PDB Short entry for 1R4L
HEADER    HYDROLASE                               07-OCT-03   1R4L              
TITLE     INHIBITOR BOUND HUMAN ANGIOTENSIN CONVERTING ENZYME-RELATED           
TITLE    2 CARBOXYPEPTIDASE (ACE2)                                              
CAVEAT     1R4L    NAG A 800 HAS WRONG CHIRALITY AT ATOM C1                     
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: ANGIOTENSIN I CONVERTING ENZYME 2;                         
COMPND   3 CHAIN: A;                                                            
COMPND   4 FRAGMENT: EXTRACELLULAR DOMAINS;                                     
COMPND   5 SYNONYM: ANGIOTENSIN CONVERTING ENZYME-LIKE PROTEIN, ANGIOTENSIN     
COMPND   6 CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE;                          
COMPND   7 ENGINEERED: YES;                                                     
COMPND   8 MOL_ID: 2;                                                           
COMPND   9 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  10 CHAIN: B;                                                            
COMPND  11 ENGINEERED: YES;                                                     
COMPND  12 MOL_ID: 3;                                                           
COMPND  13 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  14 CHAIN: C;                                                            
COMPND  15 ENGINEERED: YES;                                                     
COMPND  16 MOL_ID: 4;                                                           
COMPND  17 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  18 CHAIN: D;                                                            
COMPND  19 ENGINEERED: YES;                                                     
COMPND  20 MOL_ID: 5;                                                           
COMPND  21 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  22 CHAIN: E;                                                            
COMPND  23 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 GENE: ACE2;                                                          
SOURCE   6 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE   7 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE   8 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE   9 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  10 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  11 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  12 MOL_ID: 2;                                                           
SOURCE  13 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  14 ORGANISM_COMMON: HUMAN;                                              
SOURCE  15 ORGANISM_TAXID: 9606;                                                
SOURCE  16 GENE: ACE2;                                                          
SOURCE  17 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  18 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  19 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  20 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  21 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  22 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  23 MOL_ID: 3;                                                           
SOURCE  24 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  25 ORGANISM_COMMON: HUMAN;                                              
SOURCE  26 ORGANISM_TAXID: 9606;                                                
SOURCE  27 GENE: ACE2;                                                          
SOURCE  28 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  29 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  30 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  31 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  32 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  33 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  34 MOL_ID: 4;                                                           
SOURCE  35 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  36 ORGANISM_COMMON: HUMAN;                                              
SOURCE  37 ORGANISM_TAXID: 9606;                                                
SOURCE  38 GENE: ACE2;                                                          
SOURCE  39 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  40 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  41 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  42 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  43 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  44 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  45 MOL_ID: 5;                                                           
SOURCE  46 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  47 ORGANISM_COMMON: HUMAN;                                              
SOURCE  48 ORGANISM_TAXID: 9606;                                                
SOURCE  49 GENE: ACE2;                                                          
SOURCE  50 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  51 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  52 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  53 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  54 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  55 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9                                  
KEYWDS    ZINC METALLOPEPTIDASE DOMAIN, COLLECTRIN HOMOLOGY DOMAIN, INHIBITOR   
KEYWDS   2 BOUND CONFORMATION, CHLORIDE ION BINDING SITE, ZINC ION BINDING      
KEYWDS   3 SITE, HYDROLASE                                                      
EXPDTA    X-RAY DIFFRACTION                                                     
AUTHOR    P.TOWLER,B.STAKER,S.G.PRASAD,S.MENON,D.RYAN,J.TANG,T.PARSONS,         
AUTHOR   2 M.FISHER,D.WILLIAMS,N.A.DALES,M.A.PATANE,M.W.PANTOLIANO              
REVDAT   6   29-JUL-20 1R4L    1       CAVEAT COMPND REMARK HETNAM              
REVDAT   6 2                   1       LINK   SITE                              
REVDAT   5   13-JUL-11 1R4L    1       VERSN                                    
REVDAT   4   24-FEB-09 1R4L    1       VERSN                                    
REVDAT   3   04-MAY-04 1R4L    1       AUTHOR                                   
REVDAT   2   27-APR-04 1R4L    1       JRNL                                     
REVDAT   1   03-FEB-04 1R4L    0                                                
JRNL        AUTH   P.TOWLER,B.STAKER,S.G.PRASAD,S.MENON,J.TANG,T.PARSONS,       
JRNL        AUTH 2 D.RYAN,M.FISHER,D.WILLIAMS,N.A.DALES,M.A.PATANE,             
JRNL        AUTH 3 M.W.PANTOLIANO                                               
JRNL        TITL   ACE2 X-RAY STRUCTURES REVEAL A LARGE HINGE-BENDING MOTION    
JRNL        TITL 2 IMPORTANT FOR INHIBITOR BINDING AND CATALYSIS.               
