12.785   5.694  1.00131.58           O  
ATOM    605  CB  THR A  92      21.219  15.533   4.572  1.00131.62           C  
ATOM    606  OG1 THR A  92      22.566  15.762   4.137  1.00132.07           O  
ATOM    607  CG2 THR A  92      21.104  15.799   6.069  1.00129.42           C  
ATOM    608  N   VAL A  93      18.495  14.613   4.738  1.00127.17           N  
ATOM    609  CA  VAL A  93      17.182  14.461   5.359  1.00123.12           C  
ATOM    610  C   VAL A  93      16.721  13.006   5.456  1.00120.18           C  
ATOM    611  O   VAL A  93      15.940  12.651   6.336  1.00118.41           O  
ATOM    612  CB  VAL A  93      16.121  15.274   4.581  1.00123.08           C  
ATOM    613  CG1 VAL A  93      16.482  16.751   4.597  1.00120.98           C  
ATOM    614  CG2 VAL A  93      16.038  14.778   3.148  1.00123.48           C  
ATOM    615  N   LYS A  94      17.221  12.172   4.552  1.00118.56           N  
ATOM    616  CA  LYS A  94      16.871  10.753   4.501  1.00117.43           C  
ATOM    617  C   LYS A  94      17.661   9.903   5.499  1.00114.35           C  
ATOM    618  O   LYS A  94      17.084   9.188   6.319  1.00112.80           O  
ATOM    619  CB  LYS A  94      17.097  10.232   3.075  1.00119.86           C  
ATOM    620  CG  LYS A  94      16.931   8.731   2.876  1.00119.46           C  
ATOM    621  CD  LYS A  94      17.235   8.366   1.431  1.00119.58           C  
ATOM    622  CE  LYS A  94      17.253   6.868   1.226  1.00121.37           C  
ATOM    623  NZ  LYS A  94      17.701   6.504  -0.147  1.00122.85           N  
ATOM    624  N   LEU A  95      18.983   9.976   5.423  1.00111.53           N  
ATOM    625  CA  LEU A  95      19.821   9.202   6.326  1.00109.23           C  
ATOM    626  C   LEU A  95      19.586   9.617   7.769  1.00106.31           C  
ATOM    627  O   LEU A  95      19.714   8.805   8.687  1.00106.38           O  
ATOM    628  CB  LEU A  95      21.303   9.363   5.955  1.00110.09           C  
ATOM    629  CG  LEU A  95      21.930  10.756   5.849  1.00109.12           C  
ATOM    630  CD1 LEU A  95      22.165  11.338   7.229  1.00108.22           C  
ATOM    631  CD2 LEU A  95      23.248  10.645   5.109  1.00109.62           C  
ATOM    632  N   GLN A  96      19.237  10.884   7.963  1.00102.79           N  
ATOM    633  CA  GLN A  96      18.981  11.391   9.299  1.00 99.47           C  
ATOM    634  C   GLN A  96      17.725  10.686   9.783  1.00 99.01           C  
ATOM    635  O   GLN A  96      17.581  10.370  10.964  1.00 99.99           O  
ATOM    636  CB  GLN A  96      18.773  12.909   9.267  1.00 95.53           C  
ATOM    637  CG  GLN A  96      19.333  13.611  10.494  1.00 93.74           C  
ATOM    638  CD  GLN A  96      19.275  15.127  10.406  1.00 92.94           C  
ATOM    639  OE1 GLN A  96      19.658  15.726   9.397  1.00 90.16           O  
ATOM    640  NE2 GLN A  96      18.809  15.757  11.478  1.00 92.85           N  
ATOM    641  N   LEU A  97      16.828  10.417   8.843  1.00 97.13           N  
ATOM    642  CA  LEU A  97      15.581   9.741   9.147  1.00 95.99           C  
ATOM    643  C   LEU A  97      15.903   8.320   9.594  1.00 94.87           C  
ATOM    644  O   LEU A  97      15.363   7.836  10.586  1.00 93.37           O  
ATOM    645  CB  LEU A  97      14.695   9.714   7.897  1.00 97.59           C  
ATOM    646  CG  LEU A  97      13.172   9.805   8.039  1.00 97.41           C  
ATOM    647  CD1 LEU A  97      12.634   8.586   8.753  1.00 97.28           C  
ATOM    648  CD2 LEU A  97      12.813  11.078   8.791  1.00 96.61           C  
ATOM    649  N   GLN A  98      16.802   7.672   8.856  1.00 95.54           N  
ATOM    650  CA  GLN A  98      17.226   6.297   9.130  1.00 95.35           C  
ATOM    651  C   GLN A  98      17.368   5.978  10.606  1.00 95.35           C  
ATOM    652  O   GLN A  98      16.714   5.071  11.122  1.00 94.25           O  
ATOM    653  CB  GLN A  98      18.560   6.003   8.440  1.00 94.45           C  
ATOM    654  CG  GLN A  98      18.507   6.092   6.927  1.00 95.67           C  
ATOM    655  CD  GLN A  98      19.794   5.634   6.271  1.00 94.41           C  
ATOM    656  OE1 GLN A  98      20.277   4.538   6.540  1.00 96.50           O  
ATOM    657  NE2 GLN A  98      20.350   6.467   5.400  1.00 91.21           N  
ATOM    658  N   ALA A  99      18.238   6.727  11.273  1.00 95.95           N  
ATOM    659  CA  ALA A  99      18.492   6.533  12.691  1.00 97.65           C  
ATOM    660  C   ALA A  99      17.199   6.376  13.485  1.00100.16           C  
ATOM    661  O   ALA A  99      16.902   5.293  14.002  1.00101.57           O  
ATOM    662  CB  ALA A  99      19.298   7.704  13.232  1.00 95.06           C  
ATOM    663  N   LEU A 100      16.431   7.461  13.562  1.00101.10           N  
ATOM    664  CA  LEU A 100      15.170   7.497  14.300  1.00100.50           C  
ATOM    665  C   LEU A 100      14.193   6.350  14.050  1.00102.11           C  
ATOM    666  O   LEU A 100      13.625   5.804  15.002  1.00101.44           O  
ATOM    667  CB  LEU A 100      14.462   8.827  14.041  1.00 99.03           C  
ATOM    668  CG  LEU A 100      14.989  10.034  14.819  1.00 97.88           C  
ATOM    669  CD1 LEU A 100      14.202  11.283  14.455  1.00 96.41           C  
ATOM    670  CD2 LEU A 100      14.871   9.755  16.308  1.00 97.79           C  
ATOM    671  N   GLN A 101      13.987   5.993  12.783  1.00104.07           N  
ATOM    672  CA  GLN A 101      13.060   4.916  12.434  1.00106.30           C  
ATOM    673  C   GLN A 101      13.357   3.605  13.150  1.00108.11           C  
ATOM    674  O   GLN A 101      12.441   2.837  13.458  1.00108.77           O  
ATOM    675  CB  GLN A 101      13.062   4.659  10.926  1.00105.80           C  
ATOM    676  CG  GLN A 101      12.315   5.689  10.106  1.00107.51           C  
ATOM    677  CD  GLN A 101      12.107   5.244   8.666  1.00109.48           C  
ATOM    678  OE1 GLN A 101      11.394   4.274   8.401  1.00110.39           O  
ATOM    679  NE2 GLN A 101      12.735   5.948   7.729  1.00108.73           N  
ATOM    680  N   GLN A 102      14.635   3.349  13.412  1.00108.47           N  
ATOM    681  CA  GLN A 102      15.033   2.120  14.077  1.00108.89           C  
ATOM    682  C   GLN A 102      14.604   2.085  15.536  1.00109.03           C  
ATOM    683  O   GLN A 102      15.033   2.915  16.331  1.00107.65           O  
ATOM    684  CB  GLN A 102      16.547   1.932  13.968  1.00109.24           C  
ATOM    685  CG  GLN A 102      17.036   1.825  12.530  1.00110.75           C  
ATOM    686  CD  GLN A 102      18.446   1.272  12.419  1.00112.34           C  
ATOM    687  OE1 GLN A 102      19.394   1.823  12.983  1.00113.55           O  
ATOM    688  NE2 GLN A 102      18.591   0.176  11.682  1.00111.46           N  
ATOM    689  N   ASN A 103      13.742   1.127  15.875  1.00111.25           N  
ATOM    690  CA  ASN A 103      13.275   0.984  17.249  1.00113.41           C  
ATOM    691  C   ASN A 103      14.551   0.833  18.051  1.00113.00           C  
ATOM    692  O   ASN A 103      15.351  -0.057  17.775  1.00114.18           O  
ATOM    693  CB  ASN A 103      12.418  -0.281  17.438  1.00116.07           C  
ATOM    694  CG  ASN A 103      11.371  -0.465  16.348  1.00119.39           C  
ATOM    695  OD1 ASN A 103      11.695  -0.911  15.249  1.00120.83           O  
ATOM    696  ND2 ASN A 103      10.124  -0.114  16.659  1.00121.34           N  
ATOM    697  N   GLY A 104      14.753   1.703  19.031  1.00112.18           N  
ATOM    698  CA  GLY A 104      15.965   1.616  19.824  1.00111.28           C  
ATOM    699  C   GLY A 104      16.065   0.308  20.581  1.00109.27           C  
ATOM    700  O   GLY A 104      15.552  -0.724  20.153  1.00107.67           O  
ATOM    701  N   SER A 105      16.744   0.345  21.717  1.00108.25           N  
ATOM    702  CA  SER A 105      16.870  -0.847  22.529  1.00106.53           C  
ATOM    703  C   SER A 105      15.496  -1.001  23.185  1.00104.25           C  
ATOM    704  O   SER A 105      15.339  -1.702  24.185  1.00104.51           O  
ATOM    705  CB  SER A 105      17.972  -0.656  23.582  1.00107.81           C  
ATOM    706  OG  SER A 105      18.456  -1.901  24.069  1.00105.70           O  
ATOM    707  N   SER A 106      14.507  -0.321  22.608  1.00101.47           N  
ATOM    708  CA  SER A 106      13.129  -0.364  23.095  1.00 99.33           C  
ATOM    709  C   SER A 106      12.542  -1.697  22.664  1.00 96.85           C  
ATOM    710  O   SER A 106      11.586  -2.202  23.257  1.00 95.01           O  
ATOM    711  CB  SER A 106      12.312   0.790  22.497  1.00 99.59           C  
ATOM    712  OG  SER A 106      12.292   0.738  21.079  1.00 99.02           O  
ATOM    713  N   VAL A 107      13.148  -2.252  21.619  1.00 94.78           N  
ATOM    714  CA  VAL A 107      12.766  -3.537  21.048  1.00 92.19           C  
ATOM    715  C   VAL A 107      12.695  -4.588  22.154  1.00 90.66           C  
ATOM    716  O   VAL A 107      12.175  -5.690  21.957  1.00 89.48           O  
ATOM    717  CB  VAL A 107      13.807  -3.982  19.990  1.00 92.29           C  
ATOM    718  CG1 VAL A 107      13.477  -5.354  19.479  1.00 92.90           C  
ATOM    719  CG2 VAL A 107      13.838  -2.993  18.838  1.00 92.27           C  
ATOM    720  N   LEU A 108      13.224  -4.232  23.319  1.00 89.46           N  
ATOM    721  CA  LEU A 108      13.237  -5.122  24.467  1.00 88.69           C  
ATOM    722  C   LEU A 108      11.972  -4.999  25.291  1.00 90.25           C  
ATOM    723  O   LEU A 108      11.272  -3.977  25.255  1.00 88.35           O  
ATOM    724  CB  LEU A 108      14.450  -4.839  25.354  1.00 86.41           C  
ATOM    725  CG  LEU A 108      15.798  -5.341  24.846  1.00 84.70           C  
ATOM    726  CD1 LEU A 108      16.914  -4.564  25.503  1.00 87.67           C  
ATOM    727  CD2 LEU A 108      15.927  -6.816  25.132  1.00 83.56           C  
ATOM    728  N   SER A 109      11.703  -6.061  26.040  1.00 92.49           N  
ATOM    729  CA  SER A 109      10.535  -6.158  26.893  1.00 93.95           C  
ATOM    730  C   SER A 109      10.471  -5.099  27.974  1.00 96.54           C  
ATOM    731  O   SER A 109      10.558  -5.423  29.155  1.00 97.48           O  
ATOM    732  CB  SER A 109      10.492  -7.536  27.544  1.00 93.61           C  
ATOM    733  OG  SER A 109       9.615  -7.539  28.652  1.00 92.64           O  
ATOM    734  N   GLU A 110      10.316  -3.840  27.569  1.00 99.13           N  
ATOM    735  CA  GLU A 110      10.211  -2.727  28.511  1.00101.16           C  
ATOM    736  C   GLU A 110      10.834  -3.042  29.877  1.00100.20           C  
ATOM    737  O   GLU A 110      12.011  -2.765  30.110  1.00100.30           O  
ATOM    738  CB  GLU A 110       8.729  -2.341  28.666  1.00104.23           C  
ATOM    739  CG  GLU A 110       8.405  -1.386  29.806  1.00107.40           C  
ATOM    740  CD  GLU A 110       9.336  -0.197  29.848  1.00110.56           C  
ATOM    741  OE1 GLU A 110       9.652   0.344  28.765  1.00110.45           O  
ATOM    742  OE2 GLU A 110       9.745   0.198  30.964  1.00112.70           O  
ATOM    743  N   ASP A 111      10.048  -3.634  30.770  1.00 98.46           N  
ATOM    744  CA  ASP A 111      10.532  -3.974  32.098  1.00 98.63           C  
ATOM    745  C   ASP A 111      11.531  -5.123  32.101  1.00 97.16           C  
ATOM    746  O   ASP A 111      11.645  -5.871  33.073  1.00 96.37           O  
ATOM    747  CB  ASP A 111       9.348  -4.291  33.005  1.00102.23           C  
ATOM    748  CG  ASP A 111       8.468  -3.080  33.238  1.00104.53           C  
ATOM    749  OD1 ASP A 111       8.988  -2.063  33.752  1.00105.90           O  
ATOM    750  OD2 ASP A 111       7.267  -3.141  32.902  1.00105.08           O  
ATOM    751  N   LYS A 112      12.248  -5.250  30.992  1.00 96.50           N  
ATOM    752  CA  LYS A 112      13.275  -6.267  30.818  1.00 95.59           C  
ATOM    753  C   LYS A 112      14.579  -5.506  30.644  1.00 94.58           C  
ATOM    754  O   LYS A 112      15.548  -5.732  31.367  1.00 95.84           O  
ATOM    755  CB  LYS A 112      12.997  -7.114  29.575  1.00 95.03           C  
ATOM    756  CG  LYS A 112      14.248  -7.638  28.911  1.00 94.44           C  
ATOM    757  CD  LYS A 112      13.970  -8.903  28.134  1.00 97.31           C  
ATOM    758  CE  LYS A 112      13.630 -10.068  29.060  1.00 96.39           C  
ATOM    759  NZ  LYS A 112      13.482 -11.352  28.299  1.00 96.77           N  
ATOM    760  N   SER A 113      14.584  -4.591  29.681  1.00 91.50           N  
ATOM    761  CA  SER A 113      15.745  -3.760  29.415  1.00 87.90           C  
ATOM    762  C   SER A 113      16.235  -3.134  30.721  1.00 86.51           C  
ATOM    763  O   SER A 113      17.391  -2.724  30.833  1.00 85.36           O  
ATOM    764  CB  SER A 113      15.370  -2.669  28.414  1.00 88.08           C  
ATOM    765  OG  SER A 113      14.155  -2.045  28.786  1.00 84.75           O  
ATOM    766  N   LYS A 114      15.345  -3.057  31.707  1.00 84.82           N  
ATOM    767  CA  LYS A 114      15.710  -2.502  32.996  1.00 82.07           C  
ATOM    768  C   LYS A 114      16.841  -3.346  33.539  1.00 80.73           C  
ATOM    769  O   LYS A 114      17.873  -2.816  33.933  1.00 83.52           O  
ATOM    770  CB  LYS A 114      14.532  -2.528  33.974  1.00 81.28           C  
ATOM    771  CG  LYS A 114      13.373  -1.614  33.588  1.00 83.05           C  
ATOM    772  CD  LYS A 114      12.522  -1.196  34.797  1.00 82.74           C  
ATOM    773  CE  LYS A 114      11.973  -2.384  35.577  1.00 80.63           C  
ATOM    774  NZ  LYS A 114      13.046  -3.222  36.186  1.00 77.24           N  
ATOM    775  N   ARG A 115      16.656  -4.661  33.547  1.00 78.87           N  
ATOM    776  CA  ARG A 115      17.693  -5.555  34.044  1.00 77.52           C  
ATOM    777  C   ARG A 115      19.012  -5.307  33.321  1.00 76.99           C  
ATOM    778  O   ARG A 115      20.075  -5.416  33.923  1.00 78.47           O  
ATOM    779  CB  ARG A 115      17.297  -7.014  33.863  1.00 78.65           C  
ATOM    780  CG  ARG A 115      18.363  -7.990  34.349  1.00 81.23           C  
ATOM    781  CD  ARG A 115      18.392  -8.065  35.868  1.00 83.97           C  
ATOM    782  NE  ARG A 115      19.420  -8.979  36.364  1.00 85.02           N  
ATOM    783  CZ  ARG A 115      20.635  -8.600  36.750  1.00 85.46           C  
ATOM    784  NH1 ARG A 115      21.512  -9.497  37.187  1.00 84.49           N  
ATOM    785  NH2 ARG A 115      20.970  -7.318  36.712  1.00 85.41           N  
ATOM    786  N   LEU A 116      18.949  -4.983  32.031  1.00 75.67           N  
ATOM    787  CA  LEU A 116      20.166  -4.708  31.273  1.00 72.94           C  
ATOM    788  C   LEU A 116      20.889  -3.580  31.975  1.00 74.07           C  
ATOM    789  O   LEU A 116      22.065  -3.702  32.308  1.00 76.32           O  
ATOM    790  CB  LEU A 116      19.850  -4.277  29.841  1.00 70.05           C  
ATOM    791  CG  LEU A 116      21.064  -3.917  28.976  1.00 65.70           C  
ATOM    792  CD1 LEU A 116      22.010  -5.117  28.867  1.00 61.79           C  
ATOM    793  CD2 LEU A 116      20.588  -3.468  27.602  1.00 63.44           C  
ATOM    794  N   ASN A 117      20.179  -2.480  32.204  1.00 73.27           N  
ATOM    795  CA  ASN A 117      20.766  -1.338  32.888  1.00 73.26           C  
ATOM    796  C   ASN A 117      21.308  -1.783  34.230  1.00 71.86           C  
ATOM    797  O   ASN A 117      22.484  -1.587  34.527  1.00 72.81           O  
ATOM    798  CB  ASN A 117      19.727  -0.250  33.079  1.00 75.88           C  
ATOM    799  CG  ASN A 117      19.147   0.209  31.773  1.00 82.56           C  
ATOM    800  OD1 ASN A 117      18.542   1.278  31.685  1.00 89.01           O  
ATOM    801  ND2 ASN A 117      19.321  -0.606  30.738  1.00 84.35           N  
ATOM    802  N   THR A 118      20.447  -2.384  35.039  1.00 69.78           N  
ATOM    803  CA  THR A 118      20.855  -2.891  36.340  1.00 69.27           C  
ATOM    804  C   THR A 118      22.195  -3.600  36.189  1.00 69.09           C  
ATOM    805  O   THR A 118      23.103  -3.436  37.004  1.00 68.64           O  
ATOM    806  CB  THR A 118      19.837  -3.892  36.866  1.00 68.70           C  
ATOM    807  OG1 THR A 118      18.663  -3.197  37.293  1.00 68.68           O  
ATOM    808  CG2 THR A 118      20.420  -4.679  38.010  1.00 70.29           C  
ATOM    809  N   ILE A 119      22.299  -4.387  35.125  1.00 69.42           N  
ATOM    810  CA  ILE A 119      23.509  -5.131  34.799  1.00 69.28           C  
ATOM    811  C   ILE A 119      24.603  -4.156  34.364  1.00 67.66           C  
ATOM    812  O   ILE A 119      25.722  -4.184  34.884  1.00 67.50           O  
ATOM    813  CB  ILE A 119      23.221  -6.147  33.663  1.00 69.47           C  
ATOM    814  CG1 ILE A 119      22.276  -7.227  34.186  1.00 70.66           C  
ATOM    815  CG2 ILE A 119      24.505  -6.774  33.154  1.00 69.39           C  
ATOM    816  CD1 ILE A 119      21.919  -8.291  33.172  1.00 76.99           C  
ATOM    817  N   LEU A 120      24.263  -3.291  33.413  1.00 65.06           N  
ATOM    818  CA  LEU A 120      25.189  -2.294  32.902  1.00 64.12           C  
ATOM    819  C   LEU A 120      25.775  -1.421  33.998  1.00 64.49           C  
ATOM    820  O   LEU A 120      26.994  -1.271  34.093  1.00 64.52           O  
ATOM    821  CB  LEU A 120      24.495  -1.401  31.880  1.00 61.10           C  
ATOM    822  CG  LEU A 120      24.448  -1.991  30.482  1.00 60.63           C  
ATOM    823  CD1 LEU A 120      24.199  -0.894  29.477  1.00 60.78           C  
ATOM    824  CD2 LEU A 120      25.783  -2.669  30.195  1.00 63.19           C  
ATOM    825  N   ASN A 121      24.899  -0.840  34.814  1.00 63.36           N  
ATOM    826  CA  ASN A 121      25.326   0.028  35.899  1.00 63.45           C  
ATOM    827  C   ASN A 121      26.268  -0.646  36.860  1.00 63.23           C  
ATOM    828  O   ASN A 121      27.282  -0.057  37.247  1.00 66.25           O  
ATOM    829  CB  ASN A 121      24.131   0.564  36.669  1.00 65.88           C  
ATOM    830  CG  ASN A 121      23.517   1.761  35.999  1.00 69.06           C  
ATOM    831  OD1 ASN A 121      24.221   2.545  35.365  1.00 74.36           O  
ATOM    832  ND2 ASN A 121      22.207   1.925  36.144  1.00 70.19           N  
ATOM    833  N   THR A 122      25.938  -1.871  37.259  1.00 59.26           N  
ATOM    834  CA  THR A 122      26.808  -2.595  38.174  1.00 56.13           C  
ATOM    835  C   THR A 122      28.161  -2.715  37.521  1.00 54.69           C  
ATOM    836  O   THR A 122      29.138  -2.104  37.960  1.00 55.52           O  
ATOM    837  CB  THR A 122      26.324  -4.015  38.450  1.00 56.89           C  
ATOM    838  OG1 THR A 122      24.950  -3.984  38.852  1.00 62.46           O  
ATOM    839  CG2 THR A 122      27.171  -4.655  39.552  1.00 49.11           C  
ATOM    840  N   MET A 123      28.204  -3.504  36.458  1.00 52.91           N  
ATOM    841  CA  MET A 123      29.436  -3.723  35.728  1.00 54.52           C  
ATOM    842  C   MET A 123      30.360  -2.530  35.827  1.00 54.75           C  
ATOM    843  O   MET A 123      31.546  -2.681  36.093  1.00 53.43           O  
ATOM    844  CB  MET A 123      29.118  -4.024  34.280  1.00 55.60           C  
ATOM    845  CG  MET A 123      28.370  -5.313  34.116  1.00 55.64           C  
ATOM    846  SD  MET A 123      29.019  -6.111  32.690  1.00 57.71           S  
ATOM    847  CE  MET A 123      28.245  -5.087  31.381  1.00 58.24           C  
ATOM    848  N   SER A 124      29.806  -1.343  35.614  1.00 56.37           N  
ATOM    849  CA  SER A 124      30.579  -0.115  35.712  1.00 58.32           C  
ATOM    850  C   SER A 124      31.123   0.059  37.124  1.00 59.23           C  
ATOM    851  O   SER A 124      32.344   0.111  37.338  1.00 57.83           O  
ATOM    852  CB  SER A 124      29.710   1.096  35.390  1.00 57.44           C  
ATOM    853  OG  SER A 124      30.242   2.256  36.017  1.00 57.40           O  
ATOM    854  N   THR A 125      30.208   0.164  38.085  1.00 56.84           N  
ATOM    855  CA  THR A 125      30.621   0.354  39.460  1.00 57.21           C  
ATOM    856  C   THR A 125      31.671  -0.676  39.817  1.00 55.19           C  
ATOM    857  O   THR A 125      32.772  -0.310  40.207  1.00 56.09           O  
ATOM    858  CB  THR A 125      29.439   0.257  40.445  1.00 57.60           C  
ATOM    859  OG1 THR A 125      29.200  -1.114  40.780  1.00 59.19           O  
ATOM    860  CG2 THR A 125      28.189   0.874  39.828  1.00 54.28           C  
ATOM    861  N   ILE A 126      31.350  -1.958  39.660  1.00 53.45           N  
ATOM    862  CA  ILE A 126      32.311  -3.015  39.981  1.00 52.20           C  
ATOM    863  C   ILE A 126      33.716  -2.634  39.520  1.00 52.37           C  
ATOM    864  O   ILE A 126      34.670  -2.681  40.284  1.00 53.06           O  
ATOM    865  CB  ILE A 126      31.938  -4.360  39.324  1.00 46.66           C  
ATOM    866  CG1 ILE A 126      30.668  -4.907  39.956  1.00 44.84           C  
ATOM    867  CG2 ILE A 126      33.050  -5.360  39.524  1.00 43.88           C  
ATOM    868  CD1 ILE A 126      30.742  -4.958  41.450  1.00 48.07           C  
ATOM    869  N   TYR A 127      33.825  -2.235  38.265  1.00 52.37           N  
ATOM    870  CA  TYR A 127      35.097  -1.844  37.695  1.00 52.26           C  
ATOM    871  C   TYR A 127      35.697  -0.662  38.447  1.00 54.53           C  
ATOM    872  O   TYR A 127      36.732  -0.792  39.095  1.00 57.08           O  
ATOM    873  CB  TYR A 127      34.901  -1.490  36.216  1.00 52.01           C  
ATOM    874  CG  TYR A 127      36.176  -1.208  35.464  1.00 50.31           C  
ATOM    875  CD1 TYR A 127      36.574   0.089  35.194  1.00 45.77           C  
ATOM    876  CD2 TYR A 127      36.987  -2.249  35.028  1.00 53.22           C  
ATOM    877  CE1 TYR A 127      37.736   0.344  34.512  1.00 45.65           C  
ATOM    878  CE2 TYR A 127      38.162  -2.000  34.342  1.00 52.40           C  
ATOM    879  CZ  TYR A 127      38.527  -0.700  34.087  1.00 48.59           C  
ATOM    880  OH  TYR A 127      39.683  -0.449  33.395  1.00 49.50           O  
ATOM    881  N   SER A 128      35.045   0.493  38.363  1.00 54.78           N  
ATOM    882  CA  SER A 128      35.545   1.692  39.020  1.00 53.17           C  
ATOM    883  C   SER A 128      35.076   1.745  40.451  1.00 53.67           C  
ATOM    884  O   SER A 128      34.339   2.652  40.816  1.00 57.92           O  
ATOM    885  CB  SER A 128      35.042   2.923  38.285  1.00 51.65           C  
ATOM    886  OG  SER A 128      35.268   2.779  36.899  1.00 55.23           O  
ATOM    887  N   THR A 129      35.511   0.789  41.265  1.00 51.66           N  
ATOM    888  CA  THR A 129      35.086   0.725  42.662  1.00 48.95           C  
ATOM    889  C   THR A 129      35.642  -0.534  43.291  1.00 48.50           C  
ATOM    890  O   THR A 129      35.905  -0.588  44.482  1.00 48.16           O  
ATOM    891  CB  THR A 129      33.538   0.692  42.760  1.00 49.13           C  
ATOM    892  OG1 THR A 129      33.051   1.956  43.214  1.00 44.12           O  
ATOM    893  CG2 THR A 129      33.079  -0.388  43.685  1.00 46.98           C  
ATOM    894  N   GLY A 130      35.813  -1.558  42.471  1.00 52.10           N  
ATOM    895  CA  GLY A 130      36.350  -2.819  42.956  1.00 53.76           C  
ATOM    896  C   GLY A 130      37.702  -2.695  43.627  1.00 50.82           C  
ATOM    897  O   GLY A 130      38.542  -1.893  43.229  1.00 47.40           O  
ATOM    898  N   LYS A 131      37.916  -3.506  44.650  1.00 52.46           N  
ATOM    899  CA  LYS A 131      39.172  -3.457  45.360  1.00 59.55           C  
ATOM    900  C   LYS A 131      39.786  -4.828  45.614  1.00 61.57           C  
ATOM    901  O   LYS A 131      39.073  -5.817  45.788  1.00 62.67           O  
ATOM    902  CB  LYS A 131      38.974  -2.761  46.710  1.00 63.60           C  
ATOM    903  CG  LYS A 131      38.290  -1.417  46.642  1.00 65.65           C  
ATOM    904  CD  LYS A 131      38.715  -0.544  47.810  1.00 68.77           C  
ATOM    905  CE  LYS A 131      38.112   0.859  47.709  1.00 72.65           C  
ATOM    906  NZ  LYS A 131      38.644   1.833  48.721  1.00 74.31           N  
ATOM    907  N   VAL A 132      41.112  -4.885  45.607  1.00 62.43           N  
ATOM    908  CA  VAL A 132      41.812  -6.119  45.941  1.00 67.99           C  
ATOM    909  C   VAL A 132      42.527  -5.691  47.214  1.00 71.21           C  
ATOM    910  O   VAL A 132      43.005  -4.561  47.295  1.00 72.93           O  
ATOM    911  CB  VAL A 132      42.862  -6.550  44.882  1.00 66.36           C  
ATOM    912  CG1 VAL A 132      42.169  -7.017  43.620  1.00 65.52           C  
ATOM    913  CG2 VAL A 132      43.804  -5.412  44.588  1.00 66.83           C  
ATOM    914  N   CYS A 133      42.586  -6.556  48.220  1.00 74.38           N  
ATOM    915  CA  CYS A 133      43.246  -6.159  49.455  1.00 74.98           C  
ATOM    916  C   CYS A 133      44.462  -7.013  49.812  1.00 72.27           C  
ATOM    917  O   CYS A 133      44.395  -8.235  49.827  1.00 69.84           O  
ATOM    918  CB  CYS A 133      42.232  -6.136  50.601  1.00 77.38           C  
ATOM    919  SG  CYS A 133      42.484  -4.709  51.716  1.00 88.41           S  
ATOM    920  N   ASN A 134      45.574  -6.336  50.081  1.00 70.70           N  
ATOM    921  CA  ASN A 134      46.837  -6.968  50.425  1.00 71.95           C  
ATOM    922  C   ASN A 134      46.648  -8.197  51.303  1.00 75.23           C  
ATOM    923  O   ASN A 134      45.943  -8.137  52.305  1.00 78.73           O  
ATOM    924  CB  ASN A 134      47.717  -5.969  51.155  1.00 69.38           C  
ATOM    925  CG  ASN A 134      49.097  -6.505  51.412  1.00 69.36           C  
ATOM    926  OD1 ASN A 134      49.266  -7.687  51.698  1.00 65.32           O  
ATOM    927  ND2 ASN A 134      50.097  -5.636  51.324  1.00 68.18           N  
ATOM    928  N   PRO A 135      47.299  -9.324  50.952  1.00 77.21           N  
ATOM    929  CA  PRO A 135      47.199 -10.578  51.711  1.00 77.41           C  
ATOM    930  C   PRO A 135      47.694 -10.424  53.137  1.00 76.80           C  
ATOM    931  O   PRO A 135      47.000 -10.758  54.095  1.00 75.13           O  
ATOM    932  CB  PRO A 135      48.088 -11.541  50.918  1.00 78.09           C  
ATOM    933  CG  PRO A 135      48.073 -10.981  49.541  1.00 78.01           C  
ATOM    934  CD  PRO A 135      48.200  -9.500  49.803  1.00 78.08           C  
ATOM    935  N   ASP A 136      48.910  -9.908  53.249  1.00 76.86           N  
ATOM    936  CA  ASP A 136      49.567  -9.700  54.522  1.00 76.31           C  
ATOM    937  C   ASP A 136      49.069  -8.487  55.297  1.00 74.99           C  
ATOM    938  O   ASP A 136      49.756  -8.024  56.208  1.00 77.40           O  
ATOM    939  CB  ASP A 136      51.071  -9.578  54.295  1.00 79.35           C  
ATOM    940  CG  ASP A 136      51.403  -8.716  53.096  1.00 85.13           C  
ATOM    941  OD1 ASP A 136      51.103  -9.140  51.958  1.00 88.69           O  
ATOM    942  OD2 ASP A 136      51.953  -7.610  53.283  1.00 88.84           O  
ATOM    943  N   ASN A 137      47.890  -7.975  54.937  1.00 70.87           N  
ATOM    944  CA  ASN A 137      47.290  -6.820  55.626  1.00 65.97           C  
ATOM    945  C   ASN A 137      45.919  -6.465  55.060  1.00 62.86           C  
ATOM    946  O   ASN A 137      45.771  -5.526  54.278  1.00 64.52           O  
ATOM    947  CB  ASN A 137      48.199  -5.589  55.543  1.00 64.33           C  
ATOM    948  CG  ASN A 137      47.622  -4.386  56.274  1.00 64.24           C  
ATOM    949  OD1 ASN A 137      48.230  -3.323  56.299  1.00 65.49           O  
ATOM    950  ND2 ASN A 137      46.444  -4.550  56.871  1.00 63.84           N  
ATOM    951  N   PRO A 138      44.896  -7.209  55.473  1.00 58.09           N  
ATOM    952  CA  PRO A 138      43.497  -7.069  55.078  1.00 57.92           C  
ATOM    953  C   PRO A 138      43.008  -5.631  54.962  1.00 57.59           C  
ATOM    954  O   PRO A 138      41.910  -5.390  54.461  1.00 55.65           O  
ATOM    955  CB  PRO A 138      42.761  -7.816  56.180  1.00 57.13           C  
ATOM    956  CG  PRO A 138      43.700  -8.893  56.512  1.00 59.16           C  
ATOM    957  CD  PRO A 138      45.030  -8.196  56.551  1.00 57.79           C  
ATOM    958  N   GLN A 139      43.802  -4.677  55.437  1.00 57.46           N  
ATOM    959  CA  GLN A 139      43.380  -3.286  55.382  1.00 58.14           C  
ATOM    960  C   GLN A 139      44.047  -2.448  54.296  1.00 59.76           C  
ATOM    961  O   GLN A 139      43.617  -1.327  54.004  1.00 57.49           O  
ATOM    962  CB  GLN A 139      43.542  -2.646  56.757  1.00 56.04           C  
ATOM    963  CG  GLN A 139      42.529  -3.194  57.761  1.00 55.55           C  
ATOM    964  CD  GLN A 139      42.931  -4.539  58.340  1.00 56.88           C  
ATOM    965  OE1 GLN A 139      42.079  -5.344  58.709  1.00 53.59           O  
ATOM    966  NE2 GLN A 139      44.237  -4.780  58.437  1.00 55.30           N  
ATOM    967  N   GLU A 140      45.091  -2.990  53.685  1.00 61.34           N  
ATOM    968  CA  GLU A 140      45.736  -2.272  52.609  1.00 63.14           C  
ATOM    969  C   GLU A 140      45.021  -2.749  51.348  1.00 64.40           C  
ATOM    970  O   GLU A 140      45.370  -3.786  50.783  1.00 63.47           O  
ATOM    971  CB  GLU A 140      47.222  -2.612  52.534  1.00 63.96           C  
ATOM    972  CG  GLU A 140      48.028  -1.631  51.698  1.00 70.37           C  
ATOM    973  CD  GLU A 140      49.398  -2.173  51.303  1.00 77.67           C  
ATOM    974  OE1 GLU A 140      50.132  -2.680  52.185  1.00 78.90           O  
ATOM    975  OE2 GLU A 140      49.745  -2.086  50.104  1.00 79.18           O  
ATOM    976  N   CYS A 141      43.985  -2.013  50.946  1.00 65.33           N  
ATOM    977  CA  CYS A 141      43.223  -2.342  49.743  1.00 66.25           C  
ATOM    978  C   CYS A 141      43.599  -1.360  48.628  1.00 63.91           C  
ATOM    979  O   CYS A 141      43.931  -0.205  48.881  1.00 63.99           O  
ATOM    980  CB  CYS A 141      41.712  -2.255  50.006  1.00 71.02           C  
ATOM    981  SG  CYS A 141      41.015  -3.348  51.298  1.00 80.75           S  
ATOM    982  N   LEU A 142      43.553  -1.822  47.388  1.00 62.07           N  
ATOM    983  CA  LEU A 142      43.891  -0.967  46.266  1.00 57.78           C  
ATOM    984  C   LEU A 142      42.810  -0.948  45.189  1.00 59.14           C  
ATOM    985  O   LEU A 142      42.307  -1.995  44.748  1.00 61.10           O  
ATOM    986  CB  LEU A 142      45.215  -1.409  45.652  1.00 54.62           C  
ATOM    987  CG  LEU A 142      46.441  -1.148  46.514  1.00 54.74           C  
ATOM    988  CD1 LEU A 142      47.703  -1.321  45.690  1.00 53.05           C  
ATOM    989  CD2 LEU A 142      46.364   0.261  47.054  1.00 55.41           C  
ATOM    990  N   LEU A 143      42.451   0.261  44.777  1.00 54.94           N  
ATOM    991  CA  LEU A 143      41.456   0.459  43.744  1.00 52.07           C  
ATOM    992  C   LEU A 143      42.250   0.189  42.467  1.00 55.18           C  
ATOM    993  O   LEU A 143      43.468   0.037  42.536  1.00 58.32           O  
ATOM    994  CB  LEU A 143      40.983   1.911  43.812  1.00 48.21           C  
ATOM    995  CG  LEU A 143      39.497   2.272  43.896  1.00 43.65           C  
ATOM    996  CD1 LEU A 143      38.729   1.185  44.558  1.00 41.36           C  
ATOM    997  CD2 LEU A 143      39.342   3.570  44.654  1.00 43.44           C  
ATOM    998  N   LEU A 144      41.604   0.108  41.307  1.00 56.65           N  
ATOM    999  CA  LEU A 144      42.374  -0.128  40.088  1.00 55.18           C  
ATOM   1000  C   LEU A 144      43.128   1.142  39.693  1.00 54.17           C  
ATOM   1001  O   LEU A 144      44.125   1.076  38.988  1.00 51.90           O  
ATOM   1002  CB  LEU A 144      41.472  -0.579  38.933  1.00 56.60           C  
ATOM   1003  CG  LEU A 144      42.175  -0.783  37.579  1.00 56.33           C  
ATOM   1004  CD1 LEU A 144      43.275  -1.808  37.736  1.00 60.39           C  
ATOM   1005  CD2 LEU A 144      41.188  -1.235  36.519  1.00 55.72           C  
ATOM   1006  N   GLU A 145      42.653   2.298  40.150  1.00 54.18           N  
ATOM   1007  CA  GLU A 145      43.315   3.563  39.836  1.00 56.09           C  
ATOM   1008  C   GLU A 145      43.468   4.483  41.052  1.00 57.75           C  
ATOM   1009  O   GLU A 145      42.499   5.062  41.537  1.00 60.31           O  
ATOM   1010  CB  GLU A 145      42.548   4.287  38.729  1.00 57.55           C  
ATOM   1011  CG  GLU A 145      42.844   5.775  38.576  1.00 61.78           C  
ATOM   1012  CD  GLU A 145      44.246   6.061  38.091  1.00 68.45           C  
ATOM   1013  OE1 GLU A 145      44.875   5.139  37.520  1.00 71.91           O  
ATOM   1014  OE2 GLU A 145      44.713   7.214  38.269  1.00 69.06           O  
ATOM   1015  N   PRO A 146      44.694   4.590  41.589  1.00 57.04           N  
ATOM   1016  CA  PRO A 146      45.851   3.857  41.062  1.00 55.61           C  
ATOM   1017  C   PRO A 146      46.157   2.715  42.024  1.00 57.21           C  
ATOM   1018  O   PRO A 146      45.415   2.478  42.977  1.00 55.70           O  
ATOM   1019  CB  PRO A 146      46.938   4.912  41.046  1.00 52.15           C  
ATOM   1020  CG  PRO A 146      46.648   5.679  42.308  1.00 53.37           C  
ATOM   1021  CD  PRO A 146      45.125   5.745  42.399  1.00 52.78           C  
ATOM   1022  N   GLY A 147      47.251   2.015  41.794  1.00 59.74           N  
ATOM   1023  CA  GLY A 147      47.582   0.910  42.674  1.00 63.54           C  
ATOM   1024  C   GLY A 147      47.722  -0.309  41.800  1.00 65.72           C  
ATOM   1025  O   GLY A 147      48.829  -0.612  41.342  1.00 67.32           O  
ATOM   1026  N   LEU A 148      46.620  -1.017  41.560  1.00 63.78           N  
ATOM   1027  CA  LEU A 148      46.705  -2.161  40.678  1.00 62.62           C  
ATOM   1028  C   LEU A 148      47.374  -1.585  39.440  1.00 62.57           C  
ATOM   1029  O   LEU A 148      48.200  -2.234  38.813  1.00 64.84           O  
ATOM   1030  CB  LEU A 148      45.319  -2.695  40.318  1.00 62.03           C  
ATOM   1031  CG  LEU A 148      44.666  -3.677  41.291  1.00 60.26           C  
ATOM   1032  CD1 LEU A 148      45.745  -4.292  42.167  1.00 52.67           C  
ATOM   1033  CD2 LEU A 148      43.610  -2.966  42.121  1.00 56.88           C  
ATOM   1034  N   ASN A 149      47.028  -0.340  39.121  1.00 62.42           N  
ATOM   1035  CA  ASN A 149      47.582   0.358  37.968  1.00 61.55           C  
ATOM   1036  C   ASN A 149      49.041   0.768  38.128  1.00 60.33           C  
ATOM   1037  O   ASN A 149      49.871   0.350  37.331  1.00 61.60           O  
ATOM   1038  CB  ASN A 149      46.739   1.600  37.621  1.00 65.79           C  
ATOM   1039  CG  ASN A 149      45.649   1.318  36.572  1.00 65.87           C  
ATOM   1040  OD1 ASN A 149      44.879   2.218  36.198  1.00 62.43           O  
ATOM   1041  ND2 ASN A 149      45.590   0.073  36.091  1.00 63.86           N  
ATOM   1042  N   GLU A 150      49.374   1.582  39.131  1.00 60.13           N  
ATOM   1043  CA  GLU A 150      50.777   2.007  39.297  1.00 59.04           C  
ATOM   1044  C   GLU A 150      51.725   0.800  39.303  1.00 59.64           C  
ATOM   1045  O   GLU A 150      52.800   0.833  38.693  1.00 56.45           O  
ATOM   1046  CB  GLU A 150      50.954   2.818  40.576  1.00 52.91           C  
ATOM   1047  N   ILE A 151      51.306  -0.266  39.983  1.00 58.78           N  
ATOM   1048  CA  ILE A 151      52.087  -1.488  40.076  1.00 56.49           C  
ATOM   1049  C   ILE A 151      52.296  -2.117  38.706  1.00 56.04           C  
ATOM   1050  O   ILE A 151      53.429  -2.258  38.262  1.00 57.38           O  
ATOM   1051  CB  ILE A 151      51.399  -2.511  40.988  1.00 57.86           C  
ATOM   1052  CG1 ILE A 151      51.400  -2.008  42.433  1.00 55.22           C  
ATOM   1053  CG2 ILE A 151      52.100  -3.855  40.875  1.00 61.26           C  
ATOM   1054  CD1 ILE A 151      50.617  -2.888  43.381  1.00 50.20           C  
ATOM   1055  N   MET A 152      51.203  -2.491  38.040  1.00 56.07           N  
ATOM   1056  CA  MET A 152      51.257  -3.101  36.705  1.00 55.53           C  
ATOM   1057  C   MET A 152      51.972  -2.242  35.673  1.00 55.30           C  
ATOM   1058  O   MET A 152      52.216  -2.686  34.559  1.00 56.36           O  
ATOM   1059  CB  MET A 152      49.853  -3.382  36.186  1.00 55.11           C  
ATOM   1060  CG  MET A 152      49.129  -4.437  36.949  1.00 56.90           C  
ATOM   1061  SD  MET A 152      50.172  -5.859  37.021  1.00 61.11           S  
ATOM   1062  CE  MET A 152      49.745  -6.682  35.499  1.00 59.53           C  
ATOM   1063  N   ALA A 153      52.300  -1.011  36.044  1.00 55.14           N  
ATOM   1064  CA  ALA A 153      52.981  -0.095  35.144  1.00 54.50           C  
ATOM   1065  C   ALA A 153      54.414   0.180  35.574  1.00 54.22           C  
ATOM   1066  O   ALA A 153      55.220   0.634  34.766  1.00 51.20           O  
ATOM   1067  CB  ALA A 153      52.213   1.217  35.066  1.00 56.97           C  
ATOM   1068  N   ASN A 154      54.729  -0.101  36.841  1.00 55.33           N  
ATOM   1069  CA  ASN A 154      56.072   0.147  37.378  1.00 55.70           C  
ATOM   1070  C   ASN A 154      56.785  -1.060  38.008  1.00 55.54           C  
ATOM   1071  O   ASN A 154      57.918  -1.375  37.647  1.00 57.10           O  
ATOM   1072  CB  ASN A 154      56.002   1.280  38.396  1.00 56.00           C  
ATOM   1073  CG  ASN A 154      55.404   2.536  37.815  1.00 59.73           C  
ATOM   1074  OD1 ASN A 154      54.820   3.350  38.532  1.00 63.89           O  
ATOM   1075  ND2 ASN A 154      55.552   2.710  36.507  1.00 60.23           N  
ATOM   1076  N   SER A 155      56.137  -1.724  38.955  1.00 53.28           N  
ATOM   1077  CA  SER A 155      56.742  -2.876  39.600  1.00 52.41           C  
ATOM   1078  C   SER A 155      57.539  -3.725  38.624  1.00 54.27           C  
ATOM   1079  O   SER A 155      57.158  -3.889  37.463  1.00 50.56           O  
ATOM   1080  CB  SER A 155      55.666  -3.755  40.243  1.00 52.79           C  
ATOM   1081  OG  SER A 155      56.169  -5.040  40.590  1.00 47.73           O  
ATOM   1082  N   LEU A 156      58.659  -4.252  39.115  1.00 58.09           N  
ATOM   1083  CA  LEU A 156      59.527  -5.140  38.344  1.00 56.86           C  
ATOM   1084  C   LEU A 156      59.565  -6.484  39.089  1.00 56.12           C  
ATOM   1085  O   LEU A 156      60.162  -7.452  38.644  1.00 57.05           O  
ATOM   1086  CB  LEU A 156      60.938  -4.550  38.211  1.00 51.83           C  
ATOM   1087  CG  LEU A 156      60.974  -3.158  37.579  1.00 50.23           C  
ATOM   1088  CD1 LEU A 156      60.778  -2.126  38.679  1.00 51.84           C  
ATOM   1089  CD2 LEU A 156      62.280  -2.918  36.854  1.00 42.99           C  
ATOM   1090  N   ASP A 157      58.896  -6.545  40.224  1.00 55.14           N  
ATOM   1091  CA  ASP A 157      58.877  -7.773  40.973  1.00 58.38           C  
ATOM   1092  C   ASP A 157      57.917  -8.762  40.342  1.00 56.60           C  
ATOM   1093  O   ASP A 157      56.726  -8.714  40.627  1.00 59.43           O  
ATOM   1094  CB  ASP A 157      58.444  -7.500  42.412  1.00 66.16           C  
ATOM   1095  CG  ASP A 157      58.585  -8.724  43.301  1.00 73.48           C  
ATOM   1096  OD1 ASP A 157      59.731  -9.213  43.485  1.00 77.07           O  
ATOM   1097  OD2 ASP A 157      57.547  -9.200  43.810  1.00 75.93           O  
ATOM   1098  N   TYR A 158      58.418  -9.657  39.497  1.00 53.03           N  
ATOM   1099  CA  TYR A 158      57.563 -10.666  38.854  1.00 53.44           C  
ATOM   1100  C   TYR A 158      56.424 -11.127  39.769  1.00 58.04           C  
ATOM   1101  O   TYR A 158      55.388 -11.599  39.302  1.00 60.45           O  
ATOM   1102  CB  TYR A 158      58.393 -11.884  38.467  1.00 45.98           C  
ATOM   1103  CG  TYR A 158      57.628 -12.984  37.781  1.00 41.17           C  
ATOM   1104  CD1 TYR A 158      57.699 -13.151  36.399  1.00 42.21           C  
ATOM   1105  CD2 TYR A 158      56.819 -13.852  38.504  1.00 42.17           C  
ATOM   1106  CE1 TYR A 158      56.973 -14.158  35.746  1.00 40.77           C  
ATOM   1107  CE2 TYR A 158      56.088 -14.863  37.866  1.00 43.68           C  
ATOM   1108  CZ  TYR A 158      56.165 -15.007  36.487  1.00 44.55           C  
ATOM   1109  OH  TYR A 158      55.398 -15.959  35.849  1.00 42.72           O  
ATOM   1110  N   ASN A 159      56.627 -10.990  41.075  1.00 61.73           N  
ATOM   1111  CA  ASN A 159      55.640 -11.401  42.068  1.00 65.31           C  
ATOM   1112  C   ASN A 159      54.597 -10.329  42.377  1.00 65.30           C  
ATOM   1113  O   ASN A 159      53.407 -10.629  42.479  1.00 65.81           O  
ATOM   1114  CB  ASN A 159      56.363 -11.846  43.350  1.00 67.82           C  
ATOM   1115  CG  ASN A 159      57.154 -13.130  43.151  1.00 68.56           C  
ATOM   1116  OD1 ASN A 159      56.583 -14.222  43.152  1.00 67.24           O  
ATOM   1117  ND2 ASN A 159      58.468 -13.002  42.953  1.00 65.29           N  
ATOM   1118  N   GLU A 160      55.040  -9.087  42.551  1.00 66.52           N  
ATOM   1119  CA  GLU A 160      54.117  -7.977  42.807  1.00 64.64           C  
ATOM   1120  C   GLU A 160      53.270  -7.945  41.536  1.00 63.80           C  
ATOM   1121  O   GLU A 160      52.043  -8.034  41.590  1.00 63.85           O  
ATOM   1122  CB  GLU A 160      54.898  -6.666  42.955  1.00 64.65           C  
ATOM   1123  CG  GLU A 160      54.103  -5.457  43.423  1.00 62.66           C  
ATOM   1124  CD  GLU A 160      54.986  -4.209  43.557  1.00 68.28           C  
ATOM   1125  OE1 GLU A 160      54.508  -3.184  44.084  1.00 71.59           O  
ATOM   1126  OE2 GLU A 160      56.166  -4.246  43.134  1.00 67.34           O  
ATOM   1127  N   ARG A 161      53.947  -7.844  40.393  1.00 58.87           N  
ATOM   1128  CA  ARG A 161      53.273  -7.828  39.116  1.00 55.39           C  
ATOM   1129  C   ARG A 161      52.231  -8.929  39.128  1.00 55.67           C  
ATOM   1130  O   ARG A 161      51.058  -8.698  38.862  1.00 60.47           O  
ATOM   1131  CB  ARG A 161      54.242  -8.122  37.969  1.00 52.68           C  
ATOM   1132  CG  ARG A 161      55.422  -7.197  37.834  1.00 54.20           C  
ATOM   1133  CD  ARG A 161      55.016  -5.754  37.656  1.00 55.36           C  
ATOM   1134  NE  ARG A 161      54.203  -5.519  36.467  1.00 54.88           N  
ATOM   1135  CZ  ARG A 161      54.662  -5.494  35.227  1.00 50.73           C  
ATOM   1136  NH1 ARG A 161      55.942  -5.691  34.983  1.00 56.31           N  
ATOM   1137  NH2 ARG A 161      53.832  -5.263  34.231  1.00 52.18           N  
ATOM   1138  N   LEU A 162      52.663 -10.135  39.458  1.00 53.88           N  
ATOM   1139  CA  LEU A 162      51.773 -11.286  39.442  1.00 52.46           C  
ATOM   1140  C   LEU A 162      50.537 -11.263  40.339  1.00 52.92           C  
ATOM   1141  O   LEU A 162      49.450 -11.636  39.903  1.00 51.64           O  
ATOM   1142  CB  LEU A 162      52.584 -12.539  39.715  1.00 49.06           C  
ATOM   1143  CG  LEU A 162      52.092 -13.726  38.914  1.00 46.12           C  
ATOM   1144  CD1 LEU A 162      53.196 -14.738  38.898  1.00 47.90           C  
ATOM   1145  CD2 LEU A 162      50.800 -14.290  39.493  1.00 39.58           C  
ATOM   1146  N   TRP A 163      50.689 -10.853  41.593  1.00 57.13           N  
ATOM   1147  CA  TRP A 163      49.536 -10.800  42.488  1.00 58.55           C  
ATOM   1148  C   TRP A 163      48.513  -9.849  41.854  1.00 57.20           C  
ATOM   1149  O   TRP A 163      47.422 -10.267  41.457  1.00 51.25           O  
ATOM   1150  CB  TRP A 163      49.965 -10.315  43.886  1.00 59.94           C  
ATOM   1151  CG  TRP A 163      48.806  -9.978  44.793  1.00 64.45           C  
ATOM   1152  CD1 TRP A 163      47.932 -10.850  45.389  1.00 63.49           C  
ATOM   1153  CD2 TRP A 163      48.329  -8.665  45.100  1.00 66.04           C  
ATOM   1154  NE1 TRP A 163      46.936 -10.153  46.037  1.00 61.82           N  
ATOM   1155  CE2 TRP A 163      47.159  -8.812  45.872  1.00 63.73           C  
ATOM   1156  CE3 TRP A 163      48.778  -7.377  44.789  1.00 66.68           C  
ATOM   1157  CZ2 TRP A 163      46.438  -7.727  46.331  1.00 66.58           C  
ATOM   1158  CZ3 TRP A 163      48.060  -6.300  45.246  1.00 66.16           C  
ATOM   1159  CH2 TRP A 163      46.902  -6.479  46.008  1.00 67.90           C  
ATOM   1160  N   ALA A 164      48.896  -8.577  41.742  1.00 58.75           N  
ATOM   1161  CA  ALA A 164      48.057  -7.533  41.141  1.00 60.67           C  
ATOM   1162  C   ALA A 164      47.222  -8.079  39.993  1.00 59.26           C  
ATOM   1163  O   ALA A 164      45.997  -8.042  40.042  1.00 59.54           O  
ATOM   1164  CB  ALA A 164      48.935  -6.372  40.631  1.00 60.33           C  
ATOM   1165  N   TRP A 165      47.909  -8.567  38.965  1.00 56.85           N  
ATOM   1166  CA  TRP A 165      47.283  -9.136  37.783  1.00 58.36           C  
ATOM   1167  C   TRP A 165      46.193 -10.154  38.119  1.00 61.52           C  
ATOM   1168  O   TRP A 165      45.041 -10.003  37.718  1.00 64.21           O  
ATOM   1169  CB  TRP A 165      48.345  -9.822  36.938  1.00 57.73           C  
ATOM   1170  CG  TRP A 165      47.882 -10.265  35.594  1.00 56.91           C  
ATOM   1171  CD1 TRP A 165      48.088  -9.620  34.418  1.00 59.56           C  
ATOM   1172  CD2 TRP A 165      47.165 -11.465  35.274  1.00 54.45           C  
ATOM   1173  NE1 TRP A 165      47.552 -10.342  33.379  1.00 61.63           N  
ATOM   1174  CE2 TRP A 165      46.977 -11.479  33.879  1.00 57.24           C  
ATOM   1175  CE3 TRP A 165      46.665 -12.524  36.028  1.00 53.39           C  
ATOM   1176  CZ2 TRP A 165      46.309 -12.510  33.220  1.00 53.74           C  
ATOM   1177  CZ3 TRP A 165      46.003 -13.547  35.373  1.00 54.13           C  
ATOM   1178  CH2 TRP A 165      45.831 -13.531  33.982  1.00 53.15           C  
ATOM   1179  N   GLU A 166      46.567 -11.200  38.845  1.00 62.64           N  
ATOM   1180  CA  GLU A 166      45.634 -12.258  39.219  1.00 63.33           C  
ATOM   1181  C   GLU A 166      44.520 -11.766  40.161  1.00 63.94           C  
ATOM   1182  O   GLU A 166      43.324 -11.945  39.894  1.00 60.60           O  
ATOM   1183  CB  GLU A 166      46.431 -13.414  39.855  1.00 62.33           C  
ATOM   1184  CG  GLU A 166      45.612 -14.554  40.484  1.00 61.31           C  
ATOM   1185  CD  GLU A 166      44.763 -15.316  39.482  1.00 61.25           C  
ATOM   1186  OE1 GLU A 166      45.212 -15.466  38.328  1.00 64.34           O  
ATOM   1187  OE2 GLU A 166      43.661 -15.780  39.848  1.00 56.62           O  
ATOM   1188  N   SER A 167      44.923 -11.149  41.267  1.00 65.39           N  
ATOM   1189  CA  SER A 167      43.975 -10.638  42.247  1.00 64.08           C  
ATOM   1190  C   SER A 167      42.862  -9.839  41.575  1.00 62.41           C  
