PDB Full entry for 3HO5
HEADER    SIGNALING PROTEIN                       01-JUN-09   3HO5              
TITLE     CRYSTAL STRUCTURE OF HEDGEHOG-INTERACTING PROTEIN (HHIP) AND SONIC    
TITLE    2 HEDGEHOG (SHH) COMPLEX                                               
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: HEDGEHOG-INTERACTING PROTEIN;                              
COMPND   3 CHAIN: A, B;                                                         
COMPND   4 FRAGMENT: UNP RESIDUES 193-667;                                      
COMPND   5 SYNONYM: HHIP, HIP;                                                  
COMPND   6 ENGINEERED: YES;                                                     
COMPND   7 MOL_ID: 2;                                                           
COMPND   8 MOLECULE: SONIC HEDGEHOG PROTEIN;                                    
COMPND   9 CHAIN: H;                                                            
COMPND  10 FRAGMENT: UNP RESIDUES 29-197;                                       
COMPND  11 SYNONYM: SHH, HHG-1, SONIC HEDGEHOG PROTEIN N-PRODUCT, SONIC HEDGEHOG
COMPND  12 PROTEIN C-PRODUCT;                                                   
COMPND  13 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 GENE: HHIP, HIP, UNQ5825/PRO19644;                                   
SOURCE   6 EXPRESSION_SYSTEM: TRICHOPLUSIA NI;                                  
SOURCE   7 EXPRESSION_SYSTEM_TAXID: 7111;                                       
SOURCE   8 EXPRESSION_SYSTEM_CELL_LINE: INSECT CELLS;                           
SOURCE   9 EXPRESSION_SYSTEM_VECTOR_TYPE: GATEWAY VECTOR PENTR/D-TOPO           
SOURCE  10 (INVITROGEN);                                                        
SOURCE  11 EXPRESSION_SYSTEM_PLASMID: PENTR/D-TOPO WITH HONEYBEE MELITTIN       
SOURCE  12 SECRETION SIGNAL;                                                    
SOURCE  13 MOL_ID: 2;                                                           
SOURCE  14 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  15 ORGANISM_COMMON: HUMAN;                                              
SOURCE  16 ORGANISM_TAXID: 9606;                                                
SOURCE  17 GENE: SHH;                                                           
SOURCE  18 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE  19 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE  20 EXPRESSION_SYSTEM_CELL_LINE: ROSETTA 2 (NOVAGEN);                    
SOURCE  21 EXPRESSION_SYSTEM_VECTOR_TYPE: PET101/D-TOPO (INVITROGEN) WITH T7    
SOURCE  22 PROMOTER;                                                            
SOURCE  23 EXPRESSION_SYSTEM_PLASMID: PET101/D-TOPO (INVITROGEN)                
KEYWDS    RECEPTOR ECTODOMAIN, SIX-BLADED-PROPELLER DOMAIN, EGF DOMAIN,         
KEYWDS   2 DISULFIDE BOND, CALCIUM CATION, ZINC CATION, CELL MEMBRANE, EGF-LIKE 
KEYWDS   3 DOMAIN, GLYCOPROTEIN, MEMBRANE, SECRETED, AUTOCATALYTIC CLEAVAGE,    
KEYWDS   4 DEVELOPMENTAL PROTEIN, DISEASE MUTATION, HOLOPROSENCEPHALY,          
KEYWDS   5 HYDROLASE, LIPOPROTEIN, MICROPHTHALMIA, PALMITATE, PROTEASE,         
KEYWDS   6 SIGNALING PROTEIN                                                    
EXPDTA    X-RAY DIFFRACTION                                                     
AUTHOR    S.G.HYMOWITZ,I.BOSANAC                                                
REVDAT   3   13-JUL-11 3HO5    1       VERSN                                    
REVDAT   2   28-APR-10 3HO5    1       JRNL                                     
REVDAT   1   23-JUN-09 3HO5    0                                                
JRNL        AUTH   I.BOSANAC,H.R.MAUN,S.J.SCALES,X.WEN,A.LINGEL,J.F.BAZAN,      
JRNL        AUTH 2 F.J.DE SAUVAGE,S.G.HYMOWITZ,R.A.LAZARUS                      
JRNL        TITL   THE STRUCTURE OF SHH IN COMPLEX WITH HHIP REVEALS A          
JRNL        TITL 2 RECOGNITION ROLE FOR THE SHH PSEUDO ACTIVE SITE IN           
JRNL        TITL 3 SIGNALING.                                                   
JRNL        REF    NAT.STRUCT.MOL.BIOL.          V.  16   691 2009              
JRNL        REFN                   ISSN 1545-9993                               
JRNL        PMID   19561609                                                     
JRNL        DOI    10.1038/NSMB.1632                                            
REMARK   2                                                                      
REMARK   2 RESOLUTION.    3.01 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   PROGRAM     : REFMAC 5.2.0019                                      
REMARK   3   AUTHORS     : MURSHUDOV,VAGIN,DODSON                               
REMARK   3                                                                      
REMARK   3    REFINEMENT TARGET : MAXIMUM LIKELIHOOD                            
REMARK   3                                                                      
REMARK   3  DATA USED IN REFINEMENT.                                            
REMARK   3   RESOLUTION RANGE HIGH (ANGSTROMS) : 3.01                           
REMARK   3   RESOLUTION RANGE LOW  (ANGSTROMS) : 30.00                          
REMARK   3   DATA CUTOFF            (SIGMA(F)) : 0.000                          
REMARK   3   COMPLETENESS FOR RANGE        (%) : 99.8                           
REMARK   3   NUMBER OF REFLECTIONS             : 35147                          
REMARK   3                                                                      
REMARK   3  FIT TO DATA USED IN REFINEMENT.                                     
REMARK   3   CROSS-VALIDATION METHOD          : THROUGHOUT                      
REMARK   3   FREE R VALUE TEST SET SELECTION  : RANDOM                          
REMARK   3   R VALUE     (WORKING + TEST SET) : 0.234                           
REMARK   3   R VALUE            (WORKING SET) : 0.231                           
REMARK   3   FREE R VALUE                     : 0.287                           
REMARK   3   FREE R VALUE TEST SET SIZE   (%) : 5.100                           
REMARK   3   FREE R VALUE TEST SET COUNT      : 1874                            
REMARK   3                                                                      
REMARK   3  FIT IN THE HIGHEST RESOLUTION BIN.                                  
REMARK   3   TOTAL NUMBER OF BINS USED           : 25                           
REMARK   3   BIN RESOLUTION RANGE HIGH       (A) : 3.00                         
REMARK   3   BIN RESOLUTION RANGE LOW        (A) : 3.07                         
REMARK   3   REFLECTION IN BIN     (WORKING SET) : 2039                         
REMARK   3   BIN COMPLETENESS (WORKING+TEST) (%) : 99.44                        
REMARK   3   BIN R VALUE           (WORKING SET) : 0.2930                       
REMARK   3   BIN FREE R VALUE SET COUNT          : 103                          
REMARK   3   BIN FREE R VALUE                    : 0.3400                       
REMARK   3                                                                      
REMARK   3  NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT.                    
REMARK   3   PROTEIN ATOMS            : 8251                                    
REMARK   3   NUCLEIC ACID ATOMS       : 0                                       
REMARK   3   HETEROGEN ATOMS          : 4                                       
REMARK   3   SOLVENT ATOMS            : 0                                       
REMARK   3                                                                      
REMARK   3  B VALUES.                                                           
REMARK   3   B VALUE TYPE : LIKELY RESIDUAL                                     
REMARK   3   FROM WILSON PLOT           (A**2) : NULL                           
REMARK   3   MEAN B VALUE      (OVERALL, A**2) : 96.67                          
REMARK   3   OVERALL ANISOTROPIC B VALUE.                                       
REMARK   3    B11 (A**2) : 4.78000                                              
REMARK   3    B22 (A**2) : 4.78000                                              
REMARK   3    B33 (A**2) : -7.17000                                             
REMARK   3    B12 (A**2) : 2.39000                                              
REMARK   3    B13 (A**2) : 0.00000                                              
REMARK   3    B23 (A**2) : 0.00000                                              
REMARK   3                                                                      
REMARK   3  ESTIMATED OVERALL COORDINATE ERROR.                                 
REMARK   3   ESU BASED ON R VALUE                            (A): 1.342         
REMARK   3   ESU BASED ON FREE R VALUE                       (A): 0.425         
REMARK   3   ESU BASED ON MAXIMUM LIKELIHOOD                 (A): 0.336         
REMARK   3   ESU FOR B VALUES BASED ON MAXIMUM LIKELIHOOD (A**2): 40.143        
REMARK   3                                                                      
REMARK   3 CORRELATION COEFFICIENTS.                                            
REMARK   3   CORRELATION COEFFICIENT FO-FC      : 0.921                         
REMARK   3   CORRELATION COEFFICIENT FO-FC FREE : 0.885                         
REMARK   3                                                                      
REMARK   3  RMS DEVIATIONS FROM IDEAL VALUES        COUNT    RMS    WEIGHT      
REMARK   3   BOND LENGTHS REFINED ATOMS        (A):  8444 ; 0.008 ; 0.021       
REMARK   3   BOND LENGTHS OTHERS               (A):  NULL ;  NULL ;  NULL       
REMARK   3   BOND ANGLES REFINED ATOMS   (DEGREES): 11395 ; 1.186 ; 1.960       
REMARK   3   BOND ANGLES OTHERS          (DEGREES):  NULL ;  NULL ;  NULL       
REMARK   3   TORSION ANGLES, PERIOD 1    (DEGREES):  1044 ; 6.529 ; 5.000       
REMARK   3   TORSION ANGLES, PERIOD 2    (DEGREES):   394 ;33.348 ;23.680       
REMARK   3   TORSION ANGLES, PERIOD 3    (DEGREES):  1425 ;19.747 ;15.000       
REMARK   3   TORSION ANGLES, PERIOD 4    (DEGREES):    58 ;15.728 ;15.000       
REMARK   3   CHIRAL-CENTER RESTRAINTS       (A**3):  1198 ; 0.080 ; 0.200       
REMARK   3   GENERAL PLANES REFINED ATOMS      (A):  6462 ; 0.003 ; 0.020       
REMARK   3   GENERAL PLANES OTHERS             (A):  NULL ;  NULL ;  NULL       
REMARK   3   NON-BONDED CONTACTS REFINED ATOMS (A):  3517 ; 0.204 ; 0.200       
REMARK   3   NON-BONDED CONTACTS OTHERS        (A):  NULL ;  NULL ;  NULL       
REMARK   3   NON-BONDED TORSION REFINED ATOMS  (A):  5485 ; 0.306 ; 0.200       
REMARK   3   NON-BONDED TORSION OTHERS         (A):  NULL ;  NULL ;  NULL       
REMARK   3   H-BOND (X...Y) REFINED ATOMS      (A):   242 ; 0.141 ; 0.200       
REMARK   3   H-BOND (X...Y) OTHERS             (A):  NULL ;  NULL ;  NULL       
REMARK   3   POTENTIAL METAL-ION REFINED ATOMS (A):  NULL ;  NULL ;  NULL       
REMARK   3   POTENTIAL METAL-ION OTHERS        (A):  NULL ;  NULL ;  NULL       
REMARK   3   SYMMETRY VDW REFINED ATOMS        (A):    61 ; 0.200 ; 0.200       
REMARK   3   SYMMETRY VDW OTHERS               (A):  NULL ;  NULL ;  NULL       
REMARK   3   SYMMETRY H-BOND REFINED ATOMS     (A):     3 ; 0.224 ; 0.200       
REMARK   3   SYMMETRY H-BOND OTHERS            (A):  NULL ;  NULL ;  NULL       
REMARK   3   SYMMETRY METAL-ION REFINED ATOMS  (A):  NULL ;  NULL ;  NULL       
REMARK   3   SYMMETRY METAL-ION OTHERS         (A):  NULL ;  NULL ;  NULL       
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL FACTOR RESTRAINTS.     COUNT   RMS    WEIGHT      
REMARK   3   MAIN-CHAIN BOND REFINED ATOMS  (A**2):  5344 ; 2.161 ; 2.500       
REMARK   3   MAIN-CHAIN BOND OTHER ATOMS    (A**2):  NULL ;  NULL ;  NULL       
REMARK   3   MAIN-CHAIN ANGLE REFINED ATOMS (A**2):  8350 ; 3.635 ; 5.000       
REMARK   3   SIDE-CHAIN BOND REFINED ATOMS  (A**2):  3463 ; 1.997 ; 2.500       
REMARK   3   SIDE-CHAIN ANGLE REFINED ATOMS (A**2):  3045 ; 3.223 ; 5.000       
REMARK   3                                                                      
REMARK   3 ANISOTROPIC THERMAL FACTOR RESTRAINTS.    COUNT   RMS   WEIGHT       
REMARK   3   RIGID-BOND RESTRAINTS          (A**2):  NULL ;  NULL ;  NULL       
REMARK   3   SPHERICITY; FREE ATOMS         (A**2):  NULL ;  NULL ;  NULL       
REMARK   3   SPHERICITY; BONDED ATOMS       (A**2):  NULL ;  NULL ;  NULL       
REMARK   3                                                                      
REMARK   3  NCS RESTRAINTS STATISTICS                                           
REMARK   3   NUMBER OF DIFFERENT NCS GROUPS : NULL                              
REMARK   3                                                                      
REMARK   3  TLS DETAILS                                                         
REMARK   3   NUMBER OF TLS GROUPS  : 7                                          
REMARK   3                                                                      
REMARK   3   TLS GROUP : 1                                                      
REMARK   3    NUMBER OF COMPONENTS GROUP : 1                                    
REMARK   3    COMPONENTS        C SSSEQI   TO  C SSSEQI                         
REMARK   3    RESIDUE RANGE :   A   214        A   603                          
REMARK   3    ORIGIN FOR THE GROUP (A):  13.5418  28.7701  48.7252              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:  -0.5773 T22:   0.0072                                     
REMARK   3      T33:  -0.5072 T12:  -0.2034                                     
REMARK   3      T13:  -0.0647 T23:  -0.1130                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   4.2304 L22:   2.2035                                     
REMARK   3      L33:   5.6920 L12:  -0.8665                                     
REMARK   3      L13:  -1.0870 L23:   0.0995                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0035 S12:   1.4707 S13:   0.1007                       
REMARK   3      S21:  -0.4375 S22:   0.0482 S23:  -0.0093                       
REMARK   3      S31:  -0.0521 S32:   0.0539 S33:  -0.0516                       
REMARK   3                                                                      
REMARK   3   TLS GROUP : 2                                                      
REMARK   3    NUMBER OF COMPONENTS GROUP : 1                                    
REMARK   3    COMPONENTS        C SSSEQI   TO  C SSSEQI                         
REMARK   3    RESIDUE RANGE :   A   604        A   637                          
REMARK   3    ORIGIN FOR THE GROUP (A):  41.0485  17.6891  39.6322              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:  -0.0738 T22:   0.9407                                     
REMARK   3      T33:  -0.0092 T12:   0.0831                                     
REMARK   3      T13:   0.0702 T23:  -0.4029                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:  19.0273 L22:   0.6190                                     
REMARK   3      L33:  11.6971 L12:   3.4319                                     
REMARK   3      L13: -14.9186 L23:  -2.6908                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.5742 S12:   0.9847 S13:  -0.5733                       
REMARK   3      S21:  -0.5663 S22:  -0.8648 S23:  -0.3755                       
REMARK   3      S31:   0.7574 S32:   0.4312 S33:   1.4389                       
REMARK   3                                                                      
REMARK   3   TLS GROUP : 3                                                      
REMARK   3    NUMBER OF COMPONENTS GROUP : 1                                    
REMARK   3    COMPONENTS        C SSSEQI   TO  C SSSEQI                         
REMARK   3    RESIDUE RANGE :   A   638        A   669                          
REMARK   3    ORIGIN FOR THE GROUP (A):  63.2572  24.0824  30.9176              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:  -0.3984 T22:  -0.5158                                     
REMARK   3      T33:  -0.2734 T12:   0.0479                                     
REMARK   3      T13:   0.1202 T23:  -0.0557                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:  19.5851 L22:  10.8279                                     
REMARK   3      L33:  25.7191 L12:  -3.5468                                     
REMARK   3      L13:  11.0969 L23:   2.6616                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.5733 S12:  -0.0285 S13:   1.8190                       
REMARK   3      S21:   0.1869 S22:  -0.5694 S23:  -0.1920                       
REMARK   3      S31:  -2.4019 S32:  -0.8979 S33:  -0.0039                       
REMARK   3                                                                      
REMARK   3   TLS GROUP : 4                                                      
REMARK   3    NUMBER OF COMPONENTS GROUP : 1                                    
REMARK   3    COMPONENTS        C SSSEQI   TO  C SSSEQI                         
REMARK   3    RESIDUE RANGE :   B   214        B   603                          
REMARK   3    ORIGIN FOR THE GROUP (A):   7.0523  25.9662  98.6709              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:  -0.3603 T22:  -0.4969                                     
REMARK   3      T33:  -0.3930 T12:   0.0667                                     
REMARK   3      T13:   0.0250 T23:   0.1228                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.1991 L22:   1.9124                                     
REMARK   3      L33:   6.3512 L12:  -0.5354                                     
REMARK   3      L13:  -0.4551 L23:   0.8778                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.2454 S12:  -0.6976 S13:  -0.3102                       
REMARK   3      S21:   0.5887 S22:   0.1954 S23:   0.0436                       
REMARK   3      S31:   0.7498 S32:   0.2605 S33:   0.0500                       
REMARK   3                                                                      
REMARK   3   TLS GROUP : 5                                                      
REMARK   3    NUMBER OF COMPONENTS GROUP : 1                                    
REMARK   3    COMPONENTS        C SSSEQI   TO  C SSSEQI                         
REMARK   3    RESIDUE RANGE :   B   604        B   637                          
REMARK   3    ORIGIN FOR THE GROUP (A): -15.5961  44.2787 108.6657              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:  -0.4438 T22:   0.1957                                     
REMARK   3      T33:  -0.3473 T12:   0.2062                                     
REMARK   3      T13:   0.1719 T23:  -0.1343                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.8966 L22:   7.9702                                     
REMARK   3      L33:   8.3801 L12:  -0.2110                                     
REMARK   3      L13:  -0.1629 L23:   6.3729                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.3586 S12:  -0.7337 S13:  -0.1109                       
REMARK   3      S21:   0.4230 S22:  -0.1590 S23:   0.4796                       
REMARK   3      S31:  -0.5194 S32:  -0.9657 S33:   0.5176                       
REMARK   3                                                                      
REMARK   3   TLS GROUP : 6                                                      
REMARK   3    NUMBER OF COMPONENTS GROUP : 1                                    
REMARK   3    COMPONENTS        C SSSEQI   TO  C SSSEQI                         
REMARK   3    RESIDUE RANGE :   B   638        B   669                          
REMARK   3    ORIGIN FOR THE GROUP (A): -19.9242  64.3175 122.8157              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:  -0.7689 T22:  -0.4586                                     
REMARK   3      T33:  -0.6479 T12:  -0.1707                                     
REMARK   3      T13:   0.0987 T23:  -0.0418                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:  24.2735 L22:  31.4133                                     
REMARK   3      L33:  14.1006 L12:  -5.1463                                     
REMARK   3      L13:   1.1620 L23:   0.6334                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.9788 S12:  -0.5984 S13:   1.0498                       
REMARK   3      S21:   1.2449 S22:   1.3659 S23:  -1.0860                       
REMARK   3      S31:  -0.0503 S32:   2.3235 S33:  -0.3871                       
REMARK   3                                                                      
REMARK   3   TLS GROUP : 7                                                      
REMARK   3    NUMBER OF COMPONENTS GROUP : 1                                    
REMARK   3    COMPONENTS        C SSSEQI   TO  C SSSEQI                         
REMARK   3    RESIDUE RANGE :   H    38        H   191                          
REMARK   3    ORIGIN FOR THE GROUP (A):  17.4700  34.0870 136.9189              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.7295 T22:   1.2638                                     
REMARK   3      T33:  -0.1123 T12:   0.2086                                     
REMARK   3      T13:  -0.2030 T23:   0.0130                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   7.4315 L22:   6.0294                                     
REMARK   3      L33:   5.6755 L12:   1.3144                                     
REMARK   3      L13:   0.4240 L23:  -0.5407                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0538 S12:  -1.1717 S13:   0.1966                       
REMARK   3      S21:   0.8086 S22:   0.0638 S23:  -0.3688                       
REMARK   3      S31:  -0.1383 S32:   0.3085 S33:  -0.0100                       
REMARK   3                                                                      
REMARK   3  BULK SOLVENT MODELLING.                                             
REMARK   3   METHOD USED : MASK                                                 
REMARK   3   PARAMETERS FOR MASK CALCULATION                                    
REMARK   3   VDW PROBE RADIUS   : 1.40                                          
REMARK   3   ION PROBE RADIUS   : 0.80                                          
REMARK   3   SHRINKAGE RADIUS   : 0.80                                          
REMARK   3                                                                      
REMARK   3  OTHER REFINEMENT REMARKS: HYDROGENS HAVE BEEN ADDED IN THE RIDING   
REMARK   3  POSITIONS                                                           
REMARK   4                                                                      
REMARK   4 3HO5 COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 04-JUN-09.                  
REMARK 100 THE RCSB ID CODE IS RCSB053374.                                      
REMARK 200                                                                      
REMARK 200 EXPERIMENTAL DETAILS                                                 
REMARK 200  EXPERIMENT TYPE                : X-RAY DIFFRACTION                  
REMARK 200  DATE OF DATA COLLECTION        : 06-JUN-07                          
REMARK 200  TEMPERATURE           (KELVIN) : 100                                
REMARK 200  PH                             : 7.0                                
REMARK 200  NUMBER OF CRYSTALS USED        : 1                                  
REMARK 200                                                                      
REMARK 200  SYNCHROTRON              (Y/N) : Y                                  
REMARK 200  RADIATION SOURCE               : SSRL                               
REMARK 200  BEAMLINE                       : BL11-1                             
REMARK 200  X-RAY GENERATOR MODEL          : NULL                               
REMARK 200  MONOCHROMATIC OR LAUE    (M/L) : M                                  
REMARK 200  WAVELENGTH OR RANGE        (A) : 0.97839                            
REMARK 200  MONOCHROMATOR                  : SIDE SCATTERING BENT CUBE-ROOT I   
REMARK 200                                   -BEAM SINGLE CRYSTAL; ASYMMETRIC   
REMARK 200                                   CUT 4.965 DEGS                     
REMARK 200  OPTICS                         : FLAT MIRROR (VERTICAL FOCUSING);   
REMARK 200                                   SINGLE CRYSTAL SI(111) BENT        
REMARK 200                                   MONOCHROMATOR (HO RIZONTAL         
REMARK 200                                   FOCUSING)                          
REMARK 200                                                                      
REMARK 200  DETECTOR TYPE                  : CCD                                
REMARK 200  DETECTOR MANUFACTURER          : MARMOSAIC 325 MM CCD               
REMARK 200  INTENSITY-INTEGRATION SOFTWARE : HKL-2000                           
REMARK 200  DATA SCALING SOFTWARE          : HKL-2000                           
REMARK 200                                                                      
REMARK 200  NUMBER OF UNIQUE REFLECTIONS   : 37106                              
REMARK 200  RESOLUTION RANGE HIGH      (A) : 3.000                              
REMARK 200  RESOLUTION RANGE LOW       (A) : 50.000                             
REMARK 200  REJECTION CRITERIA  (SIGMA(I)) : -3.000                             
REMARK 200                                                                      
REMARK 200 OVERALL.                                                             
REMARK 200  COMPLETENESS FOR RANGE     (%) : 99.8                               
REMARK 200  DATA REDUNDANCY                : 8.700                              
REMARK 200  R MERGE                    (I) : NULL                               
REMARK 200  R SYM                      (I) : 0.08500                            
REMARK 200  <I/SIGMA(I)> FOR THE DATA SET  : 24.2000                            
REMARK 200                                                                      
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.                                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 3.00                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE LOW  (A) : 3.11                     
REMARK 200  COMPLETENESS FOR SHELL     (%) : 100.0                              
REMARK 200  DATA REDUNDANCY IN SHELL       : 8.90                               
REMARK 200  R MERGE FOR SHELL          (I) : NULL                               
REMARK 200  R SYM FOR SHELL            (I) : 0.58900                            
REMARK 200  <I/SIGMA(I)> FOR SHELL         : 4.300                              
REMARK 200                                                                      
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH                              
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: MOLECULAR REPLACEMENT        
REMARK 200 SOFTWARE USED: PHASER                                                
REMARK 200 STARTING MODEL: PDB ENTRIES 1VHH, 3HO4                               
REMARK 200                                                                      
REMARK 200 REMARK: NULL                                                         
REMARK 280                                                                      
REMARK 280 CRYSTAL                                                              
REMARK 280 SOLVENT CONTENT, VS   (%): 65.31                                     
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 3.55                     
REMARK 280                                                                      
REMARK 280 CRYSTALLIZATION CONDITIONS: 0.1 M BIS-TRIS PROPANE PH 7.0 AND 2.2-   
REMARK 280  2.5 M SODIUM FORMATE, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE    
REMARK 280  292K                                                                
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY                                            
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 31 2 1                         
REMARK 290                                                                      
REMARK 290      SYMOP   SYMMETRY                                                
REMARK 290     NNNMMM   OPERATOR                                                
REMARK 290       1555   X,Y,Z                                                   
REMARK 290       2555   -Y,X-Y,Z+1/3                                            
REMARK 290       3555   -X+Y,-X,Z+2/3                                           
REMARK 290       4555   Y,X,-Z                                                  
REMARK 290       5555   X-Y,-Y,-Z+2/3                                           
REMARK 290       6555   -X,-X+Y,-Z+1/3                                          
REMARK 290                                                                      
REMARK 290     WHERE NNN -> OPERATOR NUMBER                                     
REMARK 290           MMM -> TRANSLATION VECTOR                                  
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS                            
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM             
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY                
REMARK 290 RELATED MOLECULES.                                                   
REMARK 290   SMTRY1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   2 -0.500000 -0.866025  0.000000        0.00000            
REMARK 290   SMTRY2   2  0.866025 -0.500000  0.000000        0.00000            
REMARK 290   SMTRY3   2  0.000000  0.000000  1.000000      100.94333            
REMARK 290   SMTRY1   3 -0.500000  0.866025  0.000000        0.00000            
REMARK 290   SMTRY2   3 -0.866025 -0.500000  0.000000        0.00000            
REMARK 290   SMTRY3   3  0.000000  0.000000  1.000000      201.88667            
REMARK 290   SMTRY1   4 -0.500000  0.866025  0.000000        0.00000            
REMARK 290   SMTRY2   4  0.866025  0.500000  0.000000        0.00000            
REMARK 290   SMTRY3   4  0.000000  0.000000 -1.000000        0.00000            
REMARK 290   SMTRY1   5  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   5  0.000000 -1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   5  0.000000  0.000000 -1.000000      201.88667            
REMARK 290   SMTRY1   6 -0.500000 -0.866025  0.000000        0.00000            
REMARK 290   SMTRY2   6 -0.866025  0.500000  0.000000        0.00000            
REMARK 290   SMTRY3   6  0.000000  0.000000 -1.000000      100.94333            
REMARK 290                                                                      
REMARK 290 REMARK: NULL                                                         
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1, 2                                                    
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: MONOMERIC                         
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: MONOMERIC                  
REMARK 350 SOFTWARE USED: PISA                                                  
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A                                     
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 2                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: DIMERIC                           
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: DIMERIC                    
REMARK 350 SOFTWARE USED: PISA                                                  
REMARK 350 TOTAL BURIED SURFACE AREA: 2010 ANGSTROM**2                          
REMARK 350 SURFACE AREA OF THE COMPLEX: 28520 ANGSTROM**2                       
REMARK 350 CHANGE IN SOLVENT FREE ENERGY: -58.0 KCAL/MOL                        
REMARK 350 APPLY THE FOLLOWING TO CHAINS: B, H                                  
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 400                                                                      
REMARK 400 COMPOUND                                                             
REMARK 400 THE SECOND MOLECULE OF SONIC HEDGEHOG PROTEIN WAS CRYSTALLIZED BUT   
REMARK 400 APPEARED TO BE LARGELY DISORDERED AND WAS NOT INCLUDED IN THE FINAL  
REMARK 400 MODEL. THE SEQUENCE IS:                                              
REMARK 400 GFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADR 
REMARK 400  LMTQRCKDKLNALAISVMNQWPGV                                            
REMARK 400  KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKA 
REMARK 400  ENSVAAKSGG                                                          
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     SER A   193                                                      
REMARK 465     ASN A   194                                                      
REMARK 465     TYR A   195                                                      
REMARK 465     LEU A   196                                                      
REMARK 465     ASP A   197                                                      
REMARK 465     GLN A   198                                                      
REMARK 465     MET A   199                                                      
REMARK 465     GLU A   200                                                      
REMARK 465     GLU A   201                                                      
REMARK 465     TYR A   202                                                      
REMARK 465     ASP A   203                                                      
REMARK 465     LYS A   204                                                      
REMARK 465     VAL A   205                                                      
REMARK 465     GLU A   206                                                      
REMARK 465     GLU A   207                                                      
REMARK 465     ILE A   208                                                      
REMARK 465     SER A   209                                                      
REMARK 465     ARG A   210                                                      
REMARK 465     LYS A   211                                                      
REMARK 465     HIS A   212                                                      
REMARK 465     LYS A   213                                                      
REMARK 465     GLN A   307                                                      
REMARK 465     GLU A   308                                                      
REMARK 465     ASN A   419                                                      
REMARK 465     GLN A   420                                                      
REMARK 465     PRO A   421                                                      
REMARK 465     PRO A   441                                                      
REMARK 465     THR A   442                                                      
REMARK 465     ASP A   443                                                      
REMARK 465     ILE A   444                                                      
REMARK 465     ASN A   445                                                      
REMARK 465     ILE A   446                                                      
REMARK 465     HIS A   671                                                      
REMARK 465     HIS A   672                                                      
REMARK 465     HIS A   673                                                      
REMARK 465     SER B   193                                                      
REMARK 465     ASN B   194                                                      
REMARK 465     TYR B   195                                                      
REMARK 465     LEU B   196                                                      
REMARK 465     ASP B   197                                                      
REMARK 465     GLN B   198                                                      
REMARK 465     MET B   199                                                      
REMARK 465     GLU B   200                                                      
REMARK 465     GLU B   201                                                      
REMARK 465     TYR B   202                                                      
REMARK 465     ASP B   203                                                      
REMARK 465     LYS B   204                                                      
REMARK 465     VAL B   205                                                      
REMARK 465     GLU B   206                                                      
REMARK 465     GLU B   207                                                      
REMARK 465     ILE B   208                                                      
REMARK 465     SER B   209                                                      
REMARK 465     ARG B   210                                                      
REMARK 465     LYS B   211                                                      
REMARK 465     HIS B   212                                                      
REMARK 465     LYS B   213                                                      
REMARK 465     PRO B   441                                                      
REMARK 465     THR B   442                                                      
REMARK 465     ASP B   443                                                      
REMARK 465     ILE B   444                                                      
REMARK 465     ASN B   445                                                      
REMARK 465     ILE B   446                                                      
REMARK 465     HIS B   671                                                      
REMARK 465     HIS B   672                                                      
REMARK 465     HIS B   673                                                      
REMARK 465     GLY H    29                                                      
REMARK 465     PHE H    30                                                      
REMARK 465     GLY H    31                                                      
REMARK 465     LYS H    32                                                      
REMARK 465     ARG H    33                                                      
REMARK 465     ARG H    34                                                      
REMARK 465     HIS H    35                                                      
REMARK 465     PRO H    36                                                      
REMARK 465     LYS H    37                                                      
REMARK 465     ALA H   192                                                      
REMARK 465     ALA H   193                                                      
REMARK 465     LYS H   194                                                      
REMARK 465     SER H   195                                                      
REMARK 465     GLY H   196                                                      
REMARK 465     GLY H   197                                                      
REMARK 480                                                                      
REMARK 480 ZERO OCCUPANCY ATOM                                                  
REMARK 480 THE FOLLOWING RESIDUES HAVE ATOMS MODELED WITH ZERO                  
REMARK 480 OCCUPANCY. THE LOCATION AND PROPERTIES OF THESE ATOMS                
REMARK 480 MAY NOT BE RELIABLE. (M=MODEL NUMBER; RES=RESIDUE NAME;              
REMARK 480 C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):         
REMARK 480   M RES C SSEQI ATOMS                                                
REMARK 480     ARG A  410   CB   CG   CD   NE   CZ   NH1  NH2                   
REMARK 480     LYS A  458   CB   CG   CD   CE   NZ                              
REMARK 480     ARG A  460   CB   CG   CD   NE   CZ   NH1  NH2                   
REMARK 480     ARG B  410   CB   CG   CD   NE   CZ   NH1  NH2                   
REMARK 480     LYS B  458   CB   CG   CD   CE   NZ                              
REMARK 480     ARG B  460   CB   CG   CD   NE   CZ   NH1  NH2                   
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   O    THR A   527     N    GLN A   529              2.15            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND LENGTHS                                      
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,2(A3,1X,A1,I4,A1,1X,A4,3X),1X,F6.3)               
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   RES CSSEQI ATM2   DEVIATION                     
REMARK 500    ARG A 460   CA    ARG A 460   CB     -0.210                       
REMARK 500    CYS B 218   CB    CYS B 218   SG     -0.102                       
REMARK 500    ARG B 410   CA    ARG B 410   CB     -0.142                       
REMARK 500    LYS B 458   CA    LYS B 458   CB     -0.147                       
REMARK 500    ARG B 460   CA    ARG B 460   CB     -0.231                       
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500    LYS A 458   CB  -  CA  -  C   ANGL. DEV. = -14.4 DEGREES          
REMARK 500    ARG A 460   N   -  CA  -  CB  ANGL. DEV. =  12.2 DEGREES          
REMARK 500    LEU B 299   CA  -  CB  -  CG  ANGL. DEV. =  18.2 DEGREES          
REMARK 500    ARG B 460   N   -  CA  -  CB  ANGL. DEV. = -19.3 DEGREES          
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    GLN A 228       82.50     21.52                                   
REMARK 500    GLN A 240       45.01    -82.23                                   
REMARK 500    ILE A 276     -102.20    -11.68                                   
REMARK 500    LYS A 277      -74.13      8.33                                   
REMARK 500    ALA A 311       32.88   -145.07                                   
REMARK 500    ASP A 362       -8.80     70.25                                   
REMARK 500    HIS A 430      -90.73   -107.82                                   
REMARK 500    ASP A 431       77.41   -117.05                                   
REMARK 500    LYS A 458       53.27   -112.43                                   
REMARK 500    ARG A 460     -162.63     56.18                                   
REMARK 500    ILE A 469     -161.12     63.49                                   
REMARK 500    SER A 487      -32.59   -138.94                                   
REMARK 500    ASN A 488       32.99    -85.99                                   
REMARK 500    CYS A 500      -37.22   -131.23                                   
REMARK 500    THR A 527       50.22   -106.63                                   
REMARK 500    LYS A 528       22.76    -12.29                                   
REMARK 500    SER A 542        2.44    -62.94                                   
REMARK 500    CYS A 612      103.95    -58.26                                   
REMARK 500    ARG A 613      -94.85    -43.80                                   
REMARK 500    SER B 224     -156.81   -129.03                                   
REMARK 500    GLN B 228       72.95     38.52                                   
REMARK 500    GLN B 240       49.69    -71.90                                   
REMARK 500    ILE B 276      -55.35   -133.52                                   
REMARK 500    ASN B 292       42.81   -106.72                                   
REMARK 500    LYS B 295      -62.20   -103.62                                   
REMARK 500    GLN B 307      -52.49     63.08                                   
REMARK 500    GLU B 308       51.85     27.33                                   
REMARK 500    ASP B 377      -71.15    -57.87                                   
REMARK 500    HIS B 430      -80.05   -116.46                                   
REMARK 500    LYS B 458       66.41    -69.49                                   
REMARK 500    ARG B 460      -97.86    -61.21                                   
REMARK 500    SER B 461      108.18   -167.07                                   
REMARK 500    ILE B 469     -171.20     59.95                                   
REMARK 500    LEU B 480       65.34   -110.37                                   
REMARK 500    PRO B 485       30.26    -97.53                                   
REMARK 500    ASN B 576       45.39   -142.75                                   
REMARK 500    PRO B 627      115.02    -30.18                                   
REMARK 500    HIS B 669      -71.90   -127.34                                   
REMARK 500    ALA H  58     -103.89   -103.94                                   
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: NON-CIS, NON-TRANS                                         
REMARK 500                                                                      
REMARK 500 THE FOLLOWING PEPTIDE BONDS DEVIATE SIGNIFICANTLY FROM BOTH          
REMARK 500 CIS AND TRANS CONFORMATION.  CIS BONDS, IF ANY, ARE LISTED           
REMARK 500 ON CISPEP RECORDS.  TRANS IS DEFINED AS 180 +/- 30 AND               
REMARK 500 CIS IS DEFINED AS 0 +/- 30 DEGREES.                                  
REMARK 500                                 MODEL     OMEGA                      
REMARK 500 GLY A  275     ILE A  276                  149.82                    
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CHIRAL CENTERS                                             
REMARK 500                                                                      
REMARK 500 UNEXPECTED CONFIGURATION OF THE FOLLOWING CHIRAL                     
REMARK 500 CENTER(S) USING IMPROPER CA--C--CB--N CHIRALITY                      
REMARK 500 FOR AMINO ACIDS AND C1'--O4'--N1(N9)--C2' FOR                        
REMARK 500 NUCLEIC ACIDS OR EQUIVALENT ANGLE                                    
REMARK 500 M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN                            
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE                   
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,6X,F5.1,6X,A1,10X,A1,3X,A16)       
REMARK 500                                                                      
REMARK 500  M RES CSSEQI    IMPROPER   EXPECTED   FOUND DETAILS                 
REMARK 500    ARG A 460        24.1      L          L   OUTSIDE RANGE           
REMARK 500    LYS A 528        24.9      L          L   OUTSIDE RANGE           
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 620                                                                      
REMARK 620 METAL COORDINATION                                                   
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):                             
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              ZN H 400  ZN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 ASP B 383   OD2                                                    
REMARK 620 2 HIS H 140   NE2 103.2                                              
REMARK 620 3 ASP H 147   OD1 138.4  99.2                                        
REMARK 620 4 HIS H 182   ND1  98.0 105.5 109.2                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              CA H 401  CA                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 GLU H  89   OE1                                                    
REMARK 620 2 GLU H  89   OE2  55.8                                              
REMARK 620 3 GLU H  90   OE1  72.7  83.1                                        
REMARK 620 4 GLU H  90   OE2 119.3  86.4  55.5                                  
REMARK 620 5 ASP H  95   OD1 140.3 159.5  90.7  74.1                            
REMARK 620 6 ASP H  95   OD2  85.1 140.4  79.3 111.2  56.0                      
REMARK 620 7 THR H 125   O    88.4 104.9 150.7 151.1  90.0  76.8                
REMARK 620 8 GLU H 126   OE2 145.0  91.4 119.3  63.8  74.6 128.1  89.1          
REMARK 620 N                    1     2     3     4     5     6     7           
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              CA H 402  CA                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 GLU H  90   OE2                                                    
REMARK 620 2 GLU H 126   OE1 120.1                                              
REMARK 620 3 GLU H 126   OE2  64.1  56.4                                        
REMARK 620 4 ASP H 129   OD1 158.5  72.9 123.6                                  
REMARK 620 5 ASP H 131   OD2 104.2 128.1 156.9  74.9                            
REMARK 620 N                    1     2     3     4                             
REMARK 800                                                                      
REMARK 800 SITE                                                                 
REMARK 800 SITE_IDENTIFIER: AC1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE ZN H 400                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CA H 401                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CA H 402                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE ZN A 902                  
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: 3HO3   RELATED DB: PDB                                   
REMARK 900 RELATED ID: 3HO4   RELATED DB: PDB                                   
DBREF  3HO5 A  193   667  UNP    Q96QV1   HHIP_HUMAN     193    667             
DBREF  3HO5 B  193   667  UNP    Q96QV1   HHIP_HUMAN     193    667             
DBREF  3HO5 H   29   197  UNP    Q15465   SHH_HUMAN       29    197             
SEQADV 3HO5 HIS A  668  UNP  Q96QV1              EXPRESSION TAG                 
SEQADV 3HO5 HIS A  669  UNP  Q96QV1              EXPRESSION TAG                 
SEQADV 3HO5 HIS A  670  UNP  Q96QV1              EXPRESSION TAG                 
SEQADV 3HO5 HIS A  671  UNP  Q96QV1              EXPRESSION TAG                 
SEQADV 3HO5 HIS A  672  UNP  Q96QV1              EXPRESSION TAG                 
SEQADV 3HO5 HIS A  673  UNP  Q96QV1              EXPRESSION TAG                 
SEQADV 3HO5 HIS B  668  UNP  Q96QV1              EXPRESSION TAG                 
SEQADV 3HO5 HIS B  669  UNP  Q96QV1              EXPRESSION TAG                 
SEQADV 3HO5 HIS B  670  UNP  Q96QV1              EXPRESSION TAG                 
SEQADV 3HO5 HIS B  671  UNP  Q96QV1              EXPRESSION TAG                 
SEQADV 3HO5 HIS B  672  UNP  Q96QV1              EXPRESSION TAG                 
SEQADV 3HO5 HIS B  673  UNP  Q96QV1              EXPRESSION TAG                 
SEQRES   1 A  481  SER ASN TYR LEU ASP GLN MET GLU GLU TYR ASP LYS VAL          
SEQRES   2 A  481  GLU GLU ILE SER ARG LYS HIS LYS HIS ASN CYS PHE CYS          
SEQRES   3 A  481  ILE GLN GLU VAL VAL SER GLY LEU ARG GLN PRO VAL GLY          
SEQRES   4 A  481  ALA LEU HIS SER GLY ASP GLY SER GLN ARG LEU PHE ILE          
SEQRES   5 A  481  LEU GLU LYS GLU GLY TYR VAL LYS ILE LEU THR PRO GLU          
SEQRES   6 A  481  GLY GLU ILE PHE LYS GLU PRO TYR LEU ASP ILE HIS LYS          
SEQRES   7 A  481  LEU VAL GLN SER GLY ILE LYS GLY GLY ASP GLU ARG GLY          
SEQRES   8 A  481  LEU LEU SER LEU ALA PHE HIS PRO ASN TYR LYS LYS ASN          
SEQRES   9 A  481  GLY LYS LEU TYR VAL SER TYR THR THR ASN GLN GLU ARG          
SEQRES  10 A  481  TRP ALA ILE GLY PRO HIS ASP HIS ILE LEU ARG VAL VAL          
SEQRES  11 A  481  GLU TYR THR VAL SER ARG LYS ASN PRO HIS GLN VAL ASP          
SEQRES  12 A  481  LEU ARG THR ALA ARG VAL PHE LEU GLU VAL ALA GLU LEU          
SEQRES  13 A  481  HIS ARG LYS HIS LEU GLY GLY GLN LEU LEU PHE GLY PRO          
SEQRES  14 A  481  ASP GLY PHE LEU TYR ILE ILE LEU GLY ASP GLY MET ILE          
SEQRES  15 A  481  THR LEU ASP ASP MET GLU GLU MET ASP GLY LEU SER ASP          
SEQRES  16 A  481  PHE THR GLY SER VAL LEU ARG LEU ASP VAL ASP THR ASP          
SEQRES  17 A  481  MET CYS ASN VAL PRO TYR SER ILE PRO ARG SER ASN PRO          
SEQRES  18 A  481  HIS PHE ASN SER THR ASN GLN PRO PRO GLU VAL PHE ALA          
SEQRES  19 A  481  HIS GLY LEU HIS ASP PRO GLY ARG CYS ALA VAL ASP ARG          
SEQRES  20 A  481  HIS PRO THR ASP ILE ASN ILE ASN LEU THR ILE LEU CYS          
SEQRES  21 A  481  SER ASP SER ASN GLY LYS ASN ARG SER SER ALA ARG ILE          
SEQRES  22 A  481  LEU GLN ILE ILE LYS GLY LYS ASP TYR GLU SER GLU PRO          
SEQRES  23 A  481  SER LEU LEU GLU PHE LYS PRO PHE SER ASN GLY PRO LEU          
SEQRES  24 A  481  VAL GLY GLY PHE VAL TYR ARG GLY CYS GLN SER GLU ARG          
SEQRES  25 A  481  LEU TYR GLY SER TYR VAL PHE GLY ASP ARG ASN GLY ASN          
SEQRES  26 A  481  PHE LEU THR LEU GLN GLN SER PRO VAL THR LYS GLN TRP          
SEQRES  27 A  481  GLN GLU LYS PRO LEU CYS LEU GLY THR SER GLY SER CYS          
SEQRES  28 A  481  ARG GLY TYR PHE SER GLY HIS ILE LEU GLY PHE GLY GLU          
SEQRES  29 A  481  ASP GLU LEU GLY GLU VAL TYR ILE LEU SER SER SER LYS          
SEQRES  30 A  481  SER MET THR GLN THR HIS ASN GLY LYS LEU TYR LYS ILE          
SEQRES  31 A  481  VAL ASP PRO LYS ARG PRO LEU MET PRO GLU GLU CYS ARG          
SEQRES  32 A  481  ALA THR VAL GLN PRO ALA GLN THR LEU THR SER GLU CYS          
SEQRES  33 A  481  SER ARG LEU CYS ARG ASN GLY TYR CYS THR PRO THR GLY          
SEQRES  34 A  481  LYS CYS CYS CYS SER PRO GLY TRP GLU GLY ASP PHE CYS          
SEQRES  35 A  481  ARG THR ALA LYS CYS GLU PRO ALA CYS ARG HIS GLY GLY          
SEQRES  36 A  481  VAL CYS VAL ARG PRO ASN LYS CYS LEU CYS LYS LYS GLY          
SEQRES  37 A  481  TYR LEU GLY PRO GLN CYS GLU HIS HIS HIS HIS HIS HIS          
SEQRES   1 B  481  SER ASN TYR LEU ASP GLN MET GLU GLU TYR ASP LYS VAL          
SEQRES   2 B  481  GLU GLU ILE SER ARG LYS HIS LYS HIS ASN CYS PHE CYS          
SEQRES   3 B  481  ILE GLN GLU VAL VAL SER GLY LEU ARG GLN PRO VAL GLY          
SEQRES   4 B  481  ALA LEU HIS SER GLY ASP GLY SER GLN ARG LEU PHE ILE          
SEQRES   5 B  481  LEU GLU LYS GLU GLY TYR VAL LYS ILE LEU THR PRO GLU          
SEQRES   6 B  481  GLY GLU ILE PHE LYS GLU PRO TYR LEU ASP ILE HIS LYS          
SEQRES   7 B  481  LEU VAL GLN SER GLY ILE LYS GLY GLY ASP GLU ARG GLY          
SEQRES   8 B  481  LEU LEU SER LEU ALA PHE HIS PRO ASN TYR LYS LYS ASN          
SEQRES   9 B  481  GLY LYS LEU TYR VAL SER TYR THR THR ASN GLN GLU ARG          
SEQRES  10 B  481  TRP ALA ILE GLY PRO HIS ASP HIS ILE LEU ARG VAL VAL          
SEQRES  11 B  481  GLU TYR THR VAL SER ARG LYS ASN PRO HIS GLN VAL ASP          
SEQRES  12 B  481  LEU ARG THR ALA ARG VAL PHE LEU GLU VAL ALA GLU LEU          
SEQRES  13 B  481  HIS ARG LYS HIS LEU GLY GLY GLN LEU LEU PHE GLY PRO          
SEQRES  14 B  481  ASP GLY PHE LEU TYR ILE ILE LEU GLY ASP GLY MET ILE          
SEQRES  15 B  481  THR LEU ASP ASP MET GLU GLU MET ASP GLY LEU SER ASP          
SEQRES  16 B  481  PHE THR GLY SER VAL LEU ARG LEU ASP VAL ASP THR ASP          
SEQRES  17 B  481  MET CYS ASN VAL PRO TYR SER ILE PRO ARG SER ASN PRO          
SEQRES  18 B  481  HIS PHE ASN SER THR ASN GLN PRO PRO GLU VAL PHE ALA          
SEQRES  19 B  481  HIS GLY LEU HIS ASP PRO GLY ARG CYS ALA VAL ASP ARG          
SEQRES  20 B  481  HIS PRO THR ASP ILE ASN ILE ASN LEU THR ILE LEU CYS          
SEQRES  21 B  481  SER ASP SER ASN GLY LYS ASN ARG SER SER ALA ARG ILE          
SEQRES  22 B  481  LEU GLN ILE ILE LYS GLY LYS ASP TYR GLU SER GLU PRO          
SEQRES  23 B  481  SER LEU LEU GLU PHE LYS PRO PHE SER ASN GLY PRO LEU          
SEQRES  24 B  481  VAL GLY GLY PHE VAL TYR ARG GLY CYS GLN SER GLU ARG          
SEQRES  25 B  481  LEU TYR GLY SER TYR VAL PHE GLY ASP ARG ASN GLY ASN          
SEQRES  26 B  481  PHE LEU THR LEU GLN GLN SER PRO VAL THR LYS GLN TRP          
SEQRES  27 B  481  GLN GLU LYS PRO LEU CYS LEU GLY THR SER GLY SER CYS          
SEQRES  28 B  481  ARG GLY TYR PHE SER GLY HIS ILE LEU GLY PHE GLY GLU          
SEQRES  29 B  481  ASP GLU LEU GLY GLU VAL TYR ILE LEU SER SER SER LYS          
SEQRES  30 B  481  SER MET THR GLN THR HIS ASN GLY LYS LEU TYR LYS ILE          
SEQRES  31 B  481  VAL ASP PRO LYS ARG PRO LEU MET PRO GLU GLU CYS ARG          
SEQRES  32 B  481  ALA THR VAL GLN PRO ALA GLN THR LEU THR SER GLU CYS          
SEQRES  33 B  481  SER ARG LEU CYS ARG ASN GLY TYR CYS THR PRO THR GLY          
SEQRES  34 B  481  LYS CYS CYS CYS SER PRO GLY TRP GLU GLY ASP PHE CYS          
SEQRES  35 B  481  ARG THR ALA LYS CYS GLU PRO ALA CYS ARG HIS GLY GLY          
SEQRES  36 B  481  VAL CYS VAL ARG PRO ASN LYS CYS LEU CYS LYS LYS GLY          
SEQRES  37 B  481  TYR LEU GLY PRO GLN CYS GLU HIS HIS HIS HIS HIS HIS          
SEQRES   1 H  169  GLY PHE GLY LYS ARG ARG HIS PRO LYS LYS LEU THR PRO          
SEQRES   2 H  169  LEU ALA TYR LYS GLN PHE ILE PRO ASN VAL ALA GLU LYS          
SEQRES   3 H  169  THR LEU GLY ALA SER GLY ARG TYR GLU GLY LYS ILE SER          
SEQRES   4 H  169  ARG ASN SER GLU ARG PHE LYS GLU LEU THR PRO ASN TYR          
SEQRES   5 H  169  ASN PRO ASP ILE ILE PHE LYS ASP GLU GLU ASN THR GLY          
SEQRES   6 H  169  ALA ASP ARG LEU MET THR GLN ARG CYS LYS ASP LYS LEU          
SEQRES   7 H  169  ASN ALA LEU ALA ILE SER VAL MET ASN GLN TRP PRO GLY          
SEQRES   8 H  169  VAL LYS LEU ARG VAL THR GLU GLY TRP ASP GLU ASP GLY          
SEQRES   9 H  169  HIS HIS SER GLU GLU SER LEU HIS TYR GLU GLY ARG ALA          
SEQRES  10 H  169  VAL ASP ILE THR THR SER ASP ARG ASP ARG SER LYS TYR          
SEQRES  11 H  169  GLY MET LEU ALA ARG LEU ALA VAL GLU ALA GLY PHE ASP          
SEQRES  12 H  169  TRP VAL TYR TYR GLU SER LYS ALA HIS ILE HIS CYS SER          
SEQRES  13 H  169  VAL LYS ALA GLU ASN SER VAL ALA ALA LYS SER GLY GLY          
HET     ZN  H 400       1                                                       
HET     CA  H 401       1                                                       
HET     CA  H 402       1                                                       
HET     ZN  A 902       1                                                       
HETNAM      ZN ZINC ION                                                         
HETNAM      CA CALCIUM ION                                                      
FORMUL   4   ZN    2(ZN 2+)                                                     
FORMUL   5   CA    2(CA 2+)                                                     
HELIX    1   1 ASN A  292  GLY A  297  1                                   6    
HELIX    2   2 PRO A  361  GLY A  363  5                                   3    
HELIX    3   3 THR A  375  MET A  382  1                                   8    
HELIX    4   4 PRO A  591  ARG A  595  5                                   5    
HELIX    5   5 SER A  606  CYS A  612  1                                   7    
HELIX    6   6 ASN B  292  GLY B  297  1                                   6    
HELIX    7   7 THR B  375  GLU B  381  1                                   7    
HELIX    8   8 SER B  568  HIS B  575  1                                   8    
HELIX    9   9 PRO B  591  ARG B  595  5                                   5    
HELIX   10  10 SER B  606  CYS B  612  1                                   7    
HELIX   11  11 GLY H   93  ASP H   95  5                                   3    
HELIX   12  12 THR H   99  TRP H  117  1                                  19    
HELIX   13  13 ASP H  154  SER H  156  5                                   3    
HELIX   14  14 LYS H  157  GLY H  169  1                                  13    
SHEET    1   A 4 CYS A 218  LEU A 226  0                                        
SHEET    2   A 4 GLY A 577  VAL A 583 -1  O  VAL A 583   N  CYS A 218           
SHEET    3   A 4 VAL A 562  SER A 567 -1  N  ILE A 564   O  TYR A 580           
SHEET    4   A 4 HIS A 550  GLU A 556 -1  N  HIS A 550   O  SER A 567           
SHEET    1   B 4 PRO A 229  LEU A 233  0                                        
SHEET    2   B 4 LEU A 242  GLU A 246 -1  O  PHE A 243   N  LEU A 233           
SHEET    3   B 4 TYR A 250  LEU A 254 -1  O  LEU A 254   N  LEU A 242           
SHEET    4   B 4 LEU A 266  ASP A 267 -1  O  LEU A 266   N  VAL A 251           
SHEET    1   C 4 LEU A 284  PHE A 289  0                                        
SHEET    2   C 4 LYS A 298  THR A 305 -1  O  SER A 302   N  SER A 286           
SHEET    3   C 4 HIS A 317  VAL A 326 -1  O  ARG A 320   N  TYR A 303           
SHEET    4   C 4 VAL A 334  GLU A 347 -1  O  PHE A 342   N  VAL A 321           
SHEET    1   D 4 GLY A 354  PHE A 359  0                                        
SHEET    2   D 4 LEU A 365  LEU A 369 -1  O  TYR A 366   N  LEU A 358           
SHEET    3   D 4 SER A 391  LEU A 395 -1  O  LEU A 395   N  LEU A 365           
SHEET    4   D 4 VAL A 424  HIS A 427 -1  O  PHE A 425   N  VAL A 392           
SHEET    1   E 4 ALA A 436  ASP A 438  0                                        
SHEET    2   E 4 THR A 449  ASP A 454 -1  O  THR A 449   N  ASP A 438           
SHEET    3   E 4 SER A 462  GLN A 467 -1  O  ARG A 464   N  CYS A 452           
SHEET    4   E 4 LEU A 481  PHE A 483 -1  O  PHE A 483   N  ALA A 463           
SHEET    1   F 4 GLY A 493  VAL A 496  0                                        
SHEET    2   F 4 TYR A 509  GLY A 512 -1  O  VAL A 510   N  PHE A 495           
SHEET    3   F 4 PHE A 518  GLN A 523 -1  O  LEU A 519   N  PHE A 511           
SHEET    4   F 4 TRP A 530  GLU A 532 -1  O  GLN A 531   N  GLN A 522           
SHEET    1   G 2 TRP A 629  GLU A 630  0                                        
SHEET    2   G 2 THR A 636  ALA A 637 -1  O  THR A 636   N  GLU A 630           
SHEET    1   H 2 VAL A 648  ARG A 651  0                                        
SHEET    2   H 2 LYS A 654  LEU A 656 -1  O  LEU A 656   N  VAL A 648           
SHEET    1   I 4 CYS B 218  LEU B 226  0                                        
SHEET    2   I 4 GLY B 577  VAL B 583 -1  O  GLY B 577   N  LEU B 226           
SHEET    3   I 4 VAL B 562  SER B 567 -1  N  ILE B 564   O  TYR B 580           
SHEET    4   I 4 HIS B 550  GLU B 556 -1  N  LEU B 552   O  LEU B 565           
SHEET    1   J 4 PRO B 229  LEU B 233  0                                        
SHEET    2   J 4 LEU B 242  GLU B 246 -1  O  PHE B 243   N  LEU B 233           
SHEET    3   J 4 TYR B 250  LEU B 254 -1  O  TYR B 250   N  GLU B 246           
SHEET    4   J 4 LEU B 266  ASP B 267 -1  O  LEU B 266   N  VAL B 251           
SHEET    1   K 4 LEU B 284  PHE B 289  0                                        
SHEET    2   K 4 LYS B 298  THR B 305 -1  O  SER B 302   N  LEU B 285           
SHEET    3   K 4 HIS B 317  VAL B 326 -1  O  ARG B 320   N  TYR B 303           
SHEET    4   K 4 VAL B 334  GLU B 347 -1  O  ARG B 340   N  GLU B 323           
SHEET    1   L 4 GLY B 354  PHE B 359  0                                        
SHEET    2   L 4 LEU B 365  LEU B 369 -1  O  TYR B 366   N  LEU B 358           
SHEET    3   L 4 SER B 391  LEU B 395 -1  O  LEU B 395   N  LEU B 365           
SHEET    4   L 4 VAL B 424  HIS B 427 -1  O  PHE B 425   N  VAL B 392           