JRNL        REF    J.BIOL.CHEM.                  V. 279 17996 2004              
JRNL        REFN                   ISSN 0021-9258                               
JRNL        PMID   14754895                                                     
JRNL        DOI    10.1074/JBC.M311191200                                       
REMARK   1                                                                      
REMARK   1 REFERENCE 1                                                          
REMARK   1  AUTH   N.DALES,A.E.GOULD,J.A.BROWN,E.F.CALDERWOOD,B.GUAN,C.A.MINOR, 
REMARK   1  AUTH 2 J.M.GAVIN,P.HALES,V.K.KAUSHIK,M.STEWART,P.J.TUMMINO,         
REMARK   1  AUTH 3 C.S.VICKERS,T.D.OCAIN,M.A.PATANE                             
REMARK   1  TITL   SUBSTRATE BASED DESIGN OF THE FIRST CLASS OF                 
REMARK   1  TITL 2 ANGIOTENSIN-CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE       
REMARK   1  TITL 3 (ACE2) INHIBITORS                                            
REMARK   1  REF    J.AM.CHEM.SOC.                V. 124 11852 2002              
REMARK   1  REFN                   ISSN 0002-7863                               
REMARK   1  DOI    10.1021/JA0277226                                            
REMARK   1 REFERENCE 2                                                          
REMARK   1  AUTH   C.VICKERS,P.HALES,V.KAUSHIK,L.DICK,J.GAVIN,J.TANG,K.GODBOUT, 
REMARK   1  AUTH 2 T.PARSONS,E.BARONAS,F.HSIEH,S.ACTON,M.PATANE,A.NICHOLS,      
REMARK   1  AUTH 3 P.TUMMINO                                                    
REMARK   1  TITL   HYDROLYSIS OF BIOLOGICAL PEPTIDES BY HUMAN                   
REMARK   1  TITL 2 ANGIOTENSIN-CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE       
REMARK   1  REF    J.BIOL.CHEM.                  V. 277 14838 2002              
REMARK   1  REFN                   ISSN 0021-9258                               
REMARK   1  DOI    10.1074/JBC.M200581200                                       
REMARK   2                                                                      
REMARK   2 RESOLUTION.    3.00 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   PROGRAM     : CNX 2002                                             
REMARK   3   AUTHORS     : BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-              
REMARK   3               : KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,              
REMARK   3               : READ,RICE,SIMONSON,WARREN,ACCELRYS                   
REMARK   3               : SOFTWARE INC.(BADGER,BERARD,KUMAR,SZALMA,            
REMARK   3               : YIP,DZAKULA)                                         
REMARK   3                                                                      
REMARK   3  DATA USED IN REFINEMENT.                                            
REMARK   3   RESOLUTION RANGE HIGH (ANGSTROMS) : 3.00                           
REMARK   3   RESOLUTION RANGE LOW  (ANGSTROMS) : 43.26                          
REMARK   3   DATA CUTOFF            (SIGMA(F)) : 0.000                          
REMARK   3   DATA CUTOFF HIGH         (ABS(F)) : 2938880.390                    
REMARK   3   DATA CUTOFF LOW          (ABS(F)) : 0.0000                         
REMARK   3   COMPLETENESS (WORKING+TEST)   (%) : 96.8                           
REMARK   3   NUMBER OF REFLECTIONS             : 17228                          
REMARK   3                                                                      
REMARK   3  FIT TO DATA USED IN REFINEMENT.                                     
REMARK   3   CROSS-VALIDATION METHOD          : THROUGHOUT                      
REMARK   3   FREE R VALUE TEST SET SELECTION  : RANDOM                          
REMARK   3   R VALUE     (WORKING + TEST SET) : 0.253                           
REMARK   3   R VALUE            (WORKING SET) : 0.253                           
REMARK   3   FREE R VALUE                     : 0.337                           
REMARK   3   FREE R VALUE TEST SET SIZE   (%) : 10.000                          
REMARK   3   FREE R VALUE TEST SET COUNT      : 1730                            
REMARK   3   ESTIMATED ERROR OF FREE R VALUE  : 0.008                           
REMARK   3                                                                      
REMARK   3  FIT/AGREEMENT OF MODEL WITH ALL DATA.                               
REMARK   3   R VALUE     (WORKING + TEST SET, NO CUTOFF) : NULL                 
REMARK   3   R VALUE            (WORKING SET, NO CUTOFF) : NULL                 
REMARK   3   FREE R VALUE                    (NO CUTOFF) : NULL                 
REMARK   3   FREE R VALUE TEST SET SIZE   (%, NO CUTOFF) : NULL                 
REMARK   3   FREE R VALUE TEST SET COUNT     (NO CUTOFF) : NULL                 
REMARK   3   ESTIMATED ERROR OF FREE R VALUE (NO CUTOFF) : NULL                 
REMARK   3   TOTAL NUMBER OF REFLECTIONS     (NO CUTOFF) : NULL                 
REMARK   3                                                                      
REMARK   3  FIT IN THE HIGHEST RESOLUTION BIN.                                  
REMARK   3   TOTAL NUMBER OF BINS USED           : 6                            
REMARK   3   BIN RESOLUTION RANGE HIGH       (A) : 3.00                         
REMARK   3   BIN RESOLUTION RANGE LOW        (A) : 3.19                         
REMARK   3   BIN COMPLETENESS (WORKING+TEST) (%) : 85.10                        
REMARK   3   REFLECTIONS IN BIN    (WORKING SET) : 2250                         
REMARK   3   BIN R VALUE           (WORKING SET) : 0.3790                       
REMARK   3   BIN FREE R VALUE                    : 0.4600                       
REMARK   3   BIN FREE R VALUE TEST SET SIZE  (%) : 9.90                         
REMARK   3   BIN FREE R VALUE TEST SET COUNT     : 247                          
REMARK   3   ESTIMATED ERROR OF BIN FREE R VALUE : 0.029                        
REMARK   3                                                                      
REMARK   3  NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT.                    