ATOM   1191  O   SER A 167      41.693 -10.131  41.764  1.00 62.22           O  
ATOM   1192  CB  SER A 167      44.711  -9.777  43.287  1.00 65.73           C  
ATOM   1193  OG  SER A 167      45.669  -8.917  42.686  1.00 64.04           O  
ATOM   1194  N   TRP A 168      43.230  -8.835  40.787  1.00 60.41           N  
ATOM   1195  CA  TRP A 168      42.245  -8.022  40.095  1.00 57.80           C  
ATOM   1196  C   TRP A 168      41.255  -8.912  39.360  1.00 58.54           C  
ATOM   1197  O   TRP A 168      40.055  -8.838  39.611  1.00 62.13           O  
ATOM   1198  CB  TRP A 168      42.927  -7.078  39.101  1.00 55.57           C  
ATOM   1199  CG  TRP A 168      41.957  -6.265  38.287  1.00 54.95           C  
ATOM   1200  CD1 TRP A 168      41.816  -6.282  36.934  1.00 56.06           C  
ATOM   1201  CD2 TRP A 168      40.994  -5.317  38.776  1.00 53.50           C  
ATOM   1202  NE1 TRP A 168      40.829  -5.408  36.548  1.00 53.72           N  
ATOM   1203  CE2 TRP A 168      40.310  -4.804  37.658  1.00 51.49           C  
ATOM   1204  CE3 TRP A 168      40.646  -4.855  40.049  1.00 53.31           C  
ATOM   1205  CZ2 TRP A 168      39.304  -3.857  37.772  1.00 51.82           C  
ATOM   1206  CZ3 TRP A 168      39.639  -3.909  40.161  1.00 51.75           C  
ATOM   1207  CH2 TRP A 168      38.983  -3.422  39.031  1.00 53.92           C  
ATOM   1208  N   ARG A 169      41.751  -9.756  38.458  1.00 57.43           N  
ATOM   1209  CA  ARG A 169      40.882 -10.653  37.700  1.00 55.54           C  
ATOM   1210  C   ARG A 169      40.140 -11.612  38.622  1.00 58.08           C  
ATOM   1211  O   ARG A 169      38.988 -11.967  38.359  1.00 58.33           O  
ATOM   1212  CB  ARG A 169      41.692 -11.442  36.656  1.00 52.65           C  
ATOM   1213  CG  ARG A 169      42.200 -10.577  35.499  1.00 52.12           C  
ATOM   1214  CD  ARG A 169      43.047 -11.351  34.507  1.00 50.02           C  
ATOM   1215  NE  ARG A 169      43.590 -10.516  33.431  1.00 51.93           N  
ATOM   1216  CZ  ARG A 169      44.269  -9.378  33.609  1.00 53.95           C  
ATOM   1217  NH1 ARG A 169      44.731  -8.703  32.561  1.00 46.95           N  
ATOM   1218  NH2 ARG A 169      44.480  -8.897  34.828  1.00 53.91           N  
ATOM   1219  N   SER A 170      40.798 -12.020  39.709  1.00 58.77           N  
ATOM   1220  CA  SER A 170      40.207 -12.943  40.675  1.00 57.98           C  
ATOM   1221  C   SER A 170      39.137 -12.307  41.547  1.00 59.01           C  
ATOM   1222  O   SER A 170      38.008 -12.774  41.598  1.00 59.99           O  
ATOM   1223  CB  SER A 170      41.283 -13.516  41.576  1.00 58.89           C  
ATOM   1224  OG  SER A 170      40.678 -14.197  42.658  1.00 62.30           O  
ATOM   1225  N   GLU A 171      39.504 -11.250  42.257  1.00 61.59           N  
ATOM   1226  CA  GLU A 171      38.550 -10.565  43.110  1.00 63.15           C  
ATOM   1227  C   GLU A 171      37.425  -9.973  42.283  1.00 61.93           C  
ATOM   1228  O   GLU A 171      36.313 -10.491  42.317  1.00 63.97           O  
ATOM   1229  CB  GLU A 171      39.221  -9.452  43.929  1.00 67.53           C  
ATOM   1230  CG  GLU A 171      39.450  -9.800  45.405  1.00 69.72           C  
ATOM   1231  CD  GLU A 171      40.722 -10.601  45.634  1.00 71.70           C  
ATOM   1232  OE1 GLU A 171      41.821 -10.032  45.450  1.00 73.05           O  
ATOM   1233  OE2 GLU A 171      40.627 -11.795  45.996  1.00 71.11           O  
ATOM   1234  N   VAL A 172      37.702  -8.906  41.535  1.00 58.14           N  
ATOM   1235  CA  VAL A 172      36.650  -8.286  40.739  1.00 57.50           C  
ATOM   1236  C   VAL A 172      36.246  -9.071  39.504  1.00 55.98           C  
ATOM   1237  O   VAL A 172      35.073  -9.386  39.325  1.00 55.12           O  
ATOM   1238  CB  VAL A 172      37.020  -6.858  40.296  1.00 57.77           C  
ATOM   1239  CG1 VAL A 172      37.373  -6.016  41.508  1.00 60.97           C  
ATOM   1240  CG2 VAL A 172      38.150  -6.891  39.303  1.00 56.19           C  
ATOM   1241  N   GLY A 173      37.208  -9.391  38.654  1.00 56.26           N  
ATOM   1242  CA  GLY A 173      36.890 -10.116  37.442  1.00 58.04           C  
ATOM   1243  C   GLY A 173      35.761 -11.123  37.575  1.00 60.30           C  
ATOM   1244  O   GLY A 173      34.807 -11.105  36.797  1.00 60.84           O  
ATOM   1245  N   LYS A 174      35.870 -11.995  38.571  1.00 61.80           N  
ATOM   1246  CA  LYS A 174      34.888 -13.043  38.809  1.00 61.86           C  
ATOM   1247  C   LYS A 174      33.476 -12.528  39.044  1.00 62.38           C  
ATOM   1248  O   LYS A 174      32.502 -13.146  38.607  1.00 65.64           O  
ATOM   1249  CB  LYS A 174      35.319 -13.898  39.997  1.00 64.05           C  
ATOM   1250  CG  LYS A 174      35.412 -15.371  39.676  1.00 67.97           C  
ATOM   1251  CD  LYS A 174      36.754 -15.725  39.074  1.00 72.78           C  
ATOM   1252  CE  LYS A 174      37.669 -16.345  40.118  1.00 76.56           C  
ATOM   1253  NZ  LYS A 174      37.108 -17.620  40.661  1.00 76.40           N  
ATOM   1254  N   GLN A 175      33.360 -11.408  39.744  1.00 60.88           N  
ATOM   1255  CA  GLN A 175      32.053 -10.829  40.022  1.00 59.73           C  
ATOM   1256  C   GLN A 175      31.390 -10.513  38.701  1.00 59.72           C  
ATOM   1257  O   GLN A 175      30.214 -10.798  38.496  1.00 58.99           O  
ATOM   1258  CB  GLN A 175      32.191  -9.532  40.816  1.00 61.60           C  
ATOM   1259  CG  GLN A 175      32.767  -9.665  42.213  1.00 60.53           C  
ATOM   1260  CD  GLN A 175      32.676  -8.364  42.985  1.00 63.65           C  
ATOM   1261  OE1 GLN A 175      31.587  -7.790  43.145  1.00 61.18           O  
ATOM   1262  NE2 GLN A 175      33.820  -7.885  43.467  1.00 65.73           N  
ATOM   1263  N   LEU A 176      32.167  -9.902  37.813  1.00 59.58           N  
ATOM   1264  CA  LEU A 176      31.684  -9.525  36.497  1.00 60.71           C  
ATOM   1265  C   LEU A 176      31.049 -10.696  35.753  1.00 63.31           C  
ATOM   1266  O   LEU A 176      29.935 -10.582  35.235  1.00 67.52           O  
ATOM   1267  CB  LEU A 176      32.823  -8.958  35.637  1.00 56.73           C  
ATOM   1268  CG  LEU A 176      33.361  -7.546  35.867  1.00 51.28           C  
ATOM   1269  CD1 LEU A 176      32.206  -6.568  36.035  1.00 45.69           C  
ATOM   1270  CD2 LEU A 176      34.248  -7.545  37.070  1.00 51.39           C  
ATOM   1271  N   ARG A 177      31.754 -11.818  35.700  1.00 61.80           N  
ATOM   1272  CA  ARG A 177      31.254 -12.974  34.980  1.00 61.61           C  
ATOM   1273  C   ARG A 177      29.722 -13.093  34.904  1.00 61.10           C  
ATOM   1274  O   ARG A 177      29.128 -12.751  33.883  1.00 58.04           O  
ATOM   1275  CB  ARG A 177      31.869 -14.255  35.552  1.00 62.19           C  
ATOM   1276  CG  ARG A 177      31.594 -15.473  34.696  1.00 62.38           C  
ATOM   1277  CD  ARG A 177      31.919 -15.157  33.254  1.00 60.53           C  
ATOM   1278  NE  ARG A 177      31.518 -16.222  32.347  1.00 61.83           N  
ATOM   1279  CZ  ARG A 177      32.302 -17.223  31.971  1.00 62.55           C  
ATOM   1280  NH1 ARG A 177      31.835 -18.140  31.139  1.00 62.49           N  
ATOM   1281  NH2 ARG A 177      33.550 -17.302  32.412  1.00 61.30           N  
ATOM   1282  N   PRO A 178      29.065 -13.523  36.000  1.00 62.48           N  
ATOM   1283  CA  PRO A 178      27.606 -13.700  36.078  1.00 62.44           C  
ATOM   1284  C   PRO A 178      26.796 -12.714  35.276  1.00 63.27           C  
ATOM   1285  O   PRO A 178      25.920 -13.093  34.507  1.00 65.49           O  
ATOM   1286  CB  PRO A 178      27.315 -13.560  37.566  1.00 60.07           C  
ATOM   1287  CG  PRO A 178      28.529 -14.129  38.184  1.00 62.90           C  
ATOM   1288  CD  PRO A 178      29.637 -13.495  37.358  1.00 62.20           C  
ATOM   1289  N   LEU A 179      27.087 -11.439  35.475  1.00 65.26           N  
ATOM   1290  CA  LEU A 179      26.366 -10.385  34.786  1.00 65.53           C  
ATOM   1291  C   LEU A 179      26.779 -10.255  33.337  1.00 64.76           C  
ATOM   1292  O   LEU A 179      26.007  -9.753  32.526  1.00 65.79           O  
ATOM   1293  CB  LEU A 179      26.570  -9.040  35.494  1.00 66.35           C  
ATOM   1294  CG  LEU A 179      26.092  -8.922  36.943  1.00 64.74           C  
ATOM   1295  CD1 LEU A 179      26.201  -7.478  37.349  1.00 62.66           C  
ATOM   1296  CD2 LEU A 179      24.643  -9.405  37.092  1.00 63.43           C  
ATOM   1297  N   TYR A 180      27.990 -10.686  32.998  1.00 63.10           N  
ATOM   1298  CA  TYR A 180      28.405 -10.565  31.609  1.00 64.79           C  
ATOM   1299  C   TYR A 180      27.626 -11.587  30.820  1.00 65.94           C  
ATOM   1300  O   TYR A 180      27.149 -11.317  29.720  1.00 66.79           O  
ATOM   1301  CB  TYR A 180      29.901 -10.813  31.430  1.00 63.49           C  
ATOM   1302  CG  TYR A 180      30.422 -10.209  30.142  1.00 62.01           C  
ATOM   1303  CD1 TYR A 180      30.404  -8.837  29.946  1.00 61.55           C  
ATOM   1304  CD2 TYR A 180      30.884 -11.005  29.106  1.00 63.87           C  
ATOM   1305  CE1 TYR A 180      30.828  -8.271  28.756  1.00 62.52           C  
ATOM   1306  CE2 TYR A 180      31.309 -10.445  27.901  1.00 63.17           C  
ATOM   1307  CZ  TYR A 180      31.278  -9.076  27.737  1.00 61.98           C  
ATOM   1308  OH  TYR A 180      31.703  -8.505  26.561  1.00 58.69           O  
ATOM   1309  N   GLU A 181      27.490 -12.771  31.399  1.00 67.56           N  
ATOM   1310  CA  GLU A 181      26.748 -13.827  30.746  1.00 66.74           C  
ATOM   1311  C   GLU A 181      25.361 -13.269  30.414  1.00 67.31           C  
ATOM   1312  O   GLU A 181      24.899 -13.397  29.286  1.00 68.31           O  
ATOM   1313  CB  GLU A 181      26.689 -15.066  31.655  1.00 62.55           C  
ATOM   1314  CG  GLU A 181      28.079 -15.453  32.192  1.00 61.96           C  
ATOM   1315  CD  GLU A 181      28.255 -16.939  32.524  1.00 61.54           C  
ATOM   1316  OE1 GLU A 181      27.400 -17.501  33.240  1.00 62.47           O  
ATOM   1317  OE2 GLU A 181      29.267 -17.541  32.079  1.00 52.89           O  
ATOM   1318  N   GLU A 182      24.716 -12.610  31.371  1.00 68.09           N  
ATOM   1319  CA  GLU A 182      23.388 -12.043  31.117  1.00 71.05           C  
ATOM   1320  C   GLU A 182      23.466 -10.903  30.104  1.00 70.00           C  
ATOM   1321  O   GLU A 182      22.557 -10.696  29.307  1.00 70.46           O  
ATOM   1322  CB  GLU A 182      22.770 -11.497  32.408  1.00 73.20           C  
ATOM   1323  CG  GLU A 182      22.781 -12.463  33.585  1.00 81.22           C  
ATOM   1324  CD  GLU A 182      22.211 -11.837  34.853  1.00 84.94           C  
ATOM   1325  OE1 GLU A 182      21.051 -11.361  34.810  1.00 86.93           O  
ATOM   1326  OE2 GLU A 182      22.920 -11.820  35.888  1.00 84.50           O  
ATOM   1327  N   TYR A 183      24.566 -10.164  30.145  1.00 68.10           N  
ATOM   1328  CA  TYR A 183      24.755  -9.024  29.262  1.00 64.54           C  
ATOM   1329  C   TYR A 183      24.740  -9.397  27.777  1.00 63.49           C  
ATOM   1330  O   TYR A 183      23.976  -8.813  27.002  1.00 60.31           O  
ATOM   1331  CB  TYR A 183      26.051  -8.285  29.667  1.00 59.22           C  
ATOM   1332  CG  TYR A 183      26.630  -7.344  28.629  1.00 55.20           C  
ATOM   1333  CD1 TYR A 183      27.791  -7.675  27.944  1.00 54.13           C  
ATOM   1334  CD2 TYR A 183      26.024  -6.133  28.332  1.00 53.06           C  
ATOM   1335  CE1 TYR A 183      28.335  -6.828  26.997  1.00 51.56           C  
ATOM   1336  CE2 TYR A 183      26.565  -5.278  27.380  1.00 50.28           C  
ATOM   1337  CZ  TYR A 183      27.722  -5.633  26.720  1.00 50.22           C  
ATOM   1338  OH  TYR A 183      28.288  -4.786  25.796  1.00 49.68           O  
ATOM   1339  N   VAL A 184      25.556 -10.370  27.377  1.00 63.58           N  
ATOM   1340  CA  VAL A 184      25.595 -10.755  25.969  1.00 65.88           C  
ATOM   1341  C   VAL A 184      24.184 -11.158  25.537  1.00 67.18           C  
ATOM   1342  O   VAL A 184      23.702 -10.717  24.498  1.00 68.43           O  
ATOM   1343  CB  VAL A 184      26.589 -11.937  25.690  1.00 65.75           C  
ATOM   1344  CG1 VAL A 184      27.836 -11.792  26.543  1.00 62.56           C  
ATOM   1345  CG2 VAL A 184      25.910 -13.281  25.925  1.00 67.02           C  
ATOM   1346  N   VAL A 185      23.522 -11.981  26.347  1.00 65.85           N  
ATOM   1347  CA  VAL A 185      22.165 -12.426  26.067  1.00 64.81           C  
ATOM   1348  C   VAL A 185      21.223 -11.240  25.843  1.00 66.43           C  
ATOM   1349  O   VAL A 185      20.786 -10.974  24.724  1.00 66.19           O  
ATOM   1350  CB  VAL A 185      21.616 -13.248  27.233  1.00 64.64           C  
ATOM   1351  CG1 VAL A 185      20.195 -13.671  26.938  1.00 64.52           C  
ATOM   1352  CG2 VAL A 185      22.505 -14.451  27.480  1.00 64.78           C  
ATOM   1353  N   LEU A 186      20.905 -10.525  26.914  1.00 68.20           N  
ATOM   1354  CA  LEU A 186      20.014  -9.375  26.811  1.00 70.18           C  
ATOM   1355  C   LEU A 186      20.363  -8.470  25.636  1.00 71.04           C  
ATOM   1356  O   LEU A 186      19.522  -8.161  24.797  1.00 70.57           O  
ATOM   1357  CB  LEU A 186      20.052  -8.548  28.099  1.00 69.27           C  
ATOM   1358  CG  LEU A 186      19.268  -9.079  29.297  1.00 68.67           C  
ATOM   1359  CD1 LEU A 186      17.881  -9.463  28.803  1.00 68.20           C  
ATOM   1360  CD2 LEU A 186      19.966 -10.273  29.936  1.00 68.40           C  
ATOM   1361  N   LYS A 187      21.616  -8.046  25.588  1.00 72.86           N  
ATOM   1362  CA  LYS A 187      22.079  -7.156  24.540  1.00 73.79           C  
ATOM   1363  C   LYS A 187      21.871  -7.787  23.153  1.00 74.12           C  
ATOM   1364  O   LYS A 187      21.499  -7.100  22.199  1.00 71.93           O  
ATOM   1365  CB  LYS A 187      23.560  -6.835  24.787  1.00 74.90           C  
ATOM   1366  CG  LYS A 187      24.017  -5.429  24.389  1.00 75.15           C  
ATOM   1367  CD  LYS A 187      23.468  -4.354  25.314  1.00 72.75           C  
ATOM   1368  CE  LYS A 187      24.104  -3.011  25.002  1.00 72.36           C  
ATOM   1369  NZ  LYS A 187      23.523  -1.910  25.813  1.00 73.12           N  
ATOM   1370  N   ASN A 188      22.102  -9.095  23.057  1.00 75.59           N  
ATOM   1371  CA  ASN A 188      21.954  -9.839  21.801  1.00 77.16           C  
ATOM   1372  C   ASN A 188      20.510  -9.765  21.319  1.00 79.93           C  
ATOM   1373  O   ASN A 188      20.239  -9.386  20.180  1.00 79.78           O  
ATOM   1374  CB  ASN A 188      22.339 -11.304  22.014  1.00 73.74           C  
ATOM   1375  CG  ASN A 188      23.454 -11.755  21.105  1.00 71.80           C  
ATOM   1376  OD1 ASN A 188      24.108 -10.948  20.448  1.00 73.07           O  
ATOM   1377  ND2 ASN A 188      23.686 -13.059  21.071  1.00 71.24           N  
ATOM   1378  N   GLU A 189      19.593 -10.145  22.203  1.00 81.55           N  
ATOM   1379  CA  GLU A 189      18.171 -10.116  21.910  1.00 84.27           C  
ATOM   1380  C   GLU A 189      17.787  -8.742  21.360  1.00 85.89           C  
ATOM   1381  O   GLU A 189      17.036  -8.635  20.398  1.00 86.97           O  
ATOM   1382  CB  GLU A 189      17.382 -10.400  23.189  1.00 85.07           C  
ATOM   1383  CG  GLU A 189      15.878 -10.513  23.000  1.00 87.02           C  
ATOM   1384  CD  GLU A 189      15.157 -10.807  24.301  1.00 88.20           C  
ATOM   1385  OE1 GLU A 189      15.672 -11.636  25.080  1.00 88.71           O  
ATOM   1386  OE2 GLU A 189      14.076 -10.221  24.544  1.00 89.40           O  
ATOM   1387  N   MET A 190      18.305  -7.691  21.981  1.00 88.49           N  
ATOM   1388  CA  MET A 190      18.020  -6.329  21.544  1.00 89.87           C  
ATOM   1389  C   MET A 190      18.533  -6.140  20.125  1.00 89.31           C  
ATOM   1390  O   MET A 190      17.834  -5.604  19.265  1.00 89.10           O  
ATOM   1391  CB  MET A 190      18.686  -5.322  22.501  1.00 91.89           C  
ATOM   1392  CG  MET A 190      18.738  -3.877  22.007  1.00 94.77           C  
ATOM   1393  SD  MET A 190      20.214  -3.471  21.016  1.00 99.73           S  
ATOM   1394  CE  MET A 190      21.149  -2.452  22.180  1.00 99.70           C  
ATOM   1395  N   ALA A 191      19.756  -6.597  19.884  1.00 88.86           N  
ATOM   1396  CA  ALA A 191      20.378  -6.474  18.572  1.00 89.12           C  
ATOM   1397  C   ALA A 191      19.569  -7.177  17.498  1.00 88.80           C  
ATOM   1398  O   ALA A 191      18.917  -6.535  16.674  1.00 87.74           O  
ATOM   1399  CB  ALA A 191      21.792  -7.052  18.605  1.00 88.86           C  
ATOM   1400  N   ARG A 192      19.626  -8.505  17.522  1.00 88.36           N  
ATOM   1401  CA  ARG A 192      18.938  -9.341  16.551  1.00 86.85           C  
ATOM   1402  C   ARG A 192      17.475  -8.966  16.339  1.00 85.96           C  
ATOM   1403  O   ARG A 192      16.973  -9.042  15.221  1.00 88.47           O  
ATOM   1404  CB  ARG A 192      19.074 -10.813  16.955  1.00 86.15           C  
ATOM   1405  CG  ARG A 192      20.529 -11.287  17.006  1.00 88.44           C  
ATOM   1406  CD  ARG A 192      20.643 -12.711  17.504  1.00 89.01           C  
ATOM   1407  NE  ARG A 192      19.722 -12.931  18.613  1.00 94.71           N  
ATOM   1408  CZ  ARG A 192      19.701 -14.019  19.375  1.00 96.39           C  
ATOM   1409  NH1 ARG A 192      18.814 -14.118  20.357  1.00 96.59           N  
ATOM   1410  NH2 ARG A 192      20.573 -15.000  19.167  1.00 96.98           N  
ATOM   1411  N   ALA A 193      16.787  -8.551  17.394  1.00 84.42           N  
ATOM   1412  CA  ALA A 193      15.390  -8.168  17.248  1.00 81.95           C  
ATOM   1413  C   ALA A 193      15.337  -6.796  16.592  1.00 81.51           C  
ATOM   1414  O   ALA A 193      14.293  -6.141  16.561  1.00 80.98           O  
ATOM   1415  CB  ALA A 193      14.703  -8.141  18.602  1.00 81.79           C  
ATOM   1416  N   ASN A 194      16.484  -6.362  16.077  1.00 81.46           N  
ATOM   1417  CA  ASN A 194      16.588  -5.078  15.394  1.00 80.87           C  
ATOM   1418  C   ASN A 194      17.125  -5.266  13.981  1.00 79.21           C  
ATOM   1419  O   ASN A 194      17.648  -4.336  13.370  1.00 77.83           O  
ATOM   1420  CB  ASN A 194      17.478  -4.103  16.172  1.00 80.12           C  
ATOM   1421  CG  ASN A 194      16.695  -2.935  16.737  1.00 79.51           C  
ATOM   1422  OD1 ASN A 194      15.987  -2.236  16.005  1.00 75.71           O  
ATOM   1423  ND2 ASN A 194      16.813  -2.718  18.046  1.00 79.47           N  
ATOM   1424  N   HIS A 195      16.990  -6.489  13.478  1.00 77.63           N  
ATOM   1425  CA  HIS A 195      17.403  -6.817  12.127  1.00 75.42           C  
ATOM   1426  C   HIS A 195      18.899  -6.990  11.970  1.00 73.22           C  
ATOM   1427  O   HIS A 195      19.439  -6.699  10.904  1.00 75.75           O  
ATOM   1428  CB  HIS A 195      16.895  -5.734  11.168  1.00 77.31           C  
ATOM   1429  CG  HIS A 195      15.439  -5.413  11.342  1.00 81.73           C  
ATOM   1430  ND1 HIS A 195      14.911  -4.168  11.068  1.00 81.81           N  
ATOM   1431  CD2 HIS A 195      14.405  -6.170  11.786  1.00 80.73           C  
ATOM   1432  CE1 HIS A 195      13.617  -4.171  11.339  1.00 81.61           C  
ATOM   1433  NE2 HIS A 195      13.285  -5.374  11.776  1.00 80.52           N  
ATOM   1434  N   TYR A 196      19.571  -7.454  13.020  1.00 69.05           N  
ATOM   1435  CA  TYR A 196      21.016  -7.677  12.958  1.00 65.98           C  
ATOM   1436  C   TYR A 196      21.284  -9.107  13.385  1.00 65.02           C  
ATOM   1437  O   TYR A 196      20.455  -9.720  14.039  1.00 61.29           O  
ATOM   1438  CB  TYR A 196      21.772  -6.714  13.884  1.00 65.62           C  
ATOM   1439  CG  TYR A 196      21.786  -5.252  13.456  1.00 63.52           C  
ATOM   1440  CD1 TYR A 196      22.582  -4.812  12.398  1.00 62.10           C  
ATOM   1441  CD2 TYR A 196      21.011  -4.309  14.124  1.00 60.41           C  
ATOM   1442  CE1 TYR A 196      22.599  -3.465  12.025  1.00 60.81           C  
ATOM   1443  CE2 TYR A 196      21.021  -2.972  13.755  1.00 57.69           C  
ATOM   1444  CZ  TYR A 196      21.810  -2.555  12.713  1.00 59.11           C  
ATOM   1445  OH  TYR A 196      21.796  -1.221  12.368  1.00 60.98           O  
ATOM   1446  N   GLU A 197      22.447  -9.630  13.020  1.00 68.40           N  
ATOM   1447  CA  GLU A 197      22.814 -11.007  13.345  1.00 72.07           C  
ATOM   1448  C   GLU A 197      23.122 -11.213  14.813  1.00 73.87           C  
ATOM   1449  O   GLU A 197      22.982 -12.316  15.343  1.00 74.41           O  
ATOM   1450  CB  GLU A 197      24.012 -11.425  12.500  1.00 71.77           C  
ATOM   1451  CG  GLU A 197      23.693 -11.408  11.025  1.00 73.67           C  
ATOM   1452  CD  GLU A 197      24.905 -11.177  10.165  1.00 75.65           C  
ATOM   1453  OE1 GLU A 197      25.871 -11.970  10.282  1.00 75.47           O  
ATOM   1454  OE2 GLU A 197      24.880 -10.202   9.375  1.00 72.82           O  
ATOM   1455  N   ASP A 198      23.550 -10.138  15.461  1.00 77.05           N  
ATOM   1456  CA  ASP A 198      23.877 -10.152  16.883  1.00 78.54           C  
ATOM   1457  C   ASP A 198      24.271  -8.745  17.279  1.00 77.09           C  
ATOM   1458  O   ASP A 198      24.077  -7.803  16.517  1.00 78.85           O  
ATOM   1459  CB  ASP A 198      25.024 -11.126  17.164  1.00 78.90           C  
ATOM   1460  CG  ASP A 198      26.207 -10.901  16.261  1.00 81.22           C  
ATOM   1461  OD1 ASP A 198      26.642 -11.868  15.591  1.00 83.90           O  
ATOM   1462  OD2 ASP A 198      26.699  -9.755  16.225  1.00 80.08           O  
ATOM   1463  N   TYR A 199      24.821  -8.590  18.469  1.00 75.74           N  
ATOM   1464  CA  TYR A 199      25.220  -7.266  18.903  1.00 74.93           C  
ATOM   1465  C   TYR A 199      26.483  -6.853  18.150  1.00 74.41           C  
ATOM   1466  O   TYR A 199      26.633  -5.696  17.771  1.00 76.00           O  
ATOM   1467  CB  TYR A 199      25.446  -7.272  20.414  1.00 75.14           C  
ATOM   1468  CG  TYR A 199      25.699  -5.919  21.021  1.00 74.65           C  
ATOM   1469  CD1 TYR A 199      24.898  -4.830  20.719  1.00 73.28           C  
ATOM   1470  CD2 TYR A 199      26.731  -5.739  21.918  1.00 77.23           C  
ATOM   1471  CE1 TYR A 199      25.130  -3.597  21.303  1.00 75.56           C  
ATOM   1472  CE2 TYR A 199      26.969  -4.520  22.504  1.00 77.71           C  
ATOM   1473  CZ  TYR A 199      26.176  -3.453  22.198  1.00 76.22           C  
ATOM   1474  OH  TYR A 199      26.460  -2.247  22.791  1.00 75.58           O  
ATOM   1475  N   GLY A 200      27.380  -7.807  17.914  1.00 72.28           N  
ATOM   1476  CA  GLY A 200      28.606  -7.500  17.200  1.00 69.26           C  
ATOM   1477  C   GLY A 200      28.285  -6.946  15.832  1.00 68.64           C  
ATOM   1478  O   GLY A 200      28.850  -5.950  15.396  1.00 67.03           O  
ATOM   1479  N   ASP A 201      27.364  -7.610  15.146  1.00 70.47           N  
ATOM   1480  CA  ASP A 201      26.938  -7.184  13.820  1.00 68.28           C  
ATOM   1481  C   ASP A 201      26.470  -5.742  13.962  1.00 64.28           C  
ATOM   1482  O   ASP A 201      26.583  -4.954  13.033  1.00 63.00           O  
ATOM   1483  CB  ASP A 201      25.805  -8.096  13.314  1.00 68.88           C  
ATOM   1484  CG  ASP A 201      25.278  -7.684  11.951  1.00 70.43           C  
ATOM   1485  OD1 ASP A 201      26.098  -7.406  11.047  1.00 68.29           O  
ATOM   1486  OD2 ASP A 201      24.038  -7.647  11.784  1.00 72.13           O  
ATOM   1487  N   TYR A 202      25.960  -5.406  15.142  1.00 60.55           N  
ATOM   1488  CA  TYR A 202      25.506  -4.054  15.420  1.00 60.20           C  
ATOM   1489  C   TYR A 202      26.701  -3.073  15.484  1.00 60.59           C  
ATOM   1490  O   TYR A 202      26.780  -2.124  14.699  1.00 60.70           O  
ATOM   1491  CB  TYR A 202      24.729  -4.027  16.734  1.00 59.85           C  
ATOM   1492  CG  TYR A 202      24.185  -2.666  17.098  1.00 64.71           C  
ATOM   1493  CD1 TYR A 202      23.197  -2.063  16.334  1.00 66.42           C  
ATOM   1494  CD2 TYR A 202      24.660  -1.982  18.209  1.00 66.86           C  
ATOM   1495  CE1 TYR A 202      22.693  -0.822  16.665  1.00 68.68           C  
ATOM   1496  CE2 TYR A 202      24.166  -0.738  18.546  1.00 69.13           C  
ATOM   1497  CZ  TYR A 202      23.181  -0.163  17.770  1.00 70.58           C  
ATOM   1498  OH  TYR A 202      22.692   1.083  18.098  1.00 72.73           O  
ATOM   1499  N   TRP A 203      27.635  -3.292  16.404  1.00 57.81           N  
ATOM   1500  CA  TRP A 203      28.784  -2.396  16.500  1.00 55.85           C  
ATOM   1501  C   TRP A 203      29.539  -2.329  15.184  1.00 54.19           C  
ATOM   1502  O   TRP A 203      30.323  -1.405  14.976  1.00 55.20           O  
ATOM   1503  CB  TRP A 203      29.795  -2.856  17.555  1.00 61.07           C  
ATOM   1504  CG  TRP A 203      29.466  -2.607  18.971  1.00 61.78           C  
ATOM   1505  CD1 TRP A 203      28.606  -1.681  19.470  1.00 62.82           C  
ATOM   1506  CD2 TRP A 203      30.060  -3.255  20.093  1.00 64.22           C  
ATOM   1507  NE1 TRP A 203      28.627  -1.711  20.843  1.00 63.94           N  
ATOM   1508  CE2 TRP A 203      29.516  -2.670  21.250  1.00 65.18           C  
ATOM   1509  CE3 TRP A 203      31.007  -4.274  20.232  1.00 67.49           C  
ATOM   1510  CZ2 TRP A 203      29.885  -3.071  22.536  1.00 66.35           C  
ATOM   1511  CZ3 TRP A 203      31.376  -4.673  21.512  1.00 69.84           C  
ATOM   1512  CH2 TRP A 203      30.815  -4.070  22.646  1.00 67.29           C  
ATOM   1513  N   ARG A 204      29.369  -3.334  14.326  1.00 50.95           N  
ATOM   1514  CA  ARG A 204      30.072  -3.329  13.049  1.00 48.37           C  
ATOM   1515  C   ARG A 204      29.269  -2.404  12.185  1.00 48.01           C  
ATOM   1516  O   ARG A 204      29.709  -1.984  11.114  1.00 47.36           O  
ATOM   1517  CB  ARG A 204      30.121  -4.718  12.415  1.00 50.87           C  
ATOM   1518  CG  ARG A 204      31.275  -5.622  12.880  1.00 52.89           C  
ATOM   1519  CD  ARG A 204      31.467  -6.821  11.913  1.00 54.31           C  
ATOM   1520  NE  ARG A 204      30.318  -7.731  11.838  1.00 47.81           N  
ATOM   1521  CZ  ARG A 204      30.025  -8.634  12.766  1.00 46.23           C  
ATOM   1522  NH1 ARG A 204      30.796  -8.757  13.837  1.00 43.44           N  
ATOM   1523  NH2 ARG A 204      28.950  -9.401  12.637  1.00 48.37           N  
ATOM   1524  N   GLY A 205      28.080  -2.083  12.688  1.00 46.62           N  
ATOM   1525  CA  GLY A 205      27.185  -1.189  11.993  1.00 43.98           C  
ATOM   1526  C   GLY A 205      27.912   0.098  11.716  1.00 44.67           C  
ATOM   1527  O   GLY A 205      28.122   0.442  10.561  1.00 46.96           O  
ATOM   1528  N   ASP A 206      28.310   0.783  12.785  1.00 44.26           N  
ATOM   1529  CA  ASP A 206      29.026   2.055  12.729  1.00 45.42           C  
ATOM   1530  C   ASP A 206      29.795   2.290  11.445  1.00 47.86           C  
ATOM   1531  O   ASP A 206      29.726   3.373  10.859  1.00 48.97           O  
ATOM   1532  CB  ASP A 206      29.987   2.148  13.905  1.00 47.97           C  
ATOM   1533  CG  ASP A 206      30.598   3.528  14.064  1.00 49.97           C  
ATOM   1534  OD1 ASP A 206      31.254   4.046  13.129  1.00 51.01           O  
ATOM   1535  OD2 ASP A 206      30.423   4.094  15.152  1.00 51.44           O  
ATOM   1536  N   TYR A 207      30.534   1.281  11.008  1.00 50.06           N  
ATOM   1537  CA  TYR A 207      31.316   1.399   9.784  1.00 55.37           C  
ATOM   1538  C   TYR A 207      30.541   1.324   8.465  1.00 56.71           C  
ATOM   1539  O   TYR A 207      31.070   1.666   7.405  1.00 55.69           O  
ATOM   1540  CB  TYR A 207      32.402   0.335   9.772  1.00 56.31           C  
ATOM   1541  CG  TYR A 207      33.488   0.611  10.767  1.00 58.20           C  
ATOM   1542  CD1 TYR A 207      33.347   0.230  12.096  1.00 60.21           C  
ATOM   1543  CD2 TYR A 207      34.645   1.282  10.386  1.00 55.51           C  
ATOM   1544  CE1 TYR A 207      34.328   0.507  13.018  1.00 57.80           C  
ATOM   1545  CE2 TYR A 207      35.624   1.563  11.297  1.00 55.64           C  
ATOM   1546  CZ  TYR A 207      35.458   1.174  12.611  1.00 57.55           C  
ATOM   1547  OH  TYR A 207      36.423   1.462  13.530  1.00 59.44           O  
ATOM   1548  N   GLU A 208      29.290   0.889   8.532  1.00 58.11           N  
ATOM   1549  CA  GLU A 208      28.465   0.738   7.344  1.00 61.74           C  
ATOM   1550  C   GLU A 208      27.991   1.997   6.627  1.00 63.54           C  
ATOM   1551  O   GLU A 208      27.650   3.000   7.256  1.00 65.48           O  
ATOM   1552  CB  GLU A 208      27.250  -0.121   7.677  1.00 62.49           C  
ATOM   1553  CG  GLU A 208      26.212  -0.158   6.575  1.00 63.28           C  
ATOM   1554  CD  GLU A 208      25.186  -1.245   6.797  1.00 66.74           C  
ATOM   1555  OE1 GLU A 208      24.802  -1.492   7.965  1.00 68.19           O  
ATOM   1556  OE2 GLU A 208      24.757  -1.850   5.798  1.00 67.82           O  
ATOM   1557  N   VAL A 209      27.991   1.925   5.296  1.00 64.21           N  
ATOM   1558  CA  VAL A 209      27.527   3.007   4.435  1.00 65.72           C  
ATOM   1559  C   VAL A 209      26.824   2.327   3.249  1.00 69.79           C  
ATOM   1560  O   VAL A 209      27.333   1.351   2.689  1.00 70.06           O  
ATOM   1561  CB  VAL A 209      28.690   3.922   3.914  1.00 61.34           C  
ATOM   1562  CG1 VAL A 209      29.799   3.994   4.923  1.00 60.33           C  
ATOM   1563  CG2 VAL A 209      29.187   3.444   2.599  1.00 58.56           C  
ATOM   1564  N   ASN A 210      25.637   2.826   2.899  1.00 71.63           N  
ATOM   1565  CA  ASN A 210      24.843   2.273   1.804  1.00 70.17           C  
ATOM   1566  C   ASN A 210      24.599   3.327   0.752  1.00 71.49           C  
ATOM   1567  O   ASN A 210      25.332   3.410  -0.234  1.00 74.21           O  
ATOM   1568  CB  ASN A 210      23.498   1.779   2.323  1.00 69.30           C  
ATOM   1569  CG  ASN A 210      23.635   0.582   3.231  1.00 72.29           C  
ATOM   1570  OD1 ASN A 210      22.999   0.506   4.290  1.00 71.76           O  
ATOM   1571  ND2 ASN A 210      24.467  -0.371   2.819  1.00 71.99           N  
ATOM   1572  N   GLY A 211      23.561   4.127   0.978  1.00 69.56           N  
ATOM   1573  CA  GLY A 211      23.196   5.185   0.055  1.00 70.89           C  
ATOM   1574  C   GLY A 211      24.096   5.375  -1.157  1.00 70.84           C  
ATOM   1575  O   GLY A 211      23.722   5.049  -2.277  1.00 69.89           O  
ATOM   1576  N   VAL A 212      25.290   5.907  -0.928  1.00 71.66           N  
ATOM   1577  CA  VAL A 212      26.237   6.153  -2.001  1.00 70.61           C  
ATOM   1578  C   VAL A 212      26.754   4.867  -2.640  1.00 71.99           C  
ATOM   1579  O   VAL A 212      26.943   3.847  -1.977  1.00 71.59           O  
ATOM   1580  CB  VAL A 212      27.426   6.980  -1.495  1.00 70.25           C  
ATOM   1581  CG1 VAL A 212      28.282   7.426  -2.672  1.00 68.36           C  
ATOM   1582  CG2 VAL A 212      26.918   8.178  -0.686  1.00 64.77           C  
ATOM   1583  N   ASP A 213      26.981   4.939  -3.946  1.00 74.43           N  
ATOM   1584  CA  ASP A 213      27.451   3.810  -4.731  1.00 75.48           C  
ATOM   1585  C   ASP A 213      28.941   3.978  -5.019  1.00 74.43           C  
ATOM   1586  O   ASP A 213      29.397   5.063  -5.390  1.00 71.78           O  
ATOM   1587  CB  ASP A 213      26.632   3.730  -6.037  1.00 78.85           C  
ATOM   1588  CG  ASP A 213      27.006   2.528  -6.910  1.00 83.79           C  
ATOM   1589  OD1 ASP A 213      27.104   1.397  -6.378  1.00 84.42           O  
ATOM   1590  OD2 ASP A 213      27.189   2.715  -8.140  1.00 84.90           O  
ATOM   1591  N   GLY A 214      29.696   2.900  -4.845  1.00 73.43           N  
ATOM   1592  CA  GLY A 214      31.126   2.970  -5.081  1.00 72.13           C  
ATOM   1593  C   GLY A 214      31.775   3.413  -3.792  1.00 69.88           C  
ATOM   1594  O   GLY A 214      32.998   3.461  -3.656  1.00 68.83           O  
ATOM   1595  N   TYR A 215      30.920   3.740  -2.835  1.00 66.88           N  
ATOM   1596  CA  TYR A 215      31.358   4.187  -1.534  1.00 63.43           C  
ATOM   1597  C   TYR A 215      30.710   3.310  -0.497  1.00 64.03           C  
ATOM   1598  O   TYR A 215      31.077   3.339   0.672  1.00 63.97           O  
ATOM   1599  CB  TYR A 215      30.965   5.639  -1.322  1.00 57.42           C  
ATOM   1600  CG  TYR A 215      31.813   6.572  -2.137  1.00 57.96           C  
ATOM   1601  CD1 TYR A 215      31.877   6.466  -3.514  1.00 55.09           C  
ATOM   1602  CD2 TYR A 215      32.583   7.541  -1.528  1.00 59.48           C  
ATOM   1603  CE1 TYR A 215      32.684   7.297  -4.249  1.00 52.34           C  
ATOM   1604  CE2 TYR A 215      33.391   8.371  -2.261  1.00 55.90           C  
ATOM   1605  CZ  TYR A 215      33.438   8.244  -3.613  1.00 52.78           C  
ATOM   1606  OH  TYR A 215      34.267   9.068  -4.318  1.00 53.98           O  
ATOM   1607  N   ASP A 216      29.742   2.520  -0.934  1.00 64.40           N  
ATOM   1608  CA  ASP A 216      29.057   1.636  -0.019  1.00 66.54           C  
ATOM   1609  C   ASP A 216      30.085   0.736   0.655  1.00 63.42           C  
ATOM   1610  O   ASP A 216      31.027   0.279   0.014  1.00 63.10           O  
ATOM   1611  CB  ASP A 216      28.000   0.813  -0.785  1.00 74.99           C  
ATOM   1612  CG  ASP A 216      27.666  -0.526  -0.106  1.00 83.75           C  
ATOM   1613  OD1 ASP A 216      28.272  -1.562  -0.487  1.00 85.67           O  
ATOM   1614  OD2 ASP A 216      26.802  -0.541   0.807  1.00 86.89           O  
ATOM   1615  N   TYR A 217      29.921   0.529   1.961  1.00 60.66           N  
ATOM   1616  CA  TYR A 217      30.792  -0.351   2.746  1.00 58.16           C  
ATOM   1617  C   TYR A 217      29.823  -1.221   3.564  1.00 57.43           C  
ATOM   1618  O   TYR A 217      28.873  -0.713   4.161  1.00 57.54           O  
ATOM   1619  CB  TYR A 217      31.716   0.461   3.678  1.00 56.11           C  
ATOM   1620  CG  TYR A 217      32.815  -0.363   4.323  1.00 52.84           C  
ATOM   1621  CD1 TYR A 217      34.052  -0.510   3.717  1.00 48.38           C  
ATOM   1622  CD2 TYR A 217      32.585  -1.050   5.514  1.00 53.98           C  
ATOM   1623  CE1 TYR A 217      35.039  -1.332   4.279  1.00 52.48           C  
ATOM   1624  CE2 TYR A 217      33.553  -1.870   6.082  1.00 52.69           C  
ATOM   1625  CZ  TYR A 217      34.781  -2.016   5.464  1.00 54.21           C  
ATOM   1626  OH  TYR A 217      35.729  -2.860   6.025  1.00 48.58           O  
ATOM   1627  N   SER A 218      30.046  -2.530   3.574  1.00 55.45           N  
ATOM   1628  CA  SER A 218      29.164  -3.435   4.295  1.00 55.27           C  
ATOM   1629  C   SER A 218      29.681  -3.808   5.670  1.00 56.18           C  
ATOM   1630  O   SER A 218      30.835  -3.570   5.987  1.00 58.02           O  
ATOM   1631  CB  SER A 218      28.931  -4.694   3.464  1.00 54.23           C  
ATOM   1632  OG  SER A 218      30.046  -4.976   2.638  1.00 54.28           O  
ATOM   1633  N   ARG A 219      28.824  -4.387   6.497  1.00 56.40           N  
ATOM   1634  CA  ARG A 219      29.256  -4.764   7.824  1.00 58.97           C  
ATOM   1635  C   ARG A 219      30.172  -5.973   7.789  1.00 61.37           C  
ATOM   1636  O   ARG A 219      31.254  -5.953   8.362  1.00 62.24           O  
ATOM   1637  CB  ARG A 219      28.052  -5.041   8.718  1.00 58.57           C  
ATOM   1638  CG  ARG A 219      27.221  -3.804   8.983  1.00 61.63           C  
ATOM   1639  CD  ARG A 219      26.369  -3.979  10.226  1.00 65.90           C  
ATOM   1640  NE  ARG A 219      25.442  -5.093  10.090  1.00 66.87           N  
ATOM   1641  CZ  ARG A 219      24.364  -5.069   9.317  1.00 66.84           C  
ATOM   1642  NH1 ARG A 219      24.073  -3.981   8.614  1.00 61.85           N  
ATOM   1643  NH2 ARG A 219      23.586  -6.140   9.243  1.00 69.03           N  
ATOM   1644  N   GLY A 220      29.744  -7.025   7.107  1.00 63.97           N  
ATOM   1645  CA  GLY A 220      30.562  -8.220   7.038  1.00 66.62           C  
ATOM   1646  C   GLY A 220      31.950  -7.922   6.512  1.00 67.53           C  
ATOM   1647  O   GLY A 220      32.888  -8.708   6.707  1.00 67.02           O  
ATOM   1648  N   GLN A 221      32.070  -6.781   5.834  1.00 66.53           N  
ATOM   1649  CA  GLN A 221      33.336  -6.342   5.264  1.00 66.17           C  
ATOM   1650  C   GLN A 221      34.300  -5.973   6.392  1.00 66.81           C  
ATOM   1651  O   GLN A 221      35.333  -6.622   6.559  1.00 68.97           O  
ATOM   1652  CB  GLN A 221      33.109  -5.137   4.358  1.00 65.62           C  
ATOM   1653  CG  GLN A 221      34.333  -4.703   3.601  1.00 70.75           C  
ATOM   1654  CD  GLN A 221      34.711  -5.674   2.504  1.00 75.90           C  
ATOM   1655  OE1 GLN A 221      33.943  -5.890   1.566  1.00 78.90           O  
ATOM   1656  NE2 GLN A 221      35.901  -6.267   2.612  1.00 77.33           N  
ATOM   1657  N   LEU A 222      33.952  -4.942   7.165  1.00 65.06           N  
ATOM   1658  CA  LEU A 222      34.765  -4.481   8.294  1.00 61.96           C  
ATOM   1659  C   LEU A 222      35.576  -5.651   8.858  1.00 64.10           C  
ATOM   1660  O   LEU A 222      36.769  -5.510   9.152  1.00 63.34           O  
ATOM   1661  CB  LEU A 222      33.854  -3.875   9.377  1.00 56.49           C  
ATOM   1662  CG  LEU A 222      34.334  -3.152  10.652  1.00 51.94           C  
ATOM   1663  CD1 LEU A 222      34.652  -4.150  11.720  1.00 52.57           C  
ATOM   1664  CD2 LEU A 222      35.521  -2.268  10.373  1.00 48.18           C  
ATOM   1665  N   ILE A 223      34.948  -6.816   8.991  1.00 62.94           N  
ATOM   1666  CA  ILE A 223      35.693  -7.946   9.505  1.00 63.82           C  
ATOM   1667  C   ILE A 223      36.859  -8.242   8.581  1.00 65.44           C  
ATOM   1668  O   ILE A 223      37.973  -7.788   8.821  1.00 66.39           O  
ATOM   1669  CB  ILE A 223      34.850  -9.224   9.621  1.00 63.27           C  
ATOM   1670  CG1 ILE A 223      33.694  -9.016  10.589  1.00 62.64           C  
ATOM   1671  CG2 ILE A 223      35.719 -10.363  10.146  1.00 59.77           C  
ATOM   1672  CD1 ILE A 223      32.979 -10.302  10.930  1.00 63.32           C  
ATOM   1673  N   GLU A 224      36.589  -8.984   7.512  1.00 67.98           N  
ATOM   1674  CA  GLU A 224      37.624  -9.375   6.561  1.00 70.37           C  
ATOM   1675  C   GLU A 224      38.529  -8.253   6.058  1.00 68.48           C  
ATOM   1676  O   GLU A 224      39.546  -8.504   5.409  1.00 67.04           O  
ATOM   1677  CB  GLU A 224      37.001 -10.125   5.383  1.00 75.53           C  
ATOM   1678  CG  GLU A 224      36.024  -9.334   4.548  1.00 82.38           C  
ATOM   1679  CD  GLU A 224      35.616 -10.090   3.295  1.00 87.75           C  
ATOM   1680  OE1 GLU A 224      35.019 -11.185   3.424  1.00 88.38           O  
ATOM   1681  OE2 GLU A 224      35.900  -9.590   2.180  1.00 90.83           O  
ATOM   1682  N   ASP A 225      38.172  -7.016   6.370  1.00 67.52           N  
ATOM   1683  CA  ASP A 225      38.994  -5.889   5.965  1.00 66.11           C  
ATOM   1684  C   ASP A 225      40.064  -5.708   7.035  1.00 62.33           C  
ATOM   1685  O   ASP A 225      41.152  -5.234   6.745  1.00 60.24           O  
ATOM   1686  CB  ASP A 225      38.140  -4.630   5.823  1.00 71.03           C  
ATOM   1687  CG  ASP A 225      38.444  -3.865   4.551  1.00 72.36           C  
ATOM   1688  OD1 ASP A 225      38.736  -4.524   3.529  1.00 73.50           O  
ATOM   1689  OD2 ASP A 225      38.375  -2.614   4.571  1.00 72.94           O  
ATOM   1690  N   VAL A 226      39.735  -6.085   8.272  1.00 60.37           N  
ATOM   1691  CA  VAL A 226      40.676  -6.026   9.392  1.00 59.42           C  
ATOM   1692  C   VAL A 226      41.587  -7.236   9.236  1.00 59.26           C  
ATOM   1693  O   VAL A 226      42.796  -7.159   9.457  1.00 56.11           O  
ATOM   1694  CB  VAL A 226      39.966  -6.142  10.745  1.00 60.32           C  
ATOM   1695  CG1 VAL A 226      40.988  -6.228  11.861  1.00 59.27           C  
ATOM   1696  CG2 VAL A 226      39.068  -4.948  10.962  1.00 62.56           C  
ATOM   1697  N   GLU A 227      40.972  -8.357   8.864  1.00 60.74           N  
ATOM   1698  CA  GLU A 227      41.667  -9.614   8.608  1.00 61.80           C  
ATOM   1699  C   GLU A 227      42.853  -9.315   7.691  1.00 62.31           C  
ATOM   1700  O   GLU A 227      44.008  -9.375   8.112  1.00 62.24           O  
ATOM   1701  CB  GLU A 227      40.739 -10.589   7.876  1.00 62.76           C  
ATOM   1702  CG  GLU A 227      39.397 -10.836   8.536  1.00 66.15           C  
ATOM   1703  CD  GLU A 227      39.484 -11.814   9.674  1.00 71.00           C  
ATOM   1704  OE1 GLU A 227      38.423 -12.270  10.159  1.00 71.34           O  
ATOM   1705  OE2 GLU A 227      40.622 -12.124  10.086  1.00 77.11           O  
ATOM   1706  N   HIS A 228      42.540  -8.995   6.434  1.00 61.57           N  
ATOM   1707  CA  HIS A 228      43.533  -8.680   5.411  1.00 60.96           C  
ATOM   1708  C   HIS A 228      44.588  -7.710   5.923  1.00 59.07           C  
ATOM   1709  O   HIS A 228      45.774  -8.012   5.954  1.00 61.50           O  
ATOM   1710  CB  HIS A 228      42.827  -8.089   4.188  1.00 65.50           C  
ATOM   1711  CG  HIS A 228      43.753  -7.609   3.108  1.00 72.10           C  
ATOM   1712  ND1 HIS A 228      44.696  -6.622   3.312  1.00 76.01           N  
ATOM   1713  CD2 HIS A 228      43.838  -7.941   1.797  1.00 73.57           C  
ATOM   1714  CE1 HIS A 228      45.320  -6.364   2.175  1.00 74.01           C  
ATOM   1715  NE2 HIS A 228      44.817  -7.150   1.241  1.00 75.46           N  
ATOM   1716  N   THR A 229      44.153  -6.534   6.330  1.00 58.04           N  
ATOM   1717  CA  THR A 229      45.068  -5.526   6.841  1.00 56.67           C  
ATOM   1718  C   THR A 229      45.943  -6.050   8.002  1.00 53.97           C  
ATOM   1719  O   THR A 229      47.000  -5.499   8.288  1.00 48.95           O  
ATOM   1720  CB  THR A 229      44.257  -4.268   7.285  1.00 56.59           C  
ATOM   1721  OG1 THR A 229      45.148  -3.212   7.640  1.00 63.00           O  
ATOM   1722  CG2 THR A 229      43.380  -4.585   8.466  1.00 52.58           C  
ATOM   1723  N   PHE A 230      45.505  -7.124   8.655  1.00 54.55           N  
ATOM   1724  CA  PHE A 230      46.245  -7.687   9.784  1.00 55.55           C  
ATOM   1725  C   PHE A 230      47.488  -8.481   9.397  1.00 57.45           C  
ATOM   1726  O   PHE A 230      48.459  -8.521  10.159  1.00 55.34           O  
ATOM   1727  CB  PHE A 230      45.329  -8.571  10.635  1.00 53.08           C  
ATOM   1728  CG  PHE A 230      45.955  -9.030  11.930  1.00 54.03           C  
ATOM   1729  CD1 PHE A 230      46.644  -8.138  12.740  1.00 54.91           C  
ATOM   1730  CD2 PHE A 230      45.817 -10.333  12.362  1.00 51.66           C  
ATOM   1731  CE1 PHE A 230      47.176  -8.541  13.953  1.00 51.64           C  
ATOM   1732  CE2 PHE A 230      46.346 -10.733  13.575  1.00 50.49           C  
ATOM   1733  CZ  PHE A 230      47.024  -9.837  14.369  1.00 50.22           C  
ATOM   1734  N   GLU A 231      47.451  -9.119   8.225  1.00 59.85           N  
ATOM   1735  CA  GLU A 231      48.581  -9.907   7.733  1.00 59.79           C  
ATOM   1736  C   GLU A 231      49.805  -9.014   7.632  1.00 59.95           C  
ATOM   1737  O   GLU A 231      50.799  -9.232   8.309  1.00 64.93           O  
ATOM   1738  CB  GLU A 231      48.291 -10.485   6.349  1.00 61.76           C  
ATOM   1739  CG  GLU A 231      46.975 -11.211   6.246  1.00 68.48           C  
ATOM   1740  CD  GLU A 231      46.912 -12.397   7.163  1.00 72.04           C  
ATOM   1741  OE1 GLU A 231      47.266 -13.515   6.725  1.00 73.13           O  
ATOM   1742  OE2 GLU A 231      46.522 -12.204   8.332  1.00 76.45           O  
ATOM   1743  N   GLU A 232      49.735  -7.995   6.793  1.00 56.71           N  
ATOM   1744  CA  GLU A 232      50.875  -7.116   6.640  1.00 56.94           C  
ATOM   1745  C   GLU A 232      51.357  -6.538   7.969  1.00 56.74           C  
ATOM   1746  O   GLU A 232      52.432  -5.941   8.038  1.00 60.17           O  
ATOM   1747  CB  GLU A 232      50.527  -5.999   5.657  1.00 60.33           C  
ATOM   1748  CG  GLU A 232      50.311  -6.516   4.236  1.00 65.94           C  
ATOM   1749  CD  GLU A 232      49.881  -5.440   3.247  1.00 65.77           C  
ATOM   1750  OE1 GLU A 232      48.697  -5.019   3.283  1.00 64.64           O  
ATOM   1751  OE2 GLU A 232      50.735  -5.024   2.435  1.00 63.35           O  
ATOM   1752  N   ILE A 233      50.577  -6.727   9.028  1.00 53.98           N  
ATOM   1753  CA  ILE A 233      50.942  -6.198  10.337  1.00 54.61           C  
ATOM   1754  C   ILE A 233      51.694  -7.214  11.181  1.00 56.16           C  
ATOM   1755  O   ILE A 233      52.467  -6.841  12.062  1.00 55.03           O  
ATOM   1756  CB  ILE A 233      49.684  -5.723  11.127  1.00 55.16           C  
ATOM   1757  CG1 ILE A 233      49.155  -4.420  10.536  1.00 51.50           C  
ATOM   1758  CG2 ILE A 233      50.025  -5.497  12.609  1.00 52.09           C  
ATOM   1759  CD1 ILE A 233      50.075  -3.252  10.769  1.00 50.25           C  
ATOM   1760  N   LYS A 234      51.466  -8.497  10.908  1.00 56.44           N  
ATOM   1761  CA  LYS A 234      52.112  -9.564  11.662  1.00 56.88           C  
ATOM   1762  C   LYS A 234      53.633  -9.527  11.639  1.00 60.22           C  
ATOM   1763  O   LYS A 234      54.254  -9.453  12.695  1.00 64.29           O  
ATOM   1764  CB  LYS A 234      51.608 -10.926  11.198  1.00 52.22           C  
ATOM   1765  CG  LYS A 234      50.185 -11.192  11.627  1.00 52.52           C  
ATOM   1766  CD  LYS A 234      49.805 -12.637  11.442  1.00 50.99           C  
ATOM   1767  CE  LYS A 234      48.493 -12.922  12.131  1.00 55.27           C  
ATOM   1768  NZ  LYS A 234      48.220 -14.383  12.290  1.00 59.45           N  
ATOM   1769  N   PRO A 235      54.264  -9.587  10.451  1.00 61.15           N  
ATOM   1770  CA  PRO A 235      55.730  -9.542  10.456  1.00 61.58           C  
ATOM   1771  C   PRO A 235      56.280  -8.534  11.473  1.00 61.95           C  
ATOM   1772  O   PRO A 235      56.936  -8.910  12.444  1.00 63.79           O  
ATOM   1773  CB  PRO A 235      56.058  -9.163   9.015  1.00 58.49           C  
ATOM   1774  CG  PRO A 235      55.034  -9.948   8.260  1.00 60.11           C  
ATOM   1775  CD  PRO A 235      53.751  -9.738   9.077  1.00 61.71           C  
ATOM   1776  N   LEU A 236      55.988  -7.258  11.257  1.00 60.20           N  