SHEET    1   M 4 ALA B 436  ASP B 438  0                                        
SHEET    2   M 4 THR B 449  ASP B 454 -1  O  THR B 449   N  ASP B 438           
SHEET    3   M 4 SER B 462  GLN B 467 -1  O  SER B 462   N  ASP B 454           
SHEET    4   M 4 LEU B 481  PHE B 483 -1  O  PHE B 483   N  ALA B 463           
SHEET    1   N 4 GLY B 493  VAL B 496  0                                        
SHEET    2   N 4 TYR B 509  GLY B 512 -1  O  VAL B 510   N  PHE B 495           
SHEET    3   N 4 PHE B 518  GLN B 523 -1  O  LEU B 519   N  PHE B 511           
SHEET    4   N 4 TRP B 530  LEU B 535 -1  O  LYS B 533   N  THR B 520           
SHEET    1   O 2 GLY B 615  CYS B 617  0                                        
SHEET    2   O 2 CYS B 623  CYS B 625 -1  O  CYS B 624   N  TYR B 616           
SHEET    1   P 2 TRP B 629  GLU B 630  0                                        
SHEET    2   P 2 THR B 636  ALA B 637 -1  O  THR B 636   N  GLU B 630           
SHEET    1   Q 2 VAL B 648  ARG B 651  0                                        
SHEET    2   Q 2 LYS B 654  LEU B 656 -1  O  LEU B 656   N  VAL B 648           
SHEET    1   R 6 PHE H  47  ILE H  48  0                                        
SHEET    2   R 6 TRP H 172  TYR H 174 -1  O  VAL H 173   N  ILE H  48           
SHEET    3   R 6 ILE H 181  SER H 184 -1  O  HIS H 182   N  TYR H 174           
SHEET    4   R 6 ALA H 145  THR H 150 -1  N  ILE H 148   O  ILE H 181           
SHEET    5   R 6 LEU H 122  GLU H 126 -1  N  ARG H 123   O  THR H 149           
SHEET    6   R 6 ILE H  84  PHE H  86  1  N  ILE H  85   O  VAL H 124           
SHEET    1   S 2 THR H  77  PRO H  78  0                                        
SHEET    2   S 2 LEU H  97  MET H  98 -1  O  MET H  98   N  THR H  77           
SSBOND   1 CYS A  216    CYS A  536                          1555   1555  2.04  
SSBOND   2 CYS A  218    CYS A  543                          1555   1555  2.04  
SSBOND   3 CYS A  402    CYS A  624                          1555   1555  2.03  
SSBOND   4 CYS A  435    CYS A  452                          1555   1555  2.04  
SSBOND   5 CYS A  500    CYS A  594                          1555   1555  2.03  
SSBOND   6 CYS A  608    CYS A  617                          1555   1555  2.04  
SSBOND   7 CYS A  612    CYS A  623                          1555   1555  2.04  
SSBOND   8 CYS A  625    CYS A  634                          1555   1555  2.03  
SSBOND   9 CYS A  639    CYS A  649                          1555   1555  2.04  
SSBOND  10 CYS A  643    CYS A  655                          1555   1555  2.03  
SSBOND  11 CYS A  657    CYS A  666                          1555   1555  2.04  
SSBOND  12 CYS B  216    CYS B  536                          1555   1555  2.04  
SSBOND  13 CYS B  218    CYS B  543                          1555   1555  2.05  
SSBOND  14 CYS B  402    CYS B  624                          1555   1555  2.03  
SSBOND  15 CYS B  435    CYS B  452                          1555   1555  2.03  
SSBOND  16 CYS B  500    CYS B  594                          1555   1555  2.04  
SSBOND  17 CYS B  608    CYS B  617                          1555   1555  2.03  
SSBOND  18 CYS B  612    CYS B  623                          1555   1555  2.04  
SSBOND  19 CYS B  625    CYS B  634                          1555   1555  2.02  
SSBOND  20 CYS B  639    CYS B  649                          1555   1555  2.04  
SSBOND  21 CYS B  643    CYS B  655                          1555   1555  2.05  
SSBOND  22 CYS B  657    CYS B  666                          1555   1555  2.03  
LINK         OD2 ASP B 383                ZN    ZN H 400     1555   1555  2.17  
LINK         OE1 GLU H  89                CA    CA H 401     1555   1555  2.33  
LINK         OE2 GLU H  89                CA    CA H 401     1555   1555  2.34  
LINK         OE1 GLU H  90                CA    CA H 401     1555   1555  2.34  
LINK         OE2 GLU H  90                CA    CA H 401     1555   1555  2.35  
LINK         OE2 GLU H  90                CA    CA H 402     1555   1555  2.33  
LINK         OD1 ASP H  95                CA    CA H 401     1555   1555  2.33  
LINK         OD2 ASP H  95                CA    CA H 401     1555   1555  2.33  
LINK         O   THR H 125                CA    CA H 401     1555   1555  2.36  
LINK         OE1 GLU H 126                CA    CA H 402     1555   1555  2.33  
LINK         OE2 GLU H 126                CA    CA H 401     1555   1555  2.34  
LINK         OE2 GLU H 126                CA    CA H 402     1555   1555  2.33  
LINK         OD1 ASP H 129                CA    CA H 402     1555   1555  2.32  
LINK         OD2 ASP H 131                CA    CA H 402     1555   1555  2.34  
LINK         NE2 HIS H 140                ZN    ZN H 400     1555   1555  2.07  
LINK         OD1 ASP H 147                ZN    ZN H 400     1555   1555  2.00  
LINK         ND1 HIS H 182                ZN    ZN H 400     1555   1555  2.07  
LINK         OD1 ASP A 383                ZN    ZN A 902     1555   1555  2.56  
CISPEP   1 ILE H   48    PRO H   49          0         3.29                     
SITE     1 AC1  4 ASP B 383  HIS H 140  ASP H 147  HIS H 182                    
SITE     1 AC2  5 GLU H  89  GLU H  90  ASP H  95  THR H 125                    
SITE     2 AC2  5 GLU H 126                                                     
SITE     1 AC3  4 GLU H  90  GLU H 126  ASP H 129  ASP H 131                    
SITE     1 AC4  1 ASP A 383                                                     
CRYST1  101.618  101.618  302.830  90.00  90.00 120.00 P 31 2 1     12          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.009841  0.005682  0.000000        0.00000                         
SCALE2      0.000000  0.011363  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.003302        0.00000                         
ATOM      1  N   HIS A 214      -9.620  21.274  70.320  1.00123.07           N  
ATOM      2  CA  HIS A 214      -9.462  22.268  69.218  1.00122.43           C  
ATOM      3  C   HIS A 214      -8.593  21.702  68.094  1.00115.38           C  
ATOM      4  O   HIS A 214      -7.945  20.667  68.263  1.00111.14           O  
ATOM      5  CB  HIS A 214      -8.847  23.566  69.756  1.00130.75           C  
ATOM      6  CG  HIS A 214      -9.634  24.797  69.419  1.00137.67           C  
ATOM      7  ND1 HIS A 214     -10.040  25.098  68.135  1.00140.80           N  
ATOM      8  CD2 HIS A 214     -10.088  25.805  70.203  1.00138.95           C  
ATOM      9  CE1 HIS A 214     -10.712  26.236  68.143  1.00141.79           C  
ATOM     10  NE2 HIS A 214     -10.755  26.686  69.385  1.00141.60           N  
ATOM     11  N   ASN A 215      -8.577  22.383  66.950  1.00111.60           N  
ATOM     12  CA  ASN A 215      -7.804  21.923  65.797  1.00108.13           C  
ATOM     13  C   ASN A 215      -6.713  22.886  65.320  1.00105.08           C  
ATOM     14  O   ASN A 215      -6.251  22.801  64.176  1.00105.33           O  
ATOM     15  CB  ASN A 215      -8.743  21.557  64.650  1.00108.75           C  
ATOM     16  CG  ASN A 215      -9.508  20.271  64.914  1.00110.13           C  
ATOM     17  OD1 ASN A 215      -8.953  19.287  65.411  1.00109.75           O  
ATOM     18  ND2 ASN A 215     -10.790  20.272  64.571  1.00111.63           N  
ATOM     19  N   CYS A 216      -6.295  23.784  66.210  1.00 99.69           N  
ATOM     20  CA  CYS A 216      -5.299  24.791  65.884  1.00 95.99           C  
ATOM     21  C   CYS A 216      -3.904  24.204  65.890  1.00 94.09           C  
ATOM     22  O   CYS A 216      -3.661  23.165  66.501  1.00 94.24           O  
ATOM     23  CB  CYS A 216      -5.355  25.936  66.895  1.00 99.65           C  
ATOM     24  SG  CYS A 216      -6.791  27.023  66.776  1.00104.03           S  
ATOM     25  N   PHE A 217      -2.981  24.879  65.216  1.00 92.78           N  
ATOM     26  CA  PHE A 217      -1.567  24.555  65.358  1.00 90.92           C  
ATOM     27  C   PHE A 217      -0.907  25.518  66.338  1.00 92.75           C  
ATOM     28  O   PHE A 217      -1.588  26.312  66.993  1.00 91.45           O  
ATOM     29  CB  PHE A 217      -0.864  24.480  63.999  1.00 87.54           C  
ATOM     30  CG  PHE A 217      -1.203  23.237  63.227  1.00 85.14           C  
ATOM     31  CD1 PHE A 217      -2.445  23.091  62.631  1.00 87.23           C  
ATOM     32  CD2 PHE A 217      -0.295  22.195  63.130  1.00 83.81           C  
ATOM     33  CE1 PHE A 217      -2.772  21.922  61.943  1.00 89.05           C  
ATOM     34  CE2 PHE A 217      -0.607  21.031  62.433  1.00 83.00           C  
ATOM     35  CZ  PHE A 217      -1.841  20.895  61.844  1.00 86.71           C  
ATOM     36  N   CYS A 218       0.413  25.449  66.426  1.00 96.57           N  
ATOM     37  CA  CYS A 218       1.126  25.869  67.619  1.00 95.30           C  
ATOM     38  C   CYS A 218       2.533  26.342  67.248  1.00 97.81           C  
ATOM     39  O   CYS A 218       3.274  25.598  66.588  1.00 99.69           O  
ATOM     40  CB  CYS A 218       1.247  24.626  68.475  1.00 96.84           C  
ATOM     41  SG  CYS A 218       1.495  24.882  70.158  1.00102.74           S  
ATOM     42  N   ILE A 219       2.933  27.551  67.639  1.00 95.49           N  
ATOM     43  CA  ILE A 219       4.323  27.951  67.330  1.00 96.44           C  
ATOM     44  C   ILE A 219       5.236  28.058  68.540  1.00 93.09           C  
ATOM     45  O   ILE A 219       4.798  28.438  69.627  1.00 97.72           O  
ATOM     46  CB  ILE A 219       4.452  29.186  66.404  1.00 98.44           C  
ATOM     47  CG1 ILE A 219       3.836  30.423  67.043  1.00101.86           C  
ATOM     48  CG2 ILE A 219       3.827  28.882  65.027  1.00 96.92           C  
ATOM     49  CD1 ILE A 219       2.356  30.635  66.662  1.00106.49           C  
ATOM     50  N   GLN A 220       6.497  27.689  68.327  1.00 88.37           N  
ATOM     51  CA  GLN A 220       7.499  27.575  69.385  1.00 89.74           C  
ATOM     52  C   GLN A 220       8.809  28.278  68.979  1.00 93.56           C  
ATOM     53  O   GLN A 220       9.345  28.042  67.882  1.00 94.30           O  
ATOM     54  CB  GLN A 220       7.773  26.097  69.663  1.00 89.33           C  
ATOM     55  CG  GLN A 220       8.560  25.840  70.923  1.00 94.27           C  
ATOM     56  CD  GLN A 220       7.676  25.706  72.141  1.00100.74           C  
ATOM     57  OE1 GLN A 220       6.818  24.820  72.199  1.00104.17           O  
ATOM     58  NE2 GLN A 220       7.885  26.575  73.134  1.00103.01           N  
ATOM     59  N   GLU A 221       9.336  29.127  69.860  1.00 92.34           N  
ATOM     60  CA  GLU A 221      10.565  29.848  69.544  1.00 90.75           C  
ATOM     61  C   GLU A 221      11.755  28.906  69.602  1.00 90.08           C  
ATOM     62  O   GLU A 221      11.984  28.272  70.629  1.00 91.07           O  
ATOM     63  CB  GLU A 221      10.764  31.009  70.500  1.00 88.49           C  
ATOM     64  CG  GLU A 221      11.779  32.027  70.036  1.00 94.56           C  
ATOM     65  CD  GLU A 221      11.927  33.189  71.012  1.00103.20           C  
ATOM     66  OE1 GLU A 221      10.900  33.815  71.379  1.00106.21           O  
ATOM     67  OE2 GLU A 221      13.077  33.480  71.409  1.00106.11           O  
ATOM     68  N   VAL A 222      12.493  28.795  68.497  1.00 88.14           N  
ATOM     69  CA  VAL A 222      13.712  27.980  68.491  1.00 89.84           C  
ATOM     70  C   VAL A 222      14.976  28.801  68.747  1.00 91.18           C  
ATOM     71  O   VAL A 222      15.772  28.438  69.607  1.00 88.27           O  
ATOM     72  CB  VAL A 222      13.909  27.176  67.194  1.00 88.81           C  
ATOM     73  CG1 VAL A 222      15.073  26.224  67.366  1.00 92.23           C  
ATOM     74  CG2 VAL A 222      12.689  26.385  66.866  1.00 93.27           C  
ATOM     75  N   VAL A 223      15.150  29.887  67.984  1.00 94.03           N  
ATOM     76  CA  VAL A 223      16.352  30.736  68.020  1.00 93.38           C  
ATOM     77  C   VAL A 223      15.965  32.207  67.866  1.00 93.74           C  
ATOM     78  O   VAL A 223      15.008  32.532  67.153  1.00 89.91           O  
ATOM     79  CB  VAL A 223      17.341  30.360  66.879  1.00 94.48           C  
ATOM     80  CG1 VAL A 223      18.403  31.445  66.661  1.00 92.87           C  
ATOM     81  CG2 VAL A 223      18.016  29.037  67.166  1.00 97.56           C  
ATOM     82  N   SER A 224      16.713  33.088  68.532  1.00 94.90           N  
ATOM     83  CA  SER A 224      16.549  34.531  68.352  1.00 95.27           C  
ATOM     84  C   SER A 224      17.887  35.219  68.084  1.00 94.52           C  
ATOM     85  O   SER A 224      18.900  34.560  67.880  1.00 97.74           O  
ATOM     86  CB  SER A 224      15.880  35.142  69.569  1.00 98.10           C  
ATOM     87  OG  SER A 224      16.616  34.811  70.727  1.00106.34           O  
ATOM     88  N   GLY A 225      17.877  36.548  68.060  1.00 91.53           N  
ATOM     89  CA  GLY A 225      19.082  37.326  67.825  1.00 88.78           C  
ATOM     90  C   GLY A 225      19.699  37.184  66.449  1.00 91.23           C  
ATOM     91  O   GLY A 225      20.875  37.494  66.263  1.00 97.38           O  
ATOM     92  N   LEU A 226      18.910  36.717  65.488  1.00 89.18           N  
ATOM     93  CA  LEU A 226      19.339  36.624  64.101  1.00 88.14           C  
ATOM     94  C   LEU A 226      19.252  37.986  63.397  1.00 91.34           C  
ATOM     95  O   LEU A 226      18.593  38.906  63.884  1.00 90.40           O  
ATOM     96  CB  LEU A 226      18.464  35.611  63.371  1.00 87.63           C  
ATOM     97  CG  LEU A 226      18.514  34.161  63.858  1.00 86.66           C  
ATOM     98  CD1 LEU A 226      17.217  33.461  63.498  1.00 83.46           C  
ATOM     99  CD2 LEU A 226      19.740  33.404  63.309  1.00 82.55           C  
ATOM    100  N   ARG A 227      19.920  38.120  62.256  1.00 93.98           N  
ATOM    101  CA  ARG A 227      19.818  39.347  61.471  1.00 97.91           C  
ATOM    102  C   ARG A 227      18.942  39.066  60.257  1.00 98.45           C  
ATOM    103  O   ARG A 227      19.270  38.189  59.464  1.00103.46           O  
ATOM    104  CB  ARG A 227      21.192  39.843  60.995  1.00 99.85           C  
ATOM    105  CG  ARG A 227      22.413  39.164  61.603  1.00103.28           C  
ATOM    106  CD  ARG A 227      23.608  39.351  60.670  1.00106.74           C  
ATOM    107  NE  ARG A 227      24.611  38.287  60.757  1.00106.77           N  
ATOM    108  CZ  ARG A 227      25.878  38.476  61.117  1.00107.22           C  
ATOM    109  NH1 ARG A 227      26.307  39.689  61.437  1.00106.69           N  
ATOM    110  NH2 ARG A 227      26.722  37.451  61.158  1.00107.81           N  
ATOM    111  N   GLN A 228      17.843  39.808  60.113  1.00 95.22           N  
ATOM    112  CA  GLN A 228      16.902  39.650  58.989  1.00 92.82           C  
ATOM    113  C   GLN A 228      16.981  38.287  58.313  1.00 89.99           C  
ATOM    114  O   GLN A 228      17.656  38.136  57.302  1.00 90.18           O  
ATOM    115  CB  GLN A 228      17.107  40.739  57.942  1.00 95.48           C  
ATOM    116  CG  GLN A 228      16.658  42.124  58.363  1.00103.28           C  
ATOM    117  CD  GLN A 228      16.340  43.013  57.165  1.00107.66           C  
ATOM    118  OE1 GLN A 228      16.964  44.069  56.968  1.00106.71           O  
ATOM    119  NE2 GLN A 228      15.370  42.580  56.347  1.00106.72           N  
ATOM    120  N   PRO A 229      16.309  37.280  58.880  1.00 91.20           N  
ATOM    121  CA  PRO A 229      16.324  35.950  58.272  1.00 93.30           C  
ATOM    122  C   PRO A 229      15.553  35.882  56.945  1.00 95.68           C  
ATOM    123  O   PRO A 229      14.596  36.630  56.734  1.00 98.49           O  
ATOM    124  CB  PRO A 229      15.659  35.082  59.332  1.00 93.12           C  
ATOM    125  CG  PRO A 229      14.785  36.011  60.077  1.00 94.74           C  
ATOM    126  CD  PRO A 229      15.518  37.311  60.119  1.00 91.92           C  
ATOM    127  N   VAL A 230      15.982  34.986  56.065  1.00 93.47           N  
ATOM    128  CA  VAL A 230      15.429  34.889  54.723  1.00 92.69           C  
ATOM    129  C   VAL A 230      14.694  33.566  54.574  1.00 92.67           C  
ATOM    130  O   VAL A 230      13.677  33.491  53.888  1.00 93.87           O  
ATOM    131  CB  VAL A 230      16.554  34.962  53.660  1.00 92.62           C  
ATOM    132  CG1 VAL A 230      15.991  35.119  52.245  1.00 93.13           C  
ATOM    133  CG2 VAL A 230      17.468  36.102  53.968  1.00 94.76           C  
ATOM    134  N   GLY A 231      15.229  32.534  55.224  1.00 92.98           N  
ATOM    135  CA  GLY A 231      14.731  31.161  55.127  1.00 93.63           C  
ATOM    136  C   GLY A 231      15.683  30.222  55.849  1.00 95.71           C  
ATOM    137  O   GLY A 231      16.681  30.666  56.413  1.00101.29           O  
ATOM    138  N   ALA A 232      15.381  28.927  55.849  1.00 94.68           N  
ATOM    139  CA  ALA A 232      16.283  27.927  56.431  1.00 95.46           C  
ATOM    140  C   ALA A 232      16.054  26.565  55.791  1.00 99.05           C  
ATOM    141  O   ALA A 232      14.919  26.219  55.443  1.00102.84           O  
ATOM    142  CB  ALA A 232      16.102  27.836  57.946  1.00 91.74           C  
ATOM    143  N   LEU A 233      17.124  25.793  55.631  1.00 95.89           N  
ATOM    144  CA  LEU A 233      16.991  24.440  55.096  1.00 96.00           C  
ATOM    145  C   LEU A 233      18.046  23.490  55.661  1.00 97.19           C  
ATOM    146  O   LEU A 233      18.881  23.889  56.483  1.00 96.64           O  
ATOM    147  CB  LEU A 233      17.010  24.443  53.559  1.00 92.04           C  
ATOM    148  CG  LEU A 233      18.332  24.511  52.802  1.00 91.21           C  
ATOM    149  CD1 LEU A 233      18.098  24.169  51.349  1.00 93.77           C  
ATOM    150  CD2 LEU A 233      18.978  25.886  52.926  1.00 96.61           C  
ATOM    151  N   HIS A 234      17.989  22.237  55.218  1.00 94.34           N  
ATOM    152  CA  HIS A 234      18.885  21.214  55.711  1.00 94.62           C  
ATOM    153  C   HIS A 234      19.803  20.724  54.607  1.00 96.32           C  
ATOM    154  O   HIS A 234      19.569  20.971  53.424  1.00 96.29           O  
ATOM    155  CB  HIS A 234      18.093  20.044  56.285  1.00 94.89           C  
ATOM    156  CG  HIS A 234      17.384  19.239  55.248  1.00 97.35           C  
ATOM    157  ND1 HIS A 234      16.038  19.377  54.992  1.00102.33           N  
ATOM    158  CD2 HIS A 234      17.834  18.298  54.388  1.00 97.15           C  
ATOM    159  CE1 HIS A 234      15.686  18.545  54.027  1.00101.31           C  
ATOM    160  NE2 HIS A 234      16.760  17.883  53.641  1.00 99.84           N  
ATOM    161  N   SER A 235      20.824  19.985  55.023  1.00 97.39           N  
ATOM    162  CA  SER A 235      21.914  19.563  54.166  1.00 95.03           C  
ATOM    163  C   SER A 235      21.605  18.281  53.403  1.00 95.10           C  
ATOM    164  O   SER A 235      22.233  17.995  52.387  1.00 94.78           O  
ATOM    165  CB  SER A 235      23.148  19.353  55.035  1.00 95.99           C  
ATOM    166  OG  SER A 235      24.239  18.931  54.256  1.00100.03           O  
ATOM    167  N   GLY A 236      20.646  17.508  53.911  1.00 96.79           N  
ATOM    168  CA  GLY A 236      20.284  16.206  53.344  1.00 92.61           C  
ATOM    169  C   GLY A 236      21.352  15.152  53.556  1.00 92.01           C  
ATOM    170  O   GLY A 236      21.354  14.118  52.888  1.00 94.27           O  
ATOM    171  N   ASP A 237      22.255  15.404  54.496  1.00 91.41           N  
ATOM    172  CA  ASP A 237      23.426  14.558  54.671  1.00 92.44           C  
ATOM    173  C   ASP A 237      23.380  13.638  55.894  1.00 94.64           C  
ATOM    174  O   ASP A 237      24.310  12.856  56.114  1.00 96.74           O  
ATOM    175  CB  ASP A 237      24.697  15.412  54.676  1.00 92.78           C  
ATOM    176  CG  ASP A 237      24.804  16.307  55.891  1.00 93.61           C  
ATOM    177  OD1 ASP A 237      23.781  16.575  56.557  1.00 94.08           O  
ATOM    178  OD2 ASP A 237      25.933  16.758  56.169  1.00 96.19           O  
ATOM    179  N   GLY A 238      22.310  13.729  56.682  1.00 93.06           N  
ATOM    180  CA  GLY A 238      22.120  12.824  57.810  1.00 93.77           C  
ATOM    181  C   GLY A 238      22.312  13.499  59.145  1.00 97.28           C  
ATOM    182  O   GLY A 238      21.672  13.128  60.134  1.00100.06           O  
ATOM    183  N   SER A 239      23.222  14.469  59.179  1.00 99.12           N  
ATOM    184  CA  SER A 239      23.321  15.396  60.297  1.00100.60           C  
ATOM    185  C   SER A 239      22.100  16.284  60.205  1.00105.13           C  
ATOM    186  O   SER A 239      21.846  16.890  59.162  1.00113.20           O  
ATOM    187  CB  SER A 239      24.575  16.256  60.174  1.00 98.44           C  
ATOM    188  OG  SER A 239      24.508  17.112  59.041  1.00 92.90           O  
ATOM    189  N   GLN A 240      21.329  16.363  61.273  1.00102.34           N  
ATOM    190  CA  GLN A 240      20.112  17.145  61.212  1.00101.05           C  
ATOM    191  C   GLN A 240      20.436  18.623  61.439  1.00101.05           C  
ATOM    192  O   GLN A 240      19.766  19.320  62.205  1.00105.12           O  
ATOM    193  CB  GLN A 240      19.085  16.602  62.202  1.00102.58           C  
ATOM    194  CG  GLN A 240      18.713  15.148  61.944  1.00103.80           C  
ATOM    195  CD  GLN A 240      18.140  14.462  63.168  1.00105.39           C  
ATOM    196  OE1 GLN A 240      17.736  15.121  64.132  1.00107.62           O  
ATOM    197  NE2 GLN A 240      18.094  13.130  63.135  1.00103.49           N  
ATOM    198  N   ARG A 241      21.490  19.080  60.768  1.00 97.96           N  
ATOM    199  CA  ARG A 241      21.867  20.487  60.740  1.00 97.16           C  
ATOM    200  C   ARG A 241      20.774  21.308  60.078  1.00 98.82           C  
ATOM    201  O   ARG A 241      20.061  20.816  59.200  1.00101.25           O  
ATOM    202  CB  ARG A 241      23.175  20.664  59.976  1.00 95.33           C  
ATOM    203  CG  ARG A 241      24.375  20.943  60.853  1.00 98.59           C  
ATOM    204  CD  ARG A 241      25.545  20.016  60.554  1.00101.99           C  
ATOM    205  NE  ARG A 241      25.665  19.670  59.137  1.00101.95           N  
ATOM    206  CZ  ARG A 241      26.592  20.154  58.321  1.00101.71           C  
ATOM    207  NH1 ARG A 241      27.493  21.013  58.767  1.00102.35           N  
ATOM    208  NH2 ARG A 241      26.625  19.770  57.054  1.00103.28           N  
ATOM    209  N   LEU A 242      20.629  22.551  60.520  1.00 96.23           N  
ATOM    210  CA  LEU A 242      19.704  23.474  59.886  1.00 95.13           C  
ATOM    211  C   LEU A 242      20.456  24.747  59.543  1.00 95.56           C  
ATOM    212  O   LEU A 242      21.030  25.400  60.412  1.00 95.95           O  
ATOM    213  CB  LEU A 242      18.508  23.767  60.792  1.00 94.28           C  
ATOM    214  CG  LEU A 242      17.410  24.710  60.294  1.00 90.99           C  
ATOM    215  CD1 LEU A 242      16.648  24.122  59.131  1.00 87.15           C  
ATOM    216  CD2 LEU A 242      16.472  24.996  61.430  1.00 92.85           C  
ATOM    217  N   PHE A 243      20.456  25.076  58.260  1.00 94.74           N  
ATOM    218  CA  PHE A 243      21.197  26.204  57.753  1.00 94.09           C  
ATOM    219  C   PHE A 243      20.242  27.361  57.580  1.00 95.64           C  
ATOM    220  O   PHE A 243      19.306  27.272  56.779  1.00102.49           O  
ATOM    221  CB  PHE A 243      21.839  25.824  56.417  1.00 95.69           C  
ATOM    222  CG  PHE A 243      22.896  24.762  56.536  1.00 94.04           C  
ATOM    223  CD1 PHE A 243      22.547  23.416  56.587  1.00 94.28           C  
ATOM    224  CD2 PHE A 243      24.236  25.110  56.612  1.00 92.93           C  
ATOM    225  CE1 PHE A 243      23.513  22.436  56.706  1.00 94.83           C  
ATOM    226  CE2 PHE A 243      25.209  24.136  56.727  1.00 95.57           C  
ATOM    227  CZ  PHE A 243      24.846  22.793  56.776  1.00 96.15           C  
ATOM    228  N   ILE A 244      20.455  28.436  58.338  1.00 91.68           N  
ATOM    229  CA  ILE A 244      19.585  29.616  58.232  1.00 89.94           C  
ATOM    230  C   ILE A 244      20.218  30.820  57.515  1.00 92.43           C  
ATOM    231  O   ILE A 244      21.322  31.255  57.851  1.00 93.74           O  
ATOM    232  CB  ILE A 244      18.902  30.043  59.573  1.00 85.49           C  
ATOM    233  CG1 ILE A 244      18.981  31.549  59.732  1.00 91.39           C  
ATOM    234  CG2 ILE A 244      19.496  29.377  60.810  1.00 77.97           C  
ATOM    235  CD1 ILE A 244      17.953  32.098  60.660  1.00101.35           C  
ATOM    236  N   LEU A 245      19.485  31.350  56.535  1.00 93.15           N  
ATOM    237  CA  LEU A 245      19.944  32.450  55.690  1.00 92.77           C  
ATOM    238  C   LEU A 245      19.630  33.809  56.299  1.00 93.95           C  
ATOM    239  O   LEU A 245      18.531  34.034  56.803  1.00 97.71           O  
ATOM    240  CB  LEU A 245      19.293  32.391  54.301  1.00 92.93           C  
ATOM    241  CG  LEU A 245      19.012  31.143  53.450  1.00 92.44           C  
ATOM    242  CD1 LEU A 245      19.173  31.520  51.989  1.00 90.39           C  
ATOM    243  CD2 LEU A 245      19.906  29.956  53.767  1.00 95.03           C  
ATOM    244  N   GLU A 246      20.597  34.713  56.227  1.00 92.07           N  
ATOM    245  CA  GLU A 246      20.415  36.096  56.649  1.00 93.58           C  
ATOM    246  C   GLU A 246      20.649  37.037  55.455  1.00 93.94           C  
ATOM    247  O   GLU A 246      21.554  36.810  54.644  1.00 92.16           O  
ATOM    248  CB  GLU A 246      21.374  36.428  57.789  1.00 93.97           C  
ATOM    249  CG  GLU A 246      21.167  35.598  59.043  1.00 93.60           C  
ATOM    250  CD  GLU A 246      22.146  35.959  60.149  1.00 95.84           C  
ATOM    251  OE1 GLU A 246      21.692  36.171  61.294  1.00 96.87           O  
ATOM    252  OE2 GLU A 246      23.367  36.040  59.877  1.00 97.31           O  
ATOM    253  N   LYS A 247      19.847  38.099  55.364  1.00 92.67           N  
ATOM    254  CA  LYS A 247      19.752  38.887  54.134  1.00 93.10           C  
ATOM    255  C   LYS A 247      21.020  39.649  53.770  1.00 95.69           C  
ATOM    256  O   LYS A 247      21.255  39.938  52.596  1.00 96.67           O  
ATOM    257  CB  LYS A 247      18.561  39.839  54.182  1.00 92.94           C  
ATOM    258  CG  LYS A 247      18.024  40.183  52.812  1.00 95.00           C  
ATOM    259  CD  LYS A 247      17.018  41.306  52.877  1.00 98.82           C  
ATOM    260  CE  LYS A 247      16.733  41.859  51.486  1.00102.01           C  
ATOM    261  NZ  LYS A 247      15.416  42.557  51.439  1.00104.44           N  
ATOM    262  N   GLU A 248      21.835  39.978  54.766  1.00 94.44           N  
ATOM    263  CA  GLU A 248      23.066  40.716  54.507  1.00 92.05           C  
ATOM    264  C   GLU A 248      24.105  39.838  53.808  1.00 91.77           C  
ATOM    265  O   GLU A 248      25.038  40.354  53.184  1.00 93.97           O  
ATOM    266  CB  GLU A 248      23.613  41.351  55.790  1.00 91.38           C  
ATOM    267  CG  GLU A 248      22.735  42.478  56.348  1.00 92.65           C  
ATOM    268  CD  GLU A 248      23.262  43.062  57.653  1.00 96.05           C  
ATOM    269  OE1 GLU A 248      23.365  42.323  58.655  1.00 99.97           O  
ATOM    270  OE2 GLU A 248      23.563  44.273  57.686  1.00 99.35           O  
ATOM    271  N   GLY A 249      23.919  38.518  53.893  1.00 90.51           N  
ATOM    272  CA  GLY A 249      24.778  37.550  53.201  1.00 90.47           C  
ATOM    273  C   GLY A 249      25.512  36.556  54.090  1.00 90.67           C  
ATOM    274  O   GLY A 249      26.717  36.339  53.928  1.00 85.73           O  
ATOM    275  N   TYR A 250      24.781  35.948  55.024  1.00 93.67           N  
ATOM    276  CA  TYR A 250      25.333  34.923  55.909  1.00 94.00           C  
ATOM    277  C   TYR A 250      24.469  33.666  55.901  1.00 94.48           C  
ATOM    278  O   TYR A 250      23.247  33.748  55.820  1.00 95.77           O  
ATOM    279  CB  TYR A 250      25.425  35.432  57.345  1.00 92.70           C  
ATOM    280  CG  TYR A 250      26.119  36.762  57.519  1.00 94.53           C  
ATOM    281  CD1 TYR A 250      25.410  37.959  57.408  1.00 95.96           C  
ATOM    282  CD2 TYR A 250      27.479  36.828  57.833  1.00 92.93           C  
ATOM    283  CE1 TYR A 250      26.044  39.189  57.582  1.00 96.02           C  
ATOM    284  CE2 TYR A 250      28.119  38.051  58.013  1.00 91.55           C  
ATOM    285  CZ  TYR A 250      27.399  39.226  57.885  1.00 93.40           C  
ATOM    286  OH  TYR A 250      28.021  40.441  58.059  1.00 92.28           O  
ATOM    287  N   VAL A 251      25.110  32.505  55.983  1.00 94.64           N  
ATOM    288  CA  VAL A 251      24.406  31.269  56.290  1.00 95.07           C  
ATOM    289  C   VAL A 251      24.977  30.720  57.594  1.00 95.53           C  
ATOM    290  O   VAL A 251      26.159  30.387  57.669  1.00 97.13           O  
ATOM    291  CB  VAL A 251      24.518  30.210  55.163  1.00 97.78           C  
ATOM    292  CG1 VAL A 251      23.734  28.961  55.526  1.00 98.41           C  
ATOM    293  CG2 VAL A 251      24.018  30.761  53.833  1.00 98.95           C  
ATOM    294  N   LYS A 252      24.130  30.661  58.619  1.00 94.77           N  
ATOM    295  CA  LYS A 252      24.496  30.121  59.925  1.00 91.85           C  
ATOM    296  C   LYS A 252      23.936  28.705  60.120  1.00 92.39           C  
ATOM    297  O   LYS A 252      22.894  28.353  59.559  1.00 89.60           O  
ATOM    298  CB  LYS A 252      23.944  31.014  61.023  1.00 89.69           C  
ATOM    299  CG  LYS A 252      24.484  32.420  61.060  1.00 87.01           C  
ATOM    300  CD  LYS A 252      23.633  33.235  62.019  1.00 86.23           C  
ATOM    301  CE  LYS A 252      24.381  34.400  62.609  1.00 86.60           C  
ATOM    302  NZ  LYS A 252      23.466  35.213  63.454  1.00 88.65           N  
ATOM    303  N   ILE A 253      24.627  27.910  60.934  1.00 92.41           N  
ATOM    304  CA  ILE A 253      24.231  26.533  61.224  1.00 90.99           C  
ATOM    305  C   ILE A 253      23.536  26.456  62.572  1.00 93.34           C  
ATOM    306  O   ILE A 253      24.034  26.980  63.575  1.00 97.95           O  
ATOM    307  CB  ILE A 253      25.470  25.596  61.241  1.00 91.47           C  
ATOM    308  CG1 ILE A 253      25.969  25.333  59.817  1.00 91.09           C  
ATOM    309  CG2 ILE A 253      25.162  24.283  61.945  1.00 90.79           C  
ATOM    310  CD1 ILE A 253      27.377  24.780  59.732  1.00 90.02           C  
ATOM    311  N   LEU A 254      22.379  25.811  62.600  1.00 93.69           N  
ATOM    312  CA  LEU A 254      21.747  25.462  63.872  1.00 93.23           C  
ATOM    313  C   LEU A 254      21.903  23.974  64.079  1.00 95.23           C  
ATOM    314  O   LEU A 254      21.519  23.165  63.224  1.00 98.64           O  
ATOM    315  CB  LEU A 254      20.262  25.847  63.921  1.00 92.04           C  
ATOM    316  CG  LEU A 254      19.498  25.418  65.180  1.00 89.06           C  
ATOM    317  CD1 LEU A 254      20.121  25.987  66.462  1.00 89.17           C  
ATOM    318  CD2 LEU A 254      18.050  25.824  65.084  1.00 88.58           C  
ATOM    319  N   THR A 255      22.473  23.630  65.223  1.00 94.32           N  
ATOM    320  CA  THR A 255      22.758  22.256  65.570  1.00 94.33           C  
ATOM    321  C   THR A 255      21.453  21.579  66.028  1.00 97.01           C  
ATOM    322  O   THR A 255      20.574  22.240  66.593  0.70 94.89           O  
ATOM    323  CB  THR A 255      23.919  22.234  66.592  1.00 96.60           C  
ATOM    324  OG1 THR A 255      25.011  21.490  66.053  1.00104.53           O  
ATOM    325  CG2 THR A 255      23.528  21.707  67.960  1.00 94.21           C  
ATOM    326  N   PRO A 256      21.296  20.269  65.747  1.00 99.16           N  
ATOM    327  CA  PRO A 256      20.016  19.598  66.024  1.00 97.00           C  
ATOM    328  C   PRO A 256      19.750  19.545  67.518  1.00 96.27           C  
ATOM    329  O   PRO A 256      18.638  19.263  67.953  1.00101.92           O  
ATOM    330  CB  PRO A 256      20.227  18.186  65.476  1.00 94.29           C  
ATOM    331  CG  PRO A 256      21.685  17.991  65.489  1.00 98.93           C  
ATOM    332  CD  PRO A 256      22.293  19.335  65.201  1.00 99.49           C  
ATOM    333  N   GLU A 257      20.794  19.826  68.279  1.00 92.87           N  
ATOM    334  CA  GLU A 257      20.757  19.891  69.720  1.00 91.56           C  
ATOM    335  C   GLU A 257      20.514  21.352  70.160  1.00 92.99           C  
ATOM    336  O   GLU A 257      20.404  21.648  71.349  1.00 90.35           O  
ATOM    337  CB  GLU A 257      22.099  19.368  70.236  1.00 90.19           C  
ATOM    338  CG  GLU A 257      22.096  18.825  71.633  1.00 91.57           C  
ATOM    339  CD  GLU A 257      21.390  17.497  71.753  1.00 93.30           C  
ATOM    340  OE1 GLU A 257      21.359  16.714  70.777  1.00 87.19           O  
ATOM    341  OE2 GLU A 257      20.856  17.236  72.853  1.00 99.43           O  
ATOM    342  N   GLY A 258      20.462  22.262  69.189  1.00 95.27           N  
ATOM    343  CA  GLY A 258      20.055  23.644  69.433  1.00 94.18           C  
ATOM    344  C   GLY A 258      21.086  24.750  69.573  1.00 93.59           C  
ATOM    345  O   GLY A 258      20.750  25.807  70.101  1.00 98.56           O  
ATOM    346  N   GLU A 259      22.318  24.534  69.104  1.00 91.31           N  
ATOM    347  CA  GLU A 259      23.385  25.562  69.160  1.00 86.62           C  
ATOM    348  C   GLU A 259      23.611  26.276  67.834  1.00 85.74           C  
ATOM    349  O   GLU A 259      23.656  25.641  66.785  1.00 87.01           O  
ATOM    350  CB  GLU A 259      24.702  24.949  69.603  1.00 85.26           C  
ATOM    351  CG  GLU A 259      24.732  24.550  71.061  1.00 92.24           C  
ATOM    352  CD  GLU A 259      25.111  25.689  71.984  1.00 98.13           C  
ATOM    353  OE1 GLU A 259      25.862  26.587  71.543  1.00102.56           O  
ATOM    354  OE2 GLU A 259      24.674  25.677  73.160  1.00 99.40           O  
ATOM    355  N   ILE A 260      23.741  27.600  67.870  1.00 86.63           N  
ATOM    356  CA  ILE A 260      24.178  28.325  66.675  1.00 85.88           C  
ATOM    357  C   ILE A 260      25.697  28.432  66.733  1.00 87.50           C  
ATOM    358  O   ILE A 260      26.255  29.006  67.672  1.00 86.78           O  
ATOM    359  CB  ILE A 260      23.581  29.740  66.558  1.00 84.39           C  
ATOM    360  CG1 ILE A 260      22.046  29.711  66.521  1.00 87.88           C  
ATOM    361  CG2 ILE A 260      24.129  30.430  65.327  1.00 82.49           C  
ATOM    362  CD1 ILE A 260      21.434  29.353  65.167  1.00 89.67           C  
ATOM    363  N   PHE A 261      26.364  27.850  65.743  1.00 87.12           N  
ATOM    364  CA  PHE A 261      27.808  27.909  65.688  1.00 87.90           C  
ATOM    365  C   PHE A 261      28.255  29.369  65.549  1.00 90.93           C  
ATOM    366  O   PHE A 261      27.666  30.131  64.770  1.00 91.63           O  
ATOM    367  CB  PHE A 261      28.327  27.067  64.524  1.00 87.91           C  
ATOM    368  CG  PHE A 261      28.292  25.576  64.768  1.00 86.26           C  
ATOM    369  CD1 PHE A 261      28.413  24.689  63.699  1.00 87.51           C  
ATOM    370  CD2 PHE A 261      28.149  25.054  66.050  1.00 85.95           C  
ATOM    371  CE1 PHE A 261      28.392  23.302  63.899  1.00 87.11           C  
ATOM    372  CE2 PHE A 261      28.127  23.668  66.262  1.00 87.96           C  
ATOM    373  CZ  PHE A 261      28.246  22.791  65.181  1.00 87.02           C  
ATOM    374  N   LYS A 262      29.278  29.756  66.312  1.00 92.76           N  
ATOM    375  CA  LYS A 262      29.764  31.140  66.299  1.00 96.31           C  
ATOM    376  C   LYS A 262      30.304  31.524  64.927  1.00 96.26           C  
ATOM    377  O   LYS A 262      30.009  32.607  64.419  1.00 95.39           O  
ATOM    378  CB  LYS A 262      30.829  31.372  67.373  1.00 99.21           C  
ATOM    379  CG  LYS A 262      31.145  32.843  67.621  1.00101.53           C  
ATOM    380  CD  LYS A 262      32.527  33.008  68.252  1.00104.26           C  
ATOM    381  CE  LYS A 262      32.944  34.474  68.337  1.00105.49           C  
ATOM    382  NZ  LYS A 262      32.104  35.264  69.292  1.00106.91           N  
ATOM    383  N   GLU A 263      31.086  30.631  64.330  1.00 97.42           N  
ATOM    384  CA  GLU A 263      31.563  30.843  62.975  1.00 99.29           C  
ATOM    385  C   GLU A 263      30.467  30.512  61.968  1.00 96.94           C  
ATOM    386  O   GLU A 263      29.882  29.423  62.019  1.00100.90           O  
ATOM    387  CB  GLU A 263      32.808  30.008  62.705  1.00104.71           C  
ATOM    388  CG  GLU A 263      33.826  30.728  61.840  1.00113.02           C  
ATOM    389  CD  GLU A 263      34.215  32.091  62.406  1.00117.12           C  
ATOM    390  OE1 GLU A 263      34.793  32.146  63.515  1.00116.93           O  
ATOM    391  OE2 GLU A 263      33.935  33.108  61.736  1.00120.32           O  
ATOM    392  N   PRO A 264      30.154  31.460  61.069  1.00 91.35           N  
ATOM    393  CA  PRO A 264      29.176  31.194  60.008  1.00 88.10           C  
ATOM    394  C   PRO A 264      29.613  30.074  59.066  1.00 87.11           C  
ATOM    395  O   PRO A 264      30.811  29.823  58.911  1.00 91.33           O  
ATOM    396  CB  PRO A 264      29.104  32.524  59.258  1.00 85.83           C  
ATOM    397  CG  PRO A 264      29.569  33.535  60.250  1.00 88.42           C  
ATOM    398  CD  PRO A 264      30.650  32.843  61.010  1.00 90.04           C  
ATOM    399  N   TYR A 265      28.641  29.401  58.463  1.00 83.86           N  
ATOM    400  CA  TYR A 265      28.901  28.386  57.447  1.00 83.45           C  
ATOM    401  C   TYR A 265      29.301  29.065  56.146  1.00 84.56           C  
ATOM    402  O   TYR A 265      30.193  28.597  55.440  1.00 87.51           O  
ATOM    403  CB  TYR A 265      27.650  27.529  57.236  1.00 84.71           C  
ATOM    404  CG  TYR A 265      27.730  26.506  56.124  1.00 84.29           C  
ATOM    405  CD1 TYR A 265      28.492  25.346  56.266  1.00 87.52           C  
ATOM    406  CD2 TYR A 265      27.024  26.683  54.945  1.00 82.38           C  
ATOM    407  CE1 TYR A 265      28.560  24.396  55.253  1.00 86.89           C  
ATOM    408  CE2 TYR A 265      27.080  25.739  53.931  1.00 85.17           C  
ATOM    409  CZ  TYR A 265      27.849  24.599  54.086  1.00 85.72           C  
ATOM    410  OH  TYR A 265      27.915  23.668  53.073  1.00 84.14           O  
ATOM    411  N   LEU A 266      28.642  30.180  55.848  1.00 84.64           N  
ATOM    412  CA  LEU A 266      28.893  30.935  54.630  1.00 87.91           C  
ATOM    413  C   LEU A 266      28.886  32.430  54.959  1.00 90.39           C  
ATOM    414  O   LEU A 266      27.848  32.970  55.357  1.00 92.53           O  
ATOM    415  CB  LEU A 266      27.807  30.591  53.601  1.00 89.67           C  
ATOM    416  CG  LEU A 266      27.984  30.748  52.087  1.00 90.34           C  
ATOM    417  CD1 LEU A 266      27.465  32.081  51.588  1.00 91.51           C  
ATOM    418  CD2 LEU A 266      29.427  30.507  51.646  1.00 90.53           C  
ATOM    419  N   ASP A 267      30.041  33.089  54.849  1.00 89.35           N  
ATOM    420  CA  ASP A 267      30.094  34.540  55.071  1.00 91.08           C  
ATOM    421  C   ASP A 267      30.519  35.288  53.811  1.00 93.15           C  
ATOM    422  O   ASP A 267      31.713  35.465  53.521  1.00 94.47           O  
ATOM    423  CB  ASP A 267      30.943  34.939  56.288  1.00 91.06           C  
ATOM    424  CG  ASP A 267      31.071  36.464  56.442  1.00 93.24           C  
ATOM    425  OD1 ASP A 267      30.267  37.196  55.819  1.00 92.25           O  
ATOM    426  OD2 ASP A 267      31.978  36.934  57.175  1.00 93.49           O  
ATOM    427  N   ILE A 268      29.502  35.761  53.102  1.00 91.93           N  
ATOM    428  CA  ILE A 268      29.642  36.249  51.750  1.00 89.78           C  
ATOM    429  C   ILE A 268      29.157  37.700  51.645  1.00 90.36           C  
ATOM    430  O   ILE A 268      28.963  38.225  50.544  1.00 89.59           O  
ATOM    431  CB  ILE A 268      28.861  35.302  50.812  1.00 91.21           C  
ATOM    432  CG1 ILE A 268      29.557  35.160  49.467  1.00 92.93           C  
ATOM    433  CG2 ILE A 268      27.356  35.675  50.705  1.00 90.08           C  
ATOM    434  CD1 ILE A 268      28.862  34.169  48.564  1.00 98.15           C  
ATOM    435  N   HIS A 269      29.013  38.350  52.803  1.00 91.26           N  
ATOM    436  CA  HIS A 269      28.330  39.649  52.923  1.00 90.75           C  
ATOM    437  C   HIS A 269      28.988  40.791  52.153  1.00 89.13           C  
ATOM    438  O   HIS A 269      28.339  41.791  51.846  1.00 88.00           O  
ATOM    439  CB  HIS A 269      28.140  40.032  54.402  1.00 92.27           C  
ATOM    440  CG  HIS A 269      29.347  40.654  55.033  1.00 94.42           C  
ATOM    441  ND1 HIS A 269      30.518  39.959  55.252  1.00 96.45           N  
ATOM    442  CD2 HIS A 269      29.562  41.906  55.501  1.00 94.26           C  
ATOM    443  CE1 HIS A 269      31.403  40.757  55.822  1.00 94.42           C  
ATOM    444  NE2 HIS A 269      30.848  41.945  55.983  1.00 94.02           N  
ATOM    445  N   LYS A 270      30.272  40.641  51.850  1.00 89.97           N  
ATOM    446  CA  LYS A 270      30.992  41.659  51.100  1.00 92.54           C  
ATOM    447  C   LYS A 270      30.627  41.600  49.620  1.00 92.45           C  
ATOM    448  O   LYS A 270      30.564  42.630  48.949  1.00 91.21           O  
ATOM    449  CB  LYS A 270      32.499  41.523  51.311  1.00 93.26           C  
ATOM    450  CG  LYS A 270      32.969  41.912  52.717  1.00 94.65           C  
ATOM    451  CD  LYS A 270      34.484  41.796  52.843  1.00 95.08           C  
ATOM    452  CE  LYS A 270      34.994  42.396  54.144  1.00 96.69           C  
ATOM    453  NZ  LYS A 270      36.471  42.646  54.093  1.00 96.69           N  
ATOM    454  N   LEU A 271      30.362  40.392  49.128  1.00 93.27           N  
ATOM    455  CA  LEU A 271      30.002  40.189  47.725  1.00 95.10           C  
ATOM    456  C   LEU A 271      28.569  40.618  47.413  1.00 95.47           C  
ATOM    457  O   LEU A 271      28.271  41.041  46.299  1.00 97.35           O  
ATOM    458  CB  LEU A 271      30.222  38.727  47.302  1.00 95.88           C  
ATOM    459  CG  LEU A 271      31.650  38.165  47.212  1.00 96.96           C  
ATOM    460  CD1 LEU A 271      31.619  36.669  46.927  1.00 96.02           C  
ATOM    461  CD2 LEU A 271      32.501  38.891  46.160  1.00 99.27           C  
ATOM    462  N   VAL A 272      27.684  40.508  48.394  1.00 95.94           N  
ATOM    463  CA  VAL A 272      26.268  40.795  48.176  1.00 96.66           C  
ATOM    464  C   VAL A 272      25.905  42.237  48.534  1.00 96.93           C  
ATOM    465  O   VAL A 272      26.274  42.743  49.597  1.00 96.47           O  
ATOM    466  CB  VAL A 272      25.331  39.736  48.874  1.00 97.49           C  
ATOM    467  CG1 VAL A 272      25.965  39.172  50.125  1.00 97.89           C  
ATOM    468  CG2 VAL A 272      23.949  40.306  49.190  1.00 99.37           C  
ATOM    469  N   GLN A 273      25.203  42.894  47.616  1.00 99.60           N  
ATOM    470  CA  GLN A 273      24.664  44.222  47.860  1.00104.73           C  
ATOM    471  C   GLN A 273      23.279  44.049  48.468  1.00108.27           C  
ATOM    472  O   GLN A 273      22.298  43.859  47.751  1.00108.10           O  
ATOM    473  CB  GLN A 273      24.623  45.039  46.554  1.00105.35           C  
ATOM    474  CG  GLN A 273      23.895  46.389  46.631  1.00105.58           C  
ATOM    475  CD  GLN A 273      24.457  47.312  47.692  1.00106.89           C  
ATOM    476  OE1 GLN A 273      25.465  47.984  47.476  1.00108.74           O  
ATOM    477  NE2 GLN A 273      23.800  47.356  48.847  1.00107.33           N  
ATOM    478  N   SER A 274      23.215  44.094  49.796  1.00113.46           N  
ATOM    479  CA  SER A 274      21.967  43.855  50.521  1.00118.45           C  
ATOM    480  C   SER A 274      21.309  45.161  50.945  1.00123.26           C  
ATOM    481  O   SER A 274      21.767  45.839  51.875  1.00125.76           O  
ATOM    482  CB  SER A 274      22.200  42.948  51.732  1.00118.15           C  
ATOM    483  OG  SER A 274      22.968  43.597  52.731  1.00118.01           O  
ATOM    484  N   GLY A 275      20.221  45.493  50.256  1.00126.09           N  
ATOM    485  CA  GLY A 275      19.541  46.766  50.432  1.00128.87           C  
ATOM    486  C   GLY A 275      18.803  46.974  51.743  1.00131.10           C  
ATOM    487  O   GLY A 275      17.840  46.262  52.063  1.00130.78           O  
ATOM    488  N   ILE A 276      19.345  47.911  52.525  1.00132.75           N  
ATOM    489  CA  ILE A 276      18.600  48.760  53.473  1.00134.17           C  
ATOM    490  C   ILE A 276      17.055  48.775  53.405  1.00133.46           C  
ATOM    491  O   ILE A 276      16.391  47.858  53.902  1.00132.05           O  
ATOM    492  CB  ILE A 276      19.109  50.231  53.328  1.00135.48           C  
ATOM    493  CG1 ILE A 276      19.362  50.574  51.843  1.00135.50           C  
ATOM    494  CG2 ILE A 276      20.382  50.440  54.153  1.00135.84           C  
ATOM    495  CD1 ILE A 276      19.417  52.070  51.532  1.00134.77           C  
ATOM    496  N   LYS A 277      16.528  49.848  52.802  1.00132.64           N  
ATOM    497  CA  LYS A 277      15.095  50.193  52.680  1.00132.18           C  
ATOM    498  C   LYS A 277      14.048  49.372  53.449  1.00131.40           C  
ATOM    499  O   LYS A 277      13.497  49.843  54.444  1.00132.61           O  
ATOM    500  CB  LYS A 277      14.689  50.299  51.200  1.00132.45           C  
ATOM    501  CG  LYS A 277      15.344  51.438  50.426  1.00132.37           C  
ATOM    502  CD  LYS A 277      14.595  52.751  50.610  1.00132.08           C  
ATOM    503  CE  LYS A 277      15.225  53.863  49.787  1.00131.49           C  
ATOM    504  NZ  LYS A 277      14.499  55.151  49.953  1.00131.05           N  
ATOM    505  N   GLY A 278      13.781  48.156  52.983  1.00129.02           N  
ATOM    506  CA  GLY A 278      12.577  47.434  53.381  1.00127.19           C  
ATOM    507  C   GLY A 278      11.614  47.604  52.225  1.00126.04           C  
ATOM    508  O   GLY A 278      11.309  48.732  51.823  1.00125.16           O  
ATOM    509  N   GLY A 279      11.146  46.487  51.677  1.00124.83           N  
ATOM    510  CA  GLY A 279      10.526  46.494  50.353  1.00124.14           C  
ATOM    511  C   GLY A 279      11.629  46.371  49.314  1.00122.43           C  
ATOM    512  O   GLY A 279      11.407  45.868  48.207  1.00122.58           O  
ATOM    513  N   ASP A 280      12.817  46.853  49.687  1.00119.11           N  
ATOM    514  CA  ASP A 280      14.055  46.599  48.967  1.00115.27           C  
ATOM    515  C   ASP A 280      14.395  45.132  49.144  1.00113.45           C  
ATOM    516  O   ASP A 280      14.415  44.626  50.262  1.00113.43           O  
ATOM    517  CB  ASP A 280      15.177  47.456  49.541  1.00114.42           C  
ATOM    518  CG  ASP A 280      16.343  47.611  48.590  1.00114.07           C  
ATOM    519  OD1 ASP A 280      16.689  46.635  47.893  1.00113.49           O  
ATOM    520  OD2 ASP A 280      16.922  48.717  48.547  1.00114.77           O  
ATOM    521  N   GLU A 281      14.683  44.463  48.037  1.00113.91           N  
ATOM    522  CA  GLU A 281      14.694  43.006  47.987  1.00116.88           C  
ATOM    523  C   GLU A 281      16.095  42.444  47.717  1.00116.60           C  
ATOM    524  O   GLU A 281      16.239  41.274  47.354  1.00119.09           O  
ATOM    525  CB  GLU A 281      13.738  42.576  46.872  1.00117.50           C  
ATOM    526  CG  GLU A 281      12.958  41.300  47.111  1.00120.08           C  
ATOM    527  CD  GLU A 281      11.783  41.160  46.146  1.00121.22           C  
ATOM    528  OE1 GLU A 281      10.910  42.058  46.136  1.00123.28           O  
ATOM    529  OE2 GLU A 281      11.730  40.155  45.399  1.00122.12           O  
ATOM    530  N   ARG A 282      17.119  43.264  47.953  1.00113.17           N  
ATOM    531  CA  ARG A 282      18.421  43.123  47.285  1.00108.98           C  
ATOM    532  C   ARG A 282      19.489  42.212  47.931  1.00107.58           C  
ATOM    533  O   ARG A 282      20.636  42.199  47.487  1.00108.77           O  
ATOM    534  CB  ARG A 282      19.005  44.525  47.062  1.00106.84           C  
ATOM    535  CG  ARG A 282      19.422  44.809  45.647  1.00102.76           C  
ATOM    536  CD  ARG A 282      19.086  46.232  45.264  1.00101.60           C  
ATOM    537  NE  ARG A 282      20.209  47.152  45.423  1.00101.89           N  
ATOM    538  CZ  ARG A 282      20.318  48.063  46.387  1.00100.48           C  
ATOM    539  NH1 ARG A 282      19.367  48.192  47.303  1.00 98.60           N  
ATOM    540  NH2 ARG A 282      21.383  48.852  46.431  1.00100.43           N  
ATOM    541  N   GLY A 283      19.132  41.442  48.952  1.00103.68           N  
ATOM    542  CA  GLY A 283      20.146  40.673  49.682  1.00100.96           C  
ATOM    543  C   GLY A 283      20.530  39.299  49.155  1.00 97.73           C  
ATOM    544  O   GLY A 283      20.651  39.090  47.952  1.00 96.82           O  
ATOM    545  N   LEU A 284      20.765  38.376  50.086  1.00 96.35           N  
ATOM    546  CA  LEU A 284      20.922  36.957  49.791  1.00 93.15           C  
ATOM    547  C   LEU A 284      19.523  36.361  49.657  1.00 94.10           C  
ATOM    548  O   LEU A 284      18.661  36.622  50.493  1.00 97.59           O  
ATOM    549  CB  LEU A 284      21.692  36.272  50.922  1.00 89.39           C  
ATOM    550  CG  LEU A 284      21.663  34.745  51.034  1.00 87.32           C  
ATOM    551  CD1 LEU A 284      22.634  34.095  50.050  1.00 85.24           C  
ATOM    552  CD2 LEU A 284      21.969  34.310  52.459  1.00 85.46           C  
ATOM    553  N   LEU A 285      19.302  35.556  48.620  1.00 92.42           N  
ATOM    554  CA  LEU A 285      17.947  35.158  48.242  1.00 91.58           C  
ATOM    555  C   LEU A 285      17.622  33.695  48.531  1.00 93.05           C  
ATOM    556  O   LEU A 285      16.558  33.387  49.077  1.00 91.37           O  
ATOM    557  CB  LEU A 285      17.678  35.492  46.768  1.00 92.07           C  
ATOM    558  CG  LEU A 285      18.204  36.849  46.269  1.00 93.42           C  
ATOM    559  CD1 LEU A 285      18.085  36.963  44.763  1.00 92.04           C  
ATOM    560  CD2 LEU A 285      17.535  38.041  46.961  1.00 92.16           C  
ATOM    561  N   SER A 286      18.530  32.792  48.176  1.00 94.83           N  
ATOM    562  CA  SER A 286      18.249  31.367  48.345  1.00 96.33           C  
ATOM    563  C   SER A 286      19.505  30.497  48.383  1.00 95.90           C  
ATOM    564  O   SER A 286      20.534  30.838  47.790  1.00 96.11           O  
ATOM    565  CB  SER A 286      17.293  30.880  47.247  1.00 97.09           C  
ATOM    566  OG  SER A 286      16.867  29.551  47.477  1.00 99.29           O  
ATOM    567  N   LEU A 287      19.394  29.376  49.093  1.00 94.30           N  
ATOM    568  CA  LEU A 287      20.434  28.359  49.149  1.00 96.89           C  
ATOM    569  C   LEU A 287      19.814  27.010  48.792  1.00 98.11           C  
ATOM    570  O   LEU A 287      18.661  26.744  49.154  1.00101.39           O  
ATOM    571  CB  LEU A 287      21.016  28.286  50.561  1.00 96.98           C  
ATOM    572  CG  LEU A 287      22.494  27.979  50.827  1.00 96.55           C  
ATOM    573  CD1 LEU A 287      22.666  27.540  52.268  1.00 97.36           C  
ATOM    574  CD2 LEU A 287      23.056  26.920  49.916  1.00 99.40           C  
ATOM    575  N   ALA A 288      20.570  26.168  48.087  1.00 95.07           N  
ATOM    576  CA  ALA A 288      20.148  24.789  47.810  1.00 95.79           C  
ATOM    577  C   ALA A 288      21.323  23.809  47.848  1.00 97.53           C  
ATOM    578  O   ALA A 288      22.397  24.082  47.299  1.00 97.86           O  
ATOM    579  CB  ALA A 288      19.418  24.699  46.483  1.00 93.15           C  
ATOM    580  N   PHE A 289      21.112  22.669  48.505  1.00 96.61           N  
ATOM    581  CA  PHE A 289      22.156  21.656  48.652  1.00 93.03           C  
ATOM    582  C   PHE A 289      22.015  20.564  47.601  1.00 96.25           C  
ATOM    583  O   PHE A 289      20.906  20.236  47.175  1.00 99.43           O  
ATOM    584  CB  PHE A 289      22.115  21.040  50.050  1.00 88.82           C  
ATOM    585  CG  PHE A 289      22.616  21.954  51.137  1.00 85.63           C  
ATOM    586  CD1 PHE A 289      21.750  22.821  51.787  1.00 84.40           C  
ATOM    587  CD2 PHE A 289      23.953  21.934  51.515  1.00 85.29           C  
ATOM    588  CE1 PHE A 289      22.203  23.659  52.789  1.00 85.83           C  
ATOM    589  CE2 PHE A 289      24.422  22.770  52.512  1.00 86.20           C  
ATOM    590  CZ  PHE A 289      23.544  23.634  53.156  1.00 87.79           C  
ATOM    591  N   HIS A 290      23.142  20.001  47.182  1.00 96.54           N  
ATOM    592  CA  HIS A 290      23.133  18.941  46.187  1.00 95.07           C  
ATOM    593  C   HIS A 290      22.569  17.655  46.783  1.00 95.91           C  
ATOM    594  O   HIS A 290      22.895  17.303  47.914  1.00 98.04           O  
ATOM    595  CB  HIS A 290      24.534  18.702  45.644  1.00 93.95           C  
ATOM    596  CG  HIS A 290      24.556  17.925  44.367  1.00 94.48           C  
ATOM    597  ND1 HIS A 290      24.383  16.559  44.325  1.00 94.75           N  
ATOM    598  CD2 HIS A 290      24.725  18.322  43.084  1.00 94.58           C  
ATOM    599  CE1 HIS A 290      24.448  16.146  43.072  1.00 95.49           C  
ATOM    600  NE2 HIS A 290      24.655  17.196  42.298  1.00 95.12           N  
ATOM    601  N   PRO A 291      21.695  16.962  46.032  1.00 96.45           N  
ATOM    602  CA  PRO A 291      21.151  15.667  46.442  1.00 98.80           C  
ATOM    603  C   PRO A 291      22.227  14.673  46.888  1.00104.08           C  
ATOM    604  O   PRO A 291      21.929  13.726  47.621  1.00105.89           O  
ATOM    605  CB  PRO A 291      20.469  15.172  45.171  1.00 99.15           C  
ATOM    606  CG  PRO A 291      20.053  16.418  44.477  1.00 97.16           C  
ATOM    607  CD  PRO A 291      21.141  17.402  44.737  1.00 96.10           C  
ATOM    608  N   ASN A 292      23.462  14.895  46.433  1.00107.55           N  
ATOM    609  CA  ASN A 292      24.634  14.144  46.894  1.00106.76           C  
ATOM    610  C   ASN A 292      25.722  15.013  47.542  1.00102.96           C  
ATOM    611  O   ASN A 292      26.917  14.768  47.368  1.00104.36           O  
ATOM    612  CB  ASN A 292      25.212  13.297  45.760  1.00109.32           C  
ATOM    613  CG  ASN A 292      24.739  11.865  45.814  1.00113.17           C  
ATOM    614  OD1 ASN A 292      24.950  11.165  46.807  1.00113.78           O  
ATOM    615  ND2 ASN A 292      24.100  11.412  44.740  1.00116.12           N  
ATOM    616  N   TYR A 293      25.293  16.020  48.297  1.00 98.13           N  
ATOM    617  CA  TYR A 293      26.193  16.855  49.082  1.00 96.28           C  
ATOM    618  C   TYR A 293      27.006  16.012  50.078  1.00 98.65           C  
ATOM    619  O   TYR A 293      28.184  16.290  50.322  1.00 99.08           O  
ATOM    620  CB  TYR A 293      25.392  17.944  49.796  1.00 92.96           C  
ATOM    621  CG  TYR A 293      26.157  18.754  50.817  1.00 94.02           C  
ATOM    622  CD1 TYR A 293      26.649  20.018  50.507  1.00 95.04           C  
ATOM    623  CD2 TYR A 293      26.367  18.265  52.109  1.00 93.77           C  
ATOM    624  CE1 TYR A 293      27.351  20.769  51.458  1.00 95.61           C  
ATOM    625  CE2 TYR A 293      27.064  19.004  53.059  1.00 92.83           C  
ATOM    626  CZ  TYR A 293      27.551  20.253  52.732  1.00 93.17           C  
ATOM    627  OH  TYR A 293      28.239  20.977  53.681  1.00 92.68           O  
ATOM    628  N   LYS A 294      26.379  14.981  50.641  1.00 99.12           N  
ATOM    629  CA  LYS A 294      27.067  14.048  51.542  1.00 98.04           C  
ATOM    630  C   LYS A 294      28.329  13.454  50.898  1.00 96.80           C  
ATOM    631  O   LYS A 294      29.294  13.124  51.596  1.00 95.10           O  
ATOM    632  CB  LYS A 294      26.109  12.941  51.993  1.00 97.86           C  
ATOM    633  CG  LYS A 294      26.663  12.010  53.059  1.00 97.56           C  
ATOM    634  CD  LYS A 294      25.615  11.016  53.519  1.00 99.16           C  
ATOM    635  CE  LYS A 294      26.151  10.142  54.642  1.00102.52           C  
ATOM    636  NZ  LYS A 294      25.075   9.711  55.587  1.00104.29           N  
ATOM    637  N   LYS A 295      28.308  13.331  49.570  1.00 97.66           N  
ATOM    638  CA  LYS A 295      29.475  12.882  48.802  1.00101.45           C  
ATOM    639  C   LYS A 295      30.314  14.055  48.283  1.00 98.68           C  
ATOM    640  O   LYS A 295      31.503  14.161  48.609  1.00 97.65           O  
ATOM    641  CB  LYS A 295      29.065  11.978  47.629  1.00102.77           C  
ATOM    642  CG  LYS A 295      28.460  10.640  48.028  1.00106.15           C  
ATOM    643  CD  LYS A 295      28.138   9.785  46.801  1.00106.40           C  
ATOM    644  CE  LYS A 295      27.339   8.538  47.181  1.00108.76           C  
ATOM    645  NZ  LYS A 295      27.318   7.515  46.092  1.00109.27           N  
ATOM    646  N   ASN A 296      29.691  14.931  47.491  1.00 95.40           N  
ATOM    647  CA  ASN A 296      30.417  15.980  46.771  1.00 93.37           C  
ATOM    648  C   ASN A 296      30.511  17.325  47.481  1.00 93.69           C  
ATOM    649  O   ASN A 296      31.349  18.152  47.133  1.00 96.88           O  
ATOM    650  CB  ASN A 296      29.872  16.155  45.344  1.00 92.56           C  
ATOM    651  CG  ASN A 296      28.453  16.711  45.306  1.00 92.33           C  
ATOM    652  OD1 ASN A 296      28.059  17.530  46.144  1.00 91.06           O  
ATOM    653  ND2 ASN A 296      27.682  16.277  44.309  1.00 89.64           N  
ATOM    654  N   GLY A 297      29.644  17.544  48.462  1.00 93.57           N  
ATOM    655  CA  GLY A 297      29.660  18.776  49.251  1.00 95.02           C  
ATOM    656  C   GLY A 297      29.399  20.052  48.469  1.00 95.82           C  
ATOM    657  O   GLY A 297      30.085  21.059  48.660  1.00 94.78           O  
ATOM    658  N   LYS A 298      28.394  20.020  47.599  1.00 96.96           N  
ATOM    659  CA  LYS A 298      28.136  21.155  46.720  1.00 96.40           C  
ATOM    660  C   LYS A 298      26.890  21.964  47.070  1.00 96.45           C  
ATOM    661  O   LYS A 298      25.799  21.420  47.218  1.00 97.29           O  
ATOM    662  CB  LYS A 298      28.140  20.718  45.260  1.00 94.50           C  
ATOM    663  CG  LYS A 298      29.500  20.219  44.833  1.00 94.67           C  
ATOM    664  CD  LYS A 298      29.738  20.443  43.367  1.00 95.41           C  
ATOM    665  CE  LYS A 298      31.224  20.499  43.061  1.00 93.64           C  
ATOM    666  NZ  LYS A 298      31.828  21.816  43.402  1.00 92.36           N  
ATOM    667  N   LEU A 299      27.097  23.270  47.217  1.00 96.46           N  
ATOM    668  CA  LEU A 299      26.052  24.236  47.510  1.00 94.90           C  
ATOM    669  C   LEU A 299      25.679  24.976  46.255  1.00 94.39           C  
ATOM    670  O   LEU A 299      26.459  25.043  45.303  1.00 93.91           O  
ATOM    671  CB  LEU A 299      26.571  25.311  48.454  1.00 95.36           C  
ATOM    672  CG  LEU A 299      27.094  25.065  49.851  1.00 97.44           C  
ATOM    673  CD1 LEU A 299      28.502  24.488  49.825  1.00 96.58           C  
ATOM    674  CD2 LEU A 299      27.076  26.429  50.506  1.00 99.39           C  
ATOM    675  N   TYR A 300      24.496  25.577  46.280  1.00 94.79           N  
ATOM    676  CA  TYR A 300      24.105  26.543  45.266  1.00 95.34           C  
ATOM    677  C   TYR A 300      23.441  27.733  45.937  1.00 97.31           C  
ATOM    678  O   TYR A 300      22.487  27.581  46.705  1.00 98.70           O  
ATOM    679  CB  TYR A 300      23.231  25.889  44.190  1.00 92.34           C  
ATOM    680  CG  TYR A 300      23.966  24.762  43.504  1.00 90.87           C  
ATOM    681  CD1 TYR A 300      23.869  23.454  43.977  1.00 89.57           C  
ATOM    682  CD2 TYR A 300      24.804  25.011  42.419  1.00 90.63           C  
ATOM    683  CE1 TYR A 300      24.562  22.422  43.377  1.00 89.68           C  
ATOM    684  CE2 TYR A 300      25.502  23.982  41.807  1.00 91.26           C  
ATOM    685  CZ  TYR A 300      25.376  22.691  42.295  1.00 91.67           C  
ATOM    686  OH  TYR A 300      26.063  21.662  41.700  1.00 92.91           O  
ATOM    687  N   VAL A 301      23.991  28.911  45.666  1.00 97.80           N  
ATOM    688  CA  VAL A 301      23.527  30.150  46.260  1.00 99.53           C  
ATOM    689  C   VAL A 301      23.052  31.102  45.173  1.00101.48           C  
ATOM    690  O   VAL A 301      23.706  31.257  44.142  1.00105.38           O  
ATOM    691  CB  VAL A 301      24.657  30.838  47.041  1.00101.30           C  
ATOM    692  CG1 VAL A 301      24.154  32.114  47.700  1.00103.24           C  
ATOM    693  CG2 VAL A 301      25.240  29.893  48.085  1.00103.98           C  
ATOM    694  N   SER A 302      21.908  31.732  45.400  1.00100.36           N  
ATOM    695  CA  SER A 302      21.486  32.836  44.559  1.00100.40           C  
ATOM    696  C   SER A 302      21.498  34.106  45.393  1.00100.85           C  
ATOM    697  O   SER A 302      20.890  34.156  46.467  1.00104.48           O  
ATOM    698  CB  SER A 302      20.098  32.583  43.979  1.00102.07           C  
ATOM    699  OG  SER A 302      19.154  32.366  45.009  1.00104.22           O  
ATOM    700  N   TYR A 303      22.208  35.119  44.907  1.00 97.91           N  
ATOM    701  CA  TYR A 303      22.295  36.401  45.594  1.00 94.67           C  
ATOM    702  C   TYR A 303      22.418  37.584  44.640  1.00 95.83           C  
ATOM    703  O   TYR A 303      22.587  37.418  43.426  1.00 95.57           O  