REMARK   3   PROTEIN ATOMS            : 5147                                    
REMARK   3   NUCLEIC ACID ATOMS       : 0                                       
REMARK   3   HETEROGEN ATOMS          : 58                                      
REMARK   3   SOLVENT ATOMS            : 13                                      
REMARK   3                                                                      
REMARK   3  B VALUES.                                                           
REMARK   3   FROM WILSON PLOT           (A**2) : 63.00                          
REMARK   3   MEAN B VALUE      (OVERALL, A**2) : 74.50                          
REMARK   3   OVERALL ANISOTROPIC B VALUE.                                       
REMARK   3    B11 (A**2) : 20.07000                                             
REMARK   3    B22 (A**2) : 15.00000                                             
REMARK   3    B33 (A**2) : -35.07000                                            
REMARK   3    B12 (A**2) : 0.00000                                              
REMARK   3    B13 (A**2) : 20.30000                                             
REMARK   3    B23 (A**2) : 0.00000                                              
REMARK   3                                                                      
REMARK   3  ESTIMATED COORDINATE ERROR.                                         
REMARK   3   ESD FROM LUZZATI PLOT        (A) : 0.39                            
REMARK   3   ESD FROM SIGMAA              (A) : 0.62                            
REMARK   3   LOW RESOLUTION CUTOFF        (A) : 5.00                            
REMARK   3                                                                      
REMARK   3  CROSS-VALIDATED ESTIMATED COORDINATE ERROR.                         
REMARK   3   ESD FROM C-V LUZZATI PLOT    (A) : 0.56                            
REMARK   3   ESD FROM C-V SIGMAA          (A) : 0.74                            
REMARK   3                                                                      
REMARK   3  RMS DEVIATIONS FROM IDEAL VALUES.                                   
REMARK   3   BOND LENGTHS                 (A) : 0.008                           
REMARK   3   BOND ANGLES            (DEGREES) : 1.500                           
REMARK   3   DIHEDRAL ANGLES        (DEGREES) : 22.20                           
REMARK   3   IMPROPER ANGLES        (DEGREES) : 0.970                           
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL MODEL : RESTRAINED                                
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL FACTOR RESTRAINTS.    RMS    SIGMA                
REMARK   3   MAIN-CHAIN BOND              (A**2) : 2.020 ; 1.500                
REMARK   3   MAIN-CHAIN ANGLE             (A**2) : 3.420 ; 2.000                
REMARK   3   SIDE-CHAIN BOND              (A**2) : 2.750 ; 2.000                
REMARK   3   SIDE-CHAIN ANGLE             (A**2) : 4.270 ; 2.500                
REMARK   3                                                                      
REMARK   3  BULK SOLVENT MODELING.                                              
REMARK   3   METHOD USED : FLAT MODEL                                           
REMARK   3   KSOL        : 0.30                                                 
REMARK   3   BSOL        : 56.63                                                
REMARK   3                                                                      
REMARK   3  NCS MODEL : NULL                                                    
REMARK   3                                                                      
REMARK   3  NCS RESTRAINTS.                         RMS   SIGMA/WEIGHT          
REMARK   3   GROUP  1  POSITIONAL            (A) : NULL  ; NULL                 
REMARK   3   GROUP  1  B-FACTOR           (A**2) : NULL  ; NULL                 
REMARK   3                                                                      
REMARK   3  PARAMETER FILE  1  : PROTEIN_REP.PARAM                              
REMARK   3  PARAMETER FILE  2  : XX5_PAR.PARAM                                  
REMARK   3  PARAMETER FILE  3  : WATER_REP.PARAM                                
REMARK   3  PARAMETER FILE  4  : ION.PARAM                                      
REMARK   3  PARAMETER FILE  5  : CARBOHYDRATE.PARAM                             
REMARK   3  PARAMETER FILE  6  : NULL                                           
REMARK   3  TOPOLOGY FILE  1   : PROTEIN.TOP                                    
REMARK   3  TOPOLOGY FILE  2   : XX5_TOP.TOP                                    
REMARK   3  TOPOLOGY FILE  3   : WATER.TOP                                      
REMARK   3  TOPOLOGY FILE  4   : ION.TOP                                        
REMARK   3  TOPOLOGY FILE  5   : CARBOHYDRATE.TOP                               
REMARK   3  TOPOLOGY FILE  6   : NULL                                           
REMARK   3                                                                      
REMARK   3  OTHER REFINEMENT REMARKS: NULL                                      
REMARK   4                                                                      
REMARK   4 1R4L COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 30-OCT-03.                  
REMARK 100 THE DEPOSITION ID IS D_1000020429.                                   