ATOM   1777  CA  LEU A 236      56.452  -6.212  12.153  1.00 57.43           C  
ATOM   1778  C   LEU A 236      56.136  -6.473  13.617  1.00 57.96           C  
ATOM   1779  O   LEU A 236      56.814  -5.946  14.499  1.00 61.34           O  
ATOM   1780  CB  LEU A 236      55.842  -4.879  11.753  1.00 56.89           C  
ATOM   1781  CG  LEU A 236      56.218  -3.738  12.684  1.00 54.09           C  
ATOM   1782  CD1 LEU A 236      57.708  -3.701  12.805  1.00 52.42           C  
ATOM   1783  CD2 LEU A 236      55.692  -2.433  12.146  1.00 54.97           C  
ATOM   1784  N   TYR A 237      55.098  -7.261  13.887  1.00 55.77           N  
ATOM   1785  CA  TYR A 237      54.727  -7.559  15.269  1.00 54.85           C  
ATOM   1786  C   TYR A 237      55.694  -8.583  15.804  1.00 59.31           C  
ATOM   1787  O   TYR A 237      56.428  -8.324  16.758  1.00 60.31           O  
ATOM   1788  CB  TYR A 237      53.306  -8.122  15.365  1.00 46.79           C  
ATOM   1789  CG  TYR A 237      52.889  -8.481  16.783  1.00 40.53           C  
ATOM   1790  CD1 TYR A 237      53.130  -7.610  17.835  1.00 36.62           C  
ATOM   1791  CD2 TYR A 237      52.242  -9.686  17.065  1.00 38.66           C  
ATOM   1792  CE1 TYR A 237      52.747  -7.921  19.127  1.00 32.61           C  
ATOM   1793  CE2 TYR A 237      51.851 -10.010  18.361  1.00 30.92           C  
ATOM   1794  CZ  TYR A 237      52.113  -9.122  19.390  1.00 33.43           C  
ATOM   1795  OH  TYR A 237      51.782  -9.437  20.697  1.00 31.32           O  
ATOM   1796  N   GLU A 238      55.690  -9.752  15.169  1.00 62.88           N  
ATOM   1797  CA  GLU A 238      56.561 -10.840  15.563  1.00 61.77           C  
ATOM   1798  C   GLU A 238      57.934 -10.320  15.930  1.00 60.40           C  
ATOM   1799  O   GLU A 238      58.331 -10.425  17.083  1.00 64.08           O  
ATOM   1800  CB  GLU A 238      56.661 -11.880  14.449  1.00 62.65           C  
ATOM   1801  CG  GLU A 238      55.306 -12.489  14.065  1.00 65.36           C  
ATOM   1802  CD  GLU A 238      55.439 -13.717  13.173  1.00 67.79           C  
ATOM   1803  OE1 GLU A 238      55.540 -14.837  13.721  1.00 64.25           O  
ATOM   1804  OE2 GLU A 238      55.458 -13.558  11.928  1.00 67.74           O  
ATOM   1805  N   HIS A 239      58.660  -9.731  14.991  1.00 56.41           N  
ATOM   1806  CA  HIS A 239      59.983  -9.251  15.359  1.00 57.26           C  
ATOM   1807  C   HIS A 239      59.946  -8.313  16.550  1.00 57.39           C  
ATOM   1808  O   HIS A 239      60.890  -8.268  17.331  1.00 60.98           O  
ATOM   1809  CB  HIS A 239      60.687  -8.565  14.189  1.00 58.71           C  
ATOM   1810  CG  HIS A 239      61.034  -9.492  13.067  1.00 59.62           C  
ATOM   1811  ND1 HIS A 239      62.119  -9.291  12.242  1.00 60.98           N  
ATOM   1812  CD2 HIS A 239      60.414 -10.603  12.608  1.00 58.61           C  
ATOM   1813  CE1 HIS A 239      62.149 -10.238  11.322  1.00 62.35           C  
ATOM   1814  NE2 HIS A 239      61.125 -11.047  11.522  1.00 59.74           N  
ATOM   1815  N   LEU A 240      58.860  -7.568  16.707  1.00 55.91           N  
ATOM   1816  CA  LEU A 240      58.760  -6.645  17.831  1.00 53.93           C  
ATOM   1817  C   LEU A 240      58.462  -7.432  19.090  1.00 52.33           C  
ATOM   1818  O   LEU A 240      58.900  -7.060  20.166  1.00 50.87           O  
ATOM   1819  CB  LEU A 240      57.668  -5.596  17.566  1.00 54.71           C  
ATOM   1820  CG  LEU A 240      57.355  -4.433  18.538  1.00 55.24           C  
ATOM   1821  CD1 LEU A 240      56.360  -4.897  19.621  1.00 51.67           C  
ATOM   1822  CD2 LEU A 240      58.651  -3.850  19.123  1.00 46.24           C  
ATOM   1823  N   HIS A 241      57.726  -8.530  18.939  1.00 54.31           N  
ATOM   1824  CA  HIS A 241      57.355  -9.401  20.056  1.00 57.10           C  
ATOM   1825  C   HIS A 241      58.514 -10.305  20.452  1.00 57.39           C  
ATOM   1826  O   HIS A 241      58.808 -10.465  21.629  1.00 55.04           O  
ATOM   1827  CB  HIS A 241      56.141 -10.248  19.670  1.00 59.91           C  
ATOM   1828  CG  HIS A 241      55.902 -11.424  20.568  1.00 64.97           C  
ATOM   1829  ND1 HIS A 241      56.661 -12.575  20.507  1.00 66.59           N  
ATOM   1830  CD2 HIS A 241      54.965 -11.643  21.521  1.00 64.60           C  
ATOM   1831  CE1 HIS A 241      56.197 -13.452  21.381  1.00 64.76           C  
ATOM   1832  NE2 HIS A 241      55.168 -12.912  22.009  1.00 64.78           N  
ATOM   1833  N   ALA A 242      59.164 -10.890  19.453  1.00 59.08           N  
ATOM   1834  CA  ALA A 242      60.304 -11.766  19.667  1.00 61.82           C  
ATOM   1835  C   ALA A 242      61.540 -10.973  20.101  1.00 62.71           C  
ATOM   1836  O   ALA A 242      62.554 -11.558  20.495  1.00 65.06           O  
ATOM   1837  CB  ALA A 242      60.604 -12.541  18.398  1.00 62.96           C  
ATOM   1838  N   TYR A 243      61.465  -9.649  20.012  1.00 61.01           N  
ATOM   1839  CA  TYR A 243      62.574  -8.806  20.433  1.00 61.65           C  
ATOM   1840  C   TYR A 243      62.387  -8.435  21.884  1.00 65.86           C  
ATOM   1841  O   TYR A 243      63.359  -8.219  22.600  1.00 69.58           O  
ATOM   1842  CB  TYR A 243      62.635  -7.512  19.637  1.00 58.69           C  
ATOM   1843  CG  TYR A 243      63.423  -6.396  20.320  1.00 57.44           C  
ATOM   1844  CD1 TYR A 243      64.732  -6.108  19.950  1.00 56.80           C  
ATOM   1845  CD2 TYR A 243      62.831  -5.591  21.292  1.00 57.93           C  
ATOM   1846  CE1 TYR A 243      65.426  -5.040  20.516  1.00 57.74           C  
ATOM   1847  CE2 TYR A 243      63.516  -4.523  21.867  1.00 59.28           C  
ATOM   1848  CZ  TYR A 243      64.810  -4.246  21.470  1.00 60.11           C  
ATOM   1849  OH  TYR A 243      65.455  -3.132  21.970  1.00 57.05           O  
ATOM   1850  N   VAL A 244      61.136  -8.330  22.319  1.00 67.50           N  
ATOM   1851  CA  VAL A 244      60.873  -7.958  23.702  1.00 68.96           C  
ATOM   1852  C   VAL A 244      60.599  -9.169  24.572  1.00 69.60           C  
ATOM   1853  O   VAL A 244      60.114  -9.036  25.700  1.00 70.51           O  
ATOM   1854  CB  VAL A 244      59.684  -6.982  23.825  1.00 68.72           C  
ATOM   1855  CG1 VAL A 244      59.913  -5.769  22.925  1.00 64.54           C  
ATOM   1856  CG2 VAL A 244      58.390  -7.700  23.504  1.00 66.81           C  
ATOM   1857  N   ARG A 245      60.873 -10.351  24.027  1.00 68.49           N  
ATOM   1858  CA  ARG A 245      60.716 -11.592  24.778  1.00 66.16           C  
ATOM   1859  C   ARG A 245      62.141 -11.780  25.231  1.00 65.48           C  
ATOM   1860  O   ARG A 245      62.434 -12.469  26.202  1.00 65.83           O  
ATOM   1861  CB  ARG A 245      60.295 -12.750  23.879  1.00 62.27           C  
ATOM   1862  CG  ARG A 245      61.316 -13.172  22.822  1.00 62.40           C  
ATOM   1863  CD  ARG A 245      60.719 -14.356  22.128  1.00 57.97           C  
ATOM   1864  NE  ARG A 245      59.864 -15.002  23.114  1.00 55.61           N  
ATOM   1865  CZ  ARG A 245      58.969 -15.936  22.841  1.00 58.33           C  
ATOM   1866  NH1 ARG A 245      58.245 -16.453  23.826  1.00 55.61           N  
ATOM   1867  NH2 ARG A 245      58.795 -16.345  21.588  1.00 60.04           N  
ATOM   1868  N   ALA A 246      63.023 -11.126  24.490  1.00 63.74           N  
ATOM   1869  CA  ALA A 246      64.431 -11.143  24.779  1.00 61.97           C  
ATOM   1870  C   ALA A 246      64.611 -10.246  25.989  1.00 60.76           C  
ATOM   1871  O   ALA A 246      64.522 -10.712  27.115  1.00 61.24           O  
ATOM   1872  CB  ALA A 246      65.203 -10.600  23.602  1.00 62.58           C  
ATOM   1873  N   LYS A 247      64.828  -8.957  25.752  1.00 58.99           N  
ATOM   1874  CA  LYS A 247      65.042  -7.995  26.823  1.00 57.80           C  
ATOM   1875  C   LYS A 247      64.094  -8.143  28.000  1.00 59.60           C  
ATOM   1876  O   LYS A 247      64.248  -7.454  29.009  1.00 58.17           O  
ATOM   1877  CB  LYS A 247      64.977  -6.579  26.264  1.00 55.49           C  
ATOM   1878  CG  LYS A 247      65.866  -6.421  25.054  1.00 54.68           C  
ATOM   1879  CD  LYS A 247      66.245  -4.993  24.801  1.00 54.80           C  
ATOM   1880  CE  LYS A 247      67.027  -4.432  25.964  1.00 57.51           C  
ATOM   1881  NZ  LYS A 247      67.939  -3.329  25.538  1.00 59.39           N  
ATOM   1882  N   LEU A 248      63.114  -9.038  27.865  1.00 62.15           N  
ATOM   1883  CA  LEU A 248      62.156  -9.310  28.939  1.00 63.98           C  
ATOM   1884  C   LEU A 248      62.689 -10.502  29.732  1.00 68.48           C  
ATOM   1885  O   LEU A 248      62.448 -10.605  30.936  1.00 72.80           O  
ATOM   1886  CB  LEU A 248      60.757  -9.619  28.385  1.00 57.86           C  
ATOM   1887  CG  LEU A 248      59.594  -8.758  28.904  1.00 52.49           C  
ATOM   1888  CD1 LEU A 248      58.602  -9.619  29.640  1.00 51.95           C  
ATOM   1889  CD2 LEU A 248      60.110  -7.677  29.820  1.00 50.36           C  
ATOM   1890  N   MET A 249      63.402 -11.407  29.055  1.00 70.01           N  
ATOM   1891  CA  MET A 249      64.020 -12.547  29.733  1.00 70.12           C  
ATOM   1892  C   MET A 249      65.133 -11.924  30.576  1.00 69.72           C  
ATOM   1893  O   MET A 249      65.322 -12.277  31.738  1.00 69.59           O  
ATOM   1894  CB  MET A 249      64.647 -13.529  28.733  1.00 70.43           C  
ATOM   1895  CG  MET A 249      63.653 -14.414  27.984  1.00 75.43           C  
ATOM   1896  SD  MET A 249      64.410 -15.604  26.811  1.00 77.29           S  
ATOM   1897  CE  MET A 249      65.607 -14.537  25.935  1.00 70.17           C  
ATOM   1898  N   ASN A 250      65.842 -10.975  29.966  1.00 67.94           N  
ATOM   1899  CA  ASN A 250      66.952 -10.257  30.582  1.00 67.00           C  
ATOM   1900  C   ASN A 250      66.625  -9.652  31.932  1.00 68.15           C  
ATOM   1901  O   ASN A 250      67.530  -9.268  32.667  1.00 69.17           O  
ATOM   1902  CB  ASN A 250      67.417  -9.134  29.656  1.00 69.29           C  
ATOM   1903  CG  ASN A 250      68.673  -8.433  30.159  1.00 71.88           C  
ATOM   1904  OD1 ASN A 250      69.771  -8.670  29.651  1.00 73.56           O  
ATOM   1905  ND2 ASN A 250      68.517  -7.565  31.158  1.00 72.05           N  
ATOM   1906  N   ALA A 251      65.344  -9.549  32.264  1.00 68.73           N  
ATOM   1907  CA  ALA A 251      64.963  -8.958  33.540  1.00 68.95           C  
ATOM   1908  C   ALA A 251      63.948  -9.795  34.298  1.00 69.01           C  
ATOM   1909  O   ALA A 251      63.301  -9.305  35.220  1.00 70.25           O  
ATOM   1910  CB  ALA A 251      64.427  -7.545  33.320  1.00 69.38           C  
ATOM   1911  N   TYR A 252      63.812 -11.054  33.891  1.00 69.76           N  
ATOM   1912  CA  TYR A 252      62.910 -12.030  34.523  1.00 72.04           C  
ATOM   1913  C   TYR A 252      63.369 -13.431  34.081  1.00 73.04           C  
ATOM   1914  O   TYR A 252      62.547 -14.287  33.724  1.00 72.03           O  
ATOM   1915  CB  TYR A 252      61.459 -11.810  34.076  1.00 71.95           C  
ATOM   1916  CG  TYR A 252      60.875 -10.468  34.453  1.00 71.19           C  
ATOM   1917  CD1 TYR A 252      60.462 -10.201  35.747  1.00 69.00           C  
ATOM   1918  CD2 TYR A 252      60.758  -9.457  33.511  1.00 74.53           C  
ATOM   1919  CE1 TYR A 252      59.948  -8.961  36.092  1.00 71.24           C  
ATOM   1920  CE2 TYR A 252      60.246  -8.212  33.847  1.00 74.89           C  
ATOM   1921  CZ  TYR A 252      59.843  -7.968  35.137  1.00 72.36           C  
ATOM   1922  OH  TYR A 252      59.348  -6.723  35.458  1.00 68.74           O  
ATOM   1923  N   PRO A 253      64.695 -13.685  34.134  1.00 72.38           N  
ATOM   1924  CA  PRO A 253      65.312 -14.954  33.739  1.00 69.03           C  
ATOM   1925  C   PRO A 253      64.719 -16.150  34.460  1.00 69.26           C  
ATOM   1926  O   PRO A 253      64.439 -16.085  35.645  1.00 65.02           O  
ATOM   1927  CB  PRO A 253      66.771 -14.731  34.086  1.00 67.98           C  
ATOM   1928  CG  PRO A 253      66.666 -13.913  35.344  1.00 65.63           C  
ATOM   1929  CD  PRO A 253      65.630 -12.900  34.972  1.00 69.33           C  
ATOM   1930  N   SER A 254      64.536 -17.241  33.727  1.00 74.13           N  
ATOM   1931  CA  SER A 254      63.973 -18.478  34.269  1.00 79.45           C  
ATOM   1932  C   SER A 254      62.448 -18.434  34.251  1.00 83.93           C  
ATOM   1933  O   SER A 254      61.777 -19.385  34.679  1.00 84.25           O  
ATOM   1934  CB  SER A 254      64.426 -18.698  35.710  1.00 77.23           C  
ATOM   1935  OG  SER A 254      63.595 -17.977  36.600  1.00 71.92           O  
ATOM   1936  N   TYR A 255      61.911 -17.326  33.749  1.00 86.92           N  
ATOM   1937  CA  TYR A 255      60.470 -17.124  33.697  1.00 87.44           C  
ATOM   1938  C   TYR A 255      59.864 -17.140  32.291  1.00 88.24           C  
ATOM   1939  O   TYR A 255      58.713 -17.551  32.107  1.00 89.24           O  
ATOM   1940  CB  TYR A 255      60.128 -15.807  34.399  1.00 86.71           C  
ATOM   1941  CG  TYR A 255      60.104 -15.895  35.911  1.00 84.61           C  
ATOM   1942  CD1 TYR A 255      60.758 -14.953  36.694  1.00 83.84           C  
ATOM   1943  CD2 TYR A 255      59.384 -16.895  36.553  1.00 84.34           C  
ATOM   1944  CE1 TYR A 255      60.693 -15.003  38.078  1.00 84.12           C  
ATOM   1945  CE2 TYR A 255      59.309 -16.953  37.931  1.00 84.38           C  
ATOM   1946  CZ  TYR A 255      59.963 -16.006  38.692  1.00 85.20           C  
ATOM   1947  OH  TYR A 255      59.872 -16.061  40.070  1.00 85.59           O  
ATOM   1948  N   ILE A 256      60.629 -16.712  31.293  1.00 87.51           N  
ATOM   1949  CA  ILE A 256      60.092 -16.684  29.943  1.00 87.27           C  
ATOM   1950  C   ILE A 256      60.929 -17.442  28.914  1.00 86.00           C  
ATOM   1951  O   ILE A 256      62.119 -17.166  28.720  1.00 84.63           O  
ATOM   1952  CB  ILE A 256      59.910 -15.231  29.480  1.00 89.46           C  
ATOM   1953  CG1 ILE A 256      59.368 -14.390  30.639  1.00 88.50           C  
ATOM   1954  CG2 ILE A 256      58.935 -15.179  28.309  1.00 87.91           C  
ATOM   1955  CD1 ILE A 256      59.435 -12.916  30.390  1.00 90.05           C  
ATOM   1956  N   SER A 257      60.279 -18.396  28.253  1.00 84.00           N  
ATOM   1957  CA  SER A 257      60.909 -19.228  27.230  1.00 84.78           C  
ATOM   1958  C   SER A 257      61.316 -18.474  25.967  1.00 84.59           C  
ATOM   1959  O   SER A 257      60.529 -17.720  25.406  1.00 87.00           O  
ATOM   1960  CB  SER A 257      59.959 -20.356  26.825  1.00 83.23           C  
ATOM   1961  OG  SER A 257      60.340 -20.901  25.573  1.00 82.74           O  
ATOM   1962  N   PRO A 258      62.551 -18.677  25.489  1.00 84.01           N  
ATOM   1963  CA  PRO A 258      62.922 -17.950  24.272  1.00 83.12           C  
ATOM   1964  C   PRO A 258      62.130 -18.467  23.059  1.00 82.19           C  
ATOM   1965  O   PRO A 258      62.597 -18.368  21.921  1.00 80.98           O  
ATOM   1966  CB  PRO A 258      64.422 -18.231  24.140  1.00 83.00           C  
ATOM   1967  CG  PRO A 258      64.856 -18.525  25.546  1.00 82.23           C  
ATOM   1968  CD  PRO A 258      63.718 -19.353  26.079  1.00 83.44           C  
ATOM   1969  N   ILE A 259      60.936 -19.015  23.301  1.00 80.56           N  
ATOM   1970  CA  ILE A 259      60.119 -19.542  22.207  1.00 80.57           C  
ATOM   1971  C   ILE A 259      58.584 -19.584  22.444  1.00 81.12           C  
ATOM   1972  O   ILE A 259      57.853 -20.210  21.670  1.00 80.17           O  
ATOM   1973  CB  ILE A 259      60.601 -20.970  21.825  1.00 78.87           C  
ATOM   1974  CG1 ILE A 259      60.210 -21.292  20.385  1.00 77.74           C  
ATOM   1975  CG2 ILE A 259      59.978 -22.002  22.760  1.00 77.14           C  
ATOM   1976  CD1 ILE A 259      60.428 -22.726  19.994  1.00 76.44           C  
ATOM   1977  N   GLY A 260      58.079 -18.918  23.482  1.00 80.58           N  
ATOM   1978  CA  GLY A 260      56.644 -18.979  23.714  1.00 80.33           C  
ATOM   1979  C   GLY A 260      55.925 -17.865  24.461  1.00 80.42           C  
ATOM   1980  O   GLY A 260      55.892 -17.855  25.689  1.00 82.74           O  
ATOM   1981  N   CYS A 261      55.343 -16.941  23.698  1.00 79.75           N  
ATOM   1982  CA  CYS A 261      54.559 -15.798  24.186  1.00 76.44           C  
ATOM   1983  C   CYS A 261      54.633 -15.425  25.655  1.00 73.79           C  
ATOM   1984  O   CYS A 261      54.111 -16.136  26.507  1.00 73.34           O  
ATOM   1985  CB  CYS A 261      53.105 -16.030  23.824  1.00 78.32           C  
ATOM   1986  SG  CYS A 261      52.598 -17.718  24.097  1.00 84.80           S  
ATOM   1987  N   LEU A 262      55.236 -14.273  25.932  1.00 72.03           N  
ATOM   1988  CA  LEU A 262      55.415 -13.774  27.297  1.00 70.74           C  
ATOM   1989  C   LEU A 262      54.201 -13.892  28.215  1.00 70.78           C  
ATOM   1990  O   LEU A 262      53.062 -14.013  27.766  1.00 71.87           O  
ATOM   1991  CB  LEU A 262      55.843 -12.305  27.279  1.00 69.44           C  
ATOM   1992  CG  LEU A 262      56.737 -11.795  26.152  1.00 69.84           C  
ATOM   1993  CD1 LEU A 262      55.888 -11.426  24.940  1.00 70.16           C  
ATOM   1994  CD2 LEU A 262      57.489 -10.577  26.633  1.00 69.08           C  
ATOM   1995  N   PRO A 263      54.444 -13.879  29.534  1.00 71.40           N  
ATOM   1996  CA  PRO A 263      53.359 -13.973  30.520  1.00 69.48           C  
ATOM   1997  C   PRO A 263      52.573 -12.651  30.629  1.00 65.41           C  
ATOM   1998  O   PRO A 263      53.151 -11.562  30.631  1.00 63.81           O  
ATOM   1999  CB  PRO A 263      54.098 -14.365  31.807  1.00 71.17           C  
ATOM   2000  CG  PRO A 263      55.505 -13.837  31.590  1.00 69.59           C  
ATOM   2001  CD  PRO A 263      55.756 -14.156  30.154  1.00 70.38           C  
ATOM   2002  N   ALA A 264      51.255 -12.763  30.732  1.00 61.49           N  
ATOM   2003  CA  ALA A 264      50.357 -11.606  30.790  1.00 61.01           C  
ATOM   2004  C   ALA A 264      50.624 -10.441  31.752  1.00 61.34           C  
ATOM   2005  O   ALA A 264      50.128  -9.337  31.532  1.00 61.44           O  
ATOM   2006  CB  ALA A 264      48.920 -12.101  31.002  1.00 57.88           C  
ATOM   2007  N   HIS A 265      51.403 -10.650  32.803  1.00 61.11           N  
ATOM   2008  CA  HIS A 265      51.605  -9.579  33.769  1.00 61.68           C  
ATOM   2009  C   HIS A 265      52.865  -8.736  33.679  1.00 61.29           C  
ATOM   2010  O   HIS A 265      53.087  -7.873  34.528  1.00 60.04           O  
ATOM   2011  CB  HIS A 265      51.503 -10.158  35.177  1.00 65.07           C  
ATOM   2012  CG  HIS A 265      52.441 -11.299  35.424  1.00 69.30           C  
ATOM   2013  ND1 HIS A 265      52.449 -12.437  34.647  1.00 68.08           N  
ATOM   2014  CD2 HIS A 265      53.420 -11.466  36.346  1.00 69.14           C  
ATOM   2015  CE1 HIS A 265      53.394 -13.253  35.078  1.00 68.90           C  
ATOM   2016  NE2 HIS A 265      53.997 -12.687  36.107  1.00 67.50           N  
ATOM   2017  N   LEU A 266      53.692  -8.966  32.669  1.00 62.78           N  
ATOM   2018  CA  LEU A 266      54.933  -8.195  32.549  1.00 64.87           C  
ATOM   2019  C   LEU A 266      54.867  -7.279  31.339  1.00 65.09           C  
ATOM   2020  O   LEU A 266      55.867  -6.674  30.942  1.00 65.70           O  
ATOM   2021  CB  LEU A 266      56.141  -9.135  32.402  1.00 64.81           C  
ATOM   2022  CG  LEU A 266      56.163 -10.491  33.123  1.00 63.74           C  
ATOM   2023  CD1 LEU A 266      57.430 -11.211  32.729  1.00 62.74           C  
ATOM   2024  CD2 LEU A 266      56.085 -10.325  34.636  1.00 62.48           C  
ATOM   2025  N   LEU A 267      53.670  -7.164  30.776  1.00 63.70           N  
ATOM   2026  CA  LEU A 267      53.455  -6.367  29.588  1.00 61.12           C  
ATOM   2027  C   LEU A 267      53.491  -4.860  29.724  1.00 61.67           C  
ATOM   2028  O   LEU A 267      53.525  -4.164  28.717  1.00 64.98           O  
ATOM   2029  CB  LEU A 267      52.155  -6.801  28.944  1.00 58.61           C  
ATOM   2030  CG  LEU A 267      52.334  -8.258  28.545  1.00 57.46           C  
ATOM   2031  CD1 LEU A 267      51.020  -8.902  28.134  1.00 57.09           C  
ATOM   2032  CD2 LEU A 267      53.354  -8.294  27.439  1.00 57.17           C  
ATOM   2033  N   GLY A 268      53.494  -4.340  30.946  1.00 59.94           N  
ATOM   2034  CA  GLY A 268      53.553  -2.897  31.100  1.00 56.58           C  
ATOM   2035  C   GLY A 268      52.271  -2.268  31.595  1.00 56.16           C  
ATOM   2036  O   GLY A 268      52.223  -1.060  31.816  1.00 53.86           O  
ATOM   2037  N   ASP A 269      51.228  -3.080  31.737  1.00 56.68           N  
ATOM   2038  CA  ASP A 269      49.943  -2.616  32.251  1.00 58.01           C  
ATOM   2039  C   ASP A 269      48.916  -3.740  32.361  1.00 55.35           C  
ATOM   2040  O   ASP A 269      48.950  -4.714  31.631  1.00 54.75           O  
ATOM   2041  CB  ASP A 269      49.396  -1.430  31.430  1.00 64.08           C  
ATOM   2042  CG  ASP A 269      49.090  -1.783  29.990  1.00 68.52           C  
ATOM   2043  OD1 ASP A 269      48.781  -0.848  29.214  1.00 68.46           O  
ATOM   2044  OD2 ASP A 269      49.148  -2.979  29.638  1.00 72.93           O  
ATOM   2045  N   MET A 270      48.003  -3.583  33.301  1.00 55.60           N  
ATOM   2046  CA  MET A 270      46.992  -4.578  33.588  1.00 56.54           C  
ATOM   2047  C   MET A 270      46.555  -5.533  32.500  1.00 55.96           C  
ATOM   2048  O   MET A 270      46.173  -6.664  32.798  1.00 57.98           O  
ATOM   2049  CB  MET A 270      45.756  -3.905  34.169  1.00 61.52           C  
ATOM   2050  CG  MET A 270      44.760  -4.894  34.752  1.00 64.75           C  
ATOM   2051  SD  MET A 270      45.538  -6.040  35.918  1.00 65.24           S  
ATOM   2052  CE  MET A 270      45.184  -5.205  37.482  1.00 63.85           C  
ATOM   2053  N   TRP A 271      46.591  -5.115  31.243  1.00 54.72           N  
ATOM   2054  CA  TRP A 271      46.142  -6.027  30.196  1.00 54.65           C  
ATOM   2055  C   TRP A 271      47.189  -6.296  29.131  1.00 54.97           C  
ATOM   2056  O   TRP A 271      47.127  -7.305  28.418  1.00 59.98           O  
ATOM   2057  CB  TRP A 271      44.856  -5.487  29.548  1.00 49.85           C  
ATOM   2058  CG  TRP A 271      43.805  -5.180  30.563  1.00 45.07           C  
ATOM   2059  CD1 TRP A 271      42.896  -6.047  31.109  1.00 44.73           C  
ATOM   2060  CD2 TRP A 271      43.633  -3.940  31.244  1.00 42.07           C  
ATOM   2061  NE1 TRP A 271      42.173  -5.419  32.096  1.00 41.48           N  
ATOM   2062  CE2 TRP A 271      42.609  -4.124  32.197  1.00 43.27           C  
ATOM   2063  CE3 TRP A 271      44.247  -2.689  31.141  1.00 40.20           C  
ATOM   2064  CZ2 TRP A 271      42.191  -3.102  33.040  1.00 45.00           C  
ATOM   2065  CZ3 TRP A 271      43.831  -1.682  31.969  1.00 41.00           C  
ATOM   2066  CH2 TRP A 271      42.813  -1.891  32.910  1.00 45.37           C  
ATOM   2067  N   GLY A 272      48.163  -5.412  29.024  1.00 49.77           N  
ATOM   2068  CA  GLY A 272      49.163  -5.625  28.011  1.00 49.45           C  
ATOM   2069  C   GLY A 272      48.622  -5.020  26.742  1.00 50.63           C  
ATOM   2070  O   GLY A 272      49.116  -5.300  25.642  1.00 54.07           O  
ATOM   2071  N   ARG A 273      47.589  -4.195  26.910  1.00 46.33           N  
ATOM   2072  CA  ARG A 273      46.966  -3.503  25.805  1.00 42.23           C  
ATOM   2073  C   ARG A 273      48.018  -2.589  25.212  1.00 44.21           C  
ATOM   2074  O   ARG A 273      48.068  -2.398  23.994  1.00 45.17           O  
ATOM   2075  CB  ARG A 273      45.779  -2.687  26.298  1.00 41.72           C  
ATOM   2076  CG  ARG A 273      45.215  -1.744  25.252  1.00 39.49           C  
ATOM   2077  CD  ARG A 273      43.880  -1.127  25.629  1.00 33.82           C  
ATOM   2078  NE  ARG A 273      43.636   0.007  24.753  1.00 38.69           N  
ATOM   2079  CZ  ARG A 273      42.827   1.019  25.032  1.00 38.57           C  
ATOM   2080  NH1 ARG A 273      42.691   2.012  24.168  1.00 35.46           N  
ATOM   2081  NH2 ARG A 273      42.157   1.036  26.170  1.00 37.80           N  
ATOM   2082  N   PHE A 274      48.858  -2.034  26.087  1.00 45.25           N  
ATOM   2083  CA  PHE A 274      49.956  -1.151  25.689  1.00 49.11           C  
ATOM   2084  C   PHE A 274      51.269  -1.534  26.361  1.00 51.32           C  
ATOM   2085  O   PHE A 274      51.377  -1.486  27.587  1.00 55.86           O  
ATOM   2086  CB  PHE A 274      49.664   0.291  26.057  1.00 48.63           C  
ATOM   2087  CG  PHE A 274      48.419   0.819  25.461  1.00 53.30           C  
ATOM   2088  CD1 PHE A 274      47.264   0.912  26.217  1.00 55.81           C  
ATOM   2089  CD2 PHE A 274      48.391   1.220  24.140  1.00 56.52           C  
ATOM   2090  CE1 PHE A 274      46.105   1.399  25.671  1.00 55.46           C  
ATOM   2091  CE2 PHE A 274      47.232   1.709  23.583  1.00 57.69           C  
ATOM   2092  CZ  PHE A 274      46.086   1.798  24.352  1.00 58.04           C  
ATOM   2093  N   TRP A 275      52.266  -1.884  25.554  1.00 49.43           N  
ATOM   2094  CA  TRP A 275      53.587  -2.256  26.053  1.00 49.54           C  
ATOM   2095  C   TRP A 275      54.447  -1.013  26.163  1.00 53.18           C  
ATOM   2096  O   TRP A 275      55.664  -1.077  26.043  1.00 53.77           O  
ATOM   2097  CB  TRP A 275      54.280  -3.190  25.076  1.00 43.71           C  
ATOM   2098  CG  TRP A 275      53.538  -4.434  24.774  1.00 42.13           C  
ATOM   2099  CD1 TRP A 275      52.370  -4.893  25.363  1.00 43.32           C  
ATOM   2100  CD2 TRP A 275      53.939  -5.434  23.847  1.00 34.77           C  
ATOM   2101  NE1 TRP A 275      52.038  -6.131  24.847  1.00 39.13           N  
ATOM   2102  CE2 TRP A 275      52.988  -6.482  23.917  1.00 36.44           C  
ATOM   2103  CE3 TRP A 275      55.011  -5.547  22.963  1.00 29.29           C  
ATOM   2104  CZ2 TRP A 275      53.090  -7.622  23.136  1.00 31.45           C  
ATOM   2105  CZ3 TRP A 275      55.105  -6.666  22.194  1.00 30.04           C  
ATOM   2106  CH2 TRP A 275      54.149  -7.697  22.283  1.00 31.55           C  
ATOM   2107  N   THR A 276      53.831   0.130  26.391  1.00 57.41           N  
ATOM   2108  CA  THR A 276      54.620   1.346  26.431  1.00 61.18           C  
ATOM   2109  C   THR A 276      55.478   1.503  27.692  1.00 61.14           C  
ATOM   2110  O   THR A 276      56.461   2.245  27.701  1.00 61.39           O  
ATOM   2111  CB  THR A 276      53.698   2.584  26.198  1.00 61.24           C  
ATOM   2112  OG1 THR A 276      54.493   3.771  26.119  1.00 61.67           O  
ATOM   2113  CG2 THR A 276      52.667   2.711  27.302  1.00 63.36           C  
ATOM   2114  N   ASN A 277      55.133   0.789  28.753  1.00 59.83           N  
ATOM   2115  CA  ASN A 277      55.916   0.904  29.971  1.00 57.81           C  
ATOM   2116  C   ASN A 277      57.124  -0.038  30.022  1.00 56.36           C  
ATOM   2117  O   ASN A 277      57.993   0.103  30.884  1.00 58.13           O  
ATOM   2118  CB  ASN A 277      55.014   0.712  31.186  1.00 57.30           C  
ATOM   2119  CG  ASN A 277      54.306   1.995  31.589  1.00 55.58           C  
ATOM   2120  OD1 ASN A 277      53.465   1.989  32.477  1.00 55.53           O  
ATOM   2121  ND2 ASN A 277      54.655   3.100  30.943  1.00 52.11           N  
ATOM   2122  N   LEU A 278      57.178  -0.992  29.096  1.00 51.97           N  
ATOM   2123  CA  LEU A 278      58.300  -1.920  29.000  1.00 46.06           C  
ATOM   2124  C   LEU A 278      59.347  -1.152  28.247  1.00 46.58           C  
ATOM   2125  O   LEU A 278      60.100  -1.739  27.495  1.00 47.52           O  
ATOM   2126  CB  LEU A 278      57.946  -3.130  28.142  1.00 44.66           C  
ATOM   2127  CG  LEU A 278      57.286  -4.385  28.716  1.00 50.78           C  
ATOM   2128  CD1 LEU A 278      56.263  -3.992  29.767  1.00 53.40           C  
ATOM   2129  CD2 LEU A 278      56.661  -5.209  27.586  1.00 42.21           C  
ATOM   2130  N   TYR A 279      59.384   0.164  28.412  1.00 49.48           N  
ATOM   2131  CA  TYR A 279      60.353   0.957  27.663  1.00 51.17           C  
ATOM   2132  C   TYR A 279      61.761   0.893  28.226  1.00 55.54           C  
ATOM   2133  O   TYR A 279      62.725   0.784  27.463  1.00 57.80           O  
ATOM   2134  CB  TYR A 279      59.916   2.425  27.552  1.00 43.75           C  
ATOM   2135  CG  TYR A 279      60.814   3.180  26.614  1.00 35.24           C  
ATOM   2136  CD1 TYR A 279      61.107   2.662  25.371  1.00 29.27           C  
ATOM   2137  CD2 TYR A 279      61.453   4.357  27.006  1.00 37.46           C  
ATOM   2138  CE1 TYR A 279      62.020   3.273  24.536  1.00 29.19           C  
ATOM   2139  CE2 TYR A 279      62.373   4.986  26.173  1.00 30.44           C  
ATOM   2140  CZ  TYR A 279      62.648   4.429  24.938  1.00 30.25           C  
ATOM   2141  OH  TYR A 279      63.550   5.020  24.088  1.00 34.49           O  
ATOM   2142  N   SER A 280      61.867   0.954  29.557  1.00 59.68           N  
ATOM   2143  CA  SER A 280      63.148   0.912  30.267  1.00 60.01           C  
ATOM   2144  C   SER A 280      63.777  -0.468  30.209  1.00 60.04           C  
ATOM   2145  O   SER A 280      64.976  -0.615  30.396  1.00 60.07           O  
ATOM   2146  CB  SER A 280      62.951   1.325  31.715  1.00 61.87           C  
ATOM   2147  OG  SER A 280      62.433   2.643  31.780  1.00 67.52           O  
ATOM   2148  N   LEU A 281      62.956  -1.475  29.943  1.00 60.51           N  
ATOM   2149  CA  LEU A 281      63.426  -2.847  29.818  1.00 62.03           C  
ATOM   2150  C   LEU A 281      63.779  -3.171  28.363  1.00 66.24           C  
ATOM   2151  O   LEU A 281      64.448  -4.179  28.093  1.00 70.27           O  
ATOM   2152  CB  LEU A 281      62.350  -3.825  30.293  1.00 56.37           C  
ATOM   2153  CG  LEU A 281      62.184  -3.923  31.804  1.00 56.65           C  
ATOM   2154  CD1 LEU A 281      62.233  -2.542  32.413  1.00 54.76           C  
ATOM   2155  CD2 LEU A 281      60.882  -4.636  32.130  1.00 56.27           C  
ATOM   2156  N   THR A 282      63.339  -2.318  27.432  1.00 66.37           N  
ATOM   2157  CA  THR A 282      63.578  -2.561  26.010  1.00 65.42           C  
ATOM   2158  C   THR A 282      64.263  -1.451  25.229  1.00 65.23           C  
ATOM   2159  O   THR A 282      64.562  -1.642  24.048  1.00 64.86           O  
ATOM   2160  CB  THR A 282      62.264  -2.903  25.272  1.00 64.91           C  
ATOM   2161  OG1 THR A 282      61.375  -1.790  25.361  1.00 64.73           O  
ATOM   2162  CG2 THR A 282      61.584  -4.131  25.894  1.00 64.23           C  
ATOM   2163  N   VAL A 283      64.500  -0.303  25.866  1.00 64.23           N  
ATOM   2164  CA  VAL A 283      65.179   0.811  25.197  1.00 63.19           C  
ATOM   2165  C   VAL A 283      66.388   0.193  24.483  1.00 64.77           C  
ATOM   2166  O   VAL A 283      67.200  -0.484  25.102  1.00 66.60           O  
ATOM   2167  CB  VAL A 283      65.615   1.904  26.236  1.00 60.08           C  
ATOM   2168  CG1 VAL A 283      66.532   1.311  27.263  1.00 62.47           C  
ATOM   2169  CG2 VAL A 283      66.289   3.067  25.546  1.00 57.12           C  
ATOM   2170  N   PRO A 284      66.512   0.409  23.162  1.00 67.48           N  
ATOM   2171  CA  PRO A 284      67.612  -0.138  22.357  1.00 69.00           C  
ATOM   2172  C   PRO A 284      69.011   0.401  22.673  1.00 68.93           C  
ATOM   2173  O   PRO A 284      70.005  -0.305  22.496  1.00 67.16           O  
ATOM   2174  CB  PRO A 284      67.167   0.176  20.930  1.00 70.08           C  
ATOM   2175  CG  PRO A 284      66.539   1.526  21.094  1.00 68.33           C  
ATOM   2176  CD  PRO A 284      65.718   1.371  22.371  1.00 69.47           C  
ATOM   2177  N   PHE A 285      69.079   1.649  23.126  1.00 69.57           N  
ATOM   2178  CA  PHE A 285      70.344   2.284  23.469  1.00 73.20           C  
ATOM   2179  C   PHE A 285      70.088   3.156  24.687  1.00 76.44           C  
ATOM   2180  O   PHE A 285      70.238   4.383  24.628  1.00 76.08           O  
ATOM   2181  CB  PHE A 285      70.848   3.148  22.308  1.00 75.03           C  
ATOM   2182  CG  PHE A 285      70.689   2.502  20.961  1.00 80.12           C  
ATOM   2183  CD1 PHE A 285      69.536   2.693  20.217  1.00 82.36           C  
ATOM   2184  CD2 PHE A 285      71.667   1.662  20.458  1.00 81.50           C  
ATOM   2185  CE1 PHE A 285      69.360   2.056  18.998  1.00 83.34           C  
ATOM   2186  CE2 PHE A 285      71.497   1.024  19.241  1.00 83.78           C  
ATOM   2187  CZ  PHE A 285      70.340   1.221  18.510  1.00 83.27           C  
ATOM   2188  N   GLY A 286      69.706   2.501  25.785  1.00 78.57           N  
ATOM   2189  CA  GLY A 286      69.385   3.178  27.035  1.00 81.42           C  
ATOM   2190  C   GLY A 286      70.254   4.298  27.600  1.00 83.27           C  
ATOM   2191  O   GLY A 286      69.944   4.824  28.671  1.00 81.66           O  
ATOM   2192  N   GLN A 287      71.322   4.685  26.908  1.00 86.12           N  
ATOM   2193  CA  GLN A 287      72.181   5.742  27.430  1.00 88.67           C  
ATOM   2194  C   GLN A 287      72.024   7.096  26.747  1.00 86.79           C  
ATOM   2195  O   GLN A 287      72.529   8.105  27.243  1.00 87.82           O  
ATOM   2196  CB  GLN A 287      73.651   5.296  27.411  1.00 92.92           C  
ATOM   2197  CG  GLN A 287      74.105   4.729  26.098  1.00 96.68           C  
ATOM   2198  CD  GLN A 287      74.019   5.748  25.002  1.00100.08           C  
ATOM   2199  OE1 GLN A 287      74.748   6.741  25.003  1.00102.49           O  
ATOM   2200  NE2 GLN A 287      73.113   5.522  24.061  1.00103.35           N  
ATOM   2201  N   LYS A 288      71.339   7.126  25.609  1.00 83.52           N  
ATOM   2202  CA  LYS A 288      71.106   8.394  24.929  1.00 80.19           C  
ATOM   2203  C   LYS A 288      70.008   9.058  25.753  1.00 78.77           C  
ATOM   2204  O   LYS A 288      69.359   8.404  26.569  1.00 78.06           O  
ATOM   2205  CB  LYS A 288      70.629   8.164  23.491  1.00 81.40           C  
ATOM   2206  CG  LYS A 288      71.711   7.711  22.517  1.00 79.76           C  
ATOM   2207  CD  LYS A 288      72.527   8.881  21.997  1.00 80.05           C  
ATOM   2208  CE  LYS A 288      73.816   8.410  21.327  1.00 80.80           C  
ATOM   2209  NZ  LYS A 288      73.590   7.453  20.211  1.00 79.51           N  
ATOM   2210  N   PRO A 289      69.786  10.360  25.556  1.00 77.15           N  
ATOM   2211  CA  PRO A 289      68.758  11.104  26.295  1.00 77.57           C  
ATOM   2212  C   PRO A 289      67.363  10.481  26.236  1.00 78.94           C  
ATOM   2213  O   PRO A 289      66.740  10.444  25.175  1.00 79.22           O  
ATOM   2214  CB  PRO A 289      68.803  12.477  25.645  1.00 76.15           C  
ATOM   2215  CG  PRO A 289      70.256  12.603  25.269  1.00 77.03           C  
ATOM   2216  CD  PRO A 289      70.540  11.252  24.664  1.00 75.64           C  
ATOM   2217  N   ASN A 290      66.881  10.006  27.387  1.00 79.93           N  
ATOM   2218  CA  ASN A 290      65.561   9.377  27.499  1.00 77.16           C  
ATOM   2219  C   ASN A 290      64.561  10.198  26.707  1.00 75.97           C  
ATOM   2220  O   ASN A 290      64.496  11.428  26.827  1.00 74.42           O  
ATOM   2221  CB  ASN A 290      65.109   9.278  28.976  1.00 75.65           C  
ATOM   2222  CG  ASN A 290      64.095   8.140  29.225  1.00 74.96           C  
ATOM   2223  OD1 ASN A 290      63.600   7.958  30.342  1.00 70.83           O  
ATOM   2224  ND2 ASN A 290      63.794   7.374  28.184  1.00 77.75           N  
ATOM   2225  N   ILE A 291      63.800   9.497  25.877  1.00 74.46           N  
ATOM   2226  CA  ILE A 291      62.791  10.116  25.044  1.00 71.40           C  
ATOM   2227  C   ILE A 291      61.411   9.788  25.621  1.00 71.29           C  
ATOM   2228  O   ILE A 291      60.398   9.755  24.914  1.00 72.30           O  
ATOM   2229  CB  ILE A 291      62.942   9.632  23.586  1.00 68.84           C  
ATOM   2230  CG1 ILE A 291      62.633  10.803  22.666  1.00 68.73           C  
ATOM   2231  CG2 ILE A 291      62.086   8.398  23.321  1.00 65.14           C  
ATOM   2232  CD1 ILE A 291      63.332  12.070  23.115  1.00 64.76           C  
ATOM   2233  N   ASP A 292      61.407   9.541  26.929  1.00 68.16           N  
ATOM   2234  CA  ASP A 292      60.207   9.247  27.700  1.00 66.71           C  
ATOM   2235  C   ASP A 292      60.190  10.359  28.746  1.00 67.09           C  
ATOM   2236  O   ASP A 292      60.385  10.120  29.941  1.00 68.50           O  
ATOM   2237  CB  ASP A 292      60.318   7.862  28.361  1.00 65.80           C  
ATOM   2238  CG  ASP A 292      59.166   7.559  29.323  1.00 64.67           C  
ATOM   2239  OD1 ASP A 292      59.098   6.426  29.840  1.00 67.42           O  
ATOM   2240  OD2 ASP A 292      58.332   8.442  29.580  1.00 63.33           O  
ATOM   2241  N   VAL A 293      59.977  11.581  28.264  1.00 65.88           N  
ATOM   2242  CA  VAL A 293      59.938  12.784  29.089  1.00 66.12           C  
ATOM   2243  C   VAL A 293      58.978  12.704  30.278  1.00 69.11           C  
ATOM   2244  O   VAL A 293      58.403  13.717  30.704  1.00 69.07           O  
ATOM   2245  CB  VAL A 293      59.549  13.991  28.238  1.00 63.76           C  
ATOM   2246  CG1 VAL A 293      60.473  14.097  27.052  1.00 62.49           C  
ATOM   2247  CG2 VAL A 293      58.122  13.846  27.769  1.00 65.59           C  
ATOM   2248  N   THR A 294      58.808  11.498  30.813  1.00 69.97           N  
ATOM   2249  CA  THR A 294      57.928  11.282  31.949  1.00 70.78           C  
ATOM   2250  C   THR A 294      58.670  11.807  33.154  1.00 70.04           C  
ATOM   2251  O   THR A 294      58.070  12.253  34.122  1.00 67.97           O  
ATOM   2252  CB  THR A 294      57.618   9.778  32.137  1.00 70.66           C  
ATOM   2253  OG1 THR A 294      56.752   9.597  33.263  1.00 69.63           O  
ATOM   2254  CG2 THR A 294      58.892   9.002  32.360  1.00 72.73           C  
ATOM   2255  N   ASP A 295      59.994  11.771  33.055  1.00 73.51           N  
ATOM   2256  CA  ASP A 295      60.886  12.227  34.119  1.00 76.18           C  
ATOM   2257  C   ASP A 295      61.100  13.746  34.052  1.00 75.71           C  
ATOM   2258  O   ASP A 295      60.871  14.460  35.026  1.00 76.46           O  
ATOM   2259  CB  ASP A 295      62.226  11.479  34.003  1.00 76.91           C  
ATOM   2260  CG  ASP A 295      62.043   9.958  33.880  1.00 78.59           C  
ATOM   2261  OD1 ASP A 295      61.844   9.293  34.922  1.00 75.35           O  
ATOM   2262  OD2 ASP A 295      62.081   9.431  32.737  1.00 75.83           O  
ATOM   2263  N   ALA A 296      61.531  14.238  32.898  1.00 76.47           N  
ATOM   2264  CA  ALA A 296      61.756  15.667  32.721  1.00 77.14           C  
ATOM   2265  C   ALA A 296      60.546  16.456  33.205  1.00 78.51           C  
ATOM   2266  O   ALA A 296      60.672  17.579  33.680  1.00 78.03           O  
ATOM   2267  CB  ALA A 296      62.013  15.967  31.258  1.00 76.28           C  
ATOM   2268  N   MET A 297      59.370  15.853  33.080  1.00 81.61           N  
ATOM   2269  CA  MET A 297      58.120  16.491  33.485  1.00 83.83           C  
ATOM   2270  C   MET A 297      58.038  16.723  34.989  1.00 84.27           C  
ATOM   2271  O   MET A 297      57.478  17.723  35.442  1.00 83.79           O  
ATOM   2272  CB  MET A 297      56.920  15.641  33.037  1.00 84.80           C  
ATOM   2273  CG  MET A 297      56.562  15.740  31.556  1.00 81.42           C  
ATOM   2274  SD  MET A 297      55.166  14.682  31.135  1.00 77.08           S  
ATOM   2275  CE  MET A 297      53.821  15.566  31.905  1.00 71.22           C  
ATOM   2276  N   VAL A 298      58.584  15.789  35.760  1.00 85.48           N  
ATOM   2277  CA  VAL A 298      58.560  15.909  37.209  1.00 85.65           C  
ATOM   2278  C   VAL A 298      59.610  16.923  37.655  1.00 86.89           C  
ATOM   2279  O   VAL A 298      59.333  17.781  38.499  1.00 86.39           O  
ATOM   2280  CB  VAL A 298      58.829  14.558  37.887  1.00 83.99           C  
ATOM   2281  CG1 VAL A 298      58.598  14.684  39.381  1.00 85.29           C  
ATOM   2282  CG2 VAL A 298      57.923  13.495  37.300  1.00 80.93           C  
ATOM   2283  N   ASP A 299      60.810  16.826  37.083  1.00 86.73           N  
ATOM   2284  CA  ASP A 299      61.879  17.761  37.412  1.00 86.71           C  
ATOM   2285  C   ASP A 299      61.588  19.095  36.748  1.00 84.33           C  
ATOM   2286  O   ASP A 299      62.485  19.726  36.189  1.00 84.00           O  
ATOM   2287  CB  ASP A 299      63.237  17.254  36.920  1.00 91.13           C  
ATOM   2288  CG  ASP A 299      63.738  16.064  37.709  1.00 95.85           C  
ATOM   2289  OD1 ASP A 299      63.509  16.026  38.940  1.00 97.74           O  
ATOM   2290  OD2 ASP A 299      64.379  15.176  37.102  1.00 98.01           O  
ATOM   2291  N   GLN A 300      60.322  19.500  36.799  1.00 81.20           N  
ATOM   2292  CA  GLN A 300      59.857  20.755  36.221  1.00 77.94           C  
ATOM   2293  C   GLN A 300      58.509  20.995  36.885  1.00 77.10           C  
ATOM   2294  O   GLN A 300      57.868  22.027  36.700  1.00 74.00           O  
ATOM   2295  CB  GLN A 300      59.715  20.622  34.698  1.00 75.28           C  
ATOM   2296  CG  GLN A 300      60.090  21.882  33.916  1.00 73.44           C  
ATOM   2297  CD  GLN A 300      60.404  21.615  32.439  1.00 74.63           C  
ATOM   2298  OE1 GLN A 300      61.300  20.832  32.108  1.00 73.34           O  
ATOM   2299  NE2 GLN A 300      59.671  22.276  31.549  1.00 73.05           N  
ATOM   2300  N   ALA A 301      58.106  20.011  37.683  1.00 78.62           N  
ATOM   2301  CA  ALA A 301      56.855  20.055  38.422  1.00 82.74           C  
ATOM   2302  C   ALA A 301      55.661  20.373  37.544  1.00 86.57           C  
ATOM   2303  O   ALA A 301      54.951  21.345  37.787  1.00 87.07           O  
ATOM   2304  CB  ALA A 301      56.951  21.069  39.535  1.00 81.00           C  
ATOM   2305  N   TRP A 302      55.443  19.552  36.523  1.00 90.89           N  
ATOM   2306  CA  TRP A 302      54.319  19.742  35.613  1.00 93.28           C  
ATOM   2307  C   TRP A 302      53.065  19.219  36.285  1.00 92.43           C  
ATOM   2308  O   TRP A 302      53.097  18.154  36.896  1.00 91.54           O  
ATOM   2309  CB  TRP A 302      54.519  18.941  34.325  1.00 98.76           C  
ATOM   2310  CG  TRP A 302      55.298  19.609  33.248  1.00104.83           C  
ATOM   2311  CD1 TRP A 302      56.604  19.989  33.293  1.00108.42           C  
ATOM   2312  CD2 TRP A 302      54.837  19.911  31.927  1.00107.82           C  
ATOM   2313  NE1 TRP A 302      56.990  20.505  32.077  1.00110.91           N  
ATOM   2314  CE2 TRP A 302      55.922  20.466  31.221  1.00110.10           C  
ATOM   2315  CE3 TRP A 302      53.611  19.763  31.272  1.00107.95           C  
ATOM   2316  CZ2 TRP A 302      55.819  20.873  29.894  1.00110.14           C  
ATOM   2317  CZ3 TRP A 302      53.510  20.169  29.959  1.00109.16           C  
ATOM   2318  CH2 TRP A 302      54.608  20.718  29.282  1.00110.26           C  
ATOM   2319  N   ASP A 303      51.962  19.953  36.172  1.00 91.23           N  
ATOM   2320  CA  ASP A 303      50.705  19.493  36.758  1.00 90.63           C  
ATOM   2321  C   ASP A 303      49.629  19.218  35.695  1.00 90.55           C  
ATOM   2322  O   ASP A 303      49.891  19.277  34.486  1.00 88.98           O  
ATOM   2323  CB  ASP A 303      50.179  20.495  37.793  1.00 87.70           C  
ATOM   2324  CG  ASP A 303      50.146  21.904  37.273  1.00 86.83           C  
ATOM   2325  OD1 ASP A 303      49.573  22.773  37.964  1.00 87.23           O  
ATOM   2326  OD2 ASP A 303      50.699  22.144  36.182  1.00 85.34           O  
ATOM   2327  N   ALA A 304      48.424  18.895  36.154  1.00 88.88           N  
ATOM   2328  CA  ALA A 304      47.330  18.608  35.246  1.00 85.40           C  
ATOM   2329  C   ALA A 304      47.201  19.771  34.281  1.00 84.33           C  
ATOM   2330  O   ALA A 304      47.564  19.654  33.113  1.00 84.95           O  
ATOM   2331  CB  ALA A 304      46.037  18.414  36.023  1.00 85.44           C  
ATOM   2332  N   GLN A 305      46.704  20.898  34.781  1.00 82.14           N  
ATOM   2333  CA  GLN A 305      46.525  22.084  33.955  1.00 80.98           C  
ATOM   2334  C   GLN A 305      47.659  22.262  32.953  1.00 78.03           C  
ATOM   2335  O   GLN A 305      47.459  22.106  31.755  1.00 77.44           O  
ATOM   2336  CB  GLN A 305      46.408  23.325  34.837  1.00 84.53           C  
ATOM   2337  CG  GLN A 305      46.292  24.629  34.065  1.00 91.42           C  
ATOM   2338  CD  GLN A 305      45.367  25.632  34.745  1.00 96.33           C  
ATOM   2339  OE1 GLN A 305      44.162  25.391  34.877  1.00 98.16           O  
ATOM   2340  NE2 GLN A 305      45.926  26.761  35.180  1.00 96.36           N  
ATOM   2341  N   ARG A 306      48.851  22.577  33.444  1.00 76.25           N  
ATOM   2342  CA  ARG A 306      50.009  22.770  32.577  1.00 71.67           C  
ATOM   2343  C   ARG A 306      49.999  21.812  31.392  1.00 70.25           C  
ATOM   2344  O   ARG A 306      50.358  22.195  30.281  1.00 71.72           O  
ATOM   2345  CB  ARG A 306      51.297  22.578  33.371  1.00 69.05           C  
ATOM   2346  CG  ARG A 306      52.544  22.564  32.518  1.00 69.74           C  
ATOM   2347  CD  ARG A 306      52.868  23.935  31.995  1.00 70.92           C  
ATOM   2348  NE  ARG A 306      54.018  23.935  31.094  1.00 74.23           N  
ATOM   2349  CZ  ARG A 306      55.238  23.514  31.418  1.00 75.35           C  
ATOM   2350  NH1 ARG A 306      55.488  23.045  32.632  1.00 75.27           N  
ATOM   2351  NH2 ARG A 306      56.216  23.569  30.523  1.00 76.11           N  
ATOM   2352  N   ILE A 307      49.587  20.569  31.630  1.00 68.93           N  
ATOM   2353  CA  ILE A 307      49.539  19.563  30.571  1.00 67.20           C  
ATOM   2354  C   ILE A 307      48.430  19.881  29.579  1.00 67.15           C  
ATOM   2355  O   ILE A 307      48.689  20.173  28.414  1.00 66.68           O  
ATOM   2356  CB  ILE A 307      49.304  18.153  31.145  1.00 65.26           C  
ATOM   2357  CG1 ILE A 307      50.550  17.672  31.889  1.00 61.36           C  
ATOM   2358  CG2 ILE A 307      48.959  17.201  30.035  1.00 65.80           C  
ATOM   2359  CD1 ILE A 307      50.435  16.263  32.418  1.00 57.17           C  
ATOM   2360  N   PHE A 308      47.191  19.826  30.049  1.00 67.83           N  
ATOM   2361  CA  PHE A 308      46.038  20.130  29.211  1.00 68.56           C  
ATOM   2362  C   PHE A 308      46.121  21.544  28.640  1.00 70.27           C  