ATOM    704  CB  TYR A 303      23.450  36.402  46.596  1.00 93.01           C  
ATOM    705  CG  TYR A 303      24.841  36.295  45.992  1.00 92.58           C  
ATOM    706  CD1 TYR A 303      25.610  37.434  45.740  1.00 90.92           C  
ATOM    707  CD2 TYR A 303      25.402  35.052  45.711  1.00 92.64           C  
ATOM    708  CE1 TYR A 303      26.895  37.332  45.205  1.00 90.74           C  
ATOM    709  CE2 TYR A 303      26.679  34.942  45.180  1.00 92.69           C  
ATOM    710  CZ  TYR A 303      27.424  36.079  44.927  1.00 92.14           C  
ATOM    711  OH  TYR A 303      28.693  35.943  44.395  1.00 91.65           O  
ATOM    712  N   THR A 304      22.337  38.779  45.215  1.00 95.62           N  
ATOM    713  CA  THR A 304      22.359  40.022  44.466  1.00 96.94           C  
ATOM    714  C   THR A 304      23.690  40.723  44.705  1.00 99.11           C  
ATOM    715  O   THR A 304      24.135  40.827  45.849  1.00100.86           O  
ATOM    716  CB  THR A 304      21.187  40.918  44.902  1.00 97.41           C  
ATOM    717  OG1 THR A 304      19.976  40.443  44.305  1.00 97.31           O  
ATOM    718  CG2 THR A 304      21.403  42.353  44.488  1.00 99.71           C  
ATOM    719  N   THR A 305      24.315  41.204  43.628  1.00 98.28           N  
ATOM    720  CA  THR A 305      25.669  41.757  43.697  1.00 97.59           C  
ATOM    721  C   THR A 305      25.901  42.955  42.780  1.00100.66           C  
ATOM    722  O   THR A 305      25.114  43.212  41.866  1.00100.46           O  
ATOM    723  CB  THR A 305      26.739  40.669  43.397  1.00 96.27           C  
ATOM    724  OG1 THR A 305      28.046  41.253  43.443  1.00 96.86           O  
ATOM    725  CG2 THR A 305      26.524  40.035  42.025  1.00 94.98           C  
ATOM    726  N   ASN A 306      26.994  43.674  43.046  1.00104.19           N  
ATOM    727  CA  ASN A 306      27.478  44.762  42.194  1.00105.90           C  
ATOM    728  C   ASN A 306      28.874  44.467  41.646  1.00105.40           C  
ATOM    729  O   ASN A 306      29.036  44.061  40.494  1.00105.05           O  
ATOM    730  CB  ASN A 306      27.503  46.087  42.966  1.00108.67           C  
ATOM    731  CG  ASN A 306      26.118  46.700  43.144  1.00111.18           C  
ATOM    732  OD1 ASN A 306      25.093  46.021  43.026  1.00112.98           O  
ATOM    733  ND2 ASN A 306      26.087  47.995  43.440  1.00111.23           N  
ATOM    734  N   ARG A 309      31.653  44.118  39.238  1.00167.98           N  
ATOM    735  CA  ARG A 309      31.527  45.262  38.342  1.00167.78           C  
ATOM    736  C   ARG A 309      31.077  44.822  36.946  1.00167.70           C  
ATOM    737  O   ARG A 309      31.867  44.282  36.164  1.00167.61           O  
ATOM    738  CB  ARG A 309      32.847  46.041  38.271  1.00167.66           C  
ATOM    739  CG  ARG A 309      32.727  47.422  37.639  1.00167.57           C  
ATOM    740  CD  ARG A 309      34.093  48.047  37.401  1.00167.59           C  
ATOM    741  NE  ARG A 309      33.993  49.362  36.767  1.00167.49           N  
ATOM    742  CZ  ARG A 309      33.970  49.573  35.453  1.00167.57           C  
ATOM    743  NH1 ARG A 309      34.038  48.556  34.602  1.00167.55           N  
ATOM    744  NH2 ARG A 309      33.877  50.810  34.984  1.00167.61           N  
ATOM    745  N   TRP A 310      29.799  45.053  36.654  1.00167.19           N  
ATOM    746  CA  TRP A 310      29.207  44.733  35.355  1.00166.35           C  
ATOM    747  C   TRP A 310      29.323  45.930  34.410  1.00165.07           C  
ATOM    748  O   TRP A 310      29.066  47.072  34.803  1.00164.96           O  
ATOM    749  CB  TRP A 310      27.741  44.319  35.537  1.00167.08           C  
ATOM    750  CG  TRP A 310      26.989  43.972  34.265  1.00167.52           C  
ATOM    751  CD1 TRP A 310      26.433  44.849  33.374  1.00167.60           C  
ATOM    752  CD2 TRP A 310      26.682  42.657  33.772  1.00167.61           C  
ATOM    753  NE1 TRP A 310      25.816  44.165  32.354  1.00167.60           N  
ATOM    754  CE2 TRP A 310      25.952  42.820  32.572  1.00167.44           C  
ATOM    755  CE3 TRP A 310      26.959  41.358  34.223  1.00167.52           C  
ATOM    756  CZ2 TRP A 310      25.496  41.733  31.816  1.00167.05           C  
ATOM    757  CZ3 TRP A 310      26.503  40.276  33.470  1.00167.26           C  
ATOM    758  CH2 TRP A 310      25.780  40.474  32.280  1.00167.14           C  
ATOM    759  N   ALA A 311      29.717  45.656  33.168  1.00163.29           N  
ATOM    760  CA  ALA A 311      29.868  46.688  32.143  1.00161.75           C  
ATOM    761  C   ALA A 311      29.482  46.166  30.753  1.00160.11           C  
ATOM    762  O   ALA A 311      30.050  46.583  29.737  1.00160.13           O  
ATOM    763  CB  ALA A 311      31.299  47.238  32.144  1.00161.94           C  
ATOM    764  N   ILE A 312      28.508  45.256  30.721  1.00157.33           N  
ATOM    765  CA  ILE A 312      28.049  44.639  29.471  1.00154.68           C  
ATOM    766  C   ILE A 312      26.623  45.093  29.111  1.00151.04           C  
ATOM    767  O   ILE A 312      26.024  44.603  28.147  1.00150.34           O  
ATOM    768  CB  ILE A 312      28.141  43.080  29.519  1.00155.25           C  
ATOM    769  CG1 ILE A 312      29.287  42.618  30.433  1.00155.44           C  
ATOM    770  CG2 ILE A 312      28.304  42.504  28.105  1.00154.85           C  
ATOM    771  CD1 ILE A 312      29.159  41.185  30.941  1.00155.19           C  
ATOM    772  N   GLY A 313      26.094  46.039  29.887  1.00147.20           N  
ATOM    773  CA  GLY A 313      24.758  46.587  29.650  1.00142.79           C  
ATOM    774  C   GLY A 313      24.206  47.406  30.807  1.00138.93           C  
ATOM    775  O   GLY A 313      24.951  47.767  31.723  1.00139.31           O  
ATOM    776  N   PRO A 314      22.892  47.713  30.769  1.00134.94           N  
ATOM    777  CA  PRO A 314      22.243  48.485  31.829  1.00131.22           C  
ATOM    778  C   PRO A 314      21.922  47.629  33.051  1.00127.07           C  
ATOM    779  O   PRO A 314      21.596  46.447  32.908  1.00126.88           O  
ATOM    780  CB  PRO A 314      20.948  48.958  31.166  1.00131.66           C  
ATOM    781  CG  PRO A 314      20.623  47.890  30.188  1.00132.40           C  
ATOM    782  CD  PRO A 314      21.942  47.345  29.699  1.00133.81           C  
ATOM    783  N   HIS A 315      22.017  48.228  34.237  1.00122.71           N  
ATOM    784  CA  HIS A 315      21.689  47.534  35.486  1.00118.46           C  
ATOM    785  C   HIS A 315      21.632  48.455  36.704  1.00114.66           C  
ATOM    786  O   HIS A 315      22.210  49.547  36.709  1.00112.72           O  
ATOM    787  CB  HIS A 315      22.676  46.378  35.748  1.00118.67           C  
ATOM    788  CG  HIS A 315      24.051  46.824  36.146  1.00118.68           C  
ATOM    789  ND1 HIS A 315      24.617  46.493  37.358  1.00118.47           N  
ATOM    790  CD2 HIS A 315      24.972  47.573  35.494  1.00118.74           C  
ATOM    791  CE1 HIS A 315      25.827  47.018  37.437  1.00118.16           C  
ATOM    792  NE2 HIS A 315      26.066  47.680  36.319  1.00118.83           N  
ATOM    793  N   ASP A 316      20.900  48.006  37.721  1.00111.17           N  
ATOM    794  CA  ASP A 316      21.066  48.507  39.078  1.00106.93           C  
ATOM    795  C   ASP A 316      22.004  47.530  39.774  1.00102.28           C  
ATOM    796  O   ASP A 316      22.896  47.931  40.523  1.00 99.80           O  
ATOM    797  CB  ASP A 316      19.728  48.568  39.815  1.00107.42           C  
ATOM    798  CG  ASP A 316      19.845  49.225  41.182  1.00108.47           C  
ATOM    799  OD1 ASP A 316      20.062  50.455  41.235  1.00109.53           O  
ATOM    800  OD2 ASP A 316      19.721  48.516  42.203  1.00108.13           O  
ATOM    801  N   HIS A 317      21.790  46.245  39.495  1.00 99.92           N  
ATOM    802  CA  HIS A 317      22.592  45.149  40.028  1.00 99.76           C  
ATOM    803  C   HIS A 317      22.411  43.903  39.156  1.00100.06           C  
ATOM    804  O   HIS A 317      21.677  43.939  38.166  1.00101.12           O  
ATOM    805  CB  HIS A 317      22.203  44.853  41.482  1.00 99.41           C  
ATOM    806  CG  HIS A 317      20.752  44.534  41.674  1.00 98.73           C  
ATOM    807  ND1 HIS A 317      20.271  43.243  41.712  1.00 97.99           N  
ATOM    808  CD2 HIS A 317      19.677  45.340  41.848  1.00 98.92           C  
ATOM    809  CE1 HIS A 317      18.965  43.266  41.906  1.00 97.84           C  
ATOM    810  NE2 HIS A 317      18.578  44.526  41.987  1.00 98.55           N  
ATOM    811  N   ILE A 318      23.088  42.812  39.512  1.00 99.29           N  
ATOM    812  CA  ILE A 318      22.904  41.531  38.817  1.00 99.28           C  
ATOM    813  C   ILE A 318      22.605  40.391  39.791  1.00 98.94           C  
ATOM    814  O   ILE A 318      23.342  40.176  40.756  1.00101.22           O  
ATOM    815  CB  ILE A 318      24.105  41.160  37.894  1.00 98.92           C  
ATOM    816  CG1 ILE A 318      25.435  41.248  38.652  1.00100.62           C  
ATOM    817  CG2 ILE A 318      24.131  42.054  36.659  1.00 98.02           C  
ATOM    818  CD1 ILE A 318      26.656  40.768  37.858  1.00101.04           C  
ATOM    819  N   LEU A 319      21.507  39.677  39.543  1.00 96.28           N  
ATOM    820  CA  LEU A 319      21.164  38.496  40.328  1.00 93.13           C  
ATOM    821  C   LEU A 319      22.059  37.353  39.894  1.00 94.20           C  
ATOM    822  O   LEU A 319      22.046  36.949  38.730  1.00 94.35           O  
ATOM    823  CB  LEU A 319      19.695  38.107  40.147  1.00 90.58           C  
ATOM    824  CG  LEU A 319      19.126  37.052  41.109  1.00 88.59           C  
ATOM    825  CD1 LEU A 319      17.613  37.141  41.154  1.00 89.75           C  
ATOM    826  CD2 LEU A 319      19.560  35.632  40.765  1.00 86.65           C  
ATOM    827  N   ARG A 320      22.823  36.830  40.845  1.00 94.47           N  
ATOM    828  CA  ARG A 320      23.813  35.807  40.562  1.00 94.75           C  
ATOM    829  C   ARG A 320      23.351  34.438  41.066  1.00 93.60           C  
ATOM    830  O   ARG A 320      22.541  34.351  41.988  1.00 94.00           O  
ATOM    831  CB  ARG A 320      25.136  36.209  41.210  1.00 97.30           C  
ATOM    832  CG  ARG A 320      26.376  35.624  40.574  1.00100.18           C  
ATOM    833  CD  ARG A 320      27.624  36.223  41.207  1.00102.27           C  
ATOM    834  NE  ARG A 320      28.361  37.087  40.288  1.00105.24           N  
ATOM    835  CZ  ARG A 320      29.258  37.994  40.666  1.00106.05           C  
ATOM    836  NH1 ARG A 320      29.521  38.179  41.956  1.00106.05           N  
ATOM    837  NH2 ARG A 320      29.883  38.730  39.752  1.00104.56           N  
ATOM    838  N   VAL A 321      23.842  33.380  40.424  1.00 92.30           N  
ATOM    839  CA  VAL A 321      23.690  32.002  40.910  1.00 89.24           C  
ATOM    840  C   VAL A 321      25.072  31.349  40.866  1.00 89.20           C  
ATOM    841  O   VAL A 321      25.672  31.207  39.792  1.00 87.50           O  
ATOM    842  CB  VAL A 321      22.674  31.173  40.072  1.00 85.84           C  
ATOM    843  CG1 VAL A 321      22.674  29.708  40.506  1.00 81.52           C  
ATOM    844  CG2 VAL A 321      21.279  31.756  40.188  1.00 86.04           C  
ATOM    845  N   VAL A 322      25.572  30.970  42.039  1.00 87.86           N  
ATOM    846  CA  VAL A 322      26.946  30.496  42.185  1.00 89.17           C  
ATOM    847  C   VAL A 322      26.985  29.124  42.847  1.00 91.72           C  
ATOM    848  O   VAL A 322      26.127  28.803  43.674  1.00 93.81           O  
ATOM    849  CB  VAL A 322      27.780  31.483  43.039  1.00 87.95           C  
ATOM    850  CG1 VAL A 322      29.215  31.015  43.166  1.00 89.54           C  
ATOM    851  CG2 VAL A 322      27.745  32.869  42.445  1.00 86.39           C  
ATOM    852  N   GLU A 323      27.981  28.318  42.484  1.00 91.11           N  
ATOM    853  CA  GLU A 323      28.221  27.061  43.179  1.00 91.89           C  
ATOM    854  C   GLU A 323      29.378  27.177  44.166  1.00 92.44           C  
ATOM    855  O   GLU A 323      30.476  27.620  43.808  1.00 91.02           O  
ATOM    856  CB  GLU A 323      28.486  25.926  42.193  1.00 92.74           C  
ATOM    857  CG  GLU A 323      28.854  24.610  42.866  1.00 95.22           C  
ATOM    858  CD  GLU A 323      29.356  23.573  41.890  1.00 97.57           C  
ATOM    859  OE1 GLU A 323      30.591  23.482  41.693  1.00 96.15           O  
ATOM    860  OE2 GLU A 323      28.513  22.851  41.317  1.00 99.26           O  
ATOM    861  N   TYR A 324      29.118  26.776  45.409  1.00 93.13           N  
ATOM    862  CA  TYR A 324      30.164  26.674  46.427  1.00 95.16           C  
ATOM    863  C   TYR A 324      30.429  25.229  46.840  1.00 95.73           C  
ATOM    864  O   TYR A 324      29.636  24.332  46.557  1.00 97.91           O  
ATOM    865  CB  TYR A 324      29.823  27.529  47.654  1.00 95.51           C  
ATOM    866  CG  TYR A 324      30.177  28.982  47.475  1.00 95.15           C  
ATOM    867  CD1 TYR A 324      31.463  29.441  47.743  1.00 94.78           C  
ATOM    868  CD2 TYR A 324      29.232  29.895  47.017  1.00 94.38           C  
ATOM    869  CE1 TYR A 324      31.794  30.770  47.567  1.00 95.13           C  
ATOM    870  CE2 TYR A 324      29.553  31.226  46.838  1.00 93.97           C  
ATOM    871  CZ  TYR A 324      30.834  31.658  47.114  1.00 95.31           C  
ATOM    872  OH  TYR A 324      31.159  32.982  46.934  1.00 96.92           O  
ATOM    873  N   THR A 325      31.553  25.013  47.514  1.00 93.94           N  
ATOM    874  CA  THR A 325      31.908  23.690  48.008  1.00 91.29           C  
ATOM    875  C   THR A 325      32.414  23.821  49.443  1.00 89.81           C  
ATOM    876  O   THR A 325      33.140  24.764  49.752  1.00 91.49           O  
ATOM    877  CB  THR A 325      32.972  23.034  47.098  1.00 89.22           C  
ATOM    878  OG1 THR A 325      32.584  23.185  45.726  1.00 86.78           O  
ATOM    879  CG2 THR A 325      33.123  21.553  47.405  1.00 88.75           C  
ATOM    880  N   VAL A 326      32.013  22.894  50.315  1.00 87.75           N  
ATOM    881  CA  VAL A 326      32.503  22.870  51.699  1.00 88.84           C  
ATOM    882  C   VAL A 326      34.011  22.733  51.776  1.00 89.76           C  
ATOM    883  O   VAL A 326      34.628  22.044  50.955  1.00 90.84           O  
ATOM    884  CB  VAL A 326      31.924  21.705  52.551  1.00 89.43           C  
ATOM    885  CG1 VAL A 326      31.042  22.231  53.669  1.00 90.48           C  
ATOM    886  CG2 VAL A 326      31.216  20.684  51.695  1.00 89.40           C  
ATOM    887  N   SER A 327      34.593  23.385  52.777  1.00 88.03           N  
ATOM    888  CA  SER A 327      35.982  23.165  53.127  1.00 87.19           C  
ATOM    889  C   SER A 327      36.216  21.669  53.302  1.00 88.55           C  
ATOM    890  O   SER A 327      35.505  21.008  54.059  1.00 85.65           O  
ATOM    891  CB  SER A 327      36.320  23.900  54.421  1.00 85.44           C  
ATOM    892  OG  SER A 327      37.670  23.704  54.781  1.00 88.35           O  
ATOM    893  N   ARG A 328      37.198  21.135  52.581  1.00 93.75           N  
ATOM    894  CA  ARG A 328      37.601  19.742  52.767  1.00 96.51           C  
ATOM    895  C   ARG A 328      38.072  19.493  54.197  1.00 93.84           C  
ATOM    896  O   ARG A 328      38.076  18.357  54.664  1.00 92.58           O  
ATOM    897  CB  ARG A 328      38.663  19.292  51.745  1.00 97.82           C  
ATOM    898  CG  ARG A 328      39.150  20.344  50.743  1.00100.85           C  
ATOM    899  CD  ARG A 328      40.343  19.809  49.931  1.00102.81           C  
ATOM    900  NE  ARG A 328      40.501  20.475  48.633  1.00108.37           N  
ATOM    901  CZ  ARG A 328      41.546  20.322  47.814  1.00112.13           C  
ATOM    902  NH1 ARG A 328      42.564  19.527  48.139  1.00113.26           N  
ATOM    903  NH2 ARG A 328      41.579  20.974  46.657  1.00112.36           N  
ATOM    904  N   LYS A 329      38.426  20.575  54.890  1.00 94.66           N  
ATOM    905  CA  LYS A 329      39.000  20.508  56.234  1.00 95.70           C  
ATOM    906  C   LYS A 329      38.005  20.809  57.350  1.00 96.40           C  
ATOM    907  O   LYS A 329      38.206  20.387  58.491  1.00 97.56           O  
ATOM    908  CB  LYS A 329      40.221  21.429  56.334  1.00 96.76           C  
ATOM    909  CG  LYS A 329      41.435  20.887  55.586  1.00 99.19           C  
ATOM    910  CD  LYS A 329      42.545  21.907  55.469  1.00101.10           C  
ATOM    911  CE  LYS A 329      43.526  21.496  54.387  1.00102.27           C  
ATOM    912  NZ  LYS A 329      44.748  22.339  54.414  1.00104.44           N  
ATOM    913  N   ASN A 330      36.939  21.536  57.024  1.00 96.51           N  
ATOM    914  CA  ASN A 330      35.919  21.877  58.010  1.00 98.56           C  
ATOM    915  C   ASN A 330      34.493  21.648  57.483  1.00 99.58           C  
ATOM    916  O   ASN A 330      33.977  22.448  56.700  1.00101.53           O  
ATOM    917  CB  ASN A 330      36.117  23.318  58.512  1.00100.32           C  
ATOM    918  CG  ASN A 330      35.231  23.658  59.712  1.00102.28           C  
ATOM    919  OD1 ASN A 330      34.745  22.773  60.419  1.00103.24           O  
ATOM    920  ND2 ASN A 330      35.028  24.950  59.947  1.00102.18           N  
ATOM    921  N   PRO A 331      33.843  20.559  57.928  1.00 98.65           N  
ATOM    922  CA  PRO A 331      32.521  20.205  57.418  1.00 99.28           C  
ATOM    923  C   PRO A 331      31.441  21.221  57.802  1.00101.87           C  
ATOM    924  O   PRO A 331      30.301  21.120  57.330  1.00104.21           O  
ATOM    925  CB  PRO A 331      32.244  18.852  58.080  1.00 98.68           C  
ATOM    926  CG  PRO A 331      33.035  18.883  59.322  1.00100.83           C  
ATOM    927  CD  PRO A 331      34.299  19.607  58.955  1.00 99.60           C  
ATOM    928  N   HIS A 332      31.801  22.195  58.635  1.00101.67           N  
ATOM    929  CA  HIS A 332      30.856  23.231  59.052  1.00100.41           C  
ATOM    930  C   HIS A 332      31.146  24.604  58.452  1.00100.59           C  
ATOM    931  O   HIS A 332      30.624  25.622  58.926  1.00100.68           O  
ATOM    932  CB  HIS A 332      30.799  23.312  60.570  1.00 97.87           C  
ATOM    933  CG  HIS A 332      30.404  22.026  61.212  1.00 98.36           C  
ATOM    934  ND1 HIS A 332      31.226  21.345  62.080  1.00100.39           N  
ATOM    935  CD2 HIS A 332      29.282  21.282  61.091  1.00100.16           C  
ATOM    936  CE1 HIS A 332      30.620  20.243  62.482  1.00102.29           C  
ATOM    937  NE2 HIS A 332      29.441  20.179  61.892  1.00103.07           N  
ATOM    938  N   GLN A 333      31.962  24.624  57.398  1.00 97.87           N  
ATOM    939  CA  GLN A 333      32.300  25.862  56.716  1.00 95.06           C  
ATOM    940  C   GLN A 333      32.681  25.606  55.261  1.00 95.00           C  
ATOM    941  O   GLN A 333      33.420  24.670  54.965  1.00 95.21           O  
ATOM    942  CB  GLN A 333      33.449  26.539  57.445  1.00 94.39           C  
ATOM    943  CG  GLN A 333      33.423  28.049  57.401  1.00 94.97           C  
ATOM    944  CD  GLN A 333      34.519  28.649  58.252  1.00 94.84           C  
ATOM    945  OE1 GLN A 333      34.543  28.472  59.474  1.00 92.57           O  
ATOM    946  NE2 GLN A 333      35.444  29.356  57.609  1.00 95.79           N  
ATOM    947  N   VAL A 334      32.165  26.433  54.357  1.00 94.17           N  
ATOM    948  CA  VAL A 334      32.529  26.351  52.943  1.00 95.13           C  
ATOM    949  C   VAL A 334      33.742  27.248  52.701  1.00 95.89           C  
ATOM    950  O   VAL A 334      33.881  28.281  53.359  1.00 99.51           O  
ATOM    951  CB  VAL A 334      31.347  26.776  52.012  1.00 96.09           C  
ATOM    952  CG1 VAL A 334      30.065  26.958  52.805  1.00 94.21           C  
ATOM    953  CG2 VAL A 334      31.656  28.056  51.237  1.00 96.66           C  
ATOM    954  N   ASP A 335      34.629  26.875  51.783  1.00 93.86           N  
ATOM    955  CA  ASP A 335      35.679  27.822  51.431  1.00 97.49           C  
ATOM    956  C   ASP A 335      35.299  28.663  50.214  1.00 95.58           C  
ATOM    957  O   ASP A 335      34.936  28.142  49.164  1.00 93.41           O  
ATOM    958  CB  ASP A 335      37.094  27.195  51.360  1.00101.59           C  
ATOM    959  CG  ASP A 335      37.367  26.463  50.061  1.00 99.98           C  
ATOM    960  OD1 ASP A 335      36.480  25.710  49.612  1.00102.10           O  
ATOM    961  OD2 ASP A 335      38.481  26.629  49.513  1.00 95.39           O  
ATOM    962  N   LEU A 336      35.379  29.977  50.398  1.00 96.45           N  
ATOM    963  CA  LEU A 336      34.887  30.957  49.435  1.00 95.90           C  
ATOM    964  C   LEU A 336      35.630  30.944  48.099  1.00 94.75           C  
ATOM    965  O   LEU A 336      35.154  31.528  47.127  1.00 97.07           O  
ATOM    966  CB  LEU A 336      34.913  32.365  50.054  1.00 96.00           C  
ATOM    967  CG  LEU A 336      34.384  32.522  51.487  1.00 95.92           C  
ATOM    968  CD1 LEU A 336      34.717  33.895  52.041  1.00 96.50           C  
ATOM    969  CD2 LEU A 336      32.882  32.270  51.565  1.00 97.37           C  
ATOM    970  N   ARG A 337      36.779  30.269  48.052  1.00 93.05           N  
ATOM    971  CA  ARG A 337      37.607  30.204  46.838  1.00 91.98           C  
ATOM    972  C   ARG A 337      37.004  29.310  45.755  1.00 89.08           C  
ATOM    973  O   ARG A 337      37.465  29.325  44.615  1.00 90.58           O  
ATOM    974  CB  ARG A 337      39.022  29.713  47.163  1.00 92.11           C  
ATOM    975  CG  ARG A 337      39.654  30.344  48.403  1.00 94.04           C  
ATOM    976  CD  ARG A 337      41.113  29.934  48.562  1.00 95.46           C  
ATOM    977  NE  ARG A 337      41.299  28.483  48.635  1.00 99.18           N  
ATOM    978  CZ  ARG A 337      41.622  27.807  49.736  1.00101.03           C  
ATOM    979  NH1 ARG A 337      41.805  28.439  50.889  1.00104.07           N  
ATOM    980  NH2 ARG A 337      41.768  26.491  49.682  1.00100.37           N  
ATOM    981  N   THR A 338      35.975  28.543  46.116  1.00 85.43           N  
ATOM    982  CA  THR A 338      35.362  27.557  45.221  1.00 79.82           C  
ATOM    983  C   THR A 338      34.212  28.118  44.396  1.00 81.42           C  
ATOM    984  O   THR A 338      33.534  27.368  43.681  1.00 82.65           O  
ATOM    985  CB  THR A 338      34.835  26.335  45.998  1.00 76.77           C  
ATOM    986  OG1 THR A 338      34.125  26.776  47.160  1.00 76.70           O  
ATOM    987  CG2 THR A 338      35.972  25.424  46.418  1.00 76.11           C  
ATOM    988  N   ALA A 339      33.994  29.428  44.498  1.00 82.11           N  
ATOM    989  CA  ALA A 339      32.895  30.099  43.797  1.00 82.83           C  
ATOM    990  C   ALA A 339      32.932  29.830  42.293  1.00 83.25           C  
ATOM    991  O   ALA A 339      33.937  30.102  41.633  1.00 88.58           O  
ATOM    992  CB  ALA A 339      32.930  31.598  44.072  1.00 81.99           C  
ATOM    993  N   ARG A 340      31.850  29.263  41.772  1.00 78.73           N  
ATOM    994  CA  ARG A 340      31.687  29.045  40.344  0.50 79.60           C  
ATOM    995  C   ARG A 340      30.414  29.723  39.896  1.00 84.48           C  
ATOM    996  O   ARG A 340      29.315  29.218  40.141  1.00 89.15           O  
ATOM    997  CB  ARG A 340      31.569  27.559  40.022  0.50 76.39           C  
ATOM    998  CG  ARG A 340      32.864  26.848  39.814  0.50 74.62           C  
ATOM    999  CD  ARG A 340      32.823  26.042  38.525  0.50 75.59           C  
ATOM   1000  NE  ARG A 340      31.632  25.205  38.384  0.50 77.15           N  
ATOM   1001  CZ  ARG A 340      31.460  24.021  38.967  0.50 77.57           C  
ATOM   1002  NH1 ARG A 340      32.398  23.517  39.762  0.50 78.67           N  
ATOM   1003  NH2 ARG A 340      30.338  23.341  38.765  0.50 75.54           N  
ATOM   1004  N   VAL A 341      30.554  30.872  39.250  1.00 86.70           N  
ATOM   1005  CA  VAL A 341      29.398  31.579  38.718  1.00 88.77           C  
ATOM   1006  C   VAL A 341      28.718  30.692  37.676  1.00 89.57           C  
ATOM   1007  O   VAL A 341      29.365  30.213  36.750  1.00 90.61           O  
ATOM   1008  CB  VAL A 341      29.791  32.954  38.125  1.00 90.41           C  
ATOM   1009  CG1 VAL A 341      28.671  33.525  37.272  1.00 91.71           C  
ATOM   1010  CG2 VAL A 341      30.156  33.931  39.242  1.00 91.74           C  
ATOM   1011  N   PHE A 342      27.422  30.455  37.866  1.00 91.39           N  
ATOM   1012  CA  PHE A 342      26.612  29.670  36.940  1.00 91.12           C  
ATOM   1013  C   PHE A 342      25.827  30.604  36.036  1.00 92.01           C  
ATOM   1014  O   PHE A 342      25.833  30.458  34.814  1.00 90.19           O  
ATOM   1015  CB  PHE A 342      25.640  28.778  37.721  1.00 91.52           C  
ATOM   1016  CG  PHE A 342      26.160  27.394  38.006  1.00 91.77           C  
ATOM   1017  CD1 PHE A 342      25.287  26.314  38.038  1.00 91.85           C  
ATOM   1018  CD2 PHE A 342      27.511  27.162  38.239  1.00 92.29           C  
ATOM   1019  CE1 PHE A 342      25.747  25.028  38.302  1.00 91.67           C  
ATOM   1020  CE2 PHE A 342      27.978  25.877  38.498  1.00 92.65           C  
ATOM   1021  CZ  PHE A 342      27.091  24.809  38.530  1.00 91.89           C  
ATOM   1022  N   LEU A 343      25.150  31.567  36.658  1.00 95.29           N  
ATOM   1023  CA  LEU A 343      24.255  32.478  35.957  1.00 98.17           C  
ATOM   1024  C   LEU A 343      24.371  33.883  36.516  1.00 99.05           C  
ATOM   1025  O   LEU A 343      24.430  34.075  37.733  1.00101.91           O  
ATOM   1026  CB  LEU A 343      22.800  32.007  36.087  1.00 98.77           C  
ATOM   1027  CG  LEU A 343      22.314  30.823  35.245  1.00 99.10           C  
ATOM   1028  CD1 LEU A 343      21.013  30.259  35.798  1.00 97.63           C  
ATOM   1029  CD2 LEU A 343      22.150  31.225  33.784  1.00100.83           C  
ATOM   1030  N   GLU A 344      24.404  34.861  35.621  1.00 97.45           N  
ATOM   1031  CA  GLU A 344      24.344  36.259  36.011  1.00 97.29           C  
ATOM   1032  C   GLU A 344      23.162  36.892  35.299  1.00 96.59           C  
ATOM   1033  O   GLU A 344      23.113  36.938  34.066  1.00 97.55           O  
ATOM   1034  CB  GLU A 344      25.644  36.980  35.660  1.00 99.32           C  
ATOM   1035  CG  GLU A 344      26.837  36.586  36.528  1.00 99.69           C  
ATOM   1036  CD  GLU A 344      28.174  37.061  35.962  1.00 98.37           C  
ATOM   1037  OE1 GLU A 344      28.917  37.746  36.700  1.00 98.12           O  
ATOM   1038  OE2 GLU A 344      28.479  36.749  34.787  1.00 95.90           O  
ATOM   1039  N   VAL A 345      22.198  37.358  36.085  1.00 94.41           N  
ATOM   1040  CA  VAL A 345      20.969  37.931  35.552  1.00 90.52           C  
ATOM   1041  C   VAL A 345      20.910  39.425  35.866  1.00 90.46           C  
ATOM   1042  O   VAL A 345      20.646  39.820  37.003  1.00 89.59           O  
ATOM   1043  CB  VAL A 345      19.720  37.202  36.109  1.00 88.41           C  
ATOM   1044  CG1 VAL A 345      18.441  37.816  35.562  1.00 88.59           C  
ATOM   1045  CG2 VAL A 345      19.776  35.714  35.781  1.00 86.69           C  
ATOM   1046  N   ALA A 346      21.173  40.245  34.851  1.00 91.68           N  
ATOM   1047  CA  ALA A 346      21.095  41.699  34.985  1.00 93.13           C  
ATOM   1048  C   ALA A 346      19.717  42.133  35.487  1.00 95.37           C  
ATOM   1049  O   ALA A 346      18.688  41.700  34.956  1.00 95.61           O  
ATOM   1050  CB  ALA A 346      21.425  42.374  33.661  1.00 91.04           C  
ATOM   1051  N   GLU A 347      19.703  42.970  36.520  1.00 96.68           N  
ATOM   1052  CA  GLU A 347      18.450  43.477  37.063  1.00 99.36           C  
ATOM   1053  C   GLU A 347      18.396  45.000  37.038  1.00100.42           C  
ATOM   1054  O   GLU A 347      19.395  45.680  37.290  1.00100.25           O  
ATOM   1055  CB  GLU A 347      18.224  42.962  38.483  1.00101.34           C  
ATOM   1056  CG  GLU A 347      16.777  42.566  38.772  1.00104.20           C  
ATOM   1057  CD  GLU A 347      16.461  41.111  38.417  1.00106.18           C  
ATOM   1058  OE1 GLU A 347      17.334  40.409  37.861  1.00107.25           O  
ATOM   1059  OE2 GLU A 347      15.332  40.660  38.703  1.00107.57           O  
ATOM   1060  N   LEU A 348      17.215  45.526  36.733  1.00102.07           N  
ATOM   1061  CA  LEU A 348      17.019  46.964  36.615  1.00103.54           C  
ATOM   1062  C   LEU A 348      16.369  47.577  37.849  1.00104.97           C  
ATOM   1063  O   LEU A 348      16.660  48.722  38.196  1.00105.85           O  
ATOM   1064  CB  LEU A 348      16.207  47.293  35.357  1.00103.89           C  
ATOM   1065  CG  LEU A 348      16.986  47.283  34.034  1.00103.67           C  
ATOM   1066  CD1 LEU A 348      16.054  47.123  32.847  1.00103.82           C  
ATOM   1067  CD2 LEU A 348      17.843  48.535  33.881  1.00103.06           C  
ATOM   1068  N   HIS A 349      15.501  46.815  38.510  1.00105.71           N  
ATOM   1069  CA  HIS A 349      14.773  47.318  39.675  1.00105.62           C  
ATOM   1070  C   HIS A 349      15.097  46.557  40.954  1.00105.47           C  
ATOM   1071  O   HIS A 349      15.753  45.515  40.913  1.00107.43           O  
ATOM   1072  CB  HIS A 349      13.271  47.322  39.397  1.00106.06           C  
ATOM   1073  CG  HIS A 349      12.865  48.310  38.351  1.00105.88           C  
ATOM   1074  ND1 HIS A 349      12.481  49.599  38.655  1.00106.04           N  
ATOM   1075  CD2 HIS A 349      12.810  48.208  37.003  1.00105.56           C  
ATOM   1076  CE1 HIS A 349      12.194  50.244  37.539  1.00106.59           C  
ATOM   1077  NE2 HIS A 349      12.385  49.422  36.522  1.00106.90           N  
ATOM   1078  N   ARG A 350      14.641  47.088  42.085  1.00103.75           N  
ATOM   1079  CA  ARG A 350      14.929  46.497  43.391  1.00101.98           C  
ATOM   1080  C   ARG A 350      13.699  45.809  43.989  1.00103.40           C  
ATOM   1081  O   ARG A 350      13.466  45.874  45.198  1.00104.00           O  
ATOM   1082  CB  ARG A 350      15.488  47.562  44.341  1.00 98.92           C  
ATOM   1083  CG  ARG A 350      16.687  48.291  43.777  1.00 96.33           C  
ATOM   1084  CD  ARG A 350      17.210  49.379  44.693  1.00 94.21           C  
ATOM   1085  NE  ARG A 350      18.391  50.016  44.109  1.00 93.26           N  
ATOM   1086  CZ  ARG A 350      19.115  50.958  44.702  1.00 92.93           C  
ATOM   1087  NH1 ARG A 350      18.791  51.391  45.914  1.00 93.96           N  
ATOM   1088  NH2 ARG A 350      20.168  51.468  44.082  1.00 92.05           N  
ATOM   1089  N   LYS A 351      12.929  45.149  43.124  1.00104.81           N  
ATOM   1090  CA  LYS A 351      11.701  44.435  43.494  1.00106.84           C  
ATOM   1091  C   LYS A 351      11.388  43.355  42.459  1.00106.47           C  
ATOM   1092  O   LYS A 351      11.917  43.392  41.344  1.00106.39           O  
ATOM   1093  CB  LYS A 351      10.522  45.408  43.592  1.00109.85           C  
ATOM   1094  CG  LYS A 351      10.352  46.062  44.953  1.00114.14           C  
ATOM   1095  CD  LYS A 351       9.622  47.390  44.841  1.00116.54           C  
ATOM   1096  CE  LYS A 351       9.542  48.090  46.189  1.00118.28           C  
ATOM   1097  NZ  LYS A 351       9.020  49.479  46.053  1.00118.98           N  
ATOM   1098  N   HIS A 352      10.526  42.404  42.828  1.00105.76           N  
ATOM   1099  CA  HIS A 352      10.096  41.319  41.930  1.00106.31           C  
ATOM   1100  C   HIS A 352      11.259  40.410  41.526  1.00104.52           C  
ATOM   1101  O   HIS A 352      11.266  39.853  40.428  1.00105.99           O  
ATOM   1102  CB  HIS A 352       9.428  41.886  40.666  1.00109.80           C  
ATOM   1103  CG  HIS A 352       8.047  42.420  40.884  1.00114.03           C  
ATOM   1104  ND1 HIS A 352       7.751  43.365  41.844  1.00116.06           N  
ATOM   1105  CD2 HIS A 352       6.884  42.164  40.240  1.00115.26           C  
ATOM   1106  CE1 HIS A 352       6.462  43.651  41.796  1.00115.97           C  
ATOM   1107  NE2 HIS A 352       5.913  42.935  40.832  1.00116.39           N  
ATOM   1108  N   LEU A 353      12.234  40.259  42.417  1.00100.67           N  
ATOM   1109  CA  LEU A 353      13.482  39.572  42.091  1.00 98.77           C  
ATOM   1110  C   LEU A 353      13.369  38.049  42.045  1.00 99.30           C  
ATOM   1111  O   LEU A 353      13.787  37.427  41.066  1.00100.03           O  
ATOM   1112  CB  LEU A 353      14.586  39.996  43.065  1.00 98.44           C  
ATOM   1113  CG  LEU A 353      15.565  41.124  42.702  1.00 98.67           C  
ATOM   1114  CD1 LEU A 353      14.921  42.358  42.062  1.00 96.42           C  
ATOM   1115  CD2 LEU A 353      16.310  41.520  43.956  1.00 99.86           C  
ATOM   1116  N   GLY A 354      12.806  37.456  43.098  1.00 99.92           N  
ATOM   1117  CA  GLY A 354      12.738  35.999  43.228  1.00 98.61           C  
ATOM   1118  C   GLY A 354      14.103  35.421  43.557  1.00 99.00           C  
ATOM   1119  O   GLY A 354      14.852  35.999  44.349  1.00100.51           O  
ATOM   1120  N   GLY A 355      14.431  34.283  42.950  1.00 97.53           N  
ATOM   1121  CA  GLY A 355      15.746  33.666  43.121  1.00 96.13           C  
ATOM   1122  C   GLY A 355      15.736  32.338  43.854  1.00 95.93           C  
ATOM   1123  O   GLY A 355      16.787  31.751  44.100  1.00 96.08           O  
ATOM   1124  N   GLN A 356      14.545  31.864  44.202  1.00 96.51           N  
ATOM   1125  CA  GLN A 356      14.380  30.590  44.887  1.00 99.23           C  
ATOM   1126  C   GLN A 356      15.072  29.462  44.124  1.00100.71           C  
ATOM   1127  O   GLN A 356      14.832  29.277  42.927  1.00102.89           O  
ATOM   1128  CB  GLN A 356      12.890  30.286  45.037  1.00 99.91           C  
ATOM   1129  CG  GLN A 356      12.551  29.123  45.958  1.00100.98           C  
ATOM   1130  CD  GLN A 356      11.049  28.874  46.043  1.00101.27           C  
ATOM   1131  OE1 GLN A 356      10.240  29.744  45.705  1.00102.82           O  
ATOM   1132  NE2 GLN A 356      10.671  27.683  46.497  1.00 99.87           N  
ATOM   1133  N   LEU A 357      15.941  28.726  44.816  1.00 99.86           N  
ATOM   1134  CA  LEU A 357      16.615  27.562  44.230  1.00 98.14           C  
ATOM   1135  C   LEU A 357      16.059  26.263  44.809  1.00 98.35           C  
ATOM   1136  O   LEU A 357      15.700  26.217  45.990  1.00101.82           O  
ATOM   1137  CB  LEU A 357      18.127  27.621  44.477  1.00 95.71           C  
ATOM   1138  CG  LEU A 357      18.973  28.821  44.040  1.00 95.16           C  
ATOM   1139  CD1 LEU A 357      20.433  28.472  44.172  1.00 95.79           C  
ATOM   1140  CD2 LEU A 357      18.688  29.260  42.619  1.00 94.63           C  
ATOM   1141  N   LEU A 358      16.000  25.212  43.991  1.00 94.07           N  
ATOM   1142  CA  LEU A 358      15.547  23.898  44.464  1.00 93.33           C  
ATOM   1143  C   LEU A 358      15.955  22.755  43.535  1.00 96.04           C  
ATOM   1144  O   LEU A 358      16.086  22.948  42.324  1.00 97.44           O  
ATOM   1145  CB  LEU A 358      14.025  23.903  44.653  1.00 93.45           C  
ATOM   1146  CG  LEU A 358      13.157  23.991  43.390  1.00 93.78           C  
ATOM   1147  CD1 LEU A 358      12.690  22.601  42.936  1.00 92.57           C  
ATOM   1148  CD2 LEU A 358      11.975  24.916  43.610  1.00 92.08           C  
ATOM   1149  N   PHE A 359      16.137  21.565  44.105  1.00 98.73           N  
ATOM   1150  CA  PHE A 359      16.366  20.342  43.315  1.00100.52           C  
ATOM   1151  C   PHE A 359      15.145  19.423  43.319  1.00 98.90           C  
ATOM   1152  O   PHE A 359      14.753  18.921  44.366  1.00102.03           O  
ATOM   1153  CB  PHE A 359      17.548  19.543  43.871  1.00100.91           C  
ATOM   1154  CG  PHE A 359      18.888  20.024  43.414  1.00100.66           C  
ATOM   1155  CD1 PHE A 359      19.717  20.727  44.283  1.00100.45           C  
ATOM   1156  CD2 PHE A 359      19.337  19.751  42.129  1.00100.93           C  
ATOM   1157  CE1 PHE A 359      20.967  21.165  43.880  1.00100.20           C  
ATOM   1158  CE2 PHE A 359      20.587  20.184  41.709  1.00101.67           C  
ATOM   1159  CZ  PHE A 359      21.403  20.896  42.586  1.00101.85           C  
ATOM   1160  N   GLY A 360      14.553  19.182  42.157  1.00 96.60           N  
ATOM   1161  CA  GLY A 360      13.481  18.191  42.062  1.00 97.94           C  
ATOM   1162  C   GLY A 360      14.061  16.788  42.084  1.00 98.39           C  
ATOM   1163  O   GLY A 360      15.279  16.631  42.141  1.00101.54           O  
ATOM   1164  N   PRO A 361      13.204  15.751  42.061  1.00 97.67           N  
ATOM   1165  CA  PRO A 361      13.743  14.409  41.818  1.00 97.24           C  
ATOM   1166  C   PRO A 361      14.286  14.283  40.392  1.00 98.60           C  
ATOM   1167  O   PRO A 361      14.052  15.160  39.550  1.00 97.62           O  
ATOM   1168  CB  PRO A 361      12.536  13.493  42.041  1.00 96.97           C  
ATOM   1169  CG  PRO A 361      11.537  14.337  42.808  1.00 96.76           C  
ATOM   1170  CD  PRO A 361      11.750  15.722  42.290  1.00 97.09           C  
ATOM   1171  N   ASP A 362      15.018  13.204  40.134  1.00101.35           N  
ATOM   1172  CA  ASP A 362      15.838  13.081  38.919  1.00105.56           C  
ATOM   1173  C   ASP A 362      17.051  14.031  38.968  1.00105.22           C  
ATOM   1174  O   ASP A 362      17.942  13.959  38.111  1.00107.55           O  
ATOM   1175  CB  ASP A 362      15.014  13.273  37.632  1.00109.37           C  
ATOM   1176  CG  ASP A 362      13.921  12.209  37.458  1.00113.67           C  
ATOM   1177  OD1 ASP A 362      13.799  11.650  36.343  1.00113.67           O  
ATOM   1178  OD2 ASP A 362      13.177  11.934  38.428  1.00115.60           O  
ATOM   1179  N   GLY A 363      17.065  14.914  39.972  1.00100.18           N  
ATOM   1180  CA  GLY A 363      18.252  15.678  40.360  1.00 94.35           C  
ATOM   1181  C   GLY A 363      18.573  16.977  39.639  1.00 93.49           C  
ATOM   1182  O   GLY A 363      19.678  17.505  39.796  1.00 94.42           O  
ATOM   1183  N   PHE A 364      17.632  17.498  38.852  1.00 92.63           N  
ATOM   1184  CA  PHE A 364      17.842  18.765  38.143  1.00 92.38           C  
ATOM   1185  C   PHE A 364      17.587  19.979  39.042  1.00 93.69           C  
ATOM   1186  O   PHE A 364      16.692  19.957  39.887  1.00 96.56           O  
ATOM   1187  CB  PHE A 364      16.964  18.846  36.895  1.00 91.59           C  
ATOM   1188  CG  PHE A 364      17.104  17.671  35.966  1.00 92.91           C  
ATOM   1189  CD1 PHE A 364      18.357  17.247  35.530  1.00 93.25           C  
ATOM   1190  CD2 PHE A 364      15.974  16.998  35.506  1.00 93.39           C  
ATOM   1191  CE1 PHE A 364      18.482  16.162  34.658  1.00 92.14           C  
ATOM   1192  CE2 PHE A 364      16.090  15.911  34.633  1.00 90.98           C  
ATOM   1193  CZ  PHE A 364      17.344  15.495  34.212  1.00 91.33           C  
ATOM   1194  N   LEU A 365      18.374  21.034  38.855  1.00 93.26           N  
ATOM   1195  CA  LEU A 365      18.234  22.253  39.651  1.00 92.95           C  
ATOM   1196  C   LEU A 365      17.249  23.210  39.004  1.00 95.10           C  
ATOM   1197  O   LEU A 365      17.333  23.471  37.800  1.00 97.10           O  
ATOM   1198  CB  LEU A 365      19.588  22.946  39.822  1.00 92.83           C  
ATOM   1199  CG  LEU A 365      19.655  24.279  40.573  1.00 92.21           C  
ATOM   1200  CD1 LEU A 365      19.470  24.063  42.063  1.00 93.08           C  
ATOM   1201  CD2 LEU A 365      20.980  24.972  40.302  1.00 92.25           C  
ATOM   1202  N   TYR A 366      16.327  23.728  39.814  1.00 94.73           N  
ATOM   1203  CA  TYR A 366      15.327  24.697  39.366  1.00 92.80           C  
ATOM   1204  C   TYR A 366      15.592  26.069  39.972  1.00 92.44           C  
ATOM   1205  O   TYR A 366      15.880  26.189  41.169  1.00 94.00           O  
ATOM   1206  CB  TYR A 366      13.922  24.241  39.749  1.00 92.73           C  
ATOM   1207  CG  TYR A 366      13.431  23.005  39.025  1.00 93.32           C  
ATOM   1208  CD1 TYR A 366      13.830  21.729  39.431  1.00 93.90           C  
ATOM   1209  CD2 TYR A 366      12.546  23.107  37.951  1.00 92.17           C  
ATOM   1210  CE1 TYR A 366      13.377  20.588  38.776  1.00 93.38           C  
ATOM   1211  CE2 TYR A 366      12.082  21.971  37.294  1.00 93.00           C  
ATOM   1212  CZ  TYR A 366      12.504  20.714  37.711  1.00 93.04           C  
ATOM   1213  OH  TYR A 366      12.063  19.581  37.060  1.00 92.26           O  
ATOM   1214  N   ILE A 367      15.503  27.097  39.139  1.00 90.48           N  
ATOM   1215  CA  ILE A 367      15.682  28.470  39.588  1.00 92.18           C  
ATOM   1216  C   ILE A 367      14.397  29.218  39.258  1.00 94.63           C  
ATOM   1217  O   ILE A 367      13.918  29.162  38.123  1.00 96.34           O  
ATOM   1218  CB  ILE A 367      16.909  29.157  38.906  1.00 93.70           C  
ATOM   1219  CG1 ILE A 367      18.234  28.471  39.282  1.00 93.94           C  
ATOM   1220  CG2 ILE A 367      16.990  30.636  39.281  1.00 92.62           C  
ATOM   1221  CD1 ILE A 367      18.701  27.383  38.329  1.00 93.26           C  
ATOM   1222  N   ILE A 368      13.831  29.900  40.251  1.00 96.65           N  
ATOM   1223  CA  ILE A 368      12.567  30.623  40.066  1.00 97.20           C  
ATOM   1224  C   ILE A 368      12.789  32.129  40.106  1.00 96.35           C  
ATOM   1225  O   ILE A 368      12.835  32.740  41.172  1.00 95.67           O  
ATOM   1226  CB  ILE A 368      11.484  30.202  41.100  1.00 96.80           C  
ATOM   1227  CG1 ILE A 368      11.274  28.682  41.074  1.00 96.54           C  
ATOM   1228  CG2 ILE A 368      10.170  30.932  40.823  1.00 94.50           C  
ATOM   1229  CD1 ILE A 368      10.632  28.118  42.322  1.00 96.01           C  
ATOM   1230  N   LEU A 369      12.926  32.719  38.928  1.00 97.43           N  
ATOM   1231  CA  LEU A 369      13.215  34.137  38.826  1.00 99.75           C  
ATOM   1232  C   LEU A 369      11.941  34.935  38.629  1.00100.70           C  
ATOM   1233  O   LEU A 369      11.047  34.511  37.897  1.00102.22           O  
ATOM   1234  CB  LEU A 369      14.188  34.394  37.676  1.00 99.99           C  
ATOM   1235  CG  LEU A 369      15.574  33.761  37.818  1.00 98.38           C  
ATOM   1236  CD1 LEU A 369      16.343  33.863  36.506  1.00 98.49           C  
ATOM   1237  CD2 LEU A 369      16.344  34.408  38.952  1.00 96.47           C  
ATOM   1238  N   GLY A 370      11.865  36.088  39.285  1.00100.75           N  
ATOM   1239  CA  GLY A 370      10.703  36.959  39.177  1.00101.92           C  
ATOM   1240  C   GLY A 370      10.747  37.942  38.019  1.00104.70           C  
ATOM   1241  O   GLY A 370      11.710  37.985  37.251  1.00104.81           O  
ATOM   1242  N   ASP A 371       9.680  38.732  37.919  1.00106.83           N  
ATOM   1243  CA  ASP A 371       9.491  39.782  36.921  1.00105.91           C  
ATOM   1244  C   ASP A 371      10.720  40.660  36.795  1.00103.84           C  
ATOM   1245  O   ASP A 371      11.147  40.991  35.692  1.00104.65           O  
ATOM   1246  CB  ASP A 371       8.338  40.679  37.378  1.00110.43           C  
ATOM   1247  CG  ASP A 371       7.274  40.874  36.322  1.00114.51           C  
ATOM   1248  OD1 ASP A 371       7.074  39.973  35.480  1.00116.79           O  
ATOM   1249  OD2 ASP A 371       6.607  41.930  36.359  1.00116.81           O  
ATOM   1250  N   GLY A 372      11.277  41.034  37.945  1.00101.83           N  
ATOM   1251  CA  GLY A 372      12.324  42.046  38.026  1.00101.60           C  
ATOM   1252  C   GLY A 372      11.758  43.422  37.740  1.00100.26           C  
ATOM   1253  O   GLY A 372      12.493  44.410  37.689  1.00 98.38           O  
ATOM   1254  N   MET A 373      10.437  43.467  37.575  1.00102.20           N  
ATOM   1255  CA  MET A 373       9.721  44.630  37.061  1.00103.84           C  
ATOM   1256  C   MET A 373      10.253  45.032  35.681  1.00106.22           C  
ATOM   1257  O   MET A 373      10.243  46.208  35.307  1.00106.60           O  
ATOM   1258  CB  MET A 373       9.745  45.790  38.066  1.00103.65           C  
ATOM   1259  CG  MET A 373       8.715  45.651  39.186  1.00102.37           C  
ATOM   1260  SD  MET A 373       8.616  47.104  40.253  1.00102.57           S  
ATOM   1261  CE  MET A 373       8.158  48.394  39.088  1.00102.45           C  
ATOM   1262  N   ILE A 374      10.706  44.026  34.931  1.00108.09           N  
ATOM   1263  CA  ILE A 374      11.244  44.210  33.586  1.00109.73           C  
ATOM   1264  C   ILE A 374      10.109  44.471  32.595  1.00111.59           C  
ATOM   1265  O   ILE A 374       9.194  43.653  32.452  1.00111.67           O  
ATOM   1266  CB  ILE A 374      12.102  42.984  33.140  1.00109.24           C  
ATOM   1267  CG1 ILE A 374      13.332  42.793  34.053  1.00107.87           C  
ATOM   1268  CG2 ILE A 374      12.500  43.084  31.659  1.00108.96           C  
ATOM   1269  CD1 ILE A 374      14.402  43.889  33.976  1.00105.99           C  
ATOM   1270  N   THR A 375      10.182  45.620  31.923  1.00113.32           N  
ATOM   1271  CA  THR A 375       9.137  46.064  30.997  1.00114.71           C  
ATOM   1272  C   THR A 375       9.618  46.139  29.538  1.00115.96           C  
ATOM   1273  O   THR A 375      10.819  46.255  29.275  1.00114.28           O  
ATOM   1274  CB  THR A 375       8.500  47.408  31.461  1.00114.17           C  
ATOM   1275  OG1 THR A 375       7.388  47.734  30.619  1.00114.29           O  
ATOM   1276  CG2 THR A 375       9.515  48.552  31.442  1.00113.92           C  
ATOM   1277  N   LEU A 376       8.664  46.081  28.606  1.00118.99           N  
ATOM   1278  CA  LEU A 376       8.934  46.048  27.159  1.00120.76           C  
ATOM   1279  C   LEU A 376       9.774  47.215  26.647  1.00122.99           C  
ATOM   1280  O   LEU A 376      10.474  47.080  25.641  1.00123.14           O  
ATOM   1281  CB  LEU A 376       7.624  45.975  26.365  1.00119.81           C  
ATOM   1282  CG  LEU A 376       6.711  44.760  26.555  1.00119.71           C  
ATOM   1283  CD1 LEU A 376       5.380  44.988  25.852  1.00120.07           C  
ATOM   1284  CD2 LEU A 376       7.372  43.472  26.066  1.00118.97           C  
ATOM   1285  N   ASP A 377       9.688  48.354  27.334  1.00125.90           N  
ATOM   1286  CA  ASP A 377      10.493  49.536  27.021  1.00128.50           C  
ATOM   1287  C   ASP A 377      11.987  49.241  27.103  1.00130.17           C  
ATOM   1288  O   ASP A 377      12.717  49.441  26.131  1.00130.99           O  
ATOM   1289  CB  ASP A 377      10.154  50.691  27.971  1.00128.96           C  
ATOM   1290  CG  ASP A 377       8.949  51.493  27.521  1.00129.32           C  
ATOM   1291  OD1 ASP A 377       8.891  51.883  26.334  1.00129.22           O  
ATOM   1292  OD2 ASP A 377       8.064  51.750  28.365  1.00129.90           O  
ATOM   1293  N   ASP A 378      12.420  48.752  28.264  1.00130.95           N  
ATOM   1294  CA  ASP A 378      13.836  48.551  28.567  1.00131.47           C  
ATOM   1295  C   ASP A 378      14.420  47.300  27.902  1.00132.32           C  
ATOM   1296  O   ASP A 378      15.640  47.189  27.743  1.00131.43           O  
ATOM   1297  CB  ASP A 378      14.045  48.509  30.086  1.00131.02           C  
ATOM   1298  CG  ASP A 378      13.354  49.662  30.810  1.00130.63           C  
ATOM   1299  OD1 ASP A 378      13.432  50.815  30.332  1.00131.09           O  
ATOM   1300  OD2 ASP A 378      12.733  49.412  31.864  1.00129.97           O  
ATOM   1301  N   MET A 379      13.544  46.370  27.517  1.00133.92           N  
ATOM   1302  CA  MET A 379      13.944  45.154  26.802  1.00136.08           C  
ATOM   1303  C   MET A 379      14.425  45.469  25.384  1.00135.89           C  
ATOM   1304  O   MET A 379      15.479  44.991  24.955  1.00135.83           O  
ATOM   1305  CB  MET A 379      12.794  44.138  26.751  1.00136.32           C  
ATOM   1306  CG  MET A 379      12.447  43.512  28.095  1.00137.92           C  
ATOM   1307  SD  MET A 379      11.416  42.026  28.006  1.00138.85           S  
ATOM   1308  CE  MET A 379      12.598  40.785  27.476  1.00138.12           C  
ATOM   1309  N   GLU A 380      13.646  46.280  24.670  1.00135.56           N  
ATOM   1310  CA  GLU A 380      13.951  46.660  23.290  1.00134.70           C  
ATOM   1311  C   GLU A 380      14.748  47.964  23.210  1.00133.87           C  
ATOM   1312  O   GLU A 380      15.111  48.413  22.121  1.00134.21           O  
ATOM   1313  CB  GLU A 380      12.662  46.761  22.471  1.00135.20           C  
ATOM   1314  CG  GLU A 380      11.939  45.429  22.291  1.00136.10           C  
ATOM   1315  CD  GLU A 380      10.500  45.588  21.833  1.00136.97           C  
ATOM   1316  OE1 GLU A 380       9.851  46.588  22.213  1.00137.33           O  
ATOM   1317  OE2 GLU A 380      10.012  44.704  21.098  1.00137.38           O  
ATOM   1318  N   GLU A 381      15.010  48.561  24.371  1.00133.06           N  
ATOM   1319  CA  GLU A 381      15.850  49.752  24.485  1.00132.36           C  
ATOM   1320  C   GLU A 381      17.324  49.343  24.454  1.00131.61           C  
ATOM   1321  O   GLU A 381      18.078  49.763  23.570  1.00131.78           O  
ATOM   1322  CB  GLU A 381      15.528  50.497  25.789  1.00132.91           C  
ATOM   1323  CG  GLU A 381      16.178  51.867  25.959  1.00132.73           C  
ATOM   1324  CD  GLU A 381      16.028  52.415  27.375  1.00131.77           C  
ATOM   1325  OE1 GLU A 381      16.415  51.713  28.335  1.00129.90           O  
ATOM   1326  OE2 GLU A 381      15.529  53.552  27.530  1.00132.17           O  
ATOM   1327  N   MET A 382      17.719  48.519  25.425  1.00130.14           N  
ATOM   1328  CA  MET A 382      19.085  48.013  25.533  1.00127.93           C  
ATOM   1329  C   MET A 382      19.128  46.486  25.491  1.00125.93           C  
ATOM   1330  O   MET A 382      18.144  45.816  25.815  1.00125.34           O  
ATOM   1331  CB  MET A 382      19.753  48.529  26.811  1.00127.92           C  
ATOM   1332  CG  MET A 382      20.434  49.885  26.667  1.00127.83           C  
ATOM   1333  SD  MET A 382      21.838  49.865  25.525  1.00129.03           S  
ATOM   1334  CE  MET A 382      23.051  48.917  26.442  1.00128.55           C  
ATOM   1335  N   ASP A 383      20.278  45.947  25.096  1.00124.05           N  
ATOM   1336  CA  ASP A 383      20.446  44.505  24.930  1.00122.21           C  
ATOM   1337  C   ASP A 383      21.204  43.833  26.071  1.00121.12           C  
ATOM   1338  O   ASP A 383      21.266  42.604  26.131  1.00121.30           O  
ATOM   1339  CB  ASP A 383      21.126  44.198  23.596  1.00121.93           C  
ATOM   1340  CG  ASP A 383      20.227  44.469  22.413  1.00121.92           C  
ATOM   1341  OD1 ASP A 383      19.767  45.621  22.263  1.00122.51           O  
ATOM   1342  OD2 ASP A 383      19.980  43.530  21.629  1.00121.68           O  
ATOM   1343  N   GLY A 384      21.773  44.631  26.972  1.00119.73           N  
ATOM   1344  CA  GLY A 384      22.463  44.097  28.149  1.00118.62           C  
ATOM   1345  C   GLY A 384      21.496  43.491  29.153  1.00117.74           C  
ATOM   1346  O   GLY A 384      21.818  43.339  30.334  1.00117.71           O  
ATOM   1347  N   LEU A 385      20.311  43.137  28.661  1.00116.32           N  
ATOM   1348  CA  LEU A 385      19.225  42.607  29.470  1.00114.60           C  
ATOM   1349  C   LEU A 385      19.019  41.118  29.190  1.00113.64           C  
ATOM   1350  O   LEU A 385      19.263  40.642  28.082  1.00112.63           O  
ATOM   1351  CB  LEU A 385      17.953  43.418  29.200  1.00114.36           C  
ATOM   1352  CG  LEU A 385      16.597  43.005  29.764  1.00114.81           C  
ATOM   1353  CD1 LEU A 385      15.829  44.231  30.224  1.00115.44           C  
ATOM   1354  CD2 LEU A 385      15.815  42.223  28.719  1.00114.76           C  
ATOM   1355  N   SER A 386      18.558  40.398  30.209  1.00114.36           N  
ATOM   1356  CA  SER A 386      18.465  38.942  30.179  1.00114.23           C  
ATOM   1357  C   SER A 386      17.123  38.421  29.652  1.00113.40           C  
ATOM   1358  O   SER A 386      16.097  39.094  29.752  1.00114.37           O  
ATOM   1359  CB  SER A 386      18.723  38.394  31.588  1.00114.65           C  
ATOM   1360  OG  SER A 386      18.812  36.981  31.591  1.00115.25           O  
ATOM   1361  N   ASP A 387      17.149  37.213  29.093  1.00111.26           N  
ATOM   1362  CA  ASP A 387      15.935  36.491  28.713  1.00109.62           C  
ATOM   1363  C   ASP A 387      15.332  35.739  29.895  1.00110.12           C  
ATOM   1364  O   ASP A 387      14.203  35.246  29.815  1.00110.12           O  
ATOM   1365  CB  ASP A 387      16.242  35.482  27.605  1.00108.79           C  
ATOM   1366  CG  ASP A 387      15.881  35.990  26.227  1.00107.38           C  
ATOM   1367  OD1 ASP A 387      14.811  36.618  26.071  1.00107.23           O  
ATOM   1368  OD2 ASP A 387      16.663  35.738  25.292  1.00106.73           O  
ATOM   1369  N   PHE A 388      16.087  35.667  30.990  1.00109.58           N  
ATOM   1370  CA  PHE A 388      15.787  34.756  32.094  1.00108.38           C  
ATOM   1371  C   PHE A 388      14.717  35.208  33.102  1.00108.32           C  
ATOM   1372  O   PHE A 388      14.102  34.365  33.765  1.00110.67           O  
ATOM   1373  CB  PHE A 388      17.076  34.384  32.834  1.00108.14           C  
ATOM   1374  CG  PHE A 388      18.024  33.526  32.032  1.00108.67           C  
ATOM   1375  CD1 PHE A 388      19.355  33.902  31.874  1.00107.91           C  
ATOM   1376  CD2 PHE A 388      17.593  32.336  31.445  1.00108.95           C  
ATOM   1377  CE1 PHE A 388      20.239  33.113  31.145  1.00107.46           C  
ATOM   1378  CE2 PHE A 388      18.473  31.540  30.713  1.00108.06           C  
ATOM   1379  CZ  PHE A 388      19.796  31.931  30.563  1.00107.48           C  
ATOM   1380  N   THR A 389      14.502  36.518  33.222  1.00104.79           N  
ATOM   1381  CA  THR A 389      13.567  37.062  34.219  1.00100.97           C  
ATOM   1382  C   THR A 389      12.124  36.622  33.983  1.00 99.07           C  
ATOM   1383  O   THR A 389      11.682  36.507  32.841  1.00 98.08           O  
ATOM   1384  CB  THR A 389      13.607  38.602  34.284  1.00100.12           C  
ATOM   1385  OG1 THR A 389      13.330  39.145  32.991  1.00 99.37           O  
ATOM   1386  CG2 THR A 389      14.963  39.087  34.756  1.00100.94           C  
ATOM   1387  N   GLY A 390      11.405  36.378  35.077  1.00 97.39           N  
ATOM   1388  CA  GLY A 390      10.020  35.925  35.026  1.00 95.31           C  
ATOM   1389  C   GLY A 390       9.871  34.492  34.547  1.00 95.00           C  
ATOM   1390  O   GLY A 390       8.854  34.134  33.959  1.00 95.80           O  
ATOM   1391  N   SER A 391      10.881  33.667  34.809  1.00 95.70           N  
ATOM   1392  CA  SER A 391      10.893  32.293  34.322  1.00 96.21           C  
ATOM   1393  C   SER A 391      11.369  31.276  35.347  1.00 97.57           C  
ATOM   1394  O   SER A 391      12.135  31.597  36.259  1.00 99.68           O  
ATOM   1395  CB  SER A 391      11.772  32.189  33.081  1.00 97.02           C  
ATOM   1396  OG  SER A 391      11.244  32.968  32.026  1.00101.67           O  
ATOM   1397  N   VAL A 392      10.901  30.044  35.185  1.00 96.68           N  
ATOM   1398  CA  VAL A 392      11.474  28.904  35.884  1.00 97.13           C  
ATOM   1399  C   VAL A 392      12.532  28.291  34.966  1.00 98.30           C  
ATOM   1400  O   VAL A 392      12.233  27.912  33.829  1.00100.20           O  
ATOM   1401  CB  VAL A 392      10.407  27.836  36.242  1.00 96.66           C  
ATOM   1402  CG1 VAL A 392      11.038  26.675  37.013  1.00 96.06           C  
ATOM   1403  CG2 VAL A 392       9.270  28.446  37.048  1.00 96.39           C  
ATOM   1404  N   LEU A 393      13.767  28.210  35.450  1.00 95.79           N  
ATOM   1405  CA  LEU A 393      14.836  27.574  34.686  1.00 95.64           C  
ATOM   1406  C   LEU A 393      15.220  26.242  35.319  1.00 95.79           C  
ATOM   1407  O   LEU A 393      15.319  26.133  36.546  1.00 96.63           O  
ATOM   1408  CB  LEU A 393      16.062  28.483  34.597  1.00 96.01           C  
ATOM   1409  CG  LEU A 393      15.839  29.987  34.435  1.00 95.50           C  
ATOM   1410  CD1 LEU A 393      17.156  30.726  34.604  1.00 93.77           C  
ATOM   1411  CD2 LEU A 393      15.194  30.310  33.097  1.00 95.67           C  
ATOM   1412  N   ARG A 394      15.434  25.237  34.473  1.00 93.50           N  
ATOM   1413  CA  ARG A 394      15.797  23.897  34.927  1.00 91.49           C  
ATOM   1414  C   ARG A 394      17.131  23.488  34.311  1.00 89.75           C  
ATOM   1415  O   ARG A 394      17.268  23.455  33.087  1.00 88.64           O  
ATOM   1416  CB  ARG A 394      14.695  22.885  34.576  1.00 92.27           C  
ATOM   1417  CG  ARG A 394      14.970  21.467  35.064  1.00 92.05           C  
ATOM   1418  CD  ARG A 394      13.784  20.538  34.867  1.00 90.78           C  
ATOM   1419  NE  ARG A 394      13.666  20.018  33.508  1.00 91.03           N  
ATOM   1420  CZ  ARG A 394      13.011  18.906  33.182  1.00 89.69           C  
ATOM   1421  NH1 ARG A 394      12.410  18.176  34.114  1.00 89.68           N  
ATOM   1422  NH2 ARG A 394      12.964  18.516  31.919  1.00 90.16           N  
ATOM   1423  N   LEU A 395      18.104  23.176  35.166  1.00 89.47           N  
ATOM   1424  CA  LEU A 395      19.478  22.904  34.719  1.00 88.81           C  
ATOM   1425  C   LEU A 395      20.008  21.556  35.198  1.00 89.18           C  
ATOM   1426  O   LEU A 395      19.591  21.053  36.251  1.00 90.32           O  
ATOM   1427  CB  LEU A 395      20.434  24.011  35.192  1.00 85.75           C  
ATOM   1428  CG  LEU A 395      20.116  25.483  34.920  1.00 82.48           C  
ATOM   1429  CD1 LEU A 395      21.231  26.382  35.430  1.00 82.18           C  
ATOM   1430  CD2 LEU A 395      19.883  25.713  33.450  1.00 80.18           C  
ATOM   1431  N   ASP A 396      20.930  20.984  34.424  1.00 86.77           N  
ATOM   1432  CA  ASP A 396      21.655  19.788  34.849  1.00 87.45           C  
ATOM   1433  C   ASP A 396      23.067  20.151  35.312  1.00 89.28           C  
ATOM   1434  O   ASP A 396      23.976  20.344  34.493  1.00 88.68           O  
ATOM   1435  CB  ASP A 396      21.708  18.744  33.731  1.00 86.12           C  
ATOM   1436  CG  ASP A 396      22.147  17.372  34.226  1.00 86.52           C  
ATOM   1437  OD1 ASP A 396      22.277  17.177  35.456  1.00 87.39           O  
ATOM   1438  OD2 ASP A 396      22.355  16.478  33.378  1.00 87.38           O  
ATOM   1439  N   VAL A 397      23.241  20.243  36.629  1.00 88.33           N  
ATOM   1440  CA  VAL A 397      24.541  20.573  37.206  1.00 88.69           C  
ATOM   1441  C   VAL A 397      25.543  19.433  37.061  1.00 90.30           C  
ATOM   1442  O   VAL A 397      26.754  19.668  37.069  1.00 90.94           O  
ATOM   1443  CB  VAL A 397      24.449  21.004  38.700  1.00 87.87           C  
ATOM   1444  CG1 VAL A 397      23.591  22.246  38.842  1.00 88.60           C  
ATOM   1445  CG2 VAL A 397      23.934  19.871  39.589  1.00 86.73           C  
ATOM   1446  N   ASP A 398      25.034  18.208  36.923  1.00 91.27           N  
ATOM   1447  CA  ASP A 398      25.873  17.015  36.848  1.00 94.12           C  
ATOM   1448  C   ASP A 398      26.526  16.890  35.464  1.00 96.97           C  
ATOM   1449  O   ASP A 398      26.219  15.982  34.682  1.00 97.40           O  
ATOM   1450  CB  ASP A 398      25.075  15.757  37.233  1.00 95.39           C  
ATOM   1451  CG  ASP A 398      24.558  15.788  38.689  1.00 98.28           C  
ATOM   1452  OD1 ASP A 398      24.939  16.684  39.486  1.00 96.93           O  
ATOM   1453  OD2 ASP A 398      23.757  14.895  39.039  1.00 98.83           O  
ATOM   1454  N   THR A 399      27.433  17.827  35.184  1.00 99.58           N  
ATOM   1455  CA  THR A 399      28.158  17.894  33.921  1.00100.82           C  
ATOM   1456  C   THR A 399      29.490  17.194  34.053  1.00101.61           C  
ATOM   1457  O   THR A 399      30.052  17.113  35.146  1.00102.23           O  
ATOM   1458  CB  THR A 399      28.493  19.349  33.516  1.00101.83           C  
ATOM   1459  OG1 THR A 399      27.741  20.277  34.308  1.00103.46           O  
ATOM   1460  CG2 THR A 399      28.227  19.575  32.025  1.00101.82           C  
ATOM   1461  N   ASP A 400      29.989  16.692  32.930  1.00103.06           N  
ATOM   1462  CA  ASP A 400      31.356  16.203  32.834  1.00104.06           C  
ATOM   1463  C   ASP A 400      32.144  17.125  31.907  1.00104.46           C  
ATOM   1464  O   ASP A 400      33.355  16.981  31.744  1.00104.61           O  
ATOM   1465  CB  ASP A 400      31.373  14.757  32.336  1.00105.43           C  
ATOM   1466  CG  ASP A 400      30.763  13.780  33.339  1.00107.53           C  
ATOM   1467  OD1 ASP A 400      31.044  12.569  33.223  1.00108.58           O  
ATOM   1468  OD2 ASP A 400      30.007  14.210  34.241  1.00108.17           O  
ATOM   1469  N   MET A 401      31.433  18.080  31.313  1.00106.36           N  
ATOM   1470  CA  MET A 401      32.025  19.106  30.459  1.00107.93           C  
ATOM   1471  C   MET A 401      32.746  20.141  31.312  1.00106.47           C  
ATOM   1472  O   MET A 401      32.402  20.344  32.481  1.00105.84           O  
ATOM   1473  CB  MET A 401      30.937  19.806  29.637  1.00110.34           C  
ATOM   1474  CG  MET A 401      30.301  18.959  28.548  1.00111.29           C  
ATOM   1475  SD  MET A 401      31.106  19.167  26.952  1.00113.78           S  
ATOM   1476  CE  MET A 401      30.509  20.780  26.444  1.00113.67           C  
ATOM   1477  N   CYS A 402      33.739  20.798  30.719  1.00105.25           N  
ATOM   1478  CA  CYS A 402      34.500  21.834  31.413  1.00103.97           C  