REMARK 200                                                                      
REMARK 200 EXPERIMENTAL DETAILS                                                 
REMARK 200  EXPERIMENT TYPE                : X-RAY DIFFRACTION                  
REMARK 200  DATE OF DATA COLLECTION        : NULL                               
REMARK 200  TEMPERATURE           (KELVIN) : NULL                               
REMARK 200  PH                             : 7.5                                
REMARK 200  NUMBER OF CRYSTALS USED        : 1                                  
REMARK 200                                                                      
REMARK 200  SYNCHROTRON              (Y/N) : Y                                  
REMARK 200  RADIATION SOURCE               : NSLS                               
REMARK 200  BEAMLINE                       : X25                                
REMARK 200  X-RAY GENERATOR MODEL          : NULL                               
REMARK 200  MONOCHROMATIC OR LAUE    (M/L) : M                                  
REMARK 200  WAVELENGTH OR RANGE        (A) : NULL                               
REMARK 200  MONOCHROMATOR                  : NULL                               
REMARK 200  OPTICS                         : NULL                               
REMARK 200                                                                      
REMARK 200  DETECTOR TYPE                  : AREA DETECTOR                      
REMARK 200  DETECTOR MANUFACTURER          : NULL                               
REMARK 200  INTENSITY-INTEGRATION SOFTWARE : NULL                               
REMARK 200  DATA SCALING SOFTWARE          : SCALEPACK                          
REMARK 200                                                                      
REMARK 200  NUMBER OF UNIQUE REFLECTIONS   : 17526                              
REMARK 200  RESOLUTION RANGE HIGH      (A) : 3.000                              
REMARK 200  RESOLUTION RANGE LOW       (A) : 50.000                             
REMARK 200  REJECTION CRITERIA  (SIGMA(I)) : 0.000                              
REMARK 200                                                                      
REMARK 200 OVERALL.                                                             
REMARK 200  COMPLETENESS FOR RANGE     (%) : 95.9                               
REMARK 200  DATA REDUNDANCY                : NULL                               
REMARK 200  R MERGE                    (I) : NULL                               
REMARK 200  R SYM                      (I) : 0.07000                            
REMARK 200  <I/SIGMA(I)> FOR THE DATA SET  : 13.2000                            
REMARK 200                                                                      
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.                                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 3.00                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE LOW  (A) : 3.08                     
REMARK 200  COMPLETENESS FOR SHELL     (%) : 74.5                               
REMARK 200  DATA REDUNDANCY IN SHELL       : NULL                               
REMARK 200  R MERGE FOR SHELL          (I) : NULL                               
REMARK 200  R SYM FOR SHELL            (I) : 0.23000                            
REMARK 200  <I/SIGMA(I)> FOR SHELL         : 2.000                              
REMARK 200                                                                      
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH                              
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: MOLECULAR REPLACEMENT        
REMARK 200 SOFTWARE USED: AMORE                                                 
REMARK 200 STARTING MODEL: PDB ENTRY 1R42                                       
REMARK 200                                                                      
REMARK 200 REMARK: NULL                                                         
REMARK 280                                                                      
REMARK 280 CRYSTAL                                                              
REMARK 280 SOLVENT CONTENT, VS   (%): 58.18                                     
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 2.94                     
REMARK 280                                                                      
REMARK 280 CRYSTALLIZATION CONDITIONS: 19% PEG 3000, 100MM TRIS-HCL, 600MM      
REMARK 280  NACL, PH 7.5, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 291K       
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY                                            
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: C 1 2 1                          
REMARK 290                                                                      
REMARK 290      SYMOP   SYMMETRY                                                
REMARK 290     NNNMMM   OPERATOR                                                
REMARK 290       1555   X,Y,Z                                                   
REMARK 290       2555   -X,Y,-Z                                                 
REMARK 290       3555   X+1/2,Y+1/2,Z                                           
REMARK 290       4555   -X+1/2,Y+1/2,-Z                                         
REMARK 290                                                                      
REMARK 290     WHERE NNN -> OPERATOR NUMBER                                     
REMARK 290           MMM -> TRANSLATION VECTOR                                  
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS                            
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM             
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY                
REMARK 290 RELATED MOLECULES.                                                   
REMARK 290   SMTRY1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   2 -1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   2  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   2  0.000000  0.000000 -1.000000        0.00000            
REMARK 290   SMTRY1   3  1.000000  0.000000  0.000000       50.26550            
REMARK 290   SMTRY2   3  0.000000  1.000000  0.000000       43.25450            
REMARK 290   SMTRY3   3  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   4 -1.000000  0.000000  0.000000       50.26550            
REMARK 290   SMTRY2   4  0.000000  1.000000  0.000000       43.25450            
REMARK 290   SMTRY3   4  0.000000  0.000000 -1.000000        0.00000            
REMARK 290                                                                      
REMARK 290 REMARK: NULL                                                         
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: PENTAMERIC                        
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, C, D, E                         
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     MET A     1                                                      
REMARK 465     SER A     2                                                      
REMARK 465     SER A     3                                                      
REMARK 465     SER A     4                                                      
REMARK 465     SER A     5                                                      
REMARK 465     TRP A     6                                                      
REMARK 465     LEU A     7                                                      
REMARK 465     LEU A     8                                                      
REMARK 465     LEU A     9                                                      
REMARK 465     SER A    10                                                      
REMARK 465     LEU A    11                                                      
REMARK 465     VAL A    12                                                      
REMARK 465     ALA A    13                                                      
REMARK 465     VAL A    14                                                      
REMARK 465     THR A    15                                                      
REMARK 465     ALA A    16                                                      
REMARK 465     ALA A    17                                                      
REMARK 465     GLN A    18                                                      
REMARK 470                                                                      
REMARK 470 MISSING ATOM                                                         
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 470 I=INSERTION CODE):                                                   
REMARK 470   M RES CSSEQI  ATOMS                                                
REMARK 470     GLU A 150    CG   CD   OE1  OE2                                  
REMARK 470     PHE A 428    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     GLN A 429    CG   CD   OE1  NE2                                  
REMARK 470     GLU A 430    CG   CD   OE1  OE2                                  
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   O    HIS A   505     O    ASP A   509              2.14            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS                                             
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS THAT ARE RELATED BY CRYSTALLOGRAPHIC             
REMARK 500 SYMMETRY ARE IN CLOSE CONTACT.  AN ATOM LOCATED WITHIN 0.15          
REMARK 500 ANGSTROMS OF A SYMMETRY RELATED ATOM IS ASSUMED TO BE ON A           
REMARK 500 SPECIAL POSITION AND IS, THEREFORE, LISTED IN REMARK 375             
REMARK 500 INSTEAD OF REMARK 500.  ATOMS WITH NON-BLANK ALTERNATE               
REMARK 500 LOCATION INDICATORS ARE NOT INCLUDED IN THE CALCULATIONS.            