ATOM   2363  O   PHE A 308      45.279  21.954  27.847  1.00 72.87           O  
ATOM   2364  CB  PHE A 308      44.756  19.975  30.030  1.00 65.98           C  
ATOM   2365  CG  PHE A 308      44.266  18.567  30.113  1.00 65.71           C  
ATOM   2366  CD1 PHE A 308      43.436  18.054  29.135  1.00 64.09           C  
ATOM   2367  CD2 PHE A 308      44.668  17.742  31.140  1.00 65.55           C  
ATOM   2368  CE1 PHE A 308      43.020  16.743  29.178  1.00 64.76           C  
ATOM   2369  CE2 PHE A 308      44.253  16.426  31.184  1.00 67.42           C  
ATOM   2370  CZ  PHE A 308      43.428  15.928  30.200  1.00 65.35           C  
ATOM   2371  N   LYS A 309      47.138  22.291  29.047  1.00 71.24           N  
ATOM   2372  CA  LYS A 309      47.310  23.652  28.568  1.00 71.77           C  
ATOM   2373  C   LYS A 309      48.352  23.601  27.478  1.00 73.15           C  
ATOM   2374  O   LYS A 309      48.265  24.308  26.480  1.00 74.02           O  
ATOM   2375  CB  LYS A 309      47.793  24.558  29.696  1.00 70.97           C  
ATOM   2376  CG  LYS A 309      47.433  26.023  29.527  1.00 70.11           C  
ATOM   2377  CD  LYS A 309      45.972  26.297  29.869  1.00 66.07           C  
ATOM   2378  CE  LYS A 309      45.644  27.772  29.701  1.00 64.14           C  
ATOM   2379  NZ  LYS A 309      44.253  28.105  30.089  1.00 63.96           N  
ATOM   2380  N   GLU A 310      49.345  22.749  27.677  1.00 76.95           N  
ATOM   2381  CA  GLU A 310      50.404  22.592  26.698  1.00 81.41           C  
ATOM   2382  C   GLU A 310      49.837  21.795  25.526  1.00 81.57           C  
ATOM   2383  O   GLU A 310      50.396  21.803  24.429  1.00 83.29           O  
ATOM   2384  CB  GLU A 310      51.586  21.838  27.309  1.00 85.04           C  
ATOM   2385  CG  GLU A 310      52.913  22.074  26.599  1.00 91.30           C  
ATOM   2386  CD  GLU A 310      53.420  23.494  26.787  1.00 96.25           C  
ATOM   2387  OE1 GLU A 310      53.444  23.964  27.946  1.00 99.19           O  
ATOM   2388  OE2 GLU A 310      53.797  24.140  25.786  1.00 97.50           O  
ATOM   2389  N   ALA A 311      48.727  21.101  25.769  1.00 79.82           N  
ATOM   2390  CA  ALA A 311      48.080  20.301  24.732  1.00 76.64           C  
ATOM   2391  C   ALA A 311      47.179  21.211  23.910  1.00 74.36           C  
ATOM   2392  O   ALA A 311      47.281  21.259  22.686  1.00 72.70           O  
ATOM   2393  CB  ALA A 311      47.265  19.175  25.365  1.00 77.77           C  
ATOM   2394  N   GLU A 312      46.301  21.930  24.603  1.00 71.94           N  
ATOM   2395  CA  GLU A 312      45.391  22.868  23.968  1.00 72.10           C  
ATOM   2396  C   GLU A 312      46.208  23.848  23.141  1.00 73.13           C  
ATOM   2397  O   GLU A 312      45.727  24.422  22.163  1.00 73.19           O  
ATOM   2398  CB  GLU A 312      44.617  23.632  25.033  1.00 71.62           C  
ATOM   2399  CG  GLU A 312      43.805  24.794  24.508  1.00 69.45           C  
ATOM   2400  CD  GLU A 312      43.591  25.833  25.576  1.00 69.37           C  
ATOM   2401  OE1 GLU A 312      44.615  26.313  26.106  1.00 69.15           O  
ATOM   2402  OE2 GLU A 312      42.423  26.166  25.888  1.00 65.74           O  
ATOM   2403  N   LYS A 313      47.452  24.044  23.552  1.00 74.16           N  
ATOM   2404  CA  LYS A 313      48.345  24.940  22.842  1.00 75.10           C  
ATOM   2405  C   LYS A 313      48.674  24.369  21.467  1.00 74.80           C  
ATOM   2406  O   LYS A 313      48.996  25.110  20.547  1.00 74.23           O  
ATOM   2407  CB  LYS A 313      49.636  25.146  23.643  1.00 75.00           C  
ATOM   2408  CG  LYS A 313      50.742  25.864  22.871  1.00 77.47           C  
ATOM   2409  CD  LYS A 313      50.324  27.278  22.463  1.00 80.76           C  
ATOM   2410  CE  LYS A 313      51.328  27.930  21.510  1.00 77.93           C  
ATOM   2411  NZ  LYS A 313      51.350  27.271  20.174  1.00 76.38           N  
ATOM   2412  N   PHE A 314      48.586  23.051  21.324  1.00 76.44           N  
ATOM   2413  CA  PHE A 314      48.901  22.415  20.051  1.00 78.10           C  
ATOM   2414  C   PHE A 314      47.837  22.681  18.980  1.00 77.77           C  
ATOM   2415  O   PHE A 314      48.141  23.197  17.907  1.00 76.74           O  
ATOM   2416  CB  PHE A 314      49.079  20.907  20.240  1.00 79.47           C  
ATOM   2417  CG  PHE A 314      49.758  20.229  19.080  1.00 83.61           C  
ATOM   2418  CD1 PHE A 314      51.127  20.327  18.908  1.00 86.17           C  
ATOM   2419  CD2 PHE A 314      49.027  19.512  18.147  1.00 85.58           C  
ATOM   2420  CE1 PHE A 314      51.753  19.723  17.825  1.00 88.25           C  
ATOM   2421  CE2 PHE A 314      49.648  18.905  17.061  1.00 86.71           C  
ATOM   2422  CZ  PHE A 314      51.011  19.012  16.902  1.00 87.13           C  
ATOM   2423  N   PHE A 315      46.592  22.328  19.270  1.00 77.72           N  
ATOM   2424  CA  PHE A 315      45.507  22.540  18.320  1.00 78.92           C  
ATOM   2425  C   PHE A 315      45.435  23.994  17.852  1.00 79.14           C  
ATOM   2426  O   PHE A 315      45.203  24.276  16.673  1.00 78.83           O  
ATOM   2427  CB  PHE A 315      44.186  22.124  18.960  1.00 79.61           C  
ATOM   2428  CG  PHE A 315      44.115  20.664  19.285  1.00 83.32           C  
ATOM   2429  CD1 PHE A 315      43.907  19.729  18.285  1.00 83.59           C  
ATOM   2430  CD2 PHE A 315      44.295  20.218  20.589  1.00 86.27           C  
ATOM   2431  CE1 PHE A 315      43.880  18.376  18.578  1.00 85.64           C  
ATOM   2432  CE2 PHE A 315      44.269  18.864  20.892  1.00 86.51           C  
ATOM   2433  CZ  PHE A 315      44.062  17.942  19.885  1.00 87.60           C  
ATOM   2434  N   VAL A 316      45.642  24.917  18.781  1.00 78.51           N  
ATOM   2435  CA  VAL A 316      45.599  26.333  18.452  1.00 78.31           C  
ATOM   2436  C   VAL A 316      46.756  26.728  17.524  1.00 76.24           C  
ATOM   2437  O   VAL A 316      46.705  27.753  16.854  1.00 74.02           O  
ATOM   2438  CB  VAL A 316      45.635  27.194  19.748  1.00 79.89           C  
ATOM   2439  CG1 VAL A 316      46.948  26.997  20.472  1.00 79.57           C  
ATOM   2440  CG2 VAL A 316      45.419  28.660  19.416  1.00 81.65           C  
ATOM   2441  N   SER A 317      47.794  25.904  17.472  1.00 76.72           N  
ATOM   2442  CA  SER A 317      48.935  26.209  16.623  1.00 78.32           C  
ATOM   2443  C   SER A 317      48.636  25.823  15.184  1.00 80.48           C  
ATOM   2444  O   SER A 317      49.291  26.297  14.256  1.00 82.25           O  
ATOM   2445  CB  SER A 317      50.186  25.469  17.102  1.00 77.54           C  
ATOM   2446  OG  SER A 317      50.197  24.126  16.660  1.00 74.39           O  
ATOM   2447  N   VAL A 318      47.646  24.958  14.998  1.00 81.08           N  
ATOM   2448  CA  VAL A 318      47.270  24.529  13.658  1.00 81.56           C  
ATOM   2449  C   VAL A 318      45.805  24.839  13.382  1.00 83.76           C  
ATOM   2450  O   VAL A 318      45.023  23.952  13.037  1.00 85.42           O  
ATOM   2451  CB  VAL A 318      47.511  23.029  13.465  1.00 79.30           C  
ATOM   2452  CG1 VAL A 318      48.987  22.731  13.593  1.00 78.84           C  
ATOM   2453  CG2 VAL A 318      46.724  22.243  14.487  1.00 78.14           C  
ATOM   2454  N   GLY A 319      45.442  26.108  13.538  1.00 82.75           N  
ATOM   2455  CA  GLY A 319      44.077  26.521  13.293  1.00 81.15           C  
ATOM   2456  C   GLY A 319      43.209  26.354  14.517  1.00 81.60           C  
ATOM   2457  O   GLY A 319      43.194  27.216  15.385  1.00 81.87           O  
ATOM   2458  N   LEU A 320      42.496  25.233  14.573  1.00 83.19           N  
ATOM   2459  CA  LEU A 320      41.582  24.891  15.662  1.00 82.90           C  
ATOM   2460  C   LEU A 320      41.644  25.796  16.887  1.00 83.23           C  
ATOM   2461  O   LEU A 320      42.719  26.139  17.372  1.00 83.11           O  
ATOM   2462  CB  LEU A 320      41.793  23.431  16.064  1.00 83.35           C  
ATOM   2463  CG  LEU A 320      41.229  22.412  15.069  1.00 82.82           C  
ATOM   2464  CD1 LEU A 320      39.708  22.453  15.092  1.00 85.98           C  
ATOM   2465  CD2 LEU A 320      41.740  22.713  13.677  1.00 81.36           C  
ATOM   2466  N   PRO A 321      40.470  26.176  17.411  1.00 84.07           N  
ATOM   2467  CA  PRO A 321      40.255  27.045  18.574  1.00 86.99           C  
ATOM   2468  C   PRO A 321      40.893  26.616  19.894  1.00 90.24           C  
ATOM   2469  O   PRO A 321      41.525  25.564  19.983  1.00 92.71           O  
ATOM   2470  CB  PRO A 321      38.731  27.112  18.666  1.00 84.10           C  
ATOM   2471  CG  PRO A 321      38.309  25.784  18.150  1.00 82.04           C  
ATOM   2472  CD  PRO A 321      39.190  25.616  16.945  1.00 82.85           C  
ATOM   2473  N   ASN A 322      40.735  27.459  20.913  1.00 92.75           N  
ATOM   2474  CA  ASN A 322      41.253  27.165  22.247  1.00 94.31           C  
ATOM   2475  C   ASN A 322      40.080  26.522  22.968  1.00 92.42           C  
ATOM   2476  O   ASN A 322      38.932  26.715  22.575  1.00 90.78           O  
ATOM   2477  CB  ASN A 322      41.641  28.446  22.999  1.00 99.23           C  
ATOM   2478  CG  ASN A 322      42.517  29.377  22.176  1.00104.56           C  
ATOM   2479  OD1 ASN A 322      43.555  28.968  21.652  1.00107.14           O  
ATOM   2480  ND2 ASN A 322      42.104  30.643  22.068  1.00104.78           N  
ATOM   2481  N   MET A 323      40.353  25.755  24.014  1.00 92.06           N  
ATOM   2482  CA  MET A 323      39.266  25.133  24.753  1.00 91.13           C  
ATOM   2483  C   MET A 323      38.391  26.252  25.299  1.00 90.75           C  
ATOM   2484  O   MET A 323      38.896  27.319  25.650  1.00 90.36           O  
ATOM   2485  CB  MET A 323      39.814  24.289  25.901  1.00 90.28           C  
ATOM   2486  CG  MET A 323      40.562  23.054  25.456  1.00 88.68           C  
ATOM   2487  SD  MET A 323      39.504  21.932  24.536  1.00 88.29           S  
ATOM   2488  CE  MET A 323      40.146  22.163  22.894  1.00 87.93           C  
ATOM   2489  N   THR A 324      37.084  26.013  25.358  1.00 90.16           N  
ATOM   2490  CA  THR A 324      36.148  27.016  25.858  1.00 90.31           C  
ATOM   2491  C   THR A 324      36.280  27.195  27.364  1.00 91.66           C  
ATOM   2492  O   THR A 324      36.581  26.244  28.086  1.00 93.26           O  
ATOM   2493  CB  THR A 324      34.691  26.633  25.543  1.00 89.32           C  
ATOM   2494  OG1 THR A 324      34.343  25.430  26.237  1.00 87.60           O  
ATOM   2495  CG2 THR A 324      34.517  26.421  24.055  1.00 88.72           C  
ATOM   2496  N   GLN A 325      36.054  28.415  27.837  1.00 90.72           N  
ATOM   2497  CA  GLN A 325      36.153  28.693  29.261  1.00 90.09           C  
ATOM   2498  C   GLN A 325      35.146  27.864  30.065  1.00 89.42           C  
ATOM   2499  O   GLN A 325      35.215  27.815  31.290  1.00 91.23           O  
ATOM   2500  CB  GLN A 325      35.944  30.185  29.513  1.00 90.72           C  
ATOM   2501  CG  GLN A 325      35.849  30.553  30.973  1.00 94.34           C  
ATOM   2502  CD  GLN A 325      35.746  32.043  31.184  1.00 97.53           C  
ATOM   2503  OE1 GLN A 325      36.724  32.773  31.021  1.00 98.66           O  
ATOM   2504  NE2 GLN A 325      34.553  32.510  31.540  1.00 98.70           N  
ATOM   2505  N   GLY A 326      34.212  27.213  29.376  1.00 87.59           N  
ATOM   2506  CA  GLY A 326      33.235  26.378  30.058  1.00 83.33           C  
ATOM   2507  C   GLY A 326      33.882  25.038  30.354  1.00 81.47           C  
ATOM   2508  O   GLY A 326      33.614  24.400  31.368  1.00 77.85           O  
ATOM   2509  N   PHE A 327      34.746  24.614  29.441  1.00 80.91           N  
ATOM   2510  CA  PHE A 327      35.477  23.366  29.585  1.00 81.95           C  
ATOM   2511  C   PHE A 327      36.406  23.483  30.782  1.00 82.02           C  
ATOM   2512  O   PHE A 327      36.385  22.642  31.682  1.00 82.17           O  
ATOM   2513  CB  PHE A 327      36.280  23.096  28.306  1.00 84.12           C  
ATOM   2514  CG  PHE A 327      37.445  22.147  28.486  1.00 84.76           C  
ATOM   2515  CD1 PHE A 327      38.659  22.599  28.976  1.00 81.58           C  
ATOM   2516  CD2 PHE A 327      37.334  20.813  28.123  1.00 86.36           C  
ATOM   2517  CE1 PHE A 327      39.733  21.746  29.096  1.00 81.12           C  
ATOM   2518  CE2 PHE A 327      38.411  19.955  28.244  1.00 84.76           C  
ATOM   2519  CZ  PHE A 327      39.610  20.424  28.731  1.00 82.76           C  
ATOM   2520  N   TRP A 328      37.214  24.542  30.785  1.00 81.11           N  
ATOM   2521  CA  TRP A 328      38.165  24.791  31.859  1.00 78.90           C  
ATOM   2522  C   TRP A 328      37.508  24.868  33.223  1.00 78.69           C  
ATOM   2523  O   TRP A 328      38.175  24.700  34.240  1.00 78.09           O  
ATOM   2524  CB  TRP A 328      38.930  26.089  31.608  1.00 78.14           C  
ATOM   2525  CG  TRP A 328      40.077  25.940  30.667  1.00 78.98           C  
ATOM   2526  CD1 TRP A 328      40.206  26.512  29.437  1.00 81.44           C  
ATOM   2527  CD2 TRP A 328      41.248  25.142  30.863  1.00 77.99           C  
ATOM   2528  NE1 TRP A 328      41.387  26.118  28.850  1.00 79.93           N  
ATOM   2529  CE2 TRP A 328      42.043  25.275  29.705  1.00 79.30           C  
ATOM   2530  CE3 TRP A 328      41.702  24.330  31.903  1.00 79.58           C  
ATOM   2531  CZ2 TRP A 328      43.264  24.624  29.557  1.00 81.32           C  
ATOM   2532  CZ3 TRP A 328      42.913  23.684  31.758  1.00 82.38           C  
ATOM   2533  CH2 TRP A 328      43.682  23.835  30.591  1.00 84.15           C  
ATOM   2534  N   GLU A 329      36.201  25.104  33.247  1.00 78.46           N  
ATOM   2535  CA  GLU A 329      35.494  25.227  34.511  1.00 78.83           C  
ATOM   2536  C   GLU A 329      34.599  24.048  34.914  1.00 78.35           C  
ATOM   2537  O   GLU A 329      33.771  24.180  35.812  1.00 79.54           O  
ATOM   2538  CB  GLU A 329      34.678  26.520  34.506  1.00 81.31           C  
ATOM   2539  CG  GLU A 329      34.138  26.918  35.867  1.00 87.52           C  
ATOM   2540  CD  GLU A 329      33.550  28.318  35.882  1.00 91.14           C  
ATOM   2541  OE1 GLU A 329      32.517  28.543  35.211  1.00 92.77           O  
ATOM   2542  OE2 GLU A 329      34.130  29.192  36.567  1.00 92.24           O  
ATOM   2543  N   ASN A 330      34.745  22.896  34.266  1.00 75.59           N  
ATOM   2544  CA  ASN A 330      33.931  21.742  34.648  1.00 71.65           C  
ATOM   2545  C   ASN A 330      34.688  20.439  34.462  1.00 70.28           C  
ATOM   2546  O   ASN A 330      34.369  19.427  35.084  1.00 69.29           O  
ATOM   2547  CB  ASN A 330      32.640  21.690  33.839  1.00 71.06           C  
ATOM   2548  CG  ASN A 330      31.910  23.001  33.840  1.00 70.83           C  
ATOM   2549  OD1 ASN A 330      32.316  23.950  33.176  1.00 68.14           O  
ATOM   2550  ND2 ASN A 330      30.832  23.072  34.599  1.00 72.18           N  
ATOM   2551  N   SER A 331      35.692  20.455  33.599  1.00 67.79           N  
ATOM   2552  CA  SER A 331      36.462  19.248  33.369  1.00 66.67           C  
ATOM   2553  C   SER A 331      37.121  18.842  34.675  1.00 66.53           C  
ATOM   2554  O   SER A 331      37.639  19.692  35.399  1.00 68.66           O  
ATOM   2555  CB  SER A 331      37.540  19.489  32.308  1.00 64.97           C  
ATOM   2556  OG  SER A 331      36.979  19.886  31.069  1.00 63.09           O  
ATOM   2557  N   MET A 332      37.079  17.550  34.987  1.00 65.91           N  
ATOM   2558  CA  MET A 332      37.716  17.020  36.190  1.00 63.66           C  
ATOM   2559  C   MET A 332      39.034  16.418  35.707  1.00 65.12           C  
ATOM   2560  O   MET A 332      39.055  15.292  35.218  1.00 67.75           O  
ATOM   2561  CB  MET A 332      36.837  15.947  36.819  1.00 58.76           C  
ATOM   2562  CG  MET A 332      37.423  15.338  38.057  1.00 60.05           C  
ATOM   2563  SD  MET A 332      36.233  14.314  38.914  1.00 65.75           S  
ATOM   2564  CE  MET A 332      35.666  15.440  40.143  1.00 65.14           C  
ATOM   2565  N   LEU A 333      40.127  17.169  35.838  1.00 65.76           N  
ATOM   2566  CA  LEU A 333      41.441  16.727  35.360  1.00 67.57           C  
ATOM   2567  C   LEU A 333      42.392  16.068  36.376  1.00 71.12           C  
ATOM   2568  O   LEU A 333      43.607  16.020  36.152  1.00 69.61           O  
ATOM   2569  CB  LEU A 333      42.153  17.909  34.704  1.00 65.09           C  
ATOM   2570  CG  LEU A 333      41.294  18.747  33.756  1.00 64.85           C  
ATOM   2571  CD1 LEU A 333      42.135  19.830  33.117  1.00 65.98           C  
ATOM   2572  CD2 LEU A 333      40.693  17.863  32.696  1.00 66.77           C  
ATOM   2573  N   THR A 334      41.837  15.561  37.476  1.00 74.06           N  
ATOM   2574  CA  THR A 334      42.605  14.895  38.531  1.00 76.65           C  
ATOM   2575  C   THR A 334      41.643  14.248  39.509  1.00 80.76           C  
ATOM   2576  O   THR A 334      40.636  14.850  39.895  1.00 81.11           O  
ATOM   2577  CB  THR A 334      43.475  15.872  39.344  1.00 75.26           C  
ATOM   2578  OG1 THR A 334      42.747  17.086  39.567  1.00 70.92           O  
ATOM   2579  CG2 THR A 334      44.783  16.157  38.630  1.00 75.38           C  
ATOM   2580  N   ASP A 335      41.958  13.022  39.914  1.00 83.78           N  
ATOM   2581  CA  ASP A 335      41.113  12.291  40.849  1.00 85.23           C  
ATOM   2582  C   ASP A 335      40.921  13.136  42.098  1.00 87.75           C  
ATOM   2583  O   ASP A 335      41.894  13.612  42.689  1.00 87.53           O  
ATOM   2584  CB  ASP A 335      41.770  10.951  41.216  1.00 83.34           C  
ATOM   2585  CG  ASP A 335      40.831  10.010  41.971  1.00 82.15           C  
ATOM   2586  OD1 ASP A 335      41.214   8.839  42.189  1.00 79.42           O  
ATOM   2587  OD2 ASP A 335      39.716  10.435  42.348  1.00 80.79           O  
ATOM   2588  N   PRO A 336      39.658  13.371  42.496  1.00 90.11           N  
ATOM   2589  CA  PRO A 336      39.398  14.168  43.697  1.00 92.56           C  
ATOM   2590  C   PRO A 336      39.848  13.398  44.953  1.00 95.91           C  
ATOM   2591  O   PRO A 336      39.589  13.810  46.090  1.00 97.26           O  
ATOM   2592  CB  PRO A 336      37.888  14.401  43.632  1.00 89.96           C  
ATOM   2593  CG  PRO A 336      37.388  13.210  42.881  1.00 89.03           C  
ATOM   2594  CD  PRO A 336      38.404  13.069  41.786  1.00 89.33           C  
ATOM   2595  N   GLY A 337      40.533  12.278  44.718  1.00 97.67           N  
ATOM   2596  CA  GLY A 337      41.044  11.441  45.792  1.00 98.01           C  
ATOM   2597  C   GLY A 337      39.957  10.858  46.665  1.00 97.48           C  
ATOM   2598  O   GLY A 337      38.859  10.552  46.190  1.00 97.32           O  
ATOM   2599  N   ASN A 338      40.275  10.678  47.942  1.00 96.52           N  
ATOM   2600  CA  ASN A 338      39.304  10.166  48.891  1.00 96.22           C  
ATOM   2601  C   ASN A 338      38.243  11.258  48.974  1.00 96.94           C  
ATOM   2602  O   ASN A 338      38.560  12.435  48.764  1.00 98.08           O  
ATOM   2603  CB  ASN A 338      39.967   9.945  50.248  1.00 96.53           C  
ATOM   2604  CG  ASN A 338      40.864   8.731  50.261  1.00 94.80           C  
ATOM   2605  OD1 ASN A 338      40.387   7.597  50.220  1.00 93.35           O  
ATOM   2606  ND2 ASN A 338      42.172   8.959  50.308  1.00 94.41           N  
ATOM   2607  N   VAL A 339      37.001  10.874  49.275  1.00 95.61           N  
ATOM   2608  CA  VAL A 339      35.879  11.820  49.332  1.00 94.69           C  
ATOM   2609  C   VAL A 339      35.394  12.008  47.899  1.00 92.66           C  
ATOM   2610  O   VAL A 339      35.861  12.911  47.192  1.00 92.31           O  
ATOM   2611  CB  VAL A 339      36.295  13.215  49.886  1.00 95.99           C  
ATOM   2612  CG1 VAL A 339      35.235  14.261  49.547  1.00 95.90           C  
ATOM   2613  CG2 VAL A 339      36.478  13.144  51.386  1.00 96.23           C  
ATOM   2614  N   GLN A 340      34.476  11.139  47.476  1.00 88.00           N  
ATOM   2615  CA  GLN A 340      33.925  11.180  46.128  1.00 83.23           C  
ATOM   2616  C   GLN A 340      34.731  10.251  45.225  1.00 77.69           C  
ATOM   2617  O   GLN A 340      35.931  10.444  45.019  1.00 74.74           O  
ATOM   2618  CB  GLN A 340      33.955  12.619  45.588  1.00 86.85           C  
ATOM   2619  CG  GLN A 340      33.451  12.804  44.172  1.00 91.96           C  
ATOM   2620  CD  GLN A 340      33.676  14.219  43.656  1.00 96.21           C  
ATOM   2621  OE1 GLN A 340      34.803  14.720  43.662  1.00 97.68           O  
ATOM   2622  NE2 GLN A 340      32.603  14.868  43.203  1.00 98.65           N  
ATOM   2623  N   LYS A 341      34.053   9.236  44.700  1.00 72.95           N  
ATOM   2624  CA  LYS A 341      34.665   8.257  43.814  1.00 69.75           C  
ATOM   2625  C   LYS A 341      34.069   8.329  42.405  1.00 66.14           C  
ATOM   2626  O   LYS A 341      32.882   8.071  42.211  1.00 63.86           O  
ATOM   2627  CB  LYS A 341      34.497   6.847  44.400  1.00 71.71           C  
ATOM   2628  CG  LYS A 341      33.071   6.462  44.769  1.00 74.20           C  
ATOM   2629  CD  LYS A 341      32.506   7.313  45.913  1.00 79.62           C  
ATOM   2630  CE  LYS A 341      33.330   7.186  47.197  1.00 80.54           C  
ATOM   2631  NZ  LYS A 341      32.611   7.739  48.386  1.00 75.69           N  
ATOM   2632  N   ALA A 342      34.910   8.665  41.427  1.00 63.84           N  
ATOM   2633  CA  ALA A 342      34.486   8.813  40.032  1.00 63.28           C  
ATOM   2634  C   ALA A 342      35.210   7.873  39.093  1.00 60.96           C  
ATOM   2635  O   ALA A 342      36.361   7.557  39.338  1.00 63.60           O  
ATOM   2636  CB  ALA A 342      34.734  10.243  39.586  1.00 65.31           C  
ATOM   2637  N   VAL A 343      34.562   7.433  38.012  1.00 60.28           N  
ATOM   2638  CA  VAL A 343      35.260   6.541  37.082  1.00 61.50           C  
ATOM   2639  C   VAL A 343      36.461   7.359  36.587  1.00 63.38           C  
ATOM   2640  O   VAL A 343      36.302   8.453  36.030  1.00 62.11           O  
ATOM   2641  CB  VAL A 343      34.364   6.049  35.862  1.00 57.27           C  
ATOM   2642  CG1 VAL A 343      32.927   5.873  36.291  1.00 52.06           C  
ATOM   2643  CG2 VAL A 343      34.492   6.978  34.674  1.00 58.97           C  
ATOM   2644  N   CYS A 344      37.664   6.835  36.822  1.00 64.41           N  
ATOM   2645  CA  CYS A 344      38.882   7.547  36.452  1.00 63.97           C  
ATOM   2646  C   CYS A 344      39.347   7.443  35.015  1.00 60.99           C  
ATOM   2647  O   CYS A 344      40.248   8.185  34.601  1.00 58.63           O  
ATOM   2648  CB  CYS A 344      40.023   7.148  37.386  1.00 66.68           C  
ATOM   2649  SG  CYS A 344      40.215   8.238  38.842  1.00 74.23           S  
ATOM   2650  N   HIS A 345      38.734   6.530  34.264  1.00 59.04           N  
ATOM   2651  CA  HIS A 345      39.076   6.332  32.862  1.00 56.28           C  
ATOM   2652  C   HIS A 345      38.876   7.676  32.166  1.00 55.46           C  
ATOM   2653  O   HIS A 345      37.802   8.279  32.255  1.00 60.27           O  
ATOM   2654  CB  HIS A 345      38.161   5.278  32.243  1.00 55.25           C  
ATOM   2655  CG  HIS A 345      38.745   4.618  31.036  1.00 58.93           C  
ATOM   2656  ND1 HIS A 345      39.524   3.484  31.112  1.00 61.19           N  
ATOM   2657  CD2 HIS A 345      38.718   4.967  29.729  1.00 60.86           C  
ATOM   2658  CE1 HIS A 345      39.954   3.165  29.904  1.00 61.62           C  
ATOM   2659  NE2 HIS A 345      39.479   4.050  29.047  1.00 59.04           N  
ATOM   2660  N   PRO A 346      39.908   8.171  31.476  1.00 52.00           N  
ATOM   2661  CA  PRO A 346      39.843   9.456  30.769  1.00 50.15           C  
ATOM   2662  C   PRO A 346      38.763   9.458  29.700  1.00 49.22           C  
ATOM   2663  O   PRO A 346      38.788   8.656  28.765  1.00 49.12           O  
ATOM   2664  CB  PRO A 346      41.236   9.597  30.142  1.00 51.17           C  
ATOM   2665  CG  PRO A 346      42.090   8.680  30.921  1.00 49.35           C  
ATOM   2666  CD  PRO A 346      41.191   7.505  31.224  1.00 50.33           C  
ATOM   2667  N   THR A 347      37.816  10.367  29.817  1.00 46.62           N  
ATOM   2668  CA  THR A 347      36.773  10.414  28.821  1.00 47.28           C  
ATOM   2669  C   THR A 347      36.491  11.846  28.423  1.00 49.26           C  
ATOM   2670  O   THR A 347      36.535  12.728  29.267  1.00 52.78           O  
ATOM   2671  CB  THR A 347      35.508   9.744  29.356  1.00 44.21           C  
ATOM   2672  OG1 THR A 347      34.995  10.489  30.461  1.00 42.74           O  
ATOM   2673  CG2 THR A 347      35.830   8.341  29.825  1.00 41.61           C  
ATOM   2674  N   ALA A 348      36.238  12.087  27.135  1.00 51.78           N  
ATOM   2675  CA  ALA A 348      35.937  13.440  26.647  1.00 52.39           C  
ATOM   2676  C   ALA A 348      34.439  13.555  26.510  1.00 51.52           C  
ATOM   2677  O   ALA A 348      33.857  12.906  25.663  1.00 54.92           O  
ATOM   2678  CB  ALA A 348      36.584  13.665  25.310  1.00 54.06           C  
ATOM   2679  N   TRP A 349      33.810  14.378  27.333  1.00 53.06           N  
ATOM   2680  CA  TRP A 349      32.360  14.507  27.289  1.00 55.16           C  
ATOM   2681  C   TRP A 349      31.806  15.570  26.359  1.00 58.88           C  
ATOM   2682  O   TRP A 349      32.431  16.599  26.107  1.00 59.71           O  
ATOM   2683  CB  TRP A 349      31.811  14.763  28.694  1.00 52.06           C  
ATOM   2684  CG  TRP A 349      31.864  13.573  29.606  1.00 50.65           C  
ATOM   2685  CD1 TRP A 349      32.961  12.811  29.908  1.00 47.43           C  
ATOM   2686  CD2 TRP A 349      30.770  13.007  30.336  1.00 48.06           C  
ATOM   2687  NE1 TRP A 349      32.614  11.807  30.778  1.00 44.26           N  
ATOM   2688  CE2 TRP A 349      31.276  11.902  31.058  1.00 46.59           C  
ATOM   2689  CE3 TRP A 349      29.411  13.324  30.450  1.00 46.41           C  
ATOM   2690  CZ2 TRP A 349      30.469  11.112  31.887  1.00 47.65           C  
ATOM   2691  CZ3 TRP A 349      28.609  12.539  31.273  1.00 49.06           C  
ATOM   2692  CH2 TRP A 349      29.143  11.443  31.981  1.00 47.48           C  
ATOM   2693  N   ASP A 350      30.614  15.288  25.843  1.00 62.96           N  
ATOM   2694  CA  ASP A 350      29.884  16.203  24.978  1.00 63.92           C  
ATOM   2695  C   ASP A 350      28.468  16.177  25.543  1.00 61.48           C  
ATOM   2696  O   ASP A 350      27.732  15.212  25.376  1.00 61.13           O  
ATOM   2697  CB  ASP A 350      29.894  15.723  23.522  1.00 70.57           C  
ATOM   2698  CG  ASP A 350      29.275  16.744  22.560  1.00 76.53           C  
ATOM   2699  OD1 ASP A 350      29.346  16.545  21.321  1.00 77.00           O  
ATOM   2700  OD2 ASP A 350      28.714  17.747  23.051  1.00 79.81           O  
ATOM   2701  N   LEU A 351      28.099  17.219  26.263  1.00 58.91           N  
ATOM   2702  CA  LEU A 351      26.771  17.251  26.834  1.00 61.77           C  
ATOM   2703  C   LEU A 351      25.859  18.075  25.912  1.00 65.23           C  
ATOM   2704  O   LEU A 351      24.675  18.312  26.203  1.00 62.80           O  
ATOM   2705  CB  LEU A 351      26.839  17.864  28.232  1.00 58.02           C  
ATOM   2706  CG  LEU A 351      27.794  17.229  29.233  1.00 49.38           C  
ATOM   2707  CD1 LEU A 351      28.903  18.185  29.562  1.00 45.70           C  
ATOM   2708  CD2 LEU A 351      27.034  16.891  30.482  1.00 49.29           C  
ATOM   2709  N   GLY A 352      26.434  18.500  24.789  1.00 67.26           N  
ATOM   2710  CA  GLY A 352      25.697  19.291  23.826  1.00 69.38           C  
ATOM   2711  C   GLY A 352      25.379  20.639  24.419  1.00 72.24           C  
ATOM   2712  O   GLY A 352      25.878  20.972  25.496  1.00 75.18           O  
ATOM   2713  N   LYS A 353      24.552  21.417  23.726  1.00 71.76           N  
ATOM   2714  CA  LYS A 353      24.168  22.738  24.204  1.00 70.29           C  
ATOM   2715  C   LYS A 353      25.408  23.612  24.414  1.00 69.40           C  
ATOM   2716  O   LYS A 353      25.371  24.605  25.145  1.00 69.32           O  
ATOM   2717  CB  LYS A 353      23.366  22.602  25.505  1.00 70.27           C  
ATOM   2718  CG  LYS A 353      22.744  23.884  26.009  1.00 76.73           C  
ATOM   2719  CD  LYS A 353      21.841  24.557  24.954  1.00 84.98           C  
ATOM   2720  CE  LYS A 353      22.625  25.477  23.989  1.00 86.47           C  
ATOM   2721  NZ  LYS A 353      21.784  26.108  22.917  1.00 86.43           N  
ATOM   2722  N   GLY A 354      26.505  23.231  23.761  1.00 67.61           N  
ATOM   2723  CA  GLY A 354      27.740  23.987  23.866  1.00 65.88           C  
ATOM   2724  C   GLY A 354      28.595  23.638  25.064  1.00 65.96           C  
ATOM   2725  O   GLY A 354      29.625  24.266  25.305  1.00 63.24           O  
ATOM   2726  N   ASP A 355      28.183  22.619  25.807  1.00 67.70           N  
ATOM   2727  CA  ASP A 355      28.911  22.197  26.999  1.00 69.93           C  
ATOM   2728  C   ASP A 355      29.952  21.086  26.769  1.00 70.88           C  
ATOM   2729  O   ASP A 355      29.609  19.918  26.570  1.00 70.14           O  
ATOM   2730  CB  ASP A 355      27.909  21.758  28.066  1.00 67.83           C  
ATOM   2731  CG  ASP A 355      28.566  21.494  29.392  1.00 67.67           C  
ATOM   2732  OD1 ASP A 355      27.856  21.039  30.312  1.00 66.85           O  
ATOM   2733  OD2 ASP A 355      29.789  21.747  29.507  1.00 64.24           O  
ATOM   2734  N   PHE A 356      31.227  21.461  26.821  1.00 72.91           N  
ATOM   2735  CA  PHE A 356      32.321  20.511  26.615  1.00 76.13           C  
ATOM   2736  C   PHE A 356      33.152  20.270  27.888  1.00 76.27           C  
ATOM   2737  O   PHE A 356      33.606  21.216  28.539  1.00 77.31           O  
ATOM   2738  CB  PHE A 356      33.241  21.012  25.496  1.00 77.42           C  
ATOM   2739  CG  PHE A 356      32.532  21.285  24.202  1.00 80.09           C  
ATOM   2740  CD1 PHE A 356      31.652  22.342  24.088  1.00 80.42           C  
ATOM   2741  CD2 PHE A 356      32.746  20.480  23.096  1.00 82.42           C  
ATOM   2742  CE1 PHE A 356      31.003  22.590  22.897  1.00 80.46           C  
ATOM   2743  CE2 PHE A 356      32.096  20.727  21.904  1.00 81.69           C  
ATOM   2744  CZ  PHE A 356      31.227  21.780  21.805  1.00 79.97           C  
ATOM   2745  N   ARG A 357      33.356  19.003  28.235  1.00 73.49           N  
ATOM   2746  CA  ARG A 357      34.123  18.660  29.427  1.00 70.86           C  
ATOM   2747  C   ARG A 357      34.968  17.400  29.212  1.00 69.31           C  
ATOM   2748  O   ARG A 357      34.745  16.639  28.272  1.00 71.69           O  
ATOM   2749  CB  ARG A 357      33.176  18.422  30.612  1.00 68.71           C  
ATOM   2750  CG  ARG A 357      32.192  19.541  30.916  1.00 69.79           C  
ATOM   2751  CD  ARG A 357      31.269  19.154  32.087  1.00 73.69           C  
ATOM   2752  NE  ARG A 357      30.241  20.153  32.396  1.00 73.97           N  
ATOM   2753  CZ  ARG A 357      29.304  20.004  33.332  1.00 74.85           C  
ATOM   2754  NH1 ARG A 357      28.409  20.957  33.543  1.00 73.46           N  
ATOM   2755  NH2 ARG A 357      29.259  18.902  34.064  1.00 76.12           N  
ATOM   2756  N   ILE A 358      35.942  17.190  30.091  1.00 64.94           N  
ATOM   2757  CA  ILE A 358      36.798  16.010  30.044  1.00 59.40           C  
ATOM   2758  C   ILE A 358      37.038  15.518  31.454  1.00 59.90           C  
ATOM   2759  O   ILE A 358      37.502  16.274  32.297  1.00 62.95           O  
ATOM   2760  CB  ILE A 358      38.164  16.300  29.459  1.00 54.16           C  
ATOM   2761  CG1 ILE A 358      38.098  16.231  27.939  1.00 50.45           C  
ATOM   2762  CG2 ILE A 358      39.172  15.314  30.037  1.00 49.87           C  
ATOM   2763  CD1 ILE A 358      39.398  16.554  27.267  1.00 46.89           C  
ATOM   2764  N   LEU A 359      36.727  14.257  31.711  1.00 57.72           N  
ATOM   2765  CA  LEU A 359      36.927  13.679  33.031  1.00 55.57           C  
ATOM   2766  C   LEU A 359      38.138  12.744  32.992  1.00 56.91           C  
ATOM   2767  O   LEU A 359      38.070  11.644  32.446  1.00 57.23           O  
ATOM   2768  CB  LEU A 359      35.667  12.928  33.452  1.00 49.79           C  
ATOM   2769  CG  LEU A 359      35.631  12.260  34.819  1.00 48.35           C  
ATOM   2770  CD1 LEU A 359      34.208  11.914  35.166  1.00 43.42           C  
ATOM   2771  CD2 LEU A 359      36.492  11.015  34.813  1.00 52.04           C  
ATOM   2772  N   MET A 360      39.248  13.187  33.571  1.00 58.63           N  
ATOM   2773  CA  MET A 360      40.467  12.384  33.575  1.00 63.24           C  
ATOM   2774  C   MET A 360      41.291  12.561  34.851  1.00 64.93           C  
ATOM   2775  O   MET A 360      41.637  13.682  35.219  1.00 63.92           O  
ATOM   2776  CB  MET A 360      41.326  12.752  32.355  1.00 64.01           C  
ATOM   2777  CG  MET A 360      42.611  11.948  32.197  1.00 62.64           C  
ATOM   2778  SD  MET A 360      43.551  12.462  30.752  1.00 65.75           S  
ATOM   2779  CE  MET A 360      45.192  11.795  31.109  1.00 61.52           C  
ATOM   2780  N   CYS A 361      41.599  11.457  35.529  1.00 66.18           N  
ATOM   2781  CA  CYS A 361      42.408  11.534  36.740  1.00 66.12           C  
ATOM   2782  C   CYS A 361      43.845  11.622  36.243  1.00 66.53           C  
ATOM   2783  O   CYS A 361      44.606  10.654  36.293  1.00 67.21           O  
ATOM   2784  CB  CYS A 361      42.181  10.297  37.617  1.00 64.67           C  
ATOM   2785  SG  CYS A 361      40.417  10.108  38.051  1.00 70.71           S  
ATOM   2786  N   THR A 362      44.195  12.807  35.744  1.00 66.87           N  
ATOM   2787  CA  THR A 362      45.520  13.063  35.187  1.00 66.46           C  
ATOM   2788  C   THR A 362      46.668  12.844  36.150  1.00 68.04           C  
ATOM   2789  O   THR A 362      46.594  13.163  37.336  1.00 71.00           O  
ATOM   2790  CB  THR A 362      45.651  14.496  34.632  1.00 63.06           C  
ATOM   2791  OG1 THR A 362      44.445  14.858  33.951  1.00 63.55           O  
ATOM   2792  CG2 THR A 362      46.803  14.568  33.642  1.00 57.72           C  
ATOM   2793  N   LYS A 363      47.742  12.299  35.609  1.00 68.27           N  
ATOM   2794  CA  LYS A 363      48.933  12.018  36.374  1.00 68.45           C  
ATOM   2795  C   LYS A 363      50.049  12.641  35.534  1.00 68.23           C  
ATOM   2796  O   LYS A 363      49.854  12.898  34.343  1.00 68.54           O  
ATOM   2797  CB  LYS A 363      49.065  10.495  36.517  1.00 68.74           C  
ATOM   2798  CG  LYS A 363      47.782   9.876  37.103  1.00 72.05           C  
ATOM   2799  CD  LYS A 363      47.404   8.504  36.524  1.00 74.49           C  
ATOM   2800  CE  LYS A 363      48.157   7.353  37.192  1.00 74.32           C  
ATOM   2801  NZ  LYS A 363      47.635   6.014  36.777  1.00 69.30           N  
ATOM   2802  N   VAL A 364      51.195  12.919  36.149  1.00 66.11           N  
ATOM   2803  CA  VAL A 364      52.306  13.519  35.430  1.00 64.60           C  
ATOM   2804  C   VAL A 364      53.215  12.450  34.839  1.00 65.62           C  
ATOM   2805  O   VAL A 364      54.331  12.253  35.297  1.00 66.38           O  
ATOM   2806  CB  VAL A 364      53.123  14.413  36.353  1.00 62.69           C  
ATOM   2807  CG1 VAL A 364      54.185  15.133  35.557  1.00 65.62           C  
ATOM   2808  CG2 VAL A 364      52.217  15.401  37.039  1.00 58.61           C  
ATOM   2809  N   THR A 365      52.714  11.770  33.814  1.00 66.81           N  
ATOM   2810  CA  THR A 365      53.416  10.699  33.114  1.00 67.47           C  
ATOM   2811  C   THR A 365      53.509  11.190  31.678  1.00 68.25           C  
ATOM   2812  O   THR A 365      52.902  12.207  31.354  1.00 69.06           O  
ATOM   2813  CB  THR A 365      52.558   9.416  33.127  1.00 69.00           C  
ATOM   2814  OG1 THR A 365      52.179   9.110  34.473  1.00 70.97           O  
ATOM   2815  CG2 THR A 365      53.311   8.246  32.531  1.00 70.56           C  
ATOM   2816  N   MET A 366      54.267  10.506  30.818  1.00 69.30           N  
ATOM   2817  CA  MET A 366      54.316  10.921  29.410  1.00 70.42           C  
ATOM   2818  C   MET A 366      53.084  10.288  28.755  1.00 71.07           C  
ATOM   2819  O   MET A 366      52.649  10.690  27.677  1.00 70.15           O  
ATOM   2820  CB  MET A 366      55.577  10.427  28.697  1.00 68.23           C  
ATOM   2821  CG  MET A 366      55.683  10.953  27.265  1.00 65.95           C  
ATOM   2822  SD  MET A 366      57.092  10.349  26.302  1.00 64.61           S  
ATOM   2823  CE  MET A 366      57.150  11.554  24.995  1.00 60.22           C  
ATOM   2824  N   ASP A 367      52.541   9.281  29.433  1.00 71.01           N  
ATOM   2825  CA  ASP A 367      51.353   8.599  28.980  1.00 68.92           C  
ATOM   2826  C   ASP A 367      50.244   9.610  29.084  1.00 68.79           C  
ATOM   2827  O   ASP A 367      49.547   9.867  28.115  1.00 71.57           O  
ATOM   2828  CB  ASP A 367      51.044   7.407  29.882  1.00 71.76           C  
ATOM   2829  CG  ASP A 367      51.392   6.080  29.231  1.00 75.84           C  
ATOM   2830  OD1 ASP A 367      51.384   5.037  29.924  1.00 78.03           O  
ATOM   2831  OD2 ASP A 367      51.667   6.080  28.015  1.00 78.13           O  
ATOM   2832  N   ASP A 368      50.086  10.198  30.262  1.00 69.17           N  
ATOM   2833  CA  ASP A 368      49.037  11.188  30.469  1.00 70.43           C  
ATOM   2834  C   ASP A 368      49.289  12.484  29.713  1.00 69.38           C  
ATOM   2835  O   ASP A 368      48.419  13.342  29.643  1.00 71.31           O  
ATOM   2836  CB  ASP A 368      48.851  11.476  31.960  1.00 72.16           C  
ATOM   2837  CG  ASP A 368      48.194  10.325  32.692  1.00 74.40           C  
ATOM   2838  OD1 ASP A 368      48.713   9.195  32.597  1.00 79.76           O  
ATOM   2839  OD2 ASP A 368      47.163  10.542  33.361  1.00 72.57           O  
ATOM   2840  N   PHE A 369      50.480  12.639  29.153  1.00 67.34           N  
ATOM   2841  CA  PHE A 369      50.766  13.836  28.374  1.00 67.20           C  
ATOM   2842  C   PHE A 369      50.103  13.671  27.008  1.00 67.84           C  
ATOM   2843  O   PHE A 369      49.483  14.600  26.489  1.00 68.75           O  
ATOM   2844  CB  PHE A 369      52.269  14.014  28.196  1.00 66.39           C  
ATOM   2845  CG  PHE A 369      52.641  14.967  27.094  1.00 67.01           C  
ATOM   2846  CD1 PHE A 369      53.083  14.488  25.866  1.00 68.25           C  
ATOM   2847  CD2 PHE A 369      52.589  16.338  27.293  1.00 62.90           C  
ATOM   2848  CE1 PHE A 369      53.473  15.360  24.863  1.00 66.22           C  
ATOM   2849  CE2 PHE A 369      52.974  17.208  26.299  1.00 61.00           C  
ATOM   2850  CZ  PHE A 369      53.419  16.720  25.082  1.00 64.21           C  
ATOM   2851  N   LEU A 370      50.241  12.473  26.442  1.00 66.77           N  
ATOM   2852  CA  LEU A 370      49.657  12.132  25.155  1.00 63.49           C  
ATOM   2853  C   LEU A 370      48.154  11.900  25.238  1.00 62.61           C  
ATOM   2854  O   LEU A 370      47.413  12.405  24.405  1.00 63.58           O  
ATOM   2855  CB  LEU A 370      50.324  10.887  24.590  1.00 62.76           C  
ATOM   2856  CG  LEU A 370      51.816  11.080  24.349  1.00 65.15           C  
ATOM   2857  CD1 LEU A 370      52.333   9.971  23.433  1.00 62.18           C  
ATOM   2858  CD2 LEU A 370      52.047  12.449  23.716  1.00 65.84           C  
ATOM   2859  N   THR A 371      47.696  11.139  26.231  1.00 61.08           N  
ATOM   2860  CA  THR A 371      46.261  10.885  26.370  1.00 60.95           C  
ATOM   2861  C   THR A 371      45.477  12.188  26.416  1.00 63.88           C  
ATOM   2862  O   THR A 371      44.288  12.230  26.070  1.00 65.54           O  
ATOM   2863  CB  THR A 371      45.929  10.093  27.633  1.00 56.58           C  
ATOM   2864  OG1 THR A 371      46.459   8.773  27.515  1.00 54.34           O  
ATOM   2865  CG2 THR A 371      44.425  10.004  27.815  1.00 53.66           C  
ATOM   2866  N   ALA A 372      46.146  13.249  26.857  1.00 63.64           N  
ATOM   2867  CA  ALA A 372      45.525  14.559  26.925  1.00 60.18           C  
ATOM   2868  C   ALA A 372      45.318  15.011  25.477  1.00 57.96           C  
ATOM   2869  O   ALA A 372      44.248  15.509  25.124  1.00 57.15           O  
ATOM   2870  CB  ALA A 372      46.430  15.514  27.659  1.00 62.45           C  
ATOM   2871  N   HIS A 373      46.342  14.826  24.642  1.00 52.29           N  
ATOM   2872  CA  HIS A 373      46.248  15.186  23.228  1.00 50.42           C  
ATOM   2873  C   HIS A 373      45.188  14.328  22.580  1.00 48.51           C  
ATOM   2874  O   HIS A 373      44.660  14.654  21.525  1.00 52.22           O  
ATOM   2875  CB  HIS A 373      47.560  14.937  22.499  1.00 49.38           C  
ATOM   2876  CG  HIS A 373      48.571  16.012  22.699  1.00 52.07           C  
ATOM   2877  ND1 HIS A 373      48.893  16.506  23.943  1.00 54.38           N  
ATOM   2878  CD2 HIS A 373      49.366  16.659  21.818  1.00 54.66           C  
ATOM   2879  CE1 HIS A 373      49.849  17.410  23.819  1.00 55.56           C  
ATOM   2880  NE2 HIS A 373      50.155  17.521  22.540  1.00 55.77           N  
ATOM   2881  N   HIS A 374      44.898  13.199  23.197  1.00 44.78           N  
ATOM   2882  CA  HIS A 374      43.891  12.346  22.645  1.00 39.84           C  
ATOM   2883  C   HIS A 374      42.603  12.990  23.047  1.00 43.68           C  
ATOM   2884  O   HIS A 374      41.990  13.713  22.270  1.00 46.21           O  
ATOM   2885  CB  HIS A 374      43.941  10.972  23.257  1.00 33.87           C  
ATOM   2886  CG  HIS A 374      42.898  10.055  22.716  1.00 31.49           C  
ATOM   2887  ND1 HIS A 374      43.050   9.384  21.524  1.00 30.35           N  
ATOM   2888  CD2 HIS A 374      41.668   9.731  23.178  1.00 26.61           C  
ATOM   2889  CE1 HIS A 374      41.959   8.680  21.277  1.00 27.99           C  
ATOM   2890  NE2 HIS A 374      41.106   8.875  22.264  1.00 28.29           N  
ATOM   2891  N   GLU A 375      42.204  12.730  24.287  1.00 46.07           N  
ATOM   2892  CA  GLU A 375      40.962  13.266  24.826  1.00 47.59           C  
ATOM   2893  C   GLU A 375      40.633  14.645  24.273  1.00 46.90           C  
ATOM   2894  O   GLU A 375      39.509  14.890  23.866  1.00 43.08           O  
ATOM   2895  CB  GLU A 375      41.031  13.299  26.352  1.00 48.74           C  
ATOM   2896  CG  GLU A 375      41.222  11.917  26.954  1.00 52.97           C  
ATOM   2897  CD  GLU A 375      40.246  10.898  26.387  1.00 54.77           C  
ATOM   2898  OE1 GLU A 375      39.022  11.102  26.506  1.00 56.61           O  
ATOM   2899  OE2 GLU A 375      40.699   9.890  25.819  1.00 53.53           O  
ATOM   2900  N   MET A 376      41.609  15.545  24.247  1.00 50.58           N  
ATOM   2901  CA  MET A 376      41.359  16.877  23.708  1.00 53.67           C  
ATOM   2902  C   MET A 376      40.871  16.711  22.258  1.00 53.73           C  
ATOM   2903  O   MET A 376      39.797  17.201  21.907  1.00 54.64           O  
ATOM   2904  CB  MET A 376      42.633  17.732  23.768  1.00 56.15           C  
ATOM   2905  CG  MET A 376      42.375  19.234  23.632  1.00 60.15           C  
ATOM   2906  SD  MET A 376      43.444  20.315  24.656  1.00 66.07           S  
ATOM   2907  CE  MET A 376      42.620  20.149  26.231  1.00 58.88           C  
ATOM   2908  N   GLY A 377      41.651  16.012  21.430  1.00 50.72           N  
ATOM   2909  CA  GLY A 377      41.257  15.773  20.054  1.00 46.52           C  
ATOM   2910  C   GLY A 377      39.781  15.406  19.967  1.00 46.57           C  
ATOM   2911  O   GLY A 377      39.049  15.895  19.125  1.00 45.96           O  
ATOM   2912  N   HIS A 378      39.326  14.529  20.839  1.00 48.51           N  
ATOM   2913  CA  HIS A 378      37.924  14.170  20.815  1.00 51.76           C  
ATOM   2914  C   HIS A 378      37.120  15.447  20.846  1.00 52.98           C  
ATOM   2915  O   HIS A 378      36.210  15.648  20.060  1.00 56.95           O  
ATOM   2916  CB  HIS A 378      37.562  13.331  22.031  1.00 51.12           C  
ATOM   2917  CG  HIS A 378      37.628  11.864  21.781  1.00 53.92           C  
ATOM   2918  ND1 HIS A 378      37.298  11.308  20.566  1.00 55.33           N  
ATOM   2919  CD2 HIS A 378      37.903  10.829  22.606  1.00 57.69           C  
ATOM   2920  CE1 HIS A 378      37.360   9.993  20.652  1.00 55.61           C  
ATOM   2921  NE2 HIS A 378      37.723   9.676  21.880  1.00 57.99           N  
ATOM   2922  N   ILE A 379      37.473  16.318  21.772  1.00 53.95           N  
ATOM   2923  CA  ILE A 379      36.777  17.572  21.925  1.00 53.68           C  
ATOM   2924  C   ILE A 379      36.857  18.436  20.686  1.00 57.10           C  
ATOM   2925  O   ILE A 379      35.832  18.834  20.139  1.00 60.16           O  
ATOM   2926  CB  ILE A 379      37.345  18.357  23.082  1.00 49.03           C  
ATOM   2927  CG1 ILE A 379      37.060  17.617  24.383  1.00 45.59           C  
ATOM   2928  CG2 ILE A 379      36.744  19.732  23.101  1.00 51.75           C  
ATOM   2929  CD1 ILE A 379      35.619  17.295  24.580  1.00 43.31           C  
ATOM   2930  N   GLN A 380      38.074  18.726  20.238  1.00 59.34           N  
ATOM   2931  CA  GLN A 380      38.259  19.575  19.068  1.00 58.79           C  
ATOM   2932  C   GLN A 380      37.377  19.104  17.930  1.00 56.79           C  
ATOM   2933  O   GLN A 380      37.033  19.877  17.049  1.00 58.68           O  
ATOM   2934  CB  GLN A 380      39.723  19.585  18.622  1.00 58.92           C  
ATOM   2935  CG  GLN A 380      40.151  20.919  18.039  1.00 62.67           C  
ATOM   2936  CD  GLN A 380      40.311  21.983  19.106  1.00 64.80           C  
ATOM   2937  OE1 GLN A 380      41.426  22.404  19.420  1.00 65.58           O  
ATOM   2938  NE2 GLN A 380      39.195  22.414  19.683  1.00 66.13           N  
ATOM   2939  N   TYR A 381      37.016  17.830  17.965  1.00 54.11           N  
ATOM   2940  CA  TYR A 381      36.162  17.241  16.950  1.00 53.84           C  
ATOM   2941  C   TYR A 381      34.720  17.557  17.355  1.00 54.14           C  
ATOM   2942  O   TYR A 381      34.015  18.261  16.642  1.00 53.90           O  
ATOM   2943  CB  TYR A 381      36.400  15.733  16.910  1.00 56.36           C  
ATOM   2944  CG  TYR A 381      35.926  15.007  15.670  1.00 59.27           C  
ATOM   2945  CD1 TYR A 381      35.842  13.626  15.654  1.00 60.97           C  
ATOM   2946  CD2 TYR A 381      35.575  15.691  14.517  1.00 62.81           C  
ATOM   2947  CE1 TYR A 381      35.423  12.948  14.530  1.00 63.23           C  
ATOM   2948  CE2 TYR A 381      35.150  15.012  13.378  1.00 61.14           C  