ATOM   1479  C   CYS A 402      34.427  23.186  30.696  1.00104.26           C  
ATOM   1480  O   CYS A 402      34.929  24.197  31.199  1.00103.24           O  
ATOM   1481  CB  CYS A 402      35.949  21.381  31.611  1.00101.63           C  
ATOM   1482  SG  CYS A 402      36.097  19.824  32.543  1.00 99.15           S  
ATOM   1483  N   ASN A 403      33.784  23.189  29.529  1.00105.44           N  
ATOM   1484  CA  ASN A 403      33.576  24.402  28.737  1.00105.90           C  
ATOM   1485  C   ASN A 403      32.361  25.179  29.218  1.00105.74           C  
ATOM   1486  O   ASN A 403      32.330  26.409  29.144  1.00106.20           O  
ATOM   1487  CB  ASN A 403      33.403  24.052  27.257  1.00106.78           C  
ATOM   1488  CG  ASN A 403      34.435  23.054  26.770  1.00108.59           C  
ATOM   1489  OD1 ASN A 403      34.563  21.958  27.321  1.00109.50           O  
ATOM   1490  ND2 ASN A 403      35.174  23.425  25.728  1.00108.82           N  
ATOM   1491  N   VAL A 404      31.362  24.440  29.700  1.00104.75           N  
ATOM   1492  CA  VAL A 404      30.119  25.004  30.215  1.00102.70           C  
ATOM   1493  C   VAL A 404      30.017  24.646  31.703  1.00102.26           C  
ATOM   1494  O   VAL A 404      30.380  23.532  32.090  1.00103.29           O  
ATOM   1495  CB  VAL A 404      28.880  24.445  29.463  1.00101.80           C  
ATOM   1496  CG1 VAL A 404      27.778  25.489  29.399  1.00103.65           C  
ATOM   1497  CG2 VAL A 404      29.238  24.010  28.059  1.00102.01           C  
ATOM   1498  N   PRO A 405      29.546  25.590  32.548  1.00100.61           N  
ATOM   1499  CA  PRO A 405      29.378  25.297  33.977  1.00 99.89           C  
ATOM   1500  C   PRO A 405      28.205  24.374  34.305  1.00 99.27           C  
ATOM   1501  O   PRO A 405      28.182  23.777  35.384  1.00100.08           O  
ATOM   1502  CB  PRO A 405      29.145  26.678  34.595  1.00100.06           C  
ATOM   1503  CG  PRO A 405      28.568  27.490  33.498  1.00100.34           C  
ATOM   1504  CD  PRO A 405      29.186  26.986  32.229  1.00100.52           C  
ATOM   1505  N   TYR A 406      27.241  24.276  33.390  1.00 98.49           N  
ATOM   1506  CA  TYR A 406      26.058  23.425  33.572  1.00 96.87           C  
ATOM   1507  C   TYR A 406      25.559  22.862  32.244  1.00 97.32           C  
ATOM   1508  O   TYR A 406      25.665  23.506  31.195  1.00 96.43           O  
ATOM   1509  CB  TYR A 406      24.924  24.181  34.284  1.00 94.93           C  
ATOM   1510  CG  TYR A 406      24.472  25.433  33.565  1.00 94.24           C  
ATOM   1511  CD1 TYR A 406      25.024  26.676  33.878  1.00 94.79           C  
ATOM   1512  CD2 TYR A 406      23.500  25.377  32.572  1.00 93.66           C  
ATOM   1513  CE1 TYR A 406      24.623  27.832  33.212  1.00 95.03           C  
ATOM   1514  CE2 TYR A 406      23.095  26.525  31.898  1.00 95.22           C  
ATOM   1515  CZ  TYR A 406      23.657  27.749  32.225  1.00 95.38           C  
ATOM   1516  OH  TYR A 406      23.251  28.886  31.560  1.00 94.96           O  
ATOM   1517  N   SER A 407      25.015  21.653  32.306  1.00 98.40           N  
ATOM   1518  CA  SER A 407      24.421  21.007  31.146  1.00 99.09           C  
ATOM   1519  C   SER A 407      22.908  21.232  31.144  1.00100.96           C  
ATOM   1520  O   SER A 407      22.316  21.553  32.181  1.00102.49           O  
ATOM   1521  CB  SER A 407      24.740  19.511  31.162  1.00 98.13           C  
ATOM   1522  OG  SER A 407      24.209  18.857  30.028  1.00 98.03           O  
ATOM   1523  N   ILE A 408      22.297  21.083  29.972  1.00100.86           N  
ATOM   1524  CA  ILE A 408      20.847  21.179  29.818  1.00100.86           C  
ATOM   1525  C   ILE A 408      20.293  19.786  29.521  1.00101.62           C  
ATOM   1526  O   ILE A 408      20.702  19.156  28.544  1.00102.13           O  
ATOM   1527  CB  ILE A 408      20.454  22.173  28.689  1.00100.65           C  
ATOM   1528  CG1 ILE A 408      20.773  23.613  29.109  1.00100.41           C  
ATOM   1529  CG2 ILE A 408      18.974  22.028  28.308  1.00100.09           C  
ATOM   1530  CD1 ILE A 408      20.771  24.611  27.959  1.00101.33           C  
ATOM   1531  N   PRO A 409      19.371  19.295  30.371  1.00101.94           N  
ATOM   1532  CA  PRO A 409      18.765  17.977  30.168  1.00102.41           C  
ATOM   1533  C   PRO A 409      18.039  17.889  28.832  1.00102.99           C  
ATOM   1534  O   PRO A 409      17.463  18.880  28.380  1.00103.73           O  
ATOM   1535  CB  PRO A 409      17.761  17.862  31.321  1.00103.35           C  
ATOM   1536  CG  PRO A 409      17.567  19.251  31.825  1.00102.97           C  
ATOM   1537  CD  PRO A 409      18.850  19.961  31.578  1.00102.11           C  
ATOM   1538  N   ARG A 410      18.080  16.708  28.214  1.00103.79           N  
ATOM   1539  CA  ARG A 410      17.438  16.460  26.917  1.00102.31           C  
ATOM   1540  C   ARG A 410      15.922  16.640  26.975  1.00102.05           C  
ATOM   1541  O   ARG A 410      15.290  16.957  25.967  1.00102.12           O  
ATOM   1542  CB  ARG A 410      17.777  15.114  26.462  0.00 20.00           C  
ATOM   1543  CG  ARG A 410      19.249  14.901  26.147  0.00 20.00           C  
ATOM   1544  CD  ARG A 410      19.575  13.515  25.613  0.00 20.00           C  
ATOM   1545  NE  ARG A 410      21.007  13.336  25.392  0.00 20.00           N  
ATOM   1546  CZ  ARG A 410      21.568  12.189  25.041  0.00 20.00           C  
ATOM   1547  NH1 ARG A 410      20.819  11.107  24.864  0.00 20.00           N  
ATOM   1548  NH2 ARG A 410      22.881  12.117  24.861  0.00 20.00           N  
ATOM   1549  N   SER A 411      15.357  16.451  28.168  1.00102.21           N  
ATOM   1550  CA  SER A 411      13.917  16.567  28.410  1.00101.07           C  
ATOM   1551  C   SER A 411      13.436  18.004  28.654  1.00102.47           C  
ATOM   1552  O   SER A 411      12.315  18.218  29.115  1.00101.98           O  
ATOM   1553  CB  SER A 411      13.496  15.653  29.572  1.00 98.60           C  
ATOM   1554  OG  SER A 411      14.431  15.691  30.637  1.00 95.50           O  
ATOM   1555  N   ASN A 412      14.285  18.981  28.348  1.00105.72           N  
ATOM   1556  CA  ASN A 412      13.897  20.386  28.402  1.00109.60           C  
ATOM   1557  C   ASN A 412      13.181  20.821  27.131  1.00114.50           C  
ATOM   1558  O   ASN A 412      13.525  20.363  26.035  1.00114.22           O  
ATOM   1559  CB  ASN A 412      15.120  21.286  28.607  1.00109.63           C  
ATOM   1560  CG  ASN A 412      15.432  21.542  30.068  1.00111.07           C  
ATOM   1561  OD1 ASN A 412      16.313  22.339  30.391  1.00111.40           O  
ATOM   1562  ND2 ASN A 412      14.712  20.873  30.960  1.00111.19           N  
ATOM   1563  N   PRO A 413      12.182  21.712  27.270  1.00118.07           N  
ATOM   1564  CA  PRO A 413      11.687  22.412  26.090  1.00120.17           C  
ATOM   1565  C   PRO A 413      12.713  23.473  25.692  1.00122.06           C  
ATOM   1566  O   PRO A 413      13.237  24.179  26.560  1.00125.41           O  
ATOM   1567  CB  PRO A 413      10.388  23.057  26.579  1.00119.87           C  
ATOM   1568  CG  PRO A 413      10.564  23.215  28.048  1.00119.00           C  
ATOM   1569  CD  PRO A 413      11.476  22.113  28.502  1.00117.99           C  
ATOM   1570  N   HIS A 414      13.000  23.568  24.398  1.00121.67           N  
ATOM   1571  CA  HIS A 414      14.073  24.424  23.874  1.00124.30           C  
ATOM   1572  C   HIS A 414      15.464  23.835  24.138  1.00126.62           C  
ATOM   1573  O   HIS A 414      16.445  24.575  24.256  1.00126.92           O  
ATOM   1574  CB  HIS A 414      13.996  25.858  24.422  1.00123.38           C  
ATOM   1575  CG  HIS A 414      12.631  26.465  24.355  1.00123.20           C  
ATOM   1576  ND1 HIS A 414      11.807  26.558  25.455  1.00122.03           N  
ATOM   1577  CD2 HIS A 414      11.948  27.016  23.323  1.00124.13           C  
ATOM   1578  CE1 HIS A 414      10.675  27.139  25.105  1.00122.72           C  
ATOM   1579  NE2 HIS A 414      10.734  27.426  23.816  1.00124.61           N  
ATOM   1580  N   PHE A 415      15.545  22.507  24.219  1.00129.38           N  
ATOM   1581  CA  PHE A 415      16.826  21.810  24.388  1.00132.50           C  
ATOM   1582  C   PHE A 415      17.780  22.030  23.202  1.00134.07           C  
ATOM   1583  O   PHE A 415      19.003  22.008  23.368  1.00135.11           O  
ATOM   1584  CB  PHE A 415      16.600  20.309  24.646  1.00133.65           C  
ATOM   1585  CG  PHE A 415      17.854  19.472  24.554  1.00134.72           C  
ATOM   1586  CD1 PHE A 415      18.818  19.518  25.558  1.00134.74           C  
ATOM   1587  CD2 PHE A 415      18.072  18.642  23.456  1.00134.96           C  
ATOM   1588  CE1 PHE A 415      19.979  18.749  25.470  1.00134.68           C  
ATOM   1589  CE2 PHE A 415      19.230  17.870  23.360  1.00134.82           C  
ATOM   1590  CZ  PHE A 415      20.184  17.923  24.370  1.00134.34           C  
ATOM   1591  N   ASN A 416      17.222  22.253  22.016  1.00134.49           N  
ATOM   1592  CA  ASN A 416      18.031  22.455  20.820  1.00136.26           C  
ATOM   1593  C   ASN A 416      17.814  23.819  20.161  1.00137.81           C  
ATOM   1594  O   ASN A 416      18.694  24.310  19.450  1.00138.41           O  
ATOM   1595  CB  ASN A 416      17.769  21.327  19.812  1.00136.50           C  
ATOM   1596  CG  ASN A 416      18.924  21.122  18.837  1.00135.98           C  
ATOM   1597  OD1 ASN A 416      18.727  21.104  17.621  1.00134.99           O  
ATOM   1598  ND2 ASN A 416      20.132  20.956  19.370  1.00135.99           N  
ATOM   1599  N   SER A 417      16.655  24.427  20.420  1.00138.87           N  
ATOM   1600  CA  SER A 417      16.193  25.633  19.711  1.00139.73           C  
ATOM   1601  C   SER A 417      17.242  26.734  19.539  1.00139.50           C  
ATOM   1602  O   SER A 417      18.011  27.028  20.459  1.00139.05           O  
ATOM   1603  CB  SER A 417      14.937  26.203  20.378  1.00139.92           C  
ATOM   1604  OG  SER A 417      14.367  27.233  19.588  1.00140.64           O  
ATOM   1605  N   THR A 418      17.249  27.337  18.351  1.00139.17           N  
ATOM   1606  CA  THR A 418      18.202  28.389  17.992  1.00138.78           C  
ATOM   1607  C   THR A 418      17.882  29.715  18.684  1.00137.28           C  
ATOM   1608  O   THR A 418      18.786  30.446  19.090  1.00135.43           O  
ATOM   1609  CB  THR A 418      18.284  28.586  16.448  1.00139.69           C  
ATOM   1610  OG1 THR A 418      19.262  29.586  16.133  1.00140.31           O  
ATOM   1611  CG2 THR A 418      16.929  28.993  15.860  1.00139.88           C  
ATOM   1612  N   PRO A 422      16.889  28.717  26.169  1.00109.87           N  
ATOM   1613  CA  PRO A 422      17.002  27.257  26.179  1.00110.33           C  
ATOM   1614  C   PRO A 422      16.858  26.675  27.581  1.00110.14           C  
ATOM   1615  O   PRO A 422      16.229  25.629  27.761  1.00110.09           O  
ATOM   1616  CB  PRO A 422      18.415  27.000  25.633  1.00110.16           C  
ATOM   1617  CG  PRO A 422      19.160  28.264  25.856  1.00110.35           C  
ATOM   1618  CD  PRO A 422      18.154  29.378  25.806  1.00110.71           C  
ATOM   1619  N   GLU A 423      17.440  27.362  28.561  1.00110.09           N  
ATOM   1620  CA  GLU A 423      17.355  26.974  29.965  1.00108.97           C  
ATOM   1621  C   GLU A 423      15.959  27.219  30.535  1.00107.12           C  
ATOM   1622  O   GLU A 423      15.614  26.688  31.594  1.00106.74           O  
ATOM   1623  CB  GLU A 423      18.393  27.739  30.789  1.00109.68           C  
ATOM   1624  CG  GLU A 423      19.839  27.371  30.480  1.00110.74           C  
ATOM   1625  CD  GLU A 423      20.491  28.265  29.441  1.00112.48           C  
ATOM   1626  OE1 GLU A 423      21.709  28.099  29.215  1.00112.87           O  
ATOM   1627  OE2 GLU A 423      19.802  29.130  28.855  1.00112.91           O  
ATOM   1628  N   VAL A 424      15.173  28.030  29.825  1.00105.30           N  
ATOM   1629  CA  VAL A 424      13.815  28.384  30.233  1.00102.70           C  
ATOM   1630  C   VAL A 424      12.901  27.166  30.139  1.00102.27           C  
ATOM   1631  O   VAL A 424      12.769  26.548  29.078  1.00101.48           O  
ATOM   1632  CB  VAL A 424      13.244  29.569  29.404  1.00100.78           C  
ATOM   1633  CG1 VAL A 424      11.822  29.895  29.828  1.00100.13           C  
ATOM   1634  CG2 VAL A 424      14.117  30.805  29.558  1.00101.14           C  
ATOM   1635  N   PHE A 425      12.296  26.826  31.274  1.00101.91           N  
ATOM   1636  CA  PHE A 425      11.397  25.685  31.384  1.00101.49           C  
ATOM   1637  C   PHE A 425       9.944  26.152  31.328  1.00100.55           C  
ATOM   1638  O   PHE A 425       9.078  25.434  30.827  1.00 99.62           O  
ATOM   1639  CB  PHE A 425      11.686  24.923  32.682  1.00102.69           C  
ATOM   1640  CG  PHE A 425      10.927  23.632  32.822  1.00103.80           C  
ATOM   1641  CD1 PHE A 425      11.270  22.519  32.062  1.00103.63           C  
ATOM   1642  CD2 PHE A 425       9.885  23.520  33.736  1.00104.41           C  
ATOM   1643  CE1 PHE A 425      10.573  21.319  32.194  1.00103.42           C  
ATOM   1644  CE2 PHE A 425       9.184  22.322  33.877  1.00105.13           C  
ATOM   1645  CZ  PHE A 425       9.530  21.219  33.103  1.00103.58           C  
ATOM   1646  N   ALA A 426       9.698  27.358  31.847  1.00 99.96           N  
ATOM   1647  CA  ALA A 426       8.385  28.010  31.817  1.00 99.62           C  
ATOM   1648  C   ALA A 426       8.544  29.503  32.090  1.00101.07           C  
ATOM   1649  O   ALA A 426       9.437  29.897  32.837  1.00102.03           O  
ATOM   1650  CB  ALA A 426       7.453  27.386  32.846  1.00 97.81           C  
ATOM   1651  N   HIS A 427       7.690  30.327  31.485  1.00103.26           N  
ATOM   1652  CA  HIS A 427       7.681  31.768  31.765  1.00106.60           C  
ATOM   1653  C   HIS A 427       6.293  32.267  32.173  1.00106.95           C  
ATOM   1654  O   HIS A 427       5.312  31.522  32.106  1.00107.57           O  
ATOM   1655  CB  HIS A 427       8.231  32.576  30.579  1.00110.09           C  
ATOM   1656  CG  HIS A 427       7.308  32.641  29.399  1.00116.03           C  
ATOM   1657  ND1 HIS A 427       6.146  33.384  29.401  1.00118.68           N  
ATOM   1658  CD2 HIS A 427       7.389  32.076  28.170  1.00118.16           C  
ATOM   1659  CE1 HIS A 427       5.543  33.261  28.230  1.00119.80           C  
ATOM   1660  NE2 HIS A 427       6.278  32.474  27.464  1.00119.50           N  
ATOM   1661  N   GLY A 428       6.223  33.529  32.594  1.00106.46           N  
ATOM   1662  CA  GLY A 428       4.957  34.159  32.965  1.00105.71           C  
ATOM   1663  C   GLY A 428       4.918  34.730  34.372  1.00105.63           C  
ATOM   1664  O   GLY A 428       4.038  35.534  34.694  1.00108.12           O  
ATOM   1665  N   LEU A 429       5.869  34.309  35.206  1.00102.41           N  
ATOM   1666  CA  LEU A 429       5.966  34.728  36.606  1.00 98.28           C  
ATOM   1667  C   LEU A 429       6.164  36.226  36.781  1.00 97.41           C  
ATOM   1668  O   LEU A 429       6.933  36.844  36.052  1.00 98.19           O  
ATOM   1669  CB  LEU A 429       7.129  33.999  37.274  1.00 98.01           C  
ATOM   1670  CG  LEU A 429       6.884  32.765  38.142  1.00 98.64           C  
ATOM   1671  CD1 LEU A 429       5.531  32.112  37.897  1.00 98.86           C  
ATOM   1672  CD2 LEU A 429       8.011  31.777  37.927  1.00 98.81           C  
ATOM   1673  N   HIS A 430       5.468  36.806  37.752  1.00 97.48           N  
ATOM   1674  CA  HIS A 430       5.671  38.205  38.096  1.00 98.93           C  
ATOM   1675  C   HIS A 430       6.396  38.313  39.435  1.00 99.73           C  
ATOM   1676  O   HIS A 430       7.624  38.303  39.485  1.00 99.70           O  
ATOM   1677  CB  HIS A 430       4.344  38.972  38.121  1.00102.58           C  
ATOM   1678  CG  HIS A 430       3.688  39.100  36.780  1.00106.45           C  
ATOM   1679  ND1 HIS A 430       4.029  40.082  35.874  1.00108.29           N  
ATOM   1680  CD2 HIS A 430       2.706  38.374  36.195  1.00106.75           C  
ATOM   1681  CE1 HIS A 430       3.289  39.952  34.787  1.00108.04           C  
ATOM   1682  NE2 HIS A 430       2.478  38.923  34.956  1.00107.47           N  
ATOM   1683  N   ASP A 431       5.634  38.383  40.521  1.00 99.84           N  
ATOM   1684  CA  ASP A 431       6.197  38.606  41.843  1.00100.52           C  
ATOM   1685  C   ASP A 431       5.935  37.416  42.772  1.00102.69           C  
ATOM   1686  O   ASP A 431       5.057  37.485  43.639  1.00104.46           O  
ATOM   1687  CB  ASP A 431       5.615  39.890  42.432  1.00 98.71           C  
ATOM   1688  CG  ASP A 431       6.339  40.339  43.676  1.00 98.52           C  
ATOM   1689  OD1 ASP A 431       7.517  39.965  43.867  1.00 98.77           O  
ATOM   1690  OD2 ASP A 431       5.721  41.076  44.465  1.00 98.95           O  
ATOM   1691  N   PRO A 432       6.707  36.323  42.609  1.00102.32           N  
ATOM   1692  CA  PRO A 432       6.391  35.118  43.367  1.00101.38           C  
ATOM   1693  C   PRO A 432       6.983  35.133  44.761  1.00101.85           C  
ATOM   1694  O   PRO A 432       8.098  35.618  44.954  1.00105.67           O  
ATOM   1695  CB  PRO A 432       7.033  34.006  42.538  1.00100.35           C  
ATOM   1696  CG  PRO A 432       8.165  34.664  41.826  1.00100.97           C  
ATOM   1697  CD  PRO A 432       7.895  36.141  41.755  1.00101.46           C  
ATOM   1698  N   GLY A 433       6.235  34.609  45.725  1.00101.32           N  
ATOM   1699  CA  GLY A 433       6.759  34.403  47.071  1.00102.33           C  
ATOM   1700  C   GLY A 433       7.587  33.134  47.104  1.00102.67           C  
ATOM   1701  O   GLY A 433       8.102  32.705  46.071  1.00104.74           O  
ATOM   1702  N   ARG A 434       7.731  32.536  48.285  1.00102.02           N  
ATOM   1703  CA  ARG A 434       8.315  31.202  48.387  1.00100.26           C  
ATOM   1704  C   ARG A 434       7.298  30.195  47.839  1.00100.33           C  
ATOM   1705  O   ARG A 434       6.174  30.107  48.325  1.00101.97           O  
ATOM   1706  CB  ARG A 434       8.697  30.886  49.830  1.00 98.91           C  
ATOM   1707  CG  ARG A 434       9.679  29.737  49.986  1.00100.18           C  
ATOM   1708  CD  ARG A 434       8.983  28.457  50.398  1.00102.41           C  
ATOM   1709  NE  ARG A 434       9.889  27.310  50.412  1.00104.46           N  
ATOM   1710  CZ  ARG A 434       9.509  26.043  50.264  1.00106.41           C  
ATOM   1711  NH1 ARG A 434       8.229  25.739  50.078  1.00111.24           N  
ATOM   1712  NH2 ARG A 434      10.412  25.074  50.283  1.00106.04           N  
ATOM   1713  N   CYS A 435       7.688  29.467  46.801  1.00 98.32           N  
ATOM   1714  CA  CYS A 435       6.789  28.536  46.139  1.00 99.20           C  
ATOM   1715  C   CYS A 435       6.783  27.192  46.856  1.00 98.80           C  
ATOM   1716  O   CYS A 435       7.823  26.730  47.326  1.00 99.72           O  
ATOM   1717  CB  CYS A 435       7.205  28.348  44.680  1.00102.00           C  
ATOM   1718  SG  CYS A 435       7.252  29.872  43.696  1.00104.38           S  
ATOM   1719  N   ALA A 436       5.610  26.570  46.941  1.00 97.12           N  
ATOM   1720  CA  ALA A 436       5.484  25.253  47.554  1.00 95.15           C  
ATOM   1721  C   ALA A 436       5.937  24.189  46.568  1.00 94.35           C  
ATOM   1722  O   ALA A 436       5.703  24.310  45.370  1.00 91.87           O  
ATOM   1723  CB  ALA A 436       4.062  25.002  47.999  1.00 95.17           C  
ATOM   1724  N   VAL A 437       6.597  23.156  47.086  1.00 98.30           N  
ATOM   1725  CA  VAL A 437       7.238  22.127  46.262  1.00 98.88           C  
ATOM   1726  C   VAL A 437       6.806  20.717  46.693  1.00100.99           C  
ATOM   1727  O   VAL A 437       7.091  20.275  47.810  1.00100.74           O  
ATOM   1728  CB  VAL A 437       8.790  22.276  46.294  1.00 97.18           C  
ATOM   1729  CG1 VAL A 437       9.477  21.087  45.645  1.00 98.15           C  
ATOM   1730  CG2 VAL A 437       9.218  23.567  45.610  1.00 94.36           C  
ATOM   1731  N   ASP A 438       6.110  20.025  45.796  1.00104.07           N  
ATOM   1732  CA  ASP A 438       5.611  18.680  46.064  1.00107.81           C  
ATOM   1733  C   ASP A 438       6.454  17.653  45.317  1.00110.64           C  
ATOM   1734  O   ASP A 438       6.472  17.628  44.083  1.00110.70           O  
ATOM   1735  CB  ASP A 438       4.140  18.569  45.650  1.00109.53           C  
ATOM   1736  CG  ASP A 438       3.458  17.315  46.190  1.00111.79           C  
ATOM   1737  OD1 ASP A 438       4.114  16.258  46.315  1.00113.57           O  
ATOM   1738  OD2 ASP A 438       2.246  17.384  46.480  1.00112.05           O  
ATOM   1739  N   ARG A 439       7.144  16.805  46.075  1.00113.75           N  
ATOM   1740  CA  ARG A 439       8.018  15.783  45.497  1.00115.91           C  
ATOM   1741  C   ARG A 439       7.313  14.440  45.306  1.00116.03           C  
ATOM   1742  O   ARG A 439       7.851  13.546  44.654  1.00118.05           O  
ATOM   1743  CB  ARG A 439       9.289  15.622  46.339  1.00116.85           C  
ATOM   1744  CG  ARG A 439      10.244  16.799  46.213  1.00116.61           C  
ATOM   1745  CD  ARG A 439      11.314  16.823  47.304  1.00116.75           C  
ATOM   1746  NE  ARG A 439      11.640  18.204  47.667  1.00116.96           N  
ATOM   1747  CZ  ARG A 439      12.495  18.983  47.008  1.00114.45           C  
ATOM   1748  NH1 ARG A 439      13.139  18.528  45.948  1.00113.46           N  
ATOM   1749  NH2 ARG A 439      12.704  20.224  47.413  1.00115.01           N  
ATOM   1750  N   HIS A 440       6.110  14.319  45.870  1.00116.03           N  
ATOM   1751  CA  HIS A 440       5.271  13.116  45.763  1.00116.47           C  
ATOM   1752  C   HIS A 440       5.938  11.858  46.321  1.00118.25           C  
ATOM   1753  O   HIS A 440       6.347  11.828  47.488  1.00118.49           O  
ATOM   1754  CB  HIS A 440       4.818  12.893  44.320  1.00114.54           C  
ATOM   1755  CG  HIS A 440       3.934  13.979  43.789  1.00114.28           C  
ATOM   1756  ND1 HIS A 440       4.430  15.115  43.187  1.00113.77           N  
ATOM   1757  CD2 HIS A 440       2.585  14.098  43.759  1.00113.64           C  
ATOM   1758  CE1 HIS A 440       3.426  15.887  42.812  1.00112.32           C  
ATOM   1759  NE2 HIS A 440       2.296  15.294  43.147  1.00112.01           N  
ATOM   1760  N   ASN A 447       7.831  12.642  39.418  1.00104.45           N  
ATOM   1761  CA  ASN A 447       7.113  13.868  39.084  1.00104.93           C  
ATOM   1762  C   ASN A 447       7.138  14.908  40.203  1.00104.97           C  
ATOM   1763  O   ASN A 447       7.184  14.565  41.388  1.00107.18           O  
ATOM   1764  CB  ASN A 447       5.667  13.576  38.641  1.00105.36           C  
ATOM   1765  CG  ASN A 447       4.841  12.865  39.707  1.00106.26           C  
ATOM   1766  OD1 ASN A 447       5.361  12.101  40.522  1.00106.74           O  
ATOM   1767  ND2 ASN A 447       3.534  13.103  39.685  1.00106.59           N  
ATOM   1768  N   LEU A 448       7.101  16.178  39.800  1.00101.62           N  
ATOM   1769  CA  LEU A 448       7.221  17.317  40.700  1.00 96.55           C  
ATOM   1770  C   LEU A 448       6.067  18.290  40.499  1.00 94.10           C  
ATOM   1771  O   LEU A 448       5.577  18.460  39.383  1.00 92.52           O  
ATOM   1772  CB  LEU A 448       8.538  18.047  40.423  1.00 96.64           C  
ATOM   1773  CG  LEU A 448       8.873  19.282  41.266  1.00 96.86           C  
ATOM   1774  CD1 LEU A 448       9.792  18.913  42.419  1.00 97.25           C  
ATOM   1775  CD2 LEU A 448       9.511  20.361  40.412  1.00 97.78           C  
ATOM   1776  N   THR A 449       5.641  18.931  41.582  1.00 92.63           N  
ATOM   1777  CA  THR A 449       4.703  20.040  41.498  1.00 92.62           C  
ATOM   1778  C   THR A 449       5.284  21.235  42.232  1.00 94.13           C  
ATOM   1779  O   THR A 449       5.641  21.132  43.406  1.00 96.09           O  
ATOM   1780  CB  THR A 449       3.330  19.701  42.119  1.00 93.00           C  
ATOM   1781  OG1 THR A 449       2.746  18.577  41.446  1.00 93.31           O  
ATOM   1782  CG2 THR A 449       2.391  20.894  42.012  1.00 92.66           C  
ATOM   1783  N   ILE A 450       5.396  22.362  41.536  1.00 94.76           N  
ATOM   1784  CA  ILE A 450       5.719  23.630  42.188  1.00 94.30           C  
ATOM   1785  C   ILE A 450       4.566  24.612  42.019  1.00 95.33           C  
ATOM   1786  O   ILE A 450       4.073  24.826  40.913  1.00 95.29           O  
ATOM   1787  CB  ILE A 450       7.140  24.208  41.806  1.00 96.20           C  
ATOM   1788  CG1 ILE A 450       7.159  25.746  41.832  1.00 97.52           C  
ATOM   1789  CG2 ILE A 450       7.683  23.628  40.486  1.00 95.55           C  
ATOM   1790  CD1 ILE A 450       6.928  26.426  40.494  1.00100.13           C  
ATOM   1791  N   LEU A 451       4.131  25.175  43.142  1.00 98.92           N  
ATOM   1792  CA  LEU A 451       2.937  26.015  43.213  1.00 98.58           C  
ATOM   1793  C   LEU A 451       3.311  27.350  43.842  1.00 97.22           C  
ATOM   1794  O   LEU A 451       3.773  27.389  44.982  1.00 97.38           O  
ATOM   1795  CB  LEU A 451       1.865  25.314  44.056  1.00 98.98           C  
ATOM   1796  CG  LEU A 451       0.380  25.648  43.874  1.00101.77           C  
ATOM   1797  CD1 LEU A 451      -0.482  24.575  44.525  1.00102.02           C  
ATOM   1798  CD2 LEU A 451       0.011  27.021  44.425  1.00102.35           C  
ATOM   1799  N   CYS A 452       3.114  28.438  43.102  1.00 96.80           N  
ATOM   1800  CA  CYS A 452       3.519  29.756  43.579  1.00 98.77           C  
ATOM   1801  C   CYS A 452       2.362  30.699  43.845  1.00 97.70           C  
ATOM   1802  O   CYS A 452       1.383  30.717  43.107  1.00 99.35           O  
ATOM   1803  CB  CYS A 452       4.463  30.429  42.583  1.00102.50           C  
ATOM   1804  SG  CYS A 452       5.948  29.495  42.176  1.00109.69           S  
ATOM   1805  N   SER A 453       2.495  31.488  44.907  1.00 96.59           N  
ATOM   1806  CA  SER A 453       1.730  32.716  45.048  1.00 95.26           C  
ATOM   1807  C   SER A 453       2.383  33.759  44.134  1.00 95.77           C  
ATOM   1808  O   SER A 453       3.524  33.580  43.701  1.00 95.93           O  
ATOM   1809  CB  SER A 453       1.736  33.190  46.503  1.00 93.68           C  
ATOM   1810  OG  SER A 453       2.959  33.820  46.835  1.00 91.31           O  
ATOM   1811  N   ASP A 454       1.661  34.832  43.827  1.00 95.56           N  
ATOM   1812  CA  ASP A 454       2.177  35.886  42.963  1.00 95.12           C  
ATOM   1813  C   ASP A 454       1.398  37.157  43.228  1.00 96.20           C  
ATOM   1814  O   ASP A 454       0.174  37.153  43.198  1.00 95.74           O  
ATOM   1815  CB  ASP A 454       2.056  35.482  41.490  1.00 98.90           C  
ATOM   1816  CG  ASP A 454       2.922  36.330  40.573  1.00102.59           C  
ATOM   1817  OD1 ASP A 454       3.247  35.869  39.458  1.00103.00           O  
ATOM   1818  OD2 ASP A 454       3.275  37.463  40.957  1.00104.62           O  
ATOM   1819  N   SER A 455       2.110  38.245  43.490  1.00102.13           N  
ATOM   1820  CA  SER A 455       1.466  39.510  43.844  1.00110.47           C  
ATOM   1821  C   SER A 455       0.968  40.295  42.631  1.00115.52           C  
ATOM   1822  O   SER A 455      -0.046  40.999  42.714  1.00117.30           O  
ATOM   1823  CB  SER A 455       2.407  40.373  44.681  1.00112.89           C  
ATOM   1824  OG  SER A 455       2.712  39.732  45.911  1.00117.72           O  
ATOM   1825  N   ASN A 456       1.688  40.169  41.514  1.00118.55           N  
ATOM   1826  CA  ASN A 456       1.382  40.875  40.262  1.00121.71           C  
ATOM   1827  C   ASN A 456       1.379  42.404  40.405  1.00124.05           C  
ATOM   1828  O   ASN A 456       0.670  43.107  39.680  1.00124.73           O  
ATOM   1829  CB  ASN A 456       0.057  40.380  39.662  1.00122.86           C  
ATOM   1830  CG  ASN A 456      -0.163  38.893  39.874  1.00123.33           C  
ATOM   1831  OD1 ASN A 456       0.693  38.072  39.546  1.00122.97           O  
ATOM   1832  ND2 ASN A 456      -1.320  38.540  40.430  1.00123.82           N  
ATOM   1833  N   GLY A 457       2.189  42.907  41.336  1.00126.69           N  
ATOM   1834  CA  GLY A 457       2.215  44.328  41.667  1.00129.59           C  
ATOM   1835  C   GLY A 457       1.006  44.689  42.505  1.00132.67           C  
ATOM   1836  O   GLY A 457       0.829  44.172  43.610  1.00134.03           O  
ATOM   1837  N   LYS A 458       0.172  45.577  41.972  1.00134.84           N  
ATOM   1838  CA  LYS A 458      -1.093  45.931  42.604  1.00137.21           C  
ATOM   1839  C   LYS A 458      -2.243  45.428  41.740  1.00138.69           C  
ATOM   1840  O   LYS A 458      -3.138  46.194  41.378  1.00138.85           O  
ATOM   1841  CB  LYS A 458      -1.287  47.520  42.239  0.00 20.00           C  
ATOM   1842  CG  LYS A 458      -0.317  48.242  43.161  0.00 20.00           C  
ATOM   1843  CD  LYS A 458      -0.457  49.750  43.039  0.00 20.00           C  
ATOM   1844  CE  LYS A 458       0.496  50.472  43.977  0.00 20.00           C  
ATOM   1845  NZ  LYS A 458       0.386  51.951  43.851  0.00 20.00           N  
ATOM   1846  N   ASN A 459      -2.207  44.136  41.417  1.00139.76           N  
ATOM   1847  CA  ASN A 459      -3.174  43.533  40.503  1.00140.43           C  
ATOM   1848  C   ASN A 459      -3.599  42.140  40.978  1.00140.21           C  
ATOM   1849  O   ASN A 459      -2.993  41.130  40.604  1.00140.88           O  
ATOM   1850  CB  ASN A 459      -2.589  43.485  39.081  1.00139.89           C  
ATOM   1851  CG  ASN A 459      -3.635  43.207  38.012  1.00139.16           C  
ATOM   1852  OD1 ASN A 459      -3.298  42.776  36.909  1.00139.13           O  
ATOM   1853  ND2 ASN A 459      -4.903  43.459  38.328  1.00138.77           N  
ATOM   1854  N   ARG A 460      -4.636  42.102  41.815  1.00138.51           N  
ATOM   1855  CA  ARG A 460      -5.118  40.855  42.412  1.00135.41           C  
ATOM   1856  C   ARG A 460      -3.997  40.142  43.167  1.00132.88           C  
ATOM   1857  O   ARG A 460      -2.972  40.749  43.491  1.00134.85           O  
ATOM   1858  CB  ARG A 460      -5.863  39.983  41.749  0.00 20.00           C  
ATOM   1859  CG  ARG A 460      -7.103  40.584  41.108  0.00 20.00           C  
ATOM   1860  CD  ARG A 460      -7.803  39.660  40.124  0.00 20.00           C  
ATOM   1861  NE  ARG A 460      -8.946  40.305  39.484  0.00 20.00           N  
ATOM   1862  CZ  ARG A 460      -9.657  39.763  38.506  0.00 20.00           C  
ATOM   1863  NH1 ARG A 460      -9.349  38.555  38.051  0.00 20.00           N  
ATOM   1864  NH2 ARG A 460     -10.681  40.423  37.982  0.00 20.00           N  
ATOM   1865  N   SER A 461      -4.200  38.856  43.442  1.00128.43           N  
ATOM   1866  CA  SER A 461      -3.197  38.026  44.113  1.00122.19           C  
ATOM   1867  C   SER A 461      -3.442  36.556  43.786  1.00117.23           C  
ATOM   1868  O   SER A 461      -4.239  35.883  44.442  1.00119.31           O  
ATOM   1869  CB  SER A 461      -3.216  38.258  45.625  1.00121.39           C  
ATOM   1870  OG  SER A 461      -2.209  37.490  46.253  1.00121.86           O  
ATOM   1871  N   SER A 462      -2.740  36.067  42.772  1.00110.10           N  
ATOM   1872  CA  SER A 462      -3.055  34.779  42.169  1.00104.05           C  
ATOM   1873  C   SER A 462      -2.094  33.648  42.521  1.00100.68           C  
ATOM   1874  O   SER A 462      -0.996  33.877  43.029  1.00 99.84           O  
ATOM   1875  CB  SER A 462      -3.148  34.933  40.649  1.00104.14           C  
ATOM   1876  OG  SER A 462      -2.175  35.841  40.166  1.00102.04           O  
ATOM   1877  N   ALA A 463      -2.534  32.423  42.256  1.00 98.39           N  
ATOM   1878  CA  ALA A 463      -1.680  31.250  42.373  1.00 96.95           C  
ATOM   1879  C   ALA A 463      -1.354  30.707  40.989  1.00 97.14           C  
ATOM   1880  O   ALA A 463      -2.212  30.676  40.101  1.00 96.99           O  
ATOM   1881  CB  ALA A 463      -2.345  30.186  43.216  1.00 95.68           C  
ATOM   1882  N   ARG A 464      -0.104  30.296  40.807  1.00 96.31           N  
ATOM   1883  CA  ARG A 464       0.338  29.695  39.554  1.00 95.07           C  
ATOM   1884  C   ARG A 464       0.962  28.336  39.855  1.00 96.89           C  
ATOM   1885  O   ARG A 464       1.716  28.193  40.822  1.00 96.25           O  
ATOM   1886  CB  ARG A 464       1.321  30.617  38.827  1.00 93.43           C  
ATOM   1887  CG  ARG A 464       0.815  32.046  38.641  1.00 92.44           C  
ATOM   1888  CD  ARG A 464       1.816  32.915  37.904  1.00 94.11           C  
ATOM   1889  NE  ARG A 464       1.517  34.343  38.031  1.00 95.42           N  
ATOM   1890  CZ  ARG A 464       0.750  35.042  37.195  1.00 97.07           C  
ATOM   1891  NH1 ARG A 464       0.178  34.458  36.148  1.00 98.51           N  
ATOM   1892  NH2 ARG A 464       0.548  36.336  37.408  1.00 97.15           N  
ATOM   1893  N   ILE A 465       0.630  27.340  39.036  1.00 99.42           N  
ATOM   1894  CA  ILE A 465       1.058  25.957  39.278  1.00102.58           C  
ATOM   1895  C   ILE A 465       1.863  25.357  38.115  1.00105.57           C  
ATOM   1896  O   ILE A 465       1.511  25.527  36.941  1.00106.88           O  
ATOM   1897  CB  ILE A 465      -0.151  25.033  39.648  1.00101.52           C  
ATOM   1898  CG1 ILE A 465       0.326  23.624  40.024  1.00101.79           C  
ATOM   1899  CG2 ILE A 465      -1.177  24.979  38.515  1.00100.34           C  
ATOM   1900  CD1 ILE A 465      -0.678  22.814  40.824  1.00102.05           C  
ATOM   1901  N   LEU A 466       2.945  24.661  38.461  1.00106.93           N  
ATOM   1902  CA  LEU A 466       3.732  23.909  37.492  1.00108.19           C  
ATOM   1903  C   LEU A 466       3.851  22.437  37.893  1.00110.46           C  
ATOM   1904  O   LEU A 466       4.351  22.117  38.974  1.00109.46           O  
ATOM   1905  CB  LEU A 466       5.120  24.533  37.320  1.00106.95           C  
ATOM   1906  CG  LEU A 466       6.000  23.953  36.208  1.00106.90           C  
ATOM   1907  CD1 LEU A 466       5.566  24.460  34.832  1.00106.22           C  
ATOM   1908  CD2 LEU A 466       7.461  24.280  36.464  1.00105.73           C  
ATOM   1909  N   GLN A 467       3.372  21.556  37.016  1.00114.14           N  
ATOM   1910  CA  GLN A 467       3.518  20.106  37.177  1.00117.52           C  
ATOM   1911  C   GLN A 467       4.289  19.556  35.985  1.00120.27           C  
ATOM   1912  O   GLN A 467       4.085  20.012  34.862  1.00120.96           O  
ATOM   1913  CB  GLN A 467       2.152  19.422  37.283  1.00116.70           C  
ATOM   1914  CG  GLN A 467       1.352  19.808  38.531  1.00117.55           C  
ATOM   1915  CD  GLN A 467       0.107  18.957  38.746  1.00117.14           C  
ATOM   1916  OE1 GLN A 467      -0.207  18.070  37.953  1.00117.98           O  
ATOM   1917  NE2 GLN A 467      -0.606  19.226  39.832  1.00116.23           N  
ATOM   1918  N   ILE A 468       5.171  18.587  36.221  1.00123.79           N  
ATOM   1919  CA  ILE A 468       6.040  18.087  35.148  1.00129.61           C  
ATOM   1920  C   ILE A 468       5.605  16.743  34.546  1.00135.65           C  
ATOM   1921  O   ILE A 468       6.158  16.301  33.527  1.00137.06           O  
ATOM   1922  CB  ILE A 468       7.541  18.030  35.566  1.00128.82           C  
ATOM   1923  CG1 ILE A 468       7.809  16.850  36.508  1.00128.85           C  
ATOM   1924  CG2 ILE A 468       7.989  19.367  36.164  1.00128.94           C  
ATOM   1925  CD1 ILE A 468       9.160  16.182  36.294  1.00128.08           C  
ATOM   1926  N   ILE A 469       4.606  16.109  35.162  1.00139.48           N  
ATOM   1927  CA  ILE A 469       4.156  14.755  34.779  1.00141.46           C  
ATOM   1928  C   ILE A 469       5.290  13.737  35.015  1.00143.01           C  
ATOM   1929  O   ILE A 469       6.227  14.022  35.768  1.00145.59           O  
ATOM   1930  CB  ILE A 469       3.566  14.685  33.329  1.00140.56           C  
ATOM   1931  CG1 ILE A 469       2.734  15.935  33.013  1.00140.75           C  
ATOM   1932  CG2 ILE A 469       2.711  13.423  33.153  1.00141.06           C  
ATOM   1933  CD1 ILE A 469       2.494  16.179  31.529  1.00141.40           C  
ATOM   1934  N   LYS A 470       5.216  12.566  34.387  1.00141.64           N  
ATOM   1935  CA  LYS A 470       6.125  11.468  34.720  1.00140.96           C  
ATOM   1936  C   LYS A 470       6.990  11.009  33.544  1.00141.10           C  
ATOM   1937  O   LYS A 470       6.577  10.159  32.751  1.00140.56           O  
ATOM   1938  CB  LYS A 470       5.342  10.291  35.325  1.00141.39           C  
ATOM   1939  CG  LYS A 470       4.689  10.602  36.676  1.00140.65           C  
ATOM   1940  CD  LYS A 470       3.780   9.479  37.156  1.00139.37           C  
ATOM   1941  CE  LYS A 470       3.228   9.785  38.539  1.00136.73           C  
ATOM   1942  NZ  LYS A 470       2.446   8.648  39.094  1.00134.61           N  
ATOM   1943  N   GLY A 471       8.190  11.582  33.447  1.00141.58           N  
ATOM   1944  CA  GLY A 471       9.176  11.201  32.430  1.00141.85           C  
ATOM   1945  C   GLY A 471       8.720  11.444  31.004  1.00141.63           C  
ATOM   1946  O   GLY A 471       8.411  10.501  30.275  1.00141.91           O  
ATOM   1947  N   LYS A 472       8.686  12.714  30.610  1.00141.82           N  
ATOM   1948  CA  LYS A 472       8.201  13.117  29.293  1.00141.86           C  
ATOM   1949  C   LYS A 472       9.131  14.161  28.679  1.00141.52           C  
ATOM   1950  O   LYS A 472       9.517  15.126  29.343  1.00142.70           O  
ATOM   1951  CB  LYS A 472       6.772  13.665  29.408  1.00141.56           C  
ATOM   1952  CG  LYS A 472       6.187  14.239  28.120  1.00142.36           C  
ATOM   1953  CD  LYS A 472       4.838  14.910  28.358  1.00142.93           C  
ATOM   1954  CE  LYS A 472       3.697  13.899  28.351  1.00144.82           C  
ATOM   1955  NZ  LYS A 472       2.361  14.546  28.483  1.00145.54           N  
ATOM   1956  N   ASP A 473       9.493  13.958  27.415  1.00140.97           N  
ATOM   1957  CA  ASP A 473      10.313  14.920  26.684  1.00140.24           C  
ATOM   1958  C   ASP A 473       9.482  16.116  26.233  1.00139.36           C  
ATOM   1959  O   ASP A 473       8.419  15.953  25.626  1.00139.88           O  
ATOM   1960  CB  ASP A 473      10.989  14.258  25.481  1.00140.40           C  
ATOM   1961  CG  ASP A 473      12.202  13.438  25.871  1.00140.60           C  
ATOM   1962  OD1 ASP A 473      12.099  12.613  26.804  1.00140.75           O  
ATOM   1963  OD2 ASP A 473      13.263  13.617  25.238  1.00140.95           O  
ATOM   1964  N   TYR A 474       9.974  17.313  26.540  1.00137.44           N  
ATOM   1965  CA  TYR A 474       9.293  18.551  26.174  1.00135.94           C  
ATOM   1966  C   TYR A 474       9.966  19.226  24.984  1.00136.96           C  
ATOM   1967  O   TYR A 474      11.196  19.257  24.891  1.00137.61           O  
ATOM   1968  CB  TYR A 474       9.247  19.511  27.367  1.00132.74           C  
ATOM   1969  CG  TYR A 474       8.423  19.007  28.531  1.00131.80           C  
ATOM   1970  CD1 TYR A 474       9.030  18.407  29.637  1.00131.02           C  
ATOM   1971  CD2 TYR A 474       7.035  19.128  28.526  1.00131.95           C  
ATOM   1972  CE1 TYR A 474       8.271  17.939  30.708  1.00130.17           C  
ATOM   1973  CE2 TYR A 474       6.270  18.665  29.588  1.00131.76           C  
ATOM   1974  CZ  TYR A 474       6.893  18.074  30.673  1.00131.01           C  
ATOM   1975  OH  TYR A 474       6.124  17.621  31.712  1.00130.31           O  
ATOM   1976  N   GLU A 475       9.151  19.755  24.074  1.00137.07           N  
ATOM   1977  CA  GLU A 475       9.654  20.493  22.916  1.00137.22           C  
ATOM   1978  C   GLU A 475       9.029  21.888  22.872  1.00136.53           C  
ATOM   1979  O   GLU A 475       9.676  22.856  22.461  1.00135.81           O  
ATOM   1980  CB  GLU A 475       9.380  19.726  21.619  1.00138.20           C  
ATOM   1981  CG  GLU A 475      10.637  19.390  20.815  1.00138.85           C  
ATOM   1982  CD  GLU A 475      11.401  20.620  20.357  1.00139.17           C  
ATOM   1983  OE1 GLU A 475      12.361  21.017  21.054  1.00138.50           O  
ATOM   1984  OE2 GLU A 475      11.038  21.189  19.305  1.00139.58           O  
ATOM   1985  N   SER A 476       7.767  21.970  23.288  1.00136.28           N  
ATOM   1986  CA  SER A 476       7.097  23.242  23.550  1.00135.57           C  
ATOM   1987  C   SER A 476       6.888  23.390  25.059  1.00134.39           C  
ATOM   1988  O   SER A 476       6.823  22.391  25.782  1.00134.12           O  
ATOM   1989  CB  SER A 476       5.765  23.331  22.794  1.00135.77           C  
ATOM   1990  OG  SER A 476       4.880  22.291  23.171  1.00136.04           O  
ATOM   1991  N   GLU A 477       6.791  24.634  25.526  1.00133.34           N  
ATOM   1992  CA  GLU A 477       6.721  24.935  26.962  1.00132.52           C  
ATOM   1993  C   GLU A 477       5.460  24.418  27.658  1.00131.33           C  
ATOM   1994  O   GLU A 477       4.350  24.587  27.144  1.00132.42           O  
ATOM   1995  CB  GLU A 477       6.845  26.443  27.206  1.00132.56           C  
ATOM   1996  CG  GLU A 477       8.270  26.945  27.371  1.00132.18           C  
ATOM   1997  CD  GLU A 477       8.336  28.419  27.741  1.00132.15           C  
ATOM   1998  OE1 GLU A 477       7.520  28.866  28.577  1.00132.43           O  
ATOM   1999  OE2 GLU A 477       9.209  29.132  27.201  1.00131.23           O  
ATOM   2000  N   PRO A 478       5.632  23.777  28.831  1.00128.92           N  
ATOM   2001  CA  PRO A 478       4.499  23.443  29.691  1.00127.37           C  
ATOM   2002  C   PRO A 478       3.807  24.712  30.173  1.00125.89           C  
ATOM   2003  O   PRO A 478       4.467  25.728  30.417  1.00125.00           O  
ATOM   2004  CB  PRO A 478       5.149  22.720  30.877  1.00127.60           C  
ATOM   2005  CG  PRO A 478       6.473  22.273  30.382  1.00128.60           C  
ATOM   2006  CD  PRO A 478       6.907  23.311  29.401  1.00128.70           C  
ATOM   2007  N   SER A 479       2.484  24.648  30.294  1.00124.70           N  
ATOM   2008  CA  SER A 479       1.689  25.790  30.725  1.00121.80           C  
ATOM   2009  C   SER A 479       1.869  26.038  32.217  1.00120.11           C  
ATOM   2010  O   SER A 479       1.859  25.102  33.019  1.00120.64           O  
ATOM   2011  CB  SER A 479       0.211  25.572  30.388  1.00120.95           C  
ATOM   2012  OG  SER A 479       0.030  25.347  28.998  1.00118.90           O  
ATOM   2013  N   LEU A 480       2.057  27.304  32.575  1.00118.14           N  
ATOM   2014  CA  LEU A 480       2.171  27.713  33.970  1.00115.46           C  
ATOM   2015  C   LEU A 480       0.793  28.169  34.429  1.00116.68           C  
ATOM   2016  O   LEU A 480       0.521  29.369  34.539  1.00117.99           O  
ATOM   2017  CB  LEU A 480       3.201  28.833  34.099  1.00113.16           C  
ATOM   2018  CG  LEU A 480       3.562  29.420  35.459  1.00110.79           C  
ATOM   2019  CD1 LEU A 480       4.533  28.527  36.229  1.00108.81           C  
ATOM   2020  CD2 LEU A 480       4.158  30.785  35.206  1.00110.80           C  
ATOM   2021  N   LEU A 481      -0.066  27.186  34.691  1.00117.19           N  
ATOM   2022  CA  LEU A 481      -1.504  27.387  34.902  1.00116.00           C  
ATOM   2023  C   LEU A 481      -1.820  28.329  36.065  1.00113.63           C  
ATOM   2024  O   LEU A 481      -1.324  28.144  37.177  1.00113.60           O  
ATOM   2025  CB  LEU A 481      -2.193  26.022  35.080  1.00117.07           C  
ATOM   2026  CG  LEU A 481      -3.717  25.803  35.062  1.00117.68           C  
ATOM   2027  CD1 LEU A 481      -4.338  25.960  36.456  1.00117.66           C  
ATOM   2028  CD2 LEU A 481      -4.443  26.669  34.018  1.00118.25           C  
ATOM   2029  N   GLU A 482      -2.646  29.337  35.787  1.00112.47           N  
ATOM   2030  CA  GLU A 482      -3.031  30.340  36.780  1.00113.30           C  
ATOM   2031  C   GLU A 482      -4.469  30.160  37.278  1.00113.78           C  
ATOM   2032  O   GLU A 482      -5.368  29.810  36.511  1.00114.92           O  
ATOM   2033  CB  GLU A 482      -2.855  31.748  36.208  1.00113.86           C  
ATOM   2034  CG  GLU A 482      -2.907  32.857  37.254  1.00115.81           C  
ATOM   2035  CD  GLU A 482      -3.421  34.173  36.699  1.00118.28           C  
ATOM   2036  OE1 GLU A 482      -3.100  34.512  35.537  1.00119.48           O  
ATOM   2037  OE2 GLU A 482      -4.151  34.873  37.432  1.00119.19           O  
ATOM   2038  N   PHE A 483      -4.667  30.407  38.571  1.00113.47           N  
ATOM   2039  CA  PHE A 483      -5.986  30.392  39.204  1.00113.76           C  
ATOM   2040  C   PHE A 483      -5.975  31.337  40.407  1.00115.06           C  
ATOM   2041  O   PHE A 483      -4.907  31.639  40.946  1.00115.78           O  
ATOM   2042  CB  PHE A 483      -6.403  28.966  39.602  1.00113.45           C  
ATOM   2043  CG  PHE A 483      -5.410  28.253  40.487  1.00113.33           C  
ATOM   2044  CD1 PHE A 483      -4.291  27.625  39.945  1.00113.87           C  
ATOM   2045  CD2 PHE A 483      -5.606  28.189  41.861  1.00113.14           C  
ATOM   2046  CE1 PHE A 483      -3.374  26.962  40.763  1.00113.69           C  
ATOM   2047  CE2 PHE A 483      -4.695  27.525  42.687  1.00112.83           C  
ATOM   2048  CZ  PHE A 483      -3.580  26.911  42.137  1.00112.90           C  
ATOM   2049  N   LYS A 484      -7.152  31.806  40.823  1.00115.68           N  
ATOM   2050  CA  LYS A 484      -7.239  32.844  41.860  1.00116.22           C  
ATOM   2051  C   LYS A 484      -8.023  32.425  43.112  1.00114.19           C  
ATOM   2052  O   LYS A 484      -9.182  32.808  43.279  1.00114.95           O  
ATOM   2053  CB  LYS A 484      -7.819  34.139  41.274  1.00117.27           C  
ATOM   2054  CG  LYS A 484      -6.934  34.827  40.240  1.00117.67           C  
ATOM   2055  CD  LYS A 484      -7.457  36.223  39.922  1.00118.01           C  
ATOM   2056  CE  LYS A 484      -6.651  36.896  38.817  1.00118.36           C  
ATOM   2057  NZ  LYS A 484      -7.008  36.381  37.465  1.00118.37           N  
ATOM   2058  N   PRO A 485      -7.388  31.645  44.004  1.00113.47           N  
ATOM   2059  CA  PRO A 485      -8.076  31.156  45.191  1.00114.78           C  
ATOM   2060  C   PRO A 485      -7.894  32.015  46.454  1.00116.80           C  
ATOM   2061  O   PRO A 485      -8.432  31.668  47.509  1.00117.10           O  
ATOM   2062  CB  PRO A 485      -7.428  29.786  45.400  1.00114.17           C  
ATOM   2063  CG  PRO A 485      -6.022  29.956  44.884  1.00112.66           C  
ATOM   2064  CD  PRO A 485      -6.002  31.145  43.949  1.00113.08           C  
ATOM   2065  N   PHE A 486      -7.162  33.124  46.347  1.00117.78           N  
ATOM   2066  CA  PHE A 486      -6.809  33.927  47.521  1.00119.21           C  
ATOM   2067  C   PHE A 486      -7.736  35.114  47.783  1.00124.14           C  
ATOM   2068  O   PHE A 486      -8.370  35.635  46.864  1.00125.26           O  
ATOM   2069  CB  PHE A 486      -5.351  34.382  47.438  1.00115.77           C  
ATOM   2070  CG  PHE A 486      -4.374  33.248  47.329  1.00114.08           C  
ATOM   2071  CD1 PHE A 486      -4.396  32.204  48.246  1.00112.52           C  
ATOM   2072  CD2 PHE A 486      -3.431  33.221  46.310  1.00114.47           C  
ATOM   2073  CE1 PHE A 486      -3.498  31.152  48.150  1.00111.99           C  
ATOM   2074  CE2 PHE A 486      -2.522  32.169  46.208  1.00113.89           C  
ATOM   2075  CZ  PHE A 486      -2.557  31.133  47.130  1.00113.22           C  
ATOM   2076  N   SER A 487      -7.800  35.536  49.048  1.00128.85           N  
ATOM   2077  CA  SER A 487      -8.712  36.602  49.476  1.00131.62           C  
ATOM   2078  C   SER A 487      -8.105  37.599  50.473  1.00134.94           C  
ATOM   2079  O   SER A 487      -8.461  38.779  50.460  1.00134.88           O  
ATOM   2080  CB  SER A 487      -9.991  36.002  50.062  1.00130.17           C  
ATOM   2081  OG  SER A 487     -10.605  35.129  49.133  1.00129.90           O  
ATOM   2082  N   ASN A 488      -7.198  37.131  51.332  1.00138.12           N  
ATOM   2083  CA  ASN A 488      -6.618  37.989  52.379  1.00141.81           C  
ATOM   2084  C   ASN A 488      -5.399  38.810  51.922  1.00140.58           C  
ATOM   2085  O   ASN A 488      -4.482  39.091  52.709  1.00140.98           O  
ATOM   2086  CB  ASN A 488      -6.329  37.189  53.672  1.00146.11           C  
ATOM   2087  CG  ASN A 488      -5.000  36.429  53.629  1.00149.36           C  
ATOM   2088  OD1 ASN A 488      -4.670  35.769  52.642  1.00151.44           O  
ATOM   2089  ND2 ASN A 488      -4.236  36.519  54.714  1.00149.58           N  
ATOM   2090  N   GLY A 489      -5.410  39.206  50.650  1.00137.77           N  
ATOM   2091  CA  GLY A 489      -4.354  40.045  50.088  1.00133.81           C  
ATOM   2092  C   GLY A 489      -3.035  39.316  49.881  1.00129.13           C  
ATOM   2093  O   GLY A 489      -3.033  38.116  49.596  1.00130.27           O  
ATOM   2094  N   PRO A 490      -1.905  40.037  50.033  1.00123.50           N  
ATOM   2095  CA  PRO A 490      -0.579  39.504  49.698  1.00119.54           C  
ATOM   2096  C   PRO A 490      -0.100  38.403  50.645  1.00114.70           C  
ATOM   2097  O   PRO A 490      -0.416  38.422  51.837  1.00116.12           O  
ATOM   2098  CB  PRO A 490       0.329  40.733  49.789  1.00120.38           C  
ATOM   2099  CG  PRO A 490      -0.367  41.651  50.731  1.00121.15           C  
ATOM   2100  CD  PRO A 490      -1.833  41.418  50.547  1.00121.75           C  
ATOM   2101  N   LEU A 491       0.665  37.463  50.095  1.00108.04           N  
ATOM   2102  CA  LEU A 491       1.140  36.281  50.808  1.00103.00           C  
ATOM   2103  C   LEU A 491       2.664  36.184  50.769  1.00102.96           C  
ATOM   2104  O   LEU A 491       3.280  36.559  49.775  1.00107.39           O  
ATOM   2105  CB  LEU A 491       0.551  35.034  50.149  1.00101.88           C  
ATOM   2106  CG  LEU A 491      -0.663  34.308  50.730  1.00101.28           C  
ATOM   2107  CD1 LEU A 491      -1.875  35.206  50.861  1.00103.02           C  
ATOM   2108  CD2 LEU A 491      -0.982  33.131  49.846  1.00101.10           C  
ATOM   2109  N   VAL A 492       3.275  35.664  51.830  1.00 99.84           N  
ATOM   2110  CA  VAL A 492       4.728  35.471  51.843  1.00 97.16           C  
ATOM   2111  C   VAL A 492       5.123  34.305  50.946  1.00 98.94           C  
ATOM   2112  O   VAL A 492       6.118  34.366  50.226  1.00101.23           O  
ATOM   2113  CB  VAL A 492       5.276  35.212  53.256  1.00 96.49           C  
ATOM   2114  CG1 VAL A 492       6.778  34.981  53.211  1.00 96.49           C  
ATOM   2115  CG2 VAL A 492       4.966  36.378  54.174  1.00 99.13           C  
ATOM   2116  N   GLY A 493       4.334  33.242  50.993  1.00 99.03           N  
ATOM   2117  CA  GLY A 493       4.633  32.039  50.236  1.00 98.57           C  
ATOM   2118  C   GLY A 493       4.038  30.828  50.919  1.00 99.27           C  
ATOM   2119  O   GLY A 493       3.177  30.956  51.789  1.00101.47           O  
ATOM   2120  N   GLY A 494       4.494  29.647  50.522  1.00 97.41           N  
ATOM   2121  CA  GLY A 494       3.961  28.414  51.067  1.00 96.52           C  
ATOM   2122  C   GLY A 494       4.951  27.274  51.089  1.00 97.59           C  
ATOM   2123  O   GLY A 494       6.085  27.404  50.630  1.00 96.86           O  
ATOM   2124  N   PHE A 495       4.512  26.148  51.632  1.00 97.83           N  
ATOM   2125  CA  PHE A 495       5.318  24.942  51.651  1.00 99.67           C  
ATOM   2126  C   PHE A 495       4.423  23.712  51.609  1.00101.19           C  
ATOM   2127  O   PHE A 495       3.236  23.784  51.940  1.00103.39           O  
ATOM   2128  CB  PHE A 495       6.220  24.920  52.888  1.00 99.81           C  
ATOM   2129  CG  PHE A 495       5.491  25.155  54.190  1.00101.49           C  
ATOM   2130  CD1 PHE A 495       5.443  26.427  54.758  1.00102.89           C  
ATOM   2131  CD2 PHE A 495       4.877  24.101  54.865  1.00 99.25           C  
ATOM   2132  CE1 PHE A 495       4.780  26.646  55.968  1.00101.54           C  
ATOM   2133  CE2 PHE A 495       4.222  24.310  56.073  1.00 97.63           C  
ATOM   2134  CZ  PHE A 495       4.170  25.580  56.627  1.00 98.80           C  
ATOM   2135  N   VAL A 496       4.982  22.589  51.180  1.00100.24           N  
ATOM   2136  CA  VAL A 496       4.265  21.325  51.263  1.00 99.55           C  
ATOM   2137  C   VAL A 496       4.803  20.608  52.480  1.00101.26           C  
ATOM   2138  O   VAL A 496       5.993  20.296  52.532  1.00104.21           O  
ATOM   2139  CB  VAL A 496       4.476  20.446  50.018  1.00 97.31           C  
ATOM   2140  CG1 VAL A 496       3.771  19.114  50.196  1.00 99.24           C  
ATOM   2141  CG2 VAL A 496       3.966  21.151  48.776  1.00 97.52           C  
ATOM   2142  N   TYR A 497       3.945  20.364  53.467  1.00100.01           N  
ATOM   2143  CA  TYR A 497       4.393  19.684  54.676  1.00 99.15           C  
ATOM   2144  C   TYR A 497       4.547  18.194  54.404  1.00 99.23           C  
ATOM   2145  O   TYR A 497       3.605  17.521  54.000  1.00 98.02           O  
ATOM   2146  CB  TYR A 497       3.460  19.954  55.860  1.00 98.88           C  
ATOM   2147  CG  TYR A 497       3.859  19.254  57.151  1.00 99.80           C  
ATOM   2148  CD1 TYR A 497       4.786  19.818  58.017  1.00 99.90           C  
ATOM   2149  CD2 TYR A 497       3.294  18.035  57.511  1.00100.91           C  
ATOM   2150  CE1 TYR A 497       5.148  19.180  59.208  1.00100.38           C  
ATOM   2151  CE2 TYR A 497       3.645  17.393  58.695  1.00100.49           C  
ATOM   2152  CZ  TYR A 497       4.570  17.970  59.538  1.00100.36           C  
ATOM   2153  OH  TYR A 497       4.918  17.329  60.706  1.00100.25           O  
ATOM   2154  N   ARG A 498       5.761  17.700  54.606  1.00100.99           N  
ATOM   2155  CA  ARG A 498       6.065  16.286  54.447  1.00102.09           C  
ATOM   2156  C   ARG A 498       6.799  15.835  55.701  1.00100.52           C  
ATOM   2157  O   ARG A 498       7.590  14.894  55.684  1.00 98.13           O  
ATOM   2158  CB  ARG A 498       6.901  16.058  53.182  1.00104.91           C  
ATOM   2159  CG  ARG A 498       6.092  16.060  51.886  1.00104.94           C  
ATOM   2160  CD  ARG A 498       5.820  14.642  51.409  1.00108.63           C  
ATOM   2161  NE  ARG A 498       4.424  14.431  51.003  1.00111.26           N  
ATOM   2162  CZ  ARG A 498       3.902  14.784  49.828  1.00110.63           C  
ATOM   2163  NH1 ARG A 498       4.639  15.391  48.903  1.00111.11           N  
ATOM   2164  NH2 ARG A 498       2.627  14.538  49.583  1.00110.67           N  
ATOM   2165  N   GLY A 499       6.514  16.528  56.798  1.00101.54           N  
ATOM   2166  CA  GLY A 499       7.112  16.219  58.085  1.00101.92           C  
ATOM   2167  C   GLY A 499       6.506  15.002  58.747  1.00102.17           C  
ATOM   2168  O   GLY A 499       5.830  14.192  58.107  1.00102.63           O  
ATOM   2169  N   CYS A 500       6.743  14.887  60.048  1.00102.34           N  
ATOM   2170  CA  CYS A 500       6.430  13.671  60.772  1.00 99.34           C  
ATOM   2171  C   CYS A 500       5.658  13.933  62.049  1.00 97.82           C  
ATOM   2172  O   CYS A 500       4.785  13.145  62.406  1.00 97.95           O  
ATOM   2173  CB  CYS A 500       7.715  12.918  61.098  1.00100.65           C  
ATOM   2174  SG  CYS A 500       7.439  11.252  61.699  1.00104.06           S  
ATOM   2175  N   GLN A 501       5.984  15.022  62.746  1.00 96.63           N  
ATOM   2176  CA  GLN A 501       5.327  15.319  64.017  1.00 95.69           C  
ATOM   2177  C   GLN A 501       3.813  15.434  63.827  1.00 97.41           C  
ATOM   2178  O   GLN A 501       3.047  14.862  64.603  1.00 96.72           O  
ATOM   2179  CB  GLN A 501       5.911  16.563  64.691  1.00 89.86           C  
ATOM   2180  CG  GLN A 501       5.623  16.658  66.197  1.00 86.57           C  
ATOM   2181  CD  GLN A 501       4.324  17.389  66.523  1.00 86.34           C  
ATOM   2182  OE1 GLN A 501       3.960  18.350  65.851  1.00 88.97           O  
ATOM   2183  NE2 GLN A 501       3.635  16.951  67.576  1.00 83.72           N  
ATOM   2184  N   SER A 502       3.389  16.140  62.781  1.00 98.04           N  
ATOM   2185  CA  SER A 502       1.968  16.230  62.460  1.00 98.82           C  
ATOM   2186  C   SER A 502       1.549  15.181  61.440  1.00100.09           C  
ATOM   2187  O   SER A 502       2.058  15.151  60.318  1.00102.10           O  
ATOM   2188  CB  SER A 502       1.603  17.624  61.951  1.00 98.28           C  
ATOM   2189  OG  SER A 502       0.193  17.755  61.851  1.00 95.35           O  
ATOM   2190  N   GLU A 503       0.624  14.315  61.841  1.00100.33           N  
ATOM   2191  CA  GLU A 503       0.032  13.353  60.925  1.00 99.89           C  
ATOM   2192  C   GLU A 503      -0.917  14.081  59.992  1.00 96.56           C  
ATOM   2193  O   GLU A 503      -0.768  14.003  58.776  1.00 99.01           O  
ATOM   2194  CB  GLU A 503      -0.734  12.275  61.686  1.00101.64           C  
ATOM   2195  CG  GLU A 503       0.012  10.973  61.892  1.00103.98           C  
ATOM   2196  CD  GLU A 503      -0.785   9.982  62.725  1.00105.82           C  
ATOM   2197  OE1 GLU A 503      -1.438  10.422  63.699  1.00107.35           O  
ATOM   2198  OE2 GLU A 503      -0.760   8.766  62.413  1.00109.29           O  
ATOM   2199  N   ARG A 504      -1.878  14.800  60.573  1.00 90.96           N  
ATOM   2200  CA  ARG A 504      -2.920  15.487  59.810  1.00 84.06           C  
ATOM   2201  C   ARG A 504      -2.384  16.443  58.743  1.00 85.64           C  
ATOM   2202  O   ARG A 504      -2.893  16.468  57.617  1.00 87.29           O  
ATOM   2203  CB  ARG A 504      -3.909  16.195  60.740  1.00 81.65           C  
ATOM   2204  CG  ARG A 504      -3.307  16.843  61.976  1.00 79.31           C  
ATOM   2205  CD  ARG A 504      -4.349  17.666  62.712  1.00 79.11           C  
ATOM   2206  NE  ARG A 504      -3.758  18.582  63.685  1.00 80.28           N  
ATOM   2207  CZ  ARG A 504      -4.337  19.696  64.131  1.00 80.50           C  
ATOM   2208  NH1 ARG A 504      -5.541  20.066  63.705  1.00 80.26           N  
ATOM   2209  NH2 ARG A 504      -3.705  20.454  65.007  1.00 79.35           N  
ATOM   2210  N   LEU A 505      -1.341  17.196  59.077  1.00 85.15           N  
ATOM   2211  CA  LEU A 505      -0.782  18.182  58.147  1.00 88.78           C  
ATOM   2212  C   LEU A 505      -0.053  17.539  56.973  1.00 91.44           C  
ATOM   2213  O   LEU A 505       0.305  18.235  56.018  1.00 92.03           O  
ATOM   2214  CB  LEU A 505       0.190  19.129  58.863  1.00 90.06           C  
ATOM   2215  CG  LEU A 505       0.012  20.647  58.751  1.00 87.61           C  
ATOM   2216  CD1 LEU A 505       1.378  21.328  58.733  1.00 82.95           C  
ATOM   2217  CD2 LEU A 505      -0.830  21.038  57.533  1.00 86.71           C  
ATOM   2218  N   TYR A 506       0.172  16.224  57.048  1.00 91.48           N  
ATOM   2219  CA  TYR A 506       0.987  15.532  56.048  1.00 89.75           C  
ATOM   2220  C   TYR A 506       0.429  15.689  54.635  1.00 90.75           C  
ATOM   2221  O   TYR A 506      -0.745  15.406  54.380  1.00 92.32           O  
ATOM   2222  CB  TYR A 506       1.192  14.050  56.391  1.00 88.50           C  
ATOM   2223  CG  TYR A 506       2.173  13.390  55.457  1.00 88.40           C  
ATOM   2224  CD1 TYR A 506       3.541  13.432  55.713  1.00 90.36           C  
ATOM   2225  CD2 TYR A 506       1.741  12.762  54.294  1.00 85.73           C  
ATOM   2226  CE1 TYR A 506       4.451  12.849  54.840  1.00 90.46           C  
ATOM   2227  CE2 TYR A 506       2.639  12.180  53.417  1.00 85.90           C  
ATOM   2228  CZ  TYR A 506       3.987  12.222  53.695  1.00 88.80           C  
ATOM   2229  OH  TYR A 506       4.877  11.645  52.823  1.00 89.88           O  
ATOM   2230  N   GLY A 507       1.289  16.152  53.733  1.00 89.47           N  
ATOM   2231  CA  GLY A 507       0.947  16.343  52.328  1.00 87.69           C  
ATOM   2232  C   GLY A 507       0.103  17.573  52.041  1.00 88.07           C  
ATOM   2233  O   GLY A 507      -0.461  17.706  50.954  1.00 90.32           O  
ATOM   2234  N   SER A 508       0.013  18.478  53.007  1.00 88.78           N  
ATOM   2235  CA  SER A 508      -0.787  19.682  52.829  1.00 92.03           C  
ATOM   2236  C   SER A 508       0.027  20.849  52.261  1.00 94.11           C  
ATOM   2237  O   SER A 508       1.219  21.000  52.551  1.00 94.02           O  
ATOM   2238  CB  SER A 508      -1.462  20.071  54.143  1.00 92.22           C  
ATOM   2239  OG  SER A 508      -2.131  18.954  54.705  1.00 93.78           O  
ATOM   2240  N   TYR A 509      -0.627  21.650  51.426  1.00 95.36           N  
ATOM   2241  CA  TYR A 509      -0.047  22.881  50.925  1.00 97.36           C  
ATOM   2242  C   TYR A 509      -0.419  23.988  51.896  1.00 97.43           C  
ATOM   2243  O   TYR A 509      -1.596  24.277  52.090  1.00102.93           O  
ATOM   2244  CB  TYR A 509      -0.600  23.202  49.540  1.00 99.87           C  
ATOM   2245  CG  TYR A 509      -0.113  22.292  48.436  1.00101.49           C  
ATOM   2246  CD1 TYR A 509      -0.554  20.973  48.343  1.00102.90           C  
ATOM   2247  CD2 TYR A 509       0.766  22.758  47.465  1.00102.02           C  
ATOM   2248  CE1 TYR A 509      -0.119  20.139  47.322  1.00102.28           C  
ATOM   2249  CE2 TYR A 509       1.207  21.933  46.438  1.00102.88           C  
ATOM   2250  CZ  TYR A 509       0.761  20.625  46.375  1.00102.47           C  
ATOM   2251  OH  TYR A 509       1.195  19.804  45.358  1.00103.14           O  
ATOM   2252  N   VAL A 510       0.579  24.593  52.519  1.00 92.87           N  
ATOM   2253  CA  VAL A 510       0.335  25.641  53.503  1.00 92.90           C  
ATOM   2254  C   VAL A 510       0.888  26.957  52.976  1.00 93.23           C  