REMARK 500                                                                      
REMARK 500 DISTANCE CUTOFF:                                                     
REMARK 500 2.2 ANGSTROMS FOR CONTACTS NOT INVOLVING HYDROGEN ATOMS              
REMARK 500 1.6 ANGSTROMS FOR CONTACTS INVOLVING HYDROGEN ATOMS                  
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI  SSYMOP   DISTANCE          
REMARK 500   NH1  ARG A   582     NH1  ARG A   582     2655     2.02            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    THR A  20      162.60    -44.26                                   
REMARK 500    GLU A  22       36.52    -82.55                                   
REMARK 500    LYS A  26       -2.37    -56.76                                   
REMARK 500    ASN A  51        3.29    -58.40                                   
REMARK 500    ASN A  53       96.52   -167.11                                   
REMARK 500    THR A  55      -93.07    -58.40                                   
REMARK 500    GLU A  56      -48.81    169.65                                   
REMARK 500    ASN A  63       31.84    -72.03                                   
REMARK 500    GLN A  76        3.21    -64.09                                   
REMARK 500    LEU A  79        5.92    -67.46                                   
REMARK 500    GLN A  81        1.28    -66.44                                   
REMARK 500    LEU A  85      -92.77    -40.32                                   
REMARK 500    GLN A  86     -122.77    -62.04                                   
REMARK 500    GLN A  89     -134.02   -101.76                                   
REMARK 500    ASN A  90       62.33     21.25                                   
REMARK 500    LEU A  91      -48.92     -5.94                                   
REMARK 500    VAL A  93      -26.41    -38.82                                   
REMARK 500    SER A 109       66.05    -60.86                                   
REMARK 500    GLU A 110      -87.34     22.86                                   
REMARK 500    ASP A 111       28.52    -70.82                                   
REMARK 500    MET A 123      -46.87    -28.90                                   
REMARK 500    THR A 129      -29.93    174.82                                   
REMARK 500    ASN A 134      131.71    -37.87                                   
REMARK 500    ASN A 137       79.77   -177.76                                   
REMARK 500    PRO A 138      -11.01    -40.21                                   
REMARK 500    MET A 152       -8.17    -56.96                                   
REMARK 500    ASN A 154      -53.54   -124.39                                   
REMARK 500    SER A 155      142.81    -37.98                                   
REMARK 500    TYR A 158      -24.38    -34.16                                   
REMARK 500    GLU A 171      -72.32    -63.05                                   
REMARK 500    ARG A 177      -76.73    -28.67                                   
REMARK 500    VAL A 185      -71.83    -54.41                                   
REMARK 500    ALA A 191      -73.35    -59.65                                   
REMARK 500    HIS A 195       31.04     77.28                                   
REMARK 500    ASP A 198     -168.76   -177.71                                   
REMARK 500    ASP A 206      -46.34    -24.32                                   
REMARK 500    ASN A 210      -84.66   -120.53                                   
REMARK 500    LEU A 222      -42.87    -27.80                                   
REMARK 500    ILE A 223      -83.13    -60.32                                   
REMARK 500    GLU A 224       -9.69    -49.21                                   
REMARK 500    GLU A 227      -70.65    -48.48                                   
REMARK 500    ALA A 246      -89.41    -74.38                                   
REMARK 500    LYS A 247       -5.97    -43.74                                   
REMARK 500    TYR A 252       45.69   -161.95                                   
REMARK 500    SER A 254        0.76     84.68                                   
REMARK 500    PRO A 258       26.64    -68.49                                   
REMARK 500    ILE A 259       12.87   -154.38                                   
REMARK 500    CYS A 261      111.55     14.10                                   
REMARK 500    LEU A 262      158.15    -44.22                                   
REMARK 500    MET A 270      -30.62    -26.22                                   
REMARK 500                                                                      
REMARK 500 THIS ENTRY HAS     138 RAMACHANDRAN OUTLIERS.                        