ATOM   2949  CZ  TYR A 381      35.078  13.642  13.392  1.00 62.09           C  
ATOM   2950  OH  TYR A 381      34.671  12.953  12.266  1.00 62.41           O  
ATOM   2951  N   ASP A 382      34.289  17.044  18.504  1.00 56.23           N  
ATOM   2952  CA  ASP A 382      32.939  17.297  19.014  1.00 58.02           C  
ATOM   2953  C   ASP A 382      32.501  18.743  18.722  1.00 58.57           C  
ATOM   2954  O   ASP A 382      31.328  19.004  18.458  1.00 55.96           O  
ATOM   2955  CB  ASP A 382      32.886  17.062  20.535  1.00 62.27           C  
ATOM   2956  CG  ASP A 382      33.190  15.622  20.935  1.00 64.44           C  
ATOM   2957  OD1 ASP A 382      32.470  14.714  20.469  1.00 67.24           O  
ATOM   2958  OD2 ASP A 382      34.136  15.404  21.730  1.00 61.48           O  
ATOM   2959  N   MET A 383      33.447  19.680  18.801  1.00 59.96           N  
ATOM   2960  CA  MET A 383      33.163  21.089  18.531  1.00 60.82           C  
ATOM   2961  C   MET A 383      33.038  21.263  17.030  1.00 62.99           C  
ATOM   2962  O   MET A 383      32.013  21.701  16.518  1.00 63.46           O  
ATOM   2963  CB  MET A 383      34.303  21.990  18.997  1.00 60.05           C  
ATOM   2964  CG  MET A 383      34.740  21.827  20.442  1.00 63.32           C  
ATOM   2965  SD  MET A 383      35.792  23.209  20.965  1.00 57.43           S  
ATOM   2966  CE  MET A 383      34.485  24.292  21.471  1.00 60.15           C  
ATOM   2967  N   ALA A 384      34.112  20.912  16.333  1.00 64.12           N  
ATOM   2968  CA  ALA A 384      34.176  21.010  14.884  1.00 62.90           C  
ATOM   2969  C   ALA A 384      32.920  20.530  14.182  1.00 63.40           C  
ATOM   2970  O   ALA A 384      32.684  20.910  13.043  1.00 69.58           O  
ATOM   2971  CB  ALA A 384      35.371  20.242  14.363  1.00 59.40           C  
ATOM   2972  N   TYR A 385      32.107  19.696  14.819  1.00 60.65           N  
ATOM   2973  CA  TYR A 385      30.904  19.249  14.133  1.00 61.26           C  
ATOM   2974  C   TYR A 385      29.654  19.609  14.919  1.00 63.39           C  
ATOM   2975  O   TYR A 385      28.563  19.077  14.670  1.00 63.64           O  
ATOM   2976  CB  TYR A 385      30.974  17.732  13.818  1.00 61.65           C  
ATOM   2977  CG  TYR A 385      30.938  16.759  14.996  1.00 58.47           C  
ATOM   2978  CD1 TYR A 385      31.836  15.703  15.080  1.00 55.80           C  
ATOM   2979  CD2 TYR A 385      29.983  16.869  15.986  1.00 58.67           C  
ATOM   2980  CE1 TYR A 385      31.776  14.796  16.115  1.00 54.57           C  
ATOM   2981  CE2 TYR A 385      29.918  15.971  17.016  1.00 59.52           C  
ATOM   2982  CZ  TYR A 385      30.812  14.935  17.081  1.00 56.57           C  
ATOM   2983  OH  TYR A 385      30.711  14.048  18.132  1.00 58.32           O  
ATOM   2984  N   ALA A 386      29.827  20.533  15.865  1.00 64.18           N  
ATOM   2985  CA  ALA A 386      28.731  21.005  16.717  1.00 62.94           C  
ATOM   2986  C   ALA A 386      27.669  21.643  15.838  1.00 61.00           C  
ATOM   2987  O   ALA A 386      26.491  21.292  15.905  1.00 57.82           O  
ATOM   2988  CB  ALA A 386      29.253  22.020  17.735  1.00 62.13           C  
ATOM   2989  N   ALA A 387      28.111  22.585  15.013  1.00 60.10           N  
ATOM   2990  CA  ALA A 387      27.233  23.276  14.088  1.00 61.33           C  
ATOM   2991  C   ALA A 387      26.823  22.270  13.016  1.00 60.86           C  
ATOM   2992  O   ALA A 387      27.328  22.307  11.901  1.00 65.83           O  
ATOM   2993  CB  ALA A 387      27.979  24.438  13.462  1.00 59.72           C  
ATOM   2994  N   GLN A 388      25.904  21.375  13.344  1.00 57.39           N  
ATOM   2995  CA  GLN A 388      25.496  20.354  12.391  1.00 58.54           C  
ATOM   2996  C   GLN A 388      24.285  19.643  12.972  1.00 59.97           C  
ATOM   2997  O   GLN A 388      24.225  19.423  14.179  1.00 64.41           O  
ATOM   2998  CB  GLN A 388      26.645  19.355  12.217  1.00 59.44           C  
ATOM   2999  CG  GLN A 388      26.389  18.215  11.247  1.00 57.12           C  
ATOM   3000  CD  GLN A 388      27.066  18.431   9.914  1.00 55.19           C  
ATOM   3001  OE1 GLN A 388      26.778  17.737   8.951  1.00 59.69           O  
ATOM   3002  NE2 GLN A 388      27.977  19.388   9.855  1.00 48.54           N  
ATOM   3003  N   PRO A 389      23.313  19.262  12.132  1.00 57.54           N  
ATOM   3004  CA  PRO A 389      22.128  18.577  12.645  1.00 57.78           C  
ATOM   3005  C   PRO A 389      22.473  17.600  13.758  1.00 60.46           C  
ATOM   3006  O   PRO A 389      23.211  16.640  13.545  1.00 62.31           O  
ATOM   3007  CB  PRO A 389      21.573  17.878  11.408  1.00 57.28           C  
ATOM   3008  CG  PRO A 389      22.773  17.678  10.570  1.00 59.51           C  
ATOM   3009  CD  PRO A 389      23.444  19.020  10.694  1.00 59.18           C  
ATOM   3010  N   PHE A 390      21.941  17.863  14.948  1.00 61.84           N  
ATOM   3011  CA  PHE A 390      22.178  17.032  16.134  1.00 60.48           C  
ATOM   3012  C   PHE A 390      22.303  15.543  15.871  1.00 61.04           C  
ATOM   3013  O   PHE A 390      23.306  14.933  16.219  1.00 61.89           O  
ATOM   3014  CB  PHE A 390      21.057  17.264  17.141  1.00 55.91           C  
ATOM   3015  CG  PHE A 390      21.001  16.261  18.254  1.00 49.74           C  
ATOM   3016  CD1 PHE A 390      21.479  16.579  19.511  1.00 54.78           C  
ATOM   3017  CD2 PHE A 390      20.368  15.050  18.079  1.00 47.77           C  
ATOM   3018  CE1 PHE A 390      21.309  15.701  20.583  1.00 54.58           C  
ATOM   3019  CE2 PHE A 390      20.198  14.174  19.133  1.00 48.94           C  
ATOM   3020  CZ  PHE A 390      20.664  14.498  20.387  1.00 50.80           C  
ATOM   3021  N   LEU A 391      21.285  14.953  15.260  1.00 61.73           N  
ATOM   3022  CA  LEU A 391      21.318  13.523  15.012  1.00 62.54           C  
ATOM   3023  C   LEU A 391      22.242  13.163  13.861  1.00 63.83           C  
ATOM   3024  O   LEU A 391      21.996  12.217  13.116  1.00 67.31           O  
ATOM   3025  CB  LEU A 391      19.903  13.010  14.744  1.00 62.62           C  
ATOM   3026  CG  LEU A 391      19.763  11.507  14.967  1.00 61.68           C  
ATOM   3027  CD1 LEU A 391      21.066  10.970  15.553  1.00 63.93           C  
ATOM   3028  CD2 LEU A 391      18.608  11.218  15.902  1.00 57.98           C  
ATOM   3029  N   LEU A 392      23.328  13.905  13.728  1.00 63.32           N  
ATOM   3030  CA  LEU A 392      24.249  13.644  12.647  1.00 61.17           C  
ATOM   3031  C   LEU A 392      25.650  14.037  13.033  1.00 62.32           C  
ATOM   3032  O   LEU A 392      26.596  13.612  12.388  1.00 67.16           O  
ATOM   3033  CB  LEU A 392      23.834  14.428  11.413  1.00 60.33           C  
ATOM   3034  CG  LEU A 392      23.835  13.598  10.145  1.00 58.82           C  
ATOM   3035  CD1 LEU A 392      22.914  12.410  10.362  1.00 54.77           C  
ATOM   3036  CD2 LEU A 392      23.406  14.454   8.964  1.00 55.08           C  
ATOM   3037  N   ARG A 393      25.778  14.876  14.059  1.00 61.50           N  
ATOM   3038  CA  ARG A 393      27.084  15.314  14.560  1.00 60.67           C  
ATOM   3039  C   ARG A 393      27.681  14.088  15.276  1.00 58.52           C  
ATOM   3040  O   ARG A 393      27.259  13.746  16.382  1.00 56.63           O  
ATOM   3041  CB  ARG A 393      26.874  16.466  15.540  1.00 61.97           C  
ATOM   3042  CG  ARG A 393      25.621  16.264  16.352  1.00 64.30           C  
ATOM   3043  CD  ARG A 393      25.429  17.278  17.456  1.00 70.39           C  
ATOM   3044  NE  ARG A 393      25.249  18.647  16.977  1.00 71.70           N  
ATOM   3045  CZ  ARG A 393      24.375  19.505  17.500  1.00 70.87           C  
ATOM   3046  NH1 ARG A 393      23.591  19.135  18.508  1.00 68.39           N  
ATOM   3047  NH2 ARG A 393      24.312  20.744  17.040  1.00 70.99           N  
ATOM   3048  N   ASN A 394      28.661  13.431  14.655  1.00 55.49           N  
ATOM   3049  CA  ASN A 394      29.201  12.226  15.252  1.00 52.30           C  
ATOM   3050  C   ASN A 394      30.341  11.527  14.524  1.00 50.64           C  
ATOM   3051  O   ASN A 394      30.383  10.305  14.519  1.00 56.32           O  
ATOM   3052  CB  ASN A 394      28.079  11.211  15.406  1.00 56.19           C  
ATOM   3053  CG  ASN A 394      27.783  10.888  16.835  1.00 63.10           C  
ATOM   3054  OD1 ASN A 394      27.363  11.753  17.613  1.00 67.83           O  
ATOM   3055  ND2 ASN A 394      27.998   9.629  17.205  1.00 66.08           N  
ATOM   3056  N   GLY A 395      31.251  12.259  13.901  1.00 44.42           N  
ATOM   3057  CA  GLY A 395      32.368  11.601  13.243  1.00 37.52           C  
ATOM   3058  C   GLY A 395      32.031  10.548  12.207  1.00 35.87           C  
ATOM   3059  O   GLY A 395      31.139   9.726  12.398  1.00 30.33           O  
ATOM   3060  N   ALA A 396      32.774  10.558  11.106  1.00 37.09           N  
ATOM   3061  CA  ALA A 396      32.531   9.630  10.015  1.00 38.65           C  
ATOM   3062  C   ALA A 396      32.286   8.233  10.529  1.00 40.83           C  
ATOM   3063  O   ALA A 396      31.487   7.505   9.970  1.00 44.13           O  
ATOM   3064  CB  ALA A 396      33.689   9.646   9.069  1.00 41.81           C  
ATOM   3065  N   ASN A 397      32.999   7.870  11.590  1.00 45.47           N  
ATOM   3066  CA  ASN A 397      32.880   6.576  12.272  1.00 46.51           C  
ATOM   3067  C   ASN A 397      33.842   6.567  13.455  1.00 46.23           C  
ATOM   3068  O   ASN A 397      34.734   7.422  13.549  1.00 40.74           O  
ATOM   3069  CB  ASN A 397      33.212   5.407  11.351  1.00 50.09           C  
ATOM   3070  CG  ASN A 397      34.653   5.404  10.912  1.00 55.76           C  
ATOM   3071  OD1 ASN A 397      35.165   4.393  10.424  1.00 60.20           O  
ATOM   3072  ND2 ASN A 397      35.319   6.538  11.073  1.00 55.28           N  
ATOM   3073  N   GLU A 398      33.650   5.605  14.358  1.00 48.25           N  
ATOM   3074  CA  GLU A 398      34.499   5.481  15.543  1.00 46.93           C  
ATOM   3075  C   GLU A 398      35.987   5.610  15.217  1.00 46.74           C  
ATOM   3076  O   GLU A 398      36.683   6.413  15.835  1.00 49.43           O  
ATOM   3077  CB  GLU A 398      34.215   4.167  16.265  1.00 43.79           C  
ATOM   3078  CG  GLU A 398      33.995   2.971  15.368  1.00 45.66           C  
ATOM   3079  CD  GLU A 398      33.635   1.722  16.159  1.00 49.39           C  
ATOM   3080  OE1 GLU A 398      32.668   1.772  16.946  1.00 48.60           O  
ATOM   3081  OE2 GLU A 398      34.315   0.689  15.996  1.00 52.60           O  
ATOM   3082  N   GLY A 399      36.479   4.846  14.249  1.00 43.68           N  
ATOM   3083  CA  GLY A 399      37.876   4.981  13.898  1.00 45.11           C  
ATOM   3084  C   GLY A 399      38.259   6.456  13.866  1.00 46.69           C  
ATOM   3085  O   GLY A 399      39.134   6.910  14.598  1.00 43.98           O  
ATOM   3086  N   PHE A 400      37.569   7.210  13.020  1.00 48.55           N  
ATOM   3087  CA  PHE A 400      37.800   8.640  12.857  1.00 48.20           C  
ATOM   3088  C   PHE A 400      37.914   9.426  14.161  1.00 49.15           C  
ATOM   3089  O   PHE A 400      38.825  10.238  14.317  1.00 47.90           O  
ATOM   3090  CB  PHE A 400      36.669   9.254  12.026  1.00 49.13           C  
ATOM   3091  CG  PHE A 400      36.991   9.422  10.567  1.00 46.27           C  
ATOM   3092  CD1 PHE A 400      37.319   8.337   9.782  1.00 43.69           C  
ATOM   3093  CD2 PHE A 400      36.930  10.673   9.979  1.00 46.33           C  
ATOM   3094  CE1 PHE A 400      37.576   8.493   8.450  1.00 44.73           C  
ATOM   3095  CE2 PHE A 400      37.189  10.833   8.640  1.00 45.38           C  
ATOM   3096  CZ  PHE A 400      37.511   9.744   7.877  1.00 45.36           C  
ATOM   3097  N   HIS A 401      36.975   9.212  15.082  1.00 48.60           N  
ATOM   3098  CA  HIS A 401      36.988   9.941  16.346  1.00 47.89           C  
ATOM   3099  C   HIS A 401      38.216   9.589  17.169  1.00 48.45           C  
ATOM   3100  O   HIS A 401      38.886  10.468  17.725  1.00 49.76           O  
ATOM   3101  CB  HIS A 401      35.725   9.646  17.149  1.00 46.64           C  
ATOM   3102  CG  HIS A 401      35.013  10.878  17.625  1.00 48.55           C  
ATOM   3103  ND1 HIS A 401      35.662  11.915  18.264  1.00 46.83           N  
ATOM   3104  CD2 HIS A 401      33.702  11.217  17.600  1.00 46.45           C  
ATOM   3105  CE1 HIS A 401      34.783  12.835  18.615  1.00 44.16           C  
ATOM   3106  NE2 HIS A 401      33.587  12.435  18.225  1.00 47.65           N  
ATOM   3107  N   GLU A 402      38.509   8.295  17.245  1.00 46.39           N  
ATOM   3108  CA  GLU A 402      39.674   7.831  17.975  1.00 40.31           C  
ATOM   3109  C   GLU A 402      40.877   8.270  17.180  1.00 40.45           C  
ATOM   3110  O   GLU A 402      41.800   8.860  17.703  1.00 42.50           O  
ATOM   3111  CB  GLU A 402      39.646   6.315  18.094  1.00 35.22           C  
ATOM   3112  CG  GLU A 402      38.403   5.777  18.813  1.00 29.79           C  
ATOM   3113  CD  GLU A 402      38.260   6.361  20.206  1.00 31.34           C  
ATOM   3114  OE1 GLU A 402      39.206   7.061  20.655  1.00 23.69           O  
ATOM   3115  OE2 GLU A 402      37.215   6.114  20.853  1.00 28.36           O  
ATOM   3116  N   ALA A 403      40.830   8.027  15.883  1.00 43.22           N  
ATOM   3117  CA  ALA A 403      41.930   8.370  14.990  1.00 44.57           C  
ATOM   3118  C   ALA A 403      42.338   9.837  14.937  1.00 44.21           C  
ATOM   3119  O   ALA A 403      43.232  10.195  14.177  1.00 44.12           O  
ATOM   3120  CB  ALA A 403      41.599   7.884  13.577  1.00 39.05           C  
ATOM   3121  N   VAL A 404      41.731  10.689  15.750  1.00 46.78           N  
ATOM   3122  CA  VAL A 404      42.054  12.106  15.638  1.00 50.88           C  
ATOM   3123  C   VAL A 404      43.087  12.620  16.605  1.00 52.83           C  
ATOM   3124  O   VAL A 404      44.004  13.323  16.214  1.00 50.78           O  
ATOM   3125  CB  VAL A 404      40.750  12.985  15.722  1.00 50.76           C  
ATOM   3126  CG1 VAL A 404      40.099  12.837  17.081  1.00 51.30           C  
ATOM   3127  CG2 VAL A 404      41.060  14.435  15.419  1.00 43.62           C  
ATOM   3128  N   GLY A 405      42.939  12.277  17.874  1.00 60.68           N  
ATOM   3129  CA  GLY A 405      43.895  12.739  18.863  1.00 65.34           C  
ATOM   3130  C   GLY A 405      45.231  12.058  18.657  1.00 66.89           C  
ATOM   3131  O   GLY A 405      46.259  12.547  19.117  1.00 68.86           O  
ATOM   3132  N   GLU A 406      45.209  10.930  17.954  1.00 66.05           N  
ATOM   3133  CA  GLU A 406      46.411  10.166  17.685  1.00 65.77           C  
ATOM   3134  C   GLU A 406      47.195  10.752  16.525  1.00 66.56           C  
ATOM   3135  O   GLU A 406      48.307  10.326  16.241  1.00 67.47           O  
ATOM   3136  CB  GLU A 406      46.051   8.715  17.388  1.00 68.81           C  
ATOM   3137  CG  GLU A 406      45.427   7.960  18.564  1.00 70.43           C  
ATOM   3138  CD  GLU A 406      46.321   7.925  19.794  1.00 71.51           C  
ATOM   3139  OE1 GLU A 406      47.543   7.689  19.649  1.00 71.17           O  
ATOM   3140  OE2 GLU A 406      45.796   8.122  20.911  1.00 73.02           O  
ATOM   3141  N   ILE A 407      46.604  11.724  15.842  1.00 67.75           N  
ATOM   3142  CA  ILE A 407      47.271  12.383  14.726  1.00 66.66           C  
ATOM   3143  C   ILE A 407      48.125  13.485  15.322  1.00 68.22           C  
ATOM   3144  O   ILE A 407      49.031  14.008  14.674  1.00 70.64           O  
ATOM   3145  CB  ILE A 407      46.251  12.987  13.748  1.00 65.39           C  
ATOM   3146  CG1 ILE A 407      45.508  11.852  13.036  1.00 66.72           C  
ATOM   3147  CG2 ILE A 407      46.947  13.908  12.764  1.00 62.40           C  
ATOM   3148  CD1 ILE A 407      44.354  12.296  12.159  1.00 68.25           C  
ATOM   3149  N   MET A 408      47.818  13.820  16.572  1.00 69.69           N  
ATOM   3150  CA  MET A 408      48.538  14.838  17.328  1.00 71.33           C  
ATOM   3151  C   MET A 408      49.675  14.140  18.073  1.00 71.41           C  
ATOM   3152  O   MET A 408      50.845  14.438  17.853  1.00 73.77           O  
ATOM   3153  CB  MET A 408      47.594  15.508  18.324  1.00 73.55           C  
ATOM   3154  CG  MET A 408      46.349  16.111  17.685  1.00 77.53           C  
ATOM   3155  SD  MET A 408      46.628  17.707  16.871  1.00 82.45           S  
ATOM   3156  CE  MET A 408      47.207  17.218  15.281  1.00 81.65           C  
ATOM   3157  N   SER A 409      49.327  13.202  18.949  1.00 68.88           N  
ATOM   3158  CA  SER A 409      50.324  12.449  19.700  1.00 67.78           C  
ATOM   3159  C   SER A 409      51.428  11.933  18.777  1.00 67.91           C  
ATOM   3160  O   SER A 409      52.553  11.687  19.203  1.00 69.04           O  
ATOM   3161  CB  SER A 409      49.668  11.259  20.396  1.00 67.77           C  
ATOM   3162  OG  SER A 409      48.785  11.678  21.421  1.00 72.56           O  
ATOM   3163  N   LEU A 410      51.103  11.764  17.506  1.00 67.34           N  
ATOM   3164  CA  LEU A 410      52.075  11.265  16.545  1.00 65.86           C  
ATOM   3165  C   LEU A 410      53.103  12.361  16.291  1.00 67.30           C  
ATOM   3166  O   LEU A 410      54.306  12.114  16.146  1.00 68.90           O  
ATOM   3167  CB  LEU A 410      51.365  10.887  15.240  1.00 59.43           C  
ATOM   3168  CG  LEU A 410      51.987   9.760  14.425  1.00 52.74           C  
ATOM   3169  CD1 LEU A 410      53.370  10.142  13.999  1.00 53.94           C  
ATOM   3170  CD2 LEU A 410      52.039   8.515  15.254  1.00 51.60           C  
ATOM   3171  N   SER A 411      52.612  13.584  16.251  1.00 66.74           N  
ATOM   3172  CA  SER A 411      53.456  14.731  16.004  1.00 69.43           C  
ATOM   3173  C   SER A 411      54.035  15.269  17.318  1.00 69.41           C  
ATOM   3174  O   SER A 411      55.222  15.603  17.404  1.00 68.88           O  
ATOM   3175  CB  SER A 411      52.618  15.796  15.280  1.00 70.68           C  
ATOM   3176  OG  SER A 411      53.200  17.082  15.340  1.00 73.73           O  
ATOM   3177  N   ALA A 412      53.193  15.332  18.342  1.00 68.44           N  
ATOM   3178  CA  ALA A 412      53.603  15.847  19.637  1.00 69.16           C  
ATOM   3179  C   ALA A 412      54.155  14.759  20.548  1.00 67.98           C  
ATOM   3180  O   ALA A 412      53.626  14.515  21.635  1.00 69.21           O  
ATOM   3181  CB  ALA A 412      52.424  16.549  20.307  1.00 70.92           C  
ATOM   3182  N   ALA A 413      55.220  14.112  20.089  1.00 64.97           N  
ATOM   3183  CA  ALA A 413      55.888  13.046  20.830  1.00 62.08           C  
ATOM   3184  C   ALA A 413      57.212  12.827  20.130  1.00 60.82           C  
ATOM   3185  O   ALA A 413      58.098  12.140  20.617  1.00 62.70           O  
ATOM   3186  CB  ALA A 413      55.059  11.771  20.804  1.00 59.81           C  
ATOM   3187  N   THR A 414      57.332  13.418  18.958  1.00 61.29           N  
ATOM   3188  CA  THR A 414      58.552  13.309  18.201  1.00 63.79           C  
ATOM   3189  C   THR A 414      59.583  14.093  18.991  1.00 65.83           C  
ATOM   3190  O   THR A 414      59.268  15.140  19.568  1.00 64.76           O  
ATOM   3191  CB  THR A 414      58.390  13.935  16.786  1.00 65.10           C  
ATOM   3192  OG1 THR A 414      57.882  15.275  16.895  1.00 61.39           O  
ATOM   3193  CG2 THR A 414      57.424  13.098  15.945  1.00 67.93           C  
ATOM   3194  N   PRO A 415      60.821  13.583  19.062  1.00 66.65           N  
ATOM   3195  CA  PRO A 415      61.871  14.284  19.796  1.00 66.97           C  
ATOM   3196  C   PRO A 415      61.815  15.744  19.382  1.00 70.09           C  
ATOM   3197  O   PRO A 415      61.817  16.640  20.219  1.00 71.02           O  
ATOM   3198  CB  PRO A 415      63.122  13.582  19.319  1.00 63.56           C  
ATOM   3199  CG  PRO A 415      62.652  12.177  19.224  1.00 64.45           C  
ATOM   3200  CD  PRO A 415      61.326  12.315  18.515  1.00 65.12           C  
ATOM   3201  N   LYS A 416      61.743  15.965  18.075  1.00 73.95           N  
ATOM   3202  CA  LYS A 416      61.643  17.309  17.509  1.00 77.47           C  
ATOM   3203  C   LYS A 416      60.707  18.165  18.361  1.00 78.22           C  
ATOM   3204  O   LYS A 416      61.150  19.051  19.087  1.00 78.48           O  
ATOM   3205  CB  LYS A 416      61.100  17.229  16.072  1.00 79.52           C  
ATOM   3206  CG  LYS A 416      60.584  18.553  15.502  1.00 81.13           C  
ATOM   3207  CD  LYS A 416      61.516  19.147  14.443  1.00 81.36           C  
ATOM   3208  CE  LYS A 416      60.896  19.115  13.036  1.00 79.92           C  
ATOM   3209  NZ  LYS A 416      60.734  17.742  12.475  1.00 74.97           N  
ATOM   3210  N   HIS A 417      59.411  17.888  18.277  1.00 79.52           N  
ATOM   3211  CA  HIS A 417      58.445  18.650  19.045  1.00 80.30           C  
ATOM   3212  C   HIS A 417      58.840  18.688  20.499  1.00 81.36           C  
ATOM   3213  O   HIS A 417      59.192  19.739  21.024  1.00 81.95           O  
ATOM   3214  CB  HIS A 417      57.053  18.050  18.954  1.00 79.94           C  
ATOM   3215  CG  HIS A 417      56.046  18.795  19.768  1.00 81.79           C  
ATOM   3216  ND1 HIS A 417      55.722  20.112  19.518  1.00 81.17           N  
ATOM   3217  CD2 HIS A 417      55.328  18.429  20.856  1.00 83.17           C  
ATOM   3218  CE1 HIS A 417      54.848  20.525  20.418  1.00 82.21           C  
ATOM   3219  NE2 HIS A 417      54.592  19.524  21.242  1.00 83.82           N  
ATOM   3220  N   LEU A 418      58.772  17.525  21.141  1.00 83.41           N  
ATOM   3221  CA  LEU A 418      59.110  17.388  22.556  1.00 83.95           C  
ATOM   3222  C   LEU A 418      60.296  18.275  22.917  1.00 84.95           C  
ATOM   3223  O   LEU A 418      60.318  18.909  23.974  1.00 83.69           O  
ATOM   3224  CB  LEU A 418      59.430  15.922  22.883  1.00 82.73           C  
ATOM   3225  CG  LEU A 418      58.489  15.193  23.852  1.00 80.79           C  
ATOM   3226  CD1 LEU A 418      58.423  15.968  25.152  1.00 83.12           C  
ATOM   3227  CD2 LEU A 418      57.100  15.066  23.263  1.00 81.41           C  
ATOM   3228  N   LYS A 419      61.278  18.323  22.025  1.00 86.24           N  
ATOM   3229  CA  LYS A 419      62.463  19.134  22.245  1.00 87.30           C  
ATOM   3230  C   LYS A 419      62.047  20.589  22.393  1.00 87.16           C  
ATOM   3231  O   LYS A 419      62.098  21.146  23.484  1.00 87.43           O  
ATOM   3232  CB  LYS A 419      63.434  18.974  21.070  1.00 88.32           C  
ATOM   3233  CG  LYS A 419      64.801  19.631  21.257  1.00 90.13           C  
ATOM   3234  CD  LYS A 419      64.740  21.147  21.126  1.00 90.12           C  
ATOM   3235  CE  LYS A 419      66.136  21.724  20.970  1.00 90.36           C  
ATOM   3236  NZ  LYS A 419      66.849  21.117  19.810  1.00 88.31           N  
ATOM   3237  N   SER A 420      61.620  21.192  21.292  1.00 86.83           N  
ATOM   3238  CA  SER A 420      61.202  22.583  21.297  1.00 87.66           C  
ATOM   3239  C   SER A 420      60.168  22.913  22.377  1.00 87.53           C  
ATOM   3240  O   SER A 420      60.188  24.002  22.945  1.00 85.90           O  
ATOM   3241  CB  SER A 420      60.640  22.955  19.930  1.00 88.28           C  
ATOM   3242  OG  SER A 420      59.439  22.249  19.682  1.00 91.61           O  
ATOM   3243  N   ILE A 421      59.263  21.985  22.668  1.00 89.76           N  
ATOM   3244  CA  ILE A 421      58.246  22.257  23.678  1.00 92.08           C  
ATOM   3245  C   ILE A 421      58.852  22.508  25.058  1.00 95.81           C  
ATOM   3246  O   ILE A 421      58.371  23.373  25.792  1.00 97.75           O  
ATOM   3247  CB  ILE A 421      57.192  21.119  23.776  1.00 89.82           C  
ATOM   3248  CG1 ILE A 421      55.993  21.611  24.581  1.00 87.72           C  
ATOM   3249  CG2 ILE A 421      57.776  19.894  24.445  1.00 89.45           C  
ATOM   3250  CD1 ILE A 421      55.310  22.794  23.948  1.00 85.99           C  
ATOM   3251  N   GLY A 422      59.901  21.766  25.417  1.00 98.19           N  
ATOM   3252  CA  GLY A 422      60.531  21.977  26.715  1.00 98.98           C  
ATOM   3253  C   GLY A 422      61.159  20.775  27.401  1.00100.24           C  
ATOM   3254  O   GLY A 422      62.251  20.878  27.960  1.00100.00           O  
ATOM   3255  N   LEU A 423      60.471  19.638  27.363  1.00100.95           N  
ATOM   3256  CA  LEU A 423      60.944  18.411  27.999  1.00100.65           C  
ATOM   3257  C   LEU A 423      62.155  17.799  27.308  1.00100.95           C  
ATOM   3258  O   LEU A 423      62.308  16.579  27.296  1.00 99.29           O  
ATOM   3259  CB  LEU A 423      59.813  17.384  28.026  1.00101.67           C  
ATOM   3260  CG  LEU A 423      58.501  17.868  28.648  1.00104.69           C  
ATOM   3261  CD1 LEU A 423      57.402  16.841  28.429  1.00104.48           C  
ATOM   3262  CD2 LEU A 423      58.712  18.131  30.131  1.00105.55           C  
ATOM   3263  N   LEU A 424      63.023  18.634  26.746  1.00102.81           N  
ATOM   3264  CA  LEU A 424      64.195  18.110  26.052  1.00104.93           C  
ATOM   3265  C   LEU A 424      65.156  19.190  25.513  1.00108.65           C  
ATOM   3266  O   LEU A 424      65.613  19.095  24.371  1.00110.97           O  
ATOM   3267  CB  LEU A 424      63.723  17.224  24.897  1.00 99.78           C  
ATOM   3268  CG  LEU A 424      64.384  15.868  24.700  1.00 96.78           C  
ATOM   3269  CD1 LEU A 424      64.053  14.956  25.858  1.00 96.83           C  
ATOM   3270  CD2 LEU A 424      63.893  15.271  23.408  1.00 96.86           C  
ATOM   3271  N   SER A 425      65.466  20.201  26.330  1.00111.10           N  
ATOM   3272  CA  SER A 425      66.371  21.293  25.935  1.00111.95           C  
ATOM   3273  C   SER A 425      67.515  20.812  25.028  1.00110.84           C  
ATOM   3274  O   SER A 425      68.024  19.701  25.205  1.00109.79           O  
ATOM   3275  CB  SER A 425      66.940  21.966  27.186  1.00113.51           C  
ATOM   3276  OG  SER A 425      67.597  21.021  28.012  1.00117.48           O  
ATOM   3277  N   PRO A 426      67.961  21.669  24.083  1.00109.97           N  
ATOM   3278  CA  PRO A 426      69.028  21.413  23.103  1.00109.47           C  
ATOM   3279  C   PRO A 426      69.625  20.005  23.142  1.00109.04           C  
ATOM   3280  O   PRO A 426      70.717  19.789  23.667  1.00107.72           O  
ATOM   3281  CB  PRO A 426      70.026  22.512  23.417  1.00108.35           C  
ATOM   3282  CG  PRO A 426      69.100  23.682  23.593  1.00107.99           C  
ATOM   3283  CD  PRO A 426      67.893  23.117  24.368  1.00108.11           C  
ATOM   3284  N   ASP A 427      68.899  19.057  22.549  1.00109.58           N  
ATOM   3285  CA  ASP A 427      69.307  17.656  22.546  1.00109.84           C  
ATOM   3286  C   ASP A 427      70.221  17.215  21.417  1.00109.30           C  
ATOM   3287  O   ASP A 427      70.173  17.741  20.303  1.00106.16           O  
ATOM   3288  CB  ASP A 427      68.065  16.749  22.583  1.00110.35           C  
ATOM   3289  CG  ASP A 427      67.532  16.417  21.203  1.00110.12           C  
ATOM   3290  OD1 ASP A 427      67.427  17.339  20.364  1.00110.49           O  
ATOM   3291  OD2 ASP A 427      67.206  15.230  20.971  1.00107.71           O  
ATOM   3292  N   PHE A 428      71.047  16.225  21.741  1.00110.33           N  
ATOM   3293  CA  PHE A 428      72.014  15.645  20.821  1.00110.81           C  
ATOM   3294  C   PHE A 428      71.460  15.520  19.411  1.00109.86           C  
ATOM   3295  O   PHE A 428      70.865  14.504  19.060  1.00108.87           O  
ATOM   3296  CB  PHE A 428      72.461  14.274  21.335  1.00110.91           C  
ATOM   3297  N   GLN A 429      71.673  16.562  18.612  1.00110.16           N  
ATOM   3298  CA  GLN A 429      71.210  16.600  17.231  1.00110.28           C  
ATOM   3299  C   GLN A 429      69.968  15.726  17.043  1.00109.92           C  
ATOM   3300  O   GLN A 429      68.865  16.089  17.457  1.00109.63           O  
ATOM   3301  CB  GLN A 429      72.333  16.143  16.292  1.00107.95           C  
ATOM   3302  N   GLU A 430      70.160  14.568  16.424  1.00108.37           N  
ATOM   3303  CA  GLU A 430      69.069  13.642  16.180  1.00106.82           C  
ATOM   3304  C   GLU A 430      69.676  12.305  15.808  1.00106.95           C  
ATOM   3305  O   GLU A 430      69.110  11.563  15.010  1.00108.98           O  
ATOM   3306  CB  GLU A 430      68.183  14.155  15.048  1.00105.54           C  
ATOM   3307  N   ASP A 431      70.837  12.018  16.391  1.00106.14           N  
ATOM   3308  CA  ASP A 431      71.575  10.777  16.159  1.00106.57           C  
ATOM   3309  C   ASP A 431      70.796   9.713  15.402  1.00103.90           C  
ATOM   3310  O   ASP A 431      69.656   9.398  15.747  1.00103.07           O  
ATOM   3311  CB  ASP A 431      72.032  10.170  17.490  1.00112.09           C  
ATOM   3312  CG  ASP A 431      72.828  11.143  18.336  1.00117.07           C  
ATOM   3313  OD1 ASP A 431      73.305  10.737  19.421  1.00119.65           O  
ATOM   3314  OD2 ASP A 431      72.974  12.313  17.918  1.00120.85           O  
ATOM   3315  N   ASN A 432      71.423   9.142  14.380  1.00101.08           N  
ATOM   3316  CA  ASN A 432      70.780   8.096  13.600  1.00 98.77           C  
ATOM   3317  C   ASN A 432      70.303   6.989  14.545  1.00 95.58           C  
ATOM   3318  O   ASN A 432      69.591   6.070  14.138  1.00 93.81           O  
ATOM   3319  CB  ASN A 432      71.763   7.517  12.571  1.00100.69           C  
ATOM   3320  CG  ASN A 432      72.956   6.812  13.218  1.00102.75           C  
ATOM   3321  OD1 ASN A 432      73.734   6.135  12.540  1.00103.88           O  
ATOM   3322  ND2 ASN A 432      73.107   6.973  14.528  1.00101.85           N  
ATOM   3323  N   GLU A 433      70.689   7.099  15.815  1.00 92.90           N  
ATOM   3324  CA  GLU A 433      70.334   6.103  16.818  1.00 88.96           C  
ATOM   3325  C   GLU A 433      69.200   6.515  17.742  1.00 85.68           C  
ATOM   3326  O   GLU A 433      68.503   5.664  18.296  1.00 84.03           O  
ATOM   3327  CB  GLU A 433      71.557   5.756  17.654  1.00 90.37           C  
ATOM   3328  CG  GLU A 433      71.553   4.331  18.148  1.00 89.40           C  
ATOM   3329  CD  GLU A 433      72.735   4.030  19.022  1.00 88.98           C  
ATOM   3330  OE1 GLU A 433      72.734   4.494  20.182  1.00 88.08           O  
ATOM   3331  OE2 GLU A 433      73.662   3.340  18.545  1.00 87.23           O  
ATOM   3332  N   THR A 434      69.022   7.815  17.933  1.00 82.18           N  
ATOM   3333  CA  THR A 434      67.934   8.272  18.778  1.00 80.74           C  
ATOM   3334  C   THR A 434      66.648   7.907  18.049  1.00 79.25           C  
ATOM   3335  O   THR A 434      65.563   7.941  18.625  1.00 77.89           O  
ATOM   3336  CB  THR A 434      67.976   9.792  18.988  1.00 81.33           C  
ATOM   3337  OG1 THR A 434      67.871  10.448  17.720  1.00 81.86           O  
ATOM   3338  CG2 THR A 434      69.278  10.203  19.671  1.00 80.94           C  
ATOM   3339  N   GLU A 435      66.799   7.550  16.773  1.00 78.98           N  
ATOM   3340  CA  GLU A 435      65.692   7.157  15.900  1.00 77.89           C  
ATOM   3341  C   GLU A 435      65.121   5.797  16.282  1.00 75.41           C  
ATOM   3342  O   GLU A 435      63.973   5.701  16.713  1.00 76.24           O  
ATOM   3343  CB  GLU A 435      66.164   7.110  14.444  1.00 83.23           C  
ATOM   3344  CG  GLU A 435      65.488   8.115  13.501  1.00 90.30           C  
ATOM   3345  CD  GLU A 435      65.591   9.557  13.989  1.00 93.15           C  
ATOM   3346  OE1 GLU A 435      64.684  10.011  14.729  1.00 92.87           O  
ATOM   3347  OE2 GLU A 435      66.585  10.232  13.636  1.00 92.78           O  
ATOM   3348  N   ILE A 436      65.916   4.743  16.113  1.00 71.42           N  
ATOM   3349  CA  ILE A 436      65.460   3.404  16.459  1.00 68.82           C  
ATOM   3350  C   ILE A 436      65.043   3.446  17.905  1.00 68.59           C  
ATOM   3351  O   ILE A 436      64.259   2.625  18.372  1.00 67.63           O  
ATOM   3352  CB  ILE A 436      66.573   2.363  16.317  1.00 68.52           C  
ATOM   3353  CG1 ILE A 436      66.851   2.095  14.843  1.00 69.15           C  
ATOM   3354  CG2 ILE A 436      66.171   1.083  17.012  1.00 68.23           C  
ATOM   3355  CD1 ILE A 436      67.368   3.304  14.093  1.00 72.02           C  
ATOM   3356  N   ASN A 437      65.578   4.433  18.606  1.00 69.97           N  
ATOM   3357  CA  ASN A 437      65.299   4.621  20.015  1.00 71.09           C  
ATOM   3358  C   ASN A 437      63.878   5.128  20.202  1.00 69.09           C  
ATOM   3359  O   ASN A 437      63.082   4.534  20.931  1.00 69.37           O  
ATOM   3360  CB  ASN A 437      66.305   5.616  20.601  1.00 73.83           C  
ATOM   3361  CG  ASN A 437      66.794   5.209  21.976  1.00 74.47           C  
ATOM   3362  OD1 ASN A 437      67.163   4.049  22.191  1.00 71.69           O  
ATOM   3363  ND2 ASN A 437      66.811   6.160  22.914  1.00 70.57           N  
ATOM   3364  N   PHE A 438      63.563   6.228  19.533  1.00 69.03           N  
ATOM   3365  CA  PHE A 438      62.229   6.822  19.619  1.00 70.47           C  
ATOM   3366  C   PHE A 438      61.166   5.934  18.979  1.00 68.43           C  
ATOM   3367  O   PHE A 438      60.111   5.693  19.561  1.00 66.36           O  
ATOM   3368  CB  PHE A 438      62.232   8.187  18.942  1.00 70.37           C  
ATOM   3369  CG  PHE A 438      60.941   8.533  18.277  1.00 73.34           C  
ATOM   3370  CD1 PHE A 438      59.771   8.623  19.006  1.00 74.33           C  
ATOM   3371  CD2 PHE A 438      60.903   8.800  16.918  1.00 74.08           C  
ATOM   3372  CE1 PHE A 438      58.583   8.977  18.391  1.00 75.57           C  
ATOM   3373  CE2 PHE A 438      59.723   9.152  16.304  1.00 73.84           C  
ATOM   3374  CZ  PHE A 438      58.561   9.241  17.042  1.00 74.61           C  
ATOM   3375  N   LEU A 439      61.470   5.451  17.780  1.00 65.46           N  
ATOM   3376  CA  LEU A 439      60.577   4.593  17.030  1.00 61.86           C  
ATOM   3377  C   LEU A 439      60.237   3.269  17.733  1.00 61.31           C  
ATOM   3378  O   LEU A 439      59.213   2.659  17.430  1.00 62.93           O  
ATOM   3379  CB  LEU A 439      61.194   4.317  15.660  1.00 60.62           C  
ATOM   3380  CG  LEU A 439      60.259   3.882  14.528  1.00 63.16           C  
ATOM   3381  CD1 LEU A 439      59.240   4.986  14.220  1.00 64.38           C  
ATOM   3382  CD2 LEU A 439      61.081   3.581  13.295  1.00 61.90           C  
ATOM   3383  N   LEU A 440      61.072   2.811  18.664  1.00 58.76           N  
ATOM   3384  CA  LEU A 440      60.777   1.552  19.351  1.00 56.46           C  
ATOM   3385  C   LEU A 440      59.717   1.801  20.409  1.00 57.90           C  
ATOM   3386  O   LEU A 440      58.919   0.922  20.744  1.00 60.22           O  
ATOM   3387  CB  LEU A 440      62.038   0.956  19.995  1.00 51.98           C  
ATOM   3388  CG  LEU A 440      62.006  -0.419  20.704  1.00 46.62           C  
ATOM   3389  CD1 LEU A 440      61.253  -0.314  21.994  1.00 43.81           C  
ATOM   3390  CD2 LEU A 440      61.380  -1.479  19.832  1.00 41.96           C  
ATOM   3391  N   LYS A 441      59.699   3.009  20.946  1.00 57.27           N  
ATOM   3392  CA  LYS A 441      58.698   3.319  21.948  1.00 56.17           C  
ATOM   3393  C   LYS A 441      57.343   3.235  21.254  1.00 57.81           C  
ATOM   3394  O   LYS A 441      56.484   2.438  21.638  1.00 56.25           O  
ATOM   3395  CB  LYS A 441      58.929   4.717  22.496  1.00 53.04           C  
ATOM   3396  CG  LYS A 441      58.160   4.985  23.730  1.00 46.30           C  
ATOM   3397  CD  LYS A 441      58.543   6.298  24.305  1.00 47.78           C  
ATOM   3398  CE  LYS A 441      57.545   6.600  25.357  1.00 54.09           C  
ATOM   3399  NZ  LYS A 441      57.094   5.272  25.851  1.00 55.42           N  
ATOM   3400  N   GLN A 442      57.177   4.059  20.217  1.00 58.59           N  
ATOM   3401  CA  GLN A 442      55.957   4.096  19.419  1.00 56.49           C  
ATOM   3402  C   GLN A 442      55.491   2.682  19.179  1.00 55.65           C  
ATOM   3403  O   GLN A 442      54.394   2.307  19.587  1.00 56.23           O  
ATOM   3404  CB  GLN A 442      56.217   4.746  18.067  1.00 58.20           C  
ATOM   3405  CG  GLN A 442      56.876   6.104  18.134  1.00 62.57           C  
ATOM   3406  CD  GLN A 442      56.029   7.123  18.856  1.00 64.10           C  
ATOM   3407  OE1 GLN A 442      55.635   8.135  18.277  1.00 65.73           O  
ATOM   3408  NE2 GLN A 442      55.746   6.865  20.132  1.00 63.27           N  
ATOM   3409  N   ALA A 443      56.340   1.897  18.519  1.00 54.35           N  
ATOM   3410  CA  ALA A 443      56.018   0.508  18.202  1.00 54.61           C  
ATOM   3411  C   ALA A 443      55.406  -0.141  19.420  1.00 54.74           C  
ATOM   3412  O   ALA A 443      54.376  -0.831  19.338  1.00 54.49           O  
ATOM   3413  CB  ALA A 443      57.264  -0.234  17.796  1.00 52.16           C  
ATOM   3414  N   LEU A 444      56.052   0.113  20.556  1.00 52.43           N  
ATOM   3415  CA  LEU A 444      55.620  -0.424  21.834  1.00 50.55           C  
ATOM   3416  C   LEU A 444      54.165  -0.050  22.078  1.00 47.58           C  
ATOM   3417  O   LEU A 444      53.361  -0.895  22.457  1.00 46.55           O  
ATOM   3418  CB  LEU A 444      56.527   0.115  22.951  1.00 49.29           C  
ATOM   3419  CG  LEU A 444      57.320  -0.854  23.841  1.00 44.77           C  
ATOM   3420  CD1 LEU A 444      57.652  -2.144  23.112  1.00 37.03           C  
ATOM   3421  CD2 LEU A 444      58.573  -0.141  24.319  1.00 38.22           C  
ATOM   3422  N   THR A 445      53.829   1.211  21.833  1.00 45.88           N  
ATOM   3423  CA  THR A 445      52.468   1.691  22.028  1.00 46.23           C  
ATOM   3424  C   THR A 445      51.502   1.343  20.896  1.00 49.61           C  
ATOM   3425  O   THR A 445      50.436   0.755  21.127  1.00 51.97           O  
ATOM   3426  CB  THR A 445      52.450   3.205  22.217  1.00 41.00           C  
ATOM   3427  OG1 THR A 445      52.420   3.505  23.611  1.00 45.22           O  
ATOM   3428  CG2 THR A 445      51.247   3.804  21.575  1.00 39.37           C  
ATOM   3429  N   ILE A 446      51.882   1.692  19.672  1.00 49.84           N  
ATOM   3430  CA  ILE A 446      51.033   1.460  18.513  1.00 46.83           C  
ATOM   3431  C   ILE A 446      50.980   0.029  18.004  1.00 48.82           C  
ATOM   3432  O   ILE A 446      49.883  -0.512  17.860  1.00 52.19           O  
ATOM   3433  CB  ILE A 446      51.431   2.396  17.378  1.00 43.21           C  
ATOM   3434  CG1 ILE A 446      51.431   3.829  17.905  1.00 45.55           C  
ATOM   3435  CG2 ILE A 446      50.464   2.289  16.243  1.00 39.43           C  
ATOM   3436  CD1 ILE A 446      52.194   4.828  17.042  1.00 47.95           C  
ATOM   3437  N   VAL A 447      52.125  -0.603  17.736  1.00 47.26           N  
ATOM   3438  CA  VAL A 447      52.075  -1.980  17.230  1.00 43.75           C  
ATOM   3439  C   VAL A 447      51.729  -2.934  18.335  1.00 44.29           C  
ATOM   3440  O   VAL A 447      51.093  -3.960  18.102  1.00 42.43           O  
ATOM   3441  CB  VAL A 447      53.395  -2.478  16.637  1.00 42.84           C  
ATOM   3442  CG1 VAL A 447      53.166  -3.829  15.978  1.00 36.82           C  
ATOM   3443  CG2 VAL A 447      53.936  -1.493  15.633  1.00 46.31           C  
ATOM   3444  N   GLY A 448      52.157  -2.597  19.544  1.00 46.04           N  
ATOM   3445  CA  GLY A 448      51.868  -3.462  20.665  1.00 48.17           C  
ATOM   3446  C   GLY A 448      50.391  -3.775  20.722  1.00 49.97           C  
ATOM   3447  O   GLY A 448      49.981  -4.944  20.786  1.00 50.02           O  
ATOM   3448  N   THR A 449      49.593  -2.713  20.644  1.00 49.72           N  
ATOM   3449  CA  THR A 449      48.138  -2.803  20.735  1.00 47.22           C  
ATOM   3450  C   THR A 449      47.338  -3.475  19.597  1.00 42.56           C  
ATOM   3451  O   THR A 449      46.329  -4.126  19.869  1.00 37.12           O  
ATOM   3452  CB  THR A 449      47.560  -1.396  20.991  1.00 48.93           C  
ATOM   3453  OG1 THR A 449      46.486  -1.481  21.939  1.00 49.39           O  
ATOM   3454  CG2 THR A 449      47.055  -0.781  19.686  1.00 47.54           C  
ATOM   3455  N   LEU A 450      47.777  -3.330  18.345  1.00 37.97           N  
ATOM   3456  CA  LEU A 450      47.059  -3.908  17.207  1.00 36.08           C  
ATOM   3457  C   LEU A 450      46.616  -5.355  17.371  1.00 38.93           C  
ATOM   3458  O   LEU A 450      45.440  -5.677  17.224  1.00 36.44           O  
ATOM   3459  CB  LEU A 450      47.887  -3.778  15.946  1.00 32.92           C  
ATOM   3460  CG  LEU A 450      48.002  -2.351  15.409  1.00 39.73           C  
ATOM   3461  CD1 LEU A 450      49.075  -2.285  14.333  1.00 41.22           C  
ATOM   3462  CD2 LEU A 450      46.664  -1.912  14.841  1.00 39.72           C  
ATOM   3463  N   PRO A 451      47.554  -6.259  17.680  1.00 43.49           N  
ATOM   3464  CA  PRO A 451      47.156  -7.657  17.847  1.00 41.86           C  
ATOM   3465  C   PRO A 451      46.280  -7.846  19.094  1.00 42.74           C  
ATOM   3466  O   PRO A 451      45.388  -8.687  19.120  1.00 40.50           O  
ATOM   3467  CB  PRO A 451      48.492  -8.366  17.922  1.00 39.43           C  
ATOM   3468  CG  PRO A 451      49.338  -7.365  18.627  1.00 42.44           C  
ATOM   3469  CD  PRO A 451      48.998  -6.092  17.927  1.00 43.28           C  
ATOM   3470  N   PHE A 452      46.527  -7.044  20.122  1.00 46.18           N  
ATOM   3471  CA  PHE A 452      45.740  -7.118  21.355  1.00 47.73           C  
ATOM   3472  C   PHE A 452      44.356  -6.552  21.102  1.00 46.96           C  
ATOM   3473  O   PHE A 452      43.337  -7.084  21.575  1.00 42.86           O  
ATOM   3474  CB  PHE A 452      46.413  -6.298  22.473  1.00 51.49           C  
ATOM   3475  CG  PHE A 452      45.555  -6.126  23.697  1.00 53.40           C  
ATOM   3476  CD1 PHE A 452      44.609  -5.115  23.762  1.00 55.53           C  
ATOM   3477  CD2 PHE A 452      45.622  -7.037  24.736  1.00 55.38           C  
ATOM   3478  CE1 PHE A 452      43.737  -5.020  24.836  1.00 54.71           C  
ATOM   3479  CE2 PHE A 452      44.756  -6.946  25.806  1.00 56.65           C  
ATOM   3480  CZ  PHE A 452      43.810  -5.935  25.851  1.00 54.57           C  
ATOM   3481  N   THR A 453      44.356  -5.442  20.365  1.00 47.00           N  
ATOM   3482  CA  THR A 453      43.155  -4.711  20.023  1.00 43.17           C  
ATOM   3483  C   THR A 453      42.277  -5.531  19.145  1.00 39.19           C  
ATOM   3484  O   THR A 453      41.073  -5.518  19.307  1.00 38.81           O  
ATOM   3485  CB  THR A 453      43.479  -3.436  19.288  1.00 45.86           C  
ATOM   3486  OG1 THR A 453      44.387  -2.656  20.072  1.00 47.09           O  
ATOM   3487  CG2 THR A 453      42.207  -2.646  19.054  1.00 50.75           C  
ATOM   3488  N   TYR A 454      42.894  -6.242  18.210  1.00 38.52           N  
ATOM   3489  CA  TYR A 454      42.176  -7.113  17.280  1.00 38.97           C  
ATOM   3490  C   TYR A 454      41.548  -8.301  17.983  1.00 39.10           C  
ATOM   3491  O   TYR A 454      40.328  -8.438  18.031  1.00 38.64           O  
ATOM   3492  CB  TYR A 454      43.134  -7.633  16.217  1.00 39.92           C  
ATOM   3493  CG  TYR A 454      42.606  -8.768  15.374  1.00 43.90           C  
ATOM   3494  CD1 TYR A 454      41.345  -9.303  15.589  1.00 45.62           C  
ATOM   3495  CD2 TYR A 454      43.367  -9.292  14.341  1.00 48.19           C  
ATOM   3496  CE1 TYR A 454      40.854 -10.327  14.800  1.00 52.97           C  
ATOM   3497  CE2 TYR A 454      42.881 -10.312  13.541  1.00 52.29           C  
ATOM   3498  CZ  TYR A 454      41.625 -10.824  13.773  1.00 52.72           C  
ATOM   3499  OH  TYR A 454      41.120 -11.813  12.960  1.00 53.71           O  
ATOM   3500  N   MET A 455      42.411  -9.170  18.498  1.00 39.54           N  
ATOM   3501  CA  MET A 455      42.019 -10.393  19.191  1.00 36.36           C  
ATOM   3502  C   MET A 455      40.843 -10.216  20.130  1.00 35.30           C  
ATOM   3503  O   MET A 455      39.877 -10.952  20.033  1.00 33.01           O  
ATOM   3504  CB  MET A 455      43.238 -10.960  19.924  1.00 36.55           C  
ATOM   3505  CG  MET A 455      43.072 -12.338  20.508  1.00 38.02           C  
ATOM   3506  SD  MET A 455      42.198 -12.349  22.080  1.00 47.64           S  
ATOM   3507  CE  MET A 455      43.397 -11.568  23.104  1.00 48.71           C  
ATOM   3508  N   LEU A 456      40.913  -9.226  21.017  1.00 40.79           N  
ATOM   3509  CA  LEU A 456      39.834  -8.963  21.971  1.00 45.82           C  
ATOM   3510  C   LEU A 456      38.488  -8.762  21.263  1.00 49.91           C  
ATOM   3511  O   LEU A 456      37.505  -9.428  21.605  1.00 49.84           O  
ATOM   3512  CB  LEU A 456      40.174  -7.743  22.854  1.00 44.41           C  
ATOM   3513  CG  LEU A 456      39.068  -7.227  23.795  1.00 40.61           C  
ATOM   3514  CD1 LEU A 456      39.597  -6.795  25.148  1.00 39.77           C  
ATOM   3515  CD2 LEU A 456      38.419  -6.054  23.127  1.00 45.11           C  
ATOM   3516  N   GLU A 457      38.435  -7.866  20.278  1.00 50.07           N  
ATOM   3517  CA  GLU A 457      37.182  -7.651  19.567  1.00 56.49           C  
ATOM   3518  C   GLU A 457      36.729  -8.913  18.844  1.00 60.26           C  
ATOM   3519  O   GLU A 457      35.533  -9.181  18.733  1.00 60.91           O  
ATOM   3520  CB  GLU A 457      37.310  -6.507  18.559  1.00 57.89           C  
ATOM   3521  CG  GLU A 457      36.975  -5.123  19.133  1.00 60.28           C  
ATOM   3522  CD  GLU A 457      35.477  -4.824  19.203  1.00 59.82           C  
ATOM   3523  OE1 GLU A 457      34.834  -4.752  18.133  1.00 56.09           O  
ATOM   3524  OE2 GLU A 457      34.949  -4.651  20.326  1.00 59.55           O  
ATOM   3525  N   LYS A 458      37.679  -9.693  18.342  1.00 65.34           N  
ATOM   3526  CA  LYS A 458      37.311 -10.909  17.641  1.00 67.28           C  
ATOM   3527  C   LYS A 458      36.538 -11.766  18.623  1.00 67.40           C  
ATOM   3528  O   LYS A 458      35.368 -12.057  18.401  1.00 70.93           O  
ATOM   3529  CB  LYS A 458      38.549 -11.648  17.122  1.00 67.73           C  
ATOM   3530  CG  LYS A 458      38.234 -12.947  16.369  1.00 72.78           C  
ATOM   3531  CD  LYS A 458      37.090 -12.771  15.357  1.00 74.11           C  
ATOM   3532  CE  LYS A 458      36.821 -14.053  14.544  1.00 72.46           C  
ATOM   3533  NZ  LYS A 458      35.526 -14.019  13.795  1.00 63.20           N  
ATOM   3534  N   TRP A 459      37.176 -12.142  19.723  1.00 64.29           N  