ATOM   2255  O   VAL A 510       2.018  27.010  52.490  1.00 97.47           O  
ATOM   2256  CB  VAL A 510       1.023  25.327  54.865  1.00 92.25           C  
ATOM   2257  CG1 VAL A 510       0.637  26.357  55.920  1.00 90.67           C  
ATOM   2258  CG2 VAL A 510       0.697  23.907  55.350  1.00 90.90           C  
ATOM   2259  N   PHE A 511       0.098  28.017  53.066  1.00 88.53           N  
ATOM   2260  CA  PHE A 511       0.597  29.342  52.736  1.00 87.52           C  
ATOM   2261  C   PHE A 511       0.290  30.290  53.880  1.00 87.06           C  
ATOM   2262  O   PHE A 511      -0.803  30.255  54.450  1.00 88.11           O  
ATOM   2263  CB  PHE A 511      -0.032  29.869  51.445  1.00 91.04           C  
ATOM   2264  CG  PHE A 511       0.460  29.193  50.186  1.00 91.56           C  
ATOM   2265  CD1 PHE A 511       0.020  27.911  49.840  1.00 90.09           C  
ATOM   2266  CD2 PHE A 511       1.318  29.861  49.319  1.00 92.09           C  
ATOM   2267  CE1 PHE A 511       0.454  27.291  48.673  1.00 88.67           C  
ATOM   2268  CE2 PHE A 511       1.763  29.249  48.146  1.00 93.25           C  
ATOM   2269  CZ  PHE A 511       1.328  27.958  47.824  1.00 91.54           C  
ATOM   2270  N   GLY A 512       1.264  31.127  54.220  1.00 86.29           N  
ATOM   2271  CA  GLY A 512       1.096  32.138  55.259  1.00 86.98           C  
ATOM   2272  C   GLY A 512       1.327  33.539  54.720  1.00 89.37           C  
ATOM   2273  O   GLY A 512       2.000  33.715  53.696  1.00 89.76           O  
ATOM   2274  N   ASP A 513       0.763  34.536  55.402  1.00 89.25           N  
ATOM   2275  CA  ASP A 513       1.019  35.930  55.061  1.00 91.66           C  
ATOM   2276  C   ASP A 513       1.927  36.600  56.094  1.00 95.57           C  
ATOM   2277  O   ASP A 513       2.297  35.984  57.100  1.00 96.25           O  
ATOM   2278  CB  ASP A 513      -0.290  36.701  54.881  1.00 91.98           C  
ATOM   2279  CG  ASP A 513      -1.024  36.945  56.185  1.00 93.52           C  
ATOM   2280  OD1 ASP A 513      -2.085  37.597  56.131  1.00 95.98           O  
ATOM   2281  OD2 ASP A 513      -0.565  36.500  57.257  1.00 93.43           O  
ATOM   2282  N   ARG A 514       2.275  37.861  55.836  1.00 98.16           N  
ATOM   2283  CA  ARG A 514       3.187  38.634  56.681  1.00 99.03           C  
ATOM   2284  C   ARG A 514       2.800  38.598  58.159  1.00 97.15           C  
ATOM   2285  O   ARG A 514       3.664  38.497  59.024  1.00 99.34           O  
ATOM   2286  CB  ARG A 514       3.258  40.083  56.194  1.00 98.86           C  
ATOM   2287  CG  ARG A 514       4.594  40.749  56.439  1.00104.61           C  
ATOM   2288  CD  ARG A 514       4.683  42.134  55.804  1.00106.78           C  
ATOM   2289  NE  ARG A 514       4.610  43.235  56.772  1.00115.22           N  
ATOM   2290  CZ  ARG A 514       3.487  43.709  57.320  1.00120.00           C  
ATOM   2291  NH1 ARG A 514       2.302  43.174  57.032  1.00121.90           N  
ATOM   2292  NH2 ARG A 514       3.546  44.725  58.174  1.00120.78           N  
ATOM   2293  N   ASN A 515       1.502  38.660  58.440  1.00 97.42           N  
ATOM   2294  CA  ASN A 515       1.012  38.737  59.819  1.00 95.99           C  
ATOM   2295  C   ASN A 515       0.675  37.390  60.465  1.00 95.91           C  
ATOM   2296  O   ASN A 515       0.146  37.343  61.580  1.00 97.96           O  
ATOM   2297  CB  ASN A 515      -0.178  39.697  59.910  1.00 93.21           C  
ATOM   2298  CG  ASN A 515      -0.376  40.253  61.306  1.00 93.42           C  
ATOM   2299  OD1 ASN A 515      -1.501  40.342  61.779  1.00 96.71           O  
ATOM   2300  ND2 ASN A 515       0.714  40.629  61.973  1.00 93.15           N  
ATOM   2301  N   GLY A 516       0.987  36.302  59.763  1.00 92.52           N  
ATOM   2302  CA  GLY A 516       0.884  34.961  60.325  1.00 91.49           C  
ATOM   2303  C   GLY A 516      -0.469  34.269  60.251  1.00 93.61           C  
ATOM   2304  O   GLY A 516      -0.756  33.392  61.073  1.00 95.39           O  
ATOM   2305  N   ASN A 517      -1.299  34.666  59.284  1.00 90.79           N  
ATOM   2306  CA  ASN A 517      -2.519  33.940  58.940  1.00 86.84           C  
ATOM   2307  C   ASN A 517      -2.156  32.812  57.993  1.00 89.46           C  
ATOM   2308  O   ASN A 517      -1.563  33.059  56.944  1.00 89.82           O  
ATOM   2309  CB  ASN A 517      -3.504  34.856  58.220  1.00 85.47           C  
ATOM   2310  CG  ASN A 517      -3.746  36.151  58.950  1.00 88.77           C  
ATOM   2311  OD1 ASN A 517      -4.243  36.165  60.073  1.00 92.43           O  
ATOM   2312  ND2 ASN A 517      -3.418  37.258  58.304  1.00 90.81           N  
ATOM   2313  N   PHE A 518      -2.515  31.578  58.334  1.00 92.45           N  
ATOM   2314  CA  PHE A 518      -2.199  30.454  57.446  1.00 94.76           C  
ATOM   2315  C   PHE A 518      -3.412  29.877  56.712  1.00 98.92           C  
ATOM   2316  O   PHE A 518      -4.536  29.888  57.229  1.00101.95           O  
ATOM   2317  CB  PHE A 518      -1.428  29.370  58.195  1.00 93.01           C  
ATOM   2318  CG  PHE A 518      -0.058  29.809  58.655  1.00 93.12           C  
ATOM   2319  CD1 PHE A 518       0.098  30.540  59.834  1.00 92.05           C  
ATOM   2320  CD2 PHE A 518       1.076  29.488  57.913  1.00 91.87           C  
ATOM   2321  CE1 PHE A 518       1.348  30.943  60.256  1.00 90.67           C  
ATOM   2322  CE2 PHE A 518       2.344  29.883  58.331  1.00 88.78           C  
ATOM   2323  CZ  PHE A 518       2.479  30.615  59.497  1.00 91.22           C  
ATOM   2324  N   LEU A 519      -3.167  29.390  55.496  1.00 98.70           N  
ATOM   2325  CA  LEU A 519      -4.188  28.749  54.670  1.00 96.91           C  
ATOM   2326  C   LEU A 519      -3.774  27.336  54.326  1.00 98.00           C  
ATOM   2327  O   LEU A 519      -2.663  26.903  54.635  1.00100.52           O  
ATOM   2328  CB  LEU A 519      -4.347  29.478  53.335  1.00 97.79           C  
ATOM   2329  CG  LEU A 519      -4.357  30.992  53.179  1.00100.88           C  
ATOM   2330  CD1 LEU A 519      -4.474  31.290  51.708  1.00 99.90           C  
ATOM   2331  CD2 LEU A 519      -5.500  31.644  53.958  1.00105.73           C  
ATOM   2332  N   THR A 520      -4.668  26.631  53.647  1.00 96.31           N  
ATOM   2333  CA  THR A 520      -4.319  25.390  52.990  1.00 94.86           C  
ATOM   2334  C   THR A 520      -4.916  25.434  51.600  1.00 97.21           C  
ATOM   2335  O   THR A 520      -6.109  25.690  51.456  1.00102.85           O  
ATOM   2336  CB  THR A 520      -4.866  24.168  53.756  1.00 93.77           C  
ATOM   2337  OG1 THR A 520      -4.371  24.185  55.097  1.00 94.15           O  
ATOM   2338  CG2 THR A 520      -4.430  22.867  53.097  1.00 95.34           C  
ATOM   2339  N   LEU A 521      -4.095  25.220  50.575  1.00 96.06           N  
ATOM   2340  CA  LEU A 521      -4.634  24.907  49.254  1.00 95.61           C  
ATOM   2341  C   LEU A 521      -4.829  23.404  49.182  1.00 96.56           C  
ATOM   2342  O   LEU A 521      -3.882  22.632  49.356  1.00 98.33           O  
ATOM   2343  CB  LEU A 521      -3.726  25.388  48.114  1.00 93.99           C  
ATOM   2344  CG  LEU A 521      -3.882  26.796  47.524  1.00 92.72           C  
ATOM   2345  CD1 LEU A 521      -5.337  27.211  47.387  1.00 94.23           C  
ATOM   2346  CD2 LEU A 521      -3.153  27.796  48.369  1.00 94.58           C  
ATOM   2347  N   GLN A 522      -6.068  22.993  48.956  1.00 96.87           N  
ATOM   2348  CA  GLN A 522      -6.388  21.577  48.845  1.00 99.49           C  
ATOM   2349  C   GLN A 522      -7.074  21.330  47.507  1.00 93.83           C  
ATOM   2350  O   GLN A 522      -7.880  22.146  47.061  1.00 91.62           O  
ATOM   2351  CB  GLN A 522      -7.274  21.151  50.017  1.00100.57           C  
ATOM   2352  CG  GLN A 522      -7.389  19.647  50.232  1.00103.83           C  
ATOM   2353  CD  GLN A 522      -8.336  19.297  51.383  1.00106.43           C  
ATOM   2354  OE1 GLN A 522      -8.406  20.009  52.392  1.00110.72           O  
ATOM   2355  NE2 GLN A 522      -9.063  18.194  51.236  1.00107.03           N  
ATOM   2356  N   GLN A 523      -6.734  20.221  46.857  1.00 91.77           N  
ATOM   2357  CA  GLN A 523      -7.301  19.908  45.537  1.00 89.79           C  
ATOM   2358  C   GLN A 523      -8.344  18.804  45.589  1.00 84.98           C  
ATOM   2359  O   GLN A 523      -8.082  17.711  46.096  1.00 83.03           O  
ATOM   2360  CB  GLN A 523      -6.202  19.530  44.543  1.00 90.58           C  
ATOM   2361  CG  GLN A 523      -6.670  19.426  43.103  1.00 87.72           C  
ATOM   2362  CD  GLN A 523      -5.525  19.322  42.111  1.00 89.55           C  
ATOM   2363  OE1 GLN A 523      -4.455  18.710  42.435  1.00 92.95           O  
ATOM   2364  NE2 GLN A 523      -5.750  19.930  40.888  1.00 90.18           N  
ATOM   2365  N   SER A 524      -9.523  19.104  45.055  1.00 82.40           N  
ATOM   2366  CA  SER A 524     -10.593  18.119  44.911  1.00 81.18           C  
ATOM   2367  C   SER A 524     -10.179  16.994  43.958  1.00 77.08           C  
ATOM   2368  O   SER A 524      -9.880  17.246  42.778  1.00 78.73           O  
ATOM   2369  CB  SER A 524     -11.865  18.794  44.389  1.00 82.35           C  
ATOM   2370  OG  SER A 524     -12.918  17.844  44.179  1.00 84.01           O  
ATOM   2371  N   PRO A 525     -10.184  15.740  44.443  1.00 75.56           N  
ATOM   2372  CA  PRO A 525      -9.787  14.652  43.538  1.00 78.20           C  
ATOM   2373  C   PRO A 525     -10.841  14.472  42.416  1.00 84.93           C  
ATOM   2374  O   PRO A 525     -10.538  13.939  41.319  1.00 87.55           O  
ATOM   2375  CB  PRO A 525      -9.767  13.395  44.445  1.00 77.16           C  
ATOM   2376  CG  PRO A 525      -9.804  13.953  45.848  1.00 76.22           C  
ATOM   2377  CD  PRO A 525     -10.554  15.245  45.787  1.00 76.52           C  
ATOM   2378  N   VAL A 526     -12.070  14.909  42.693  1.00 85.49           N  
ATOM   2379  CA  VAL A 526     -13.154  14.835  41.731  1.00 85.09           C  
ATOM   2380  C   VAL A 526     -13.142  15.989  40.718  1.00 85.53           C  
ATOM   2381  O   VAL A 526     -13.021  15.755  39.468  1.00 91.13           O  
ATOM   2382  CB  VAL A 526     -14.549  14.727  42.415  1.00 87.73           C  
ATOM   2383  CG1 VAL A 526     -15.197  13.365  42.115  1.00 88.77           C  
ATOM   2384  CG2 VAL A 526     -14.450  14.994  43.919  1.00 86.89           C  
ATOM   2385  N   THR A 527     -13.314  17.224  41.240  1.00 84.38           N  
ATOM   2386  CA  THR A 527     -13.501  18.380  40.364  1.00 86.37           C  
ATOM   2387  C   THR A 527     -12.266  19.271  40.318  1.00 90.08           C  
ATOM   2388  O   THR A 527     -12.378  20.493  40.459  1.00 93.13           O  
ATOM   2389  CB  THR A 527     -14.705  19.230  40.826  1.00 86.98           C  
ATOM   2390  OG1 THR A 527     -14.457  19.747  42.142  1.00 87.03           O  
ATOM   2391  CG2 THR A 527     -15.979  18.397  40.845  1.00 89.16           C  
ATOM   2392  N   LYS A 528     -11.108  18.646  40.074  1.00 91.62           N  
ATOM   2393  CA  LYS A 528      -9.756  19.208  40.330  1.00 91.71           C  
ATOM   2394  C   LYS A 528      -9.521  20.705  40.659  1.00 91.82           C  
ATOM   2395  O   LYS A 528      -8.398  21.212  40.489  1.00 91.17           O  
ATOM   2396  CB  LYS A 528      -8.792  18.745  39.232  1.00 92.75           C  
ATOM   2397  CG  LYS A 528      -8.039  17.471  39.581  1.00 92.71           C  
ATOM   2398  CD  LYS A 528      -7.700  16.666  38.285  1.00 95.18           C  
ATOM   2399  CE  LYS A 528      -6.392  15.830  38.581  1.00 94.15           C  
ATOM   2400  NZ  LYS A 528      -6.419  15.220  40.098  1.00 93.71           N  
ATOM   2401  N   GLN A 529     -10.552  21.388  41.161  1.00 92.33           N  
ATOM   2402  CA  GLN A 529     -10.463  22.800  41.548  1.00 95.43           C  
ATOM   2403  C   GLN A 529      -9.787  22.952  42.913  1.00 97.71           C  
ATOM   2404  O   GLN A 529      -9.886  22.063  43.765  1.00 98.71           O  
ATOM   2405  CB  GLN A 529     -11.862  23.420  41.605  1.00 96.80           C  
ATOM   2406  CG  GLN A 529     -11.977  24.798  40.971  1.00 98.59           C  
ATOM   2407  CD  GLN A 529     -12.283  24.732  39.484  1.00100.06           C  
ATOM   2408  OE1 GLN A 529     -13.173  23.996  39.051  1.00 99.69           O  
ATOM   2409  NE2 GLN A 529     -11.549  25.508  38.694  1.00100.86           N  
ATOM   2410  N   TRP A 530      -9.117  24.087  43.119  1.00 97.49           N  
ATOM   2411  CA  TRP A 530      -8.421  24.369  44.373  1.00 96.61           C  
ATOM   2412  C   TRP A 530      -9.267  25.176  45.359  1.00 95.95           C  
ATOM   2413  O   TRP A 530     -10.059  26.037  44.964  1.00 94.45           O  
ATOM   2414  CB  TRP A 530      -7.106  25.095  44.105  1.00 98.75           C  
ATOM   2415  CG  TRP A 530      -6.090  24.269  43.379  1.00 99.40           C  
ATOM   2416  CD1 TRP A 530      -5.883  24.229  42.031  1.00 99.92           C  
ATOM   2417  CD2 TRP A 530      -5.132  23.372  43.961  1.00 98.87           C  
ATOM   2418  NE1 TRP A 530      -4.857  23.362  41.737  1.00100.57           N  
ATOM   2419  CE2 TRP A 530      -4.379  22.822  42.902  1.00 99.01           C  
ATOM   2420  CE3 TRP A 530      -4.844  22.973  45.273  1.00 99.87           C  
ATOM   2421  CZ2 TRP A 530      -3.355  21.891  43.112  1.00 98.21           C  
ATOM   2422  CZ3 TRP A 530      -3.823  22.049  45.481  1.00100.19           C  
ATOM   2423  CH2 TRP A 530      -3.094  21.518  44.403  1.00 99.16           C  
ATOM   2424  N   GLN A 531      -9.073  24.885  46.644  1.00 95.97           N  
ATOM   2425  CA  GLN A 531      -9.824  25.504  47.730  1.00 99.07           C  
ATOM   2426  C   GLN A 531      -8.909  25.915  48.880  1.00101.08           C  
ATOM   2427  O   GLN A 531      -8.013  25.162  49.287  1.00100.67           O  
ATOM   2428  CB  GLN A 531     -10.881  24.534  48.253  1.00102.92           C  
ATOM   2429  CG  GLN A 531     -12.307  24.855  47.826  1.00109.95           C  
ATOM   2430  CD  GLN A 531     -13.066  25.688  48.856  1.00112.63           C  
ATOM   2431  OE1 GLN A 531     -12.482  26.203  49.818  1.00113.86           O  
ATOM   2432  NE2 GLN A 531     -14.378  25.821  48.657  1.00111.60           N  
ATOM   2433  N   GLU A 532      -9.140  27.116  49.400  1.00101.20           N  
ATOM   2434  CA  GLU A 532      -8.407  27.589  50.565  1.00 99.58           C  
ATOM   2435  C   GLU A 532      -9.225  27.352  51.821  1.00 99.48           C  
ATOM   2436  O   GLU A 532     -10.441  27.562  51.832  1.00101.30           O  
ATOM   2437  CB  GLU A 532      -8.002  29.064  50.433  1.00100.17           C  
ATOM   2438  CG  GLU A 532      -9.151  30.055  50.314  1.00103.85           C  
ATOM   2439  CD  GLU A 532      -8.827  31.418  50.907  1.00106.09           C  
ATOM   2440  OE1 GLU A 532      -9.549  32.391  50.591  1.00107.99           O  
ATOM   2441  OE2 GLU A 532      -7.866  31.521  51.698  1.00106.43           O  
ATOM   2442  N   LYS A 533      -8.553  26.882  52.866  1.00 98.74           N  
ATOM   2443  CA  LYS A 533      -9.190  26.615  54.149  1.00 99.69           C  
ATOM   2444  C   LYS A 533      -8.286  27.152  55.248  1.00 98.26           C  
ATOM   2445  O   LYS A 533      -7.129  26.729  55.365  1.00101.37           O  
ATOM   2446  CB  LYS A 533      -9.449  25.113  54.332  1.00101.16           C  
ATOM   2447  CG  LYS A 533     -10.311  24.491  53.233  1.00103.21           C  
ATOM   2448  CD  LYS A 533     -10.627  23.028  53.487  1.00103.73           C  
ATOM   2449  CE  LYS A 533     -11.634  22.517  52.459  1.00107.90           C  
ATOM   2450  NZ  LYS A 533     -12.389  21.316  52.927  1.00110.19           N  
ATOM   2451  N   PRO A 534      -8.795  28.104  56.050  1.00 94.44           N  
ATOM   2452  CA  PRO A 534      -7.952  28.727  57.061  1.00 93.70           C  
ATOM   2453  C   PRO A 534      -7.421  27.722  58.081  1.00 92.93           C  
ATOM   2454  O   PRO A 534      -8.084  26.728  58.367  1.00 91.88           O  
ATOM   2455  CB  PRO A 534      -8.891  29.744  57.729  1.00 91.64           C  
ATOM   2456  CG  PRO A 534     -10.241  29.316  57.391  1.00 90.58           C  
ATOM   2457  CD  PRO A 534     -10.160  28.652  56.064  1.00 92.58           C  
ATOM   2458  N   LEU A 535      -6.213  27.969  58.580  1.00 93.82           N  
ATOM   2459  CA  LEU A 535      -5.672  27.233  59.719  1.00 96.14           C  
ATOM   2460  C   LEU A 535      -5.595  28.201  60.876  1.00 98.30           C  
ATOM   2461  O   LEU A 535      -5.117  29.322  60.711  1.00105.08           O  
ATOM   2462  CB  LEU A 535      -4.256  26.723  59.447  1.00 95.03           C  
ATOM   2463  CG  LEU A 535      -3.919  25.733  58.341  1.00 96.31           C  
ATOM   2464  CD1 LEU A 535      -2.441  25.376  58.463  1.00 97.72           C  
ATOM   2465  CD2 LEU A 535      -4.788  24.479  58.404  1.00 96.94           C  
ATOM   2466  N   CYS A 536      -6.041  27.772  62.049  1.00 96.53           N  
ATOM   2467  CA  CYS A 536      -5.903  28.608  63.227  1.00 96.01           C  
ATOM   2468  C   CYS A 536      -4.638  28.267  64.004  1.00 93.46           C  
ATOM   2469  O   CYS A 536      -4.081  27.173  63.874  1.00 90.65           O  
ATOM   2470  CB  CYS A 536      -7.131  28.517  64.131  1.00 97.97           C  
ATOM   2471  SG  CYS A 536      -7.382  26.891  64.828  1.00102.26           S  
ATOM   2472  N   LEU A 537      -4.189  29.240  64.787  1.00 90.51           N  
ATOM   2473  CA  LEU A 537      -3.136  29.055  65.758  1.00 86.62           C  
ATOM   2474  C   LEU A 537      -3.795  29.247  67.111  1.00 87.67           C  
ATOM   2475  O   LEU A 537      -4.809  29.951  67.219  1.00 88.24           O  
ATOM   2476  CB  LEU A 537      -2.052  30.106  65.554  1.00 85.07           C  
ATOM   2477  CG  LEU A 537      -0.813  29.848  64.698  1.00 87.60           C  
ATOM   2478  CD1 LEU A 537      -0.943  28.643  63.767  1.00 87.81           C  
ATOM   2479  CD2 LEU A 537      -0.425  31.119  63.931  1.00 86.84           C  
ATOM   2480  N   GLY A 538      -3.229  28.623  68.137  1.00 84.29           N  
ATOM   2481  CA  GLY A 538      -3.778  28.712  69.477  1.00 83.63           C  
ATOM   2482  C   GLY A 538      -2.795  28.189  70.495  1.00 87.10           C  
ATOM   2483  O   GLY A 538      -1.997  27.292  70.207  1.00 89.08           O  
ATOM   2484  N   THR A 539      -2.849  28.747  71.697  1.00 90.60           N  
ATOM   2485  CA  THR A 539      -1.861  28.411  72.703  1.00 95.88           C  
ATOM   2486  C   THR A 539      -2.188  27.082  73.389  1.00 93.68           C  
ATOM   2487  O   THR A 539      -3.349  26.804  73.697  1.00 97.87           O  
ATOM   2488  CB  THR A 539      -1.691  29.554  73.733  1.00 98.30           C  
ATOM   2489  OG1 THR A 539      -0.406  29.458  74.344  1.00 99.47           O  
ATOM   2490  CG2 THR A 539      -2.757  29.487  74.825  1.00103.33           C  
ATOM   2491  N   SER A 540      -1.163  26.259  73.587  1.00 89.55           N  
ATOM   2492  CA  SER A 540      -1.248  25.093  74.458  1.00 91.13           C  
ATOM   2493  C   SER A 540       0.099  24.882  75.119  1.00 94.42           C  
ATOM   2494  O   SER A 540       1.046  24.408  74.482  1.00 97.74           O  
ATOM   2495  CB  SER A 540      -1.703  23.842  73.701  1.00 93.00           C  
ATOM   2496  OG  SER A 540      -1.551  23.991  72.303  1.00 98.75           O  
ATOM   2497  N   GLY A 541       0.184  25.266  76.394  1.00 93.13           N  
ATOM   2498  CA  GLY A 541       1.452  25.308  77.107  1.00 92.84           C  
ATOM   2499  C   GLY A 541       2.337  26.393  76.531  1.00 98.30           C  
ATOM   2500  O   GLY A 541       1.869  27.268  75.817  1.00103.79           O  
ATOM   2501  N   SER A 542       3.629  26.334  76.820  1.00100.99           N  
ATOM   2502  CA  SER A 542       4.554  27.358  76.355  1.00100.33           C  
ATOM   2503  C   SER A 542       4.646  27.416  74.826  1.00101.43           C  
ATOM   2504  O   SER A 542       5.442  28.189  74.271  1.00107.92           O  
ATOM   2505  CB  SER A 542       5.942  27.146  76.974  1.00102.39           C  
ATOM   2506  OG  SER A 542       6.747  26.295  76.175  1.00104.27           O  
ATOM   2507  N   CYS A 543       3.853  26.583  74.156  1.00 97.74           N  
ATOM   2508  CA  CYS A 543       3.767  26.583  72.697  1.00 95.08           C  
ATOM   2509  C   CYS A 543       2.531  27.412  72.356  1.00 94.32           C  
ATOM   2510  O   CYS A 543       1.401  27.063  72.723  1.00 91.06           O  
ATOM   2511  CB  CYS A 543       3.693  25.151  72.166  1.00 95.14           C  
ATOM   2512  SG  CYS A 543       3.523  24.983  70.384  1.00 98.54           S  
ATOM   2513  N   ARG A 544       2.760  28.528  71.670  1.00 92.66           N  
ATOM   2514  CA  ARG A 544       1.833  29.660  71.740  1.00 91.86           C  
ATOM   2515  C   ARG A 544       1.064  29.928  70.449  1.00 90.24           C  
ATOM   2516  O   ARG A 544       1.471  29.493  69.380  1.00 93.71           O  
ATOM   2517  CB  ARG A 544       2.594  30.907  72.219  1.00 89.61           C  
ATOM   2518  CG  ARG A 544       3.241  30.721  73.593  1.00 88.57           C  
ATOM   2519  CD  ARG A 544       2.457  31.442  74.655  1.00 96.80           C  
ATOM   2520  NE  ARG A 544       2.558  30.871  76.008  1.00105.20           N  
ATOM   2521  CZ  ARG A 544       3.669  30.816  76.750  1.00110.42           C  
ATOM   2522  NH1 ARG A 544       4.849  31.260  76.286  1.00110.61           N  
ATOM   2523  NH2 ARG A 544       3.593  30.300  77.972  1.00107.49           N  
ATOM   2524  N   GLY A 545      -0.057  30.631  70.560  1.00 88.83           N  
ATOM   2525  CA  GLY A 545      -0.880  30.953  69.395  1.00 90.36           C  
ATOM   2526  C   GLY A 545      -0.411  32.131  68.557  1.00 92.07           C  
ATOM   2527  O   GLY A 545      -1.100  32.553  67.622  1.00 94.80           O  
ATOM   2528  N   TYR A 546       0.770  32.653  68.873  1.00 89.01           N  
ATOM   2529  CA  TYR A 546       1.277  33.856  68.226  1.00 86.09           C  
ATOM   2530  C   TYR A 546       2.796  33.822  68.202  1.00 86.07           C  
ATOM   2531  O   TYR A 546       3.416  33.014  68.881  1.00 87.63           O  
ATOM   2532  CB  TYR A 546       0.802  35.098  68.988  1.00 83.78           C  
ATOM   2533  CG  TYR A 546       1.182  35.056  70.452  1.00 84.58           C  
ATOM   2534  CD1 TYR A 546       0.298  34.578  71.407  1.00 85.84           C  
ATOM   2535  CD2 TYR A 546       2.438  35.464  70.877  1.00 83.97           C  
ATOM   2536  CE1 TYR A 546       0.657  34.514  72.746  1.00 85.87           C  
ATOM   2537  CE2 TYR A 546       2.797  35.412  72.209  1.00 83.03           C  
ATOM   2538  CZ  TYR A 546       1.913  34.930  73.136  1.00 83.99           C  
ATOM   2539  OH  TYR A 546       2.281  34.882  74.460  1.00 85.10           O  
ATOM   2540  N   PHE A 547       3.382  34.716  67.419  1.00 87.12           N  
ATOM   2541  CA  PHE A 547       4.818  34.942  67.399  1.00 87.62           C  
ATOM   2542  C   PHE A 547       5.037  36.435  67.260  1.00 89.58           C  
ATOM   2543  O   PHE A 547       4.084  37.192  67.023  1.00 88.77           O  
ATOM   2544  CB  PHE A 547       5.454  34.213  66.225  1.00 89.32           C  
ATOM   2545  CG  PHE A 547       4.798  34.501  64.920  1.00 90.23           C  
ATOM   2546  CD1 PHE A 547       3.608  33.859  64.571  1.00 89.83           C  
ATOM   2547  CD2 PHE A 547       5.360  35.419  64.038  1.00 90.94           C  
ATOM   2548  CE1 PHE A 547       2.989  34.132  63.365  1.00 92.54           C  
ATOM   2549  CE2 PHE A 547       4.754  35.700  62.820  1.00 92.38           C  
ATOM   2550  CZ  PHE A 547       3.563  35.059  62.482  1.00 93.74           C  
ATOM   2551  N   SER A 548       6.283  36.874  67.396  1.00 88.95           N  
ATOM   2552  CA  SER A 548       6.541  38.306  67.308  1.00 87.61           C  
ATOM   2553  C   SER A 548       7.005  38.739  65.917  1.00 86.36           C  
ATOM   2554  O   SER A 548       7.624  37.958  65.184  1.00 85.94           O  
ATOM   2555  CB  SER A 548       7.498  38.752  68.402  1.00 84.30           C  
ATOM   2556  OG  SER A 548       8.463  37.758  68.604  1.00 87.26           O  
ATOM   2557  N   GLY A 549       6.668  39.976  65.555  1.00 83.48           N  
ATOM   2558  CA  GLY A 549       7.084  40.546  64.276  1.00 87.65           C  
ATOM   2559  C   GLY A 549       6.341  40.026  63.054  1.00 89.12           C  
ATOM   2560  O   GLY A 549       5.196  39.599  63.152  1.00 91.66           O  
ATOM   2561  N   HIS A 550       7.004  40.076  61.903  1.00 89.19           N  
ATOM   2562  CA  HIS A 550       6.413  39.717  60.621  1.00 89.49           C  
ATOM   2563  C   HIS A 550       7.178  38.577  59.972  1.00 91.39           C  
ATOM   2564  O   HIS A 550       8.404  38.478  60.096  1.00 91.54           O  
ATOM   2565  CB  HIS A 550       6.451  40.905  59.673  1.00 92.91           C  
ATOM   2566  CG  HIS A 550       5.772  42.128  60.198  1.00 99.00           C  
ATOM   2567  ND1 HIS A 550       4.399  42.243  60.270  1.00101.01           N  
ATOM   2568  CD2 HIS A 550       6.275  43.302  60.651  1.00 99.66           C  
ATOM   2569  CE1 HIS A 550       4.087  43.431  60.759  1.00102.96           C  
ATOM   2570  NE2 HIS A 550       5.207  44.094  60.995  1.00101.49           N  
ATOM   2571  N   ILE A 551       6.458  37.721  59.261  1.00 90.95           N  
ATOM   2572  CA  ILE A 551       7.092  36.607  58.571  1.00 90.34           C  
ATOM   2573  C   ILE A 551       7.879  37.127  57.364  1.00 90.68           C  
ATOM   2574  O   ILE A 551       7.374  37.946  56.581  1.00 92.40           O  
ATOM   2575  CB  ILE A 551       6.052  35.539  58.160  1.00 88.24           C  
ATOM   2576  CG1 ILE A 551       5.532  34.806  59.401  1.00 88.56           C  
ATOM   2577  CG2 ILE A 551       6.636  34.558  57.146  1.00 85.95           C  
ATOM   2578  CD1 ILE A 551       4.319  33.875  59.129  1.00 91.31           C  
ATOM   2579  N   LEU A 552       9.119  36.663  57.231  1.00 86.39           N  
ATOM   2580  CA  LEU A 552       9.928  36.993  56.066  1.00 84.73           C  
ATOM   2581  C   LEU A 552      10.195  35.784  55.171  1.00 88.82           C  
ATOM   2582  O   LEU A 552      10.419  35.939  53.968  1.00 92.43           O  
ATOM   2583  CB  LEU A 552      11.244  37.654  56.481  1.00 83.51           C  
ATOM   2584  CG  LEU A 552      11.188  38.895  57.382  1.00 82.81           C  
ATOM   2585  CD1 LEU A 552      12.589  39.377  57.717  1.00 82.63           C  
ATOM   2586  CD2 LEU A 552      10.370  40.012  56.779  1.00 80.15           C  
ATOM   2587  N   GLY A 553      10.172  34.586  55.756  1.00 89.87           N  
ATOM   2588  CA  GLY A 553      10.440  33.354  55.018  1.00 87.49           C  
ATOM   2589  C   GLY A 553      10.073  32.119  55.811  1.00 89.11           C  
ATOM   2590  O   GLY A 553       9.425  32.218  56.847  1.00 91.01           O  
ATOM   2591  N   PHE A 554      10.508  30.958  55.328  1.00 90.50           N  
ATOM   2592  CA  PHE A 554      10.094  29.663  55.867  1.00 91.87           C  
ATOM   2593  C   PHE A 554      11.273  28.698  55.928  1.00 96.55           C  
ATOM   2594  O   PHE A 554      12.298  28.924  55.278  1.00 99.99           O  
ATOM   2595  CB  PHE A 554       9.002  29.054  54.989  1.00 92.41           C  
ATOM   2596  CG  PHE A 554       7.704  29.820  54.993  1.00 95.24           C  
ATOM   2597  CD1 PHE A 554       7.323  30.576  53.883  1.00 96.54           C  
ATOM   2598  CD2 PHE A 554       6.847  29.770  56.095  1.00 96.42           C  
ATOM   2599  CE1 PHE A 554       6.105  31.282  53.870  1.00 96.23           C  
ATOM   2600  CE2 PHE A 554       5.629  30.475  56.093  1.00 96.56           C  
ATOM   2601  CZ  PHE A 554       5.259  31.231  54.977  1.00 94.55           C  
ATOM   2602  N   GLY A 555      11.126  27.618  56.694  1.00 98.45           N  
ATOM   2603  CA  GLY A 555      12.212  26.655  56.876  1.00102.87           C  
ATOM   2604  C   GLY A 555      11.770  25.202  56.931  1.00107.79           C  
ATOM   2605  O   GLY A 555      10.598  24.925  57.172  1.00109.35           O  
ATOM   2606  N   GLU A 556      12.715  24.279  56.714  1.00108.84           N  
ATOM   2607  CA  GLU A 556      12.451  22.837  56.806  1.00108.50           C  
ATOM   2608  C   GLU A 556      13.616  22.010  57.391  1.00106.72           C  
ATOM   2609  O   GLU A 556      14.765  22.171  56.984  1.00104.01           O  
ATOM   2610  CB  GLU A 556      12.057  22.287  55.436  1.00108.93           C  
ATOM   2611  CG  GLU A 556      11.715  20.810  55.450  1.00111.30           C  
ATOM   2612  CD  GLU A 556      11.518  20.215  54.067  1.00112.59           C  
ATOM   2613  OE1 GLU A 556      11.256  18.995  53.992  1.00116.22           O  
ATOM   2614  OE2 GLU A 556      11.625  20.947  53.061  1.00112.83           O  
ATOM   2615  N   ASP A 557      13.281  21.136  58.344  1.00107.07           N  
ATOM   2616  CA  ASP A 557      14.168  20.110  58.910  1.00104.11           C  
ATOM   2617  C   ASP A 557      14.537  19.072  57.886  1.00105.18           C  
ATOM   2618  O   ASP A 557      13.821  18.878  56.901  1.00105.10           O  
ATOM   2619  CB  ASP A 557      13.426  19.328  59.997  1.00106.38           C  
ATOM   2620  CG  ASP A 557      13.428  20.019  61.317  1.00111.60           C  
ATOM   2621  OD1 ASP A 557      14.085  21.064  61.410  1.00119.82           O  
ATOM   2622  OD2 ASP A 557      12.791  19.524  62.273  1.00111.15           O  
ATOM   2623  N   GLU A 558      15.625  18.354  58.152  1.00105.21           N  
ATOM   2624  CA  GLU A 558      15.903  17.105  57.443  1.00102.97           C  
ATOM   2625  C   GLU A 558      14.804  16.088  57.752  1.00100.21           C  
ATOM   2626  O   GLU A 558      14.511  15.209  56.944  1.00102.77           O  
ATOM   2627  CB  GLU A 558      17.278  16.553  57.817  1.00103.72           C  
ATOM   2628  CG  GLU A 558      17.777  15.486  56.865  1.00108.83           C  
ATOM   2629  CD  GLU A 558      19.290  15.366  56.821  1.00113.61           C  
ATOM   2630  OE1 GLU A 558      19.786  14.417  56.170  1.00114.88           O  
ATOM   2631  OE2 GLU A 558      19.982  16.216  57.423  1.00115.33           O  
ATOM   2632  N   LEU A 559      14.198  16.229  58.926  1.00 96.94           N  
ATOM   2633  CA  LEU A 559      13.055  15.426  59.333  1.00 95.17           C  
ATOM   2634  C   LEU A 559      11.743  15.964  58.753  1.00 95.89           C  
ATOM   2635  O   LEU A 559      10.690  15.339  58.892  1.00 96.84           O  
ATOM   2636  CB  LEU A 559      12.965  15.382  60.858  1.00 94.86           C  
ATOM   2637  CG  LEU A 559      14.158  14.817  61.628  1.00 94.29           C  
ATOM   2638  CD1 LEU A 559      14.052  15.196  63.091  1.00 96.64           C  
ATOM   2639  CD2 LEU A 559      14.229  13.321  61.477  1.00 95.73           C  
ATOM   2640  N   GLY A 560      11.800  17.125  58.110  1.00 94.79           N  
ATOM   2641  CA  GLY A 560      10.632  17.664  57.430  1.00 94.56           C  
ATOM   2642  C   GLY A 560       9.730  18.586  58.239  1.00 96.22           C  
ATOM   2643  O   GLY A 560       8.707  19.042  57.726  1.00 99.36           O  
ATOM   2644  N   GLU A 561      10.085  18.878  59.489  1.00 91.33           N  
ATOM   2645  CA  GLU A 561       9.297  19.831  60.262  1.00 90.31           C  
ATOM   2646  C   GLU A 561       9.511  21.241  59.721  1.00 91.78           C  
ATOM   2647  O   GLU A 561      10.539  21.518  59.101  1.00 89.88           O  
ATOM   2648  CB  GLU A 561       9.608  19.748  61.758  1.00 90.19           C  
ATOM   2649  CG  GLU A 561       9.568  18.344  62.356  1.00 90.86           C  
ATOM   2650  CD  GLU A 561       8.268  17.584  62.085  1.00 96.74           C  
ATOM   2651  OE1 GLU A 561       7.264  18.207  61.655  1.00 99.03           O  
ATOM   2652  OE2 GLU A 561       8.253  16.349  62.317  1.00 97.77           O  
ATOM   2653  N   VAL A 562       8.536  22.124  59.943  1.00 94.82           N  
ATOM   2654  CA  VAL A 562       8.526  23.432  59.273  1.00 94.85           C  
ATOM   2655  C   VAL A 562       8.644  24.619  60.230  1.00 96.57           C  
ATOM   2656  O   VAL A 562       8.115  24.594  61.343  1.00101.04           O  
ATOM   2657  CB  VAL A 562       7.293  23.608  58.361  1.00 95.17           C  
ATOM   2658  CG1 VAL A 562       7.580  24.649  57.312  1.00100.75           C  
ATOM   2659  CG2 VAL A 562       6.958  22.325  57.654  1.00 92.30           C  
ATOM   2660  N   TYR A 563       9.344  25.660  59.783  1.00 95.95           N  
ATOM   2661  CA  TYR A 563       9.632  26.825  60.619  1.00 93.45           C  
ATOM   2662  C   TYR A 563       9.202  28.098  59.935  1.00 92.92           C  
ATOM   2663  O   TYR A 563       9.092  28.138  58.714  1.00 90.20           O  
ATOM   2664  CB  TYR A 563      11.130  26.932  60.875  1.00 93.14           C  
ATOM   2665  CG  TYR A 563      11.739  25.723  61.518  1.00 92.72           C  
ATOM   2666  CD1 TYR A 563      12.049  25.726  62.866  1.00 95.19           C  
ATOM   2667  CD2 TYR A 563      12.011  24.577  60.778  1.00 91.01           C  
ATOM   2668  CE1 TYR A 563      12.615  24.618  63.470  1.00 94.96           C  
ATOM   2669  CE2 TYR A 563      12.560  23.464  61.373  1.00 91.84           C  
ATOM   2670  CZ  TYR A 563      12.867  23.491  62.721  1.00 92.42           C  
ATOM   2671  OH  TYR A 563      13.425  22.396  63.335  1.00 92.16           O  
ATOM   2672  N   ILE A 564       8.962  29.143  60.725  1.00 96.78           N  
ATOM   2673  CA  ILE A 564       8.831  30.492  60.166  1.00 98.60           C  
ATOM   2674  C   ILE A 564       9.930  31.376  60.708  1.00 97.18           C  
ATOM   2675  O   ILE A 564      10.357  31.222  61.857  1.00 96.22           O  
ATOM   2676  CB  ILE A 564       7.451  31.143  60.401  1.00100.69           C  
ATOM   2677  CG1 ILE A 564       7.216  31.418  61.878  1.00103.88           C  
ATOM   2678  CG2 ILE A 564       6.336  30.273  59.814  1.00104.78           C  
ATOM   2679  CD1 ILE A 564       5.966  32.236  62.148  1.00109.18           C  
ATOM   2680  N   LEU A 565      10.404  32.281  59.859  1.00 97.16           N  
ATOM   2681  CA  LEU A 565      11.453  33.209  60.239  1.00 96.90           C  
ATOM   2682  C   LEU A 565      10.856  34.598  60.229  1.00 97.55           C  
ATOM   2683  O   LEU A 565      10.307  35.038  59.211  1.00100.26           O  
ATOM   2684  CB  LEU A 565      12.662  33.093  59.309  1.00 94.28           C  
ATOM   2685  CG  LEU A 565      13.306  31.707  59.383  1.00 95.96           C  
ATOM   2686  CD1 LEU A 565      12.978  30.884  58.162  1.00 94.81           C  
ATOM   2687  CD2 LEU A 565      14.791  31.796  59.542  1.00 97.68           C  
ATOM   2688  N   SER A 566      10.931  35.268  61.377  1.00 93.63           N  
ATOM   2689  CA  SER A 566      10.279  36.555  61.538  1.00 95.04           C  
ATOM   2690  C   SER A 566      11.242  37.670  61.914  1.00 96.79           C  
ATOM   2691  O   SER A 566      12.355  37.410  62.381  1.00 96.27           O  
ATOM   2692  CB  SER A 566       9.175  36.463  62.589  1.00 92.54           C  
ATOM   2693  OG  SER A 566       9.726  36.298  63.878  1.00 91.32           O  
ATOM   2694  N   SER A 567      10.788  38.905  61.701  1.00 96.71           N  
ATOM   2695  CA  SER A 567      11.474  40.105  62.151  1.00 98.60           C  
ATOM   2696  C   SER A 567      10.501  41.278  62.177  1.00102.90           C  
ATOM   2697  O   SER A 567       9.325  41.123  61.868  1.00101.51           O  
ATOM   2698  CB  SER A 567      12.651  40.426  61.233  1.00 99.50           C  
ATOM   2699  OG  SER A 567      13.461  41.433  61.810  1.00104.48           O  
ATOM   2700  N   SER A 568      11.001  42.451  62.555  1.00112.17           N  
ATOM   2701  CA  SER A 568      10.251  43.710  62.458  1.00118.37           C  
ATOM   2702  C   SER A 568      11.237  44.872  62.405  1.00122.09           C  
ATOM   2703  O   SER A 568      12.418  44.690  62.685  1.00121.72           O  
ATOM   2704  CB  SER A 568       9.281  43.877  63.637  1.00118.42           C  
ATOM   2705  OG  SER A 568       9.961  44.225  64.831  1.00119.33           O  
ATOM   2706  N   LYS A 569      10.751  46.059  62.043  1.00127.97           N  
ATOM   2707  CA  LYS A 569      11.571  47.278  62.056  1.00130.68           C  
ATOM   2708  C   LYS A 569      12.149  47.526  63.448  1.00133.64           C  
ATOM   2709  O   LYS A 569      13.238  48.088  63.583  1.00134.93           O  
ATOM   2710  CB  LYS A 569      10.754  48.494  61.614  1.00129.20           C  
ATOM   2711  CG  LYS A 569      10.349  48.489  60.153  1.00129.02           C  
ATOM   2712  CD  LYS A 569       9.420  49.658  59.849  1.00129.13           C  
ATOM   2713  CE  LYS A 569       9.053  49.709  58.373  1.00129.12           C  
ATOM   2714  NZ  LYS A 569       8.099  50.814  58.082  1.00129.15           N  
ATOM   2715  N   SER A 570      11.408  47.103  64.473  1.00135.58           N  
ATOM   2716  CA  SER A 570      11.854  47.206  65.858  1.00138.32           C  
ATOM   2717  C   SER A 570      12.946  46.191  66.169  1.00141.63           C  
ATOM   2718  O   SER A 570      13.946  46.530  66.809  1.00141.61           O  
ATOM   2719  CB  SER A 570      10.681  47.019  66.822  1.00137.68           C  
ATOM   2720  OG  SER A 570      11.138  46.966  68.164  1.00136.96           O  
ATOM   2721  N   MET A 571      12.746  44.952  65.716  1.00145.69           N  
ATOM   2722  CA  MET A 571      13.702  43.863  65.954  1.00149.21           C  
ATOM   2723  C   MET A 571      14.688  43.630  64.787  1.00150.40           C  
ATOM   2724  O   MET A 571      15.351  42.590  64.711  1.00151.13           O  
ATOM   2725  CB  MET A 571      12.977  42.571  66.379  1.00149.96           C  
ATOM   2726  CG  MET A 571      12.019  41.981  65.343  1.00150.70           C  
ATOM   2727  SD  MET A 571      10.917  40.660  65.929  1.00150.89           S  
ATOM   2728  CE  MET A 571      10.081  41.474  67.295  1.00150.87           C  
ATOM   2729  N   THR A 572      14.773  44.608  63.886  1.00150.25           N  
ATOM   2730  CA  THR A 572      15.824  44.652  62.870  1.00149.31           C  
ATOM   2731  C   THR A 572      16.926  45.571  63.390  1.00147.50           C  
ATOM   2732  O   THR A 572      18.106  45.215  63.365  1.00148.20           O  
ATOM   2733  CB  THR A 572      15.288  45.149  61.493  1.00150.06           C  
ATOM   2734  OG1 THR A 572      14.384  44.177  60.948  1.00149.98           O  
ATOM   2735  CG2 THR A 572      16.428  45.385  60.496  1.00149.55           C  
ATOM   2736  N   GLN A 573      16.519  46.739  63.889  1.00145.07           N  
ATOM   2737  CA  GLN A 573      17.432  47.741  64.447  1.00142.66           C  
ATOM   2738  C   GLN A 573      18.294  47.211  65.594  1.00140.42           C  
ATOM   2739  O   GLN A 573      19.347  47.778  65.899  1.00140.78           O  
ATOM   2740  CB  GLN A 573      16.649  48.979  64.913  1.00141.96           C  
ATOM   2741  CG  GLN A 573      16.046  49.809  63.782  1.00141.90           C  
ATOM   2742  CD  GLN A 573      17.089  50.308  62.792  1.00142.29           C  
ATOM   2743  OE1 GLN A 573      17.997  51.057  63.152  1.00142.74           O  
ATOM   2744  NE2 GLN A 573      16.958  49.893  61.538  1.00141.87           N  
ATOM   2745  N   THR A 574      17.842  46.128  66.221  1.00137.03           N  
ATOM   2746  CA  THR A 574      18.553  45.527  67.348  1.00134.88           C  
ATOM   2747  C   THR A 574      19.186  44.166  67.018  1.00132.34           C  
ATOM   2748  O   THR A 574      19.817  43.555  67.884  1.00134.05           O  
ATOM   2749  CB  THR A 574      17.647  45.438  68.624  1.00135.46           C  
ATOM   2750  OG1 THR A 574      18.362  44.798  69.687  1.00136.54           O  
ATOM   2751  CG2 THR A 574      16.370  44.661  68.355  1.00135.59           C  
ATOM   2752  N   HIS A 575      19.037  43.716  65.768  1.00128.07           N  
ATOM   2753  CA  HIS A 575      19.452  42.368  65.339  1.00124.16           C  
ATOM   2754  C   HIS A 575      18.700  41.264  66.091  1.00119.26           C  
ATOM   2755  O   HIS A 575      19.325  40.393  66.693  1.00119.66           O  
ATOM   2756  CB  HIS A 575      20.964  42.158  65.509  1.00127.69           C  
ATOM   2757  CG  HIS A 575      21.788  42.686  64.377  1.00133.02           C  
ATOM   2758  ND1 HIS A 575      22.167  44.009  64.281  1.00134.97           N  
ATOM   2759  CD2 HIS A 575      22.328  42.062  63.304  1.00134.04           C  
ATOM   2760  CE1 HIS A 575      22.892  44.180  63.189  1.00134.42           C  
ATOM   2761  NE2 HIS A 575      23.004  43.013  62.577  1.00134.86           N  
ATOM   2762  N   ASN A 576      17.369  41.295  66.057  1.00112.52           N  
ATOM   2763  CA  ASN A 576      16.574  40.291  66.762  1.00107.40           C  
ATOM   2764  C   ASN A 576      15.552  39.544  65.879  1.00100.93           C  
ATOM   2765  O   ASN A 576      14.360  39.514  66.171  1.00 97.54           O  
ATOM   2766  CB  ASN A 576      15.906  40.914  67.994  1.00112.31           C  
ATOM   2767  CG  ASN A 576      15.572  39.886  69.075  1.00116.91           C  
ATOM   2768  OD1 ASN A 576      15.548  38.680  68.829  1.00119.98           O  
ATOM   2769  ND2 ASN A 576      15.304  40.372  70.281  1.00118.69           N  
ATOM   2770  N   GLY A 577      16.039  38.938  64.800  1.00 95.80           N  
ATOM   2771  CA  GLY A 577      15.243  38.013  64.003  1.00 91.83           C  
ATOM   2772  C   GLY A 577      15.100  36.691  64.734  1.00 90.68           C  
ATOM   2773  O   GLY A 577      16.007  36.284  65.450  1.00 90.51           O  
ATOM   2774  N   LYS A 578      13.966  36.019  64.541  1.00 88.94           N  
ATOM   2775  CA  LYS A 578      13.615  34.822  65.303  1.00 86.94           C  
ATOM   2776  C   LYS A 578      13.385  33.639  64.385  1.00 88.99           C  
ATOM   2777  O   LYS A 578      12.865  33.807  63.272  1.00 91.27           O  
ATOM   2778  CB  LYS A 578      12.309  35.052  66.069  1.00 90.28           C  
ATOM   2779  CG  LYS A 578      12.287  36.228  67.031  1.00 91.21           C  
ATOM   2780  CD  LYS A 578      12.315  35.728  68.451  1.00 92.55           C  
ATOM   2781  CE  LYS A 578      11.587  36.667  69.379  1.00 93.03           C  
ATOM   2782  NZ  LYS A 578      12.337  37.931  69.540  1.00 98.24           N  
ATOM   2783  N   LEU A 579      13.758  32.446  64.854  1.00 89.00           N  
ATOM   2784  CA  LEU A 579      13.335  31.194  64.223  1.00 87.67           C  
ATOM   2785  C   LEU A 579      12.269  30.566  65.099  1.00 90.12           C  
ATOM   2786  O   LEU A 579      12.503  30.304  66.287  1.00 90.33           O  
ATOM   2787  CB  LEU A 579      14.499  30.206  64.048  1.00 88.35           C  
ATOM   2788  CG  LEU A 579      14.164  28.842  63.395  1.00 88.60           C  
ATOM   2789  CD1 LEU A 579      14.090  28.911  61.871  1.00 85.89           C  
ATOM   2790  CD2 LEU A 579      15.157  27.768  63.790  1.00 87.30           C  
ATOM   2791  N   TYR A 580      11.102  30.335  64.502  1.00 91.36           N  
ATOM   2792  CA  TYR A 580       9.966  29.712  65.176  1.00 90.92           C  
ATOM   2793  C   TYR A 580       9.587  28.411  64.478  1.00 93.00           C  
ATOM   2794  O   TYR A 580       9.467  28.374  63.248  1.00 94.05           O  
ATOM   2795  CB  TYR A 580       8.754  30.627  65.101  1.00 90.14           C  
ATOM   2796  CG  TYR A 580       8.721  31.795  66.044  1.00 89.34           C  
ATOM   2797  CD1 TYR A 580       8.877  33.093  65.569  1.00 89.53           C  
ATOM   2798  CD2 TYR A 580       8.481  31.613  67.410  1.00 88.19           C  
ATOM   2799  CE1 TYR A 580       8.825  34.188  66.438  1.00 90.49           C  
ATOM   2800  CE2 TYR A 580       8.418  32.695  68.282  1.00 86.57           C  
ATOM   2801  CZ  TYR A 580       8.586  33.979  67.785  1.00 89.03           C  
ATOM   2802  OH  TYR A 580       8.520  35.053  68.632  1.00 90.10           O  
ATOM   2803  N   LYS A 581       9.361  27.355  65.256  1.00 94.35           N  
ATOM   2804  CA  LYS A 581       8.920  26.078  64.692  1.00 94.59           C  
ATOM   2805  C   LYS A 581       7.405  25.909  64.829  1.00 92.00           C  
ATOM   2806  O   LYS A 581       6.837  26.288  65.864  1.00 89.80           O  
ATOM   2807  CB  LYS A 581       9.642  24.907  65.358  1.00 94.29           C  
ATOM   2808  CG  LYS A 581       9.468  23.601  64.594  1.00 94.24           C  
ATOM   2809  CD  LYS A 581       9.528  22.380  65.486  1.00 93.78           C  
ATOM   2810  CE  LYS A 581      10.928  21.856  65.586  1.00 96.76           C  
ATOM   2811  NZ  LYS A 581      10.928  20.406  65.260  1.00103.79           N  
ATOM   2812  N   ILE A 582       6.771  25.352  63.788  1.00 87.18           N  
ATOM   2813  CA  ILE A 582       5.328  25.043  63.802  1.00 88.30           C  
ATOM   2814  C   ILE A 582       5.078  23.655  64.400  1.00 90.97           C  
ATOM   2815  O   ILE A 582       5.738  22.688  64.023  1.00 95.31           O  
ATOM   2816  CB  ILE A 582       4.683  25.140  62.388  1.00 85.93           C  
ATOM   2817  CG1 ILE A 582       4.614  26.595  61.930  1.00 84.36           C  
ATOM   2818  CG2 ILE A 582       3.271  24.494  62.355  1.00 84.99           C  
ATOM   2819  CD1 ILE A 582       3.909  26.799  60.611  1.00 85.96           C  
ATOM   2820  N   VAL A 583       4.116  23.569  65.318  1.00 89.04           N  
ATOM   2821  CA  VAL A 583       3.884  22.363  66.113  1.00 91.60           C  
ATOM   2822  C   VAL A 583       2.416  21.909  66.092  1.00 92.32           C  
ATOM   2823  O   VAL A 583       1.488  22.734  66.105  1.00 94.57           O  
ATOM   2824  CB  VAL A 583       4.356  22.589  67.586  1.00 93.93           C  
ATOM   2825  CG1 VAL A 583       4.007  21.409  68.481  1.00 96.40           C  
ATOM   2826  CG2 VAL A 583       5.849  22.825  67.635  1.00 94.81           C  
ATOM   2827  N   ASP A 584       2.211  20.594  66.059  1.00 89.16           N  
ATOM   2828  CA  ASP A 584       0.872  20.016  66.197  1.00 86.90           C  
ATOM   2829  C   ASP A 584       0.666  19.508  67.634  1.00 83.83           C  
ATOM   2830  O   ASP A 584       1.217  18.467  68.018  1.00 80.66           O  
ATOM   2831  CB  ASP A 584       0.677  18.892  65.180  1.00 87.73           C  
ATOM   2832  CG  ASP A 584      -0.752  18.406  65.101  1.00 90.80           C  
ATOM   2833  OD1 ASP A 584      -1.024  17.511  64.275  1.00 92.75           O  
ATOM   2834  OD2 ASP A 584      -1.608  18.903  65.857  1.00 96.14           O  
ATOM   2835  N   PRO A 585      -0.131  20.242  68.435  1.00 82.07           N  
ATOM   2836  CA  PRO A 585      -0.237  19.901  69.856  1.00 85.36           C  
ATOM   2837  C   PRO A 585      -1.017  18.609  70.057  1.00 91.79           C  
ATOM   2838  O   PRO A 585      -0.917  17.984  71.119  1.00 95.72           O  
ATOM   2839  CB  PRO A 585      -1.001  21.086  70.477  1.00 81.17           C  
ATOM   2840  CG  PRO A 585      -1.326  22.016  69.380  1.00 81.87           C  
ATOM   2841  CD  PRO A 585      -0.987  21.380  68.061  1.00 81.29           C  
ATOM   2842  N   LYS A 586      -1.780  18.218  69.037  1.00 91.89           N  
ATOM   2843  CA  LYS A 586      -2.562  16.995  69.081  1.00 92.79           C  
ATOM   2844  C   LYS A 586      -1.685  15.741  69.054  1.00 87.88           C  
ATOM   2845  O   LYS A 586      -2.111  14.680  69.494  1.00 90.81           O  
ATOM   2846  CB  LYS A 586      -3.634  16.993  67.979  1.00 95.52           C  
ATOM   2847  CG  LYS A 586      -5.012  17.502  68.476  1.00 99.56           C  
ATOM   2848  CD  LYS A 586      -5.960  17.924  67.339  1.00 99.28           C  
ATOM   2849  CE  LYS A 586      -6.809  16.772  66.795  1.00101.89           C  
ATOM   2850  NZ  LYS A 586      -8.091  16.582  67.530  1.00103.31           N  
ATOM   2851  N   ARG A 587      -0.456  15.872  68.570  1.00 85.09           N  
ATOM   2852  CA  ARG A 587       0.500  14.764  68.581  1.00 84.77           C  
ATOM   2853  C   ARG A 587       1.639  15.007  69.572  1.00 87.02           C  
ATOM   2854  O   ARG A 587       1.891  16.150  69.961  1.00 88.54           O  
ATOM   2855  CB  ARG A 587       1.086  14.534  67.186  1.00 82.07           C  
ATOM   2856  CG  ARG A 587       0.102  14.038  66.164  1.00 83.57           C  
ATOM   2857  CD  ARG A 587       0.818  13.325  65.047  1.00 86.41           C  
ATOM   2858  NE  ARG A 587       1.119  11.930  65.369  1.00 88.50           N  
ATOM   2859  CZ  ARG A 587       2.081  11.209  64.794  1.00 89.29           C  
ATOM   2860  NH1 ARG A 587       2.870  11.741  63.869  1.00 89.96           N  
ATOM   2861  NH2 ARG A 587       2.261   9.947  65.153  1.00 89.53           N  
ATOM   2862  N   PRO A 588       2.345  13.931  69.977  1.00 87.91           N  
ATOM   2863  CA  PRO A 588       3.524  14.094  70.821  1.00 88.09           C  
ATOM   2864  C   PRO A 588       4.657  14.746  70.046  1.00 86.89           C  
ATOM   2865  O   PRO A 588       4.651  14.725  68.819  1.00 86.89           O  
ATOM   2866  CB  PRO A 588       3.903  12.647  71.175  1.00 85.83           C  
ATOM   2867  CG  PRO A 588       2.713  11.839  70.859  1.00 83.17           C  
ATOM   2868  CD  PRO A 588       2.097  12.509  69.691  1.00 85.55           C  
ATOM   2869  N   LEU A 589       5.626  15.311  70.753  1.00 88.20           N  
ATOM   2870  CA  LEU A 589       6.779  15.897  70.081  1.00 91.89           C  
ATOM   2871  C   LEU A 589       7.643  14.836  69.411  1.00 94.93           C  
ATOM   2872  O   LEU A 589       8.249  15.090  68.374  1.00100.17           O  
ATOM   2873  CB  LEU A 589       7.602  16.751  71.040  1.00 90.56           C  
ATOM   2874  CG  LEU A 589       6.932  18.056  71.470  1.00 89.39           C  
ATOM   2875  CD1 LEU A 589       7.794  18.750  72.479  1.00 86.83           C  
ATOM   2876  CD2 LEU A 589       6.661  18.961  70.270  1.00 88.03           C  
ATOM   2877  N   MET A 590       7.691  13.645  69.997  1.00 95.30           N  
ATOM   2878  CA  MET A 590       8.430  12.546  69.395  1.00 94.16           C  
ATOM   2879  C   MET A 590       7.570  11.308  69.285  1.00 92.88           C  
ATOM   2880  O   MET A 590       7.662  10.414  70.121  1.00 93.59           O  
ATOM   2881  CB  MET A 590       9.721  12.242  70.167  1.00 94.31           C  
ATOM   2882  CG  MET A 590      10.765  11.447  69.372  1.00 92.02           C  
ATOM   2883  SD  MET A 590      11.015  12.007  67.669  1.00 91.30           S  
ATOM   2884  CE  MET A 590      11.418  13.745  67.867  1.00 88.51           C  
ATOM   2885  N   PRO A 591       6.718  11.257  68.250  1.00 92.73           N  
ATOM   2886  CA  PRO A 591       5.995  10.032  67.960  1.00 92.51           C  
ATOM   2887  C   PRO A 591       6.995   8.929  67.666  1.00 94.42           C  
ATOM   2888  O   PRO A 591       8.063   9.212  67.106  1.00 93.49           O  
ATOM   2889  CB  PRO A 591       5.212  10.382  66.696  1.00 91.56           C  
ATOM   2890  CG  PRO A 591       5.075  11.856  66.733  1.00 93.72           C  
ATOM   2891  CD  PRO A 591       6.371  12.332  67.305  1.00 93.61           C  
ATOM   2892  N   GLU A 592       6.660   7.697  68.060  1.00 95.48           N  
ATOM   2893  CA  GLU A 592       7.523   6.535  67.835  1.00 96.38           C  
ATOM   2894  C   GLU A 592       8.130   6.545  66.434  1.00 93.60           C  
ATOM   2895  O   GLU A 592       9.342   6.403  66.282  1.00 92.64           O  
ATOM   2896  CB  GLU A 592       6.750   5.231  68.052  1.00 99.02           C  
ATOM   2897  CG  GLU A 592       6.779   4.676  69.474  1.00100.75           C  
ATOM   2898  CD  GLU A 592       6.443   3.180  69.529  1.00101.74           C  
ATOM   2899  OE1 GLU A 592       6.729   2.456  68.546  1.00102.89           O  
ATOM   2900  OE2 GLU A 592       5.901   2.720  70.561  1.00104.03           O  
ATOM   2901  N   GLU A 593       7.279   6.747  65.426  1.00 92.69           N  
ATOM   2902  CA  GLU A 593       7.677   6.720  64.013  1.00 94.14           C  
ATOM   2903  C   GLU A 593       8.706   7.778  63.624  1.00 96.67           C  
ATOM   2904  O   GLU A 593       9.474   7.578  62.683  1.00 98.77           O  
ATOM   2905  CB  GLU A 593       6.462   6.881  63.087  1.00 94.05           C  
ATOM   2906  CG  GLU A 593       5.116   6.474  63.670  1.00 95.53           C  
ATOM   2907  CD  GLU A 593       4.256   7.668  64.063  1.00 96.11           C  
ATOM   2908  OE1 GLU A 593       4.327   8.718  63.376  1.00 94.54           O  
ATOM   2909  OE2 GLU A 593       3.492   7.545  65.051  1.00 95.33           O  
ATOM   2910  N   CYS A 594       8.707   8.903  64.333  1.00 97.26           N  
ATOM   2911  CA  CYS A 594       9.498  10.066  63.932  1.00 98.71           C  
ATOM   2912  C   CYS A 594      10.919  10.027  64.452  1.00 98.32           C  
ATOM   2913  O   CYS A 594      11.739  10.892  64.115  1.00 96.41           O  
ATOM   2914  CB  CYS A 594       8.803  11.349  64.375  1.00100.37           C  
ATOM   2915  SG  CYS A 594       7.147  11.469  63.700  1.00102.58           S  
ATOM   2916  N   ARG A 595      11.198   9.021  65.278  1.00 98.02           N  
ATOM   2917  CA  ARG A 595      12.519   8.835  65.841  1.00 99.32           C  
ATOM   2918  C   ARG A 595      13.502   8.627  64.712  1.00 97.35           C  
ATOM   2919  O   ARG A 595      13.248   7.859  63.786  1.00 99.94           O  
ATOM   2920  CB  ARG A 595      12.540   7.648  66.804  1.00103.41           C  
ATOM   2921  CG  ARG A 595      12.025   7.974  68.194  1.00109.38           C  
ATOM   2922  CD  ARG A 595      11.778   6.710  68.998  1.00114.99           C  
ATOM   2923  NE  ARG A 595      11.298   7.012  70.346  1.00120.21           N  
ATOM   2924  CZ  ARG A 595      10.805   6.114  71.199  1.00122.39           C  
ATOM   2925  NH1 ARG A 595      10.711   4.829  70.862  1.00117.44           N  
ATOM   2926  NH2 ARG A 595      10.397   6.508  72.401  1.00125.70           N  
ATOM   2927  N   ALA A 596      14.605   9.357  64.778  1.00 95.70           N  
ATOM   2928  CA  ALA A 596      15.689   9.224  63.822  1.00 95.60           C  
ATOM   2929  C   ALA A 596      16.992   9.459  64.549  1.00 99.13           C  
ATOM   2930  O   ALA A 596      17.021  10.126  65.585  1.00104.81           O  
ATOM   2931  CB  ALA A 596      15.528  10.210  62.684  1.00 92.81           C  
ATOM   2932  N   THR A 597      18.069   8.915  64.003  1.00101.36           N  
ATOM   2933  CA  THR A 597      19.368   9.001  64.646  1.00104.79           C  
ATOM   2934  C   THR A 597      20.319   9.902  63.851  1.00105.30           C  
ATOM   2935  O   THR A 597      20.456   9.765  62.637  1.00106.38           O  
ATOM   2936  CB  THR A 597      19.953   7.591  64.926  1.00106.36           C  
ATOM   2937  OG1 THR A 597      21.252   7.712  65.514  1.00107.40           O  
ATOM   2938  CG2 THR A 597      20.029   6.744  63.646  1.00108.61           C  
ATOM   2939  N   VAL A 598      20.947  10.842  64.550  1.00106.75           N  
ATOM   2940  CA  VAL A 598      21.758  11.880  63.914  1.00107.04           C  
ATOM   2941  C   VAL A 598      23.088  11.315  63.429  1.00104.83           C  
ATOM   2942  O   VAL A 598      23.757  10.600  64.164  1.00105.87           O  
ATOM   2943  CB  VAL A 598      21.960  13.103  64.860  1.00108.46           C  
ATOM   2944  CG1 VAL A 598      22.426  12.657  66.240  1.00111.96           C  
ATOM   2945  CG2 VAL A 598      22.921  14.126  64.255  1.00109.17           C  
ATOM   2946  N   GLN A 599      23.443  11.620  62.180  1.00104.81           N  
ATOM   2947  CA  GLN A 599      24.711  11.172  61.583  1.00101.33           C  
ATOM   2948  C   GLN A 599      25.636  12.371  61.359  1.00 95.87           C  
ATOM   2949  O   GLN A 599      25.561  13.014  60.307  1.00 93.02           O  
ATOM   2950  CB  GLN A 599      24.476  10.458  60.248  1.00100.87           C  
ATOM   2951  CG  GLN A 599      23.697   9.152  60.311  1.00101.68           C  
ATOM   2952  CD  GLN A 599      23.541   8.521  58.930  1.00103.87           C  
ATOM   2953  OE1 GLN A 599      24.518   8.061  58.330  1.00104.76           O  
ATOM   2954  NE2 GLN A 599      22.311   8.506  58.416  1.00103.60           N  
ATOM   2955  N   PRO A 600      26.532  12.651  62.332  1.00 92.34           N  
ATOM   2956  CA  PRO A 600      27.317  13.887  62.354  1.00 90.54           C  
ATOM   2957  C   PRO A 600      28.076  14.112  61.047  1.00 91.12           C  
ATOM   2958  O   PRO A 600      28.690  13.177  60.510  1.00 88.94           O  
ATOM   2959  CB  PRO A 600      28.296  13.663  63.510  1.00 89.03           C  
ATOM   2960  CG  PRO A 600      27.643  12.668  64.378  1.00 87.98           C  
ATOM   2961  CD  PRO A 600      26.887  11.766  63.457  1.00 90.11           C  
ATOM   2962  N   ALA A 601      28.016  15.345  60.546  1.00 90.19           N  
ATOM   2963  CA  ALA A 601      28.647  15.707  59.279  1.00 89.42           C  
ATOM   2964  C   ALA A 601      30.152  15.421  59.267  1.00 90.57           C  
ATOM   2965  O   ALA A 601      30.869  15.726  60.226  1.00 88.95           O  
ATOM   2966  CB  ALA A 601      28.369  17.162  58.944  1.00 87.66           C  
ATOM   2967  N   GLN A 602      30.611  14.833  58.169  1.00 92.40           N  
ATOM   2968  CA  GLN A 602      31.990  14.405  58.037  1.00 95.43           C  
ATOM   2969  C   GLN A 602      32.705  15.240  56.978  1.00 96.48           C  
ATOM   2970  O   GLN A 602      32.064  15.843  56.119  1.00 97.55           O  
ATOM   2971  CB  GLN A 602      32.029  12.923  57.656  1.00 98.30           C  
ATOM   2972  CG  GLN A 602      32.987  12.069  58.486  1.00102.07           C  
ATOM   2973  CD  GLN A 602      32.377  11.591  59.800  1.00102.97           C  
ATOM   2974  OE1 GLN A 602      31.866  12.384  60.591  1.00103.69           O  
ATOM   2975  NE2 GLN A 602      32.439  10.286  60.036  1.00103.52           N  
ATOM   2976  N   THR A 603      34.033  15.278  57.049  1.00 97.06           N  
ATOM   2977  CA  THR A 603      34.847  15.937  56.031  1.00 95.53           C  
ATOM   2978  C   THR A 603      34.761  15.164  54.728  1.00 96.22           C  
ATOM   2979  O   THR A 603      34.797  13.929  54.731  1.00 98.16           O  
ATOM   2980  CB  THR A 603      36.331  15.997  56.434  1.00 95.24           C  
ATOM   2981  OG1 THR A 603      36.695  14.775  57.087  1.00 97.42           O  
ATOM   2982  CG2 THR A 603      36.602  17.163  57.365  1.00 94.15           C  
ATOM   2983  N   LEU A 604      34.649  15.900  53.622  1.00 94.62           N  
ATOM   2984  CA  LEU A 604      34.695  15.330  52.274  1.00 93.04           C  
ATOM   2985  C   LEU A 604      35.815  14.305  52.131  1.00 93.67           C  
ATOM   2986  O   LEU A 604      36.925  14.511  52.628  1.00 91.76           O  
ATOM   2987  CB  LEU A 604      34.878  16.443  51.240  1.00 91.78           C  
ATOM   2988  CG  LEU A 604      33.689  16.975  50.433  1.00 92.07           C  
ATOM   2989  CD1 LEU A 604      32.354  16.805  51.146  1.00 94.55           C  
ATOM   2990  CD2 LEU A 604      33.922  18.432  50.071  1.00 91.72           C  
ATOM   2991  N   THR A 605      35.509  13.196  51.463  1.00 95.89           N  
ATOM   2992  CA  THR A 605      36.478  12.116  51.266  1.00 97.53           C  
ATOM   2993  C   THR A 605      36.502  11.600  49.827  1.00 98.12           C  
ATOM   2994  O   THR A 605      37.385  10.822  49.459  1.00 98.72           O  
ATOM   2995  CB  THR A 605      36.232  10.935  52.239  1.00 98.83           C  
ATOM   2996  OG1 THR A 605      34.823  10.721  52.398  1.00 99.36           O  
ATOM   2997  CG2 THR A 605      36.850  11.223  53.601  1.00100.34           C  
ATOM   2998  N   SER A 606      35.540  12.050  49.020  1.00 98.82           N  
ATOM   2999  CA  SER A 606      35.396  11.607  47.631  1.00 99.19           C  
ATOM   3000  C   SER A 606      36.673  11.816  46.825  1.00 98.95           C  
ATOM   3001  O   SER A 606      37.422  12.763  47.072  1.00 99.06           O  
ATOM   3002  CB  SER A 606      34.232  12.332  46.951  1.00 99.85           C  
ATOM   3003  OG  SER A 606      34.591  13.659  46.603  1.00101.47           O  
ATOM   3004  N   GLU A 607      36.897  10.932  45.856  1.00 98.49           N  
ATOM   3005  CA  GLU A 607      38.124  10.913  45.062  1.00 98.74           C  
ATOM   3006  C   GLU A 607      38.536  12.294  44.542  1.00 98.33           C  
ATOM   3007  O   GLU A 607      39.680  12.709  44.723  1.00 97.23           O  
ATOM   3008  CB  GLU A 607      37.979   9.919  43.907  1.00 99.36           C  
ATOM   3009  CG  GLU A 607      39.274   9.580  43.183  1.00 98.91           C  
ATOM   3010  CD  GLU A 607      39.073   8.578  42.056  1.00 99.07           C  
ATOM   3011  OE1 GLU A 607      37.922   8.400  41.597  1.00 98.62           O  
ATOM   3012  OE2 GLU A 607      40.074   7.968  41.625  1.00 99.47           O  
ATOM   3013  N   CYS A 608      37.595  13.001  43.919  1.00 99.13           N  
ATOM   3014  CA  CYS A 608      37.868  14.300  43.302  1.00 99.57           C  
ATOM   3015  C   CYS A 608      38.242  15.383  44.315  1.00100.00           C  
ATOM   3016  O   CYS A 608      39.034  16.275  44.012  1.00 99.17           O  
ATOM   3017  CB  CYS A 608      36.670  14.755  42.465  1.00100.21           C  
ATOM   3018  SG  CYS A 608      36.956  16.233  41.449  1.00101.47           S  
ATOM   3019  N   SER A 609      37.674  15.298  45.515  1.00101.82           N  
ATOM   3020  CA  SER A 609      37.912  16.298  46.557  1.00103.46           C  
ATOM   3021  C   SER A 609      39.373  16.377  47.004  1.00104.80           C  
ATOM   3022  O   SER A 609      39.895  17.468  47.228  1.00105.09           O  
ATOM   3023  CB  SER A 609      37.013  16.041  47.766  1.00103.32           C  
ATOM   3024  OG  SER A 609      37.505  16.727  48.905  1.00105.04           O  
ATOM   3025  N   ARG A 610      40.017  15.218  47.131  1.00106.40           N  
ATOM   3026  CA  ARG A 610      41.385  15.124  47.657  1.00107.93           C  
ATOM   3027  C   ARG A 610      42.467  15.266  46.596  1.00105.44           C  
ATOM   3028  O   ARG A 610      43.563  15.741  46.890  1.00105.82           O  
ATOM   3029  CB  ARG A 610      41.589  13.816  48.440  1.00109.56           C  