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: PLANAR GROUPS                                              
REMARK 500                                                                      
REMARK 500 PLANAR GROUPS IN THE FOLLOWING RESIDUES HAVE A TOTAL                 
REMARK 500 RMS DISTANCE OF ALL ATOMS FROM THE BEST-FIT PLANE                    
REMARK 500 BY MORE THAN AN EXPECTED VALUE OF 6*RMSD, WITH AN                    
REMARK 500 RMSD 0.02 ANGSTROMS, OR AT LEAST ONE ATOM HAS                        
REMARK 500 AN RMSD GREATER THAN THIS VALUE                                      
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        RMS     TYPE                                    
REMARK 500    TYR A 510         0.09    SIDE CHAIN                              
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 620                                                                      
REMARK 620 METAL COORDINATION                                                   
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):                             
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              ZN A 803  ZN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HIS A 374   NE2                                                    
REMARK 620 2 HIS A 378   NE2 106.4                                              
REMARK 620 3 GLU A 402   OE1  97.4  95.8                                        
REMARK 620 4 XX5 A 804   O3  114.2  87.0 146.2                                  
REMARK 620 5 XX5 A 804   O1  140.9 108.8  95.5  52.3                            
REMARK 620 N                    1     2     3     4                             
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: 1R42   RELATED DB: PDB                                   
REMARK 900 NATIVE HUMAN ANGIOTENSIN CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE  
REMARK 900 (ACE2)                                                               
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 THE COMPLETE SEQUENCE CRYSTALLIZED BY THE AUTHORS                    
REMARK 999 (RESIDUES 1-740 OF REFERENCE SEQUENCE GB 11225609)                   
REMARK 999 IS AS FOLLOWS:                                                       
REMARK 999 MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNY                   
REMARK 999 NTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ                  
REMARK 999 QNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIM                  
REMARK 999 ANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYW                  
REMARK 999 RGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPS                  
REMARK 999 YISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQ                  
REMARK 999 RIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDF                  
REMARK 999 RILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEI                  
REMARK 999 MSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEK                  
REMARK 999 WRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSND                  
REMARK 999 YSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRL                  
REMARK 999 GKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWS                  
REMARK 999 PYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQ                   
REMARK 999 MILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRIN                  
REMARK 999 DAFRLNDNSLEFLGIQPTLGPPNQPPVS                                         
REMARK 999 THE ELECTRON DENSITY MAP FOR MUCH OF THE COLLECTRIN                  
REMARK 999 HOMOLOGY DOMAIN (RESIDUES 616-740) IS WEAK.  ONLY                    
REMARK 999 ABOUT HALF OF THIS DOMAIN WAS VISIBLE IN THE ELECTRON                
REMARK 999 DENSITY MAP, AND WHAT CAN BE SEEN IS AMBIGUOUS DUE TO                
REMARK 999 TOPOLOGY AND CONNECTIVITY ISSUES.  FOR THIS REASON,                  
REMARK 999 RESIDUES BEGINNING AT 901 ARE LABELED AS UNKNOWN (UNK).              
REMARK 999 EACH SEGMENT OF UNKNOWN RESIDUES HAS BEEN ASSIGNED                   
REMARK 999 A UNIQUE CHAIN ID. HOWEVER, IT SHOULD BE UNDERSTOOD                  
REMARK 999 THAT ONLY ONE SEQUENCE (RESIDUES 1-740) WAS CRYSTALLIZED.            
DBREF  1R4L A    1   615  UNP    Q9BYF1   ACE2_HUMAN       1    615             
DBREF  1R4L B  901   906  PDB    1R4L     1R4L           901    906             
DBREF  1R4L C  907   926  PDB    1R4L     1R4L           907    926             
DBREF  1R4L D  927   944  PDB    1R4L     1R4L           927    944             
DBREF  1R4L E  945   958  PDB    1R4L     1R4L           945    958             
SEQRES   1 A  615  MET SER SER SER SER TRP LEU LEU LEU SER LEU VAL ALA          
SEQRES   2 A  615  VAL THR ALA ALA GLN SER THR ILE GLU GLU GLN ALA LYS          
SEQRES   3 A  615  THR PHE LEU ASP LYS PHE ASN HIS GLU ALA GLU ASP LEU          