ATOM   3535  CA  TRP A 459      36.510 -12.963  20.726  1.00 64.96           C  
ATOM   3536  C   TRP A 459      35.152 -12.347  21.077  1.00 64.71           C  
ATOM   3537  O   TRP A 459      34.147 -13.049  21.241  1.00 60.45           O  
ATOM   3538  CB  TRP A 459      37.383 -13.051  21.979  1.00 66.53           C  
ATOM   3539  CG  TRP A 459      36.826 -13.925  23.075  1.00 63.67           C  
ATOM   3540  CD1 TRP A 459      37.116 -15.236  23.310  1.00 59.21           C  
ATOM   3541  CD2 TRP A 459      35.906 -13.525  24.097  1.00 61.63           C  
ATOM   3542  NE1 TRP A 459      36.438 -15.674  24.419  1.00 57.28           N  
ATOM   3543  CE2 TRP A 459      35.688 -14.643  24.920  1.00 60.90           C  
ATOM   3544  CE3 TRP A 459      35.249 -12.326  24.397  1.00 60.67           C  
ATOM   3545  CZ2 TRP A 459      34.838 -14.599  26.028  1.00 61.53           C  
ATOM   3546  CZ3 TRP A 459      34.408 -12.283  25.497  1.00 60.29           C  
ATOM   3547  CH2 TRP A 459      34.211 -13.412  26.298  1.00 59.76           C  
ATOM   3548  N   ARG A 460      35.152 -11.021  21.182  1.00 66.50           N  
ATOM   3549  CA  ARG A 460      33.968 -10.219  21.506  1.00 64.60           C  
ATOM   3550  C   ARG A 460      32.877 -10.478  20.457  1.00 61.45           C  
ATOM   3551  O   ARG A 460      31.690 -10.523  20.778  1.00 59.29           O  
ATOM   3552  CB  ARG A 460      34.365  -8.737  21.512  1.00 64.17           C  
ATOM   3553  CG  ARG A 460      33.370  -7.789  22.109  1.00 63.34           C  
ATOM   3554  CD  ARG A 460      33.603  -7.642  23.580  1.00 64.30           C  
ATOM   3555  NE  ARG A 460      33.430  -6.256  23.997  1.00 65.99           N  
ATOM   3556  CZ  ARG A 460      34.122  -5.245  23.490  1.00 65.92           C  
ATOM   3557  NH1 ARG A 460      35.026  -5.464  22.555  1.00 62.91           N  
ATOM   3558  NH2 ARG A 460      33.909  -4.015  23.919  1.00 68.84           N  
ATOM   3559  N   TRP A 461      33.296 -10.638  19.203  1.00 59.64           N  
ATOM   3560  CA  TRP A 461      32.374 -10.925  18.101  1.00 60.00           C  
ATOM   3561  C   TRP A 461      31.930 -12.385  18.181  1.00 59.18           C  
ATOM   3562  O   TRP A 461      30.738 -12.686  18.236  1.00 59.79           O  
ATOM   3563  CB  TRP A 461      33.045 -10.695  16.744  1.00 55.63           C  
ATOM   3564  CG  TRP A 461      33.222  -9.258  16.347  1.00 52.22           C  
ATOM   3565  CD1 TRP A 461      32.342  -8.231  16.548  1.00 48.69           C  
ATOM   3566  CD2 TRP A 461      34.290  -8.721  15.561  1.00 50.41           C  
ATOM   3567  NE1 TRP A 461      32.792  -7.095  15.927  1.00 47.13           N  
ATOM   3568  CE2 TRP A 461      33.988  -7.369  15.314  1.00 51.27           C  
ATOM   3569  CE3 TRP A 461      35.471  -9.254  15.034  1.00 46.90           C  
ATOM   3570  CZ2 TRP A 461      34.827  -6.543  14.563  1.00 50.03           C  
ATOM   3571  CZ3 TRP A 461      36.301  -8.431  14.287  1.00 45.57           C  
ATOM   3572  CH2 TRP A 461      35.976  -7.096  14.061  1.00 47.46           C  
ATOM   3573  N   MET A 462      32.911 -13.278  18.182  1.00 57.20           N  
ATOM   3574  CA  MET A 462      32.682 -14.707  18.273  1.00 57.94           C  
ATOM   3575  C   MET A 462      31.564 -15.011  19.250  1.00 58.39           C  
ATOM   3576  O   MET A 462      30.664 -15.795  18.967  1.00 58.37           O  
ATOM   3577  CB  MET A 462      33.942 -15.390  18.777  1.00 59.51           C  
ATOM   3578  CG  MET A 462      35.205 -14.971  18.063  1.00 64.32           C  
ATOM   3579  SD  MET A 462      35.529 -15.966  16.630  1.00 68.26           S  
ATOM   3580  CE  MET A 462      36.173 -17.455  17.435  1.00 65.69           C  
ATOM   3581  N   VAL A 463      31.636 -14.389  20.417  1.00 59.65           N  
ATOM   3582  CA  VAL A 463      30.644 -14.615  21.456  1.00 60.97           C  
ATOM   3583  C   VAL A 463      29.239 -14.179  21.057  1.00 62.52           C  
ATOM   3584  O   VAL A 463      28.303 -14.982  21.085  1.00 62.88           O  
ATOM   3585  CB  VAL A 463      31.047 -13.898  22.757  1.00 59.28           C  
ATOM   3586  CG1 VAL A 463      30.060 -14.226  23.854  1.00 57.59           C  
ATOM   3587  CG2 VAL A 463      32.452 -14.315  23.162  1.00 57.88           C  
ATOM   3588  N   PHE A 464      29.087 -12.909  20.697  1.00 63.72           N  
ATOM   3589  CA  PHE A 464      27.785 -12.398  20.293  1.00 66.25           C  
ATOM   3590  C   PHE A 464      27.289 -13.266  19.145  1.00 67.19           C  
ATOM   3591  O   PHE A 464      26.124 -13.650  19.103  1.00 66.75           O  
ATOM   3592  CB  PHE A 464      27.909 -10.941  19.841  1.00 68.51           C  
ATOM   3593  CG  PHE A 464      28.343  -9.999  20.931  1.00 68.54           C  
ATOM   3594  CD1 PHE A 464      28.773  -8.724  20.630  1.00 66.99           C  
ATOM   3595  CD2 PHE A 464      28.309 -10.384  22.259  1.00 68.70           C  
ATOM   3596  CE1 PHE A 464      29.156  -7.860  21.630  1.00 65.60           C  
ATOM   3597  CE2 PHE A 464      28.694  -9.515  23.259  1.00 64.80           C  
ATOM   3598  CZ  PHE A 464      29.116  -8.258  22.943  1.00 62.03           C  
ATOM   3599  N   LYS A 465      28.199 -13.570  18.223  1.00 67.90           N  
ATOM   3600  CA  LYS A 465      27.922 -14.410  17.062  1.00 67.07           C  
ATOM   3601  C   LYS A 465      27.371 -15.707  17.591  1.00 67.98           C  
ATOM   3602  O   LYS A 465      26.215 -16.034  17.371  1.00 68.98           O  
ATOM   3603  CB  LYS A 465      29.217 -14.690  16.317  1.00 68.58           C  
ATOM   3604  CG  LYS A 465      29.050 -15.347  14.984  1.00 72.12           C  
ATOM   3605  CD  LYS A 465      29.892 -14.607  13.951  1.00 74.84           C  
ATOM   3606  CE  LYS A 465      29.486 -13.134  13.872  1.00 74.07           C  
ATOM   3607  NZ  LYS A 465      30.336 -12.389  12.909  1.00 72.98           N  
ATOM   3608  N   GLY A 466      28.219 -16.440  18.304  1.00 70.11           N  
ATOM   3609  CA  GLY A 466      27.809 -17.701  18.898  1.00 71.76           C  
ATOM   3610  C   GLY A 466      28.920 -18.734  18.928  1.00 72.51           C  
ATOM   3611  O   GLY A 466      28.902 -19.670  19.735  1.00 71.92           O  
ATOM   3612  N   GLU A 467      29.900 -18.542  18.051  1.00 71.36           N  
ATOM   3613  CA  GLU A 467      31.028 -19.452  17.910  1.00 71.11           C  
ATOM   3614  C   GLU A 467      31.728 -19.839  19.206  1.00 70.34           C  
ATOM   3615  O   GLU A 467      32.710 -20.574  19.183  1.00 67.98           O  
ATOM   3616  CB  GLU A 467      32.046 -18.846  16.949  1.00 74.14           C  
ATOM   3617  CG  GLU A 467      31.426 -17.998  15.849  1.00 76.20           C  
ATOM   3618  CD  GLU A 467      32.429 -17.606  14.779  1.00 78.19           C  
ATOM   3619  OE1 GLU A 467      33.505 -17.074  15.127  1.00 77.05           O  
ATOM   3620  OE2 GLU A 467      32.137 -17.830  13.585  1.00 81.12           O  
ATOM   3621  N   ILE A 468      31.233 -19.338  20.331  1.00 72.13           N  
ATOM   3622  CA  ILE A 468      31.831 -19.637  21.630  1.00 76.89           C  
ATOM   3623  C   ILE A 468      30.742 -19.742  22.709  1.00 82.05           C  
ATOM   3624  O   ILE A 468      30.282 -18.730  23.257  1.00 82.86           O  
ATOM   3625  CB  ILE A 468      32.862 -18.539  22.051  1.00 73.05           C  
ATOM   3626  CG1 ILE A 468      33.831 -18.254  20.909  1.00 68.36           C  
ATOM   3627  CG2 ILE A 468      33.672 -19.007  23.245  1.00 70.91           C  
ATOM   3628  CD1 ILE A 468      34.916 -17.311  21.282  1.00 65.82           C  
ATOM   3629  N   PRO A 469      30.321 -20.979  23.028  1.00 85.41           N  
ATOM   3630  CA  PRO A 469      29.291 -21.282  24.030  1.00 85.05           C  
ATOM   3631  C   PRO A 469      29.776 -20.968  25.437  1.00 84.54           C  
ATOM   3632  O   PRO A 469      30.923 -21.247  25.792  1.00 82.10           O  
ATOM   3633  CB  PRO A 469      29.044 -22.767  23.822  1.00 87.30           C  
ATOM   3634  CG  PRO A 469      30.431 -23.265  23.478  1.00 87.77           C  
ATOM   3635  CD  PRO A 469      30.918 -22.218  22.496  1.00 86.64           C  
ATOM   3636  N   LYS A 470      28.886 -20.394  26.233  1.00 85.39           N  
ATOM   3637  CA  LYS A 470      29.207 -20.002  27.594  1.00 86.49           C  
ATOM   3638  C   LYS A 470      30.280 -20.831  28.277  1.00 87.43           C  
ATOM   3639  O   LYS A 470      31.152 -20.276  28.930  1.00 88.83           O  
ATOM   3640  CB  LYS A 470      27.933 -19.981  28.439  1.00 86.08           C  
ATOM   3641  CG  LYS A 470      26.893 -19.014  27.883  1.00 88.84           C  
ATOM   3642  CD  LYS A 470      25.809 -18.661  28.891  1.00 89.58           C  
ATOM   3643  CE  LYS A 470      24.964 -17.496  28.379  1.00 89.72           C  
ATOM   3644  NZ  LYS A 470      25.800 -16.300  28.048  1.00 84.77           N  
ATOM   3645  N   ASP A 471      30.240 -22.148  28.112  1.00 90.54           N  
ATOM   3646  CA  ASP A 471      31.225 -23.019  28.755  1.00 92.28           C  
ATOM   3647  C   ASP A 471      32.600 -23.033  28.103  1.00 91.73           C  
ATOM   3648  O   ASP A 471      33.461 -23.827  28.486  1.00 91.42           O  
ATOM   3649  CB  ASP A 471      30.699 -24.464  28.854  1.00 96.02           C  
ATOM   3650  CG  ASP A 471      30.210 -25.021  27.515  1.00 99.34           C  
ATOM   3651  OD1 ASP A 471      29.060 -24.712  27.117  1.00 99.43           O  
ATOM   3652  OD2 ASP A 471      30.977 -25.770  26.865  1.00 98.92           O  
ATOM   3653  N   GLN A 472      32.817 -22.150  27.134  1.00 91.66           N  
ATOM   3654  CA  GLN A 472      34.104 -22.095  26.450  1.00 91.30           C  
ATOM   3655  C   GLN A 472      34.625 -20.670  26.268  1.00 88.26           C  
ATOM   3656  O   GLN A 472      35.323 -20.385  25.298  1.00 88.88           O  
ATOM   3657  CB  GLN A 472      33.995 -22.769  25.078  1.00 94.86           C  
ATOM   3658  CG  GLN A 472      33.462 -24.201  25.103  1.00 97.83           C  
ATOM   3659  CD  GLN A 472      34.325 -25.148  25.923  1.00 99.42           C  
ATOM   3660  OE1 GLN A 472      35.516 -25.320  25.650  1.00100.48           O  
ATOM   3661  NE2 GLN A 472      33.723 -25.771  26.930  1.00 98.83           N  
ATOM   3662  N   TRP A 473      34.297 -19.779  27.197  1.00 84.43           N  
ATOM   3663  CA  TRP A 473      34.739 -18.394  27.096  1.00 80.99           C  
ATOM   3664  C   TRP A 473      36.206 -18.178  27.456  1.00 81.02           C  
ATOM   3665  O   TRP A 473      36.971 -17.628  26.657  1.00 80.15           O  
ATOM   3666  CB  TRP A 473      33.862 -17.497  27.966  1.00 79.18           C  
ATOM   3667  CG  TRP A 473      32.548 -17.175  27.352  1.00 75.16           C  
ATOM   3668  CD1 TRP A 473      31.997 -17.761  26.258  1.00 75.09           C  
ATOM   3669  CD2 TRP A 473      31.586 -16.233  27.833  1.00 74.18           C  
ATOM   3670  NE1 TRP A 473      30.746 -17.248  26.025  1.00 74.92           N  
ATOM   3671  CE2 TRP A 473      30.468 -16.308  26.980  1.00 75.15           C  
ATOM   3672  CE3 TRP A 473      31.561 -15.335  28.904  1.00 73.75           C  
ATOM   3673  CZ2 TRP A 473      29.329 -15.520  27.163  1.00 76.50           C  
ATOM   3674  CZ3 TRP A 473      30.432 -14.551  29.087  1.00 77.17           C  
ATOM   3675  CH2 TRP A 473      29.330 -14.650  28.220  1.00 78.43           C  
ATOM   3676  N   MET A 474      36.600 -18.591  28.658  1.00 80.43           N  
ATOM   3677  CA  MET A 474      37.988 -18.424  29.078  1.00 80.50           C  
ATOM   3678  C   MET A 474      38.839 -19.418  28.316  1.00 80.33           C  
ATOM   3679  O   MET A 474      40.072 -19.368  28.338  1.00 78.60           O  
ATOM   3680  CB  MET A 474      38.113 -18.633  30.581  1.00 80.25           C  
ATOM   3681  CG  MET A 474      37.260 -17.650  31.349  1.00 81.70           C  
ATOM   3682  SD  MET A 474      37.378 -15.997  30.607  1.00 79.99           S  
ATOM   3683  CE  MET A 474      38.960 -15.474  31.233  1.00 83.40           C  
ATOM   3684  N   LYS A 475      38.137 -20.316  27.633  1.00 80.84           N  
ATOM   3685  CA  LYS A 475      38.739 -21.339  26.800  1.00 80.68           C  
ATOM   3686  C   LYS A 475      39.384 -20.630  25.610  1.00 81.04           C  
ATOM   3687  O   LYS A 475      40.588 -20.359  25.623  1.00 83.94           O  
ATOM   3688  CB  LYS A 475      37.655 -22.302  26.316  1.00 80.99           C  
ATOM   3689  CG  LYS A 475      37.697 -23.675  26.964  1.00 84.26           C  
ATOM   3690  CD  LYS A 475      38.814 -24.515  26.375  1.00 84.84           C  
ATOM   3691  CE  LYS A 475      38.594 -24.729  24.881  1.00 86.10           C  
ATOM   3692  NZ  LYS A 475      39.755 -25.409  24.246  1.00 87.31           N  
ATOM   3693  N   LYS A 476      38.574 -20.313  24.597  1.00 77.23           N  
ATOM   3694  CA  LYS A 476      39.053 -19.634  23.392  1.00 72.18           C  
ATOM   3695  C   LYS A 476      39.880 -18.409  23.723  1.00 68.83           C  
ATOM   3696  O   LYS A 476      40.841 -18.100  23.027  1.00 67.28           O  
ATOM   3697  CB  LYS A 476      37.880 -19.180  22.513  1.00 74.86           C  
ATOM   3698  CG  LYS A 476      37.078 -20.285  21.840  1.00 77.70           C  
ATOM   3699  CD  LYS A 476      37.848 -20.961  20.710  1.00 76.56           C  
ATOM   3700  CE  LYS A 476      36.994 -22.051  20.086  1.00 78.68           C  
ATOM   3701  NZ  LYS A 476      36.327 -22.891  21.135  1.00 79.65           N  
ATOM   3702  N   TRP A 477      39.502 -17.712  24.789  1.00 66.46           N  
ATOM   3703  CA  TRP A 477      40.189 -16.489  25.178  1.00 63.36           C  
ATOM   3704  C   TRP A 477      41.697 -16.615  25.357  1.00 59.69           C  
ATOM   3705  O   TRP A 477      42.466 -15.758  24.910  1.00 57.44           O  
ATOM   3706  CB  TRP A 477      39.560 -15.911  26.449  1.00 64.75           C  
ATOM   3707  CG  TRP A 477      40.191 -14.613  26.855  1.00 67.84           C  
ATOM   3708  CD1 TRP A 477      41.135 -14.424  27.826  1.00 66.73           C  
ATOM   3709  CD2 TRP A 477      39.977 -13.333  26.251  1.00 70.68           C  
ATOM   3710  NE1 TRP A 477      41.521 -13.109  27.862  1.00 70.53           N  
ATOM   3711  CE2 TRP A 477      40.826 -12.416  26.904  1.00 72.59           C  
ATOM   3712  CE3 TRP A 477      39.154 -12.874  25.222  1.00 69.80           C  
ATOM   3713  CZ2 TRP A 477      40.872 -11.068  26.560  1.00 71.11           C  
ATOM   3714  CZ3 TRP A 477      39.203 -11.543  24.884  1.00 72.09           C  
ATOM   3715  CH2 TRP A 477      40.054 -10.654  25.550  1.00 71.71           C  
ATOM   3716  N   TRP A 478      42.133 -17.685  26.001  1.00 56.36           N  
ATOM   3717  CA  TRP A 478      43.555 -17.841  26.211  1.00 54.00           C  
ATOM   3718  C   TRP A 478      44.232 -18.620  25.111  1.00 56.25           C  
ATOM   3719  O   TRP A 478      45.431 -18.468  24.883  1.00 58.51           O  
ATOM   3720  CB  TRP A 478      43.797 -18.455  27.571  1.00 50.42           C  
ATOM   3721  CG  TRP A 478      43.517 -17.468  28.653  1.00 40.49           C  
ATOM   3722  CD1 TRP A 478      42.421 -17.419  29.454  1.00 33.63           C  
ATOM   3723  CD2 TRP A 478      44.353 -16.365  29.032  1.00 34.91           C  
ATOM   3724  NE1 TRP A 478      42.524 -16.353  30.313  1.00 35.45           N  
ATOM   3725  CE2 TRP A 478      43.703 -15.693  30.074  1.00 33.16           C  
ATOM   3726  CE3 TRP A 478      45.590 -15.885  28.587  1.00 34.36           C  
ATOM   3727  CZ2 TRP A 478      44.246 -14.569  30.683  1.00 32.92           C  
ATOM   3728  CZ3 TRP A 478      46.125 -14.769  29.186  1.00 31.82           C  
ATOM   3729  CH2 TRP A 478      45.455 -14.123  30.223  1.00 34.96           C  
ATOM   3730  N   GLU A 479      43.454 -19.458  24.434  1.00 58.91           N  
ATOM   3731  CA  GLU A 479      43.941 -20.218  23.291  1.00 60.23           C  
ATOM   3732  C   GLU A 479      44.347 -19.069  22.367  1.00 63.26           C  
ATOM   3733  O   GLU A 479      45.498 -18.987  21.902  1.00 63.14           O  
ATOM   3734  CB  GLU A 479      42.782 -20.990  22.667  1.00 60.38           C  
ATOM   3735  CG  GLU A 479      43.053 -22.438  22.334  1.00 66.15           C  
ATOM   3736  CD  GLU A 479      41.902 -23.346  22.771  1.00 70.24           C  
ATOM   3737  OE1 GLU A 479      40.724 -22.980  22.527  1.00 65.75           O  
ATOM   3738  OE2 GLU A 479      42.180 -24.423  23.356  1.00 71.10           O  
ATOM   3739  N   MET A 480      43.375 -18.169  22.154  1.00 63.11           N  
ATOM   3740  CA  MET A 480      43.510 -16.967  21.328  1.00 60.21           C  
ATOM   3741  C   MET A 480      44.643 -16.054  21.785  1.00 60.83           C  
ATOM   3742  O   MET A 480      45.540 -15.717  21.011  1.00 60.31           O  
ATOM   3743  CB  MET A 480      42.222 -16.157  21.358  1.00 55.26           C  
ATOM   3744  CG  MET A 480      41.059 -16.802  20.692  1.00 55.19           C  
ATOM   3745  SD  MET A 480      39.721 -15.626  20.473  1.00 55.75           S  
ATOM   3746  CE  MET A 480      40.311 -14.813  19.023  1.00 52.37           C  
ATOM   3747  N   LYS A 481      44.583 -15.618  23.034  1.00 59.60           N  
ATOM   3748  CA  LYS A 481      45.633 -14.756  23.536  1.00 63.73           C  
ATOM   3749  C   LYS A 481      46.975 -15.370  23.135  1.00 67.19           C  
ATOM   3750  O   LYS A 481      47.980 -14.662  23.008  1.00 67.83           O  
ATOM   3751  CB  LYS A 481      45.537 -14.641  25.061  1.00 62.99           C  
ATOM   3752  CG  LYS A 481      44.989 -13.324  25.586  1.00 59.68           C  
ATOM   3753  CD  LYS A 481      45.999 -12.204  25.435  1.00 60.27           C  
ATOM   3754  CE  LYS A 481      45.468 -10.902  26.032  1.00 66.04           C  
ATOM   3755  NZ  LYS A 481      44.136 -10.485  25.481  1.00 65.42           N  
ATOM   3756  N   ARG A 482      46.972 -16.689  22.914  1.00 69.22           N  
ATOM   3757  CA  ARG A 482      48.183 -17.422  22.548  1.00 71.36           C  
ATOM   3758  C   ARG A 482      48.585 -17.435  21.074  1.00 69.99           C  
ATOM   3759  O   ARG A 482      49.733 -17.142  20.755  1.00 71.42           O  
ATOM   3760  CB  ARG A 482      48.117 -18.857  23.093  1.00 72.30           C  
ATOM   3761  CG  ARG A 482      48.733 -18.968  24.485  1.00 76.65           C  
ATOM   3762  CD  ARG A 482      48.687 -20.368  25.091  1.00 81.08           C  
ATOM   3763  NE  ARG A 482      47.328 -20.795  25.431  1.00 85.22           N  
ATOM   3764  CZ  ARG A 482      47.002 -21.467  26.533  1.00 84.96           C  
ATOM   3765  NH1 ARG A 482      47.938 -21.794  27.419  1.00 84.00           N  
ATOM   3766  NH2 ARG A 482      45.738 -21.815  26.748  1.00 82.47           N  
ATOM   3767  N   GLU A 483      47.676 -17.772  20.167  1.00 68.82           N  
ATOM   3768  CA  GLU A 483      48.048 -17.772  18.750  1.00 69.35           C  
ATOM   3769  C   GLU A 483      48.276 -16.351  18.244  1.00 66.44           C  
ATOM   3770  O   GLU A 483      49.393 -15.986  17.884  1.00 65.67           O  
ATOM   3771  CB  GLU A 483      46.964 -18.417  17.884  1.00 71.65           C  
ATOM   3772  CG  GLU A 483      46.628 -19.841  18.229  1.00 78.65           C  
ATOM   3773  CD  GLU A 483      45.514 -20.380  17.359  1.00 82.67           C  
ATOM   3774  OE1 GLU A 483      44.462 -19.710  17.265  1.00 85.68           O  
ATOM   3775  OE2 GLU A 483      45.684 -21.471  16.774  1.00 84.63           O  
ATOM   3776  N   ILE A 484      47.192 -15.569  18.240  1.00 65.45           N  
ATOM   3777  CA  ILE A 484      47.143 -14.178  17.777  1.00 59.51           C  
ATOM   3778  C   ILE A 484      47.978 -13.156  18.551  1.00 57.83           C  
ATOM   3779  O   ILE A 484      49.010 -12.699  18.072  1.00 56.80           O  
ATOM   3780  CB  ILE A 484      45.698 -13.676  17.778  1.00 57.65           C  
ATOM   3781  CG1 ILE A 484      44.763 -14.797  17.331  1.00 54.08           C  
ATOM   3782  CG2 ILE A 484      45.568 -12.481  16.852  1.00 60.21           C  
ATOM   3783  CD1 ILE A 484      43.301 -14.428  17.367  1.00 53.57           C  
ATOM   3784  N   VAL A 485      47.537 -12.780  19.745  1.00 56.95           N  
ATOM   3785  CA  VAL A 485      48.291 -11.791  20.501  1.00 57.49           C  
ATOM   3786  C   VAL A 485      49.707 -12.241  20.744  1.00 58.13           C  
ATOM   3787  O   VAL A 485      50.643 -11.455  20.659  1.00 55.44           O  
ATOM   3788  CB  VAL A 485      47.679 -11.500  21.871  1.00 57.41           C  
ATOM   3789  CG1 VAL A 485      48.485 -10.397  22.545  1.00 54.85           C  
ATOM   3790  CG2 VAL A 485      46.221 -11.099  21.725  1.00 54.96           C  
ATOM   3791  N   GLY A 486      49.850 -13.522  21.059  1.00 62.94           N  
ATOM   3792  CA  GLY A 486      51.157 -14.086  21.335  1.00 65.15           C  
ATOM   3793  C   GLY A 486      51.444 -13.863  22.798  1.00 67.24           C  
ATOM   3794  O   GLY A 486      52.503 -13.338  23.157  1.00 69.76           O  
ATOM   3795  N   VAL A 487      50.490 -14.262  23.640  1.00 65.55           N  
ATOM   3796  CA  VAL A 487      50.606 -14.099  25.085  1.00 64.84           C  
ATOM   3797  C   VAL A 487      49.926 -15.245  25.839  1.00 65.38           C  
ATOM   3798  O   VAL A 487      48.896 -15.765  25.401  1.00 61.97           O  
ATOM   3799  CB  VAL A 487      50.005 -12.735  25.530  1.00 64.86           C  
ATOM   3800  CG1 VAL A 487      49.443 -12.833  26.924  1.00 65.81           C  
ATOM   3801  CG2 VAL A 487      51.083 -11.662  25.501  1.00 62.48           C  
ATOM   3802  N   VAL A 488      50.518 -15.633  26.973  1.00 66.69           N  
ATOM   3803  CA  VAL A 488      50.000 -16.729  27.798  1.00 65.55           C  
ATOM   3804  C   VAL A 488      49.681 -16.278  29.225  1.00 64.06           C  
ATOM   3805  O   VAL A 488      50.266 -15.314  29.732  1.00 62.62           O  
ATOM   3806  CB  VAL A 488      51.016 -17.908  27.861  1.00 63.87           C  
ATOM   3807  CG1 VAL A 488      52.183 -17.539  28.752  1.00 63.96           C  
ATOM   3808  CG2 VAL A 488      50.334 -19.177  28.354  1.00 63.20           C  
ATOM   3809  N   GLU A 489      48.761 -16.999  29.860  1.00 62.51           N  
ATOM   3810  CA  GLU A 489      48.323 -16.707  31.216  1.00 66.21           C  
ATOM   3811  C   GLU A 489      49.162 -17.358  32.314  1.00 69.56           C  
ATOM   3812  O   GLU A 489      49.503 -18.531  32.218  1.00 72.11           O  
ATOM   3813  CB  GLU A 489      46.862 -17.130  31.386  1.00 63.97           C  
ATOM   3814  CG  GLU A 489      46.585 -18.624  31.330  1.00 64.80           C  
ATOM   3815  CD  GLU A 489      46.714 -19.219  29.941  1.00 66.53           C  
ATOM   3816  OE1 GLU A 489      45.963 -20.177  29.636  1.00 63.50           O  
ATOM   3817  OE2 GLU A 489      47.566 -18.742  29.161  1.00 65.03           O  
ATOM   3818  N   PRO A 490      49.513 -16.591  33.368  1.00 72.78           N  
ATOM   3819  CA  PRO A 490      50.312 -17.025  34.528  1.00 74.67           C  
ATOM   3820  C   PRO A 490      49.579 -17.986  35.458  1.00 74.16           C  
ATOM   3821  O   PRO A 490      50.184 -18.562  36.363  1.00 76.08           O  
ATOM   3822  CB  PRO A 490      50.642 -15.711  35.243  1.00 73.27           C  
ATOM   3823  CG  PRO A 490      50.687 -14.732  34.130  1.00 75.11           C  
ATOM   3824  CD  PRO A 490      49.468 -15.120  33.316  1.00 75.30           C  
ATOM   3825  N   VAL A 491      48.281 -18.156  35.237  1.00 71.11           N  
ATOM   3826  CA  VAL A 491      47.484 -19.029  36.083  1.00 70.65           C  
ATOM   3827  C   VAL A 491      46.252 -19.536  35.349  1.00 72.04           C  
ATOM   3828  O   VAL A 491      45.480 -18.752  34.815  1.00 75.25           O  
ATOM   3829  CB  VAL A 491      46.997 -18.278  37.339  1.00 68.66           C  
ATOM   3830  CG1 VAL A 491      46.268 -19.234  38.256  1.00 70.04           C  
ATOM   3831  CG2 VAL A 491      48.163 -17.622  38.059  1.00 66.31           C  
ATOM   3832  N   PRO A 492      46.037 -20.854  35.327  1.00 72.68           N  
ATOM   3833  CA  PRO A 492      44.863 -21.386  34.637  1.00 73.09           C  
ATOM   3834  C   PRO A 492      43.596 -20.721  35.150  1.00 74.32           C  
ATOM   3835  O   PRO A 492      43.299 -20.771  36.346  1.00 75.41           O  
ATOM   3836  CB  PRO A 492      44.894 -22.864  34.994  1.00 73.22           C  
ATOM   3837  CG  PRO A 492      46.334 -23.141  35.140  1.00 76.47           C  
ATOM   3838  CD  PRO A 492      46.822 -21.941  35.925  1.00 75.22           C  
ATOM   3839  N   HIS A 493      42.853 -20.092  34.249  1.00 73.30           N  
ATOM   3840  CA  HIS A 493      41.620 -19.441  34.636  1.00 71.09           C  
ATOM   3841  C   HIS A 493      40.415 -20.262  34.211  1.00 70.01           C  
ATOM   3842  O   HIS A 493      40.149 -20.443  33.028  1.00 69.35           O  
ATOM   3843  CB  HIS A 493      41.529 -18.045  34.027  1.00 74.29           C  
ATOM   3844  CG  HIS A 493      42.475 -17.053  34.630  1.00 75.87           C  
ATOM   3845  ND1 HIS A 493      42.546 -16.822  35.986  1.00 77.94           N  
ATOM   3846  CD2 HIS A 493      43.362 -16.205  34.059  1.00 75.73           C  
ATOM   3847  CE1 HIS A 493      43.434 -15.874  36.224  1.00 77.64           C  
ATOM   3848  NE2 HIS A 493      43.943 -15.482  35.071  1.00 75.02           N  
ATOM   3849  N   ASP A 494      39.701 -20.754  35.213  1.00 70.02           N  
ATOM   3850  CA  ASP A 494      38.486 -21.554  35.072  1.00 68.36           C  
ATOM   3851  C   ASP A 494      37.366 -20.693  34.448  1.00 64.44           C  
ATOM   3852  O   ASP A 494      37.474 -19.476  34.398  1.00 62.19           O  
ATOM   3853  CB  ASP A 494      38.156 -22.081  36.498  1.00 70.28           C  
ATOM   3854  CG  ASP A 494      36.666 -22.289  36.769  1.00 72.31           C  
ATOM   3855  OD1 ASP A 494      36.342 -22.639  37.925  1.00 71.67           O  
ATOM   3856  OD2 ASP A 494      35.818 -22.115  35.873  1.00 74.18           O  
ATOM   3857  N   GLU A 495      36.314 -21.322  33.940  1.00 63.68           N  
ATOM   3858  CA  GLU A 495      35.198 -20.583  33.352  1.00 67.01           C  
ATOM   3859  C   GLU A 495      34.380 -19.914  34.460  1.00 65.91           C  
ATOM   3860  O   GLU A 495      33.181 -19.701  34.338  1.00 64.28           O  
ATOM   3861  CB  GLU A 495      34.292 -21.526  32.547  1.00 72.09           C  
ATOM   3862  CG  GLU A 495      35.040 -22.550  31.683  1.00 76.94           C  
ATOM   3863  CD  GLU A 495      35.704 -21.953  30.451  1.00 77.00           C  
ATOM   3864  OE1 GLU A 495      36.589 -22.631  29.886  1.00 74.93           O  
ATOM   3865  OE2 GLU A 495      35.337 -20.824  30.044  1.00 78.54           O  
ATOM   3866  N   THR A 496      35.045 -19.606  35.560  1.00 68.53           N  
ATOM   3867  CA  THR A 496      34.418 -18.941  36.693  1.00 70.35           C  
ATOM   3868  C   THR A 496      34.793 -17.468  36.492  1.00 70.87           C  
ATOM   3869  O   THR A 496      34.065 -16.552  36.893  1.00 70.51           O  
ATOM   3870  CB  THR A 496      35.025 -19.458  38.030  1.00 71.32           C  
ATOM   3871  OG1 THR A 496      34.231 -19.026  39.139  1.00 72.87           O  
ATOM   3872  CG2 THR A 496      36.434 -18.918  38.206  1.00 72.43           C  
ATOM   3873  N   TYR A 497      35.943 -17.276  35.843  1.00 69.98           N  
ATOM   3874  CA  TYR A 497      36.504 -15.963  35.542  1.00 68.97           C  
ATOM   3875  C   TYR A 497      35.756 -15.163  34.496  1.00 68.84           C  
ATOM   3876  O   TYR A 497      34.577 -15.390  34.227  1.00 69.47           O  
ATOM   3877  CB  TYR A 497      37.940 -16.112  35.072  1.00 67.25           C  
ATOM   3878  CG  TYR A 497      38.907 -16.436  36.173  1.00 69.44           C  
ATOM   3879  CD1 TYR A 497      39.642 -15.436  36.788  1.00 69.59           C  
ATOM   3880  CD2 TYR A 497      39.112 -17.744  36.579  1.00 68.53           C  
ATOM   3881  CE1 TYR A 497      40.565 -15.733  37.774  1.00 68.29           C  
ATOM   3882  CE2 TYR A 497      40.036 -18.048  37.564  1.00 68.31           C  
ATOM   3883  CZ  TYR A 497      40.763 -17.040  38.155  1.00 65.96           C  
ATOM   3884  OH  TYR A 497      41.721 -17.339  39.092  1.00 61.14           O  
ATOM   3885  N   CYS A 498      36.475 -14.213  33.913  1.00 67.35           N  
ATOM   3886  CA  CYS A 498      35.931 -13.347  32.886  1.00 66.67           C  
ATOM   3887  C   CYS A 498      36.936 -12.238  32.607  1.00 66.56           C  
ATOM   3888  O   CYS A 498      36.620 -11.052  32.621  1.00 65.38           O  
ATOM   3889  CB  CYS A 498      34.605 -12.754  33.333  1.00 63.46           C  
ATOM   3890  SG  CYS A 498      33.632 -12.306  31.920  1.00 71.71           S  
ATOM   3891  N   ASP A 499      38.162 -12.660  32.349  1.00 68.03           N  
ATOM   3892  CA  ASP A 499      39.262 -11.761  32.070  1.00 69.21           C  
ATOM   3893  C   ASP A 499      38.947 -10.684  31.039  1.00 68.69           C  
ATOM   3894  O   ASP A 499      39.371  -9.544  31.188  1.00 72.89           O  
ATOM   3895  CB  ASP A 499      40.478 -12.582  31.630  1.00 69.07           C  
ATOM   3896  CG  ASP A 499      40.994 -13.501  32.734  1.00 70.71           C  
ATOM   3897  OD1 ASP A 499      41.741 -14.443  32.411  1.00 67.07           O  
ATOM   3898  OD2 ASP A 499      40.664 -13.280  33.924  1.00 72.72           O  
ATOM   3899  N   PRO A 500      38.201 -11.017  29.979  1.00 66.24           N  
ATOM   3900  CA  PRO A 500      37.926  -9.957  29.015  1.00 65.28           C  
ATOM   3901  C   PRO A 500      36.756  -9.084  29.448  1.00 64.16           C  
ATOM   3902  O   PRO A 500      36.009  -8.584  28.612  1.00 66.56           O  
ATOM   3903  CB  PRO A 500      37.637 -10.729  27.735  1.00 65.13           C  
ATOM   3904  CG  PRO A 500      36.892 -11.900  28.246  1.00 68.06           C  
ATOM   3905  CD  PRO A 500      37.698 -12.309  29.485  1.00 69.21           C  
ATOM   3906  N   ALA A 501      36.600  -8.914  30.755  1.00 61.67           N  
ATOM   3907  CA  ALA A 501      35.530  -8.094  31.308  1.00 57.49           C  
ATOM   3908  C   ALA A 501      36.103  -7.291  32.448  1.00 55.11           C  
ATOM   3909  O   ALA A 501      35.385  -6.836  33.324  1.00 55.09           O  
ATOM   3910  CB  ALA A 501      34.405  -8.962  31.813  1.00 58.48           C  
ATOM   3911  N   SER A 502      37.415  -7.135  32.429  1.00 54.08           N  
ATOM   3912  CA  SER A 502      38.117  -6.391  33.454  1.00 53.50           C  
ATOM   3913  C   SER A 502      38.981  -5.357  32.748  1.00 52.83           C  
ATOM   3914  O   SER A 502      39.963  -4.859  33.295  1.00 49.57           O  
ATOM   3915  CB  SER A 502      38.985  -7.341  34.289  1.00 55.56           C  
ATOM   3916  OG  SER A 502      40.005  -7.945  33.510  1.00 57.00           O  
ATOM   3917  N   LEU A 503      38.601  -5.060  31.508  1.00 52.60           N  
ATOM   3918  CA  LEU A 503      39.306  -4.082  30.697  1.00 48.57           C  
ATOM   3919  C   LEU A 503      38.335  -2.982  30.344  1.00 49.01           C  
ATOM   3920  O   LEU A 503      38.074  -2.769  29.172  1.00 55.03           O  
ATOM   3921  CB  LEU A 503      39.809  -4.714  29.404  1.00 44.57           C  
ATOM   3922  CG  LEU A 503      40.754  -3.933  28.476  1.00 41.89           C  
ATOM   3923  CD1 LEU A 503      40.279  -4.104  27.038  1.00 45.61           C  
ATOM   3924  CD2 LEU A 503      40.800  -2.473  28.826  1.00 41.89           C  
ATOM   3925  N   PHE A 504      37.792  -2.299  31.347  1.00 48.60           N  
ATOM   3926  CA  PHE A 504      36.856  -1.193  31.125  1.00 48.74           C  
ATOM   3927  C   PHE A 504      36.021  -1.408  29.873  1.00 49.45           C  
ATOM   3928  O   PHE A 504      34.960  -2.032  29.935  1.00 53.15           O  
ATOM   3929  CB  PHE A 504      37.617   0.127  30.989  1.00 46.37           C  
ATOM   3930  CG  PHE A 504      36.726   1.321  30.859  1.00 45.09           C  
ATOM   3931  CD1 PHE A 504      35.882   1.687  31.897  1.00 45.83           C  
ATOM   3932  CD2 PHE A 504      36.730   2.075  29.711  1.00 43.28           C  
ATOM   3933  CE1 PHE A 504      35.065   2.775  31.795  1.00 39.33           C  
ATOM   3934  CE2 PHE A 504      35.915   3.165  29.599  1.00 41.95           C  
ATOM   3935  CZ  PHE A 504      35.081   3.516  30.644  1.00 44.35           C  
ATOM   3936  N   HIS A 505      36.510  -0.870  28.752  1.00 45.22           N  
ATOM   3937  CA  HIS A 505      35.885  -1.002  27.442  1.00 40.99           C  
ATOM   3938  C   HIS A 505      34.885  -2.134  27.394  1.00 43.31           C  
ATOM   3939  O   HIS A 505      33.774  -1.969  26.942  1.00 45.01           O  
ATOM   3940  CB  HIS A 505      36.963  -1.255  26.414  1.00 40.39           C  
ATOM   3941  CG  HIS A 505      37.978  -0.169  26.358  1.00 41.47           C  
ATOM   3942  ND1 HIS A 505      38.000   0.778  25.355  1.00 41.47           N  
ATOM   3943  CD2 HIS A 505      38.940   0.186  27.237  1.00 37.07           C  
ATOM   3944  CE1 HIS A 505      38.928   1.675  25.625  1.00 37.85           C  
ATOM   3945  NE2 HIS A 505      39.512   1.339  26.761  1.00 41.72           N  
ATOM   3946  N   VAL A 506      35.279  -3.310  27.842  1.00 44.51           N  
ATOM   3947  CA  VAL A 506      34.336  -4.399  27.833  1.00 45.05           C  
ATOM   3948  C   VAL A 506      33.201  -4.059  28.797  1.00 45.69           C  
ATOM   3949  O   VAL A 506      32.166  -3.572  28.378  1.00 48.56           O  
ATOM   3950  CB  VAL A 506      35.008  -5.720  28.235  1.00 44.92           C  
ATOM   3951  CG1 VAL A 506      33.953  -6.809  28.370  1.00 41.52           C  
ATOM   3952  CG2 VAL A 506      36.059  -6.101  27.184  1.00 41.23           C  
ATOM   3953  N   SER A 507      33.411  -4.273  30.086  1.00 45.91           N  
ATOM   3954  CA  SER A 507      32.386  -4.013  31.096  1.00 47.29           C  
ATOM   3955  C   SER A 507      31.554  -2.725  31.029  1.00 47.13           C  
ATOM   3956  O   SER A 507      30.598  -2.594  31.787  1.00 48.06           O  
ATOM   3957  CB  SER A 507      33.007  -4.123  32.486  1.00 48.47           C  
ATOM   3958  OG  SER A 507      34.139  -3.282  32.600  1.00 53.72           O  
ATOM   3959  N   ASN A 508      31.893  -1.782  30.148  1.00 47.66           N  
ATOM   3960  CA  ASN A 508      31.130  -0.519  30.035  1.00 47.84           C  
ATOM   3961  C   ASN A 508      30.735  -0.278  28.590  1.00 45.36           C  
ATOM   3962  O   ASN A 508      30.734   0.857  28.136  1.00 45.28           O  
ATOM   3963  CB  ASN A 508      31.973   0.693  30.479  1.00 50.90           C  
ATOM   3964  CG  ASN A 508      32.800   0.421  31.726  1.00 52.46           C  
ATOM   3965  OD1 ASN A 508      32.437   0.812  32.838  1.00 53.59           O  
ATOM   3966  ND2 ASN A 508      33.917  -0.261  31.541  1.00 50.76           N  
ATOM   3967  N   ASP A 509      30.398  -1.345  27.879  1.00 43.81           N  
ATOM   3968  CA  ASP A 509      30.050  -1.275  26.469  1.00 42.75           C  
ATOM   3969  C   ASP A 509      31.232  -0.827  25.639  1.00 40.62           C  
ATOM   3970  O   ASP A 509      32.201  -1.547  25.549  1.00 45.77           O  
ATOM   3971  CB  ASP A 509      28.860  -0.369  26.237  1.00 49.96           C  
ATOM   3972  CG  ASP A 509      27.563  -1.088  26.468  1.00 56.42           C  
ATOM   3973  OD1 ASP A 509      27.493  -2.270  26.072  1.00 59.94           O  
ATOM   3974  OD2 ASP A 509      26.622  -0.486  27.032  1.00 61.59           O  
ATOM   3975  N   TYR A 510      31.181   0.338  25.021  1.00 37.25           N  
ATOM   3976  CA  TYR A 510      32.315   0.786  24.203  1.00 39.06           C  
ATOM   3977  C   TYR A 510      32.901  -0.248  23.231  1.00 38.74           C  
ATOM   3978  O   TYR A 510      33.567  -1.188  23.630  1.00 39.16           O  
ATOM   3979  CB  TYR A 510      33.424   1.357  25.112  1.00 36.73           C  
ATOM   3980  CG  TYR A 510      32.936   2.613  25.767  1.00 35.51           C  
ATOM   3981  CD1 TYR A 510      32.569   3.691  24.996  1.00 34.30           C  
ATOM   3982  CD2 TYR A 510      32.619   2.641  27.104  1.00 37.33           C  
ATOM   3983  CE1 TYR A 510      31.885   4.737  25.515  1.00 34.40           C  
ATOM   3984  CE2 TYR A 510      31.924   3.696  27.643  1.00 39.75           C  
ATOM   3985  CZ  TYR A 510      31.550   4.743  26.835  1.00 38.63           C  
ATOM   3986  OH  TYR A 510      30.786   5.785  27.325  1.00 43.83           O  
ATOM   3987  N   SER A 511      32.637  -0.074  21.942  1.00 40.30           N  
ATOM   3988  CA  SER A 511      33.175  -0.989  20.947  1.00 40.71           C  
ATOM   3989  C   SER A 511      34.690  -0.866  21.067  1.00 41.07           C  
ATOM   3990  O   SER A 511      35.192   0.162  21.524  1.00 41.37           O  
ATOM   3991  CB  SER A 511      32.735  -0.560  19.548  1.00 44.12           C  
ATOM   3992  OG  SER A 511      33.208   0.745  19.236  1.00 43.10           O  
ATOM   3993  N   PHE A 512      35.434  -1.882  20.651  1.00 39.74           N  
ATOM   3994  CA  PHE A 512      36.872  -1.781  20.787  1.00 39.63           C  
ATOM   3995  C   PHE A 512      37.654  -1.618  19.486  1.00 40.48           C  
ATOM   3996  O   PHE A 512      38.690  -0.945  19.450  1.00 41.64           O  
ATOM   3997  CB  PHE A 512      37.399  -2.979  21.596  1.00 41.20           C  
ATOM   3998  CG  PHE A 512      38.651  -2.668  22.356  1.00 38.95           C  
ATOM   3999  CD1 PHE A 512      39.866  -3.199  21.965  1.00 34.85           C  
ATOM   4000  CD2 PHE A 512      38.629  -1.717  23.365  1.00 34.30           C  
ATOM   4001  CE1 PHE A 512      41.026  -2.779  22.548  1.00 37.47           C  
ATOM   4002  CE2 PHE A 512      39.792  -1.299  23.943  1.00 37.41           C  
ATOM   4003  CZ  PHE A 512      40.995  -1.826  23.534  1.00 35.86           C  
ATOM   4004  N   ILE A 513      37.138  -2.202  18.409  1.00 41.12           N  
ATOM   4005  CA  ILE A 513      37.788  -2.146  17.097  1.00 39.27           C  
ATOM   4006  C   ILE A 513      38.094  -0.742  16.552  1.00 36.60           C  
ATOM   4007  O   ILE A 513      38.880  -0.613  15.616  1.00 35.28           O  
ATOM   4008  CB  ILE A 513      36.956  -2.931  16.049  1.00 40.30           C  
ATOM   4009  CG1 ILE A 513      37.862  -3.445  14.916  1.00 42.76           C  
ATOM   4010  CG2 ILE A 513      35.862  -2.048  15.508  1.00 38.78           C  
ATOM   4011  CD1 ILE A 513      38.947  -4.421  15.362  1.00 39.41           C  
ATOM   4012  N   ARG A 514      37.497   0.304  17.118  1.00 35.98           N  
ATOM   4013  CA  ARG A 514      37.790   1.658  16.646  1.00 39.09           C  
ATOM   4014  C   ARG A 514      39.268   1.952  16.840  1.00 42.63           C  
ATOM   4015  O   ARG A 514      39.843   2.783  16.133  1.00 40.62           O  
ATOM   4016  CB  ARG A 514      36.997   2.721  17.406  1.00 40.39           C  
ATOM   4017  CG  ARG A 514      35.986   2.193  18.373  1.00 42.80           C  
ATOM   4018  CD  ARG A 514      36.459   2.457  19.762  1.00 45.73           C  
ATOM   4019  NE  ARG A 514      35.974   3.714  20.325  1.00 46.75           N  
ATOM   4020  CZ  ARG A 514      34.761   3.881  20.840  1.00 45.85           C  
ATOM   4021  NH1 ARG A 514      33.898   2.875  20.848  1.00 46.05           N  
ATOM   4022  NH2 ARG A 514      34.435   5.031  21.413  1.00 45.86           N  
ATOM   4023  N   TYR A 515      39.874   1.257  17.807  1.00 44.33           N  
ATOM   4024  CA  TYR A 515      41.288   1.418  18.123  1.00 40.38           C  
ATOM   4025  C   TYR A 515      42.133   0.764  17.071  1.00 40.24           C  
ATOM   4026  O   TYR A 515      43.232   1.204  16.785  1.00 41.79           O  
ATOM   4027  CB  TYR A 515      41.571   0.815  19.473  1.00 36.49           C  
ATOM   4028  CG  TYR A 515      40.796   1.512  20.552  1.00 35.03           C  
ATOM   4029  CD1 TYR A 515      41.067   2.832  20.897  1.00 30.38           C  
ATOM   4030  CD2 TYR A 515      39.774   0.862  21.213  1.00 37.53           C  
ATOM   4031  CE1 TYR A 515      40.330   3.474  21.877  1.00 27.69           C  
ATOM   4032  CE2 TYR A 515      39.039   1.494  22.193  1.00 37.28           C  
ATOM   4033  CZ  TYR A 515      39.324   2.790  22.522  1.00 30.86           C  
ATOM   4034  OH  TYR A 515      38.623   3.345  23.550  1.00 30.81           O  
ATOM   4035  N   TYR A 516      41.613  -0.296  16.484  1.00 42.34           N  
ATOM   4036  CA  TYR A 516      42.336  -0.959  15.421  1.00 45.04           C  
ATOM   4037  C   TYR A 516      42.336  -0.024  14.214  1.00 44.58           C  
ATOM   4038  O   TYR A 516      43.395   0.384  13.698  1.00 41.34           O  
ATOM   4039  CB  TYR A 516      41.642  -2.258  15.034  1.00 47.06           C  
ATOM   4040  CG  TYR A 516      42.359  -2.954  13.914  1.00 49.50           C  
ATOM   4041  CD1 TYR A 516      43.326  -3.913  14.175  1.00 48.37           C  
ATOM   4042  CD2 TYR A 516      42.131  -2.589  12.593  1.00 49.36           C  
ATOM   4043  CE1 TYR A 516      44.047  -4.480  13.155  1.00 51.06           C  
ATOM   4044  CE2 TYR A 516      42.848  -3.151  11.572  1.00 52.47           C  
ATOM   4045  CZ  TYR A 516      43.804  -4.093  11.858  1.00 53.28           C  
ATOM   4046  OH  TYR A 516      44.531  -4.637  10.837  1.00 59.89           O  
ATOM   4047  N   THR A 517      41.119   0.300  13.774  1.00 45.01           N  
ATOM   4048  CA  THR A 517      40.864   1.185  12.627  1.00 41.02           C  
ATOM   4049  C   THR A 517      41.489   2.550  12.818  1.00 36.74           C  
ATOM   4050  O   THR A 517      42.087   3.099  11.903  1.00 30.48           O  
ATOM   4051  CB  THR A 517      39.402   1.367  12.458  1.00 38.89           C  
ATOM   4052  OG1 THR A 517      38.859   1.747  13.724  1.00 39.63           O  
ATOM   4053  CG2 THR A 517      38.767   0.065  12.008  1.00 35.74           C  
ATOM   4054  N   ARG A 518      41.339   3.095  14.016  1.00 36.62           N  
ATOM   4055  CA  ARG A 518      41.930   4.380  14.332  1.00 40.49           C  
ATOM   4056  C   ARG A 518      43.428   4.353  14.092  1.00 42.50           C  
ATOM   4057  O   ARG A 518      43.997   5.318  13.608  1.00 42.91           O  
ATOM   4058  CB  ARG A 518      41.690   4.725  15.787  1.00 43.75           C  
ATOM   4059  CG  ARG A 518      42.843   5.461  16.435  1.00 48.59           C  
ATOM   4060  CD  ARG A 518      43.482   4.626  17.529  1.00 54.23           C  
ATOM   4061  NE  ARG A 518      43.903   5.469  18.640  1.00 58.14           N  
ATOM   4062  CZ  ARG A 518      44.065   5.030  19.882  1.00 60.75           C  
ATOM   4063  NH1 ARG A 518      44.445   5.867  20.840  1.00 59.79           N  
ATOM   4064  NH2 ARG A 518      43.841   3.753  20.164  1.00 60.43           N  
ATOM   4065  N   THR A 519      44.066   3.237  14.434  1.00 47.38           N  
ATOM   4066  CA  THR A 519      45.513   3.105  14.287  1.00 47.40           C  
ATOM   4067  C   THR A 519      45.966   3.242  12.856  1.00 48.75           C  
ATOM   4068  O   THR A 519      46.967   3.922  12.595  1.00 48.23           O  
ATOM   4069  CB  THR A 519      46.023   1.775  14.875  1.00 46.95           C  
ATOM   4070  OG1 THR A 519      45.936   1.836  16.305  1.00 46.13           O  
ATOM   4071  CG2 THR A 519      47.472   1.519  14.464  1.00 43.39           C  
ATOM   4072  N   LEU A 520      45.243   2.605  11.931  1.00 48.73           N  
ATOM   4073  CA  LEU A 520      45.593   2.716  10.519  1.00 46.72           C  
ATOM   4074  C   LEU A 520      45.188   4.056   9.930  1.00 46.46           C  
ATOM   4075  O   LEU A 520      45.947   4.609   9.136  1.00 46.72           O  
ATOM   4076  CB  LEU A 520      44.974   1.611   9.692  1.00 48.73           C  
ATOM   4077  CG  LEU A 520      45.797   0.337   9.665  1.00 53.47           C  
ATOM   4078  CD1 LEU A 520      45.700  -0.347  11.005  1.00 56.96           C  
ATOM   4079  CD2 LEU A 520      45.289  -0.567   8.551  1.00 56.14           C  
ATOM   4080  N   TYR A 521      44.010   4.582  10.295  1.00 43.48           N  
ATOM   4081  CA  TYR A 521      43.608   5.887   9.768  1.00 43.52           C  
ATOM   4082  C   TYR A 521      44.734   6.835  10.151  1.00 43.55           C  
ATOM   4083  O   TYR A 521      45.303   7.539   9.326  1.00 44.29           O  
ATOM   4084  CB  TYR A 521      42.312   6.416  10.401  1.00 42.35           C  
ATOM   4085  CG  TYR A 521      41.047   5.662  10.073  1.00 41.29           C  
ATOM   4086  CD1 TYR A 521      40.914   4.976   8.877  1.00 39.61           C  
ATOM   4087  CD2 TYR A 521      39.997   5.603  10.993  1.00 40.95           C  
ATOM   4088  CE1 TYR A 521      39.773   4.236   8.605  1.00 40.70           C  
ATOM   4089  CE2 TYR A 521      38.859   4.869  10.736  1.00 40.56           C  
ATOM   4090  CZ  TYR A 521      38.757   4.186   9.538  1.00 43.63           C  
ATOM   4091  OH  TYR A 521      37.645   3.433   9.278  1.00 46.19           O  
ATOM   4092  N   GLN A 522      45.030   6.831  11.435  1.00 44.75           N  
ATOM   4093  CA  GLN A 522      46.074   7.638  12.029  1.00 46.45           C  
ATOM   4094  C   GLN A 522      47.225   7.993  11.078  1.00 45.98           C  
ATOM   4095  O   GLN A 522      47.524   9.167  10.878  1.00 46.71           O  
ATOM   4096  CB  GLN A 522      46.606   6.881  13.242  1.00 48.99           C  
ATOM   4097  CG  GLN A 522      47.472   7.659  14.182  1.00 52.67           C  
ATOM   4098  CD  GLN A 522      48.217   6.738  15.128  1.00 56.33           C  
ATOM   4099  OE1 GLN A 522      47.615   6.002  15.919  1.00 52.22           O  
ATOM   4100  NE2 GLN A 522      49.540   6.762  15.039  1.00 58.22           N  
ATOM   4101  N   PHE A 523      47.866   6.994  10.480  1.00 43.81           N  
ATOM   4102  CA  PHE A 523      49.003   7.278   9.598  1.00 44.57           C  
ATOM   4103  C   PHE A 523      48.678   7.764   8.194  1.00 44.91           C  
ATOM   4104  O   PHE A 523      49.510   8.390   7.552  1.00 42.92           O  
ATOM   4105  CB  PHE A 523      49.920   6.061   9.526  1.00 42.95           C  
ATOM   4106  CG  PHE A 523      50.471   5.678  10.842  1.00 42.44           C  
ATOM   4107  CD1 PHE A 523      51.398   6.489  11.469  1.00 42.52           C  
ATOM   4108  CD2 PHE A 523      49.998   4.560  11.500  1.00 43.16           C  
ATOM   4109  CE1 PHE A 523      51.837   6.194  12.734  1.00 46.10           C  
ATOM   4110  CE2 PHE A 523      50.433   4.256  12.771  1.00 48.11           C  
ATOM   4111  CZ  PHE A 523      51.353   5.074  13.392  1.00 47.24           C  
ATOM   4112  N   GLN A 524      47.472   7.467   7.719  1.00 47.19           N  
ATOM   4113  CA  GLN A 524      47.040   7.899   6.402  1.00 43.14           C  
ATOM   4114  C   GLN A 524      46.879   9.398   6.492  1.00 45.57           C  
ATOM   4115  O   GLN A 524      47.388  10.130   5.651  1.00 45.74           O  
ATOM   4116  CB  GLN A 524      45.710   7.259   6.040  1.00 37.56           C  
ATOM   4117  CG  GLN A 524      45.707   5.761   6.185  1.00 34.78           C  
ATOM   4118  CD  GLN A 524      44.615   5.097   5.388  1.00 31.62           C  
ATOM   4119  OE1 GLN A 524      44.603   5.180   4.163  1.00 31.98           O  
ATOM   4120  NE2 GLN A 524      43.694   4.433   6.072  1.00 23.30           N  
ATOM   4121  N   PHE A 525      46.177   9.849   7.527  1.00 48.33           N  