ATOM   3030  CG  ARG A 610      40.863  12.604  47.860  1.00111.89           C  
ATOM   3031  CD  ARG A 610      40.686  11.491  48.894  1.00111.94           C  
ATOM   3032  NE  ARG A 610      41.611  10.379  48.677  1.00114.08           N  
ATOM   3033  CZ  ARG A 610      41.347   9.306  47.931  1.00114.37           C  
ATOM   3034  NH1 ARG A 610      40.177   9.179  47.315  1.00114.24           N  
ATOM   3035  NH2 ARG A 610      42.260   8.353  47.800  1.00114.64           N  
ATOM   3036  N   LEU A 611      42.155  14.865  45.367  1.00103.38           N  
ATOM   3037  CA  LEU A 611      43.156  14.789  44.303  1.00100.06           C  
ATOM   3038  C   LEU A 611      43.166  15.993  43.358  1.00 99.34           C  
ATOM   3039  O   LEU A 611      44.238  16.451  42.963  1.00100.52           O  
ATOM   3040  CB  LEU A 611      43.012  13.476  43.518  1.00 99.32           C  
ATOM   3041  CG  LEU A 611      43.767  12.218  43.983  1.00 98.72           C  
ATOM   3042  CD1 LEU A 611      43.697  11.965  45.492  1.00 98.60           C  
ATOM   3043  CD2 LEU A 611      43.268  10.997  43.229  1.00 98.82           C  
ATOM   3044  N   CYS A 612      41.985  16.500  43.007  1.00 98.99           N  
ATOM   3045  CA  CYS A 612      41.857  17.592  42.029  1.00100.50           C  
ATOM   3046  C   CYS A 612      42.632  18.840  42.461  1.00102.89           C  
ATOM   3047  O   CYS A 612      42.196  19.585  43.342  1.00102.81           O  
ATOM   3048  CB  CYS A 612      40.383  17.912  41.758  1.00 98.93           C  
ATOM   3049  SG  CYS A 612      40.059  18.925  40.299  1.00 96.63           S  
ATOM   3050  N   ARG A 613      43.780  19.035  41.808  1.00105.96           N  
ATOM   3051  CA  ARG A 613      44.801  20.042  42.140  1.00107.87           C  
ATOM   3052  C   ARG A 613      44.245  21.427  42.475  1.00108.16           C  
ATOM   3053  O   ARG A 613      43.908  21.714  43.625  1.00107.88           O  
ATOM   3054  CB  ARG A 613      45.792  20.154  40.971  1.00108.79           C  
ATOM   3055  CG  ARG A 613      47.177  20.675  41.342  1.00108.54           C  
ATOM   3056  CD  ARG A 613      47.803  21.453  40.194  1.00106.46           C  
ATOM   3057  NE  ARG A 613      47.832  22.895  40.436  1.00105.72           N  
ATOM   3058  CZ  ARG A 613      47.006  23.778  39.883  1.00105.66           C  
ATOM   3059  NH1 ARG A 613      46.059  23.380  39.045  1.00106.64           N  
ATOM   3060  NH2 ARG A 613      47.129  25.068  40.175  1.00105.41           N  
ATOM   3061  N   ASN A 614      44.204  22.285  41.460  1.00109.62           N  
ATOM   3062  CA  ASN A 614      43.528  23.570  41.523  1.00111.85           C  
ATOM   3063  C   ASN A 614      42.840  23.769  40.176  1.00112.64           C  
ATOM   3064  O   ASN A 614      43.336  23.317  39.128  1.00109.35           O  
ATOM   3065  CB  ASN A 614      44.504  24.708  41.842  1.00113.38           C  
ATOM   3066  CG  ASN A 614      43.890  25.787  42.729  1.00114.69           C  
ATOM   3067  OD1 ASN A 614      43.098  25.499  43.629  1.00115.72           O  
ATOM   3068  ND2 ASN A 614      44.273  27.037  42.486  1.00114.59           N  
ATOM   3069  N   GLY A 615      41.691  24.435  40.215  1.00112.79           N  
ATOM   3070  CA  GLY A 615      40.734  24.374  39.122  1.00109.17           C  
ATOM   3071  C   GLY A 615      39.588  23.516  39.616  1.00106.65           C  
ATOM   3072  O   GLY A 615      39.801  22.521  40.320  1.00104.82           O  
ATOM   3073  N   TYR A 616      38.373  23.903  39.242  1.00105.31           N  
ATOM   3074  CA  TYR A 616      37.163  23.340  39.831  1.00101.94           C  
ATOM   3075  C   TYR A 616      36.940  21.852  39.564  1.00100.74           C  
ATOM   3076  O   TYR A 616      37.439  21.290  38.590  1.00100.20           O  
ATOM   3077  CB  TYR A 616      35.936  24.170  39.440  1.00101.25           C  
ATOM   3078  CG  TYR A 616      35.598  24.189  37.964  1.00100.62           C  
ATOM   3079  CD1 TYR A 616      36.082  25.194  37.129  1.00100.22           C  
ATOM   3080  CD2 TYR A 616      34.759  23.223  37.411  1.00100.54           C  
ATOM   3081  CE1 TYR A 616      35.755  25.223  35.774  1.00100.68           C  
ATOM   3082  CE2 TYR A 616      34.425  23.246  36.061  1.00101.15           C  
ATOM   3083  CZ  TYR A 616      34.927  24.243  35.248  1.00100.89           C  
ATOM   3084  OH  TYR A 616      34.595  24.257  33.913  1.00100.86           O  
ATOM   3085  N   CYS A 617      36.171  21.239  40.455  1.00100.72           N  
ATOM   3086  CA  CYS A 617      35.940  19.804  40.481  1.00 98.85           C  
ATOM   3087  C   CYS A 617      34.417  19.564  40.481  1.00 95.41           C  
ATOM   3088  O   CYS A 617      33.755  19.806  41.486  1.00 94.76           O  
ATOM   3089  CB  CYS A 617      36.658  19.247  41.725  1.00 99.48           C  
ATOM   3090  SG  CYS A 617      36.061  17.731  42.498  1.00102.08           S  
ATOM   3091  N   THR A 618      33.867  19.117  39.347  1.00 92.38           N  
ATOM   3092  CA  THR A 618      32.399  19.053  39.151  1.00 92.13           C  
ATOM   3093  C   THR A 618      31.690  18.095  40.115  1.00 93.79           C  
ATOM   3094  O   THR A 618      32.325  17.184  40.654  1.00 95.38           O  
ATOM   3095  CB  THR A 618      31.970  18.658  37.699  1.00 89.65           C  
ATOM   3096  OG1 THR A 618      31.795  17.238  37.610  1.00 85.81           O  
ATOM   3097  CG2 THR A 618      32.957  19.139  36.649  1.00 91.10           C  
ATOM   3098  N   PRO A 619      30.367  18.298  40.326  1.00 92.92           N  
ATOM   3099  CA  PRO A 619      29.546  17.428  41.175  1.00 92.21           C  
ATOM   3100  C   PRO A 619      29.549  15.947  40.799  1.00 93.31           C  
ATOM   3101  O   PRO A 619      29.279  15.113  41.660  1.00 94.57           O  
ATOM   3102  CB  PRO A 619      28.134  18.002  41.012  1.00 91.38           C  
ATOM   3103  CG  PRO A 619      28.193  18.858  39.803  1.00 90.81           C  
ATOM   3104  CD  PRO A 619      29.567  19.410  39.783  1.00 91.53           C  
ATOM   3105  N   THR A 620      29.840  15.613  39.542  1.00 94.13           N  
ATOM   3106  CA  THR A 620      29.911  14.201  39.144  1.00 96.43           C  
ATOM   3107  C   THR A 620      31.199  13.551  39.624  1.00 96.45           C  
ATOM   3108  O   THR A 620      31.264  12.330  39.780  1.00 97.15           O  
ATOM   3109  CB  THR A 620      29.766  13.978  37.615  1.00 97.88           C  
ATOM   3110  OG1 THR A 620      30.529  14.957  36.902  1.00100.17           O  
ATOM   3111  CG2 THR A 620      28.309  14.061  37.191  1.00 98.00           C  
ATOM   3112  N   GLY A 621      32.217  14.372  39.858  1.00 97.07           N  
ATOM   3113  CA  GLY A 621      33.515  13.882  40.301  1.00 98.27           C  
ATOM   3114  C   GLY A 621      34.619  14.102  39.285  1.00 99.28           C  
ATOM   3115  O   GLY A 621      35.794  13.963  39.616  1.00 99.96           O  
ATOM   3116  N   LYS A 622      34.242  14.430  38.047  1.00 99.14           N  
ATOM   3117  CA  LYS A 622      35.208  14.788  37.008  1.00 99.30           C  
ATOM   3118  C   LYS A 622      35.918  16.077  37.396  1.00100.19           C  
ATOM   3119  O   LYS A 622      35.296  17.007  37.921  1.00100.36           O  
ATOM   3120  CB  LYS A 622      34.530  14.952  35.647  1.00100.87           C  
ATOM   3121  CG  LYS A 622      33.938  13.666  35.069  1.00104.00           C  
ATOM   3122  CD  LYS A 622      34.977  12.801  34.340  1.00104.64           C  
ATOM   3123  CE  LYS A 622      34.312  11.576  33.715  1.00104.48           C  
ATOM   3124  NZ  LYS A 622      35.262  10.694  32.992  1.00104.60           N  
ATOM   3125  N   CYS A 623      37.223  16.116  37.140  1.00 99.75           N  
ATOM   3126  CA  CYS A 623      38.080  17.210  37.595  1.00 98.13           C  
ATOM   3127  C   CYS A 623      38.537  18.077  36.418  1.00 94.85           C  
ATOM   3128  O   CYS A 623      39.321  17.640  35.578  1.00 94.74           O  
ATOM   3129  CB  CYS A 623      39.257  16.643  38.408  1.00 97.70           C  
ATOM   3130  SG  CYS A 623      40.634  17.758  38.732  1.00 98.50           S  
ATOM   3131  N   CYS A 624      38.015  19.302  36.364  1.00 91.82           N  
ATOM   3132  CA  CYS A 624      38.304  20.238  35.282  1.00 89.46           C  
ATOM   3133  C   CYS A 624      39.551  21.058  35.578  1.00 86.17           C  
ATOM   3134  O   CYS A 624      39.672  21.652  36.648  1.00 85.77           O  
ATOM   3135  CB  CYS A 624      37.115  21.168  35.047  1.00 91.99           C  
ATOM   3136  SG  CYS A 624      35.630  20.341  34.454  1.00 95.02           S  
ATOM   3137  N   CYS A 625      40.465  21.094  34.612  1.00 83.33           N  
ATOM   3138  CA  CYS A 625      41.765  21.735  34.793  1.00 79.33           C  
ATOM   3139  C   CYS A 625      41.770  23.203  34.397  1.00 76.87           C  
ATOM   3140  O   CYS A 625      41.136  23.599  33.422  1.00 76.74           O  
ATOM   3141  CB  CYS A 625      42.843  20.985  34.008  1.00 79.03           C  
ATOM   3142  SG  CYS A 625      43.014  19.235  34.434  1.00 79.16           S  
ATOM   3143  N   SER A 626      42.490  24.001  35.175  1.00 76.01           N  
ATOM   3144  CA  SER A 626      42.757  25.395  34.846  1.00 75.30           C  
ATOM   3145  C   SER A 626      43.790  25.458  33.718  1.00 77.18           C  
ATOM   3146  O   SER A 626      44.514  24.483  33.496  1.00 78.50           O  
ATOM   3147  CB  SER A 626      43.238  26.145  36.093  1.00 73.97           C  
ATOM   3148  OG  SER A 626      43.577  25.242  37.135  1.00 72.55           O  
ATOM   3149  N   PRO A 627      43.855  26.591  32.988  1.00 78.60           N  
ATOM   3150  CA  PRO A 627      44.773  26.702  31.845  1.00 79.39           C  
ATOM   3151  C   PRO A 627      46.198  26.212  32.138  1.00 79.30           C  
ATOM   3152  O   PRO A 627      46.836  26.662  33.098  1.00 78.29           O  
ATOM   3153  CB  PRO A 627      44.764  28.202  31.538  1.00 80.04           C  
ATOM   3154  CG  PRO A 627      43.408  28.642  31.951  1.00 80.71           C  
ATOM   3155  CD  PRO A 627      43.072  27.827  33.175  1.00 79.44           C  
ATOM   3156  N   GLY A 628      46.670  25.278  31.315  1.00 78.53           N  
ATOM   3157  CA  GLY A 628      48.016  24.730  31.446  1.00 76.39           C  
ATOM   3158  C   GLY A 628      48.178  23.605  32.457  1.00 74.46           C  
ATOM   3159  O   GLY A 628      49.254  23.443  33.031  1.00 77.09           O  
ATOM   3160  N   TRP A 629      47.115  22.836  32.682  1.00 70.39           N  
ATOM   3161  CA  TRP A 629      47.188  21.616  33.492  1.00 68.08           C  
ATOM   3162  C   TRP A 629      46.468  20.464  32.791  1.00 68.89           C  
ATOM   3163  O   TRP A 629      45.504  20.682  32.053  1.00 70.83           O  
ATOM   3164  CB  TRP A 629      46.611  21.838  34.895  1.00 66.02           C  
ATOM   3165  CG  TRP A 629      47.411  22.794  35.754  1.00 66.15           C  
ATOM   3166  CD1 TRP A 629      47.189  24.133  35.914  1.00 66.03           C  
ATOM   3167  CD2 TRP A 629      48.549  22.480  36.573  1.00 65.14           C  
ATOM   3168  NE1 TRP A 629      48.114  24.670  36.777  1.00 65.04           N  
ATOM   3169  CE2 TRP A 629      48.964  23.681  37.191  1.00 64.31           C  
ATOM   3170  CE3 TRP A 629      49.264  21.303  36.835  1.00 66.24           C  
ATOM   3171  CZ2 TRP A 629      50.059  23.741  38.061  1.00 64.94           C  
ATOM   3172  CZ3 TRP A 629      50.359  21.361  37.703  1.00 65.55           C  
ATOM   3173  CH2 TRP A 629      50.743  22.574  38.304  1.00 65.51           C  
ATOM   3174  N   GLU A 630      46.939  19.241  33.019  1.00 68.81           N  
ATOM   3175  CA  GLU A 630      46.358  18.063  32.372  1.00 69.89           C  
ATOM   3176  C   GLU A 630      46.437  16.825  33.257  1.00 69.60           C  
ATOM   3177  O   GLU A 630      47.124  16.825  34.279  1.00 67.90           O  
ATOM   3178  CB  GLU A 630      47.020  17.802  31.013  1.00 70.80           C  
ATOM   3179  CG  GLU A 630      48.486  17.394  31.085  1.00 71.93           C  
ATOM   3180  CD  GLU A 630      49.079  17.105  29.722  1.00 72.42           C  
ATOM   3181  OE1 GLU A 630      49.176  18.039  28.900  1.00 73.93           O  
ATOM   3182  OE2 GLU A 630      49.461  15.943  29.476  1.00 73.65           O  
ATOM   3183  N   GLY A 631      45.735  15.771  32.848  1.00 72.37           N  
ATOM   3184  CA  GLY A 631      45.612  14.556  33.651  1.00 77.64           C  
ATOM   3185  C   GLY A 631      44.245  14.443  34.307  1.00 82.30           C  
ATOM   3186  O   GLY A 631      43.490  15.423  34.373  1.00 82.31           O  
ATOM   3187  N   ASP A 632      43.929  13.246  34.801  1.00 84.99           N  
ATOM   3188  CA  ASP A 632      42.625  12.964  35.416  1.00 86.67           C  
ATOM   3189  C   ASP A 632      42.281  13.916  36.559  1.00 88.00           C  
ATOM   3190  O   ASP A 632      41.110  14.250  36.765  1.00 90.16           O  
ATOM   3191  CB  ASP A 632      42.562  11.520  35.922  1.00 86.69           C  
ATOM   3192  CG  ASP A 632      42.542  10.505  34.797  1.00 86.64           C  
ATOM   3193  OD1 ASP A 632      41.498   9.838  34.626  1.00 86.38           O  
ATOM   3194  OD2 ASP A 632      43.566  10.377  34.089  1.00 85.69           O  
ATOM   3195  N   PHE A 633      43.304  14.342  37.299  1.00 86.75           N  
ATOM   3196  CA  PHE A 633      43.114  15.225  38.446  1.00 83.89           C  
ATOM   3197  C   PHE A 633      43.985  16.476  38.358  1.00 82.78           C  
ATOM   3198  O   PHE A 633      44.231  17.148  39.364  1.00 82.73           O  
ATOM   3199  CB  PHE A 633      43.347  14.463  39.757  1.00 83.70           C  
ATOM   3200  CG  PHE A 633      42.460  13.260  39.920  1.00 83.93           C  
ATOM   3201  CD1 PHE A 633      42.957  11.979  39.688  1.00 84.45           C  
ATOM   3202  CD2 PHE A 633      41.121  13.409  40.281  1.00 84.93           C  
ATOM   3203  CE1 PHE A 633      42.138  10.860  39.823  1.00 84.91           C  
ATOM   3204  CE2 PHE A 633      40.291  12.300  40.424  1.00 84.97           C  
ATOM   3205  CZ  PHE A 633      40.801  11.022  40.194  1.00 85.49           C  
ATOM   3206  N   CYS A 634      44.435  16.785  37.141  1.00 81.86           N  
ATOM   3207  CA  CYS A 634      45.201  18.002  36.849  1.00 82.52           C  
ATOM   3208  C   CYS A 634      46.533  18.093  37.603  1.00 83.97           C  
ATOM   3209  O   CYS A 634      46.915  19.167  38.073  1.00 84.72           O  
ATOM   3210  CB  CYS A 634      44.355  19.253  37.125  1.00 80.64           C  
ATOM   3211  SG  CYS A 634      42.705  19.191  36.440  1.00 78.30           S  
ATOM   3212  N   ARG A 635      47.243  16.974  37.710  1.00 84.06           N  
ATOM   3213  CA  ARG A 635      48.509  16.968  38.441  1.00 84.76           C  
ATOM   3214  C   ARG A 635      49.720  17.255  37.548  1.00 82.86           C  
ATOM   3215  O   ARG A 635      50.738  17.762  38.021  1.00 84.43           O  
ATOM   3216  CB  ARG A 635      48.699  15.656  39.206  1.00 87.90           C  
ATOM   3217  CG  ARG A 635      47.491  15.228  40.023  1.00 91.46           C  
ATOM   3218  CD  ARG A 635      47.906  14.815  41.424  1.00 95.13           C  
ATOM   3219  NE  ARG A 635      47.150  13.660  41.903  1.00 96.54           N  
ATOM   3220  CZ  ARG A 635      47.591  12.406  41.855  1.00 97.12           C  
ATOM   3221  NH1 ARG A 635      48.793  12.135  41.354  1.00 97.25           N  
ATOM   3222  NH2 ARG A 635      46.833  11.419  42.314  1.00 96.37           N  
ATOM   3223  N   THR A 636      49.602  16.942  36.261  1.00 78.97           N  
ATOM   3224  CA  THR A 636      50.695  17.140  35.315  1.00 75.75           C  
ATOM   3225  C   THR A 636      50.586  18.505  34.625  1.00 73.90           C  
ATOM   3226  O   THR A 636      49.562  18.828  34.026  1.00 72.82           O  
ATOM   3227  CB  THR A 636      50.755  15.982  34.284  1.00 75.07           C  
ATOM   3228  OG1 THR A 636      50.959  14.742  34.973  1.00 73.45           O  
ATOM   3229  CG2 THR A 636      51.887  16.185  33.288  1.00 75.78           C  
ATOM   3230  N   ALA A 637      51.655  19.293  34.726  1.00 74.35           N  
ATOM   3231  CA  ALA A 637      51.722  20.634  34.145  1.00 74.81           C  
ATOM   3232  C   ALA A 637      52.108  20.627  32.667  1.00 78.15           C  
ATOM   3233  O   ALA A 637      52.739  19.690  32.171  1.00 78.48           O  
ATOM   3234  CB  ALA A 637      52.686  21.508  34.938  1.00 74.02           C  
ATOM   3235  N   LYS A 638      51.742  21.708  31.987  1.00 82.33           N  
ATOM   3236  CA  LYS A 638      51.879  21.833  30.544  1.00 86.68           C  
ATOM   3237  C   LYS A 638      52.996  22.822  30.185  1.00 90.59           C  
ATOM   3238  O   LYS A 638      52.976  23.975  30.619  1.00 91.31           O  
ATOM   3239  CB  LYS A 638      50.554  22.344  29.986  1.00 86.36           C  
ATOM   3240  CG  LYS A 638      50.025  21.617  28.773  1.00 88.31           C  
ATOM   3241  CD  LYS A 638      48.611  22.111  28.468  1.00 88.97           C  
ATOM   3242  CE  LYS A 638      47.901  21.242  27.448  1.00 88.51           C  
ATOM   3243  NZ  LYS A 638      46.554  21.778  27.152  1.00 89.43           N  
ATOM   3244  N   CYS A 639      53.974  22.368  29.405  1.00 93.95           N  
ATOM   3245  CA  CYS A 639      54.999  23.270  28.872  1.00 96.78           C  
ATOM   3246  C   CYS A 639      54.903  23.390  27.342  1.00100.16           C  
ATOM   3247  O   CYS A 639      55.320  22.484  26.611  1.00 96.05           O  
ATOM   3248  CB  CYS A 639      56.390  22.863  29.354  1.00 95.65           C  
ATOM   3249  SG  CYS A 639      56.732  23.375  31.077  1.00 98.26           S  
ATOM   3250  N   GLU A 640      54.344  24.523  26.892  1.00105.04           N  
ATOM   3251  CA  GLU A 640      53.839  24.724  25.517  1.00109.60           C  
ATOM   3252  C   GLU A 640      54.859  24.384  24.439  1.00111.53           C  
ATOM   3253  O   GLU A 640      54.538  23.614  23.533  1.00115.08           O  
ATOM   3254  CB  GLU A 640      53.265  26.135  25.311  1.00113.80           C  
ATOM   3255  CG  GLU A 640      52.042  26.473  26.176  1.00117.62           C  
ATOM   3256  CD  GLU A 640      50.728  25.962  25.606  1.00119.84           C  
ATOM   3257  OE1 GLU A 640      50.302  26.448  24.535  1.00121.59           O  
ATOM   3258  OE2 GLU A 640      50.105  25.089  26.248  1.00120.46           O  
ATOM   3259  N   PRO A 641      56.059  25.008  24.485  1.00111.89           N  
ATOM   3260  CA  PRO A 641      57.257  24.337  23.954  1.00108.91           C  
ATOM   3261  C   PRO A 641      57.939  23.581  25.096  1.00106.68           C  
ATOM   3262  O   PRO A 641      58.265  24.178  26.127  1.00104.90           O  
ATOM   3263  CB  PRO A 641      58.132  25.497  23.457  1.00107.15           C  
ATOM   3264  CG  PRO A 641      57.531  26.766  24.059  1.00110.26           C  
ATOM   3265  CD  PRO A 641      56.365  26.377  24.938  1.00111.00           C  
ATOM   3266  N   ALA A 642      58.128  22.277  24.923  1.00104.95           N  
ATOM   3267  CA  ALA A 642      58.578  21.414  26.020  1.00104.60           C  
ATOM   3268  C   ALA A 642      59.927  21.809  26.629  1.00103.82           C  
ATOM   3269  O   ALA A 642      60.749  22.457  25.975  1.00103.02           O  
ATOM   3270  CB  ALA A 642      58.602  19.962  25.570  1.00106.56           C  
ATOM   3271  N   CYS A 643      60.138  21.424  27.888  1.00104.28           N  
ATOM   3272  CA  CYS A 643      61.427  21.634  28.559  1.00101.82           C  
ATOM   3273  C   CYS A 643      62.472  20.726  27.933  1.00 98.90           C  
ATOM   3274  O   CYS A 643      62.142  19.685  27.372  1.00102.39           O  
ATOM   3275  CB  CYS A 643      61.329  21.369  30.062  1.00100.42           C  
ATOM   3276  SG  CYS A 643      60.007  22.279  30.883  1.00101.58           S  
ATOM   3277  N   ARG A 644      63.730  21.130  28.025  1.00 95.91           N  
ATOM   3278  CA  ARG A 644      64.809  20.424  27.349  1.00 94.10           C  
ATOM   3279  C   ARG A 644      65.909  19.986  28.308  1.00 90.40           C  
ATOM   3280  O   ARG A 644      65.898  20.337  29.491  1.00 90.98           O  
ATOM   3281  CB  ARG A 644      65.419  21.308  26.266  1.00 94.76           C  
ATOM   3282  CG  ARG A 644      64.525  21.611  25.107  1.00 95.32           C  
ATOM   3283  CD  ARG A 644      65.406  21.694  23.899  1.00100.27           C  
ATOM   3284  NE  ARG A 644      64.867  22.538  22.843  1.00102.33           N  
ATOM   3285  CZ  ARG A 644      65.610  23.063  21.875  1.00103.01           C  
ATOM   3286  NH1 ARG A 644      66.923  22.835  21.848  1.00100.48           N  
ATOM   3287  NH2 ARG A 644      65.043  23.818  20.940  1.00103.32           N  
ATOM   3288  N   HIS A 645      66.867  19.230  27.775  1.00 86.15           N  
ATOM   3289  CA  HIS A 645      68.037  18.781  28.534  1.00 84.38           C  
ATOM   3290  C   HIS A 645      67.655  18.323  29.943  1.00 84.69           C  
ATOM   3291  O   HIS A 645      68.289  18.693  30.930  1.00 85.81           O  
ATOM   3292  CB  HIS A 645      69.122  19.869  28.570  1.00 80.30           C  
ATOM   3293  CG  HIS A 645      69.408  20.482  27.234  1.00 77.52           C  
ATOM   3294  ND1 HIS A 645      70.063  19.806  26.225  1.00 79.14           N  
ATOM   3295  CD2 HIS A 645      69.128  21.709  26.740  1.00 75.75           C  
ATOM   3296  CE1 HIS A 645      70.177  20.591  25.168  1.00 77.38           C  
ATOM   3297  NE2 HIS A 645      69.617  21.752  25.456  1.00 78.12           N  
ATOM   3298  N   GLY A 646      66.593  17.527  30.016  1.00 86.31           N  
ATOM   3299  CA  GLY A 646      66.179  16.892  31.258  1.00 87.50           C  
ATOM   3300  C   GLY A 646      65.467  17.805  32.229  1.00 88.26           C  
ATOM   3301  O   GLY A 646      65.344  17.471  33.407  1.00 89.99           O  
ATOM   3302  N   GLY A 647      65.008  18.955  31.736  1.00 89.56           N  
ATOM   3303  CA  GLY A 647      64.241  19.916  32.538  1.00 91.28           C  
ATOM   3304  C   GLY A 647      62.925  19.306  32.993  1.00 94.39           C  
ATOM   3305  O   GLY A 647      62.485  18.294  32.439  1.00 95.92           O  
ATOM   3306  N   VAL A 648      62.312  19.897  34.019  1.00 92.42           N  
ATOM   3307  CA  VAL A 648      61.037  19.408  34.542  1.00 88.53           C  
ATOM   3308  C   VAL A 648      60.006  20.520  34.452  1.00 90.75           C  
ATOM   3309  O   VAL A 648      60.280  21.643  34.867  1.00 92.49           O  
ATOM   3310  CB  VAL A 648      61.150  18.921  36.010  1.00 83.47           C  
ATOM   3311  CG1 VAL A 648      59.796  18.521  36.537  1.00 83.85           C  
ATOM   3312  CG2 VAL A 648      62.084  17.742  36.122  1.00 80.88           C  
ATOM   3313  N   CYS A 649      58.835  20.206  33.897  1.00 90.77           N  
ATOM   3314  CA  CYS A 649      57.724  21.154  33.837  1.00 89.03           C  
ATOM   3315  C   CYS A 649      57.007  21.156  35.181  1.00 89.20           C  
ATOM   3316  O   CYS A 649      56.209  20.263  35.476  1.00 91.95           O  
ATOM   3317  CB  CYS A 649      56.754  20.792  32.705  1.00 90.65           C  
ATOM   3318  SG  CYS A 649      55.598  22.119  32.224  1.00 93.98           S  
ATOM   3319  N   VAL A 650      57.300  22.163  35.996  1.00 88.30           N  
ATOM   3320  CA  VAL A 650      56.763  22.248  37.357  1.00 87.95           C  
ATOM   3321  C   VAL A 650      55.417  22.979  37.449  1.00 87.68           C  
ATOM   3322  O   VAL A 650      54.452  22.446  37.996  1.00 88.23           O  
ATOM   3323  CB  VAL A 650      57.791  22.861  38.328  1.00 87.29           C  
ATOM   3324  CG1 VAL A 650      58.757  21.794  38.803  1.00 87.77           C  
ATOM   3325  CG2 VAL A 650      58.545  24.004  37.661  1.00 87.26           C  
ATOM   3326  N   ARG A 651      55.369  24.199  36.923  1.00 87.31           N  
ATOM   3327  CA  ARG A 651      54.136  24.971  36.806  1.00 86.76           C  
ATOM   3328  C   ARG A 651      53.829  25.073  35.310  1.00 85.69           C  
ATOM   3329  O   ARG A 651      54.644  24.635  34.499  1.00 86.21           O  
ATOM   3330  CB  ARG A 651      54.320  26.360  37.430  1.00 86.43           C  
ATOM   3331  CG  ARG A 651      54.452  26.356  38.980  1.00 87.05           C  
ATOM   3332  CD  ARG A 651      55.013  27.781  39.396  1.00 89.50           C  
ATOM   3333  NE  ARG A 651      55.174  27.874  40.852  1.00 95.30           N  
ATOM   3334  CZ  ARG A 651      54.424  28.634  41.671  1.00 97.85           C  
ATOM   3335  NH1 ARG A 651      53.434  29.394  41.196  1.00 97.96           N  
ATOM   3336  NH2 ARG A 651      54.665  28.634  42.981  1.00 97.56           N  
ATOM   3337  N   PRO A 652      52.658  25.624  34.926  1.00 86.41           N  
ATOM   3338  CA  PRO A 652      52.422  25.767  33.487  1.00 86.87           C  
ATOM   3339  C   PRO A 652      53.437  26.706  32.845  1.00 88.55           C  
ATOM   3340  O   PRO A 652      53.586  27.848  33.278  1.00 89.11           O  
ATOM   3341  CB  PRO A 652      51.015  26.365  33.411  1.00 86.10           C  
ATOM   3342  CG  PRO A 652      50.397  26.072  34.729  1.00 86.26           C  
ATOM   3343  CD  PRO A 652      51.514  26.114  35.713  1.00 86.48           C  
ATOM   3344  N   ASN A 653      54.139  26.201  31.834  1.00 90.86           N  
ATOM   3345  CA  ASN A 653      55.187  26.945  31.127  1.00 94.98           C  
ATOM   3346  C   ASN A 653      56.396  27.355  31.973  1.00 98.07           C  
ATOM   3347  O   ASN A 653      57.137  28.265  31.601  1.00101.45           O  
ATOM   3348  CB  ASN A 653      54.609  28.148  30.369  1.00 95.47           C  
ATOM   3349  CG  ASN A 653      54.035  27.763  29.017  1.00 96.72           C  
ATOM   3350  OD1 ASN A 653      54.491  26.809  28.383  1.00 95.85           O  
ATOM   3351  ND2 ASN A 653      53.030  28.511  28.565  1.00 98.35           N  
ATOM   3352  N   LYS A 654      56.596  26.680  33.100  1.00 98.30           N  
ATOM   3353  CA  LYS A 654      57.794  26.887  33.901  1.00 98.68           C  
ATOM   3354  C   LYS A 654      58.621  25.606  33.922  1.00 99.67           C  
ATOM   3355  O   LYS A 654      58.113  24.535  34.265  1.00100.92           O  
ATOM   3356  CB  LYS A 654      57.433  27.341  35.315  1.00 97.63           C  
ATOM   3357  CG  LYS A 654      58.608  27.856  36.132  1.00 99.46           C  
ATOM   3358  CD  LYS A 654      58.110  28.472  37.430  1.00104.28           C  
ATOM   3359  CE  LYS A 654      59.189  28.524  38.503  1.00106.68           C  
ATOM   3360  NZ  LYS A 654      58.654  29.092  39.782  1.00106.16           N  
ATOM   3361  N   CYS A 655      59.887  25.720  33.527  1.00 98.43           N  
ATOM   3362  CA  CYS A 655      60.802  24.582  33.514  1.00 96.20           C  
ATOM   3363  C   CYS A 655      61.792  24.664  34.666  1.00 95.65           C  
ATOM   3364  O   CYS A 655      62.348  25.727  34.948  1.00 98.53           O  
ATOM   3365  CB  CYS A 655      61.575  24.519  32.199  1.00 96.79           C  
ATOM   3366  SG  CYS A 655      60.582  24.222  30.727  1.00 99.62           S  
ATOM   3367  N   LEU A 656      62.009  23.540  35.335  1.00 92.49           N  
ATOM   3368  CA  LEU A 656      63.055  23.460  36.331  1.00 89.86           C  
ATOM   3369  C   LEU A 656      64.267  22.798  35.682  1.00 94.54           C  
ATOM   3370  O   LEU A 656      64.294  21.580  35.450  1.00 98.19           O  
ATOM   3371  CB  LEU A 656      62.592  22.676  37.550  1.00 86.30           C  
ATOM   3372  CG  LEU A 656      63.115  23.145  38.905  1.00 85.44           C  
ATOM   3373  CD1 LEU A 656      62.910  22.031  39.910  1.00 88.06           C  
ATOM   3374  CD2 LEU A 656      64.587  23.576  38.874  1.00 84.13           C  
ATOM   3375  N   CYS A 657      65.273  23.614  35.397  1.00 93.43           N  
ATOM   3376  CA  CYS A 657      66.428  23.163  34.650  1.00 93.20           C  
ATOM   3377  C   CYS A 657      67.521  22.576  35.535  1.00 93.58           C  
ATOM   3378  O   CYS A 657      67.703  23.004  36.681  1.00 91.92           O  
ATOM   3379  CB  CYS A 657      66.976  24.317  33.824  1.00 92.90           C  
ATOM   3380  SG  CYS A 657      65.709  25.081  32.803  1.00 95.62           S  
ATOM   3381  N   LYS A 658      68.236  21.589  34.990  1.00 92.03           N  
ATOM   3382  CA  LYS A 658      69.435  21.051  35.624  1.00 87.69           C  
ATOM   3383  C   LYS A 658      70.571  22.068  35.489  1.00 85.29           C  
ATOM   3384  O   LYS A 658      70.575  22.882  34.558  1.00 86.04           O  
ATOM   3385  CB  LYS A 658      69.830  19.718  34.993  1.00 88.02           C  
ATOM   3386  CG  LYS A 658      68.715  18.680  34.926  1.00 88.62           C  
ATOM   3387  CD  LYS A 658      68.463  17.997  36.276  1.00 90.05           C  
ATOM   3388  CE  LYS A 658      67.216  17.094  36.220  1.00 89.57           C  
ATOM   3389  NZ  LYS A 658      65.966  17.879  35.952  1.00 87.91           N  
ATOM   3390  N   LYS A 659      71.520  22.029  36.424  1.00 82.39           N  
ATOM   3391  CA  LYS A 659      72.612  23.000  36.474  1.00 78.09           C  
ATOM   3392  C   LYS A 659      73.319  23.086  35.126  1.00 79.88           C  
ATOM   3393  O   LYS A 659      73.626  22.065  34.503  1.00 82.32           O  
ATOM   3394  CB  LYS A 659      73.598  22.623  37.574  1.00 75.77           C  
ATOM   3395  CG  LYS A 659      74.419  23.769  38.143  1.00 76.33           C  
ATOM   3396  CD  LYS A 659      75.309  23.259  39.274  1.00 77.03           C  
ATOM   3397  CE  LYS A 659      76.538  24.129  39.446  1.00 79.80           C  
ATOM   3398  NZ  LYS A 659      77.746  23.325  39.833  1.00 80.85           N  
ATOM   3399  N   GLY A 660      73.546  24.311  34.665  1.00 80.76           N  
ATOM   3400  CA  GLY A 660      74.258  24.537  33.410  1.00 79.92           C  
ATOM   3401  C   GLY A 660      73.385  24.503  32.171  1.00 79.21           C  
ATOM   3402  O   GLY A 660      73.895  24.404  31.058  1.00 78.05           O  
ATOM   3403  N   TYR A 661      72.070  24.561  32.360  1.00 79.91           N  
ATOM   3404  CA  TYR A 661      71.153  24.754  31.247  1.00 82.54           C  
ATOM   3405  C   TYR A 661      70.243  25.928  31.547  1.00 88.30           C  
ATOM   3406  O   TYR A 661      69.439  25.882  32.474  1.00 94.04           O  
ATOM   3407  CB  TYR A 661      70.373  23.477  30.922  1.00 80.40           C  
ATOM   3408  CG  TYR A 661      71.288  22.369  30.469  1.00 80.45           C  
ATOM   3409  CD1 TYR A 661      71.757  21.420  31.376  1.00 79.18           C  
ATOM   3410  CD2 TYR A 661      71.729  22.293  29.142  1.00 80.22           C  
ATOM   3411  CE1 TYR A 661      72.619  20.414  30.979  1.00 81.81           C  
ATOM   3412  CE2 TYR A 661      72.602  21.282  28.729  1.00 80.00           C  
ATOM   3413  CZ  TYR A 661      73.044  20.349  29.659  1.00 82.36           C  
ATOM   3414  OH  TYR A 661      73.908  19.341  29.295  1.00 82.56           O  
ATOM   3415  N   LEU A 662      70.397  26.987  30.761  1.00 88.35           N  
ATOM   3416  CA  LEU A 662      69.681  28.231  30.989  1.00 89.04           C  
ATOM   3417  C   LEU A 662      68.609  28.461  29.925  1.00 87.84           C  
ATOM   3418  O   LEU A 662      68.577  27.767  28.905  1.00 86.21           O  
ATOM   3419  CB  LEU A 662      70.665  29.411  31.035  1.00 91.76           C  
ATOM   3420  CG  LEU A 662      71.856  29.296  31.995  1.00 93.76           C  
ATOM   3421  CD1 LEU A 662      73.135  28.906  31.253  1.00 93.98           C  
ATOM   3422  CD2 LEU A 662      72.062  30.598  32.744  1.00 94.89           C  
ATOM   3423  N   GLY A 663      67.735  29.435  30.179  1.00 88.14           N  
ATOM   3424  CA  GLY A 663      66.649  29.785  29.269  1.00 87.34           C  
ATOM   3425  C   GLY A 663      65.308  29.203  29.686  1.00 87.46           C  
ATOM   3426  O   GLY A 663      65.259  28.276  30.496  1.00 85.34           O  
ATOM   3427  N   PRO A 664      64.208  29.740  29.125  1.00 88.60           N  
ATOM   3428  CA  PRO A 664      62.836  29.310  29.417  1.00 89.78           C  
ATOM   3429  C   PRO A 664      62.558  27.810  29.246  1.00 92.75           C  
ATOM   3430  O   PRO A 664      61.604  27.306  29.841  1.00 96.09           O  
ATOM   3431  CB  PRO A 664      61.993  30.119  28.423  1.00 88.57           C  
ATOM   3432  CG  PRO A 664      62.951  30.632  27.410  1.00 89.29           C  
ATOM   3433  CD  PRO A 664      64.224  30.840  28.149  1.00 89.09           C  
ATOM   3434  N   GLN A 665      63.362  27.111  28.445  1.00 91.58           N  
ATOM   3435  CA  GLN A 665      63.205  25.663  28.266  1.00 89.25           C  
ATOM   3436  C   GLN A 665      64.510  24.912  28.514  1.00 92.14           C  
ATOM   3437  O   GLN A 665      64.635  23.740  28.158  1.00 93.53           O  
ATOM   3438  CB  GLN A 665      62.682  25.326  26.867  1.00 87.59           C  
ATOM   3439  CG  GLN A 665      61.215  25.635  26.637  1.00 88.07           C  
ATOM   3440  CD  GLN A 665      60.953  27.104  26.334  1.00 86.73           C  
ATOM   3441  OE1 GLN A 665      61.418  27.639  25.327  1.00 85.15           O  
ATOM   3442  NE2 GLN A 665      60.194  27.760  27.208  1.00 85.73           N  
ATOM   3443  N   CYS A 666      65.476  25.583  29.137  1.00 93.75           N  
ATOM   3444  CA  CYS A 666      66.780  24.986  29.437  1.00 92.71           C  
ATOM   3445  C   CYS A 666      67.525  24.657  28.149  1.00 91.62           C  
ATOM   3446  O   CYS A 666      68.271  23.680  28.097  1.00 90.68           O  
ATOM   3447  CB  CYS A 666      66.620  23.707  30.267  1.00 93.43           C  
ATOM   3448  SG  CYS A 666      65.217  23.687  31.396  1.00 96.15           S  
ATOM   3449  N   GLU A 667      67.321  25.470  27.115  1.00 91.03           N  
ATOM   3450  CA  GLU A 667      67.820  25.146  25.778  1.00 93.09           C  
ATOM   3451  C   GLU A 667      69.261  25.584  25.533  1.00 94.90           C  
ATOM   3452  O   GLU A 667      69.814  25.320  24.470  1.00 95.41           O  
ATOM   3453  CB  GLU A 667      66.877  25.688  24.686  1.00 93.19           C  
ATOM   3454  CG  GLU A 667      66.828  27.215  24.536  1.00 94.08           C  
ATOM   3455  CD  GLU A 667      65.826  27.898  25.468  1.00 94.72           C  
ATOM   3456  OE1 GLU A 667      65.506  27.342  26.544  1.00 93.89           O  
ATOM   3457  OE2 GLU A 667      65.366  29.011  25.119  1.00 94.50           O  
ATOM   3458  N   HIS A 668      69.866  26.240  26.520  1.00 99.12           N  
ATOM   3459  CA  HIS A 668      71.194  26.818  26.354  1.00104.55           C  
ATOM   3460  C   HIS A 668      72.226  26.249  27.303  1.00106.68           C  
ATOM   3461  O   HIS A 668      71.927  25.974  28.458  1.00105.33           O  
ATOM   3462  CB  HIS A 668      71.140  28.334  26.523  1.00109.43           C  
ATOM   3463  CG  HIS A 668      70.538  29.049  25.357  1.00113.00           C  
ATOM   3464  ND1 HIS A 668      69.845  30.233  25.488  1.00115.21           N  
ATOM   3465  CD2 HIS A 668      70.516  28.742  24.038  1.00114.43           C  
ATOM   3466  CE1 HIS A 668      69.432  30.631  24.298  1.00116.86           C  
ATOM   3467  NE2 HIS A 668      69.822  29.742  23.401  1.00116.57           N  
ATOM   3468  N   HIS A 669      73.449  26.100  26.804  1.00112.88           N  
ATOM   3469  CA  HIS A 669      74.557  25.586  27.593  1.00121.22           C  
ATOM   3470  C   HIS A 669      75.887  26.181  27.134  1.00127.11           C  
ATOM   3471  O   HIS A 669      76.250  26.065  25.963  1.00130.09           O  
ATOM   3472  CB  HIS A 669      74.593  24.052  27.513  1.00122.94           C  
ATOM   3473  CG  HIS A 669      75.834  23.439  28.091  1.00126.14           C  
ATOM   3474  ND1 HIS A 669      75.997  23.206  29.440  1.00126.88           N  
ATOM   3475  CD2 HIS A 669      76.972  23.010  27.495  1.00127.62           C  
ATOM   3476  CE1 HIS A 669      77.185  22.665  29.651  1.00127.59           C  
ATOM   3477  NE2 HIS A 669      77.796  22.535  28.487  1.00128.24           N  
ATOM   3478  N   HIS A 670      76.583  26.835  28.064  1.00132.23           N  
ATOM   3479  CA  HIS A 670      78.003  27.227  27.935  1.00137.03           C  
ATOM   3480  C   HIS A 670      78.345  28.312  28.954  1.00138.31           C  
ATOM   3481  O   HIS A 670      77.770  28.346  30.046  1.00138.70           O  
ATOM   3482  CB  HIS A 670      78.419  27.640  26.503  1.00139.36           C  
ATOM   3483  CG  HIS A 670      77.694  28.839  25.965  1.00142.66           C  
ATOM   3484  ND1 HIS A 670      76.757  28.751  24.956  1.00143.66           N  
ATOM   3485  CD2 HIS A 670      77.781  30.153  26.283  1.00143.93           C  
ATOM   3486  CE1 HIS A 670      76.292  29.958  24.684  1.00144.37           C  
ATOM   3487  NE2 HIS A 670      76.896  30.826  25.475  1.00144.49           N  
TER    3488      HIS A 670                                                      
ATOM   3489  N   HIS B 214      14.027   6.972  73.619  1.00121.99           N  
ATOM   3490  CA  HIS B 214      13.898   6.236  74.915  1.00120.58           C  
ATOM   3491  C   HIS B 214      12.817   6.813  75.839  1.00113.99           C  
ATOM   3492  O   HIS B 214      11.731   7.186  75.382  1.00111.97           O  
ATOM   3493  CB  HIS B 214      15.255   6.104  75.644  1.00125.72           C  
ATOM   3494  CG  HIS B 214      16.318   7.046  75.161  1.00129.18           C  
ATOM   3495  ND1 HIS B 214      17.604   6.630  74.881  1.00130.86           N  
ATOM   3496  CD2 HIS B 214      16.290   8.379  74.909  1.00130.51           C  
ATOM   3497  CE1 HIS B 214      18.322   7.664  74.479  1.00131.54           C  
ATOM   3498  NE2 HIS B 214      17.547   8.736  74.484  1.00131.49           N  
ATOM   3499  N   ASN B 215      13.121   6.875  77.134  1.00106.99           N  
ATOM   3500  CA  ASN B 215      12.148   7.279  78.144  1.00101.17           C  
ATOM   3501  C   ASN B 215      12.482   8.624  78.780  1.00 95.40           C  
ATOM   3502  O   ASN B 215      11.967   8.967  79.845  1.00 89.80           O  
ATOM   3503  CB  ASN B 215      12.032   6.194  79.220  1.00100.59           C  
ATOM   3504  CG  ASN B 215      11.661   4.839  78.650  1.00 98.63           C  
ATOM   3505  OD1 ASN B 215      11.025   4.736  77.598  1.00 96.60           O  
ATOM   3506  ND2 ASN B 215      12.055   3.787  79.349  1.00100.40           N  
ATOM   3507  N   CYS B 216      13.349   9.377  78.113  1.00 94.41           N  
ATOM   3508  CA  CYS B 216      13.798  10.667  78.614  1.00 91.69           C  
ATOM   3509  C   CYS B 216      12.702  11.705  78.564  1.00 88.58           C  
ATOM   3510  O   CYS B 216      11.798  11.638  77.730  1.00 90.34           O  
ATOM   3511  CB  CYS B 216      14.999  11.170  77.819  1.00 94.68           C  
ATOM   3512  SG  CYS B 216      16.586  10.417  78.238  1.00100.32           S  
ATOM   3513  N   PHE B 217      12.798  12.663  79.474  1.00 84.48           N  
ATOM   3514  CA  PHE B 217      11.909  13.799  79.494  1.00 82.89           C  
ATOM   3515  C   PHE B 217      12.589  15.017  78.870  1.00 86.58           C  
ATOM   3516  O   PHE B 217      13.716  14.948  78.387  1.00 89.22           O  
ATOM   3517  CB  PHE B 217      11.450  14.078  80.924  1.00 82.23           C  
ATOM   3518  CG  PHE B 217      10.339  13.186  81.380  1.00 81.29           C  
ATOM   3519  CD1 PHE B 217      10.597  11.884  81.790  1.00 81.66           C  
ATOM   3520  CD2 PHE B 217       9.025  13.645  81.392  1.00 82.13           C  
ATOM   3521  CE1 PHE B 217       9.568  11.050  82.203  1.00 82.02           C  
ATOM   3522  CE2 PHE B 217       7.989  12.823  81.803  1.00 82.86           C  
ATOM   3523  CZ  PHE B 217       8.262  11.517  82.208  1.00 83.42           C  
ATOM   3524  N   CYS B 218      11.910  16.147  78.933  1.00 90.97           N  
ATOM   3525  CA  CYS B 218      12.138  17.239  78.019  1.00 91.84           C  
ATOM   3526  C   CYS B 218      11.939  18.562  78.759  1.00 93.48           C  
ATOM   3527  O   CYS B 218      11.020  18.673  79.584  1.00 94.10           O  
ATOM   3528  CB  CYS B 218      11.052  17.104  76.969  1.00 93.98           C  
ATOM   3529  SG  CYS B 218      11.452  17.675  75.408  1.00 97.18           S  
ATOM   3530  N   ILE B 219      12.775  19.562  78.486  1.00 92.27           N  
ATOM   3531  CA  ILE B 219      12.498  20.917  79.014  1.00 94.43           C  
ATOM   3532  C   ILE B 219      12.328  21.976  77.953  1.00 90.49           C  
ATOM   3533  O   ILE B 219      13.033  21.982  76.942  1.00 90.78           O  
ATOM   3534  CB  ILE B 219      13.511  21.424  80.068  1.00 96.91           C  
ATOM   3535  CG1 ILE B 219      14.898  20.892  79.768  1.00100.71           C  
ATOM   3536  CG2 ILE B 219      13.046  21.062  81.474  1.00 99.16           C  
ATOM   3537  CD1 ILE B 219      15.613  20.376  80.974  1.00106.93           C  
ATOM   3538  N   GLN B 220      11.383  22.876  78.213  1.00 87.93           N  
ATOM   3539  CA  GLN B 220      11.059  23.960  77.301  1.00 87.07           C  
ATOM   3540  C   GLN B 220      11.079  25.310  78.033  1.00 87.30           C  
ATOM   3541  O   GLN B 220      10.464  25.456  79.089  1.00 90.27           O  
ATOM   3542  CB  GLN B 220       9.699  23.699  76.664  1.00 86.08           C  
ATOM   3543  CG  GLN B 220       9.446  24.504  75.420  1.00 93.67           C  
ATOM   3544  CD  GLN B 220      10.025  23.858  74.190  1.00100.49           C  
ATOM   3545  OE1 GLN B 220       9.538  22.818  73.742  1.00102.56           O  
ATOM   3546  NE2 GLN B 220      11.068  24.474  73.622  1.00104.41           N  
ATOM   3547  N   GLU B 221      11.806  26.284  77.485  1.00 87.68           N  
ATOM   3548  CA  GLU B 221      11.888  27.612  78.098  1.00 85.81           C  
ATOM   3549  C   GLU B 221      10.551  28.327  77.941  1.00 86.07           C  
ATOM   3550  O   GLU B 221      10.036  28.430  76.827  1.00 88.44           O  
ATOM   3551  CB  GLU B 221      13.018  28.434  77.486  1.00 80.91           C  
ATOM   3552  CG  GLU B 221      13.362  29.691  78.264  1.00 82.26           C  
ATOM   3553  CD  GLU B 221      14.205  30.674  77.460  1.00 89.09           C  
ATOM   3554  OE1 GLU B 221      15.274  30.269  76.961  1.00 91.31           O  
ATOM   3555  OE2 GLU B 221      13.812  31.860  77.335  1.00 94.07           O  
ATOM   3556  N   VAL B 222       9.990  28.797  79.057  1.00 82.92           N  
ATOM   3557  CA  VAL B 222       8.671  29.426  79.055  1.00 82.80           C  
ATOM   3558  C   VAL B 222       8.785  30.937  79.108  1.00 88.53           C  
ATOM   3559  O   VAL B 222       8.088  31.644  78.377  1.00 96.02           O  
ATOM   3560  CB  VAL B 222       7.806  28.962  80.243  1.00 81.71           C  
ATOM   3561  CG1 VAL B 222       6.444  29.626  80.186  1.00 77.42           C  
ATOM   3562  CG2 VAL B 222       7.668  27.436  80.261  1.00 83.73           C  
ATOM   3563  N   VAL B 223       9.660  31.417  79.990  1.00 88.60           N  
ATOM   3564  CA  VAL B 223       9.866  32.838  80.241  1.00 85.94           C  
ATOM   3565  C   VAL B 223      11.311  33.045  80.688  1.00 86.97           C  
ATOM   3566  O   VAL B 223      11.903  32.168  81.326  1.00 85.49           O  
ATOM   3567  CB  VAL B 223       8.883  33.356  81.332  1.00 85.63           C  
ATOM   3568  CG1 VAL B 223       9.450  34.548  82.107  1.00 83.16           C  
ATOM   3569  CG2 VAL B 223       7.544  33.721  80.724  1.00 86.78           C  
ATOM   3570  N   SER B 224      11.878  34.196  80.337  1.00 87.11           N  
ATOM   3571  CA  SER B 224      13.141  34.617  80.911  1.00 86.14           C  
ATOM   3572  C   SER B 224      13.037  36.039  81.446  1.00 89.37           C  
ATOM   3573  O   SER B 224      11.953  36.500  81.782  1.00 92.39           O  
ATOM   3574  CB  SER B 224      14.270  34.477  79.901  1.00 87.08           C  
ATOM   3575  OG  SER B 224      14.159  35.437  78.882  1.00 92.05           O  
ATOM   3576  N   GLY B 225      14.169  36.725  81.560  1.00 92.17           N  
ATOM   3577  CA  GLY B 225      14.196  38.074  82.111  1.00 90.13           C  
ATOM   3578  C   GLY B 225      13.802  38.185  83.572  1.00 90.72           C  
ATOM   3579  O   GLY B 225      13.696  39.283  84.098  1.00 97.08           O  
ATOM   3580  N   LEU B 226      13.573  37.055  84.229  1.00 91.11           N  
ATOM   3581  CA  LEU B 226      13.263  37.035  85.656  1.00 91.61           C  
ATOM   3582  C   LEU B 226      14.505  37.371  86.486  1.00 93.43           C  
ATOM   3583  O   LEU B 226      15.641  37.216  86.021  1.00 94.81           O  
ATOM   3584  CB  LEU B 226      12.723  35.659  86.068  1.00 91.46           C  
ATOM   3585  CG  LEU B 226      11.508  35.128  85.307  1.00 91.53           C  
ATOM   3586  CD1 LEU B 226      11.382  33.648  85.524  1.00 91.50           C  
ATOM   3587  CD2 LEU B 226      10.229  35.844  85.721  1.00 92.02           C  
ATOM   3588  N   ARG B 227      14.291  37.832  87.712  1.00 89.72           N  
ATOM   3589  CA  ARG B 227      15.403  38.096  88.598  1.00 92.13           C  
ATOM   3590  C   ARG B 227      15.343  37.179  89.795  1.00 93.52           C  
ATOM   3591  O   ARG B 227      14.437  37.285  90.612  1.00 97.98           O  
ATOM   3592  CB  ARG B 227      15.444  39.562  89.034  1.00 94.40           C  
ATOM   3593  CG  ARG B 227      14.142  40.300  88.884  1.00 95.23           C  
ATOM   3594  CD  ARG B 227      14.039  41.436  89.858  1.00 97.37           C  
ATOM   3595  NE  ARG B 227      12.651  41.869  89.962  1.00102.63           N  
ATOM   3596  CZ  ARG B 227      12.207  43.079  89.641  1.00106.10           C  
ATOM   3597  NH1 ARG B 227      13.048  44.014  89.212  1.00107.91           N  
ATOM   3598  NH2 ARG B 227      10.915  43.360  89.771  1.00108.00           N  
ATOM   3599  N   GLN B 228      16.330  36.292  89.894  1.00 92.64           N  
ATOM   3600  CA  GLN B 228      16.385  35.274  90.940  1.00 89.26           C  
ATOM   3601  C   GLN B 228      15.024  34.675  91.277  1.00 88.61           C  
ATOM   3602  O   GLN B 228      14.451  34.959  92.334  1.00 86.33           O  
ATOM   3603  CB  GLN B 228      17.084  35.793  92.184  1.00 89.30           C  
ATOM   3604  CG  GLN B 228      18.572  35.607  92.115  1.00 96.55           C  
ATOM   3605  CD  GLN B 228      19.256  35.938  93.417  1.00101.21           C  
ATOM   3606  OE1 GLN B 228      19.333  37.110  93.820  1.00 98.96           O  
ATOM   3607  NE2 GLN B 228      19.763  34.902  94.091  1.00103.58           N  
ATOM   3608  N   PRO B 229      14.503  33.838  90.368  1.00 89.51           N  
ATOM   3609  CA  PRO B 229      13.267  33.138  90.627  1.00 90.65           C  
ATOM   3610  C   PRO B 229      13.494  32.195  91.779  1.00 94.32           C  
ATOM   3611  O   PRO B 229      14.603  31.668  91.943  1.00 96.70           O  
ATOM   3612  CB  PRO B 229      13.039  32.348  89.345  1.00 93.04           C  
ATOM   3613  CG  PRO B 229      14.380  32.202  88.746  1.00 96.74           C  
ATOM   3614  CD  PRO B 229      15.060  33.488  89.053  1.00 93.27           C  
ATOM   3615  N   VAL B 230      12.453  31.996  92.577  1.00 93.84           N  
ATOM   3616  CA  VAL B 230      12.554  31.172  93.767  1.00 90.15           C  
ATOM   3617  C   VAL B 230      11.623  29.978  93.667  1.00 88.78           C  
ATOM   3618  O   VAL B 230      11.913  28.921  94.218  1.00 92.27           O  
ATOM   3619  CB  VAL B 230      12.308  32.030  95.021  1.00 90.65           C  
ATOM   3620  CG1 VAL B 230      11.496  31.292  96.067  1.00 90.83           C  
ATOM   3621  CG2 VAL B 230      13.644  32.474  95.584  1.00 94.85           C  
ATOM   3622  N   GLY B 231      10.530  30.160  92.928  1.00 87.60           N  
ATOM   3623  CA  GLY B 231       9.482  29.159  92.752  1.00 86.82           C  
ATOM   3624  C   GLY B 231       8.275  29.740  92.028  1.00 89.71           C  
ATOM   3625  O   GLY B 231       8.217  30.948  91.750  1.00 91.85           O  
ATOM   3626  N   ALA B 232       7.305  28.886  91.714  1.00 88.45           N  
ATOM   3627  CA  ALA B 232       6.103  29.337  91.024  1.00 88.92           C  
ATOM   3628  C   ALA B 232       4.904  28.494  91.412  1.00 89.88           C  
ATOM   3629  O   ALA B 232       5.057  27.307  91.676  1.00 94.65           O  
ATOM   3630  CB  ALA B 232       6.313  29.300  89.527  1.00 89.05           C  
ATOM   3631  N   LEU B 233       3.721  29.109  91.454  1.00 86.43           N  
ATOM   3632  CA  LEU B 233       2.476  28.387  91.756  1.00 88.91           C  
ATOM   3633  C   LEU B 233       1.234  29.138  91.272  1.00 90.46           C  
ATOM   3634  O   LEU B 233       1.313  30.317  90.912  1.00 94.07           O  
ATOM   3635  CB  LEU B 233       2.349  28.101  93.260  1.00 87.95           C  
ATOM   3636  CG  LEU B 233       2.000  29.249  94.210  1.00 86.93           C  
ATOM   3637  CD1 LEU B 233       1.624  28.694  95.545  1.00 84.56           C  
ATOM   3638  CD2 LEU B 233       3.175  30.213  94.365  1.00 91.91           C  
ATOM   3639  N   HIS B 234       0.097  28.445  91.275  1.00 84.23           N  
ATOM   3640  CA  HIS B 234      -1.183  29.023  90.893  1.00 83.06           C  
ATOM   3641  C   HIS B 234      -2.045  29.332  92.128  1.00 86.77           C  
ATOM   3642  O   HIS B 234      -1.692  28.967  93.248  1.00 92.37           O  
ATOM   3643  CB  HIS B 234      -1.918  28.036  90.004  1.00 85.71           C  
ATOM   3644  CG  HIS B 234      -2.358  26.801  90.723  1.00 84.62           C  
ATOM   3645  ND1 HIS B 234      -1.504  25.755  90.994  1.00 87.18           N  
ATOM   3646  CD2 HIS B 234      -3.554  26.456  91.248  1.00 81.47           C  
ATOM   3647  CE1 HIS B 234      -2.159  24.811  91.646  1.00 86.57           C  
ATOM   3648  NE2 HIS B 234      -3.404  25.216  91.817  1.00 85.18           N  
ATOM   3649  N   SER B 235      -3.190  29.971  91.925  1.00 85.98           N  
ATOM   3650  CA  SER B 235      -4.054  30.339  93.046  1.00 87.43           C  
ATOM   3651  C   SER B 235      -5.327  29.481  93.159  1.00 89.32           C  
ATOM   3652  O   SER B 235      -6.142  29.681  94.058  1.00 93.88           O  
ATOM   3653  CB  SER B 235      -4.420  31.820  92.955  1.00 89.25           C  
ATOM   3654  OG  SER B 235      -5.207  32.074  91.805  1.00 90.64           O  
ATOM   3655  N   GLY B 236      -5.489  28.530  92.246  1.00 85.84           N  
ATOM   3656  CA  GLY B 236      -6.614  27.613  92.268  1.00 82.75           C  
ATOM   3657  C   GLY B 236      -7.958  28.291  92.152  1.00 86.43           C  
ATOM   3658  O   GLY B 236      -8.927  27.864  92.782  1.00 89.10           O  
ATOM   3659  N   ASP B 237      -8.022  29.353  91.357  1.00 88.08           N  
ATOM   3660  CA  ASP B 237      -9.266  30.096  91.187  1.00 90.87           C  
ATOM   3661  C   ASP B 237      -9.876  29.905  89.800  1.00 92.86           C  
ATOM   3662  O   ASP B 237     -10.926  30.488  89.489  1.00 92.50           O  
ATOM   3663  CB  ASP B 237      -9.050  31.582  91.491  1.00 93.32           C  
ATOM   3664  CG  ASP B 237      -8.023  32.232  90.582  1.00 94.44           C  
ATOM   3665  OD1 ASP B 237      -7.414  31.532  89.744  1.00 93.20           O  
ATOM   3666  OD2 ASP B 237      -7.828  33.462  90.711  1.00 97.07           O  
ATOM   3667  N   GLY B 238      -9.207  29.099  88.973  1.00 91.84           N  
ATOM   3668  CA  GLY B 238      -9.704  28.754  87.642  1.00 92.05           C  
ATOM   3669  C   GLY B 238      -9.034  29.526  86.529  1.00 95.10           C  
ATOM   3670  O   GLY B 238      -9.047  29.091  85.380  1.00 99.46           O  
ATOM   3671  N   SER B 239      -8.469  30.683  86.870  1.00 96.19           N  
ATOM   3672  CA  SER B 239      -7.706  31.508  85.940  1.00 94.82           C  
ATOM   3673  C   SER B 239      -6.331  30.940  85.955  1.00 98.07           C  
ATOM   3674  O   SER B 239      -5.657  31.026  86.975  1.00111.72           O  
ATOM   3675  CB  SER B 239      -7.633  32.943  86.455  1.00 93.94           C  
ATOM   3676  OG  SER B 239      -6.926  33.016  87.688  1.00 87.05           O  
ATOM   3677  N   GLN B 240      -5.894  30.345  84.860  1.00 94.13           N  
ATOM   3678  CA  GLN B 240      -4.670  29.544  84.909  1.00 94.18           C  
ATOM   3679  C   GLN B 240      -3.387  30.378  85.054  1.00 95.25           C  
ATOM   3680  O   GLN B 240      -2.415  30.203  84.318  1.00101.44           O  
ATOM   3681  CB  GLN B 240      -4.608  28.604  83.711  1.00 94.11           C  
ATOM   3682  CG  GLN B 240      -5.591  27.476  83.809  1.00 94.80           C  
ATOM   3683  CD  GLN B 240      -5.932  26.903  82.462  1.00 97.66           C  
ATOM   3684  OE1 GLN B 240      -5.118  26.947  81.533  1.00100.00           O  
ATOM   3685  NE2 GLN B 240      -7.144  26.361  82.339  1.00 93.87           N  
ATOM   3686  N   ARG B 241      -3.412  31.284  86.024  1.00 92.82           N  
ATOM   3687  CA  ARG B 241      -2.312  32.174  86.334  1.00 89.16           C  
ATOM   3688  C   ARG B 241      -1.178  31.391  86.952  1.00 88.70           C  
ATOM   3689  O   ARG B 241      -1.415  30.422  87.662  1.00 93.87           O  
ATOM   3690  CB  ARG B 241      -2.796  33.234  87.310  1.00 88.34           C  
ATOM   3691  CG  ARG B 241      -3.002  34.585  86.674  1.00 90.00           C  
ATOM   3692  CD  ARG B 241      -4.418  35.115  86.818  1.00 90.51           C  
ATOM   3693  NE  ARG B 241      -5.021  34.942  88.140  1.00 91.53           N  
ATOM   3694  CZ  ARG B 241      -5.185  35.923  89.022  1.00 91.55           C  
ATOM   3695  NH1 ARG B 241      -4.771  37.155  88.737  1.00 88.48           N  
ATOM   3696  NH2 ARG B 241      -5.775  35.676  90.188  1.00 90.42           N  
ATOM   3697  N   LEU B 242       0.051  31.782  86.643  1.00 83.23           N  
ATOM   3698  CA  LEU B 242       1.197  31.234  87.328  1.00 85.62           C  
ATOM   3699  C   LEU B 242       1.940  32.384  87.985  1.00 89.16           C  
ATOM   3700  O   LEU B 242       2.387  33.323  87.323  1.00 87.97           O  
ATOM   3701  CB  LEU B 242       2.106  30.449  86.379  1.00 86.21           C  
ATOM   3702  CG  LEU B 242       3.299  29.709  87.006  1.00 85.24           C  
ATOM   3703  CD1 LEU B 242       2.842  28.679  88.009  1.00 80.85           C  
ATOM   3704  CD2 LEU B 242       4.171  29.047  85.939  1.00 86.37           C  
ATOM   3705  N   PHE B 243       2.032  32.317  89.304  1.00 90.98           N  
ATOM   3706  CA  PHE B 243       2.650  33.366  90.085  1.00 89.55           C  
ATOM   3707  C   PHE B 243       4.090  32.966  90.338  1.00 88.84           C  
ATOM   3708  O   PHE B 243       4.336  31.922  90.950  1.00 91.09           O  
ATOM   3709  CB  PHE B 243       1.890  33.534  91.404  1.00 87.74           C  
ATOM   3710  CG  PHE B 243       0.473  34.002  91.232  1.00 85.49           C  
ATOM   3711  CD1 PHE B 243      -0.551  33.091  91.013  1.00 83.39           C  
ATOM   3712  CD2 PHE B 243       0.163  35.365  91.297  1.00 88.33           C  
ATOM   3713  CE1 PHE B 243      -1.872  33.522  90.859  1.00 88.20           C  
ATOM   3714  CE2 PHE B 243      -1.158  35.816  91.146  1.00 90.74           C  
ATOM   3715  CZ  PHE B 243      -2.183  34.888  90.922  1.00 89.28           C  
ATOM   3716  N   ILE B 244       5.042  33.763  89.855  1.00 85.55           N  
ATOM   3717  CA  ILE B 244       6.452  33.413  90.069  1.00 87.73           C  
ATOM   3718  C   ILE B 244       7.137  34.288  91.115  1.00 86.08           C  
ATOM   3719  O   ILE B 244       7.092  35.509  91.032  1.00 87.30           O  
ATOM   3720  CB  ILE B 244       7.329  33.247  88.753  1.00 87.32           C  
ATOM   3721  CG1 ILE B 244       8.662  33.951  88.930  1.00 94.53           C  
ATOM   3722  CG2 ILE B 244       6.660  33.745  87.463  1.00 78.18           C  
ATOM   3723  CD1 ILE B 244       9.772  33.322  88.177  1.00102.66           C  
ATOM   3724  N   LEU B 245       7.762  33.650  92.100  1.00 84.45           N  
ATOM   3725  CA  LEU B 245       8.424  34.382  93.175  1.00 85.16           C  
ATOM   3726  C   LEU B 245       9.827  34.790  92.777  1.00 88.58           C  
ATOM   3727  O   LEU B 245      10.612  33.965  92.301  1.00 92.92           O  
ATOM   3728  CB  LEU B 245       8.519  33.554  94.457  1.00 82.28           C  
ATOM   3729  CG  LEU B 245       7.507  32.510  94.940  1.00 82.86           C  
ATOM   3730  CD1 LEU B 245       7.622  32.440  96.447  1.00 84.01           C  
ATOM   3731  CD2 LEU B 245       6.058  32.775  94.562  1.00 82.33           C  
ATOM   3732  N   GLU B 246      10.143  36.062  92.989  1.00 87.27           N  
ATOM   3733  CA  GLU B 246      11.507  36.547  92.869  1.00 83.81           C  
ATOM   3734  C   GLU B 246      12.051  36.867  94.261  1.00 85.36           C  
ATOM   3735  O   GLU B 246      11.384  37.526  95.074  1.00 83.69           O  
ATOM   3736  CB  GLU B 246      11.561  37.764  91.959  1.00 82.15           C  
ATOM   3737  CG  GLU B 246      11.283  37.427  90.518  1.00 85.39           C  
ATOM   3738  CD  GLU B 246      11.231  38.644  89.608  1.00 90.50           C  
ATOM   3739  OE1 GLU B 246      11.455  38.467  88.396  1.00 94.26           O  
ATOM   3740  OE2 GLU B 246      10.959  39.771  90.081  1.00 92.18           O  
ATOM   3741  N   LYS B 247      13.265  36.395  94.526  1.00 85.25           N  
ATOM   3742  CA  LYS B 247      13.880  36.476  95.854  1.00 86.41           C  
ATOM   3743  C   LYS B 247      13.977  37.877  96.455  1.00 87.58           C  
ATOM   3744  O   LYS B 247      13.856  38.024  97.668  1.00 89.98           O  
ATOM   3745  CB  LYS B 247      15.268  35.841  95.826  1.00 84.80           C  
ATOM   3746  CG  LYS B 247      15.737  35.349  97.164  1.00 84.79           C  
ATOM   3747  CD  LYS B 247      17.114  34.715  97.046  1.00 86.29           C  
ATOM   3748  CE  LYS B 247      17.677  34.390  98.418  1.00 86.24           C  
ATOM   3749  NZ  LYS B 247      18.989  33.746  98.266  1.00 90.09           N  
ATOM   3750  N   GLU B 248      14.212  38.895  95.626  1.00 86.72           N  
ATOM   3751  CA  GLU B 248      14.334  40.275  96.126  1.00 89.22           C  
ATOM   3752  C   GLU B 248      13.045  40.797  96.767  1.00 87.13           C  
ATOM   3753  O   GLU B 248      13.059  41.803  97.468  1.00 86.39           O  
ATOM   3754  CB  GLU B 248      14.797  41.229  95.023  1.00 94.57           C  
ATOM   3755  CG  GLU B 248      16.297  41.367  94.897  1.00101.85           C  
ATOM   3756  CD  GLU B 248      16.752  41.500  93.448  1.00110.29           C  
ATOM   3757  OE1 GLU B 248      16.534  40.548  92.655  1.00114.38           O  
ATOM   3758  OE2 GLU B 248      17.340  42.550  93.105  1.00112.70           O  
ATOM   3759  N   GLY B 249      11.938  40.106  96.525  1.00 86.77           N  
ATOM   3760  CA  GLY B 249      10.680  40.425  97.179  1.00 85.69           C  
ATOM   3761  C   GLY B 249       9.581  40.814  96.220  1.00 85.88           C  
ATOM   3762  O   GLY B 249       8.820  41.739  96.502  1.00 86.34           O  
ATOM   3763  N   TYR B 250       9.502  40.105  95.091  1.00 86.38           N  
ATOM   3764  CA  TYR B 250       8.462  40.328  94.088  1.00 86.37           C  
ATOM   3765  C   TYR B 250       7.734  39.033  93.725  1.00 88.42           C  
ATOM   3766  O   TYR B 250       8.358  37.971  93.687  1.00 92.87           O  
ATOM   3767  CB  TYR B 250       9.068  40.884  92.805  1.00 82.72           C  
ATOM   3768  CG  TYR B 250       9.927  42.118  92.944  1.00 81.90           C  
ATOM   3769  CD1 TYR B 250      11.311  42.013  93.105  1.00 81.03           C  
ATOM   3770  CD2 TYR B 250       9.369  43.392  92.856  1.00 79.08           C  
ATOM   3771  CE1 TYR B 250      12.113  43.151  93.200  1.00 80.87           C  
ATOM   3772  CE2 TYR B 250      10.158  44.529  92.951  1.00 79.05           C  
ATOM   3773  CZ  TYR B 250      11.531  44.406  93.123  1.00 80.32           C  
ATOM   3774  OH  TYR B 250      12.316  45.537  93.226  1.00 80.34           O  
ATOM   3775  N   VAL B 251       6.430  39.129  93.449  1.00 85.66           N  
ATOM   3776  CA  VAL B 251       5.669  38.045  92.808  1.00 87.45           C  
ATOM   3777  C   VAL B 251       5.113  38.548  91.477  1.00 87.42           C  
ATOM   3778  O   VAL B 251       4.365  39.521  91.443  1.00 92.91           O  
ATOM   3779  CB  VAL B 251       4.478  37.540  93.684  1.00 90.73           C  
ATOM   3780  CG1 VAL B 251       3.750  36.377  93.009  1.00 86.28           C  
ATOM   3781  CG2 VAL B 251       4.943  37.120  95.065  1.00 93.40           C  
ATOM   3782  N   LYS B 252       5.476  37.892  90.383  1.00 87.64           N  
ATOM   3783  CA  LYS B 252       4.967  38.267  89.061  1.00 87.89           C  
ATOM   3784  C   LYS B 252       3.929  37.269  88.542  1.00 89.72           C  
ATOM   3785  O   LYS B 252       3.984  36.072  88.862  1.00 92.00           O  
ATOM   3786  CB  LYS B 252       6.106  38.385  88.055  1.00 84.63           C  
ATOM   3787  CG  LYS B 252       7.022  39.552  88.283  1.00 85.25           C  
ATOM   3788  CD  LYS B 252       8.188  39.496  87.313  1.00 89.05           C  
ATOM   3789  CE  LYS B 252       9.181  40.612  87.565  1.00 91.88           C  
ATOM   3790  NZ  LYS B 252      10.480  40.394  86.855  1.00 92.83           N  
ATOM   3791  N   ILE B 253       2.991  37.769  87.740  1.00 85.39           N  
ATOM   3792  CA  ILE B 253       1.956  36.935  87.145  1.00 86.56           C  
ATOM   3793  C   ILE B 253       2.328  36.537  85.716  1.00 90.98           C  
ATOM   3794  O   ILE B 253       2.610  37.401  84.864  1.00 91.43           O  
ATOM   3795  CB  ILE B 253       0.582  37.660  87.123  1.00 83.47           C  
ATOM   3796  CG1 ILE B 253      -0.017  37.730  88.528  1.00 78.88           C  
ATOM   3797  CG2 ILE B 253      -0.386  36.969  86.160  1.00 80.77           C  
ATOM   3798  CD1 ILE B 253      -1.061  38.817  88.686  1.00 78.94           C  
ATOM   3799  N   LEU B 254       2.327  35.229  85.464  1.00 90.45           N  
ATOM   3800  CA  LEU B 254       2.428  34.711  84.106  1.00 88.21           C  
ATOM   3801  C   LEU B 254       1.075  34.235  83.635  1.00 90.24           C  
ATOM   3802  O   LEU B 254       0.509  33.265  84.147  1.00 97.24           O  
ATOM   3803  CB  LEU B 254       3.447  33.580  83.980  1.00 85.38           C  
ATOM   3804  CG  LEU B 254       3.466  32.903  82.601  1.00 81.64           C  