SEQRES   4 A  615  PHE TYR GLN SER SER LEU ALA SER TRP ASN TYR ASN THR          
SEQRES   5 A  615  ASN ILE THR GLU GLU ASN VAL GLN ASN MET ASN ASN ALA          
SEQRES   6 A  615  GLY ASP LYS TRP SER ALA PHE LEU LYS GLU GLN SER THR          
SEQRES   7 A  615  LEU ALA GLN MET TYR PRO LEU GLN GLU ILE GLN ASN LEU          
SEQRES   8 A  615  THR VAL LYS LEU GLN LEU GLN ALA LEU GLN GLN ASN GLY          
SEQRES   9 A  615  SER SER VAL LEU SER GLU ASP LYS SER LYS ARG LEU ASN          
SEQRES  10 A  615  THR ILE LEU ASN THR MET SER THR ILE TYR SER THR GLY          
SEQRES  11 A  615  LYS VAL CYS ASN PRO ASP ASN PRO GLN GLU CYS LEU LEU          
SEQRES  12 A  615  LEU GLU PRO GLY LEU ASN GLU ILE MET ALA ASN SER LEU          
SEQRES  13 A  615  ASP TYR ASN GLU ARG LEU TRP ALA TRP GLU SER TRP ARG          
SEQRES  14 A  615  SER GLU VAL GLY LYS GLN LEU ARG PRO LEU TYR GLU GLU          
SEQRES  15 A  615  TYR VAL VAL LEU LYS ASN GLU MET ALA ARG ALA ASN HIS          
SEQRES  16 A  615  TYR GLU ASP TYR GLY ASP TYR TRP ARG GLY ASP TYR GLU          
SEQRES  17 A  615  VAL ASN GLY VAL ASP GLY TYR ASP TYR SER ARG GLY GLN          
SEQRES  18 A  615  LEU ILE GLU ASP VAL GLU HIS THR PHE GLU GLU ILE LYS          
SEQRES  19 A  615  PRO LEU TYR GLU HIS LEU HIS ALA TYR VAL ARG ALA LYS          
SEQRES  20 A  615  LEU MET ASN ALA TYR PRO SER TYR ILE SER PRO ILE GLY          
SEQRES  21 A  615  CYS LEU PRO ALA HIS LEU LEU GLY ASP MET TRP GLY ARG          
SEQRES  22 A  615  PHE TRP THR ASN LEU TYR SER LEU THR VAL PRO PHE GLY          
SEQRES  23 A  615  GLN LYS PRO ASN ILE ASP VAL THR ASP ALA MET VAL ASP          
SEQRES  24 A  615  GLN ALA TRP ASP ALA GLN ARG ILE PHE LYS GLU ALA GLU          
SEQRES  25 A  615  LYS PHE PHE VAL SER VAL GLY LEU PRO ASN MET THR GLN          
SEQRES  26 A  615  GLY PHE TRP GLU ASN SER MET LEU THR ASP PRO GLY ASN          
SEQRES  27 A  615  VAL GLN LYS ALA VAL CYS HIS PRO THR ALA TRP ASP LEU          
SEQRES  28 A  615  GLY LYS GLY ASP PHE ARG ILE LEU MET CYS THR LYS VAL          
SEQRES  29 A  615  THR MET ASP ASP PHE LEU THR ALA HIS HIS GLU MET GLY          
SEQRES  30 A  615  HIS ILE GLN TYR ASP MET ALA TYR ALA ALA GLN PRO PHE          
SEQRES  31 A  615  LEU LEU ARG ASN GLY ALA ASN GLU GLY PHE HIS GLU ALA          
SEQRES  32 A  615  VAL GLY GLU ILE MET SER LEU SER ALA ALA THR PRO LYS          
SEQRES  33 A  615  HIS LEU LYS SER ILE GLY LEU LEU SER PRO ASP PHE GLN          
SEQRES  34 A  615  GLU ASP ASN GLU THR GLU ILE ASN PHE LEU LEU LYS GLN          
SEQRES  35 A  615  ALA LEU THR ILE VAL GLY THR LEU PRO PHE THR TYR MET          
SEQRES  36 A  615  LEU GLU LYS TRP ARG TRP MET VAL PHE LYS GLY GLU ILE          
SEQRES  37 A  615  PRO LYS ASP GLN TRP MET LYS LYS TRP TRP GLU MET LYS          
SEQRES  38 A  615  ARG GLU ILE VAL GLY VAL VAL GLU PRO VAL PRO HIS ASP          
SEQRES  39 A  615  GLU THR TYR CYS ASP PRO ALA SER LEU PHE HIS VAL SER          
SEQRES  40 A  615  ASN ASP TYR SER PHE ILE ARG TYR TYR THR ARG THR LEU          
SEQRES  41 A  615  TYR GLN PHE GLN PHE GLN GLU ALA LEU CYS GLN ALA ALA          
SEQRES  42 A  615  LYS HIS GLU GLY PRO LEU HIS LYS CYS ASP ILE SER ASN          
SEQRES  43 A  615  SER THR GLU ALA GLY GLN LYS LEU PHE ASN MET LEU ARG          
SEQRES  44 A  615  LEU GLY LYS SER GLU PRO TRP THR LEU ALA LEU GLU ASN          
SEQRES  45 A  615  VAL VAL GLY ALA LYS ASN MET ASN VAL ARG PRO LEU LEU          
SEQRES  46 A  615  ASN TYR PHE GLU PRO LEU PHE THR TRP LEU LYS ASP GLN          
SEQRES  47 A  615  ASN LYS ASN SER PHE VAL GLY TRP SER THR ASP TRP SER          
SEQRES  48 A  615  PRO TYR ALA ASP                                              
SEQRES   1 B    6  UNK UNK UNK UNK UNK UNK                                      
SEQRES   1 C   20  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 C   20  UNK UNK UNK UNK UNK UNK UNK                                  
SEQRES   1 D   18  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 D   18  UNK UNK UNK UNK UNK                                          
SEQRES   1 E   14  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 E   14  UNK                                                          
MODRES 1R4L ASN A   90  ASN  GLYCOSYLATION SITE                                 
MODRES 1R4L ASN A  103  ASN  GLYCOSYLATION SITE                                 
HET    NAG  A 800      14                                                       
HET    NAG  A 801      14                                                       
HET     CL  A 802       1                                                       
HET     ZN  A 803       1                                                       
HET    XX5  A 804      28                                                       
HETNAM     NAG 2-ACETAMIDO-2-DEOXY-BETA-D-GLUCOPYRANOSE                         
HETNAM      CL CHLORIDE ION                                                     
HETNAM      ZN ZINC ION                                                         