ATOM   4122  CA  PHE A 525      45.957  11.277   7.740  1.00 55.65           C  
ATOM   4123  C   PHE A 525      47.273  12.026   7.976  1.00 58.46           C  
ATOM   4124  O   PHE A 525      47.390  13.230   7.710  1.00 55.60           O  
ATOM   4125  CB  PHE A 525      45.043  11.511   8.951  1.00 57.39           C  
ATOM   4126  CG  PHE A 525      43.627  11.056   8.753  1.00 60.55           C  
ATOM   4127  CD1 PHE A 525      43.270   9.743   8.965  1.00 59.07           C  
ATOM   4128  CD2 PHE A 525      42.649  11.955   8.365  1.00 63.00           C  
ATOM   4129  CE1 PHE A 525      41.969   9.333   8.796  1.00 59.82           C  
ATOM   4130  CE2 PHE A 525      41.345  11.547   8.194  1.00 63.46           C  
ATOM   4131  CZ  PHE A 525      41.006  10.233   8.412  1.00 62.14           C  
ATOM   4132  N   GLN A 526      48.264  11.309   8.485  1.00 62.38           N  
ATOM   4133  CA  GLN A 526      49.536  11.929   8.776  1.00 65.83           C  
ATOM   4134  C   GLN A 526      50.415  12.019   7.542  1.00 67.75           C  
ATOM   4135  O   GLN A 526      51.166  12.973   7.395  1.00 71.63           O  
ATOM   4136  CB  GLN A 526      50.252  11.156   9.880  1.00 66.75           C  
ATOM   4137  CG  GLN A 526      51.475  11.868  10.428  1.00 71.46           C  
ATOM   4138  CD  GLN A 526      51.126  13.088  11.264  1.00 72.82           C  
ATOM   4139  OE1 GLN A 526      52.008  13.856  11.655  1.00 72.17           O  
ATOM   4140  NE2 GLN A 526      49.839  13.267  11.550  1.00 72.37           N  
ATOM   4141  N   GLU A 527      50.321  11.043   6.646  1.00 66.90           N  
ATOM   4142  CA  GLU A 527      51.143  11.070   5.446  1.00 66.26           C  
ATOM   4143  C   GLU A 527      50.623  12.117   4.502  1.00 65.93           C  
ATOM   4144  O   GLU A 527      51.267  12.419   3.502  1.00 70.38           O  
ATOM   4145  CB  GLU A 527      51.128   9.724   4.731  1.00 69.24           C  
ATOM   4146  CG  GLU A 527      52.286   9.540   3.760  1.00 77.71           C  
ATOM   4147  CD  GLU A 527      52.334   8.143   3.142  1.00 84.66           C  
ATOM   4148  OE1 GLU A 527      51.504   7.857   2.246  1.00 86.90           O  
ATOM   4149  OE2 GLU A 527      53.198   7.330   3.556  1.00 84.60           O  
ATOM   4150  N   ALA A 528      49.457  12.670   4.825  1.00 64.00           N  
ATOM   4151  CA  ALA A 528      48.814  13.682   3.994  1.00 60.71           C  
ATOM   4152  C   ALA A 528      49.046  15.088   4.509  1.00 60.14           C  
ATOM   4153  O   ALA A 528      49.364  15.977   3.736  1.00 62.63           O  
ATOM   4154  CB  ALA A 528      47.334  13.411   3.909  1.00 56.62           C  
ATOM   4155  N   LEU A 529      48.880  15.285   5.811  1.00 60.77           N  
ATOM   4156  CA  LEU A 529      49.075  16.592   6.442  1.00 62.72           C  
ATOM   4157  C   LEU A 529      50.549  17.054   6.423  1.00 66.21           C  
ATOM   4158  O   LEU A 529      50.843  18.245   6.302  1.00 62.60           O  
ATOM   4159  CB  LEU A 529      48.578  16.530   7.880  1.00 59.88           C  
ATOM   4160  CG  LEU A 529      47.157  16.026   8.092  1.00 56.35           C  
ATOM   4161  CD1 LEU A 529      46.991  15.633   9.523  1.00 55.60           C  
ATOM   4162  CD2 LEU A 529      46.159  17.089   7.719  1.00 56.14           C  
ATOM   4163  N   CYS A 530      51.479  16.117   6.567  1.00 71.20           N  
ATOM   4164  CA  CYS A 530      52.890  16.478   6.526  1.00 77.30           C  
ATOM   4165  C   CYS A 530      53.068  17.103   5.169  1.00 78.03           C  
ATOM   4166  O   CYS A 530      53.556  18.223   5.042  1.00 79.79           O  
ATOM   4167  CB  CYS A 530      53.777  15.238   6.660  1.00 80.95           C  
ATOM   4168  SG  CYS A 530      53.391  14.356   8.200  1.00 90.81           S  
ATOM   4169  N   GLN A 531      52.631  16.369   4.155  1.00 78.38           N  
ATOM   4170  CA  GLN A 531      52.705  16.836   2.783  1.00 79.54           C  
ATOM   4171  C   GLN A 531      51.801  18.058   2.593  1.00 76.94           C  
ATOM   4172  O   GLN A 531      51.758  18.644   1.512  1.00 77.27           O  
ATOM   4173  CB  GLN A 531      52.275  15.714   1.843  1.00 83.87           C  
ATOM   4174  CG  GLN A 531      52.930  15.770   0.483  1.00 90.16           C  
ATOM   4175  CD  GLN A 531      52.845  14.445  -0.233  1.00 93.06           C  
ATOM   4176  OE1 GLN A 531      53.384  14.285  -1.323  1.00 96.11           O  
ATOM   4177  NE2 GLN A 531      52.165  13.481   0.380  1.00 93.30           N  
ATOM   4178  N   ALA A 532      51.086  18.435   3.652  1.00 73.08           N  
ATOM   4179  CA  ALA A 532      50.189  19.582   3.625  1.00 69.56           C  
ATOM   4180  C   ALA A 532      50.737  20.649   4.552  1.00 69.90           C  
ATOM   4181  O   ALA A 532      50.017  21.545   4.992  1.00 69.70           O  
ATOM   4182  CB  ALA A 532      48.805  19.174   4.072  1.00 69.59           C  
ATOM   4183  N   ALA A 533      52.019  20.525   4.865  1.00 69.34           N  
ATOM   4184  CA  ALA A 533      52.718  21.472   5.727  1.00 69.32           C  
ATOM   4185  C   ALA A 533      54.115  21.497   5.159  1.00 68.86           C  
ATOM   4186  O   ALA A 533      55.043  22.051   5.745  1.00 67.79           O  
ATOM   4187  CB  ALA A 533      52.747  20.972   7.157  1.00 69.62           C  
ATOM   4188  N   LYS A 534      54.235  20.868   3.998  1.00 68.25           N  
ATOM   4189  CA  LYS A 534      55.490  20.762   3.280  1.00 70.74           C  
ATOM   4190  C   LYS A 534      56.575  20.148   4.162  1.00 70.75           C  
ATOM   4191  O   LYS A 534      57.409  20.856   4.716  1.00 73.20           O  
ATOM   4192  CB  LYS A 534      55.919  22.143   2.756  1.00 71.52           C  
ATOM   4193  CG  LYS A 534      57.103  22.114   1.779  1.00 73.32           C  
ATOM   4194  CD  LYS A 534      56.799  21.248   0.565  1.00 74.81           C  
ATOM   4195  CE  LYS A 534      57.979  21.138  -0.386  1.00 75.59           C  
ATOM   4196  NZ  LYS A 534      57.687  20.141  -1.461  1.00 74.26           N  
ATOM   4197  N   HIS A 535      56.541  18.824   4.293  1.00 69.86           N  
ATOM   4198  CA  HIS A 535      57.514  18.082   5.086  1.00 67.86           C  
ATOM   4199  C   HIS A 535      58.439  17.403   4.100  1.00 67.91           C  
ATOM   4200  O   HIS A 535      58.077  17.226   2.943  1.00 68.65           O  
ATOM   4201  CB  HIS A 535      56.797  17.037   5.936  1.00 70.01           C  
ATOM   4202  CG  HIS A 535      57.714  16.050   6.585  1.00 73.08           C  
ATOM   4203  ND1 HIS A 535      58.672  16.416   7.505  1.00 74.75           N  
ATOM   4204  CD2 HIS A 535      57.826  14.709   6.438  1.00 73.01           C  
ATOM   4205  CE1 HIS A 535      59.337  15.344   7.896  1.00 74.11           C  
ATOM   4206  NE2 HIS A 535      58.843  14.294   7.263  1.00 73.99           N  
ATOM   4207  N   GLU A 536      59.631  17.018   4.530  1.00 69.12           N  
ATOM   4208  CA  GLU A 536      60.543  16.374   3.593  1.00 73.04           C  
ATOM   4209  C   GLU A 536      61.409  15.304   4.213  1.00 73.79           C  
ATOM   4210  O   GLU A 536      62.608  15.230   3.949  1.00 74.61           O  
ATOM   4211  CB  GLU A 536      61.456  17.405   2.929  1.00 76.77           C  
ATOM   4212  CG  GLU A 536      61.584  17.245   1.424  1.00 77.26           C  
ATOM   4213  CD  GLU A 536      60.504  17.999   0.694  1.00 81.09           C  
ATOM   4214  OE1 GLU A 536      60.600  19.246   0.636  1.00 81.79           O  
ATOM   4215  OE2 GLU A 536      59.555  17.353   0.195  1.00 82.78           O  
ATOM   4216  N   GLY A 537      60.805  14.473   5.040  1.00 74.78           N  
ATOM   4217  CA  GLY A 537      61.554  13.403   5.663  1.00 77.07           C  
ATOM   4218  C   GLY A 537      60.563  12.294   5.885  1.00 77.92           C  
ATOM   4219  O   GLY A 537      59.442  12.366   5.376  1.00 80.70           O  
ATOM   4220  N   PRO A 538      60.943  11.237   6.601  1.00 76.63           N  
ATOM   4221  CA  PRO A 538      59.961  10.175   6.817  1.00 76.64           C  
ATOM   4222  C   PRO A 538      58.909  10.792   7.733  1.00 75.45           C  
ATOM   4223  O   PRO A 538      59.211  11.747   8.453  1.00 75.10           O  
ATOM   4224  CB  PRO A 538      60.782   9.091   7.503  1.00 78.36           C  
ATOM   4225  CG  PRO A 538      62.151   9.293   6.913  1.00 77.57           C  
ATOM   4226  CD  PRO A 538      62.291  10.797   6.978  1.00 77.05           C  
ATOM   4227  N   LEU A 539      57.685  10.279   7.716  1.00 72.92           N  
ATOM   4228  CA  LEU A 539      56.663  10.879   8.565  1.00 72.66           C  
ATOM   4229  C   LEU A 539      56.936  10.792  10.062  1.00 74.21           C  
ATOM   4230  O   LEU A 539      56.285  11.490  10.846  1.00 75.31           O  
ATOM   4231  CB  LEU A 539      55.264  10.323   8.239  1.00 68.29           C  
ATOM   4232  CG  LEU A 539      55.013   8.864   7.882  1.00 63.02           C  
ATOM   4233  CD1 LEU A 539      53.533   8.668   7.767  1.00 60.90           C  
ATOM   4234  CD2 LEU A 539      55.704   8.498   6.584  1.00 62.34           C  
ATOM   4235  N   HIS A 540      57.895   9.948  10.455  1.00 76.23           N  
ATOM   4236  CA  HIS A 540      58.264   9.794  11.865  1.00 77.69           C  
ATOM   4237  C   HIS A 540      59.306  10.859  12.195  1.00 78.11           C  
ATOM   4238  O   HIS A 540      60.177  10.674  13.033  1.00 80.16           O  
ATOM   4239  CB  HIS A 540      58.830   8.392  12.137  1.00 80.93           C  
ATOM   4240  CG  HIS A 540      60.200   8.157  11.571  1.00 86.76           C  
ATOM   4241  ND1 HIS A 540      60.891   6.980  11.771  1.00 88.79           N  
ATOM   4242  CD2 HIS A 540      61.011   8.942  10.820  1.00 89.21           C  
ATOM   4243  CE1 HIS A 540      62.065   7.050  11.168  1.00 89.83           C  
ATOM   4244  NE2 HIS A 540      62.164   8.230  10.585  1.00 90.61           N  
ATOM   4245  N   LYS A 541      59.205  11.978  11.502  1.00 77.88           N  
ATOM   4246  CA  LYS A 541      60.106  13.095  11.680  1.00 77.60           C  
ATOM   4247  C   LYS A 541      59.235  14.280  11.367  1.00 77.30           C  
ATOM   4248  O   LYS A 541      59.660  15.428  11.418  1.00 76.69           O  
ATOM   4249  CB  LYS A 541      61.238  13.019  10.662  1.00 80.67           C  
ATOM   4250  CG  LYS A 541      62.323  12.023  10.993  1.00 82.18           C  
ATOM   4251  CD  LYS A 541      63.187  12.560  12.104  1.00 82.43           C  
ATOM   4252  CE  LYS A 541      64.423  11.723  12.282  1.00 82.58           C  
ATOM   4253  NZ  LYS A 541      65.284  12.300  13.349  1.00 84.80           N  
ATOM   4254  N   CYS A 542      57.994  13.973  11.037  1.00 78.64           N  
ATOM   4255  CA  CYS A 542      57.036  14.989  10.674  1.00 82.15           C  
ATOM   4256  C   CYS A 542      56.474  15.758  11.859  1.00 81.26           C  
ATOM   4257  O   CYS A 542      55.861  15.191  12.764  1.00 80.29           O  
ATOM   4258  CB  CYS A 542      55.921  14.346   9.854  1.00 85.48           C  
ATOM   4259  SG  CYS A 542      54.428  15.352   9.638  1.00 89.95           S  
ATOM   4260  N   ASP A 543      56.715  17.066  11.829  1.00 81.64           N  
ATOM   4261  CA  ASP A 543      56.263  17.997  12.849  1.00 81.16           C  
ATOM   4262  C   ASP A 543      54.758  18.176  12.730  1.00 80.05           C  
ATOM   4263  O   ASP A 543      54.014  17.393  13.305  1.00 81.00           O  
ATOM   4264  CB  ASP A 543      56.966  19.356  12.698  1.00 85.66           C  
ATOM   4265  CG  ASP A 543      57.728  19.513  11.363  1.00 88.68           C  
ATOM   4266  OD1 ASP A 543      58.234  20.631  11.117  1.00 89.15           O  
ATOM   4267  OD2 ASP A 543      57.840  18.550  10.566  1.00 89.27           O  
ATOM   4268  N   ILE A 544      54.333  19.198  11.979  1.00 77.57           N  
ATOM   4269  CA  ILE A 544      52.917  19.534  11.715  1.00 75.70           C  
ATOM   4270  C   ILE A 544      52.402  20.655  12.607  1.00 75.57           C  
ATOM   4271  O   ILE A 544      51.277  21.124  12.443  1.00 72.55           O  
ATOM   4272  CB  ILE A 544      51.963  18.322  11.901  1.00 74.84           C  
ATOM   4273  CG1 ILE A 544      50.725  18.474  11.023  1.00 73.07           C  
ATOM   4274  CG2 ILE A 544      51.430  18.294  13.335  1.00 78.29           C  
ATOM   4275  CD1 ILE A 544      49.508  18.985  11.783  1.00 69.18           C  
ATOM   4276  N   SER A 545      53.230  21.086  13.552  1.00 77.25           N  
ATOM   4277  CA  SER A 545      52.837  22.144  14.469  1.00 77.83           C  
ATOM   4278  C   SER A 545      52.948  23.516  13.782  1.00 77.97           C  
ATOM   4279  O   SER A 545      53.825  23.721  12.942  1.00 76.52           O  
ATOM   4280  CB  SER A 545      53.714  22.077  15.732  1.00 76.89           C  
ATOM   4281  OG  SER A 545      53.004  22.516  16.886  1.00 75.66           O  
ATOM   4282  N   ASN A 546      52.037  24.431  14.128  1.00 78.50           N  
ATOM   4283  CA  ASN A 546      51.999  25.796  13.581  1.00 79.01           C  
ATOM   4284  C   ASN A 546      51.452  25.914  12.158  1.00 79.42           C  
ATOM   4285  O   ASN A 546      51.158  27.019  11.687  1.00 79.39           O  
ATOM   4286  CB  ASN A 546      53.393  26.441  13.644  1.00 77.67           C  
ATOM   4287  CG  ASN A 546      53.771  26.877  15.046  1.00 75.19           C  
ATOM   4288  OD1 ASN A 546      54.892  26.639  15.503  1.00 73.31           O  
ATOM   4289  ND2 ASN A 546      52.836  27.526  15.736  1.00 72.61           N  
ATOM   4290  N   SER A 547      51.310  24.776  11.484  1.00 79.08           N  
ATOM   4291  CA  SER A 547      50.809  24.739  10.112  1.00 77.75           C  
ATOM   4292  C   SER A 547      49.294  24.781  10.024  1.00 76.37           C  
ATOM   4293  O   SER A 547      48.639  23.796  10.364  1.00 75.90           O  
ATOM   4294  CB  SER A 547      51.300  23.470   9.414  1.00 78.23           C  
ATOM   4295  OG  SER A 547      50.535  23.200   8.254  1.00 79.95           O  
ATOM   4296  N   THR A 548      48.739  25.911   9.576  1.00 74.38           N  
ATOM   4297  CA  THR A 548      47.287  26.027   9.422  1.00 72.42           C  
ATOM   4298  C   THR A 548      46.968  25.328   8.113  1.00 72.73           C  
ATOM   4299  O   THR A 548      45.841  24.888   7.867  1.00 70.15           O  
ATOM   4300  CB  THR A 548      46.819  27.480   9.340  1.00 69.20           C  
ATOM   4301  OG1 THR A 548      47.559  28.160   8.324  1.00 69.49           O  
ATOM   4302  CG2 THR A 548      47.008  28.170  10.672  1.00 67.57           C  
ATOM   4303  N   GLU A 549      47.993  25.225   7.277  1.00 72.61           N  
ATOM   4304  CA  GLU A 549      47.865  24.546   6.009  1.00 74.47           C  
ATOM   4305  C   GLU A 549      47.328  23.178   6.390  1.00 74.19           C  
ATOM   4306  O   GLU A 549      46.442  22.636   5.730  1.00 77.32           O  
ATOM   4307  CB  GLU A 549      49.237  24.420   5.351  1.00 77.11           C  
ATOM   4308  CG  GLU A 549      49.980  25.740   5.301  1.00 83.15           C  
ATOM   4309  CD  GLU A 549      49.068  26.886   4.895  1.00 87.31           C  
ATOM   4310  OE1 GLU A 549      48.492  26.816   3.789  1.00 91.21           O  
ATOM   4311  OE2 GLU A 549      48.916  27.852   5.679  1.00 88.69           O  
ATOM   4312  N   ALA A 550      47.866  22.648   7.487  1.00 71.78           N  
ATOM   4313  CA  ALA A 550      47.475  21.347   8.023  1.00 68.40           C  
ATOM   4314  C   ALA A 550      46.214  21.460   8.883  1.00 65.40           C  
ATOM   4315  O   ALA A 550      45.212  20.792   8.639  1.00 62.29           O  
ATOM   4316  CB  ALA A 550      48.618  20.766   8.848  1.00 65.84           C  
ATOM   4317  N   GLY A 551      46.269  22.298   9.905  1.00 65.60           N  
ATOM   4318  CA  GLY A 551      45.107  22.456  10.747  1.00 66.53           C  
ATOM   4319  C   GLY A 551      43.889  22.644   9.873  1.00 68.29           C  
ATOM   4320  O   GLY A 551      42.913  21.889   9.976  1.00 65.11           O  
ATOM   4321  N   GLN A 552      43.969  23.640   8.988  1.00 70.54           N  
ATOM   4322  CA  GLN A 552      42.874  23.971   8.078  1.00 72.08           C  
ATOM   4323  C   GLN A 552      42.327  22.740   7.380  1.00 70.50           C  
ATOM   4324  O   GLN A 552      41.149  22.415   7.528  1.00 69.99           O  
ATOM   4325  CB  GLN A 552      43.324  24.993   7.031  1.00 73.81           C  
ATOM   4326  CG  GLN A 552      42.199  25.500   6.118  1.00 77.97           C  
ATOM   4327  CD  GLN A 552      41.061  26.194   6.873  1.00 79.38           C  
ATOM   4328  OE1 GLN A 552      41.259  27.227   7.531  1.00 79.26           O  
ATOM   4329  NE2 GLN A 552      39.861  25.629   6.771  1.00 76.28           N  
ATOM   4330  N   LYS A 553      43.178  22.058   6.620  1.00 68.26           N  
ATOM   4331  CA  LYS A 553      42.742  20.859   5.923  1.00 65.21           C  
ATOM   4332  C   LYS A 553      41.882  20.033   6.884  1.00 65.78           C  
ATOM   4333  O   LYS A 553      40.653  20.033   6.786  1.00 66.25           O  
ATOM   4334  CB  LYS A 553      43.948  20.044   5.427  1.00 59.28           C  
ATOM   4335  CG  LYS A 553      43.555  18.897   4.522  1.00 57.67           C  
ATOM   4336  CD  LYS A 553      44.737  18.230   3.834  1.00 61.01           C  
ATOM   4337  CE  LYS A 553      44.264  17.036   2.967  1.00 64.68           C  
ATOM   4338  NZ  LYS A 553      45.351  16.318   2.214  1.00 62.42           N  
ATOM   4339  N   LEU A 554      42.521  19.357   7.831  1.00 65.32           N  
ATOM   4340  CA  LEU A 554      41.792  18.537   8.789  1.00 65.14           C  
ATOM   4341  C   LEU A 554      40.494  19.187   9.255  1.00 66.84           C  
ATOM   4342  O   LEU A 554      39.489  18.505   9.439  1.00 65.77           O  
ATOM   4343  CB  LEU A 554      42.662  18.250  10.010  1.00 64.48           C  
ATOM   4344  CG  LEU A 554      42.017  17.404  11.109  1.00 57.54           C  
ATOM   4345  CD1 LEU A 554      41.942  15.963  10.666  1.00 50.07           C  
ATOM   4346  CD2 LEU A 554      42.823  17.544  12.381  1.00 54.10           C  
ATOM   4347  N   PHE A 555      40.514  20.504   9.451  1.00 68.99           N  
ATOM   4348  CA  PHE A 555      39.313  21.206   9.910  1.00 69.83           C  
ATOM   4349  C   PHE A 555      38.140  20.961   8.973  1.00 67.50           C  
ATOM   4350  O   PHE A 555      37.066  20.523   9.395  1.00 65.39           O  
ATOM   4351  CB  PHE A 555      39.549  22.720   9.997  1.00 71.70           C  
ATOM   4352  CG  PHE A 555      38.492  23.441  10.782  1.00 73.23           C  
ATOM   4353  CD1 PHE A 555      37.150  23.248  10.498  1.00 71.72           C  
ATOM   4354  CD2 PHE A 555      38.836  24.251  11.846  1.00 76.25           C  
ATOM   4355  CE1 PHE A 555      36.174  23.838  11.257  1.00 72.09           C  
ATOM   4356  CE2 PHE A 555      37.860  24.848  12.613  1.00 77.96           C  
ATOM   4357  CZ  PHE A 555      36.524  24.637  12.317  1.00 76.01           C  
ATOM   4358  N   ASN A 556      38.371  21.270   7.702  1.00 65.61           N  
ATOM   4359  CA  ASN A 556      37.387  21.121   6.641  1.00 65.04           C  
ATOM   4360  C   ASN A 556      36.866  19.687   6.588  1.00 65.18           C  
ATOM   4361  O   ASN A 556      35.915  19.390   5.865  1.00 64.16           O  
ATOM   4362  CB  ASN A 556      38.033  21.505   5.304  1.00 63.99           C  
ATOM   4363  CG  ASN A 556      38.715  22.865   5.358  1.00 62.78           C  
ATOM   4364  OD1 ASN A 556      39.738  23.090   4.713  1.00 62.56           O  
ATOM   4365  ND2 ASN A 556      38.146  23.778   6.126  1.00 61.54           N  
ATOM   4366  N   MET A 557      37.502  18.813   7.368  1.00 66.07           N  
ATOM   4367  CA  MET A 557      37.154  17.393   7.461  1.00 64.71           C  
ATOM   4368  C   MET A 557      36.273  17.097   8.663  1.00 62.01           C  
ATOM   4369  O   MET A 557      35.224  16.470   8.548  1.00 59.24           O  
ATOM   4370  CB  MET A 557      38.430  16.554   7.571  1.00 66.91           C  
ATOM   4371  CG  MET A 557      38.270  15.263   8.361  1.00 71.78           C  
ATOM   4372  SD  MET A 557      37.121  14.117   7.587  1.00 82.41           S  
ATOM   4373  CE  MET A 557      35.837  13.940   8.877  1.00 79.35           C  
ATOM   4374  N   LEU A 558      36.725  17.552   9.821  1.00 62.46           N  
ATOM   4375  CA  LEU A 558      36.017  17.335  11.068  1.00 64.13           C  
ATOM   4376  C   LEU A 558      34.605  17.887  11.059  1.00 65.24           C  
ATOM   4377  O   LEU A 558      33.662  17.221  11.496  1.00 65.17           O  
ATOM   4378  CB  LEU A 558      36.784  17.981  12.223  1.00 65.88           C  
ATOM   4379  CG  LEU A 558      38.017  17.299  12.807  1.00 65.36           C  
ATOM   4380  CD1 LEU A 558      38.959  16.926  11.705  1.00 68.94           C  
ATOM   4381  CD2 LEU A 558      38.690  18.234  13.791  1.00 66.40           C  
ATOM   4382  N   ARG A 559      34.461  19.109  10.561  1.00 66.02           N  
ATOM   4383  CA  ARG A 559      33.161  19.757  10.549  1.00 65.14           C  
ATOM   4384  C   ARG A 559      32.018  19.001   9.891  1.00 62.49           C  
ATOM   4385  O   ARG A 559      30.883  19.142  10.328  1.00 66.65           O  
ATOM   4386  CB  ARG A 559      33.282  21.167   9.970  1.00 66.63           C  
ATOM   4387  CG  ARG A 559      34.164  21.265   8.761  1.00 76.33           C  
ATOM   4388  CD  ARG A 559      33.497  20.678   7.532  1.00 83.17           C  
ATOM   4389  NE  ARG A 559      33.331  21.681   6.480  1.00 89.63           N  
ATOM   4390  CZ  ARG A 559      32.525  22.737   6.566  1.00 90.87           C  
ATOM   4391  NH1 ARG A 559      31.796  22.938   7.659  1.00 88.82           N  
ATOM   4392  NH2 ARG A 559      32.453  23.598   5.558  1.00 91.69           N  
ATOM   4393  N   LEU A 560      32.289  18.185   8.878  1.00 56.16           N  
ATOM   4394  CA  LEU A 560      31.207  17.457   8.227  1.00 54.42           C  
ATOM   4395  C   LEU A 560      30.436  16.461   9.108  1.00 55.28           C  
ATOM   4396  O   LEU A 560      29.481  15.850   8.628  1.00 56.29           O  
ATOM   4397  CB  LEU A 560      31.710  16.704   6.992  1.00 56.47           C  
ATOM   4398  CG  LEU A 560      32.392  17.393   5.800  1.00 60.42           C  
ATOM   4399  CD1 LEU A 560      31.621  18.621   5.334  1.00 60.42           C  
ATOM   4400  CD2 LEU A 560      33.784  17.778   6.209  1.00 65.12           C  
ATOM   4401  N   GLY A 561      30.832  16.290  10.374  1.00 53.79           N  
ATOM   4402  CA  GLY A 561      30.144  15.345  11.253  1.00 49.99           C  
ATOM   4403  C   GLY A 561      30.099  13.963  10.622  1.00 50.22           C  
ATOM   4404  O   GLY A 561      31.102  13.505  10.090  1.00 48.80           O  
ATOM   4405  N   LYS A 562      28.951  13.292  10.686  1.00 52.23           N  
ATOM   4406  CA  LYS A 562      28.786  11.973  10.065  1.00 56.02           C  
ATOM   4407  C   LYS A 562      27.743  12.084   8.959  1.00 58.84           C  
ATOM   4408  O   LYS A 562      26.863  11.228   8.815  1.00 58.59           O  
ATOM   4409  CB  LYS A 562      28.318  10.927  11.075  1.00 56.55           C  
ATOM   4410  CG  LYS A 562      28.404   9.483  10.551  1.00 56.02           C  
ATOM   4411  CD  LYS A 562      28.264   8.477  11.687  1.00 56.71           C  
ATOM   4412  CE  LYS A 562      29.249   7.325  11.567  1.00 53.56           C  
ATOM   4413  NZ  LYS A 562      29.295   6.522  12.817  1.00 54.82           N  
ATOM   4414  N   SER A 563      27.857  13.154   8.184  1.00 58.36           N  
ATOM   4415  CA  SER A 563      26.944  13.425   7.094  1.00 59.68           C  
ATOM   4416  C   SER A 563      27.645  13.201   5.764  1.00 60.08           C  
ATOM   4417  O   SER A 563      27.443  13.950   4.814  1.00 60.75           O  
ATOM   4418  CB  SER A 563      26.479  14.871   7.178  1.00 60.54           C  
ATOM   4419  OG  SER A 563      27.584  15.742   7.023  1.00 62.92           O  
ATOM   4420  N   GLU A 564      28.477  12.174   5.700  1.00 60.01           N  
ATOM   4421  CA  GLU A 564      29.214  11.872   4.479  1.00 60.46           C  
ATOM   4422  C   GLU A 564      29.930  10.565   4.745  1.00 61.78           C  
ATOM   4423  O   GLU A 564      30.764  10.486   5.643  1.00 63.41           O  
ATOM   4424  CB  GLU A 564      30.244  12.963   4.194  1.00 59.16           C  
ATOM   4425  CG  GLU A 564      30.036  13.708   2.896  1.00 62.77           C  
ATOM   4426  CD  GLU A 564      31.234  14.576   2.518  1.00 65.93           C  
ATOM   4427  OE1 GLU A 564      32.350  14.041   2.362  1.00 65.48           O  
ATOM   4428  OE2 GLU A 564      31.065  15.800   2.371  1.00 69.19           O  
ATOM   4429  N   PRO A 565      29.611   9.517   3.974  1.00 61.48           N  
ATOM   4430  CA  PRO A 565      30.262   8.220   4.182  1.00 59.95           C  
ATOM   4431  C   PRO A 565      31.750   8.417   4.432  1.00 57.50           C  
ATOM   4432  O   PRO A 565      32.414   9.143   3.688  1.00 55.37           O  
ATOM   4433  CB  PRO A 565      29.967   7.481   2.883  1.00 62.43           C  
ATOM   4434  CG  PRO A 565      28.603   8.021   2.523  1.00 62.48           C  
ATOM   4435  CD  PRO A 565      28.771   9.501   2.766  1.00 59.58           C  
ATOM   4436  N   TRP A 566      32.261   7.784   5.490  1.00 55.40           N  
ATOM   4437  CA  TRP A 566      33.671   7.910   5.856  1.00 47.72           C  
ATOM   4438  C   TRP A 566      34.578   7.572   4.710  1.00 46.36           C  
ATOM   4439  O   TRP A 566      35.672   8.124   4.600  1.00 41.49           O  
ATOM   4440  CB  TRP A 566      34.017   7.031   7.059  1.00 43.93           C  
ATOM   4441  CG  TRP A 566      33.781   5.551   6.903  1.00 37.92           C  
ATOM   4442  CD1 TRP A 566      32.697   4.841   7.336  1.00 37.08           C  
ATOM   4443  CD2 TRP A 566      34.694   4.588   6.361  1.00 32.01           C  
ATOM   4444  NE1 TRP A 566      32.886   3.504   7.107  1.00 33.65           N  
ATOM   4445  CE2 TRP A 566      34.106   3.328   6.508  1.00 30.80           C  
ATOM   4446  CE3 TRP A 566      35.955   4.674   5.769  1.00 29.81           C  
ATOM   4447  CZ2 TRP A 566      34.733   2.178   6.087  1.00 25.95           C  
ATOM   4448  CZ3 TRP A 566      36.563   3.535   5.354  1.00 21.43           C  
ATOM   4449  CH2 TRP A 566      35.959   2.308   5.512  1.00 23.93           C  
ATOM   4450  N   THR A 567      34.111   6.667   3.853  1.00 47.03           N  
ATOM   4451  CA  THR A 567      34.881   6.255   2.684  1.00 47.32           C  
ATOM   4452  C   THR A 567      35.139   7.481   1.796  1.00 48.34           C  
ATOM   4453  O   THR A 567      36.265   7.753   1.391  1.00 47.95           O  
ATOM   4454  CB  THR A 567      34.135   5.155   1.887  1.00 42.68           C  
ATOM   4455  OG1 THR A 567      33.796   5.649   0.592  1.00 44.75           O  
ATOM   4456  CG2 THR A 567      32.885   4.743   2.603  1.00 37.30           C  
ATOM   4457  N   LEU A 568      34.089   8.230   1.509  1.00 51.72           N  
ATOM   4458  CA  LEU A 568      34.233   9.429   0.701  1.00 55.18           C  
ATOM   4459  C   LEU A 568      35.105  10.400   1.489  1.00 57.36           C  
ATOM   4460  O   LEU A 568      36.115  10.891   0.988  1.00 59.15           O  
ATOM   4461  CB  LEU A 568      32.859  10.060   0.454  1.00 55.54           C  
ATOM   4462  CG  LEU A 568      32.674  11.163  -0.588  1.00 50.54           C  
ATOM   4463  CD1 LEU A 568      31.349  11.833  -0.296  1.00 51.08           C  
ATOM   4464  CD2 LEU A 568      33.783  12.182  -0.530  1.00 46.31           C  
ATOM   4465  N   ALA A 569      34.700  10.671   2.727  1.00 57.62           N  
ATOM   4466  CA  ALA A 569      35.427  11.588   3.590  1.00 58.56           C  
ATOM   4467  C   ALA A 569      36.905  11.263   3.590  1.00 59.76           C  
ATOM   4468  O   ALA A 569      37.743  12.141   3.403  1.00 60.73           O  
ATOM   4469  CB  ALA A 569      34.889  11.510   4.994  1.00 58.41           C  
ATOM   4470  N   LEU A 570      37.220   9.992   3.801  1.00 60.11           N  
ATOM   4471  CA  LEU A 570      38.605   9.548   3.827  1.00 59.85           C  
ATOM   4472  C   LEU A 570      39.225   9.959   2.509  1.00 60.79           C  
ATOM   4473  O   LEU A 570      40.230  10.661   2.482  1.00 61.44           O  
ATOM   4474  CB  LEU A 570      38.663   8.027   3.987  1.00 57.77           C  
ATOM   4475  CG  LEU A 570      39.805   7.401   4.785  1.00 52.37           C  
ATOM   4476  CD1 LEU A 570      39.500   5.950   5.014  1.00 47.93           C  
ATOM   4477  CD2 LEU A 570      41.097   7.566   4.052  1.00 50.81           C  
ATOM   4478  N   GLU A 571      38.586   9.539   1.420  1.00 62.87           N  
ATOM   4479  CA  GLU A 571      39.038   9.831   0.061  1.00 64.11           C  
ATOM   4480  C   GLU A 571      39.306  11.314  -0.169  1.00 64.86           C  
ATOM   4481  O   GLU A 571      40.316  11.695  -0.762  1.00 62.79           O  
ATOM   4482  CB  GLU A 571      37.994   9.350  -0.945  1.00 63.43           C  
ATOM   4483  CG  GLU A 571      38.576   8.752  -2.213  1.00 66.26           C  
ATOM   4484  CD  GLU A 571      38.072   9.433  -3.467  1.00 68.77           C  
ATOM   4485  OE1 GLU A 571      38.597  10.515  -3.810  1.00 70.10           O  
ATOM   4486  OE2 GLU A 571      37.145   8.886  -4.104  1.00 68.77           O  
ATOM   4487  N   ASN A 572      38.393  12.151   0.301  1.00 67.78           N  
ATOM   4488  CA  ASN A 572      38.541  13.586   0.131  1.00 71.60           C  
ATOM   4489  C   ASN A 572      39.662  14.190   0.968  1.00 73.23           C  
ATOM   4490  O   ASN A 572      40.065  15.336   0.738  1.00 76.20           O  
ATOM   4491  CB  ASN A 572      37.222  14.297   0.446  1.00 72.49           C  
ATOM   4492  CG  ASN A 572      36.366  14.487  -0.780  1.00 73.57           C  
ATOM   4493  OD1 ASN A 572      35.920  13.522  -1.392  1.00 76.31           O  
ATOM   4494  ND2 ASN A 572      36.143  15.738  -1.158  1.00 74.87           N  
ATOM   4495  N   VAL A 573      40.172  13.429   1.935  1.00 71.06           N  
ATOM   4496  CA  VAL A 573      41.237  13.942   2.778  1.00 66.47           C  
ATOM   4497  C   VAL A 573      42.576  13.356   2.392  1.00 65.83           C  
ATOM   4498  O   VAL A 573      43.508  14.094   2.071  1.00 68.49           O  
ATOM   4499  CB  VAL A 573      40.976  13.645   4.249  1.00 63.09           C  
ATOM   4500  CG1 VAL A 573      42.012  14.335   5.095  1.00 63.77           C  
ATOM   4501  CG2 VAL A 573      39.601  14.124   4.634  1.00 65.45           C  
ATOM   4502  N   VAL A 574      42.662  12.030   2.416  1.00 63.82           N  
ATOM   4503  CA  VAL A 574      43.896  11.322   2.083  1.00 63.56           C  
ATOM   4504  C   VAL A 574      43.641  10.309   0.975  1.00 66.85           C  
ATOM   4505  O   VAL A 574      43.004   9.270   1.205  1.00 69.56           O  
ATOM   4506  CB  VAL A 574      44.473  10.567   3.324  1.00 59.91           C  
ATOM   4507  CG1 VAL A 574      44.641  11.520   4.485  1.00 56.23           C  
ATOM   4508  CG2 VAL A 574      43.561   9.433   3.730  1.00 55.27           C  
ATOM   4509  N   GLY A 575      44.131  10.614  -0.226  1.00 65.57           N  
ATOM   4510  CA  GLY A 575      43.948   9.722  -1.368  1.00 64.41           C  
ATOM   4511  C   GLY A 575      42.926   8.592  -1.256  1.00 62.47           C  
ATOM   4512  O   GLY A 575      41.776   8.738  -1.663  1.00 61.25           O  
ATOM   4513  N   ALA A 576      43.348   7.462  -0.698  1.00 60.63           N  
ATOM   4514  CA  ALA A 576      42.487   6.294  -0.547  1.00 59.04           C  
ATOM   4515  C   ALA A 576      41.109   6.570   0.027  1.00 58.72           C  
ATOM   4516  O   ALA A 576      40.892   7.579   0.695  1.00 58.72           O  
ATOM   4517  CB  ALA A 576      43.184   5.243   0.303  1.00 59.36           C  
ATOM   4518  N   LYS A 577      40.190   5.643  -0.245  1.00 58.64           N  
ATOM   4519  CA  LYS A 577      38.813   5.704   0.225  1.00 57.65           C  
ATOM   4520  C   LYS A 577      38.584   4.487   1.112  1.00 60.41           C  
ATOM   4521  O   LYS A 577      37.472   3.969   1.212  1.00 62.55           O  
ATOM   4522  CB  LYS A 577      37.836   5.652  -0.944  1.00 55.15           C  
ATOM   4523  CG  LYS A 577      37.882   4.333  -1.697  1.00 57.76           C  
ATOM   4524  CD  LYS A 577      36.483   3.770  -1.954  1.00 56.16           C  
ATOM   4525  CE  LYS A 577      35.772   4.472  -3.107  1.00 53.94           C  
ATOM   4526  NZ  LYS A 577      36.352   4.135  -4.434  1.00 42.65           N  
ATOM   4527  N   ASN A 578      39.652   4.015   1.741  1.00 62.70           N  
ATOM   4528  CA  ASN A 578      39.555   2.874   2.641  1.00 63.33           C  
ATOM   4529  C   ASN A 578      40.849   2.676   3.425  1.00 62.23           C  
ATOM   4530  O   ASN A 578      41.880   3.262   3.106  1.00 62.70           O  
ATOM   4531  CB  ASN A 578      39.198   1.606   1.860  1.00 64.56           C  
ATOM   4532  CG  ASN A 578      39.000   0.397   2.763  1.00 67.87           C  
ATOM   4533  OD1 ASN A 578      38.355   0.479   3.815  1.00 69.06           O  
ATOM   4534  ND2 ASN A 578      39.546  -0.739   2.348  1.00 67.54           N  
ATOM   4535  N   MET A 579      40.765   1.850   4.460  1.00 60.03           N  
ATOM   4536  CA  MET A 579      41.866   1.535   5.352  1.00 58.41           C  
ATOM   4537  C   MET A 579      43.128   0.987   4.672  1.00 58.37           C  
ATOM   4538  O   MET A 579      43.118  -0.078   4.053  1.00 53.54           O  
ATOM   4539  CB  MET A 579      41.337   0.558   6.385  1.00 61.05           C  
ATOM   4540  CG  MET A 579      42.247   0.243   7.525  1.00 64.98           C  
ATOM   4541  SD  MET A 579      41.331  -0.814   8.657  1.00 70.96           S  
ATOM   4542  CE  MET A 579      40.783  -2.111   7.519  1.00 68.74           C  
ATOM   4543  N   ASN A 580      44.220   1.734   4.815  1.00 61.89           N  
ATOM   4544  CA  ASN A 580      45.517   1.385   4.229  1.00 64.25           C  
ATOM   4545  C   ASN A 580      46.558   1.123   5.315  1.00 63.77           C  
ATOM   4546  O   ASN A 580      46.822   1.983   6.155  1.00 63.21           O  
ATOM   4547  CB  ASN A 580      46.012   2.527   3.338  1.00 67.32           C  
ATOM   4548  CG  ASN A 580      47.256   2.158   2.551  1.00 73.13           C  
ATOM   4549  OD1 ASN A 580      47.864   3.009   1.886  1.00 75.30           O  
ATOM   4550  ND2 ASN A 580      47.639   0.881   2.612  1.00 74.28           N  
ATOM   4551  N   VAL A 581      47.163  -0.060   5.276  1.00 62.18           N  
ATOM   4552  CA  VAL A 581      48.165  -0.434   6.264  1.00 58.97           C  
ATOM   4553  C   VAL A 581      49.560   0.090   5.920  1.00 59.62           C  
ATOM   4554  O   VAL A 581      50.352   0.366   6.813  1.00 61.40           O  
ATOM   4555  CB  VAL A 581      48.235  -1.976   6.428  1.00 54.04           C  
ATOM   4556  CG1 VAL A 581      49.504  -2.511   5.809  1.00 54.41           C  
ATOM   4557  CG2 VAL A 581      48.174  -2.346   7.878  1.00 49.36           C  
ATOM   4558  N   ARG A 582      49.852   0.247   4.635  1.00 59.33           N  
ATOM   4559  CA  ARG A 582      51.170   0.704   4.205  1.00 61.97           C  
ATOM   4560  C   ARG A 582      51.736   2.008   4.781  1.00 62.20           C  
ATOM   4561  O   ARG A 582      52.924   2.088   5.060  1.00 61.37           O  
ATOM   4562  CB  ARG A 582      51.237   0.768   2.676  1.00 65.71           C  
ATOM   4563  CG  ARG A 582      51.880  -0.448   2.014  1.00 69.26           C  
ATOM   4564  CD  ARG A 582      50.994  -1.697   2.066  1.00 77.03           C  
ATOM   4565  NE  ARG A 582      49.717  -1.534   1.353  1.00 83.46           N  
ATOM   4566  CZ  ARG A 582      49.056  -2.515   0.730  1.00 82.95           C  
ATOM   4567  NH1 ARG A 582      49.544  -3.751   0.710  1.00 82.19           N  
ATOM   4568  NH2 ARG A 582      47.896  -2.264   0.129  1.00 81.21           N  
ATOM   4569  N   PRO A 583      50.918   3.054   4.953  1.00 64.12           N  
ATOM   4570  CA  PRO A 583      51.602   4.226   5.509  1.00 64.23           C  
ATOM   4571  C   PRO A 583      52.160   3.905   6.892  1.00 62.24           C  
ATOM   4572  O   PRO A 583      53.156   4.491   7.317  1.00 63.07           O  
ATOM   4573  CB  PRO A 583      50.507   5.297   5.533  1.00 63.58           C  
ATOM   4574  CG  PRO A 583      49.280   4.491   5.808  1.00 68.71           C  
ATOM   4575  CD  PRO A 583      49.459   3.259   4.912  1.00 67.21           C  
ATOM   4576  N   LEU A 584      51.518   2.971   7.590  1.00 60.25           N  
ATOM   4577  CA  LEU A 584      51.996   2.581   8.910  1.00 59.93           C  
ATOM   4578  C   LEU A 584      53.305   1.834   8.701  1.00 59.78           C  
ATOM   4579  O   LEU A 584      54.339   2.224   9.239  1.00 63.02           O  
ATOM   4580  CB  LEU A 584      50.982   1.687   9.634  1.00 56.58           C  
ATOM   4581  CG  LEU A 584      51.413   1.265  11.043  1.00 53.87           C  
ATOM   4582  CD1 LEU A 584      50.210   0.979  11.910  1.00 52.08           C  
ATOM   4583  CD2 LEU A 584      52.309   0.052  10.951  1.00 51.96           C  
ATOM   4584  N   LEU A 585      53.257   0.768   7.905  1.00 57.13           N  
ATOM   4585  CA  LEU A 585      54.441  -0.023   7.599  1.00 53.53           C  
ATOM   4586  C   LEU A 585      55.607   0.874   7.203  1.00 54.70           C  
ATOM   4587  O   LEU A 585      56.757   0.499   7.371  1.00 56.19           O  
ATOM   4588  CB  LEU A 585      54.142  -1.005   6.465  1.00 48.69           C  
ATOM   4589  CG  LEU A 585      53.679  -2.422   6.815  1.00 48.69           C  
ATOM   4590  CD1 LEU A 585      52.842  -2.423   8.064  1.00 46.22           C  
ATOM   4591  CD2 LEU A 585      52.903  -3.000   5.637  1.00 51.39           C  
ATOM   4592  N   ASN A 586      55.302   2.059   6.681  1.00 57.36           N  
ATOM   4593  CA  ASN A 586      56.324   3.018   6.254  1.00 60.56           C  
ATOM   4594  C   ASN A 586      56.928   3.755   7.438  1.00 60.17           C  
ATOM   4595  O   ASN A 586      58.122   4.077   7.451  1.00 57.50           O  
ATOM   4596  CB  ASN A 586      55.720   4.042   5.287  1.00 65.02           C  
ATOM   4597  CG  ASN A 586      55.753   3.576   3.841  1.00 69.76           C  
ATOM   4598  OD1 ASN A 586      55.038   4.111   2.985  1.00 73.75           O  
ATOM   4599  ND2 ASN A 586      56.592   2.584   3.558  1.00 70.31           N  
ATOM   4600  N   TYR A 587      56.080   4.035   8.420  1.00 59.76           N  
ATOM   4601  CA  TYR A 587      56.499   4.727   9.630  1.00 60.74           C  
ATOM   4602  C   TYR A 587      57.536   3.854  10.322  1.00 61.73           C  
ATOM   4603  O   TYR A 587      58.630   4.300  10.664  1.00 65.05           O  
ATOM   4604  CB  TYR A 587      55.300   4.907  10.557  1.00 57.76           C  
ATOM   4605  CG  TYR A 587      55.517   5.833  11.733  1.00 54.77           C  
ATOM   4606  CD1 TYR A 587      55.322   7.189  11.610  1.00 53.53           C  
ATOM   4607  CD2 TYR A 587      55.833   5.334  12.986  1.00 54.07           C  
ATOM   4608  CE1 TYR A 587      55.418   8.016  12.703  1.00 54.75           C  
ATOM   4609  CE2 TYR A 587      55.935   6.153  14.082  1.00 50.17           C  
ATOM   4610  CZ  TYR A 587      55.717   7.493  13.936  1.00 51.96           C  
ATOM   4611  OH  TYR A 587      55.722   8.313  15.032  1.00 52.36           O  
ATOM   4612  N   PHE A 588      57.184   2.594  10.504  1.00 59.70           N  
ATOM   4613  CA  PHE A 588      58.054   1.665  11.179  1.00 59.97           C  
ATOM   4614  C   PHE A 588      59.002   0.896  10.274  1.00 64.19           C  
ATOM   4615  O   PHE A 588      59.562  -0.106  10.712  1.00 68.84           O  
ATOM   4616  CB  PHE A 588      57.213   0.671  11.978  1.00 56.72           C  
ATOM   4617  CG  PHE A 588      56.392   1.298  13.060  1.00 49.45           C  
ATOM   4618  CD1 PHE A 588      55.121   0.849  13.319  1.00 46.47           C  
ATOM   4619  CD2 PHE A 588      56.896   2.324  13.824  1.00 51.92           C  
ATOM   4620  CE1 PHE A 588      54.358   1.410  14.314  1.00 47.24           C  
ATOM   4621  CE2 PHE A 588      56.135   2.890  14.826  1.00 52.34           C  
ATOM   4622  CZ  PHE A 588      54.859   2.428  15.068  1.00 48.46           C  
ATOM   4623  N   GLU A 589      59.200   1.319   9.027  1.00 66.83           N  
ATOM   4624  CA  GLU A 589      60.129   0.565   8.172  1.00 69.09           C  
ATOM   4625  C   GLU A 589      61.559   0.604   8.703  1.00 68.70           C  
ATOM   4626  O   GLU A 589      62.268  -0.402   8.639  1.00 69.16           O  
ATOM   4627  CB  GLU A 589      60.123   1.062   6.723  1.00 71.04           C  
ATOM   4628  CG  GLU A 589      59.259   0.220   5.771  1.00 74.46           C  
ATOM   4629  CD  GLU A 589      59.400  -1.290   5.984  1.00 76.34           C  
ATOM   4630  OE1 GLU A 589      58.494  -1.883   6.620  1.00 74.69           O  
ATOM   4631  OE2 GLU A 589      60.408  -1.879   5.521  1.00 74.78           O  
ATOM   4632  N   PRO A 590      62.006   1.767   9.225  1.00 67.44           N  
ATOM   4633  CA  PRO A 590      63.367   1.888   9.765  1.00 65.10           C  
ATOM   4634  C   PRO A 590      63.563   0.945  10.952  1.00 62.29           C  
ATOM   4635  O   PRO A 590      64.529   0.197  11.011  1.00 61.65           O  
ATOM   4636  CB  PRO A 590      63.446   3.358  10.179  1.00 65.29           C  
ATOM   4637  CG  PRO A 590      62.515   4.028   9.237  1.00 65.69           C  
ATOM   4638  CD  PRO A 590      61.340   3.082   9.211  1.00 65.71           C  
ATOM   4639  N   LEU A 591      62.623   0.996  11.886  1.00 61.87           N  
ATOM   4640  CA  LEU A 591      62.636   0.163  13.076  1.00 62.91           C  
ATOM   4641  C   LEU A 591      62.505  -1.313  12.743  1.00 63.21           C  
ATOM   4642  O   LEU A 591      63.054  -2.159  13.439  1.00 66.76           O  
ATOM   4643  CB  LEU A 591      61.477   0.541  13.990  1.00 64.92           C  
ATOM   4644  CG  LEU A 591      61.227  -0.404  15.164  1.00 66.27           C  
ATOM   4645  CD1 LEU A 591      62.250  -0.139  16.260  1.00 68.25           C  
ATOM   4646  CD2 LEU A 591      59.837  -0.181  15.694  1.00 67.67           C  
ATOM   4647  N   PHE A 592      61.758  -1.626  11.694  1.00 60.22           N  
ATOM   4648  CA  PHE A 592      61.558  -3.010  11.300  1.00 58.24           C  
ATOM   4649  C   PHE A 592      62.864  -3.657  10.849  1.00 62.31           C  
ATOM   4650  O   PHE A 592      63.329  -4.622  11.451  1.00 63.49           O  
ATOM   4651  CB  PHE A 592      60.535  -3.068  10.176  1.00 52.42           C  
ATOM   4652  CG  PHE A 592      60.140  -4.460   9.769  1.00 47.56           C  
ATOM   4653  CD1 PHE A 592      59.566  -5.327  10.677  1.00 49.37           C  
ATOM   4654  CD2 PHE A 592      60.275  -4.873   8.457  1.00 43.06           C  
ATOM   4655  CE1 PHE A 592      59.128  -6.575  10.278  1.00 45.84           C  
ATOM   4656  CE2 PHE A 592      59.843  -6.104   8.062  1.00 40.13           C  
ATOM   4657  CZ  PHE A 592      59.267  -6.956   8.971  1.00 43.99           C  
ATOM   4658  N   THR A 593      63.461  -3.117   9.791  1.00 65.65           N  
ATOM   4659  CA  THR A 593      64.705  -3.661   9.257  1.00 68.48           C  
ATOM   4660  C   THR A 593      65.795  -3.830  10.323  1.00 71.99           C  
ATOM   4661  O   THR A 593      66.657  -4.704  10.195  1.00 72.64           O  
ATOM   4662  CB  THR A 593      65.235  -2.791   8.076  1.00 66.66           C  
ATOM   4663  OG1 THR A 593      65.270  -1.410   8.457  1.00 63.58           O  
ATOM   4664  CG2 THR A 593      64.334  -2.945   6.857  1.00 66.54           C  
ATOM   4665  N   TRP A 594      65.739  -2.997  11.365  1.00 73.85           N  
ATOM   4666  CA  TRP A 594      66.691  -3.023  12.483  1.00 75.81           C  
ATOM   4667  C   TRP A 594      66.298  -4.162  13.415  1.00 77.31           C  
ATOM   4668  O   TRP A 594      67.157  -4.871  13.934  1.00 79.50           O  
ATOM   4669  CB  TRP A 594      66.633  -1.695  13.239  1.00 77.69           C  
ATOM   4670  CG  TRP A 594      67.494  -1.571  14.486  1.00 79.64           C  
ATOM   4671  CD1 TRP A 594      68.716  -0.967  14.581  1.00 80.82           C  
ATOM   4672  CD2 TRP A 594      67.132  -1.944  15.827  1.00 80.51           C  
ATOM   4673  NE1 TRP A 594      69.130  -0.927  15.894  1.00 80.64           N  
ATOM   4674  CE2 TRP A 594      68.177  -1.521  16.677  1.00 80.21           C  
ATOM   4675  CE3 TRP A 594      66.025  -2.586  16.390  1.00 79.92           C  
ATOM   4676  CZ2 TRP A 594      68.145  -1.719  18.053  1.00 79.49           C  
ATOM   4677  CZ3 TRP A 594      65.997  -2.780  17.756  1.00 80.32           C  
ATOM   4678  CH2 TRP A 594      67.049  -2.348  18.573  1.00 79.48           C  
ATOM   4679  N   LEU A 595      64.994  -4.315  13.643  1.00 76.62           N  
ATOM   4680  CA  LEU A 595      64.490  -5.392  14.483  1.00 76.17           C  
ATOM   4681  C   LEU A 595      64.940  -6.655  13.785  1.00 78.51           C  
ATOM   4682  O   LEU A 595      65.197  -7.673  14.417  1.00 79.89           O  
ATOM   4683  CB  LEU A 595      62.963  -5.383  14.540  1.00 74.44           C  
ATOM   4684  CG  LEU A 595      62.299  -4.920  15.831  1.00 73.58           C  
ATOM   4685  CD1 LEU A 595      62.614  -3.462  16.082  1.00 73.40           C  
ATOM   4686  CD2 LEU A 595      60.807  -5.125  15.724  1.00 73.39           C  
ATOM   4687  N   LYS A 596      65.018  -6.577  12.461  1.00 80.98           N  
ATOM   4688  CA  LYS A 596      65.454  -7.703  11.653  1.00 82.54           C  
ATOM   4689  C   LYS A 596      66.849  -8.073  12.150  1.00 84.83           C  
ATOM   4690  O   LYS A 596      67.095  -9.215  12.538  1.00 84.02           O  
ATOM   4691  CB  LYS A 596      65.497  -7.300  10.174  1.00 80.81           C  
ATOM   4692  CG  LYS A 596      64.151  -6.831   9.610  1.00 79.01           C  
ATOM   4693  CD  LYS A 596      63.201  -7.986   9.272  1.00 74.32           C  
ATOM   4694  CE  LYS A 596      63.268  -8.363   7.792  1.00 70.89           C  
ATOM   4695  NZ  LYS A 596      62.986  -7.195   6.907  1.00 64.48           N  
ATOM   4696  N   ASP A 597      67.751  -7.092  12.151  1.00 87.72           N  
ATOM   4697  CA  ASP A 597      69.117  -7.299  12.622  1.00 89.53           C  
ATOM   4698  C   ASP A 597      69.082  -7.819  14.042  1.00 89.20           C  
ATOM   4699  O   ASP A 597      69.183  -9.017  14.264  1.00 90.80           O  
ATOM   4700  CB  ASP A 597      69.914  -5.994  12.575  1.00 93.45           C  
ATOM   4701  CG  ASP A 597      70.858  -5.934  11.384  1.00100.93           C  
ATOM   4702  OD1 ASP A 597      71.838  -6.714  11.372  1.00104.12           O  
ATOM   4703  OD2 ASP A 597      70.620  -5.122  10.457  1.00104.52           O  
ATOM   4704  N   GLN A 598      68.926  -6.916  15.002  1.00 86.70           N  
ATOM   4705  CA  GLN A 598      68.875  -7.306  16.400  1.00 83.98           C  
ATOM   4706  C   GLN A 598      68.346  -8.721  16.595  1.00 83.41           C  
ATOM   4707  O   GLN A 598      68.951  -9.513  17.306  1.00 87.10           O  