ATOM   3805  CD1 LEU B 254       3.829  33.888  81.488  1.00 80.63           C  
ATOM   3806  CD2 LEU B 254       4.409  31.710  82.604  1.00 78.02           C  
ATOM   3807  N   THR B 255       0.595  34.932  82.622  1.00 91.26           N  
ATOM   3808  CA  THR B 255      -0.700  34.743  82.004  1.00 89.37           C  
ATOM   3809  C   THR B 255      -0.684  33.415  81.246  1.00 92.45           C  
ATOM   3810  O   THR B 255       0.363  33.006  80.741  0.70 93.92           O  
ATOM   3811  CB  THR B 255      -0.967  35.991  81.123  1.00 90.47           C  
ATOM   3812  OG1 THR B 255      -2.116  36.689  81.606  1.00100.02           O  
ATOM   3813  CG2 THR B 255      -1.071  35.702  79.640  1.00 86.97           C  
ATOM   3814  N   PRO B 256      -1.833  32.713  81.191  1.00 95.02           N  
ATOM   3815  CA  PRO B 256      -1.866  31.357  80.625  1.00 91.02           C  
ATOM   3816  C   PRO B 256      -1.654  31.398  79.129  1.00 90.41           C  
ATOM   3817  O   PRO B 256      -1.555  30.360  78.483  1.00 94.07           O  
ATOM   3818  CB  PRO B 256      -3.288  30.889  80.929  1.00 88.44           C  
ATOM   3819  CG  PRO B 256      -4.073  32.124  80.974  1.00 91.49           C  
ATOM   3820  CD  PRO B 256      -3.175  33.151  81.609  1.00 94.75           C  
ATOM   3821  N   GLU B 257      -1.585  32.614  78.603  1.00 90.96           N  
ATOM   3822  CA  GLU B 257      -1.434  32.880  77.190  1.00 91.15           C  
ATOM   3823  C   GLU B 257       0.004  33.347  76.923  1.00 93.07           C  
ATOM   3824  O   GLU B 257       0.396  33.588  75.781  1.00 95.97           O  
ATOM   3825  CB  GLU B 257      -2.457  33.943  76.783  1.00 89.67           C  
ATOM   3826  CG  GLU B 257      -2.734  34.041  75.310  1.00 92.79           C  
ATOM   3827  CD  GLU B 257      -3.322  32.777  74.735  1.00 95.95           C  
ATOM   3828  OE1 GLU B 257      -4.410  32.351  75.193  1.00 94.60           O  
ATOM   3829  OE2 GLU B 257      -2.692  32.219  73.805  1.00 99.04           O  
ATOM   3830  N   GLY B 258       0.789  33.478  77.987  1.00 91.08           N  
ATOM   3831  CA  GLY B 258       2.221  33.700  77.850  1.00 84.18           C  
ATOM   3832  C   GLY B 258       2.812  35.019  78.289  1.00 83.28           C  
ATOM   3833  O   GLY B 258       4.037  35.154  78.279  1.00 89.21           O  
ATOM   3834  N   GLU B 259       1.973  35.990  78.664  1.00 80.43           N  
ATOM   3835  CA  GLU B 259       2.449  37.337  78.998  1.00 81.81           C  
ATOM   3836  C   GLU B 259       2.848  37.464  80.458  1.00 82.96           C  
ATOM   3837  O   GLU B 259       2.252  36.853  81.320  1.00 84.98           O  
ATOM   3838  CB  GLU B 259       1.410  38.406  78.678  1.00 87.15           C  
ATOM   3839  CG  GLU B 259       1.055  38.536  77.208  1.00 98.92           C  
ATOM   3840  CD  GLU B 259       2.039  39.363  76.408  1.00107.33           C  
ATOM   3841  OE1 GLU B 259       2.232  40.553  76.736  1.00113.63           O  
ATOM   3842  OE2 GLU B 259       2.603  38.828  75.428  1.00111.49           O  
ATOM   3843  N   ILE B 260       3.879  38.253  80.732  1.00 84.80           N  
ATOM   3844  CA  ILE B 260       4.192  38.620  82.100  1.00 81.85           C  
ATOM   3845  C   ILE B 260       3.664  40.037  82.290  1.00 86.74           C  
ATOM   3846  O   ILE B 260       4.130  40.977  81.632  1.00 90.82           O  
ATOM   3847  CB  ILE B 260       5.703  38.552  82.382  1.00 76.09           C  
ATOM   3848  CG1 ILE B 260       6.207  37.107  82.287  1.00 79.68           C  
ATOM   3849  CG2 ILE B 260       6.014  39.113  83.752  1.00 71.22           C  
ATOM   3850  CD1 ILE B 260       6.203  36.329  83.611  1.00 82.11           C  
ATOM   3851  N   PHE B 261       2.672  40.191  83.163  1.00 85.09           N  
ATOM   3852  CA  PHE B 261       2.118  41.507  83.411  1.00 83.79           C  
ATOM   3853  C   PHE B 261       3.224  42.451  83.855  1.00 87.72           C  
ATOM   3854  O   PHE B 261       4.122  42.053  84.602  1.00 89.01           O  
ATOM   3855  CB  PHE B 261       1.043  41.451  84.479  1.00 82.80           C  
ATOM   3856  CG  PHE B 261      -0.239  40.851  84.015  1.00 84.34           C  
ATOM   3857  CD1 PHE B 261      -1.100  40.247  84.926  1.00 84.83           C  
ATOM   3858  CD2 PHE B 261      -0.598  40.884  82.671  1.00 85.14           C  
ATOM   3859  CE1 PHE B 261      -2.292  39.689  84.507  1.00 85.71           C  
ATOM   3860  CE2 PHE B 261      -1.794  40.318  82.242  1.00 85.12           C  
ATOM   3861  CZ  PHE B 261      -2.639  39.718  83.160  1.00 85.12           C  
ATOM   3862  N   LYS B 262       3.152  43.694  83.387  1.00 88.12           N  
ATOM   3863  CA  LYS B 262       4.144  44.705  83.716  1.00 87.64           C  
ATOM   3864  C   LYS B 262       4.237  44.934  85.221  1.00 88.02           C  
ATOM   3865  O   LYS B 262       5.332  44.922  85.784  1.00 90.09           O  
ATOM   3866  CB  LYS B 262       3.831  46.020  83.005  1.00 90.16           C  
ATOM   3867  CG  LYS B 262       4.913  47.054  83.198  1.00 94.85           C  
ATOM   3868  CD  LYS B 262       4.478  48.442  82.765  1.00 95.82           C  
ATOM   3869  CE  LYS B 262       5.678  49.378  82.751  1.00 96.18           C  
ATOM   3870  NZ  LYS B 262       5.370  50.635  82.028  1.00100.36           N  
ATOM   3871  N   GLU B 263       3.088  45.133  85.864  1.00 87.30           N  
ATOM   3872  CA  GLU B 263       3.053  45.434  87.291  1.00 86.24           C  
ATOM   3873  C   GLU B 263       3.063  44.150  88.122  1.00 85.09           C  
ATOM   3874  O   GLU B 263       2.268  43.234  87.887  1.00 87.48           O  
ATOM   3875  CB  GLU B 263       1.835  46.290  87.625  1.00 89.70           C  
ATOM   3876  CG  GLU B 263       2.098  47.364  88.672  1.00100.06           C  
ATOM   3877  CD  GLU B 263       2.970  48.512  88.154  1.00105.79           C  
ATOM   3878  OE1 GLU B 263       2.779  48.964  86.997  1.00105.93           O  
ATOM   3879  OE2 GLU B 263       3.848  48.966  88.917  1.00109.12           O  
ATOM   3880  N   PRO B 264       3.980  44.062  89.090  1.00 82.49           N  
ATOM   3881  CA  PRO B 264       4.026  42.873  89.937  1.00 81.68           C  
ATOM   3882  C   PRO B 264       2.710  42.679  90.671  1.00 82.74           C  
ATOM   3883  O   PRO B 264       2.015  43.661  90.970  1.00 84.91           O  
ATOM   3884  CB  PRO B 264       5.125  43.202  90.946  1.00 81.94           C  
ATOM   3885  CG  PRO B 264       5.943  44.254  90.295  1.00 83.36           C  
ATOM   3886  CD  PRO B 264       5.011  45.046  89.450  1.00 81.91           C  
ATOM   3887  N   TYR B 265       2.373  41.424  90.950  1.00 79.16           N  
ATOM   3888  CA  TYR B 265       1.218  41.099  91.766  1.00 79.10           C  
ATOM   3889  C   TYR B 265       1.484  41.508  93.203  1.00 82.65           C  
ATOM   3890  O   TYR B 265       0.605  42.064  93.858  1.00 87.74           O  
ATOM   3891  CB  TYR B 265       0.952  39.611  91.692  1.00 84.05           C  
ATOM   3892  CG  TYR B 265      -0.120  39.076  92.616  1.00 86.54           C  
ATOM   3893  CD1 TYR B 265      -1.464  39.396  92.426  1.00 88.69           C  
ATOM   3894  CD2 TYR B 265       0.207  38.206  93.650  1.00 86.14           C  
ATOM   3895  CE1 TYR B 265      -2.452  38.877  93.258  1.00 87.24           C  
ATOM   3896  CE2 TYR B 265      -0.771  37.683  94.485  1.00 86.71           C  
ATOM   3897  CZ  TYR B 265      -2.097  38.019  94.282  1.00 86.15           C  
ATOM   3898  OH  TYR B 265      -3.064  37.498  95.111  1.00 85.40           O  
ATOM   3899  N   LEU B 266       2.694  41.225  93.685  1.00 80.98           N  
ATOM   3900  CA  LEU B 266       3.123  41.624  95.020  1.00 82.93           C  
ATOM   3901  C   LEU B 266       4.501  42.262  94.903  1.00 89.36           C  
ATOM   3902  O   LEU B 266       5.426  41.647  94.364  1.00 94.32           O  
ATOM   3903  CB  LEU B 266       3.198  40.408  95.951  1.00 82.04           C  
ATOM   3904  CG  LEU B 266       2.981  40.519  97.473  1.00 79.62           C  
ATOM   3905  CD1 LEU B 266       3.698  39.389  98.185  1.00 77.04           C  
ATOM   3906  CD2 LEU B 266       3.455  41.817  98.050  1.00 82.67           C  
ATOM   3907  N   ASP B 267       4.634  43.497  95.380  1.00 90.87           N  
ATOM   3908  CA  ASP B 267       5.934  44.159  95.413  1.00 90.24           C  
ATOM   3909  C   ASP B 267       6.296  44.525  96.841  1.00 91.25           C  
ATOM   3910  O   ASP B 267       5.801  45.512  97.398  1.00 90.21           O  
ATOM   3911  CB  ASP B 267       5.969  45.393  94.510  1.00 89.79           C  
ATOM   3912  CG  ASP B 267       7.322  46.087  94.526  1.00 90.00           C  
ATOM   3913  OD1 ASP B 267       8.144  45.783  95.416  1.00 89.38           O  
ATOM   3914  OD2 ASP B 267       7.570  46.936  93.645  1.00 91.17           O  
ATOM   3915  N   ILE B 268       7.190  43.731  97.416  1.00 91.10           N  
ATOM   3916  CA  ILE B 268       7.452  43.798  98.842  1.00 88.95           C  
ATOM   3917  C   ILE B 268       8.945  44.026  99.144  1.00 88.87           C  
ATOM   3918  O   ILE B 268       9.382  43.966 100.298  1.00 87.48           O  
ATOM   3919  CB  ILE B 268       6.827  42.552  99.529  1.00 87.08           C  
ATOM   3920  CG1 ILE B 268       5.974  42.963 100.711  1.00 91.05           C  
ATOM   3921  CG2 ILE B 268       7.840  41.456  99.882  1.00 86.53           C  
ATOM   3922  CD1 ILE B 268       5.324  41.768 101.369  1.00 97.68           C  
ATOM   3923  N   HIS B 269       9.705  44.360  98.102  1.00 88.06           N  
ATOM   3924  CA  HIS B 269      11.162  44.440  98.198  1.00 87.14           C  
ATOM   3925  C   HIS B 269      11.681  45.414  99.246  1.00 88.18           C  
ATOM   3926  O   HIS B 269      12.762  45.206  99.797  1.00 87.48           O  
ATOM   3927  CB  HIS B 269      11.812  44.680  96.826  1.00 85.56           C  
ATOM   3928  CG  HIS B 269      11.866  46.115  96.408  1.00 84.72           C  
ATOM   3929  ND1 HIS B 269      10.802  46.759  95.816  1.00 86.25           N  
ATOM   3930  CD2 HIS B 269      12.870  47.021  96.465  1.00 84.29           C  
ATOM   3931  CE1 HIS B 269      11.142  48.004  95.541  1.00 86.70           C  
ATOM   3932  NE2 HIS B 269      12.392  48.190  95.926  1.00 85.30           N  
ATOM   3933  N   LYS B 270      10.917  46.466  99.529  1.00 93.62           N  
ATOM   3934  CA  LYS B 270      11.310  47.413 100.580  1.00 97.50           C  
ATOM   3935  C   LYS B 270      11.306  46.727 101.945  1.00 92.65           C  
ATOM   3936  O   LYS B 270      12.213  46.922 102.740  1.00 91.76           O  
ATOM   3937  CB  LYS B 270      10.408  48.646 100.593  1.00 99.82           C  
ATOM   3938  CG  LYS B 270      10.524  49.531  99.357  1.00103.11           C  
ATOM   3939  CD  LYS B 270       9.606  50.749  99.480  1.00104.12           C  
ATOM   3940  CE  LYS B 270       9.557  51.569  98.193  1.00106.71           C  
ATOM   3941  NZ  LYS B 270       8.756  52.818  98.377  1.00107.10           N  
ATOM   3942  N   LEU B 271      10.295  45.898 102.185  1.00 90.77           N  
ATOM   3943  CA  LEU B 271      10.168  45.136 103.424  1.00 90.79           C  
ATOM   3944  C   LEU B 271      11.221  44.050 103.619  1.00 90.06           C  
ATOM   3945  O   LEU B 271      11.661  43.800 104.743  1.00 87.27           O  
ATOM   3946  CB  LEU B 271       8.798  44.470 103.483  1.00 91.86           C  
ATOM   3947  CG  LEU B 271       7.714  45.123 104.323  1.00 92.84           C  
ATOM   3948  CD1 LEU B 271       6.376  44.471 104.008  1.00 91.60           C  
ATOM   3949  CD2 LEU B 271       8.059  44.992 105.805  1.00 94.25           C  
ATOM   3950  N   VAL B 272      11.601  43.387 102.531  1.00 91.25           N  
ATOM   3951  CA  VAL B 272      12.450  42.196 102.633  1.00 90.81           C  
ATOM   3952  C   VAL B 272      13.949  42.481 102.526  1.00 91.46           C  
ATOM   3953  O   VAL B 272      14.400  43.217 101.647  1.00 93.34           O  
ATOM   3954  CB  VAL B 272      11.971  41.030 101.691  1.00 88.94           C  
ATOM   3955  CG1 VAL B 272      11.313  41.558 100.464  1.00 87.65           C  
ATOM   3956  CG2 VAL B 272      13.111  40.067 101.327  1.00 91.12           C  
ATOM   3957  N   GLN B 273      14.697  41.921 103.472  1.00 93.15           N  
ATOM   3958  CA  GLN B 273      16.140  41.893 103.404  1.00 96.82           C  
ATOM   3959  C   GLN B 273      16.488  40.610 102.679  1.00100.38           C  
ATOM   3960  O   GLN B 273      16.126  39.524 103.132  1.00 99.71           O  
ATOM   3961  CB  GLN B 273      16.740  41.892 104.808  1.00 99.10           C  
ATOM   3962  CG  GLN B 273      18.201  42.305 104.859  1.00101.87           C  
ATOM   3963  CD  GLN B 273      18.441  43.657 104.214  1.00105.53           C  
ATOM   3964  OE1 GLN B 273      19.193  43.767 103.249  1.00108.37           O  
ATOM   3965  NE2 GLN B 273      17.781  44.689 104.727  1.00106.81           N  
ATOM   3966  N   SER B 274      17.171  40.738 101.545  1.00104.61           N  
ATOM   3967  CA  SER B 274      17.439  39.594 100.675  1.00109.02           C  
ATOM   3968  C   SER B 274      18.925  39.256 100.579  1.00111.51           C  
ATOM   3969  O   SER B 274      19.777  40.036 101.011  1.00109.01           O  
ATOM   3970  CB  SER B 274      16.850  39.831  99.276  1.00110.59           C  
ATOM   3971  OG  SER B 274      17.442  40.955  98.650  1.00112.09           O  
ATOM   3972  N   GLY B 275      19.215  38.089 100.002  1.00116.39           N  
ATOM   3973  CA  GLY B 275      20.581  37.581  99.852  1.00119.87           C  
ATOM   3974  C   GLY B 275      21.552  38.496  99.127  1.00122.07           C  
ATOM   3975  O   GLY B 275      21.147  39.365  98.352  1.00122.35           O  
ATOM   3976  N   ILE B 276      22.841  38.296  99.390  1.00124.36           N  
ATOM   3977  CA  ILE B 276      23.907  39.091  98.770  1.00127.97           C  
ATOM   3978  C   ILE B 276      25.045  38.203  98.248  1.00127.78           C  
ATOM   3979  O   ILE B 276      25.399  38.265  97.069  1.00128.96           O  
ATOM   3980  CB  ILE B 276      24.453  40.208  99.723  1.00129.17           C  
ATOM   3981  CG1 ILE B 276      24.693  39.663 101.143  1.00128.97           C  
ATOM   3982  CG2 ILE B 276      23.493  41.399  99.754  1.00129.74           C  
ATOM   3983  CD1 ILE B 276      25.586  40.533 102.017  1.00128.58           C  
ATOM   3984  N   LYS B 277      25.602  37.381  99.137  1.00126.53           N  
ATOM   3985  CA  LYS B 277      26.644  36.417  98.787  1.00122.84           C  
ATOM   3986  C   LYS B 277      25.992  35.131  98.277  1.00119.44           C  
ATOM   3987  O   LYS B 277      24.765  35.029  98.242  1.00114.07           O  
ATOM   3988  CB  LYS B 277      27.550  36.129  99.997  1.00121.41           C  
ATOM   3989  CG  LYS B 277      28.225  37.360 100.589  1.00121.70           C  
ATOM   3990  CD  LYS B 277      29.462  36.979 101.397  1.00123.88           C  
ATOM   3991  CE  LYS B 277      30.356  38.188 101.683  1.00123.51           C  
ATOM   3992  NZ  LYS B 277      29.797  39.092 102.735  1.00123.89           N  
ATOM   3993  N   GLY B 278      26.821  34.161  97.893  1.00120.72           N  
ATOM   3994  CA  GLY B 278      26.366  32.891  97.325  1.00121.76           C  
ATOM   3995  C   GLY B 278      25.223  32.203  98.054  1.00121.70           C  
ATOM   3996  O   GLY B 278      24.073  32.272  97.616  1.00122.81           O  
ATOM   3997  N   GLY B 279      25.538  31.538  99.164  1.00119.56           N  
ATOM   3998  CA  GLY B 279      24.544  30.754  99.906  1.00117.15           C  
ATOM   3999  C   GLY B 279      23.856  31.518 101.025  1.00113.53           C  
ATOM   4000  O   GLY B 279      23.763  31.036 102.160  1.00114.18           O  
ATOM   4001  N   ASP B 280      23.374  32.712 100.699  1.00107.13           N  
ATOM   4002  CA  ASP B 280      22.682  33.562 101.650  1.00101.58           C  
ATOM   4003  C   ASP B 280      21.186  33.453 101.376  1.00100.34           C  
ATOM   4004  O   ASP B 280      20.689  34.014 100.403  1.00102.51           O  
ATOM   4005  CB  ASP B 280      23.177  35.000 101.490  1.00 99.51           C  
ATOM   4006  CG  ASP B 280      22.523  35.964 102.456  1.00 97.86           C  
ATOM   4007  OD1 ASP B 280      21.848  35.519 103.404  1.00 97.80           O  
ATOM   4008  OD2 ASP B 280      22.693  37.183 102.263  1.00 97.87           O  
ATOM   4009  N   GLU B 281      20.474  32.735 102.238  1.00 98.61           N  
ATOM   4010  CA  GLU B 281      19.089  32.338 101.966  1.00100.99           C  
ATOM   4011  C   GLU B 281      18.055  33.428 102.267  1.00 98.52           C  
ATOM   4012  O   GLU B 281      16.859  33.153 102.370  1.00 99.01           O  
ATOM   4013  CB  GLU B 281      18.743  31.085 102.773  1.00101.91           C  
ATOM   4014  CG  GLU B 281      19.428  29.802 102.340  1.00102.75           C  
ATOM   4015  CD  GLU B 281      19.121  28.649 103.286  1.00105.92           C  
ATOM   4016  OE1 GLU B 281      19.980  27.746 103.427  1.00109.72           O  
ATOM   4017  OE2 GLU B 281      18.027  28.651 103.902  1.00106.89           O  
ATOM   4018  N   ARG B 282      18.510  34.667 102.351  1.00 95.10           N  
ATOM   4019  CA  ARG B 282      17.780  35.702 103.070  1.00 91.58           C  
ATOM   4020  C   ARG B 282      16.497  36.293 102.438  1.00 90.49           C  
ATOM   4021  O   ARG B 282      15.757  36.995 103.120  1.00 94.54           O  
ATOM   4022  CB  ARG B 282      18.758  36.810 103.488  1.00 86.99           C  
ATOM   4023  CG  ARG B 282      18.642  37.208 104.928  1.00 83.33           C  
ATOM   4024  CD  ARG B 282      19.987  37.547 105.530  1.00 86.72           C  
ATOM   4025  NE  ARG B 282      20.308  38.973 105.502  1.00 87.84           N  
ATOM   4026  CZ  ARG B 282      21.336  39.504 104.847  1.00 87.86           C  
ATOM   4027  NH1 ARG B 282      22.161  38.733 104.156  1.00 87.25           N  
ATOM   4028  NH2 ARG B 282      21.547  40.812 104.893  1.00 89.79           N  
ATOM   4029  N   GLY B 283      16.200  36.009 101.177  1.00 86.20           N  
ATOM   4030  CA  GLY B 283      15.059  36.703 100.510  1.00 89.85           C  
ATOM   4031  C   GLY B 283      13.588  36.430 100.870  1.00 84.20           C  
ATOM   4032  O   GLY B 283      13.245  36.192 102.025  1.00 82.16           O  
ATOM   4033  N   LEU B 284      12.717  36.523  99.863  1.00 83.73           N  
ATOM   4034  CA  LEU B 284      11.354  35.964  99.912  1.00 84.72           C  
ATOM   4035  C   LEU B 284      11.459  34.441  99.802  1.00 90.15           C  
ATOM   4036  O   LEU B 284      12.307  33.922  99.065  1.00 95.83           O  
ATOM   4037  CB  LEU B 284      10.481  36.523  98.769  1.00 80.95           C  
ATOM   4038  CG  LEU B 284       9.070  35.959  98.512  1.00 79.27           C  
ATOM   4039  CD1 LEU B 284       8.023  36.448  99.523  1.00 76.28           C  
ATOM   4040  CD2 LEU B 284       8.610  36.281  97.106  1.00 79.34           C  
ATOM   4041  N   LEU B 285      10.601  33.726 100.526  1.00 89.36           N  
ATOM   4042  CA  LEU B 285      10.797  32.294 100.725  1.00 86.55           C  
ATOM   4043  C   LEU B 285       9.667  31.421 100.205  1.00 88.71           C  
ATOM   4044  O   LEU B 285       9.927  30.369  99.628  1.00 93.70           O  
ATOM   4045  CB  LEU B 285      11.083  31.986 102.203  1.00 86.52           C  
ATOM   4046  CG  LEU B 285      12.268  32.706 102.871  1.00 86.10           C  
ATOM   4047  CD1 LEU B 285      12.482  32.248 104.308  1.00 85.35           C  
ATOM   4048  CD2 LEU B 285      13.550  32.544 102.070  1.00 85.98           C  
ATOM   4049  N   SER B 286       8.421  31.830 100.408  1.00 87.68           N  
ATOM   4050  CA  SER B 286       7.306  31.024  99.930  1.00 88.95           C  
ATOM   4051  C   SER B 286       5.992  31.800  99.791  1.00 91.12           C  
ATOM   4052  O   SER B 286       5.790  32.823 100.448  1.00 91.41           O  
ATOM   4053  CB  SER B 286       7.122  29.797 100.824  1.00 89.05           C  
ATOM   4054  OG  SER B 286       6.084  28.963 100.338  1.00 94.06           O  
ATOM   4055  N   LEU B 287       5.116  31.294  98.921  1.00 91.54           N  
ATOM   4056  CA  LEU B 287       3.768  31.825  98.741  1.00 93.01           C  
ATOM   4057  C   LEU B 287       2.791  30.674  98.868  1.00 93.92           C  
ATOM   4058  O   LEU B 287       3.079  29.568  98.407  1.00 99.08           O  
ATOM   4059  CB  LEU B 287       3.613  32.422  97.342  1.00 93.62           C  
ATOM   4060  CG  LEU B 287       2.794  33.687  97.057  1.00 92.30           C  
ATOM   4061  CD1 LEU B 287       2.266  33.641  95.637  1.00 91.48           C  
ATOM   4062  CD2 LEU B 287       1.661  33.874  98.011  1.00 93.95           C  
ATOM   4063  N   ALA B 288       1.642  30.926  99.488  1.00 90.38           N  
ATOM   4064  CA  ALA B 288       0.556  29.946  99.537  1.00 87.31           C  
ATOM   4065  C   ALA B 288      -0.761  30.670  99.406  1.00 88.58           C  
ATOM   4066  O   ALA B 288      -0.986  31.680 100.078  1.00 91.80           O  
ATOM   4067  CB  ALA B 288       0.594  29.161 100.822  1.00 85.64           C  
ATOM   4068  N   PHE B 289      -1.626  30.178  98.526  1.00 87.13           N  
ATOM   4069  CA  PHE B 289      -2.942  30.783  98.371  1.00 86.12           C  
ATOM   4070  C   PHE B 289      -3.937  30.017  99.215  1.00 87.44           C  
ATOM   4071  O   PHE B 289      -3.863  28.793  99.317  1.00 89.62           O  
ATOM   4072  CB  PHE B 289      -3.380  30.801  96.901  1.00 86.38           C  
ATOM   4073  CG  PHE B 289      -2.632  31.795  96.052  1.00 88.50           C  
ATOM   4074  CD1 PHE B 289      -1.499  31.414  95.343  1.00 89.16           C  
ATOM   4075  CD2 PHE B 289      -3.060  33.121  95.962  1.00 90.05           C  
ATOM   4076  CE1 PHE B 289      -0.807  32.335  94.548  1.00 89.21           C  
ATOM   4077  CE2 PHE B 289      -2.365  34.050  95.180  1.00 89.25           C  
ATOM   4078  CZ  PHE B 289      -1.237  33.656  94.475  1.00 86.96           C  
ATOM   4079  N   HIS B 290      -4.867  30.737  99.830  1.00 90.79           N  
ATOM   4080  CA  HIS B 290      -5.955  30.092 100.565  1.00 88.09           C  
ATOM   4081  C   HIS B 290      -6.786  29.225  99.611  1.00 88.24           C  
ATOM   4082  O   HIS B 290      -7.058  29.635  98.478  1.00 88.31           O  
ATOM   4083  CB  HIS B 290      -6.841  31.124 101.266  1.00 84.27           C  
ATOM   4084  CG  HIS B 290      -7.814  30.513 102.222  1.00 84.74           C  
ATOM   4085  ND1 HIS B 290      -8.994  29.931 101.811  1.00 83.61           N  
ATOM   4086  CD2 HIS B 290      -7.770  30.364 103.566  1.00 83.45           C  
ATOM   4087  CE1 HIS B 290      -9.638  29.457 102.860  1.00 81.77           C  
ATOM   4088  NE2 HIS B 290      -8.919  29.709 103.938  1.00 82.59           N  
ATOM   4089  N   PRO B 291      -7.177  28.016 100.060  1.00 88.01           N  
ATOM   4090  CA  PRO B 291      -7.989  27.119  99.233  1.00 87.39           C  
ATOM   4091  C   PRO B 291      -9.273  27.766  98.718  1.00 90.12           C  
ATOM   4092  O   PRO B 291      -9.794  27.350  97.686  1.00 94.79           O  
ATOM   4093  CB  PRO B 291      -8.311  25.973 100.183  1.00 87.55           C  
ATOM   4094  CG  PRO B 291      -7.172  25.969 101.146  1.00 88.57           C  
ATOM   4095  CD  PRO B 291      -6.861  27.410 101.366  1.00 86.97           C  
ATOM   4096  N   ASN B 292      -9.770  28.772  99.431  1.00 90.89           N  
ATOM   4097  CA  ASN B 292     -10.893  29.576  98.961  1.00 92.38           C  
ATOM   4098  C   ASN B 292     -10.525  30.985  98.497  1.00 92.10           C  
ATOM   4099  O   ASN B 292     -11.232  31.953  98.787  1.00 91.39           O  
ATOM   4100  CB  ASN B 292     -11.979  29.638 100.018  1.00 96.84           C  
ATOM   4101  CG  ASN B 292     -13.249  29.019  99.547  1.00102.40           C  
ATOM   4102  OD1 ASN B 292     -14.016  29.637  98.805  1.00104.60           O  
ATOM   4103  ND2 ASN B 292     -13.484  27.779  99.955  1.00106.04           N  
ATOM   4104  N   TYR B 293      -9.427  31.087  97.754  1.00 91.85           N  
ATOM   4105  CA  TYR B 293      -8.930  32.374  97.290  1.00 88.21           C  
ATOM   4106  C   TYR B 293      -9.924  33.032  96.335  1.00 89.84           C  
ATOM   4107  O   TYR B 293     -10.040  34.261  96.300  1.00 91.92           O  
ATOM   4108  CB  TYR B 293      -7.556  32.207  96.637  1.00 83.46           C  
ATOM   4109  CG  TYR B 293      -7.056  33.433  95.918  1.00 84.19           C  
ATOM   4110  CD1 TYR B 293      -6.394  34.451  96.604  1.00 85.80           C  
ATOM   4111  CD2 TYR B 293      -7.235  33.573  94.542  1.00 82.88           C  
ATOM   4112  CE1 TYR B 293      -5.930  35.587  95.935  1.00 83.21           C  
ATOM   4113  CE2 TYR B 293      -6.782  34.697  93.873  1.00 81.07           C  
ATOM   4114  CZ  TYR B 293      -6.129  35.692  94.574  1.00 81.92           C  
ATOM   4115  OH  TYR B 293      -5.696  36.798  93.896  1.00 83.71           O  
ATOM   4116  N   LYS B 294     -10.644  32.206  95.574  1.00 87.89           N  
ATOM   4117  CA  LYS B 294     -11.608  32.690  94.583  1.00 86.77           C  
ATOM   4118  C   LYS B 294     -12.706  33.527  95.244  1.00 87.97           C  
ATOM   4119  O   LYS B 294     -13.332  34.375  94.594  1.00 90.62           O  
ATOM   4120  CB  LYS B 294     -12.203  31.505  93.814  1.00 86.97           C  
ATOM   4121  CG  LYS B 294     -12.959  31.859  92.541  1.00 87.63           C  
ATOM   4122  CD  LYS B 294     -13.322  30.609  91.734  1.00 89.88           C  
ATOM   4123  CE  LYS B 294     -14.071  30.967  90.442  1.00 94.74           C  
ATOM   4124  NZ  LYS B 294     -13.912  29.948  89.350  1.00 96.10           N  
ATOM   4125  N   LYS B 295     -12.919  33.291  96.539  1.00 87.47           N  
ATOM   4126  CA  LYS B 295     -13.911  34.020  97.321  1.00 87.58           C  
ATOM   4127  C   LYS B 295     -13.265  35.068  98.224  1.00 87.17           C  
ATOM   4128  O   LYS B 295     -13.526  36.255  98.071  1.00 89.88           O  
ATOM   4129  CB  LYS B 295     -14.749  33.053  98.162  1.00 90.30           C  
ATOM   4130  CG  LYS B 295     -15.815  33.737  99.001  1.00 92.16           C  
ATOM   4131  CD  LYS B 295     -16.366  32.820 100.082  1.00 93.28           C  
ATOM   4132  CE  LYS B 295     -17.394  33.550 100.942  1.00 93.13           C  
ATOM   4133  NZ  LYS B 295     -17.860  32.714 102.084  1.00 92.99           N  
ATOM   4134  N   ASN B 296     -12.428  34.626  99.160  1.00 86.34           N  
ATOM   4135  CA  ASN B 296     -11.865  35.520 100.175  1.00 85.25           C  
ATOM   4136  C   ASN B 296     -10.604  36.284  99.764  1.00 84.59           C  
ATOM   4137  O   ASN B 296     -10.233  37.259 100.409  1.00 85.28           O  
ATOM   4138  CB  ASN B 296     -11.648  34.778 101.505  1.00 85.76           C  
ATOM   4139  CG  ASN B 296     -10.598  33.675 101.416  1.00 86.46           C  
ATOM   4140  OD1 ASN B 296      -9.658  33.746 100.620  1.00 88.50           O  
ATOM   4141  ND2 ASN B 296     -10.744  32.657 102.262  1.00 83.81           N  
ATOM   4142  N   GLY B 297      -9.946  35.830  98.703  1.00 85.37           N  
ATOM   4143  CA  GLY B 297      -8.776  36.526  98.147  1.00 85.80           C  
ATOM   4144  C   GLY B 297      -7.538  36.599  99.024  1.00 83.05           C  
ATOM   4145  O   GLY B 297      -6.794  37.575  98.974  1.00 81.58           O  
ATOM   4146  N   LYS B 298      -7.300  35.546  99.798  1.00 81.70           N  
ATOM   4147  CA  LYS B 298      -6.253  35.555 100.800  1.00 81.74           C  
ATOM   4148  C   LYS B 298      -4.984  34.807 100.404  1.00 87.06           C  
ATOM   4149  O   LYS B 298      -5.045  33.644 100.006  1.00 91.97           O  
ATOM   4150  CB  LYS B 298      -6.816  34.994 102.094  1.00 79.26           C  
ATOM   4151  CG  LYS B 298      -7.965  35.811 102.595  1.00 77.08           C  
ATOM   4152  CD  LYS B 298      -7.851  36.020 104.072  1.00 76.21           C  
ATOM   4153  CE  LYS B 298      -8.597  37.267 104.499  1.00 75.59           C  
ATOM   4154  NZ  LYS B 298      -7.798  38.498 104.312  1.00 75.91           N  
ATOM   4155  N   LEU B 299      -3.839  35.487 100.506  1.00 88.61           N  
ATOM   4156  CA  LEU B 299      -2.532  34.859 100.293  1.00 86.78           C  
ATOM   4157  C   LEU B 299      -1.841  34.728 101.623  1.00 86.05           C  
ATOM   4158  O   LEU B 299      -2.193  35.406 102.586  1.00 83.95           O  
ATOM   4159  CB  LEU B 299      -1.586  35.714  99.454  1.00 84.53           C  
ATOM   4160  CG  LEU B 299      -1.801  36.738  98.354  1.00 86.70           C  
ATOM   4161  CD1 LEU B 299      -2.849  37.792  98.656  1.00 87.23           C  
ATOM   4162  CD2 LEU B 299      -0.442  37.396  98.170  1.00 86.58           C  
ATOM   4163  N   TYR B 300      -0.817  33.882 101.650  1.00 86.62           N  
ATOM   4164  CA  TYR B 300       0.109  33.811 102.770  1.00 86.64           C  
ATOM   4165  C   TYR B 300       1.522  33.784 102.233  1.00 88.45           C  
ATOM   4166  O   TYR B 300       1.826  33.090 101.259  1.00 92.17           O  
ATOM   4167  CB  TYR B 300      -0.204  32.610 103.663  1.00 84.63           C  
ATOM   4168  CG  TYR B 300      -1.613  32.707 104.162  1.00 84.35           C  
ATOM   4169  CD1 TYR B 300      -2.672  32.236 103.387  1.00 85.31           C  
ATOM   4170  CD2 TYR B 300      -1.901  33.338 105.372  1.00 82.61           C  
ATOM   4171  CE1 TYR B 300      -3.972  32.364 103.815  1.00 85.33           C  
ATOM   4172  CE2 TYR B 300      -3.198  33.457 105.816  1.00 80.76           C  
ATOM   4173  CZ  TYR B 300      -4.224  32.975 105.029  1.00 83.24           C  
ATOM   4174  OH  TYR B 300      -5.514  33.102 105.442  1.00 84.92           O  
ATOM   4175  N   VAL B 301       2.377  34.572 102.860  1.00 87.52           N  
ATOM   4176  CA  VAL B 301       3.722  34.774 102.363  1.00 86.94           C  
ATOM   4177  C   VAL B 301       4.724  34.691 103.506  1.00 87.28           C  
ATOM   4178  O   VAL B 301       4.473  35.194 104.606  1.00 89.55           O  
ATOM   4179  CB  VAL B 301       3.805  36.110 101.568  1.00 85.20           C  
ATOM   4180  CG1 VAL B 301       4.721  37.121 102.235  1.00 84.28           C  
ATOM   4181  CG2 VAL B 301       4.198  35.843 100.129  1.00 83.90           C  
ATOM   4182  N   SER B 302       5.838  34.016 103.255  1.00 88.55           N  
ATOM   4183  CA  SER B 302       6.922  33.952 104.233  1.00 89.90           C  
ATOM   4184  C   SER B 302       8.162  34.617 103.665  1.00 90.10           C  
ATOM   4185  O   SER B 302       8.585  34.311 102.546  1.00 89.44           O  
ATOM   4186  CB  SER B 302       7.218  32.511 104.661  1.00 88.09           C  
ATOM   4187  OG  SER B 302       7.445  31.684 103.538  1.00 87.89           O  
ATOM   4188  N   TYR B 303       8.722  35.548 104.431  1.00 89.53           N  
ATOM   4189  CA  TYR B 303       9.905  36.272 103.989  1.00 90.58           C  
ATOM   4190  C   TYR B 303      10.784  36.705 105.135  1.00 92.05           C  
ATOM   4191  O   TYR B 303      10.348  36.758 106.286  1.00 93.99           O  
ATOM   4192  CB  TYR B 303       9.526  37.492 103.152  1.00 89.25           C  
ATOM   4193  CG  TYR B 303       8.782  38.578 103.901  1.00 88.70           C  
ATOM   4194  CD1 TYR B 303       9.466  39.564 104.612  1.00 87.74           C  
ATOM   4195  CD2 TYR B 303       7.392  38.639 103.868  1.00 86.32           C  
ATOM   4196  CE1 TYR B 303       8.773  40.569 105.280  1.00 87.74           C  
ATOM   4197  CE2 TYR B 303       6.700  39.634 104.530  1.00 85.08           C  
ATOM   4198  CZ  TYR B 303       7.389  40.593 105.233  1.00 87.02           C  
ATOM   4199  OH  TYR B 303       6.685  41.578 105.886  1.00 89.40           O  
ATOM   4200  N   THR B 304      12.023  37.036 104.792  1.00 93.32           N  
ATOM   4201  CA  THR B 304      13.011  37.480 105.755  1.00 94.96           C  
ATOM   4202  C   THR B 304      13.101  39.003 105.771  1.00 98.23           C  
ATOM   4203  O   THR B 304      13.328  39.636 104.735  1.00 99.37           O  
ATOM   4204  CB  THR B 304      14.380  36.850 105.456  1.00 91.92           C  
ATOM   4205  OG1 THR B 304      14.501  35.618 106.175  1.00 90.65           O  
ATOM   4206  CG2 THR B 304      15.506  37.774 105.875  1.00 94.79           C  
ATOM   4207  N   THR B 305      12.927  39.584 106.955  1.00 98.48           N  
ATOM   4208  CA  THR B 305      12.966  41.030 107.096  1.00 99.34           C  
ATOM   4209  C   THR B 305      13.904  41.491 108.195  1.00101.37           C  
ATOM   4210  O   THR B 305      14.296  40.715 109.070  1.00 96.67           O  
ATOM   4211  CB  THR B 305      11.569  41.622 107.358  1.00 99.41           C  
ATOM   4212  OG1 THR B 305      11.676  43.045 107.491  1.00 99.19           O  
ATOM   4213  CG2 THR B 305      10.954  41.039 108.634  1.00 97.93           C  
ATOM   4214  N   ASN B 306      14.238  42.777 108.138  1.00108.13           N  
ATOM   4215  CA  ASN B 306      15.105  43.391 109.121  1.00114.26           C  
ATOM   4216  C   ASN B 306      14.399  44.178 110.208  1.00119.68           C  
ATOM   4217  O   ASN B 306      13.809  45.232 109.956  1.00118.98           O  
ATOM   4218  CB  ASN B 306      16.169  44.259 108.449  1.00115.36           C  
ATOM   4219  CG  ASN B 306      17.538  43.616 108.475  1.00117.56           C  
ATOM   4220  OD1 ASN B 306      17.774  42.650 109.208  1.00117.73           O  
ATOM   4221  ND2 ASN B 306      18.456  44.154 107.682  1.00118.90           N  
ATOM   4222  N   GLN B 307      14.431  43.600 111.406  1.00126.81           N  
ATOM   4223  CA  GLN B 307      14.379  44.333 112.674  1.00132.81           C  
ATOM   4224  C   GLN B 307      13.121  45.161 113.017  1.00136.18           C  
ATOM   4225  O   GLN B 307      12.556  44.975 114.097  1.00138.14           O  
ATOM   4226  CB  GLN B 307      15.687  45.131 112.855  1.00133.82           C  
ATOM   4227  CG  GLN B 307      15.745  46.073 114.045  1.00135.58           C  
ATOM   4228  CD  GLN B 307      15.539  47.520 113.645  1.00136.44           C  
ATOM   4229  OE1 GLN B 307      15.061  47.814 112.547  1.00136.21           O  
ATOM   4230  NE2 GLN B 307      15.896  48.436 114.539  1.00137.00           N  
ATOM   4231  N   GLU B 308      12.680  46.053 112.123  1.00137.89           N  
ATOM   4232  CA  GLU B 308      11.580  47.002 112.431  1.00138.40           C  
ATOM   4233  C   GLU B 308      11.470  47.336 113.931  1.00137.51           C  
ATOM   4234  O   GLU B 308      10.399  47.238 114.537  1.00138.95           O  
ATOM   4235  CB  GLU B 308      10.227  46.556 111.834  1.00139.52           C  
ATOM   4236  CG  GLU B 308      10.074  45.057 111.530  1.00141.50           C  
ATOM   4237  CD  GLU B 308       9.744  44.207 112.752  1.00141.30           C  
ATOM   4238  OE1 GLU B 308      10.191  43.040 112.793  1.00140.14           O  
ATOM   4239  OE2 GLU B 308       9.036  44.694 113.662  1.00141.44           O  
ATOM   4240  N   ARG B 309      12.607  47.738 114.499  1.00134.95           N  
ATOM   4241  CA  ARG B 309      12.795  47.944 115.941  1.00132.62           C  
ATOM   4242  C   ARG B 309      12.312  46.784 116.816  1.00128.99           C  
ATOM   4243  O   ARG B 309      11.515  46.963 117.742  1.00129.76           O  
ATOM   4244  CB  ARG B 309      12.233  49.299 116.402  1.00134.76           C  
ATOM   4245  CG  ARG B 309      13.008  50.502 115.862  1.00135.67           C  
ATOM   4246  CD  ARG B 309      13.080  51.631 116.883  1.00136.31           C  
ATOM   4247  NE  ARG B 309      14.060  51.352 117.933  1.00136.56           N  
ATOM   4248  CZ  ARG B 309      14.269  52.117 119.003  1.00136.40           C  
ATOM   4249  NH1 ARG B 309      13.565  53.228 119.187  1.00136.43           N  
ATOM   4250  NH2 ARG B 309      15.185  51.769 119.896  1.00136.20           N  
ATOM   4251  N   TRP B 310      12.813  45.593 116.489  1.00123.49           N  
ATOM   4252  CA  TRP B 310      12.647  44.380 117.291  1.00118.61           C  
ATOM   4253  C   TRP B 310      13.606  44.480 118.477  1.00116.87           C  
ATOM   4254  O   TRP B 310      14.821  44.313 118.334  1.00117.26           O  
ATOM   4255  CB  TRP B 310      12.932  43.144 116.420  1.00114.90           C  
ATOM   4256  CG  TRP B 310      13.045  41.799 117.115  1.00114.07           C  
ATOM   4257  CD1 TRP B 310      14.091  41.352 117.874  1.00113.16           C  
ATOM   4258  CD2 TRP B 310      12.106  40.712 117.053  1.00114.02           C  
ATOM   4259  NE1 TRP B 310      13.850  40.073 118.313  1.00112.87           N  
ATOM   4260  CE2 TRP B 310      12.641  39.654 117.823  1.00113.73           C  
ATOM   4261  CE3 TRP B 310      10.857  40.536 116.436  1.00113.01           C  
ATOM   4262  CZ2 TRP B 310      11.972  38.434 117.992  1.00113.83           C  
ATOM   4263  CZ3 TRP B 310      10.191  39.320 116.606  1.00112.82           C  
ATOM   4264  CH2 TRP B 310      10.753  38.287 117.377  1.00113.26           C  
ATOM   4265  N   ALA B 311      13.044  44.786 119.641  1.00113.72           N  
ATOM   4266  CA  ALA B 311      13.815  44.958 120.864  1.00111.16           C  
ATOM   4267  C   ALA B 311      13.700  43.717 121.747  1.00108.88           C  
ATOM   4268  O   ALA B 311      14.211  43.685 122.866  1.00109.73           O  
ATOM   4269  CB  ALA B 311      13.327  46.194 121.609  1.00112.40           C  
ATOM   4270  N   ILE B 312      13.044  42.691 121.214  1.00106.78           N  
ATOM   4271  CA  ILE B 312      12.677  41.491 121.964  1.00104.45           C  
ATOM   4272  C   ILE B 312      13.874  40.567 122.259  1.00103.76           C  
ATOM   4273  O   ILE B 312      13.858  39.826 123.243  1.00104.76           O  
ATOM   4274  CB  ILE B 312      11.515  40.731 121.246  1.00104.44           C  
ATOM   4275  CG1 ILE B 312      10.368  41.705 120.920  1.00105.28           C  
ATOM   4276  CG2 ILE B 312      11.007  39.560 122.091  1.00103.31           C  
ATOM   4277  CD1 ILE B 312       9.451  41.288 119.769  1.00104.05           C  
ATOM   4278  N   GLY B 313      14.911  40.621 121.426  1.00102.44           N  
ATOM   4279  CA  GLY B 313      16.100  39.789 121.632  1.00100.52           C  
ATOM   4280  C   GLY B 313      17.081  39.772 120.470  1.00 99.38           C  
ATOM   4281  O   GLY B 313      16.868  40.463 119.472  1.00100.57           O  
ATOM   4282  N   PRO B 314      18.165  38.973 120.591  1.00 96.71           N  
ATOM   4283  CA  PRO B 314      19.230  38.910 119.591  1.00 94.02           C  
ATOM   4284  C   PRO B 314      18.766  38.260 118.295  1.00 93.22           C  
ATOM   4285  O   PRO B 314      17.947  37.337 118.321  1.00 94.35           O  
ATOM   4286  CB  PRO B 314      20.288  38.037 120.266  1.00 93.89           C  
ATOM   4287  CG  PRO B 314      19.521  37.178 121.194  1.00 94.14           C  
ATOM   4288  CD  PRO B 314      18.430  38.060 121.718  1.00 95.90           C  
ATOM   4289  N   HIS B 315      19.295  38.744 117.175  1.00 90.55           N  
ATOM   4290  CA  HIS B 315      18.895  38.266 115.859  1.00 88.29           C  
ATOM   4291  C   HIS B 315      19.784  38.850 114.772  1.00 88.18           C  
ATOM   4292  O   HIS B 315      20.405  39.896 114.959  1.00 89.06           O  
ATOM   4293  CB  HIS B 315      17.438  38.652 115.574  1.00 87.61           C  
ATOM   4294  CG  HIS B 315      17.218  40.129 115.446  1.00 87.48           C  
ATOM   4295  ND1 HIS B 315      16.983  40.743 114.234  1.00 88.10           N  
ATOM   4296  CD2 HIS B 315      17.213  41.115 116.374  1.00 85.53           C  
ATOM   4297  CE1 HIS B 315      16.834  42.042 114.423  1.00 87.28           C  
ATOM   4298  NE2 HIS B 315      16.971  42.293 115.712  1.00 86.19           N  
ATOM   4299  N   ASP B 316      19.844  38.153 113.642  1.00 87.80           N  
ATOM   4300  CA  ASP B 316      20.379  38.710 112.410  1.00 87.40           C  
ATOM   4301  C   ASP B 316      19.214  39.321 111.638  1.00 87.36           C  
ATOM   4302  O   ASP B 316      19.278  40.459 111.178  1.00 89.23           O  
ATOM   4303  CB  ASP B 316      21.049  37.618 111.577  1.00 86.70           C  
ATOM   4304  CG  ASP B 316      21.617  38.145 110.276  1.00 87.58           C  
ATOM   4305  OD1 ASP B 316      22.540  38.985 110.324  1.00 86.40           O  
ATOM   4306  OD2 ASP B 316      21.141  37.720 109.202  1.00 90.47           O  
ATOM   4307  N   HIS B 317      18.146  38.545 111.514  1.00 86.77           N  
ATOM   4308  CA  HIS B 317      16.924  38.976 110.865  1.00 86.49           C  
ATOM   4309  C   HIS B 317      15.780  38.207 111.506  1.00 87.75           C  
ATOM   4310  O   HIS B 317      16.011  37.405 112.413  1.00 88.07           O  
ATOM   4311  CB  HIS B 317      16.998  38.683 109.373  1.00 86.44           C  
ATOM   4312  CG  HIS B 317      17.222  37.239 109.051  1.00 87.76           C  
ATOM   4313  ND1 HIS B 317      16.195  36.386 108.714  1.00 89.22           N  
ATOM   4314  CD2 HIS B 317      18.353  36.498 109.016  1.00 89.05           C  
ATOM   4315  CE1 HIS B 317      16.685  35.184 108.472  1.00 90.20           C  
ATOM   4316  NE2 HIS B 317      17.992  35.223 108.655  1.00 90.16           N  
ATOM   4317  N   ILE B 318      14.548  38.462 111.068  1.00 88.60           N  
ATOM   4318  CA  ILE B 318      13.411  37.666 111.538  1.00 88.57           C  
ATOM   4319  C   ILE B 318      12.534  37.190 110.375  1.00 88.78           C  
ATOM   4320  O   ILE B 318      12.136  37.974 109.505  1.00 90.20           O  
ATOM   4321  CB  ILE B 318      12.573  38.353 112.685  1.00 88.93           C  
ATOM   4322  CG1 ILE B 318      11.689  39.475 112.157  1.00 92.26           C  
ATOM   4323  CG2 ILE B 318      13.466  38.888 113.808  1.00 87.69           C  
ATOM   4324  CD1 ILE B 318      10.374  39.596 112.898  1.00 94.20           C  
ATOM   4325  N   LEU B 319      12.275  35.886 110.359  1.00 88.25           N  
ATOM   4326  CA  LEU B 319      11.439  35.256 109.348  1.00 87.60           C  
ATOM   4327  C   LEU B 319       9.975  35.495 109.686  1.00 87.69           C  
ATOM   4328  O   LEU B 319       9.536  35.153 110.782  1.00 89.94           O  
ATOM   4329  CB  LEU B 319      11.731  33.753 109.298  1.00 86.55           C  
ATOM   4330  CG  LEU B 319      11.047  32.896 108.225  1.00 86.58           C  
ATOM   4331  CD1 LEU B 319      11.832  31.611 107.965  1.00 84.02           C  
ATOM   4332  CD2 LEU B 319       9.594  32.587 108.585  1.00 84.96           C  
ATOM   4333  N   ARG B 320       9.232  36.077 108.745  1.00 87.80           N  
ATOM   4334  CA  ARG B 320       7.804  36.371 108.930  1.00 89.26           C  
ATOM   4335  C   ARG B 320       6.907  35.480 108.092  1.00 90.33           C  
ATOM   4336  O   ARG B 320       7.218  35.200 106.928  1.00 91.51           O  
ATOM   4337  CB  ARG B 320       7.503  37.805 108.524  1.00 91.04           C  
ATOM   4338  CG  ARG B 320       7.792  38.840 109.575  1.00 96.31           C  
ATOM   4339  CD  ARG B 320       7.549  40.211 108.993  1.00 98.28           C  
ATOM   4340  NE  ARG B 320       7.444  41.233 110.023  1.00100.80           N  
ATOM   4341  CZ  ARG B 320       7.278  42.526 109.770  1.00102.89           C  
ATOM   4342  NH1 ARG B 320       7.205  42.961 108.516  1.00101.08           N  
ATOM   4343  NH2 ARG B 320       7.191  43.386 110.775  1.00104.35           N  
ATOM   4344  N   VAL B 321       5.796  35.040 108.682  1.00 88.51           N  
ATOM   4345  CA  VAL B 321       4.688  34.477 107.904  1.00 87.37           C  
ATOM   4346  C   VAL B 321       3.565  35.488 107.996  1.00 86.99           C  
ATOM   4347  O   VAL B 321       3.147  35.862 109.097  1.00 89.38           O  
ATOM   4348  CB  VAL B 321       4.199  33.110 108.425  1.00 87.52           C  
ATOM   4349  CG1 VAL B 321       3.121  32.557 107.503  1.00 86.17           C  
ATOM   4350  CG2 VAL B 321       5.350  32.121 108.529  1.00 87.50           C  
ATOM   4351  N   VAL B 322       3.103  35.959 106.843  1.00 84.21           N  
ATOM   4352  CA  VAL B 322       2.184  37.093 106.804  1.00 82.42           C  
ATOM   4353  C   VAL B 322       1.046  36.843 105.827  1.00 83.76           C  
ATOM   4354  O   VAL B 322       1.263  36.350 104.710  1.00 85.46           O  
ATOM   4355  CB  VAL B 322       2.918  38.411 106.424  1.00 81.03           C  
ATOM   4356  CG1 VAL B 322       1.930  39.552 106.226  1.00 82.38           C  
ATOM   4357  CG2 VAL B 322       3.933  38.794 107.487  1.00 81.79           C  
ATOM   4358  N   GLU B 323      -0.166  37.187 106.254  1.00 81.92           N  
ATOM   4359  CA  GLU B 323      -1.317  37.145 105.373  1.00 82.28           C  
ATOM   4360  C   GLU B 323      -1.450  38.441 104.581  1.00 83.84           C  
ATOM   4361  O   GLU B 323      -1.342  39.538 105.141  1.00 85.92           O  
ATOM   4362  CB  GLU B 323      -2.588  36.922 106.175  1.00 84.63           C  
ATOM   4363  CG  GLU B 323      -3.783  36.561 105.312  1.00 88.10           C  
ATOM   4364  CD  GLU B 323      -5.085  36.885 105.979  1.00 89.75           C  
ATOM   4365  OE1 GLU B 323      -5.429  38.082 106.014  1.00 91.20           O  
ATOM   4366  OE2 GLU B 323      -5.761  35.953 106.467  1.00 90.54           O  
ATOM   4367  N   TYR B 324      -1.685  38.304 103.278  1.00 82.01           N  
ATOM   4368  CA  TYR B 324      -2.095  39.431 102.442  1.00 81.89           C  
ATOM   4369  C   TYR B 324      -3.472  39.199 101.785  1.00 84.99           C  
ATOM   4370  O   TYR B 324      -4.003  38.083 101.802  1.00 88.81           O  
ATOM   4371  CB  TYR B 324      -1.034  39.731 101.384  1.00 75.58           C  
ATOM   4372  CG  TYR B 324       0.080  40.626 101.855  1.00 72.97           C  
ATOM   4373  CD1 TYR B 324      -0.073  42.008 101.874  1.00 75.11           C  
ATOM   4374  CD2 TYR B 324       1.298  40.092 102.272  1.00 74.54           C  
ATOM   4375  CE1 TYR B 324       0.964  42.842 102.296  1.00 76.90           C  
ATOM   4376  CE2 TYR B 324       2.348  40.910 102.695  1.00 72.69           C  
ATOM   4377  CZ  TYR B 324       2.175  42.280 102.700  1.00 76.47           C  
ATOM   4378  OH  TYR B 324       3.200  43.091 103.120  1.00 77.13           O  
ATOM   4379  N   THR B 325      -4.038  40.254 101.205  1.00 82.55           N  
ATOM   4380  CA  THR B 325      -5.320  40.164 100.511  1.00 82.82           C  
ATOM   4381  C   THR B 325      -5.245  40.899  99.170  1.00 81.57           C  
ATOM   4382  O   THR B 325      -4.694  41.995  99.103  1.00 85.18           O  
ATOM   4383  CB  THR B 325      -6.441  40.777 101.384  1.00 83.43           C  
ATOM   4384  OG1 THR B 325      -6.336  40.258 102.713  1.00 84.03           O  
ATOM   4385  CG2 THR B 325      -7.824  40.470 100.831  1.00 82.41           C  
ATOM   4386  N   VAL B 326      -5.782  40.298  98.109  1.00 79.17           N  
ATOM   4387  CA  VAL B 326      -5.873  40.985  96.816  1.00 81.99           C  
ATOM   4388  C   VAL B 326      -6.649  42.274  96.931  1.00 85.14           C  
ATOM   4389  O   VAL B 326      -7.591  42.369  97.725  1.00 88.73           O  
ATOM   4390  CB  VAL B 326      -6.600  40.169  95.706  1.00 81.37           C  
ATOM   4391  CG1 VAL B 326      -5.632  39.297  94.954  1.00 83.45           C  
ATOM   4392  CG2 VAL B 326      -7.798  39.394  96.253  1.00 77.65           C  
ATOM   4393  N   SER B 327      -6.258  43.251  96.117  1.00 84.11           N  
ATOM   4394  CA  SER B 327      -7.038  44.459  95.907  1.00 86.18           C  
ATOM   4395  C   SER B 327      -8.459  44.114  95.448  1.00 87.57           C  
ATOM   4396  O   SER B 327      -8.640  43.300  94.545  1.00 90.75           O  
ATOM   4397  CB  SER B 327      -6.342  45.327  94.862  1.00 86.76           C  
ATOM   4398  OG  SER B 327      -7.206  46.326  94.358  1.00 92.55           O  
ATOM   4399  N   ARG B 328      -9.466  44.720  96.071  1.00 88.66           N  
ATOM   4400  CA  ARG B 328     -10.841  44.526  95.607  1.00 92.63           C  
ATOM   4401  C   ARG B 328     -11.090  45.254  94.295  1.00 91.83           C  
ATOM   4402  O   ARG B 328     -12.051  44.961  93.592  1.00 94.15           O  
ATOM   4403  CB  ARG B 328     -11.879  44.915  96.672  1.00 99.03           C  
ATOM   4404  CG  ARG B 328     -11.463  46.042  97.593  1.00107.55           C  
ATOM   4405  CD  ARG B 328     -11.977  45.804  99.001  1.00114.87           C  
ATOM   4406  NE  ARG B 328     -10.988  46.205 100.007  1.00122.68           N  
ATOM   4407  CZ  ARG B 328     -11.093  45.983 101.318  1.00126.28           C  
ATOM   4408  NH1 ARG B 328     -12.155  45.361 101.819  1.00128.04           N  
ATOM   4409  NH2 ARG B 328     -10.129  46.390 102.136  1.00127.31           N  
ATOM   4410  N   LYS B 329     -10.205  46.189  93.963  1.00 91.47           N  
ATOM   4411  CA  LYS B 329     -10.313  46.964  92.730  1.00 92.34           C  
ATOM   4412  C   LYS B 329      -9.617  46.283  91.564  1.00 89.11           C  
ATOM   4413  O   LYS B 329     -10.028  46.429  90.416  1.00 90.06           O  
ATOM   4414  CB  LYS B 329      -9.756  48.374  92.933  1.00 97.61           C  
ATOM   4415  CG  LYS B 329     -10.673  49.253  93.775  1.00104.34           C  
ATOM   4416  CD  LYS B 329     -10.007  50.550  94.203  1.00109.15           C  
ATOM   4417  CE  LYS B 329     -10.962  51.379  95.050  1.00111.40           C  
ATOM   4418  NZ  LYS B 329     -10.339  52.640  95.535  1.00114.01           N  
ATOM   4419  N   ASN B 330      -8.564  45.533  91.858  1.00 86.08           N  
ATOM   4420  CA  ASN B 330      -7.775  44.907  90.811  1.00 84.49           C  
ATOM   4421  C   ASN B 330      -7.338  43.510  91.205  1.00 81.68           C  
ATOM   4422  O   ASN B 330      -6.505  43.352  92.091  1.00 87.03           O  
ATOM   4423  CB  ASN B 330      -6.570  45.789  90.464  1.00 87.35           C  
ATOM   4424  CG  ASN B 330      -5.610  45.130  89.494  1.00 88.88           C  
ATOM   4425  OD1 ASN B 330      -5.958  44.183  88.782  1.00 89.38           O  
ATOM   4426  ND2 ASN B 330      -4.385  45.636  89.462  1.00 89.88           N  
ATOM   4427  N   PRO B 331      -7.889  42.485  90.538  1.00 78.66           N  
ATOM   4428  CA  PRO B 331      -7.578  41.113  90.897  1.00 79.85           C  
ATOM   4429  C   PRO B 331      -6.151  40.705  90.528  1.00 83.03           C  
ATOM   4430  O   PRO B 331      -5.774  39.542  90.722  1.00 88.28           O  
ATOM   4431  CB  PRO B 331      -8.592  40.306  90.076  1.00 77.85           C  
ATOM   4432  CG  PRO B 331      -8.854  41.132  88.908  1.00 76.03           C  
ATOM   4433  CD  PRO B 331      -8.832  42.545  89.408  1.00 77.31           C  
ATOM   4434  N   HIS B 332      -5.368  41.646  90.004  1.00 81.86           N  
ATOM   4435  CA  HIS B 332      -4.017  41.337  89.549  1.00 82.10           C  
ATOM   4436  C   HIS B 332      -2.940  42.020  90.388  1.00 86.70           C  
ATOM   4437  O   HIS B 332      -1.782  42.130  89.965  1.00 91.46           O  
ATOM   4438  CB  HIS B 332      -3.865  41.662  88.064  1.00 78.66           C  
ATOM   4439  CG  HIS B 332      -4.647  40.752  87.171  1.00 81.15           C  
ATOM   4440  ND1 HIS B 332      -5.611  41.209  86.300  1.00 82.72           N  
ATOM   4441  CD2 HIS B 332      -4.624  39.406  87.030  1.00 83.66           C  
ATOM   4442  CE1 HIS B 332      -6.139  40.187  85.650  1.00 82.02           C  
ATOM   4443  NE2 HIS B 332      -5.557  39.080  86.075  1.00 82.98           N  
ATOM   4444  N   GLN B 333      -3.325  42.440  91.592  1.00 86.59           N  
ATOM   4445  CA  GLN B 333      -2.432  43.132  92.508  1.00 87.76           C  
ATOM   4446  C   GLN B 333      -2.940  42.999  93.946  1.00 87.23           C  
ATOM   4447  O   GLN B 333      -4.142  43.101  94.182  1.00 88.76           O  
ATOM   4448  CB  GLN B 333      -2.373  44.596  92.111  1.00 90.58           C  
ATOM   4449  CG  GLN B 333      -1.051  45.263  92.366  1.00 95.79           C  
ATOM   4450  CD  GLN B 333      -0.903  46.513  91.541  1.00 98.78           C  
ATOM   4451  OE1 GLN B 333      -1.062  46.486  90.318  1.00 99.21           O  
ATOM   4452  NE2 GLN B 333      -0.609  47.624  92.202  1.00100.84           N  
ATOM   4453  N   VAL B 334      -2.039  42.772  94.901  1.00 85.19           N  
ATOM   4454  CA  VAL B 334      -2.443  42.654  96.305  1.00 89.55           C  
ATOM   4455  C   VAL B 334      -2.444  44.025  96.982  1.00 92.69           C  
ATOM   4456  O   VAL B 334      -1.599  44.865  96.670  1.00 95.74           O  
ATOM   4457  CB  VAL B 334      -1.585  41.607  97.116  1.00 92.27           C  
ATOM   4458  CG1 VAL B 334      -0.943  40.587  96.196  1.00 93.60           C  
ATOM   4459  CG2 VAL B 334      -0.514  42.268  97.977  1.00 93.83           C  
ATOM   4460  N   ASP B 335      -3.401  44.260  97.881  1.00 93.93           N  
ATOM   4461  CA  ASP B 335      -3.439  45.502  98.655  1.00 95.33           C  
ATOM   4462  C   ASP B 335      -2.479  45.398  99.829  1.00 94.69           C  
ATOM   4463  O   ASP B 335      -2.749  44.679 100.794  1.00 94.58           O  
ATOM   4464  CB  ASP B 335      -4.855  45.808  99.160  1.00 99.06           C  
ATOM   4465  CG  ASP B 335      -4.946  47.156  99.889  1.00104.23           C  
ATOM   4466  OD1 ASP B 335      -5.432  47.195 101.039  1.00107.49           O  
ATOM   4467  OD2 ASP B 335      -4.532  48.188  99.319  1.00106.74           O  
ATOM   4468  N   LEU B 336      -1.365  46.126  99.744  1.00 93.73           N  
ATOM   4469  CA  LEU B 336      -0.293  46.060 100.753  1.00 90.43           C  
ATOM   4470  C   LEU B 336      -0.719  46.512 102.149  1.00 87.55           C  
ATOM   4471  O   LEU B 336      -0.021  46.255 103.131  1.00 91.64           O  
ATOM   4472  CB  LEU B 336       0.939  46.858 100.310  1.00 87.14           C  
ATOM   4473  CG  LEU B 336       1.592  46.510  98.974  1.00 85.66           C  
ATOM   4474  CD1 LEU B 336       2.803  47.396  98.740  1.00 84.14           C  
ATOM   4475  CD2 LEU B 336       1.979  45.037  98.902  1.00 86.01           C  
ATOM   4476  N   ARG B 337      -1.869  47.168 102.233  1.00 82.17           N  
ATOM   4477  CA  ARG B 337      -2.391  47.642 103.511  1.00 80.25           C  
ATOM   4478  C   ARG B 337      -2.986  46.503 104.334  1.00 81.20           C  
ATOM   4479  O   ARG B 337      -3.205  46.655 105.536  1.00 84.42           O  
ATOM   4480  CB  ARG B 337      -3.436  48.734 103.280  1.00 77.24           C  
ATOM   4481  CG  ARG B 337      -3.116  49.601 102.081  1.00 80.32           C  
ATOM   4482  CD  ARG B 337      -3.843  50.909 102.107  1.00 84.75           C  
ATOM   4483  NE  ARG B 337      -5.207  50.794 101.596  1.00 90.99           N  
ATOM   4484  CZ  ARG B 337      -5.557  50.938 100.321  1.00 94.11           C  
ATOM   4485  NH1 ARG B 337      -4.642  51.191  99.389  1.00 96.10           N  
ATOM   4486  NH2 ARG B 337      -6.831  50.823  99.976  1.00 95.60           N  
ATOM   4487  N   THR B 338      -3.225  45.360 103.691  1.00 80.27           N  
ATOM   4488  CA  THR B 338      -3.961  44.254 104.312  1.00 76.66           C  
ATOM   4489  C   THR B 338      -3.084  43.269 105.070  1.00 77.00           C  
ATOM   4490  O   THR B 338      -3.573  42.231 105.516  1.00 78.49           O  
ATOM   4491  CB  THR B 338      -4.766  43.449 103.274  1.00 75.06           C  
ATOM   4492  OG1 THR B 338      -3.880  42.913 102.283  1.00 76.90           O  
ATOM   4493  CG2 THR B 338      -5.808  44.314 102.609  1.00 74.78           C  
ATOM   4494  N   ALA B 339      -1.800  43.585 105.212  1.00 76.80           N  
ATOM   4495  CA  ALA B 339      -0.853  42.660 105.828  1.00 76.98           C  
ATOM   4496  C   ALA B 339      -1.240  42.369 107.268  1.00 75.55           C  
ATOM   4497  O   ALA B 339      -1.466  43.298 108.040  1.00 76.28           O  
ATOM   4498  CB  ALA B 339       0.552  43.226 105.765  1.00 79.05           C  
ATOM   4499  N   ARG B 340      -1.345  41.086 107.613  1.00 73.85           N  
ATOM   4500  CA  ARG B 340      -1.529  40.669 109.002  0.50 73.82           C  
ATOM   4501  C   ARG B 340      -0.451  39.663 109.303  1.00 81.95           C  
ATOM   4502  O   ARG B 340      -0.427  38.583 108.706  1.00 87.83           O  
ATOM   4503  CB  ARG B 340      -2.876  39.990 109.247  0.50 66.19           C  
ATOM   4504  CG  ARG B 340      -4.086  40.690 108.704  0.50 61.43           C  
ATOM   4505  CD  ARG B 340      -5.317  40.374 109.528  0.50 57.30           C  
ATOM   4506  NE  ARG B 340      -5.356  39.021 110.083  0.50 55.34           N  
ATOM   4507  CZ  ARG B 340      -5.932  37.973 109.499  0.50 54.96           C  
ATOM   4508  NH1 ARG B 340      -6.520  38.100 108.322  0.50 56.07           N  
ATOM   4509  NH2 ARG B 340      -5.922  36.788 110.093  0.50 53.93           N  
ATOM   4510  N   VAL B 341       0.438  40.019 110.225  1.00 86.27           N  
ATOM   4511  CA  VAL B 341       1.525  39.137 110.647  1.00 88.23           C  
ATOM   4512  C   VAL B 341       0.959  37.957 111.436  1.00 86.26           C  
ATOM   4513  O   VAL B 341       0.052  38.127 112.237  1.00 86.79           O  
ATOM   4514  CB  VAL B 341       2.574  39.904 111.487  1.00 89.73           C  
ATOM   4515  CG1 VAL B 341       3.806  39.053 111.712  1.00 90.92           C  
ATOM   4516  CG2 VAL B 341       2.970  41.201 110.786  1.00 91.26           C  
ATOM   4517  N   PHE B 342       1.483  36.764 111.181  1.00 87.45           N  
ATOM   4518  CA  PHE B 342       1.035  35.550 111.859  1.00 88.83           C  
ATOM   4519  C   PHE B 342       2.133  35.033 112.770  1.00 90.33           C  
ATOM   4520  O   PHE B 342       1.903  34.771 113.950  1.00 93.54           O  
ATOM   4521  CB  PHE B 342       0.692  34.464 110.839  1.00 89.35           C  
ATOM   4522  CG  PHE B 342      -0.716  34.517 110.325  1.00 89.50           C  
ATOM   4523  CD1 PHE B 342      -1.403  33.336 110.055  1.00 89.32           C  
ATOM   4524  CD2 PHE B 342      -1.357  35.731 110.097  1.00 90.25           C  
ATOM   4525  CE1 PHE B 342      -2.699  33.359 109.567  1.00 88.54           C  
ATOM   4526  CE2 PHE B 342      -2.662  35.765 109.612  1.00 90.09           C  
ATOM   4527  CZ  PHE B 342      -3.332  34.576 109.346  1.00 88.95           C  
ATOM   4528  N   LEU B 343       3.325  34.870 112.204  1.00 89.89           N  
ATOM   4529  CA  LEU B 343       4.478  34.384 112.947  1.00 88.85           C  
ATOM   4530  C   LEU B 343       5.668  35.290 112.717  1.00 88.69           C  
ATOM   4531  O   LEU B 343       5.822  35.885 111.647  1.00 90.40           O  
ATOM   4532  CB  LEU B 343       4.835  32.957 112.532  1.00 89.36           C  
ATOM   4533  CG  LEU B 343       3.753  31.884 112.686  1.00 90.97           C  
ATOM   4534  CD1 LEU B 343       4.097  30.639 111.865  1.00 90.57           C  
ATOM   4535  CD2 LEU B 343       3.518  31.534 114.154  1.00 89.80           C  
ATOM   4536  N   GLU B 344       6.498  35.393 113.744  1.00 88.45           N  
ATOM   4537  CA  GLU B 344       7.728  36.157 113.697  1.00 88.17           C  
ATOM   4538  C   GLU B 344       8.784  35.316 114.384  1.00 89.61           C  
ATOM   4539  O   GLU B 344       8.863  35.272 115.619  1.00 91.39           O  
ATOM   4540  CB  GLU B 344       7.562  37.507 114.397  1.00 87.72           C  
ATOM   4541  CG  GLU B 344       6.756  38.503 113.590  1.00 88.72           C  
ATOM   4542  CD  GLU B 344       6.728  39.889 114.204  1.00 90.88           C  
ATOM   4543  OE1 GLU B 344       7.278  40.817 113.568  1.00 93.53           O  
ATOM   4544  OE2 GLU B 344       6.156  40.055 115.308  1.00 89.04           O  
ATOM   4545  N   VAL B 345       9.574  34.626 113.570  1.00 88.05           N  
ATOM   4546  CA  VAL B 345      10.591  33.707 114.061  1.00 86.21           C  
ATOM   4547  C   VAL B 345      11.939  34.406 114.053  1.00 82.50           C  
ATOM   4548  O   VAL B 345      12.487  34.681 112.991  1.00 79.78           O  
ATOM   4549  CB  VAL B 345      10.666  32.440 113.176  1.00 88.69           C  
ATOM   4550  CG1 VAL B 345      11.497  31.365 113.843  1.00 87.56           C  
ATOM   4551  CG2 VAL B 345       9.270  31.913 112.866  1.00 91.04           C  
ATOM   4552  N   ALA B 346      12.462  34.709 115.238  1.00 84.37           N  
ATOM   4553  CA  ALA B 346      13.804  35.284 115.363  1.00 84.79           C  
ATOM   4554  C   ALA B 346      14.822  34.365 114.697  1.00 84.84           C  
ATOM   4555  O   ALA B 346      14.732  33.142 114.809  1.00 85.77           O  
ATOM   4556  CB  ALA B 346      14.162  35.504 116.820  1.00 83.99           C  
ATOM   4557  N   GLU B 347      15.777  34.958 113.993  1.00 84.34           N  
ATOM   4558  CA  GLU B 347      16.764  34.182 113.260  1.00 84.61           C  
ATOM   4559  C   GLU B 347      18.174  34.693 113.543  1.00 82.94           C  
ATOM   4560  O   GLU B 347      18.436  35.890 113.468  1.00 83.80           O  
ATOM   4561  CB  GLU B 347      16.450  34.227 111.760  1.00 85.35           C  
ATOM   4562  CG  GLU B 347      16.605  32.890 111.044  1.00 89.77           C  
ATOM   4563  CD  GLU B 347      15.513  31.890 111.390  1.00 92.30           C  
ATOM   4564  OE1 GLU B 347      14.580  32.261 112.127  1.00 95.58           O  
ATOM   4565  OE2 GLU B 347      15.580  30.731 110.926  1.00 93.02           O  
ATOM   4566  N   LEU B 348      19.080  33.781 113.873  1.00 81.51           N  
ATOM   4567  CA  LEU B 348      20.465  34.158 114.143  1.00 79.73           C  
ATOM   4568  C   LEU B 348      21.367  34.030 112.921  1.00 79.97           C  
ATOM   4569  O   LEU B 348      22.417  34.670 112.865  1.00 81.18           O  
ATOM   4570  CB  LEU B 348      21.038  33.324 115.281  1.00 78.10           C  
ATOM   4571  CG  LEU B 348      20.274  33.359 116.600  1.00 80.18           C  
ATOM   4572  CD1 LEU B 348      20.688  32.163 117.431  1.00 80.99           C  
ATOM   4573  CD2 LEU B 348      20.499  34.667 117.358  1.00 80.83           C  
ATOM   4574  N   HIS B 349      20.968  33.207 111.950  1.00 77.19           N  
ATOM   4575  CA  HIS B 349      21.813  32.957 110.786  1.00 78.05           C  
ATOM   4576  C   HIS B 349      21.080  33.105 109.455  1.00 81.77           C  
ATOM   4577  O   HIS B 349      19.906  33.477 109.418  1.00 84.14           O  
ATOM   4578  CB  HIS B 349      22.500  31.595 110.899  1.00 76.76           C  
ATOM   4579  CG  HIS B 349      23.255  31.417 112.175  1.00 75.61           C  