HETNAM     XX5 (S,S)-2-{1-CARBOXY-2-[3-(3,5-DICHLORO-BENZYL)-3H-                
HETNAM   2 XX5  IMIDAZOL-4-YL]-ETHYLAMINO}-4-METHYL-PENTANOIC ACID              
HETSYN     XX5 MLN-4760                                                         
FORMUL   6  NAG    2(C8 H15 N O6)                                               
FORMUL   8   CL    CL 1-                                                        
FORMUL   9   ZN    ZN 2+                                                        
FORMUL  10  XX5    C19 H23 CL2 N3 O4                                            
FORMUL  11  HOH   *13(H2 O)                                                     
HELIX    1   1 GLN A   24  LEU A   29  1                                   6    
HELIX    2   2 LEU A   29  ASN A   51  1                                  23    
HELIX    3   3 GLU A   56  MET A   82  1                                  27    
HELIX    4   4 ASN A   90  GLN A  102  1                                  13    
HELIX    5   5 GLY A  104  LEU A  108  5                                   5    
HELIX    6   6 LYS A  112  SER A  128  1                                  17    
HELIX    7   7 GLY A  147  SER A  155  1                                   9    
HELIX    8   8 ASP A  157  ALA A  193  1                                  37    
HELIX    9   9 ASP A  198  ARG A  204  1                                   7    
HELIX   10  10 GLY A  205  GLU A  208  5                                   4    
HELIX   11  11 SER A  218  GLU A  232  1                                  15    
HELIX   12  12 ILE A  233  ALA A  242  1                                  10    
HELIX   13  13 ARG A  245  ASN A  250  1                                   6    
HELIX   14  14 PHE A  274  LEU A  278  5                                   5    
HELIX   15  15 MET A  297  ALA A  301  5                                   5    
HELIX   16  16 ASP A  303  VAL A  316  1                                  14    
HELIX   17  17 SER A  317  GLY A  319  5                                   3    
HELIX   18  18 MET A  366  TYR A  385  1                                  20    
HELIX   19  19 PRO A  389  ARG A  393  5                                   5    
HELIX   20  20 ASN A  397  LEU A  410  1                                  14    
HELIX   21  21 THR A  414  GLY A  422  1                                   9    
HELIX   22  22 ASP A  431  GLY A  466  1                                  36    
HELIX   23  23 PRO A  469  ASP A  471  5                                   3    
HELIX   24  24 GLN A  472  ILE A  484  1                                  13    
HELIX   25  25 CYS A  498  SER A  502  5                                   5    
HELIX   26  26 ILE A  513  CYS A  530  1                                  18    
HELIX   27  27 GLN A  531  ALA A  533  5                                   3    
HELIX   28  28 PRO A  538  CYS A  542  5                                   5    
HELIX   29  29 SER A  547  ARG A  559  1                                  13    
HELIX   30  30 PRO A  565  VAL A  574  1                                  10    
HELIX   31  31 VAL A  581  PHE A  588  1                                   8    
HELIX   32  32 PHE A  588  LYS A  600  1                                  13    
HELIX   33  33 UNK D  927  UNK D  942  1                                  16    
HELIX   34  34 UNK E  949  UNK E  953  5                                   5    
SHEET    1   A 2 VAL A 132  CYS A 133  0                                        
SHEET    2   A 2 CYS A 141  LEU A 142 -1  O  LEU A 142   N  VAL A 132           
SHEET    1   B 2 THR A 347  GLY A 352  0                                        
SHEET    2   B 2 ASP A 355  LEU A 359 -1  O  ASP A 355   N  GLY A 352           
SSBOND   1 CYS A  133    CYS A  141                          1555   1555  2.05  
SSBOND   2 CYS A  344    CYS A  361                          1555   1555  2.04  
SSBOND   3 CYS A  530    CYS A  542                          1555   1555  2.03  
LINK         ND2 ASN A  90                 C1  NAG A 800     1555   1555  1.45  
LINK         ND2 ASN A 103                 C1  NAG A 801     1555   1555  1.46  
LINK         NE2 HIS A 374                ZN    ZN A 803     1555   1555  2.05  
LINK         NE2 HIS A 378                ZN    ZN A 803     1555   1555  2.32  
LINK         OE1 GLU A 402                ZN    ZN A 803     1555   1555  2.05  
LINK        ZN    ZN A 803                 O3  XX5 A 804     1555   1555  2.62  
LINK        ZN    ZN A 803                 O1  XX5 A 804     1555   1555  2.04  
CISPEP   1 GLU A  145    PRO A  146          0        -0.65                     
CRYST1  100.531   86.509  105.858  90.00 103.65  90.00 C 1 2 1       4          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.009947  0.000000  0.002416        0.00000                         
SCALE2      0.000000  0.011559  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.009721        0.00000