ATOM   4708  CB  GLN A 598      68.006  -6.330  17.176  1.00 84.89           C  
ATOM   4709  CG  GLN A 598      68.490  -4.905  17.097  1.00 86.63           C  
ATOM   4710  CD  GLN A 598      69.855  -4.729  17.715  1.00 87.54           C  
ATOM   4711  OE1 GLN A 598      70.065  -5.052  18.885  1.00 87.11           O  
ATOM   4712  NE2 GLN A 598      70.795  -4.208  16.933  1.00 87.60           N  
ATOM   4713  N   ASN A 599      67.232  -9.047  15.950  1.00 80.51           N  
ATOM   4714  CA  ASN A 599      66.632 -10.373  16.084  1.00 78.71           C  
ATOM   4715  C   ASN A 599      67.373 -11.523  15.408  1.00 78.52           C  
ATOM   4716  O   ASN A 599      67.127 -12.675  15.746  1.00 77.33           O  
ATOM   4717  CB  ASN A 599      65.192 -10.357  15.557  1.00 79.65           C  
ATOM   4718  CG  ASN A 599      64.173 -10.049  16.630  1.00 79.31           C  
ATOM   4719  OD1 ASN A 599      63.684 -10.944  17.318  1.00 79.76           O  
ATOM   4720  ND2 ASN A 599      63.845  -8.777  16.779  1.00 80.80           N  
ATOM   4721  N   LYS A 600      68.260 -11.222  14.458  1.00 79.96           N  
ATOM   4722  CA  LYS A 600      69.012 -12.252  13.714  1.00 81.45           C  
ATOM   4723  C   LYS A 600      69.308 -13.517  14.500  1.00 83.29           C  
ATOM   4724  O   LYS A 600      69.099 -14.627  14.002  1.00 84.81           O  
ATOM   4725  CB  LYS A 600      70.325 -11.679  13.158  1.00 79.32           C  
ATOM   4726  CG  LYS A 600      71.203 -10.978  14.179  1.00 79.69           C  
ATOM   4727  CD  LYS A 600      72.207 -10.061  13.495  1.00 78.00           C  
ATOM   4728  CE  LYS A 600      72.860  -9.125  14.496  1.00 77.26           C  
ATOM   4729  NZ  LYS A 600      73.830  -8.215  13.826  1.00 79.39           N  
ATOM   4730  N   ASN A 601      69.792 -13.341  15.728  1.00 84.65           N  
ATOM   4731  CA  ASN A 601      70.112 -14.455  16.615  1.00 83.85           C  
ATOM   4732  C   ASN A 601      68.865 -14.968  17.347  1.00 81.25           C  
ATOM   4733  O   ASN A 601      68.652 -16.177  17.448  1.00 81.52           O  
ATOM   4734  CB  ASN A 601      71.182 -14.022  17.628  1.00 88.16           C  
ATOM   4735  CG  ASN A 601      70.842 -12.702  18.318  1.00 93.95           C  
ATOM   4736  OD1 ASN A 601      69.859 -12.605  19.058  1.00 94.91           O  
ATOM   4737  ND2 ASN A 601      71.658 -11.675  18.071  1.00 96.92           N  
ATOM   4738  N   SER A 602      68.040 -14.044  17.837  1.00 77.43           N  
ATOM   4739  CA  SER A 602      66.814 -14.382  18.565  1.00 73.20           C  
ATOM   4740  C   SER A 602      65.740 -15.019  17.654  1.00 71.49           C  
ATOM   4741  O   SER A 602      65.757 -14.836  16.439  1.00 71.70           O  
ATOM   4742  CB  SER A 602      66.277 -13.116  19.241  1.00 71.66           C  
ATOM   4743  OG  SER A 602      65.371 -13.420  20.283  1.00 72.69           O  
ATOM   4744  N   PHE A 603      64.813 -15.768  18.248  1.00 68.48           N  
ATOM   4745  CA  PHE A 603      63.747 -16.448  17.502  1.00 68.01           C  
ATOM   4746  C   PHE A 603      62.509 -15.608  17.239  1.00 71.71           C  
ATOM   4747  O   PHE A 603      61.920 -15.046  18.170  1.00 75.29           O  
ATOM   4748  CB  PHE A 603      63.288 -17.678  18.261  1.00 62.64           C  
ATOM   4749  CG  PHE A 603      62.107 -18.369  17.645  1.00 58.11           C  
ATOM   4750  CD1 PHE A 603      61.014 -18.725  18.423  1.00 57.89           C  
ATOM   4751  CD2 PHE A 603      62.140 -18.786  16.328  1.00 56.98           C  
ATOM   4752  CE1 PHE A 603      59.981 -19.499  17.901  1.00 55.41           C  
ATOM   4753  CE2 PHE A 603      61.109 -19.563  15.802  1.00 56.66           C  
ATOM   4754  CZ  PHE A 603      60.031 -19.920  16.596  1.00 53.85           C  
ATOM   4755  N   VAL A 604      62.089 -15.551  15.978  1.00 72.06           N  
ATOM   4756  CA  VAL A 604      60.898 -14.794  15.615  1.00 69.35           C  
ATOM   4757  C   VAL A 604      59.688 -15.725  15.506  1.00 70.09           C  
ATOM   4758  O   VAL A 604      59.562 -16.513  14.564  1.00 69.47           O  
ATOM   4759  CB  VAL A 604      61.095 -14.044  14.298  1.00 67.16           C  
ATOM   4760  CG1 VAL A 604      59.768 -13.484  13.830  1.00 69.07           C  
ATOM   4761  CG2 VAL A 604      62.106 -12.920  14.490  1.00 65.81           C  
ATOM   4762  N   GLY A 605      58.803 -15.618  16.491  1.00 69.79           N  
ATOM   4763  CA  GLY A 605      57.622 -16.451  16.541  1.00 69.22           C  
ATOM   4764  C   GLY A 605      57.453 -16.909  17.973  1.00 70.54           C  
ATOM   4765  O   GLY A 605      58.282 -16.589  18.824  1.00 71.13           O  
ATOM   4766  N   TRP A 606      56.398 -17.667  18.244  1.00 72.34           N  
ATOM   4767  CA  TRP A 606      56.138 -18.137  19.596  1.00 75.35           C  
ATOM   4768  C   TRP A 606      55.378 -19.463  19.629  1.00 79.30           C  
ATOM   4769  O   TRP A 606      54.758 -19.862  18.640  1.00 77.43           O  
ATOM   4770  CB  TRP A 606      55.347 -17.069  20.358  1.00 73.82           C  
ATOM   4771  CG  TRP A 606      54.046 -16.650  19.673  1.00 71.82           C  
ATOM   4772  CD1 TRP A 606      52.887 -17.385  19.552  1.00 69.99           C  
ATOM   4773  CD2 TRP A 606      53.793 -15.404  19.015  1.00 66.48           C  
ATOM   4774  NE1 TRP A 606      51.940 -16.666  18.862  1.00 64.00           N  
ATOM   4775  CE2 TRP A 606      52.471 -15.449  18.522  1.00 63.85           C  
ATOM   4776  CE3 TRP A 606      54.556 -14.257  18.794  1.00 62.97           C  
ATOM   4777  CZ2 TRP A 606      51.903 -14.394  17.827  1.00 62.99           C  
ATOM   4778  CZ3 TRP A 606      53.992 -13.211  18.105  1.00 64.58           C  
ATOM   4779  CH2 TRP A 606      52.676 -13.284  17.628  1.00 64.56           C  
ATOM   4780  N   SER A 607      55.427 -20.127  20.783  1.00 84.34           N  
ATOM   4781  CA  SER A 607      54.756 -21.410  20.990  1.00 88.93           C  
ATOM   4782  C   SER A 607      53.353 -21.286  21.582  1.00 90.06           C  
ATOM   4783  O   SER A 607      53.154 -20.651  22.615  1.00 90.26           O  
ATOM   4784  CB  SER A 607      55.593 -22.303  21.908  1.00 90.90           C  
ATOM   4785  OG  SER A 607      54.849 -23.443  22.315  1.00 94.31           O  
ATOM   4786  N   THR A 608      52.392 -21.920  20.924  1.00 91.60           N  
ATOM   4787  CA  THR A 608      51.007 -21.903  21.368  1.00 94.32           C  
ATOM   4788  C   THR A 608      50.753 -23.054  22.340  1.00 97.65           C  
ATOM   4789  O   THR A 608      49.601 -23.410  22.609  1.00 97.85           O  
ATOM   4790  CB  THR A 608      50.051 -22.040  20.163  1.00 93.63           C  
ATOM   4791  OG1 THR A 608      48.704 -22.188  20.628  1.00 92.36           O  
ATOM   4792  CG2 THR A 608      50.434 -23.251  19.312  1.00 93.06           C  
ATOM   4793  N   ASP A 609      51.833 -23.634  22.862  1.00100.49           N  
ATOM   4794  CA  ASP A 609      51.728 -24.755  23.795  1.00103.41           C  
ATOM   4795  C   ASP A 609      52.563 -24.572  25.056  1.00103.72           C  
ATOM   4796  O   ASP A 609      52.452 -25.368  25.986  1.00103.42           O  
ATOM   4797  CB  ASP A 609      52.146 -26.071  23.115  1.00105.66           C  
ATOM   4798  CG  ASP A 609      51.034 -26.687  22.266  1.00108.10           C  
ATOM   4799  OD1 ASP A 609      50.712 -26.131  21.192  1.00109.34           O  
ATOM   4800  OD2 ASP A 609      50.483 -27.734  22.678  1.00107.49           O  
ATOM   4801  N   TRP A 610      53.393 -23.533  25.087  1.00105.10           N  
ATOM   4802  CA  TRP A 610      54.251 -23.262  26.243  1.00107.17           C  
ATOM   4803  C   TRP A 610      53.448 -23.200  27.540  1.00108.50           C  
ATOM   4804  O   TRP A 610      52.402 -23.834  27.669  1.00108.50           O  
ATOM   4805  CB  TRP A 610      55.010 -21.934  26.056  1.00108.13           C  
ATOM   4806  CG  TRP A 610      56.125 -21.712  27.063  1.00107.78           C  
ATOM   4807  CD1 TRP A 610      57.258 -22.457  27.200  1.00108.00           C  
ATOM   4808  CD2 TRP A 610      56.180 -20.712  28.091  1.00107.60           C  
ATOM   4809  NE1 TRP A 610      58.011 -21.989  28.247  1.00107.62           N  
ATOM   4810  CE2 TRP A 610      57.372 -20.918  28.811  1.00107.72           C  
ATOM   4811  CE3 TRP A 610      55.338 -19.665  28.472  1.00107.73           C  
ATOM   4812  CZ2 TRP A 610      57.743 -20.117  29.892  1.00107.48           C  
ATOM   4813  CZ3 TRP A 610      55.711 -18.871  29.547  1.00108.96           C  
ATOM   4814  CH2 TRP A 610      56.903 -19.103  30.242  1.00106.59           C  
ATOM   4815  N   SER A 611      53.959 -22.423  28.493  1.00110.46           N  
ATOM   4816  CA  SER A 611      53.341 -22.229  29.802  1.00111.85           C  
ATOM   4817  C   SER A 611      54.414 -21.844  30.822  1.00112.03           C  
ATOM   4818  O   SER A 611      55.510 -22.408  30.831  1.00111.56           O  
ATOM   4819  CB  SER A 611      52.634 -23.513  30.261  1.00111.53           C  
ATOM   4820  OG  SER A 611      51.912 -23.310  31.461  1.00110.99           O  
ATOM   4821  N   PRO A 612      54.124 -20.844  31.668  1.00112.47           N  
ATOM   4822  CA  PRO A 612      55.065 -20.390  32.696  1.00113.61           C  
ATOM   4823  C   PRO A 612      54.781 -21.097  34.030  1.00114.65           C  
ATOM   4824  O   PRO A 612      55.558 -21.002  34.984  1.00112.72           O  
ATOM   4825  CB  PRO A 612      54.789 -18.897  32.765  1.00112.79           C  
ATOM   4826  CG  PRO A 612      53.310 -18.848  32.573  1.00112.55           C  
ATOM   4827  CD  PRO A 612      53.072 -19.834  31.442  1.00112.14           C  
ATOM   4828  N   TYR A 613      53.662 -21.817  34.074  1.00116.36           N  
ATOM   4829  CA  TYR A 613      53.250 -22.527  35.279  1.00118.10           C  
ATOM   4830  C   TYR A 613      53.155 -24.050  35.124  1.00121.19           C  
ATOM   4831  O   TYR A 613      53.446 -24.783  36.070  1.00122.17           O  
ATOM   4832  CB  TYR A 613      51.909 -21.965  35.767  1.00114.42           C  
ATOM   4833  CG  TYR A 613      50.771 -22.115  34.784  1.00110.75           C  
ATOM   4834  CD1 TYR A 613      50.136 -23.336  34.605  1.00110.07           C  
ATOM   4835  CD2 TYR A 613      50.330 -21.037  34.035  1.00110.25           C  
ATOM   4836  CE1 TYR A 613      49.094 -23.477  33.710  1.00109.44           C  
ATOM   4837  CE2 TYR A 613      49.286 -21.168  33.136  1.00110.05           C  
ATOM   4838  CZ  TYR A 613      48.670 -22.389  32.977  1.00109.71           C  
ATOM   4839  OH  TYR A 613      47.619 -22.517  32.094  1.00107.49           O  
ATOM   4840  N   ALA A 614      52.753 -24.529  33.946  1.00123.61           N  
ATOM   4841  CA  ALA A 614      52.635 -25.970  33.708  1.00124.88           C  
ATOM   4842  C   ALA A 614      53.988 -26.643  33.944  1.00126.58           C  
ATOM   4843  O   ALA A 614      54.119 -27.866  33.858  1.00125.97           O  
ATOM   4844  CB  ALA A 614      52.156 -26.232  32.285  1.00123.29           C  
ATOM   4845  N   ASP A 615      54.986 -25.815  34.243  1.00128.39           N  
ATOM   4846  CA  ASP A 615      56.347 -26.259  34.512  1.00129.36           C  
ATOM   4847  C   ASP A 615      56.440 -26.779  35.942  1.00129.44           C  
ATOM   4848  O   ASP A 615      57.266 -26.247  36.714  1.00128.60           O  
ATOM   4849  CB  ASP A 615      57.314 -25.086  34.324  1.00131.12           C  
ATOM   4850  CG  ASP A 615      58.755 -25.465  34.595  1.00131.98           C  
ATOM   4851  OD1 ASP A 615      59.277 -26.362  33.900  1.00133.00           O  
ATOM   4852  OD2 ASP A 615      59.365 -24.861  35.503  1.00131.58           O  
ATOM   4853  OXT ASP A 615      55.678 -27.712  36.270  1.00130.58           O  
TER    4854      ASP A 615                                                      
ATOM   4855  N   UNK B 901      54.055 -28.683  37.957  1.00 97.40           N  
ATOM   4856  CA  UNK B 901      52.700 -29.309  37.979  1.00100.83           C  
ATOM   4857  C   UNK B 901      52.752 -30.847  38.002  1.00101.90           C  
ATOM   4858  O   UNK B 901      53.831 -31.449  38.038  1.00101.93           O  
ATOM   4859  CB  UNK B 901      51.891 -28.824  36.775  1.00 99.93           C  
ATOM   4860  N   UNK B 902      51.575 -31.471  37.996  1.00102.39           N  
ATOM   4861  CA  UNK B 902      51.457 -32.928  38.014  1.00102.42           C  
ATOM   4862  C   UNK B 902      50.267 -33.348  37.145  1.00103.25           C  
ATOM   4863  O   UNK B 902      49.110 -33.100  37.497  1.00103.56           O  
ATOM   4864  CB  UNK B 902      51.269 -33.415  39.440  1.00100.85           C  
ATOM   4865  N   UNK B 903      50.566 -33.990  36.016  1.00102.78           N  
ATOM   4866  CA  UNK B 903      49.555 -34.428  35.052  1.00101.66           C  
ATOM   4867  C   UNK B 903      48.465 -35.351  35.580  1.00102.54           C  
ATOM   4868  O   UNK B 903      48.531 -35.853  36.703  1.00100.01           O  
ATOM   4869  CB  UNK B 903      50.236 -35.082  33.853  1.00 98.50           C  
ATOM   4870  N   UNK B 904      47.460 -35.558  34.734  1.00105.46           N  
ATOM   4871  CA  UNK B 904      46.312 -36.413  35.030  1.00109.01           C  
ATOM   4872  C   UNK B 904      45.261 -36.246  33.920  1.00111.28           C  
ATOM   4873  O   UNK B 904      45.328 -35.297  33.132  1.00111.75           O  
ATOM   4874  CB  UNK B 904      45.716 -36.049  36.386  1.00107.37           C  
ATOM   4875  N   UNK B 905      44.299 -37.165  33.856  1.00112.63           N  
ATOM   4876  CA  UNK B 905      43.257 -37.105  32.832  1.00111.97           C  
ATOM   4877  C   UNK B 905      41.854 -37.377  33.380  1.00112.08           C  
ATOM   4878  O   UNK B 905      41.216 -36.483  33.932  1.00110.81           O  
ATOM   4879  CB  UNK B 905      43.581 -38.087  31.701  1.00111.99           C  
ATOM   4880  N   UNK B 906      41.389 -38.616  33.213  1.00112.86           N  
ATOM   4881  CA  UNK B 906      40.063 -39.052  33.660  1.00112.12           C  
ATOM   4882  C   UNK B 906      38.984 -38.687  32.643  1.00111.54           C  
ATOM   4883  O   UNK B 906      38.272 -39.609  32.193  1.00111.40           O  
ATOM   4884  CB  UNK B 906      39.727 -38.448  35.021  1.00111.71           C  
ATOM   4885  OXT UNK B 906      38.865 -37.490  32.304  1.00111.06           O  
TER    4886      UNK B 906                                                      
ATOM   4887  N   UNK C 907      40.592 -34.437  31.893  1.00114.70           N  
ATOM   4888  CA  UNK C 907      42.049 -34.266  32.189  1.00114.93           C  
ATOM   4889  C   UNK C 907      42.267 -33.689  33.591  1.00113.49           C  
ATOM   4890  O   UNK C 907      41.345 -33.660  34.406  1.00114.56           O  
ATOM   4891  CB  UNK C 907      42.690 -33.352  31.135  1.00116.04           C  
ATOM   4892  N   UNK C 908      43.489 -33.235  33.863  1.00110.52           N  
ATOM   4893  CA  UNK C 908      43.822 -32.641  35.154  1.00106.10           C  
ATOM   4894  C   UNK C 908      45.283 -32.210  35.234  1.00104.42           C  
ATOM   4895  O   UNK C 908      46.067 -32.409  34.303  1.00102.98           O  
ATOM   4896  CB  UNK C 908      43.506 -33.614  36.283  1.00105.06           C  
ATOM   4897  N   UNK C 909      45.629 -31.610  36.365  1.00102.45           N  
ATOM   4898  CA  UNK C 909      46.977 -31.134  36.632  1.00100.49           C  
ATOM   4899  C   UNK C 909      46.886 -30.480  37.996  1.00 99.24           C  
ATOM   4900  O   UNK C 909      45.834 -30.525  38.628  1.00 97.40           O  
ATOM   4901  CB  UNK C 909      47.405 -30.117  35.578  1.00100.57           C  
ATOM   4902  N   UNK C 910      47.971 -29.873  38.457  1.00 99.71           N  
ATOM   4903  CA  UNK C 910      47.939 -29.229  39.761  1.00 99.67           C  
ATOM   4904  C   UNK C 910      49.122 -28.301  40.023  1.00100.14           C  
ATOM   4905  O   UNK C 910      50.232 -28.529  39.538  1.00 98.62           O  
ATOM   4906  CB  UNK C 910      47.856 -30.293  40.853  1.00 99.40           C  
ATOM   4907  N   UNK C 911      48.858 -27.248  40.793  1.00100.82           N  
ATOM   4908  CA  UNK C 911      49.865 -26.260  41.174  1.00102.95           C  
ATOM   4909  C   UNK C 911      49.615 -25.917  42.650  1.00104.23           C  
ATOM   4910  O   UNK C 911      48.524 -26.163  43.165  1.00105.10           O  
ATOM   4911  CB  UNK C 911      49.733 -25.009  40.300  1.00102.65           C  
ATOM   4912  N   UNK C 912      50.605 -25.348  43.332  1.00104.92           N  
ATOM   4913  CA  UNK C 912      50.438 -25.025  44.751  1.00105.66           C  
ATOM   4914  C   UNK C 912      50.456 -23.535  45.116  1.00105.86           C  
ATOM   4915  O   UNK C 912      51.325 -22.781  44.675  1.00105.49           O  
ATOM   4916  CB  UNK C 912      51.494 -25.769  45.573  1.00105.16           C  
ATOM   4917  N   UNK C 913      49.490 -23.129  45.939  1.00105.71           N  
ATOM   4918  CA  UNK C 913      49.380 -21.744  46.396  1.00104.74           C  
ATOM   4919  C   UNK C 913      49.862 -21.636  47.845  1.00103.17           C  
ATOM   4920  O   UNK C 913      50.735 -22.400  48.260  1.00101.87           O  
ATOM   4921  CB  UNK C 913      47.940 -21.266  46.281  1.00104.43           C  
ATOM   4922  N   UNK C 914      49.295 -20.700  48.608  1.00100.77           N  
ATOM   4923  CA  UNK C 914      49.698 -20.513  49.999  1.00100.29           C  
ATOM   4924  C   UNK C 914      49.075 -19.294  50.679  1.00101.67           C  
ATOM   4925  O   UNK C 914      49.654 -18.757  51.624  1.00102.11           O  
ATOM   4926  CB  UNK C 914      51.212 -20.403  50.079  1.00 97.48           C  
ATOM   4927  N   UNK C 915      47.907 -18.855  50.217  1.00101.96           N  
ATOM   4928  CA  UNK C 915      47.255 -17.681  50.802  1.00101.64           C  
ATOM   4929  C   UNK C 915      48.052 -16.402  50.515  1.00101.51           C  
ATOM   4930  O   UNK C 915      48.024 -15.448  51.288  1.00101.32           O  
ATOM   4931  CB  UNK C 915      47.090 -17.864  52.304  1.00102.87           C  
ATOM   4932  N   UNK C 916      48.765 -16.408  49.394  1.00102.52           N  
ATOM   4933  CA  UNK C 916      49.578 -15.284  48.930  1.00103.32           C  
ATOM   4934  C   UNK C 916      50.124 -15.709  47.564  1.00105.04           C  
ATOM   4935  O   UNK C 916      51.238 -15.342  47.179  1.00103.98           O  
ATOM   4936  CB  UNK C 916      50.717 -15.006  49.898  1.00102.07           C  
ATOM   4937  N   UNK C 917      49.291 -16.490  46.865  1.00107.13           N  
ATOM   4938  CA  UNK C 917      49.518 -17.074  45.534  1.00108.72           C  
ATOM   4939  C   UNK C 917      50.592 -16.486  44.629  1.00110.31           C  
ATOM   4940  O   UNK C 917      50.346 -16.242  43.445  1.00107.07           O  
ATOM   4941  CB  UNK C 917      48.197 -17.117  44.775  1.00107.97           C  
ATOM   4942  N   UNK C 918      51.783 -16.285  45.180  1.00113.59           N  
ATOM   4943  CA  UNK C 918      52.902 -15.743  44.427  1.00116.81           C  
ATOM   4944  C   UNK C 918      53.818 -16.907  44.054  1.00119.75           C  
ATOM   4945  O   UNK C 918      54.719 -16.755  43.229  1.00120.46           O  
ATOM   4946  CB  UNK C 918      53.658 -14.711  45.273  1.00115.07           C  
ATOM   4947  N   UNK C 919      53.568 -18.066  44.667  1.00122.65           N  
ATOM   4948  CA  UNK C 919      54.346 -19.286  44.430  1.00125.13           C  
ATOM   4949  C   UNK C 919      54.178 -20.298  45.566  1.00126.77           C  
ATOM   4950  O   UNK C 919      53.602 -19.989  46.608  1.00126.67           O  
ATOM   4951  CB  UNK C 919      55.829 -18.946  44.265  1.00124.42           C  
ATOM   4952  N   UNK C 920      54.688 -21.509  45.353  1.00129.36           N  
ATOM   4953  CA  UNK C 920      54.627 -22.577  46.352  1.00131.79           C  
ATOM   4954  C   UNK C 920      55.501 -23.762  45.932  1.00132.23           C  
ATOM   4955  O   UNK C 920      55.099 -24.583  45.105  1.00131.75           O  
ATOM   4956  CB  UNK C 920      53.188 -23.031  46.558  1.00131.94           C  
ATOM   4957  N   UNK C 921      56.695 -23.828  46.521  1.00132.33           N  
ATOM   4958  CA  UNK C 921      57.691 -24.865  46.249  1.00132.59           C  
ATOM   4959  C   UNK C 921      57.157 -26.152  45.627  1.00132.43           C  
ATOM   4960  O   UNK C 921      56.084 -26.637  45.990  1.00132.48           O  
ATOM   4961  CB  UNK C 921      58.451 -25.190  47.529  1.00133.18           C  
ATOM   4962  N   UNK C 922      57.925 -26.701  44.689  1.00131.65           N  
ATOM   4963  CA  UNK C 922      57.543 -27.931  44.006  1.00131.03           C  
ATOM   4964  C   UNK C 922      57.946 -29.139  44.837  1.00130.28           C  
ATOM   4965  O   UNK C 922      57.691 -29.179  46.041  1.00130.69           O  
ATOM   4966  CB  UNK C 922      58.203 -27.999  42.630  1.00131.29           C  
ATOM   4967  N   UNK C 923      58.583 -30.113  44.190  1.00129.08           N  
ATOM   4968  CA  UNK C 923      59.022 -31.339  44.858  1.00126.44           C  
ATOM   4969  C   UNK C 923      57.836 -31.973  45.568  1.00124.69           C  
ATOM   4970  O   UNK C 923      57.163 -32.843  45.010  1.00124.62           O  
ATOM   4971  CB  UNK C 923      60.126 -31.030  45.860  1.00126.38           C  
ATOM   4972  N   UNK C 924      57.597 -31.516  46.796  1.00121.68           N  
ATOM   4973  CA  UNK C 924      56.496 -31.979  47.632  1.00119.08           C  
ATOM   4974  C   UNK C 924      55.529 -32.869  46.868  1.00117.85           C  
ATOM   4975  O   UNK C 924      54.410 -32.464  46.537  1.00116.43           O  
ATOM   4976  CB  UNK C 924      55.758 -30.784  48.207  1.00118.67           C  
ATOM   4977  N   UNK C 925      55.976 -34.085  46.584  1.00116.62           N  
ATOM   4978  CA  UNK C 925      55.160 -35.040  45.861  1.00115.24           C  
ATOM   4979  C   UNK C 925      54.412 -35.877  46.888  1.00114.02           C  
ATOM   4980  O   UNK C 925      53.201 -36.083  46.779  1.00114.82           O  
ATOM   4981  CB  UNK C 925      56.042 -35.926  44.989  1.00113.50           C  
ATOM   4982  N   UNK C 926      55.143 -36.341  47.896  1.00110.72           N  
ATOM   4983  CA  UNK C 926      54.557 -37.155  48.944  1.00108.11           C  
ATOM   4984  C   UNK C 926      53.234 -36.552  49.393  1.00106.04           C  
ATOM   4985  O   UNK C 926      52.195 -37.234  49.256  1.00104.17           O  
ATOM   4986  CB  UNK C 926      55.515 -37.251  50.115  1.00110.43           C  
ATOM   4987  OXT UNK C 926      53.261 -35.401  49.870  1.00103.19           O  
TER    4988      UNK C 926                                                      
ATOM   4989  N   UNK D 927      31.176 -31.775  38.748  1.00100.06           N  
ATOM   4990  CA  UNK D 927      31.680 -30.512  39.356  1.00100.14           C  
ATOM   4991  C   UNK D 927      32.006 -30.697  40.840  1.00100.59           C  
ATOM   4992  O   UNK D 927      33.159 -30.547  41.250  1.00101.67           O  
ATOM   4993  CB  UNK D 927      30.648 -29.406  39.179  1.00 99.05           C  
ATOM   4994  N   UNK D 928      30.993 -31.018  41.643  1.00 99.36           N  
ATOM   4995  CA  UNK D 928      31.187 -31.221  43.078  1.00 98.45           C  
ATOM   4996  C   UNK D 928      32.389 -32.125  43.342  1.00 98.54           C  
ATOM   4997  O   UNK D 928      33.273 -31.784  44.128  1.00 97.69           O  
ATOM   4998  CB  UNK D 928      29.929 -31.828  43.701  1.00 97.00           C  
ATOM   4999  N   UNK D 929      32.418 -33.277  42.677  1.00 99.65           N  
ATOM   5000  CA  UNK D 929      33.512 -34.232  42.837  1.00 99.61           C  
ATOM   5001  C   UNK D 929      34.855 -33.526  42.694  1.00 99.88           C  
ATOM   5002  O   UNK D 929      35.803 -33.822  43.423  1.00 99.31           O  
ATOM   5003  CB  UNK D 929      33.393 -35.348  41.800  1.00 98.36           C  
ATOM   5004  N   UNK D 930      34.924 -32.590  41.751  1.00100.26           N  
ATOM   5005  CA  UNK D 930      36.141 -31.830  41.496  1.00100.42           C  
ATOM   5006  C   UNK D 930      36.563 -31.005  42.722  1.00101.12           C  
ATOM   5007  O   UNK D 930      37.752 -30.910  43.036  1.00100.41           O  
ATOM   5008  CB  UNK D 930      35.940 -30.926  40.281  1.00100.71           C  
ATOM   5009  N   UNK D 931      35.597 -30.403  43.414  1.00100.40           N  
ATOM   5010  CA  UNK D 931      35.919 -29.627  44.608  1.00100.25           C  
ATOM   5011  C   UNK D 931      36.539 -30.591  45.611  1.00100.90           C  
ATOM   5012  O   UNK D 931      37.682 -30.412  46.047  1.00 99.98           O  
ATOM   5013  CB  UNK D 931      34.658 -29.009  45.197  1.00 99.57           C  
ATOM   5014  N   UNK D 932      35.767 -31.622  45.954  1.00100.65           N  
ATOM   5015  CA  UNK D 932      36.186 -32.653  46.897  1.00 99.27           C  
ATOM   5016  C   UNK D 932      37.600 -33.145  46.598  1.00 99.13           C  
ATOM   5017  O   UNK D 932      38.334 -33.547  47.504  1.00 98.12           O  
ATOM   5018  CB  UNK D 932      35.200 -33.820  46.853  1.00 97.02           C  
ATOM   5019  N   UNK D 933      37.976 -33.109  45.323  1.00 99.03           N  
ATOM   5020  CA  UNK D 933      39.299 -33.549  44.904  1.00100.29           C  
ATOM   5021  C   UNK D 933      40.351 -32.526  45.326  1.00102.29           C  
ATOM   5022  O   UNK D 933      41.428 -32.885  45.807  1.00102.58           O  
ATOM   5023  CB  UNK D 933      39.329 -33.751  43.393  1.00 96.81           C  
ATOM   5024  N   UNK D 934      40.040 -31.247  45.148  1.00104.52           N  
ATOM   5025  CA  UNK D 934      40.979 -30.203  45.532  1.00106.06           C  
ATOM   5026  C   UNK D 934      41.186 -30.341  47.025  1.00106.23           C  
ATOM   5027  O   UNK D 934      42.315 -30.314  47.513  1.00106.24           O  
ATOM   5028  CB  UNK D 934      40.411 -28.823  45.201  1.00107.67           C  
ATOM   5029  N   UNK D 935      40.073 -30.508  47.735  1.00106.07           N  
ATOM   5030  CA  UNK D 935      40.065 -30.661  49.186  1.00105.56           C  
ATOM   5031  C   UNK D 935      41.118 -31.654  49.675  1.00104.78           C  
ATOM   5032  O   UNK D 935      42.030 -31.287  50.423  1.00103.26           O  
ATOM   5033  CB  UNK D 935      38.679 -31.104  49.646  1.00104.75           C  
ATOM   5034  N   UNK D 936      40.977 -32.910  49.252  1.00103.91           N  
ATOM   5035  CA  UNK D 936      41.905 -33.971  49.632  1.00102.26           C  
ATOM   5036  C   UNK D 936      43.337 -33.580  49.295  1.00101.58           C  
ATOM   5037  O   UNK D 936      44.263 -33.884  50.051  1.00101.28           O  
ATOM   5038  CB  UNK D 936      41.539 -35.262  48.921  1.00101.41           C  
ATOM   5039  N   UNK D 937      43.507 -32.905  48.159  1.00100.07           N  
ATOM   5040  CA  UNK D 937      44.820 -32.454  47.704  1.00 99.09           C  
ATOM   5041  C   UNK D 937      45.395 -31.422  48.676  1.00 99.81           C  
ATOM   5042  O   UNK D 937      46.596 -31.408  48.962  1.00 97.73           O  
ATOM   5043  CB  UNK D 937      44.702 -31.853  46.313  1.00 96.54           C  
ATOM   5044  N   UNK D 938      44.521 -30.555  49.177  1.00101.47           N  
ATOM   5045  CA  UNK D 938      44.921 -29.523  50.123  1.00102.57           C  
ATOM   5046  C   UNK D 938      45.336 -30.210  51.414  1.00104.00           C  
ATOM   5047  O   UNK D 938      46.446 -30.005  51.916  1.00103.35           O  
ATOM   5048  CB  UNK D 938      43.756 -28.577  50.381  1.00102.83           C  
ATOM   5049  N   UNK D 939      44.427 -31.030  51.939  1.00104.63           N  
ATOM   5050  CA  UNK D 939      44.663 -31.777  53.166  1.00103.76           C  
ATOM   5051  C   UNK D 939      46.081 -32.326  53.139  1.00103.72           C  
ATOM   5052  O   UNK D 939      46.795 -32.280  54.140  1.00103.27           O  
ATOM   5053  CB  UNK D 939      43.660 -32.917  53.281  1.00102.56           C  
ATOM   5054  N   UNK D 940      46.483 -32.834  51.978  1.00103.28           N  
ATOM   5055  CA  UNK D 940      47.818 -33.387  51.810  1.00103.08           C  
ATOM   5056  C   UNK D 940      48.860 -32.418  52.350  1.00102.54           C  
ATOM   5057  O   UNK D 940      49.522 -32.699  53.347  1.00102.71           O  
ATOM   5058  CB  UNK D 940      48.084 -33.675  50.343  1.00102.71           C  
ATOM   5059  N   UNK D 941      49.000 -31.273  51.694  1.00102.25           N  
ATOM   5060  CA  UNK D 941      49.969 -30.280  52.131  1.00101.98           C  
ATOM   5061  C   UNK D 941      49.613 -29.808  53.534  1.00101.48           C  
ATOM   5062  O   UNK D 941      50.485 -29.399  54.301  1.00 99.88           O  
ATOM   5063  CB  UNK D 941      49.986 -29.101  51.159  1.00101.49           C  
ATOM   5064  N   UNK D 942      48.324 -29.887  53.862  1.00102.53           N  
ATOM   5065  CA  UNK D 942      47.811 -29.469  55.168  1.00104.43           C  
ATOM   5066  C   UNK D 942      48.243 -30.409  56.301  1.00104.51           C  
ATOM   5067  O   UNK D 942      47.803 -30.275  57.451  1.00103.99           O  
ATOM   5068  CB  UNK D 942      46.284 -29.372  55.116  1.00104.62           C  
ATOM   5069  N   UNK D 943      49.106 -31.361  55.956  1.00104.07           N  
ATOM   5070  CA  UNK D 943      49.636 -32.332  56.904  1.00100.93           C  
ATOM   5071  C   UNK D 943      51.111 -32.534  56.575  1.00 99.19           C  
ATOM   5072  O   UNK D 943      51.500 -33.582  56.060  1.00 98.54           O  
ATOM   5073  CB  UNK D 943      48.883 -33.649  56.780  1.00 99.69           C  
ATOM   5074  N   UNK D 944      51.919 -31.516  56.856  1.00 96.62           N  
ATOM   5075  CA  UNK D 944      53.351 -31.573  56.592  1.00 95.34           C  
ATOM   5076  C   UNK D 944      54.034 -30.269  56.997  1.00 95.71           C  
ATOM   5077  O   UNK D 944      54.747 -29.691  56.152  1.00 95.50           O  
ATOM   5078  CB  UNK D 944      53.596 -31.854  55.120  1.00 93.08           C  
ATOM   5079  OXT UNK D 944      53.860 -29.844  58.158  1.00 96.68           O  
TER    5080      UNK D 944                                                      
ATOM   5081  N   UNK E 945      51.970 -24.689  60.352  1.00101.09           N  
ATOM   5082  CA  UNK E 945      50.737 -23.845  60.428  1.00102.94           C  
ATOM   5083  C   UNK E 945      49.956 -23.831  59.103  1.00103.92           C  
ATOM   5084  O   UNK E 945      48.801 -24.272  59.045  1.00103.72           O  
ATOM   5085  CB  UNK E 945      51.116 -22.421  60.822  1.00101.91           C  
ATOM   5086  N   UNK E 946      50.604 -23.317  58.055  1.00103.47           N  
ATOM   5087  CA  UNK E 946      50.046 -23.207  56.701  1.00100.75           C  
ATOM   5088  C   UNK E 946      48.734 -23.952  56.435  1.00 99.19           C  
ATOM   5089  O   UNK E 946      48.704 -25.176  56.335  1.00 99.26           O  
ATOM   5090  CB  UNK E 946      51.101 -23.643  55.682  1.00 99.26           C  
ATOM   5091  N   UNK E 947      47.646 -23.202  56.310  1.00 96.99           N  
ATOM   5092  CA  UNK E 947      46.349 -23.795  56.035  1.00 94.40           C  
ATOM   5093  C   UNK E 947      46.089 -23.690  54.540  1.00 92.75           C  
ATOM   5094  O   UNK E 947      45.560 -22.684  54.068  1.00 92.01           O  
ATOM   5095  CB  UNK E 947      45.263 -23.066  56.813  1.00 92.91           C  
ATOM   5096  N   UNK E 948      46.483 -24.720  53.797  1.00 91.46           N  
ATOM   5097  CA  UNK E 948      46.279 -24.744  52.351  1.00 90.67           C  
ATOM   5098  C   UNK E 948      44.831 -25.152  52.076  1.00 91.36           C  
ATOM   5099  O   UNK E 948      44.347 -26.144  52.624  1.00 90.97           O  
ATOM   5100  CB  UNK E 948      47.245 -25.726  51.701  1.00 86.63           C  
ATOM   5101  N   UNK E 949      44.143 -24.388  51.229  1.00 92.37           N  
ATOM   5102  CA  UNK E 949      42.739 -24.663  50.919  1.00 92.83           C  
ATOM   5103  C   UNK E 949      42.454 -25.031  49.468  1.00 92.39           C  
ATOM   5104  O   UNK E 949      43.349 -25.020  48.628  1.00 92.32           O  
ATOM   5105  CB  UNK E 949      41.889 -23.468  51.313  1.00 95.42           C  
ATOM   5106  N   UNK E 950      41.192 -25.354  49.189  1.00 92.53           N  
ATOM   5107  CA  UNK E 950      40.761 -25.732  47.846  1.00 93.58           C  
ATOM   5108  C   UNK E 950      41.179 -24.641  46.884  1.00 95.18           C  
ATOM   5109  O   UNK E 950      41.632 -24.911  45.767  1.00 96.47           O  
ATOM   5110  CB  UNK E 950      39.244 -25.906  47.800  1.00 89.51           C  
ATOM   5111  N   UNK E 951      41.035 -23.403  47.344  1.00 94.92           N  
ATOM   5112  CA  UNK E 951      41.373 -22.236  46.549  1.00 93.41           C  
ATOM   5113  C   UNK E 951      42.875 -22.069  46.325  1.00 93.01           C  
ATOM   5114  O   UNK E 951      43.308 -21.098  45.709  1.00 94.24           O  
ATOM   5115  CB  UNK E 951      40.803 -20.994  47.209  1.00 92.08           C  
ATOM   5116  N   UNK E 952      43.675 -23.011  46.807  1.00 92.59           N  
ATOM   5117  CA  UNK E 952      45.119 -22.901  46.637  1.00 92.64           C  
ATOM   5118  C   UNK E 952      45.682 -23.868  45.595  1.00 92.96           C  
ATOM   5119  O   UNK E 952      46.884 -23.853  45.312  1.00 92.12           O  
ATOM   5120  CB  UNK E 952      45.816 -23.107  47.981  1.00 92.04           C  
ATOM   5121  N   UNK E 953      44.811 -24.692  45.016  1.00 93.21           N  
ATOM   5122  CA  UNK E 953      45.223 -25.675  44.017  1.00 93.60           C  
ATOM   5123  C   UNK E 953      44.863 -25.257  42.593  1.00 95.11           C  
ATOM   5124  O   UNK E 953      43.715 -25.397  42.171  1.00 96.73           O  
ATOM   5125  CB  UNK E 953      44.591 -27.023  44.337  1.00 92.40           C  
ATOM   5126  N   UNK E 954      45.851 -24.757  41.852  1.00 95.72           N  
ATOM   5127  CA  UNK E 954      45.648 -24.314  40.471  1.00 95.58           C  
ATOM   5128  C   UNK E 954      45.432 -25.479  39.495  1.00 95.34           C  
ATOM   5129  O   UNK E 954      46.395 -26.093  39.030  1.00 93.92           O  
ATOM   5130  CB  UNK E 954      46.841 -23.472  40.023  1.00 95.09           C  
ATOM   5131  N   UNK E 955      44.167 -25.763  39.182  1.00 95.34           N  
ATOM   5132  CA  UNK E 955      43.799 -26.850  38.270  1.00 97.39           C  
ATOM   5133  C   UNK E 955      43.889 -26.438  36.798  1.00 98.90           C  
ATOM   5134  O   UNK E 955      43.411 -25.369  36.425  1.00100.27           O  
ATOM   5135  CB  UNK E 955      42.381 -27.334  38.586  1.00 94.07           C  
ATOM   5136  N   UNK E 956      44.491 -27.294  35.967  1.00100.41           N  
ATOM   5137  CA  UNK E 956      44.645 -27.025  34.528  1.00101.12           C  
ATOM   5138  C   UNK E 956      44.013 -28.114  33.659  1.00101.51           C  
ATOM   5139  O   UNK E 956      43.175 -28.881  34.138  1.00 99.77           O  
ATOM   5140  CB  UNK E 956      46.127 -26.875  34.170  1.00100.66           C  
ATOM   5141  N   UNK E 957      44.427 -28.176  32.390  1.00102.85           N  
ATOM   5142  CA  UNK E 957      43.904 -29.155  31.430  1.00103.67           C  
ATOM   5143  C   UNK E 957      42.438 -29.464  31.737  1.00104.82           C  
ATOM   5144  O   UNK E 957      41.560 -28.650  31.461  1.00105.61           O  
ATOM   5145  CB  UNK E 957      44.737 -30.433  31.473  1.00103.92           C  
ATOM   5146  N   UNK E 958      42.184 -30.640  32.309  1.00106.52           N  
ATOM   5147  CA  UNK E 958      40.832 -31.075  32.696  1.00107.70           C  
ATOM   5148  C   UNK E 958      39.712 -30.744  31.713  1.00107.71           C  
ATOM   5149  O   UNK E 958      40.016 -30.442  30.542  1.00108.98           O  
ATOM   5150  CB  UNK E 958      40.483 -30.520  34.084  1.00106.20           C  
ATOM   5151  OXT UNK E 958      38.536 -30.811  32.133  1.00106.74           O  
TER    5152      UNK E 958                                                      
HETATM 5153  C1  NAG A 800      18.118  20.149   1.957  1.00133.27           C  
HETATM 5154  C2  NAG A 800      19.207  21.206   2.291  1.00132.09           C  
HETATM 5155  C3  NAG A 800      19.268  21.562   3.787  1.00131.82           C  
HETATM 5156  C4  NAG A 800      17.873  21.791   4.335  1.00131.09           C  
HETATM 5157  C5  NAG A 800      17.066  20.538   4.075  1.00131.79           C  
HETATM 5158  C6  NAG A 800      15.695  20.577   4.711  1.00133.14           C  
HETATM 5159  C7  NAG A 800      21.605  21.030   2.555  1.00130.05           C  
HETATM 5160  C8  NAG A 800      22.204  19.920   3.403  1.00128.78           C  
HETATM 5161  N2  NAG A 800      20.511  20.740   1.852  1.00131.07           N  
HETATM 5162  O3  NAG A 800      20.036  22.742   3.967  1.00133.90           O  
HETATM 5163  O4  NAG A 800      17.935  22.062   5.724  1.00131.55           O  
HETATM 5164  O5  NAG A 800      16.884  20.388   2.656  1.00132.65           O  
HETATM 5165  O6  NAG A 800      14.789  21.338   3.930  1.00134.91           O  
HETATM 5166  O7  NAG A 800      22.134  22.143   2.544  1.00128.76           O  
HETATM 5167  C1  NAG A 801       8.968  -0.712  16.002  1.00123.49           C  
HETATM 5168  C2  NAG A 801       9.244  -1.080  14.536  1.00123.98           C  
HETATM 5169  C3  NAG A 801       7.942  -1.587  13.898  1.00122.70           C  
HETATM 5170  C4  NAG A 801       7.367  -2.744  14.722  1.00121.72           C  
HETATM 5171  C5  NAG A 801       7.209  -2.323  16.190  1.00121.18           C  
HETATM 5172  C6  NAG A 801       6.741  -3.460  17.079  1.00119.04           C  
HETATM 5173  C7  NAG A 801      10.185  -0.047  12.564  1.00128.07           C  
HETATM 5174  C8  NAG A 801       9.540   0.844  11.511  1.00127.56           C  
HETATM 5175  N2  NAG A 801       9.752   0.076  13.817  1.00126.81           N  
HETATM 5176  O3  NAG A 801       8.188  -2.027  12.570  1.00122.87           O  
HETATM 5177  O4  NAG A 801       6.107  -3.129  14.193  1.00120.35           O  
HETATM 5178  O5  NAG A 801       8.475  -1.856  16.716  1.00123.34           O  
HETATM 5179  O6  NAG A 801       7.837  -4.115  17.697  1.00115.51           O  
HETATM 5180  O7  NAG A 801      11.066  -0.843  12.236  1.00129.40           O  
HETATM 5181 CL    CL A 802      43.132 -10.877  30.595  1.00 54.38          CL  
HETATM 5182 ZN    ZN A 803      39.248   8.035  22.462  1.00 37.70          ZN  
HETATM 5183  O1  XX5 A 804      38.275   6.568  23.496  1.00 34.24           O  
HETATM 5184  C2  XX5 A 804      38.329   6.978  24.645  1.00 37.98           C  
HETATM 5185  O3  XX5 A 804      38.258   8.171  24.888  1.00 35.41           O  
HETATM 5186  C4  XX5 A 804      38.497   5.953  25.798  1.00 43.43           C  
HETATM 5187  C5  XX5 A 804      37.212   5.541  26.544  1.00 40.81           C  
HETATM 5188  C6  XX5 A 804      35.846   6.059  26.119  1.00 38.40           C  
HETATM 5189  C7  XX5 A 804      34.829   5.531  27.110  1.00 44.99           C  
HETATM 5190  C8  XX5 A 804      35.445   5.521  24.741  1.00 42.43           C  
HETATM 5191  N9  XX5 A 804      39.477   6.366  26.812  1.00 49.77           N  
HETATM 5192  C10 XX5 A 804      40.870   6.006  26.523  1.00 52.31           C  
HETATM 5193  C11 XX5 A 804      41.104   4.529  26.073  1.00 52.07           C  
HETATM 5194  O12 XX5 A 804      41.443   4.331  24.910  1.00 50.89           O  
HETATM 5195  O13 XX5 A 804      40.957   3.615  26.874  1.00 50.99           O  
HETATM 5196  C14 XX5 A 804      41.777   6.341  27.739  1.00 50.77           C  
HETATM 5197  C15 XX5 A 804      43.235   6.162  27.357  1.00 48.32           C  
HETATM 5198  C16 XX5 A 804      43.858   6.771  26.249  1.00 41.23           C  
HETATM 5199  N17 XX5 A 804      45.121   6.364  26.246  1.00 47.37           N  
HETATM 5200  C18 XX5 A 804      45.264   5.543  27.309  1.00 47.63           C  
HETATM 5201  N19 XX5 A 804      44.158   5.367  28.044  1.00 47.23           N  
HETATM 5202  C20 XX5 A 804      43.951   4.519  29.301  1.00 42.67           C  
HETATM 5203  C21 XX5 A 804      43.925   5.153  30.723  1.00 40.42           C  
HETATM 5204  C22 XX5 A 804      44.666   6.346  30.990  1.00 41.89           C  
HETATM 5205  C23 XX5 A 804      44.653   6.950  32.307  1.00 49.05           C  
HETATM 5206 CL24 XX5 A 804      45.569   8.433  32.649  1.00 51.74          CL  
HETATM 5207  C25 XX5 A 804      43.905   6.381  33.369  1.00 41.90           C  
HETATM 5208  C26 XX5 A 804      43.171   4.591  31.824  1.00 40.69           C  
HETATM 5209  C27 XX5 A 804      43.162   5.207  33.146  1.00 45.72           C  
HETATM 5210 CL28 XX5 A 804      42.225   4.519  34.516  1.00 35.70          CL  
HETATM 5211  O   HOH A 805      44.043  32.168  23.748  1.00 48.18           O  
HETATM 5212  O   HOH A 806      30.080 -10.620  16.037  1.00 34.58           O  
HETATM 5213  O   HOH A 807      64.746   6.999  25.272  1.00 41.57           O  
HETATM 5214  O   HOH A 808      44.422   2.900  45.083  1.00 48.16           O  
HETATM 5215  O   HOH A 809      30.712  -5.634  25.826  1.00 39.45           O  
HETATM 5216  O   HOH A 810      38.781  28.232   8.200  1.00 48.50           O  
HETATM 5217  O   HOH A 811      68.339  -1.991  27.794  1.00 57.87           O  
HETATM 5218  O   HOH A 812      57.805  14.127   2.218  1.00 54.21           O  
HETATM 5219  O   HOH A 813      42.149  -9.088  48.109  1.00 62.10           O  
HETATM 5220  O   HOH A 814      43.452  -0.811  22.225  1.00 48.46           O  
HETATM 5221  O   HOH A 815      31.424   9.277  27.641  1.00 47.29           O  
HETATM 5222  O   HOH A 816      17.833  27.353   5.763  1.00 48.10           O  
HETATM 5223  O   HOH A 817      20.697  -0.266  19.961  1.00 74.69           O  
CONECT  592 5153                                                                
CONECT  696 5167                                                                
CONECT  919  981                                                                
CONECT  981  919                                                                
CONECT 2649 2785                                                                
CONECT 2785 2649                                                                
CONECT 2890 5182                                                                
CONECT 2921 5182                                                                
CONECT 3114 5182                                                                
CONECT 4168 4259                                                                
CONECT 4259 4168                                                                
CONECT 5153  592 5154 5164                                                      
CONECT 5154 5153 5155 5161                                                      
CONECT 5155 5154 5156 5162                                                      
CONECT 5156 5155 5157 5163                                                      
CONECT 5157 5156 5158 5164                                                      
CONECT 5158 5157 5165                                                           
CONECT 5159 5160 5161 5166                                                      
CONECT 5160 5159                                                                
CONECT 5161 5154 5159                                                           
CONECT 5162 5155                                                                
CONECT 5163 5156                                                                
CONECT 5164 5153 5157                                                           
CONECT 5165 5158                                                                
CONECT 5166 5159                                                                
CONECT 5167  696 5168 5178                                                      
CONECT 5168 5167 5169 5175                                                      
CONECT 5169 5168 5170 5176                                                      
CONECT 5170 5169 5171 5177                                                      
CONECT 5171 5170 5172 5178                                                      
CONECT 5172 5171 5179                                                           
CONECT 5173 5174 5175 5180                                                      
CONECT 5174 5173                                                                
CONECT 5175 5168 5173                                                           
CONECT 5176 5169                                                                
CONECT 5177 5170                                                                
CONECT 5178 5167 5171                                                           
CONECT 5179 5172                                                                
CONECT 5180 5173                                                                
CONECT 5182 2890 2921 3114 5183                                                 
CONECT 5182 5185                                                                
CONECT 5183 5182 5184                                                           
CONECT 5184 5183 5185 5186                                                      
CONECT 5185 5182 5184                                                           
CONECT 5186 5184 5187 5191                                                      
CONECT 5187 5186 5188                                                           
CONECT 5188 5187 5189 5190                                                      
CONECT 5189 5188                                                                
CONECT 5190 5188                                                                
CONECT 5191 5186 5192                                                           
CONECT 5192 5191 5193 5196                                                      
CONECT 5193 5192 5194 5195                                                      
CONECT 5194 5193                                                                
CONECT 5195 5193                                                                
CONECT 5196 5192 5197                                                           
CONECT 5197 5196 5198 5201                                                      
CONECT 5198 5197 5199                                                           
CONECT 5199 5198 5200                                                           
CONECT 5200 5199 5201                                                           
CONECT 5201 5197 5200 5202                                                      
CONECT 5202 5201 5203                                                           
CONECT 5203 5202 5204 5208                                                      
CONECT 5204 5203 5205                                                           
CONECT 5205 5204 5206 5207                                                      
CONECT 5206 5205                                                                
CONECT 5207 5205 5209                                                           
CONECT 5208 5203 5209                                                           
CONECT 5209 5207 5208 5210                                                      
CONECT 5210 5209                                                                
MASTER      445    0    5   34    4    0    0    6 5218    5   69   55          
END