ATOM   4580  ND1 HIS B 349      24.360  32.176 112.493  1.00 76.17           N  
ATOM   4581  CD2 HIS B 349      23.049  30.592 113.227  1.00 75.07           C  
ATOM   4582  CE1 HIS B 349      24.810  31.816 113.681  1.00 75.82           C  
ATOM   4583  NE2 HIS B 349      24.032  30.858 114.149  1.00 74.93           N  
ATOM   4584  N   ARG B 350      21.782  32.808 108.365  1.00 81.78           N  
ATOM   4585  CA  ARG B 350      21.270  33.070 107.028  1.00 81.88           C  
ATOM   4586  C   ARG B 350      21.244  31.807 106.186  1.00 86.04           C  
ATOM   4587  O   ARG B 350      21.194  31.869 104.954  1.00 87.03           O  
ATOM   4588  CB  ARG B 350      22.114  34.146 106.350  1.00 78.52           C  
ATOM   4589  CG  ARG B 350      22.167  35.441 107.126  1.00 77.50           C  
ATOM   4590  CD  ARG B 350      23.254  36.338 106.605  1.00 78.96           C  
ATOM   4591  NE  ARG B 350      23.255  37.629 107.282  1.00 78.83           N  
ATOM   4592  CZ  ARG B 350      23.980  38.673 106.900  1.00 79.17           C  
ATOM   4593  NH1 ARG B 350      24.772  38.591 105.838  1.00 81.12           N  
ATOM   4594  NH2 ARG B 350      23.907  39.808 107.575  1.00 79.91           N  
ATOM   4595  N   LYS B 351      21.284  30.665 106.865  1.00 89.50           N  
ATOM   4596  CA  LYS B 351      21.189  29.361 106.220  1.00 94.91           C  
ATOM   4597  C   LYS B 351      20.226  28.500 107.026  1.00 93.83           C  
ATOM   4598  O   LYS B 351      19.942  28.821 108.184  1.00 93.05           O  
ATOM   4599  CB  LYS B 351      22.566  28.699 106.152  1.00 96.89           C  
ATOM   4600  CG  LYS B 351      23.516  29.329 105.144  1.00 99.92           C  
ATOM   4601  CD  LYS B 351      24.932  28.774 105.292  1.00100.96           C  
ATOM   4602  CE  LYS B 351      25.751  29.006 104.023  1.00104.04           C  
ATOM   4603  NZ  LYS B 351      27.123  28.436 104.122  1.00104.95           N  
ATOM   4604  N   HIS B 352      19.723  27.421 106.420  1.00 93.34           N  
ATOM   4605  CA  HIS B 352      18.830  26.471 107.104  1.00 94.80           C  
ATOM   4606  C   HIS B 352      17.491  27.118 107.468  1.00 94.98           C  
ATOM   4607  O   HIS B 352      16.844  26.716 108.441  1.00 94.02           O  
ATOM   4608  CB  HIS B 352      19.483  25.923 108.389  1.00 95.74           C  
ATOM   4609  CG  HIS B 352      20.589  24.938 108.159  1.00 96.82           C  
ATOM   4610  ND1 HIS B 352      21.395  24.957 107.041  1.00 97.35           N  
ATOM   4611  CD2 HIS B 352      21.047  23.926 108.934  1.00 96.57           C  
ATOM   4612  CE1 HIS B 352      22.286  23.985 107.125  1.00 97.46           C  
ATOM   4613  NE2 HIS B 352      22.096  23.346 108.265  1.00 97.43           N  
ATOM   4614  N   LEU B 353      17.085  28.120 106.694  1.00 94.83           N  
ATOM   4615  CA  LEU B 353      15.902  28.919 107.021  1.00 93.24           C  
ATOM   4616  C   LEU B 353      14.589  28.145 106.875  1.00 94.81           C  
ATOM   4617  O   LEU B 353      13.881  27.938 107.864  1.00 97.45           O  
ATOM   4618  CB  LEU B 353      15.883  30.217 106.200  1.00 89.74           C  
ATOM   4619  CG  LEU B 353      16.499  31.505 106.769  1.00 85.97           C  
ATOM   4620  CD1 LEU B 353      17.579  31.279 107.818  1.00 82.02           C  
ATOM   4621  CD2 LEU B 353      17.062  32.322 105.629  1.00 85.19           C  
ATOM   4622  N   GLY B 354      14.285  27.702 105.656  1.00 95.20           N  
ATOM   4623  CA  GLY B 354      13.032  27.000 105.366  1.00 94.40           C  
ATOM   4624  C   GLY B 354      11.969  27.978 104.917  1.00 96.37           C  
ATOM   4625  O   GLY B 354      12.250  28.895 104.147  1.00 99.61           O  
ATOM   4626  N   GLY B 355      10.747  27.789 105.401  1.00 96.77           N  
ATOM   4627  CA  GLY B 355       9.657  28.722 105.124  1.00 94.08           C  
ATOM   4628  C   GLY B 355       8.691  28.285 104.040  1.00 93.43           C  
ATOM   4629  O   GLY B 355       7.876  29.079 103.581  1.00 96.90           O  
ATOM   4630  N   GLN B 356       8.778  27.029 103.624  1.00 91.52           N  
ATOM   4631  CA  GLN B 356       7.830  26.482 102.666  1.00 92.47           C  
ATOM   4632  C   GLN B 356       6.440  26.488 103.291  1.00 92.50           C  
ATOM   4633  O   GLN B 356       6.250  26.023 104.418  1.00 92.08           O  
ATOM   4634  CB  GLN B 356       8.237  25.064 102.273  1.00 93.90           C  
ATOM   4635  CG  GLN B 356       7.356  24.376 101.231  1.00 92.12           C  
ATOM   4636  CD  GLN B 356       7.881  22.986 100.850  1.00 93.88           C  
ATOM   4637  OE1 GLN B 356       9.030  22.626 101.138  1.00 94.12           O  
ATOM   4638  NE2 GLN B 356       7.038  22.206 100.195  1.00 96.45           N  
ATOM   4639  N   LEU B 357       5.486  27.049 102.557  1.00 92.38           N  
ATOM   4640  CA  LEU B 357       4.102  27.106 102.989  1.00 91.74           C  
ATOM   4641  C   LEU B 357       3.250  26.260 102.058  1.00 93.60           C  
ATOM   4642  O   LEU B 357       3.366  26.362 100.829  1.00 96.77           O  
ATOM   4643  CB  LEU B 357       3.585  28.546 102.971  1.00 91.15           C  
ATOM   4644  CG  LEU B 357       4.367  29.692 103.619  1.00 92.20           C  
ATOM   4645  CD1 LEU B 357       3.762  31.037 103.194  1.00 91.83           C  
ATOM   4646  CD2 LEU B 357       4.419  29.571 105.138  1.00 90.14           C  
ATOM   4647  N   LEU B 358       2.388  25.433 102.642  1.00 89.72           N  
ATOM   4648  CA  LEU B 358       1.422  24.663 101.864  1.00 87.64           C  
ATOM   4649  C   LEU B 358       0.113  24.499 102.628  1.00 89.93           C  
ATOM   4650  O   LEU B 358       0.095  24.522 103.867  1.00 92.00           O  
ATOM   4651  CB  LEU B 358       1.995  23.292 101.468  1.00 85.77           C  
ATOM   4652  CG  LEU B 358       2.419  22.312 102.576  1.00 83.82           C  
ATOM   4653  CD1 LEU B 358       1.656  21.011 102.477  1.00 80.79           C  
ATOM   4654  CD2 LEU B 358       3.922  22.068 102.582  1.00 83.48           C  
ATOM   4655  N   PHE B 359      -0.981  24.340 101.890  1.00 90.30           N  
ATOM   4656  CA  PHE B 359      -2.269  24.007 102.506  1.00 89.74           C  
ATOM   4657  C   PHE B 359      -2.560  22.521 102.340  1.00 89.73           C  
ATOM   4658  O   PHE B 359      -2.523  21.994 101.233  1.00 90.16           O  
ATOM   4659  CB  PHE B 359      -3.413  24.833 101.901  1.00 86.52           C  
ATOM   4660  CG  PHE B 359      -3.569  26.202 102.499  1.00 85.37           C  
ATOM   4661  CD1 PHE B 359      -2.938  27.306 101.923  1.00 85.17           C  
ATOM   4662  CD2 PHE B 359      -4.357  26.395 103.630  1.00 84.34           C  
ATOM   4663  CE1 PHE B 359      -3.087  28.591 102.469  1.00 84.09           C  
ATOM   4664  CE2 PHE B 359      -4.504  27.672 104.188  1.00 83.62           C  
ATOM   4665  CZ  PHE B 359      -3.869  28.771 103.602  1.00 84.11           C  
ATOM   4666  N   GLY B 360      -2.849  21.840 103.439  1.00 93.80           N  
ATOM   4667  CA  GLY B 360      -3.226  20.435 103.361  1.00 98.71           C  
ATOM   4668  C   GLY B 360      -4.604  20.272 102.741  1.00102.42           C  
ATOM   4669  O   GLY B 360      -5.349  21.249 102.623  1.00104.26           O  
ATOM   4670  N   PRO B 361      -4.950  19.038 102.322  1.00102.86           N  
ATOM   4671  CA  PRO B 361      -6.322  18.721 101.922  1.00 99.34           C  
ATOM   4672  C   PRO B 361      -7.270  18.950 103.085  1.00 94.82           C  
ATOM   4673  O   PRO B 361      -8.461  19.161 102.880  1.00 95.96           O  
ATOM   4674  CB  PRO B 361      -6.255  17.229 101.591  1.00101.48           C  
ATOM   4675  CG  PRO B 361      -4.825  16.974 101.270  1.00103.16           C  
ATOM   4676  CD  PRO B 361      -4.058  17.875 102.179  1.00102.91           C  
ATOM   4677  N   ASP B 362      -6.722  18.907 104.296  1.00 92.47           N  
ATOM   4678  CA  ASP B 362      -7.447  19.238 105.519  1.00 92.97           C  
ATOM   4679  C   ASP B 362      -7.867  20.708 105.555  1.00 91.54           C  
ATOM   4680  O   ASP B 362      -8.773  21.082 106.305  1.00 91.53           O  
ATOM   4681  CB  ASP B 362      -6.581  18.920 106.744  1.00 95.78           C  
ATOM   4682  CG  ASP B 362      -5.123  19.355 106.573  1.00 99.24           C  
ATOM   4683  OD1 ASP B 362      -4.868  20.494 106.121  1.00 99.98           O  
ATOM   4684  OD2 ASP B 362      -4.224  18.550 106.895  1.00101.47           O  
ATOM   4685  N   GLY B 363      -7.195  21.532 104.750  1.00 88.44           N  
ATOM   4686  CA  GLY B 363      -7.465  22.965 104.695  1.00 85.86           C  
ATOM   4687  C   GLY B 363      -6.616  23.782 105.651  1.00 86.33           C  
ATOM   4688  O   GLY B 363      -6.719  25.008 105.680  1.00 87.17           O  
ATOM   4689  N   PHE B 364      -5.785  23.104 106.441  1.00 86.89           N  
ATOM   4690  CA  PHE B 364      -4.896  23.769 107.388  1.00 86.45           C  
ATOM   4691  C   PHE B 364      -3.624  24.176 106.684  1.00 88.04           C  
ATOM   4692  O   PHE B 364      -3.271  23.601 105.653  1.00 89.77           O  
ATOM   4693  CB  PHE B 364      -4.562  22.863 108.576  1.00 84.11           C  
ATOM   4694  CG  PHE B 364      -5.768  22.374 109.333  1.00 85.10           C  
ATOM   4695  CD1 PHE B 364      -6.743  23.264 109.783  1.00 85.24           C  
ATOM   4696  CD2 PHE B 364      -5.921  21.021 109.618  1.00 85.37           C  
ATOM   4697  CE1 PHE B 364      -7.858  22.807 110.497  1.00 83.79           C  
ATOM   4698  CE2 PHE B 364      -7.033  20.558 110.331  1.00 84.16           C  
ATOM   4699  CZ  PHE B 364      -8.002  21.454 110.765  1.00 82.90           C  
ATOM   4700  N   LEU B 365      -2.938  25.166 107.249  1.00 89.89           N  
ATOM   4701  CA  LEU B 365      -1.703  25.700 106.671  1.00 89.53           C  
ATOM   4702  C   LEU B 365      -0.478  25.088 107.347  1.00 90.84           C  
ATOM   4703  O   LEU B 365      -0.398  25.040 108.578  1.00 92.13           O  
ATOM   4704  CB  LEU B 365      -1.677  27.223 106.816  1.00 86.08           C  
ATOM   4705  CG  LEU B 365      -0.419  27.966 106.388  1.00 82.69           C  
ATOM   4706  CD1 LEU B 365      -0.463  28.209 104.909  1.00 84.60           C  
ATOM   4707  CD2 LEU B 365      -0.321  29.272 107.129  1.00 82.69           C  
ATOM   4708  N   TYR B 366       0.468  24.618 106.538  1.00 89.37           N  
ATOM   4709  CA  TYR B 366       1.701  24.032 107.053  1.00 87.26           C  
ATOM   4710  C   TYR B 366       2.858  24.963 106.747  1.00 87.73           C  
ATOM   4711  O   TYR B 366       2.949  25.502 105.643  1.00 86.79           O  
ATOM   4712  CB  TYR B 366       1.960  22.666 106.419  1.00 84.77           C  
ATOM   4713  CG  TYR B 366       0.972  21.580 106.807  1.00 83.89           C  
ATOM   4714  CD1 TYR B 366      -0.362  21.632 106.389  1.00 83.30           C  
ATOM   4715  CD2 TYR B 366       1.382  20.481 107.557  1.00 81.70           C  
ATOM   4716  CE1 TYR B 366      -1.267  20.634 106.738  1.00 83.24           C  
ATOM   4717  CE2 TYR B 366       0.489  19.478 107.905  1.00 82.76           C  
ATOM   4718  CZ  TYR B 366      -0.836  19.559 107.496  1.00 83.34           C  
ATOM   4719  OH  TYR B 366      -1.722  18.560 107.848  1.00 81.95           O  
ATOM   4720  N   ILE B 367       3.726  25.156 107.736  1.00 88.03           N  
ATOM   4721  CA  ILE B 367       4.927  25.975 107.581  1.00 86.21           C  
ATOM   4722  C   ILE B 367       6.118  25.106 107.930  1.00 87.71           C  
ATOM   4723  O   ILE B 367       6.241  24.632 109.066  1.00 90.52           O  
ATOM   4724  CB  ILE B 367       4.921  27.217 108.517  1.00 85.45           C  
ATOM   4725  CG1 ILE B 367       3.686  28.093 108.282  1.00 86.35           C  
ATOM   4726  CG2 ILE B 367       6.197  28.031 108.360  1.00 82.77           C  
ATOM   4727  CD1 ILE B 367       2.556  27.840 109.269  1.00 86.64           C  
ATOM   4728  N   ILE B 368       6.986  24.887 106.951  1.00 87.40           N  
ATOM   4729  CA  ILE B 368       8.160  24.046 107.148  1.00 88.83           C  
ATOM   4730  C   ILE B 368       9.379  24.896 107.500  1.00 88.28           C  
ATOM   4731  O   ILE B 368      10.009  25.493 106.628  1.00 93.67           O  
ATOM   4732  CB  ILE B 368       8.426  23.166 105.911  1.00 90.25           C  
ATOM   4733  CG1 ILE B 368       7.299  22.143 105.752  1.00 93.27           C  
ATOM   4734  CG2 ILE B 368       9.764  22.459 106.035  1.00 91.74           C  
ATOM   4735  CD1 ILE B 368       7.253  21.453 104.398  1.00 95.84           C  
ATOM   4736  N   LEU B 369       9.703  24.957 108.783  1.00 84.37           N  
ATOM   4737  CA  LEU B 369      10.846  25.741 109.235  1.00 84.85           C  
ATOM   4738  C   LEU B 369      12.095  24.889 109.427  1.00 84.83           C  
ATOM   4739  O   LEU B 369      12.049  23.846 110.078  1.00 86.74           O  
ATOM   4740  CB  LEU B 369      10.515  26.482 110.531  1.00 83.11           C  
ATOM   4741  CG  LEU B 369       9.519  27.638 110.452  1.00 81.18           C  
ATOM   4742  CD1 LEU B 369       9.281  28.171 111.845  1.00 80.10           C  
ATOM   4743  CD2 LEU B 369      10.006  28.745 109.524  1.00 78.28           C  
ATOM   4744  N   GLY B 370      13.208  25.347 108.862  1.00 83.18           N  
ATOM   4745  CA  GLY B 370      14.479  24.661 109.002  1.00 83.82           C  
ATOM   4746  C   GLY B 370      15.161  24.973 110.317  1.00 87.93           C  
ATOM   4747  O   GLY B 370      14.618  25.699 111.146  1.00 88.80           O  
ATOM   4748  N   ASP B 371      16.364  24.424 110.481  1.00 92.88           N  
ATOM   4749  CA  ASP B 371      17.196  24.535 111.689  1.00 92.64           C  
ATOM   4750  C   ASP B 371      17.424  25.970 112.141  1.00 92.49           C  
ATOM   4751  O   ASP B 371      17.478  26.245 113.339  1.00 92.33           O  
ATOM   4752  CB  ASP B 371      18.572  23.941 111.397  1.00 94.29           C  
ATOM   4753  CG  ASP B 371      18.933  22.810 112.316  1.00 99.16           C  
ATOM   4754  OD1 ASP B 371      18.292  22.643 113.372  1.00103.30           O  
ATOM   4755  OD2 ASP B 371      19.874  22.072 111.970  1.00102.22           O  
ATOM   4756  N   GLY B 372      17.585  26.866 111.165  1.00 93.05           N  
ATOM   4757  CA  GLY B 372      18.019  28.242 111.402  1.00 92.30           C  
ATOM   4758  C   GLY B 372      19.474  28.256 111.824  1.00 92.34           C  
ATOM   4759  O   GLY B 372      20.044  29.317 112.094  1.00 92.87           O  
ATOM   4760  N   MET B 373      20.064  27.061 111.856  1.00 91.61           N  
ATOM   4761  CA  MET B 373      21.369  26.798 112.465  1.00 92.67           C  
ATOM   4762  C   MET B 373      21.426  27.121 113.962  1.00 92.74           C  
ATOM   4763  O   MET B 373      22.502  27.084 114.566  1.00 92.62           O  
ATOM   4764  CB  MET B 373      22.508  27.467 111.690  1.00 92.46           C  
ATOM   4765  CG  MET B 373      22.975  26.651 110.497  1.00 93.82           C  
ATOM   4766  SD  MET B 373      24.421  27.345 109.679  1.00 94.16           S  
ATOM   4767  CE  MET B 373      25.738  26.823 110.789  1.00 94.39           C  
ATOM   4768  N   ILE B 374      20.261  27.417 114.547  1.00 92.60           N  
ATOM   4769  CA  ILE B 374      20.108  27.604 115.995  1.00 93.14           C  
ATOM   4770  C   ILE B 374      20.557  26.339 116.729  1.00 93.11           C  
ATOM   4771  O   ILE B 374      20.081  25.241 116.426  1.00 92.69           O  
ATOM   4772  CB  ILE B 374      18.629  27.874 116.392  1.00 92.55           C  
ATOM   4773  CG1 ILE B 374      17.948  28.861 115.433  1.00 92.41           C  
ATOM   4774  CG2 ILE B 374      18.530  28.320 117.856  1.00 92.82           C  
ATOM   4775  CD1 ILE B 374      18.227  30.324 115.701  1.00 92.16           C  
ATOM   4776  N   THR B 375      21.471  26.495 117.683  1.00 93.33           N  
ATOM   4777  CA  THR B 375      21.965  25.354 118.458  1.00 95.28           C  
ATOM   4778  C   THR B 375      21.369  25.328 119.865  1.00 96.11           C  
ATOM   4779  O   THR B 375      21.175  26.376 120.478  1.00 97.23           O  
ATOM   4780  CB  THR B 375      23.526  25.288 118.497  1.00 96.08           C  
ATOM   4781  OG1 THR B 375      23.938  24.134 119.236  1.00 98.72           O  
ATOM   4782  CG2 THR B 375      24.142  26.523 119.140  1.00 96.14           C  
ATOM   4783  N   LEU B 376      21.077  24.131 120.375  1.00 96.60           N  
ATOM   4784  CA  LEU B 376      20.522  23.986 121.727  1.00 97.04           C  
ATOM   4785  C   LEU B 376      21.336  24.762 122.765  1.00 96.32           C  
ATOM   4786  O   LEU B 376      20.813  25.150 123.812  1.00 93.77           O  
ATOM   4787  CB  LEU B 376      20.411  22.511 122.132  1.00 98.14           C  
ATOM   4788  CG  LEU B 376      19.707  22.225 123.473  1.00100.24           C  
ATOM   4789  CD1 LEU B 376      18.190  22.359 123.350  1.00100.81           C  
ATOM   4790  CD2 LEU B 376      20.077  20.859 124.048  1.00 99.30           C  
ATOM   4791  N   ASP B 377      22.613  24.985 122.462  1.00 99.24           N  
ATOM   4792  CA  ASP B 377      23.462  25.847 123.276  1.00101.94           C  
ATOM   4793  C   ASP B 377      22.881  27.251 123.385  1.00102.15           C  
ATOM   4794  O   ASP B 377      22.375  27.627 124.444  1.00 99.80           O  
ATOM   4795  CB  ASP B 377      24.899  25.884 122.742  1.00103.55           C  
ATOM   4796  CG  ASP B 377      25.881  25.197 123.670  1.00105.22           C  
ATOM   4797  OD1 ASP B 377      26.936  25.796 123.961  1.00106.99           O  
ATOM   4798  OD2 ASP B 377      25.593  24.071 124.128  1.00105.72           O  
ATOM   4799  N   ASP B 378      22.925  28.007 122.287  1.00104.54           N  
ATOM   4800  CA  ASP B 378      22.422  29.383 122.281  1.00105.76           C  
ATOM   4801  C   ASP B 378      20.914  29.472 122.576  1.00104.13           C  
ATOM   4802  O   ASP B 378      20.420  30.509 123.016  1.00103.52           O  
ATOM   4803  CB  ASP B 378      22.824  30.132 120.995  1.00107.67           C  
ATOM   4804  CG  ASP B 378      22.458  29.382 119.720  1.00111.97           C  
ATOM   4805  OD1 ASP B 378      21.424  28.687 119.693  1.00114.86           O  
ATOM   4806  OD2 ASP B 378      23.202  29.503 118.722  1.00113.42           O  
ATOM   4807  N   MET B 379      20.205  28.364 122.369  1.00103.14           N  
ATOM   4808  CA  MET B 379      18.786  28.268 122.705  1.00103.00           C  
ATOM   4809  C   MET B 379      18.562  28.280 124.214  1.00 99.55           C  
ATOM   4810  O   MET B 379      17.554  28.799 124.685  1.00 99.81           O  
ATOM   4811  CB  MET B 379      18.179  27.005 122.097  1.00104.70           C  
ATOM   4812  CG  MET B 379      16.711  27.129 121.737  1.00105.45           C  
ATOM   4813  SD  MET B 379      16.151  25.692 120.807  1.00106.85           S  
ATOM   4814  CE  MET B 379      14.867  26.416 119.778  1.00106.21           C  
ATOM   4815  N   GLU B 380      19.503  27.703 124.960  1.00 98.33           N  
ATOM   4816  CA  GLU B 380      19.461  27.709 126.426  1.00 97.31           C  
ATOM   4817  C   GLU B 380      19.905  29.044 127.014  1.00 96.49           C  
ATOM   4818  O   GLU B 380      19.525  29.390 128.132  1.00 96.49           O  
ATOM   4819  CB  GLU B 380      20.348  26.598 127.000  1.00 95.92           C  
ATOM   4820  CG  GLU B 380      19.657  25.256 127.185  1.00 95.81           C  
ATOM   4821  CD  GLU B 380      20.523  24.233 127.911  1.00 97.25           C  
ATOM   4822  OE1 GLU B 380      21.695  24.532 128.230  1.00 98.18           O  
ATOM   4823  OE2 GLU B 380      20.025  23.118 128.168  1.00 98.15           O  
ATOM   4824  N   GLU B 381      20.700  29.789 126.249  1.00 96.28           N  
ATOM   4825  CA  GLU B 381      21.435  30.945 126.770  1.00 94.60           C  
ATOM   4826  C   GLU B 381      20.969  32.303 126.220  1.00 93.80           C  
ATOM   4827  O   GLU B 381      21.650  33.317 126.414  1.00 94.03           O  
ATOM   4828  CB  GLU B 381      22.937  30.762 126.506  1.00 93.57           C  
ATOM   4829  CG  GLU B 381      23.528  29.455 127.039  1.00 92.23           C  
ATOM   4830  CD  GLU B 381      24.598  28.868 126.127  1.00 92.34           C  
ATOM   4831  OE1 GLU B 381      24.720  29.318 124.965  1.00 94.62           O  
ATOM   4832  OE2 GLU B 381      25.310  27.940 126.565  1.00 89.16           O  
ATOM   4833  N   MET B 382      19.822  32.328 125.542  1.00 91.42           N  
ATOM   4834  CA  MET B 382      19.312  33.571 124.948  1.00 89.69           C  
ATOM   4835  C   MET B 382      17.799  33.742 125.104  1.00 88.69           C  
ATOM   4836  O   MET B 382      17.048  32.767 125.050  1.00 89.58           O  
ATOM   4837  CB  MET B 382      19.708  33.675 123.467  1.00 89.97           C  
ATOM   4838  CG  MET B 382      21.221  33.624 123.197  1.00 90.39           C  
ATOM   4839  SD  MET B 382      21.753  33.954 121.496  1.00 89.61           S  
ATOM   4840  CE  MET B 382      20.703  32.830 120.595  1.00 89.95           C  
ATOM   4841  N   ASP B 383      17.367  34.989 125.289  1.00 87.17           N  
ATOM   4842  CA  ASP B 383      15.945  35.333 125.418  1.00 86.07           C  
ATOM   4843  C   ASP B 383      15.354  35.855 124.106  1.00 86.36           C  
ATOM   4844  O   ASP B 383      16.050  36.483 123.307  1.00 86.02           O  
ATOM   4845  CB  ASP B 383      15.746  36.379 126.522  1.00 84.48           C  
ATOM   4846  CG  ASP B 383      16.000  35.825 127.920  1.00 84.58           C  
ATOM   4847  OD1 ASP B 383      16.176  34.596 128.067  1.00 85.36           O  
ATOM   4848  OD2 ASP B 383      16.016  36.620 128.887  1.00 83.69           O  
ATOM   4849  N   GLY B 384      14.065  35.603 123.895  1.00 87.26           N  
ATOM   4850  CA  GLY B 384      13.358  36.097 122.708  1.00 87.57           C  
ATOM   4851  C   GLY B 384      13.713  35.310 121.463  1.00 88.03           C  
ATOM   4852  O   GLY B 384      13.903  35.876 120.382  1.00 87.09           O  
ATOM   4853  N   LEU B 385      13.796  33.995 121.633  1.00 88.45           N  
ATOM   4854  CA  LEU B 385      14.198  33.086 120.577  1.00 88.07           C  
ATOM   4855  C   LEU B 385      13.084  32.078 120.328  1.00 89.60           C  
ATOM   4856  O   LEU B 385      12.603  31.432 121.264  1.00 90.08           O  
ATOM   4857  CB  LEU B 385      15.472  32.357 120.997  1.00 87.54           C  
ATOM   4858  CG  LEU B 385      16.479  31.987 119.913  1.00 86.87           C  
ATOM   4859  CD1 LEU B 385      17.218  33.229 119.439  1.00 87.40           C  
ATOM   4860  CD2 LEU B 385      17.454  30.958 120.450  1.00 85.65           C  
ATOM   4861  N   SER B 386      12.677  31.945 119.067  1.00 90.97           N  
ATOM   4862  CA  SER B 386      11.546  31.088 118.711  1.00 91.62           C  
ATOM   4863  C   SER B 386      11.733  29.626 119.093  1.00 93.12           C  
ATOM   4864  O   SER B 386      12.858  29.140 119.219  1.00 96.29           O  
ATOM   4865  CB  SER B 386      11.237  31.182 117.222  1.00 90.47           C  
ATOM   4866  OG  SER B 386      10.290  30.193 116.851  1.00 89.02           O  
ATOM   4867  N   ASP B 387      10.607  28.943 119.274  1.00 92.96           N  
ATOM   4868  CA  ASP B 387      10.582  27.511 119.518  1.00 93.25           C  
ATOM   4869  C   ASP B 387       9.992  26.769 118.325  1.00 92.83           C  
ATOM   4870  O   ASP B 387       9.654  25.585 118.420  1.00 93.38           O  
ATOM   4871  CB  ASP B 387       9.786  27.208 120.782  1.00 95.00           C  
ATOM   4872  CG  ASP B 387      10.631  27.298 122.031  1.00 98.86           C  
ATOM   4873  OD1 ASP B 387      11.660  26.582 122.111  1.00100.11           O  
ATOM   4874  OD2 ASP B 387      10.265  28.078 122.935  1.00 99.44           O  
ATOM   4875  N   PHE B 388       9.884  27.470 117.200  1.00 90.64           N  
ATOM   4876  CA  PHE B 388       9.313  26.887 115.994  1.00 89.27           C  
ATOM   4877  C   PHE B 388      10.359  26.343 115.006  1.00 88.64           C  
ATOM   4878  O   PHE B 388      10.027  25.515 114.157  1.00 90.70           O  
ATOM   4879  CB  PHE B 388       8.373  27.882 115.298  1.00 88.97           C  
ATOM   4880  CG  PHE B 388       7.267  28.410 116.180  1.00 89.85           C  
ATOM   4881  CD1 PHE B 388       7.016  29.782 116.252  1.00 90.20           C  
ATOM   4882  CD2 PHE B 388       6.474  27.545 116.937  1.00 88.10           C  
ATOM   4883  CE1 PHE B 388       5.995  30.281 117.063  1.00 88.69           C  
ATOM   4884  CE2 PHE B 388       5.453  28.036 117.750  1.00 86.45           C  
ATOM   4885  CZ  PHE B 388       5.212  29.403 117.812  1.00 87.50           C  
ATOM   4886  N   THR B 389      11.609  26.801 115.112  1.00 84.98           N  
ATOM   4887  CA  THR B 389      12.655  26.393 114.162  1.00 82.37           C  
ATOM   4888  C   THR B 389      12.862  24.888 114.181  1.00 82.51           C  
ATOM   4889  O   THR B 389      12.766  24.260 115.225  1.00 81.90           O  
ATOM   4890  CB  THR B 389      14.013  27.077 114.421  1.00 81.06           C  
ATOM   4891  OG1 THR B 389      14.438  26.823 115.766  1.00 85.48           O  
ATOM   4892  CG2 THR B 389      13.927  28.570 114.188  1.00 77.74           C  
ATOM   4893  N   GLY B 390      13.138  24.318 113.013  1.00 86.29           N  
ATOM   4894  CA  GLY B 390      13.336  22.876 112.871  1.00 87.88           C  
ATOM   4895  C   GLY B 390      12.056  22.076 113.040  1.00 88.51           C  
ATOM   4896  O   GLY B 390      12.099  20.866 113.283  1.00 90.09           O  
ATOM   4897  N   SER B 391      10.917  22.752 112.909  1.00 87.63           N  
ATOM   4898  CA  SER B 391       9.620  22.125 113.120  1.00 87.46           C  
ATOM   4899  C   SER B 391       8.691  22.337 111.943  1.00 85.86           C  
ATOM   4900  O   SER B 391       8.777  23.348 111.257  1.00 87.87           O  
ATOM   4901  CB  SER B 391       8.954  22.695 114.371  1.00 89.32           C  
ATOM   4902  OG  SER B 391       9.812  22.620 115.493  1.00 93.13           O  
ATOM   4903  N   VAL B 392       7.804  21.377 111.716  1.00 84.49           N  
ATOM   4904  CA  VAL B 392       6.674  21.575 110.822  1.00 84.93           C  
ATOM   4905  C   VAL B 392       5.532  22.096 111.678  1.00 87.46           C  
ATOM   4906  O   VAL B 392       5.157  21.464 112.673  1.00 88.15           O  
ATOM   4907  CB  VAL B 392       6.244  20.264 110.136  1.00 83.63           C  
ATOM   4908  CG1 VAL B 392       5.104  20.515 109.154  1.00 81.75           C  
ATOM   4909  CG2 VAL B 392       7.420  19.628 109.425  1.00 84.29           C  
ATOM   4910  N   LEU B 393       4.997  23.256 111.304  1.00 88.50           N  
ATOM   4911  CA  LEU B 393       3.868  23.855 112.027  1.00 88.45           C  
ATOM   4912  C   LEU B 393       2.568  23.698 111.240  1.00 88.86           C  
ATOM   4913  O   LEU B 393       2.577  23.707 109.997  1.00 90.78           O  
ATOM   4914  CB  LEU B 393       4.125  25.341 112.299  1.00 87.03           C  
ATOM   4915  CG  LEU B 393       5.489  25.788 112.825  1.00 83.88           C  
ATOM   4916  CD1 LEU B 393       5.559  27.295 112.850  1.00 82.99           C  
ATOM   4917  CD2 LEU B 393       5.757  25.223 114.199  1.00 83.42           C  
ATOM   4918  N   ARG B 394       1.457  23.571 111.963  1.00 85.02           N  
ATOM   4919  CA  ARG B 394       0.140  23.444 111.336  1.00 84.22           C  
ATOM   4920  C   ARG B 394      -0.887  24.374 111.983  1.00 82.57           C  
ATOM   4921  O   ARG B 394      -1.251  24.179 113.142  1.00 85.47           O  
ATOM   4922  CB  ARG B 394      -0.343  21.996 111.405  1.00 85.80           C  
ATOM   4923  CG  ARG B 394      -1.503  21.691 110.486  1.00 88.02           C  
ATOM   4924  CD  ARG B 394      -1.811  20.213 110.472  1.00 89.18           C  
ATOM   4925  NE  ARG B 394      -2.826  19.830 111.441  1.00 90.75           N  
ATOM   4926  CZ  ARG B 394      -3.376  18.621 111.504  1.00 94.22           C  
ATOM   4927  NH1 ARG B 394      -3.009  17.671 110.652  1.00 96.42           N  
ATOM   4928  NH2 ARG B 394      -4.297  18.356 112.420  1.00 95.98           N  
ATOM   4929  N   LEU B 395      -1.359  25.369 111.233  1.00 80.02           N  
ATOM   4930  CA  LEU B 395      -2.305  26.359 111.768  1.00 78.46           C  
ATOM   4931  C   LEU B 395      -3.668  26.337 111.080  1.00 78.96           C  
ATOM   4932  O   LEU B 395      -3.755  26.132 109.868  1.00 80.63           O  
ATOM   4933  CB  LEU B 395      -1.726  27.769 111.677  1.00 77.21           C  
ATOM   4934  CG  LEU B 395      -0.237  28.000 111.943  1.00 77.42           C  
ATOM   4935  CD1 LEU B 395       0.122  29.458 111.652  1.00 79.18           C  
ATOM   4936  CD2 LEU B 395       0.142  27.631 113.360  1.00 77.72           C  
ATOM   4937  N   ASP B 396      -4.722  26.545 111.869  1.00 79.45           N  
ATOM   4938  CA  ASP B 396      -6.081  26.661 111.350  1.00 82.48           C  
ATOM   4939  C   ASP B 396      -6.371  28.131 111.114  1.00 84.19           C  
ATOM   4940  O   ASP B 396      -6.744  28.867 112.034  1.00 82.34           O  
ATOM   4941  CB  ASP B 396      -7.110  26.056 112.316  1.00 85.29           C  
ATOM   4942  CG  ASP B 396      -8.528  26.023 111.735  1.00 88.31           C  
ATOM   4943  OD1 ASP B 396      -8.689  26.229 110.509  1.00 92.05           O  
ATOM   4944  OD2 ASP B 396      -9.483  25.779 112.508  1.00 87.04           O  
ATOM   4945  N   VAL B 397      -6.203  28.542 109.863  1.00 85.08           N  
ATOM   4946  CA  VAL B 397      -6.296  29.939 109.481  1.00 83.96           C  
ATOM   4947  C   VAL B 397      -7.739  30.450 109.500  1.00 86.44           C  
ATOM   4948  O   VAL B 397      -7.969  31.659 109.577  1.00 88.50           O  
ATOM   4949  CB  VAL B 397      -5.682  30.154 108.096  1.00 84.52           C  
ATOM   4950  CG1 VAL B 397      -5.833  31.566 107.696  1.00 89.24           C  
ATOM   4951  CG2 VAL B 397      -4.209  29.810 108.111  1.00 86.54           C  
ATOM   4952  N   ASP B 398      -8.700  29.527 109.447  1.00 87.24           N  
ATOM   4953  CA  ASP B 398     -10.122  29.865 109.373  1.00 87.65           C  
ATOM   4954  C   ASP B 398     -10.718  30.182 110.743  1.00 89.18           C  
ATOM   4955  O   ASP B 398     -11.490  29.388 111.274  1.00 89.48           O  
ATOM   4956  CB  ASP B 398     -10.916  28.713 108.743  1.00 87.54           C  
ATOM   4957  CG  ASP B 398     -10.346  28.249 107.412  1.00 89.15           C  
ATOM   4958  OD1 ASP B 398     -10.048  29.088 106.535  1.00 87.32           O  
ATOM   4959  OD2 ASP B 398     -10.215  27.022 107.238  1.00 92.44           O  
ATOM   4960  N   THR B 399     -10.376  31.343 111.302  1.00 90.74           N  
ATOM   4961  CA  THR B 399     -10.872  31.742 112.623  1.00 92.47           C  
ATOM   4962  C   THR B 399     -12.140  32.575 112.525  1.00 94.79           C  
ATOM   4963  O   THR B 399     -12.339  33.313 111.558  1.00 96.42           O  
ATOM   4964  CB  THR B 399      -9.848  32.589 113.402  1.00 92.64           C  
ATOM   4965  OG1 THR B 399      -8.528  32.337 112.911  1.00 96.24           O  
ATOM   4966  CG2 THR B 399      -9.912  32.276 114.891  1.00 90.67           C  
ATOM   4967  N   ASP B 400     -12.991  32.453 113.540  1.00 95.55           N  
ATOM   4968  CA  ASP B 400     -14.121  33.351 113.719  1.00 95.28           C  
ATOM   4969  C   ASP B 400     -13.849  34.270 114.909  1.00 96.59           C  
ATOM   4970  O   ASP B 400     -14.756  34.936 115.410  1.00 98.23           O  
ATOM   4971  CB  ASP B 400     -15.413  32.557 113.920  1.00 95.75           C  
ATOM   4972  CG  ASP B 400     -15.963  31.984 112.620  1.00 97.83           C  
ATOM   4973  OD1 ASP B 400     -17.184  32.097 112.395  1.00 98.63           O  
ATOM   4974  OD2 ASP B 400     -15.187  31.422 111.819  1.00 99.51           O  
ATOM   4975  N   MET B 401     -12.592  34.296 115.354  1.00 96.81           N  
ATOM   4976  CA  MET B 401     -12.165  35.121 116.484  1.00 97.86           C  
ATOM   4977  C   MET B 401     -11.273  36.253 115.994  1.00 95.31           C  
ATOM   4978  O   MET B 401     -10.624  36.125 114.962  1.00 98.04           O  
ATOM   4979  CB  MET B 401     -11.412  34.282 117.528  1.00103.08           C  
ATOM   4980  CG  MET B 401     -12.094  32.974 117.937  1.00107.11           C  
ATOM   4981  SD  MET B 401     -13.599  33.193 118.905  1.00111.59           S  
ATOM   4982  CE  MET B 401     -12.946  33.198 120.576  1.00112.35           C  
ATOM   4983  N   CYS B 402     -11.234  37.354 116.739  1.00 93.81           N  
ATOM   4984  CA  CYS B 402     -10.423  38.512 116.360  1.00 93.54           C  
ATOM   4985  C   CYS B 402      -9.313  38.826 117.361  1.00 93.61           C  
ATOM   4986  O   CYS B 402      -8.536  39.759 117.156  1.00 95.64           O  
ATOM   4987  CB  CYS B 402     -11.304  39.742 116.143  1.00 93.20           C  
ATOM   4988  SG  CYS B 402     -12.672  39.458 115.008  1.00 93.59           S  
ATOM   4989  N   ASN B 403      -9.236  38.034 118.428  1.00 92.83           N  
ATOM   4990  CA  ASN B 403      -8.236  38.229 119.477  1.00 93.28           C  
ATOM   4991  C   ASN B 403      -6.847  37.719 119.095  1.00 93.94           C  
ATOM   4992  O   ASN B 403      -5.840  38.253 119.562  1.00 95.43           O  
ATOM   4993  CB  ASN B 403      -8.704  37.578 120.782  1.00 93.83           C  
ATOM   4994  CG  ASN B 403      -9.994  38.195 121.317  1.00 96.09           C  
ATOM   4995  OD1 ASN B 403     -10.781  38.787 120.569  1.00 96.73           O  
ATOM   4996  ND2 ASN B 403     -10.215  38.057 122.619  1.00 96.56           N  
ATOM   4997  N   VAL B 404      -6.807  36.687 118.251  1.00 92.33           N  
ATOM   4998  CA  VAL B 404      -5.563  36.050 117.809  1.00 90.68           C  
ATOM   4999  C   VAL B 404      -5.569  35.982 116.269  1.00 90.85           C  
ATOM   5000  O   VAL B 404      -6.646  35.896 115.666  1.00 92.95           O  
ATOM   5001  CB  VAL B 404      -5.427  34.615 118.403  1.00 91.39           C  
ATOM   5002  CG1 VAL B 404      -4.000  34.091 118.283  1.00 93.83           C  
ATOM   5003  CG2 VAL B 404      -5.847  34.583 119.862  1.00 93.60           C  
ATOM   5004  N   PRO B 405      -4.383  36.066 115.623  1.00 87.56           N  
ATOM   5005  CA  PRO B 405      -4.304  35.893 114.165  1.00 86.04           C  
ATOM   5006  C   PRO B 405      -4.763  34.539 113.617  1.00 85.78           C  
ATOM   5007  O   PRO B 405      -5.327  34.495 112.527  1.00 86.40           O  
ATOM   5008  CB  PRO B 405      -2.817  36.118 113.856  1.00 84.77           C  
ATOM   5009  CG  PRO B 405      -2.115  35.963 115.145  1.00 84.14           C  
ATOM   5010  CD  PRO B 405      -3.068  36.411 116.192  1.00 86.61           C  
ATOM   5011  N   TYR B 406      -4.518  33.454 114.350  1.00 87.15           N  
ATOM   5012  CA  TYR B 406      -4.837  32.102 113.867  1.00 87.65           C  
ATOM   5013  C   TYR B 406      -5.313  31.191 114.983  1.00 90.59           C  
ATOM   5014  O   TYR B 406      -5.044  31.434 116.160  1.00 93.81           O  
ATOM   5015  CB  TYR B 406      -3.630  31.461 113.165  1.00 87.81           C  
ATOM   5016  CG  TYR B 406      -2.394  31.382 114.029  1.00 88.18           C  
ATOM   5017  CD1 TYR B 406      -1.379  32.330 113.914  1.00 87.88           C  
ATOM   5018  CD2 TYR B 406      -2.241  30.365 114.969  1.00 89.29           C  
ATOM   5019  CE1 TYR B 406      -0.245  32.267 114.716  1.00 88.58           C  
ATOM   5020  CE2 TYR B 406      -1.111  30.292 115.775  1.00 89.66           C  
ATOM   5021  CZ  TYR B 406      -0.119  31.246 115.645  1.00 89.15           C  
ATOM   5022  OH  TYR B 406       0.999  31.172 116.444  1.00 88.84           O  
ATOM   5023  N   SER B 407      -6.006  30.127 114.591  1.00 91.99           N  
ATOM   5024  CA  SER B 407      -6.556  29.142 115.519  1.00 90.32           C  
ATOM   5025  C   SER B 407      -5.788  27.829 115.364  1.00 90.01           C  
ATOM   5026  O   SER B 407      -5.147  27.604 114.344  1.00 90.70           O  
ATOM   5027  CB  SER B 407      -8.036  28.928 115.204  1.00 88.80           C  
ATOM   5028  OG  SER B 407      -8.814  28.868 116.377  1.00 88.75           O  
ATOM   5029  N   ILE B 408      -5.848  26.965 116.371  1.00 92.29           N  
ATOM   5030  CA  ILE B 408      -5.153  25.675 116.308  1.00 94.41           C  
ATOM   5031  C   ILE B 408      -6.151  24.518 116.185  1.00 95.48           C  
ATOM   5032  O   ILE B 408      -7.087  24.422 116.981  1.00 96.85           O  
ATOM   5033  CB  ILE B 408      -4.182  25.493 117.508  1.00 94.72           C  
ATOM   5034  CG1 ILE B 408      -2.969  26.406 117.325  1.00 95.88           C  
ATOM   5035  CG2 ILE B 408      -3.707  24.044 117.636  1.00 93.36           C  
ATOM   5036  CD1 ILE B 408      -2.627  27.222 118.541  1.00 97.28           C  
ATOM   5037  N   PRO B 409      -5.967  23.656 115.164  1.00 95.60           N  
ATOM   5038  CA  PRO B 409      -6.838  22.501 114.926  1.00 97.01           C  
ATOM   5039  C   PRO B 409      -6.915  21.545 116.108  1.00 98.79           C  
ATOM   5040  O   PRO B 409      -5.901  21.282 116.755  1.00 99.56           O  
ATOM   5041  CB  PRO B 409      -6.185  21.795 113.730  1.00 96.43           C  
ATOM   5042  CG  PRO B 409      -4.865  22.408 113.557  1.00 95.08           C  
ATOM   5043  CD  PRO B 409      -4.913  23.766 114.143  1.00 94.60           C  
ATOM   5044  N   ARG B 410      -8.117  21.035 116.376  1.00100.82           N  
ATOM   5045  CA  ARG B 410      -8.352  20.083 117.466  1.00101.41           C  
ATOM   5046  C   ARG B 410      -7.597  18.779 117.227  1.00103.52           C  
ATOM   5047  O   ARG B 410      -7.286  18.052 118.170  1.00105.12           O  
ATOM   5048  CB  ARG B 410      -9.669  19.716 117.732  0.00 20.00           C  
ATOM   5049  CG  ARG B 410     -10.501  20.873 118.263  0.00 20.00           C  
ATOM   5050  CD  ARG B 410     -11.959  20.524 118.514  0.00 20.00           C  
ATOM   5051  NE  ARG B 410     -12.731  21.682 118.956  0.00 20.00           N  
ATOM   5052  CZ  ARG B 410     -14.044  21.679 119.132  0.00 20.00           C  
ATOM   5053  NH1 ARG B 410     -14.743  20.574 118.909  0.00 20.00           N  
ATOM   5054  NH2 ARG B 410     -14.664  22.780 119.537  0.00 20.00           N  
ATOM   5055  N   SER B 411      -7.300  18.505 115.957  1.00104.94           N  
ATOM   5056  CA  SER B 411      -6.568  17.307 115.540  1.00104.32           C  
ATOM   5057  C   SER B 411      -5.044  17.435 115.692  1.00103.84           C  
ATOM   5058  O   SER B 411      -4.313  16.463 115.488  1.00102.47           O  
ATOM   5059  CB  SER B 411      -6.945  16.929 114.098  1.00104.41           C  
ATOM   5060  OG  SER B 411      -7.098  18.078 113.276  1.00102.71           O  
ATOM   5061  N   ASN B 412      -4.577  18.633 116.043  1.00104.84           N  
ATOM   5062  CA  ASN B 412      -3.163  18.874 116.341  1.00105.29           C  
ATOM   5063  C   ASN B 412      -2.712  18.180 117.621  1.00106.44           C  
ATOM   5064  O   ASN B 412      -3.479  18.100 118.591  1.00105.15           O  
ATOM   5065  CB  ASN B 412      -2.892  20.373 116.502  1.00105.44           C  
ATOM   5066  CG  ASN B 412      -2.326  21.014 115.257  1.00106.80           C  
ATOM   5067  OD1 ASN B 412      -2.011  22.201 115.261  1.00107.97           O  
ATOM   5068  ND2 ASN B 412      -2.193  20.243 114.186  1.00107.86           N  
ATOM   5069  N   PRO B 413      -1.457  17.688 117.641  1.00106.44           N  
ATOM   5070  CA  PRO B 413      -0.893  17.301 118.929  1.00104.74           C  
ATOM   5071  C   PRO B 413      -0.518  18.586 119.661  1.00104.10           C  
ATOM   5072  O   PRO B 413      -0.056  19.544 119.025  1.00108.37           O  
ATOM   5073  CB  PRO B 413       0.352  16.499 118.546  1.00104.68           C  
ATOM   5074  CG  PRO B 413       0.746  17.018 117.203  1.00104.67           C  
ATOM   5075  CD  PRO B 413      -0.511  17.487 116.525  1.00104.82           C  
ATOM   5076  N   HIS B 414      -0.735  18.607 120.971  1.00 99.47           N  
ATOM   5077  CA  HIS B 414      -0.534  19.801 121.806  1.00 97.78           C  
ATOM   5078  C   HIS B 414      -1.672  20.823 121.693  1.00 97.55           C  
ATOM   5079  O   HIS B 414      -1.520  21.965 122.131  1.00 96.60           O  
ATOM   5080  CB  HIS B 414       0.817  20.495 121.536  1.00 96.08           C  
ATOM   5081  CG  HIS B 414       1.979  19.558 121.413  1.00 96.46           C  
ATOM   5082  ND1 HIS B 414       2.871  19.620 120.365  1.00 95.80           N  
ATOM   5083  CD2 HIS B 414       2.392  18.535 122.199  1.00 97.62           C  
ATOM   5084  CE1 HIS B 414       3.787  18.681 120.513  1.00 95.22           C  
ATOM   5085  NE2 HIS B 414       3.519  18.007 121.616  1.00 96.65           N  
ATOM   5086  N   PHE B 415      -2.808  20.407 121.132  1.00 99.39           N  
ATOM   5087  CA  PHE B 415      -3.937  21.315 120.872  1.00102.73           C  
ATOM   5088  C   PHE B 415      -4.307  22.220 122.054  1.00105.37           C  
ATOM   5089  O   PHE B 415      -4.396  23.440 121.897  1.00107.15           O  
ATOM   5090  CB  PHE B 415      -5.168  20.542 120.367  1.00102.63           C  
ATOM   5091  CG  PHE B 415      -6.463  21.318 120.459  1.00102.43           C  
ATOM   5092  CD1 PHE B 415      -6.680  22.449 119.668  1.00101.93           C  
ATOM   5093  CD2 PHE B 415      -7.466  20.915 121.336  1.00100.55           C  
ATOM   5094  CE1 PHE B 415      -7.873  23.166 119.756  1.00101.29           C  
ATOM   5095  CE2 PHE B 415      -8.662  21.624 121.427  1.00100.25           C  
ATOM   5096  CZ  PHE B 415      -8.866  22.751 120.635  1.00101.35           C  
ATOM   5097  N   ASN B 416      -4.526  21.618 123.219  1.00106.25           N  
ATOM   5098  CA  ASN B 416      -4.870  22.360 124.431  1.00109.42           C  
ATOM   5099  C   ASN B 416      -3.664  22.446 125.375  1.00111.49           C  
ATOM   5100  O   ASN B 416      -3.727  23.092 126.424  1.00112.07           O  
ATOM   5101  CB  ASN B 416      -6.055  21.676 125.135  1.00110.34           C  
ATOM   5102  CG  ASN B 416      -6.999  22.662 125.830  1.00109.07           C  
ATOM   5103  OD1 ASN B 416      -7.090  23.834 125.462  1.00108.96           O  
ATOM   5104  ND2 ASN B 416      -7.722  22.170 126.830  1.00107.14           N  
ATOM   5105  N   SER B 417      -2.566  21.804 124.973  1.00112.79           N  
ATOM   5106  CA  SER B 417      -1.391  21.582 125.827  1.00114.20           C  
ATOM   5107  C   SER B 417      -0.812  22.830 126.494  1.00115.59           C  
ATOM   5108  O   SER B 417      -0.848  23.925 125.930  1.00115.88           O  
ATOM   5109  CB  SER B 417      -0.303  20.846 125.037  1.00113.84           C  
ATOM   5110  OG  SER B 417       0.955  20.885 125.688  1.00114.41           O  
ATOM   5111  N   THR B 418      -0.280  22.636 127.700  1.00117.00           N  
ATOM   5112  CA  THR B 418       0.350  23.704 128.481  1.00117.89           C  
ATOM   5113  C   THR B 418       1.866  23.512 128.620  1.00117.90           C  
ATOM   5114  O   THR B 418       2.588  24.458 128.939  1.00118.57           O  
ATOM   5115  CB  THR B 418      -0.285  23.847 129.894  1.00118.36           C  
ATOM   5116  OG1 THR B 418      -0.350  22.566 130.535  1.00118.49           O  
ATOM   5117  CG2 THR B 418      -1.690  24.438 129.805  1.00118.01           C  
ATOM   5118  N   ASN B 419       2.338  22.290 128.383  1.00116.94           N  
ATOM   5119  CA  ASN B 419       3.767  21.985 128.440  1.00116.43           C  
ATOM   5120  C   ASN B 419       4.490  22.183 127.101  1.00114.77           C  
ATOM   5121  O   ASN B 419       5.722  22.243 127.058  1.00115.08           O  
ATOM   5122  CB  ASN B 419       3.985  20.561 128.965  1.00118.74           C  
ATOM   5123  CG  ASN B 419       3.521  20.388 130.408  1.00123.16           C  
ATOM   5124  OD1 ASN B 419       3.198  21.359 131.098  1.00125.39           O  
ATOM   5125  ND2 ASN B 419       3.492  19.142 130.872  1.00124.41           N  
ATOM   5126  N   GLN B 420       3.717  22.301 126.021  1.00111.46           N  
ATOM   5127  CA  GLN B 420       4.262  22.373 124.661  1.00109.21           C  
ATOM   5128  C   GLN B 420       3.639  23.514 123.835  1.00106.84           C  
ATOM   5129  O   GLN B 420       2.625  24.087 124.248  1.00106.80           O  
ATOM   5130  CB  GLN B 420       4.066  21.027 123.948  1.00109.30           C  
ATOM   5131  CG  GLN B 420       4.896  19.870 124.505  1.00109.66           C  
ATOM   5132  CD  GLN B 420       6.396  20.133 124.469  1.00110.46           C  
ATOM   5133  OE1 GLN B 420       7.069  20.068 125.498  1.00111.16           O  
ATOM   5134  NE2 GLN B 420       6.924  20.436 123.287  1.00110.10           N  
ATOM   5135  N   PRO B 421       4.236  23.844 122.664  1.00103.44           N  
ATOM   5136  CA  PRO B 421       3.689  24.903 121.823  1.00101.23           C  
ATOM   5137  C   PRO B 421       2.643  24.332 120.865  1.00 99.66           C  
ATOM   5138  O   PRO B 421       2.963  23.466 120.047  1.00 99.42           O  
ATOM   5139  CB  PRO B 421       4.911  25.388 121.052  1.00100.74           C  
ATOM   5140  CG  PRO B 421       5.716  24.155 120.860  1.00101.26           C  
ATOM   5141  CD  PRO B 421       5.430  23.241 122.043  1.00102.22           C  
ATOM   5142  N   PRO B 422       1.393  24.810 120.965  1.00 99.25           N  
ATOM   5143  CA  PRO B 422       0.286  24.203 120.219  1.00 97.72           C  
ATOM   5144  C   PRO B 422       0.413  24.288 118.694  1.00 96.70           C  
ATOM   5145  O   PRO B 422      -0.308  23.585 117.986  1.00 97.30           O  
ATOM   5146  CB  PRO B 422      -0.943  24.975 120.713  1.00 98.21           C  
ATOM   5147  CG  PRO B 422      -0.415  26.244 121.269  1.00 99.52           C  
ATOM   5148  CD  PRO B 422       0.950  25.947 121.792  1.00100.53           C  
ATOM   5149  N   GLU B 423       1.328  25.130 118.209  1.00 95.63           N  
ATOM   5150  CA  GLU B 423       1.585  25.305 116.771  1.00 92.62           C  
ATOM   5151  C   GLU B 423       2.381  24.155 116.156  1.00 93.14           C  
ATOM   5152  O   GLU B 423       2.186  23.821 114.983  1.00 96.35           O  
ATOM   5153  CB  GLU B 423       2.338  26.615 116.502  1.00 90.63           C  
ATOM   5154  CG  GLU B 423       1.541  27.894 116.718  1.00 90.24           C  
ATOM   5155  CD  GLU B 423       1.483  28.344 118.173  1.00 91.54           C  
ATOM   5156  OE1 GLU B 423       0.841  29.382 118.430  1.00 93.04           O  
ATOM   5157  OE2 GLU B 423       2.066  27.676 119.060  1.00 90.51           O  
ATOM   5158  N   VAL B 424       3.289  23.570 116.936  1.00 91.05           N  
ATOM   5159  CA  VAL B 424       4.187  22.529 116.433  1.00 90.16           C  
ATOM   5160  C   VAL B 424       3.430  21.227 116.187  1.00 90.13           C  
ATOM   5161  O   VAL B 424       2.732  20.728 117.075  1.00 90.55           O  
ATOM   5162  CB  VAL B 424       5.397  22.289 117.381  1.00 89.62           C  
ATOM   5163  CG1 VAL B 424       6.199  21.073 116.947  1.00 89.71           C  
ATOM   5164  CG2 VAL B 424       6.300  23.507 117.421  1.00 88.82           C  
ATOM   5165  N   PHE B 425       3.568  20.704 114.970  1.00 90.09           N  
ATOM   5166  CA  PHE B 425       2.962  19.434 114.577  1.00 90.44           C  
ATOM   5167  C   PHE B 425       3.996  18.316 114.616  1.00 89.33           C  
ATOM   5168  O   PHE B 425       3.711  17.225 115.105  1.00 88.75           O  
ATOM   5169  CB  PHE B 425       2.336  19.541 113.182  1.00 94.00           C  
ATOM   5170  CG  PHE B 425       1.594  18.308 112.752  1.00 94.79           C  
ATOM   5171  CD1 PHE B 425       0.273  18.108 113.136  1.00 94.96           C  
ATOM   5172  CD2 PHE B 425       2.212  17.350 111.955  1.00 96.56           C  
ATOM   5173  CE1 PHE B 425      -0.422  16.967 112.748  1.00 95.34           C  
ATOM   5174  CE2 PHE B 425       1.525  16.205 111.557  1.00 97.95           C  
ATOM   5175  CZ  PHE B 425       0.203  16.013 111.957  1.00 96.44           C  
ATOM   5176  N   ALA B 426       5.186  18.598 114.088  1.00 90.11           N  
ATOM   5177  CA  ALA B 426       6.337  17.691 114.162  1.00 91.74           C  
ATOM   5178  C   ALA B 426       7.633  18.501 114.235  1.00 94.00           C  
ATOM   5179  O   ALA B 426       7.650  19.672 113.862  1.00 96.09           O  
ATOM   5180  CB  ALA B 426       6.355  16.754 112.963  1.00 90.99           C  
ATOM   5181  N   HIS B 427       8.709  17.883 114.718  1.00 96.20           N  
ATOM   5182  CA  HIS B 427      10.008  18.555 114.829  1.00 99.04           C  
ATOM   5183  C   HIS B 427      11.154  17.638 114.409  1.00 98.68           C  
ATOM   5184  O   HIS B 427      11.013  16.411 114.408  1.00 98.71           O  
ATOM   5185  CB  HIS B 427      10.247  19.049 116.264  1.00102.08           C  
ATOM   5186  CG  HIS B 427      10.732  17.982 117.200  1.00107.31           C  
ATOM   5187  ND1 HIS B 427      12.071  17.709 117.389  1.00110.17           N  
ATOM   5188  CD2 HIS B 427      10.058  17.117 117.996  1.00109.55           C  
ATOM   5189  CE1 HIS B 427      12.201  16.723 118.262  1.00110.77           C  
ATOM   5190  NE2 HIS B 427      10.994  16.346 118.645  1.00110.81           N  
ATOM   5191  N   GLY B 428      12.291  18.243 114.072  1.00 97.24           N  
ATOM   5192  CA  GLY B 428      13.520  17.498 113.822  1.00 95.17           C  
ATOM   5193  C   GLY B 428      14.146  17.770 112.472  1.00 94.53           C  
ATOM   5194  O   GLY B 428      14.898  16.941 111.959  1.00 96.75           O  
ATOM   5195  N   LEU B 429      13.833  18.930 111.899  1.00 92.87           N  
ATOM   5196  CA  LEU B 429      14.348  19.340 110.591  1.00 89.10           C  
ATOM   5197  C   LEU B 429      15.620  20.157 110.721  1.00 88.56           C  
ATOM   5198  O   LEU B 429      15.783  20.920 111.674  1.00 89.78           O  
ATOM   5199  CB  LEU B 429      13.302  20.169 109.852  1.00 87.58           C  
ATOM   5200  CG  LEU B 429      12.516  19.566 108.688  1.00 88.20           C  
ATOM   5201  CD1 LEU B 429      12.173  18.109 108.885  1.00 86.33           C  
ATOM   5202  CD2 LEU B 429      11.255  20.376 108.480  1.00 89.94           C  
ATOM   5203  N   HIS B 430      16.512  20.005 109.749  1.00 87.97           N  
ATOM   5204  CA  HIS B 430      17.758  20.754 109.736  1.00 88.50           C  
ATOM   5205  C   HIS B 430      17.848  21.688 108.530  1.00 90.15           C  
ATOM   5206  O   HIS B 430      17.582  22.885 108.640  1.00 87.96           O  
ATOM   5207  CB  HIS B 430      18.949  19.802 109.827  1.00 89.62           C  
ATOM   5208  CG  HIS B 430      18.983  19.016 111.102  1.00 93.38           C  
ATOM   5209  ND1 HIS B 430      19.674  19.436 112.218  1.00 94.23           N  
ATOM   5210  CD2 HIS B 430      18.386  17.850 111.448  1.00 93.55           C  
ATOM   5211  CE1 HIS B 430      19.514  18.557 113.191  1.00 94.56           C  
ATOM   5212  NE2 HIS B 430      18.736  17.586 112.750  1.00 94.44           N  
ATOM   5213  N   ASP B 431      18.203  21.141 107.376  1.00 91.73           N  
ATOM   5214  CA  ASP B 431      18.301  21.940 106.170  1.00 94.10           C  
ATOM   5215  C   ASP B 431      17.389  21.351 105.094  1.00 94.88           C  
ATOM   5216  O   ASP B 431      17.859  20.626 104.213  1.00 95.89           O  
ATOM   5217  CB  ASP B 431      19.758  22.006 105.699  1.00 96.62           C  
ATOM   5218  CG  ASP B 431      19.989  23.081 104.653  1.00 99.99           C  
ATOM   5219  OD1 ASP B 431      19.302  24.126 104.695  1.00101.65           O  
ATOM   5220  OD2 ASP B 431      20.865  22.881 103.786  1.00101.06           O  
ATOM   5221  N   PRO B 432      16.075  21.656 105.163  1.00 94.55           N  
ATOM   5222  CA  PRO B 432      15.158  21.039 104.216  1.00 93.58           C  
ATOM   5223  C   PRO B 432      15.188  21.756 102.883  1.00 93.20           C  
ATOM   5224  O   PRO B 432      15.415  22.962 102.836  1.00 94.42           O  
ATOM   5225  CB  PRO B 432      13.791  21.196 104.887  1.00 92.23           C  
ATOM   5226  CG  PRO B 432      13.920  22.382 105.756  1.00 92.70           C  
ATOM   5227  CD  PRO B 432      15.379  22.577 106.081  1.00 94.83           C  
ATOM   5228  N   GLY B 433      14.990  21.007 101.806  1.00 93.00           N  
ATOM   5229  CA  GLY B 433      14.872  21.602 100.487  1.00 93.79           C  
ATOM   5230  C   GLY B 433      13.418  21.941 100.249  1.00 94.15           C  
ATOM   5231  O   GLY B 433      12.659  22.165 101.203  1.00 93.94           O  
ATOM   5232  N   ARG B 434      13.027  21.986  98.978  1.00 94.11           N  
ATOM   5233  CA  ARG B 434      11.624  22.124  98.628  1.00 95.46           C  
ATOM   5234  C   ARG B 434      11.009  20.745  98.806  1.00 95.16           C  
ATOM   5235  O   ARG B 434      11.365  19.811  98.095  1.00 97.95           O  
ATOM   5236  CB  ARG B 434      11.475  22.629  97.190  1.00 98.07           C  
ATOM   5237  CG  ARG B 434      10.083  23.143  96.823  1.00102.06           C  
ATOM   5238  CD  ARG B 434       9.171  22.002  96.412  1.00105.52           C  
ATOM   5239  NE  ARG B 434       7.807  22.423  96.111  1.00106.62           N  
ATOM   5240  CZ  ARG B 434       6.781  21.585  96.000  1.00107.97           C  
ATOM   5241  NH1 ARG B 434       6.953  20.280  96.176  1.00108.64           N  
ATOM   5242  NH2 ARG B 434       5.575  22.052  95.724  1.00109.22           N  
ATOM   5243  N   CYS B 435      10.111  20.613  99.776  1.00 92.63           N  
ATOM   5244  CA  CYS B 435       9.529  19.317 100.106  1.00 91.75           C  
ATOM   5245  C   CYS B 435       8.388  18.941  99.164  1.00 91.53           C  
ATOM   5246  O   CYS B 435       7.503  19.749  98.880  1.00 92.32           O  
ATOM   5247  CB  CYS B 435       9.027  19.306 101.546  1.00 95.06           C  
ATOM   5248  SG  CYS B 435      10.236  19.818 102.772  1.00 98.20           S  
ATOM   5249  N   ALA B 436       8.418  17.700  98.690  1.00 89.96           N  
ATOM   5250  CA  ALA B 436       7.372  17.168  97.830  1.00 87.46           C  
ATOM   5251  C   ALA B 436       6.109  16.927  98.648  1.00 86.02           C  
ATOM   5252  O   ALA B 436       6.177  16.506  99.801  1.00 81.77           O  
ATOM   5253  CB  ALA B 436       7.840  15.885  97.173  1.00 88.49           C  
ATOM   5254  N   VAL B 437       4.957  17.205  98.050  1.00 90.28           N  
ATOM   5255  CA  VAL B 437       3.687  17.102  98.765  1.00 92.67           C  
ATOM   5256  C   VAL B 437       2.708  16.180  98.035  1.00 96.06           C  
ATOM   5257  O   VAL B 437       2.309  16.455  96.901  1.00 98.06           O  
ATOM   5258  CB  VAL B 437       3.046  18.499  98.988  1.00 90.05           C  
ATOM   5259  CG1 VAL B 437       1.741  18.368  99.744  1.00 89.33           C  
ATOM   5260  CG2 VAL B 437       4.004  19.432  99.736  1.00 86.83           C  
ATOM   5261  N   ASP B 438       2.333  15.088  98.695  1.00 96.49           N  
ATOM   5262  CA  ASP B 438       1.391  14.125  98.141  1.00100.56           C  
ATOM   5263  C   ASP B 438       0.024  14.338  98.779  1.00103.75           C  
ATOM   5264  O   ASP B 438      -0.112  14.259 100.003  1.00106.06           O  
ATOM   5265  CB  ASP B 438       1.889  12.696  98.405  1.00102.39           C  
ATOM   5266  CG  ASP B 438       1.169  11.639  97.563  1.00101.94           C  
ATOM   5267  OD1 ASP B 438       0.380  11.996  96.668  1.00103.28           O  
ATOM   5268  OD2 ASP B 438       1.404  10.436  97.799  1.00100.96           O  
ATOM   5269  N   ARG B 439      -0.987  14.601  97.953  1.00104.77           N  
ATOM   5270  CA  ARG B 439      -2.332  14.899  98.456  1.00105.32           C  
ATOM   5271  C   ARG B 439      -3.329  13.744  98.332  1.00107.66           C  
ATOM   5272  O   ARG B 439      -4.364  13.749  99.002  1.00110.30           O  
ATOM   5273  CB  ARG B 439      -2.884  16.166  97.797  1.00104.95           C  
ATOM   5274  CG  ARG B 439      -2.037  17.396  98.070  1.00105.07           C  
ATOM   5275  CD  ARG B 439      -2.585  18.657  97.416  1.00104.88           C  
ATOM   5276  NE  ARG B 439      -1.500  19.608  97.168  1.00106.54           N  
ATOM   5277  CZ  ARG B 439      -1.107  20.563  98.010  1.00105.38           C  
ATOM   5278  NH1 ARG B 439      -1.721  20.728  99.172  1.00103.68           N  
ATOM   5279  NH2 ARG B 439      -0.094  21.362  97.683  1.00105.18           N  
ATOM   5280  N   HIS B 440      -3.011  12.762  97.487  1.00108.19           N  
ATOM   5281  CA  HIS B 440      -3.835  11.556  97.292  1.00109.39           C  
ATOM   5282  C   HIS B 440      -5.236  11.865  96.772  1.00109.53           C  
ATOM   5283  O   HIS B 440      -5.390  12.441  95.694  1.00109.48           O  
ATOM   5284  CB  HIS B 440      -3.914  10.728  98.578  1.00110.64           C  
ATOM   5285  CG  HIS B 440      -2.579  10.301  99.103  1.00112.74           C  
ATOM   5286  ND1 HIS B 440      -1.861  11.053 100.009  1.00112.61           N  
ATOM   5287  CD2 HIS B 440      -1.828   9.203  98.847  1.00113.21           C  
ATOM   5288  CE1 HIS B 440      -0.727  10.436 100.289  1.00112.74           C  
ATOM   5289  NE2 HIS B 440      -0.682   9.311  99.597  1.00113.32           N  
ATOM   5290  N   ASN B 447      -5.716  11.650 103.874  1.00105.88           N  
ATOM   5291  CA  ASN B 447      -4.360  11.902 104.354  1.00104.82           C  
ATOM   5292  C   ASN B 447      -3.547  12.890 103.500  1.00104.93           C  
ATOM   5293  O   ASN B 447      -4.050  13.457 102.523  1.00105.11           O  
ATOM   5294  CB  ASN B 447      -3.587  10.582 104.589  1.00104.74           C  
ATOM   5295  CG  ASN B 447      -3.822   9.529 103.495  1.00105.06           C  
ATOM   5296  OD1 ASN B 447      -4.469   9.784 102.477  1.00105.42           O  
ATOM   5297  ND2 ASN B 447      -3.290   8.329 103.718  1.00103.67           N  
ATOM   5298  N   LEU B 448      -2.294  13.090 103.906  1.00102.42           N  
ATOM   5299  CA  LEU B 448      -1.369  14.037 103.298  1.00 98.92           C  
ATOM   5300  C   LEU B 448       0.035  13.533 103.602  1.00 97.85           C  
ATOM   5301  O   LEU B 448       0.320  13.152 104.740  1.00100.29           O  
ATOM   5302  CB  LEU B 448      -1.549  15.414 103.946  1.00 99.88           C  
ATOM   5303  CG  LEU B 448      -0.970  16.744 103.422  1.00101.78           C  
ATOM   5304  CD1 LEU B 448      -0.436  17.558 104.595  1.00101.23           C  
ATOM   5305  CD2 LEU B 448       0.107  16.621 102.357  1.00101.25           C  
ATOM   5306  N   THR B 449       0.908  13.518 102.598  1.00 94.05           N  
ATOM   5307  CA  THR B 449       2.309  13.163 102.809  1.00 91.26           C  
ATOM   5308  C   THR B 449       3.209  14.309 102.394  1.00 92.89           C  
ATOM   5309  O   THR B 449       3.057  14.863 101.300  1.00 97.89           O  
ATOM   5310  CB  THR B 449       2.720  11.918 102.001  1.00 90.14           C  
ATOM   5311  OG1 THR B 449       1.812  10.845 102.268  1.00 93.45           O  
ATOM   5312  CG2 THR B 449       4.124  11.477 102.372  1.00 88.36           C  
ATOM   5313  N   ILE B 450       4.145  14.672 103.262  1.00 90.06           N  
ATOM   5314  CA  ILE B 450       5.224  15.562 102.841  1.00 91.16           C  
ATOM   5315  C   ILE B 450       6.594  14.886 103.025  1.00 91.47           C  
ATOM   5316  O   ILE B 450       6.902  14.359 104.095  1.00 92.98           O  
ATOM   5317  CB  ILE B 450       5.078  17.042 103.397  1.00 93.30           C  
ATOM   5318  CG1 ILE B 450       6.437  17.739 103.582  1.00 94.21           C  
ATOM   5319  CG2 ILE B 450       4.181  17.113 104.652  1.00 93.58           C  
ATOM   5320  CD1 ILE B 450       7.027  17.650 104.982  1.00 97.98           C  
ATOM   5321  N   LEU B 451       7.380  14.870 101.947  1.00 90.03           N  
ATOM   5322  CA  LEU B 451       8.674  14.192 101.907  1.00 87.51           C  
ATOM   5323  C   LEU B 451       9.772  15.201 101.621  1.00 87.82           C  
ATOM   5324  O   LEU B 451       9.827  15.762 100.526  1.00 87.29           O  
ATOM   5325  CB  LEU B 451       8.665  13.121 100.814  1.00 87.83           C  
ATOM   5326  CG  LEU B 451       9.686  11.971 100.851  1.00 87.72           C  
ATOM   5327  CD1 LEU B 451       9.186  10.810 100.014  1.00 85.95           C  
ATOM   5328  CD2 LEU B 451      11.073  12.390 100.383  1.00 86.77           C  
ATOM   5329  N   CYS B 452      10.646  15.429 102.598  1.00 89.28           N  
ATOM   5330  CA  CYS B 452      11.700  16.435 102.460  1.00 92.22           C  
ATOM   5331  C   CYS B 452      13.064  15.811 102.256  1.00 92.32           C  
ATOM   5332  O   CYS B 452      13.341  14.730 102.772  1.00 95.11           O  
ATOM   5333  CB  CYS B 452      11.769  17.337 103.696  1.00 95.86           C  
ATOM   5334  SG  CYS B 452      10.266  18.274 104.091  1.00103.77           S  
ATOM   5335  N   SER B 453      13.912  16.497 101.499  1.00 91.85           N  
ATOM   5336  CA  SER B 453      15.340  16.214 101.502  1.00 92.68           C  
ATOM   5337  C   SER B 453      15.963  17.100 102.570  1.00 93.10           C  
ATOM   5338  O   SER B 453      15.613  18.269 102.676  1.00 99.04           O  
ATOM   5339  CB  SER B 453      15.951  16.544 100.147  1.00 92.88           C  
ATOM   5340  OG  SER B 453      15.825  17.930  99.877  1.00 95.72           O  
ATOM   5341  N   ASP B 454      16.876  16.553 103.360  1.00 90.16           N  
ATOM   5342  CA  ASP B 454      17.549  17.324 104.393  1.00 91.58           C  
ATOM   5343  C   ASP B 454      19.065  17.198 104.212  1.00 96.13           C  
ATOM   5344  O   ASP B 454      19.612  16.091 104.224  1.00 95.29           O  
ATOM   5345  CB  ASP B 454      17.109  16.826 105.775  1.00 92.72           C  
ATOM   5346  CG  ASP B 454      17.341  17.845 106.890  1.00 92.48           C  
ATOM   5347  OD1 ASP B 454      16.691  17.711 107.950  1.00 91.89           O  
ATOM   5348  OD2 ASP B 454      18.166  18.764 106.730  1.00 92.90           O  
ATOM   5349  N   SER B 455      19.735  18.335 104.023  1.00101.04           N  
ATOM   5350  CA  SER B 455      21.192  18.363 103.861  1.00105.22           C  
ATOM   5351  C   SER B 455      21.907  18.068 105.171  1.00108.19           C  
ATOM   5352  O   SER B 455      22.900  17.336 105.193  1.00109.11           O  
ATOM   5353  CB  SER B 455      21.656  19.717 103.319  1.00106.10           C  
ATOM   5354  OG  SER B 455      21.278  19.885 101.963  1.00108.83           O  
ATOM   5355  N   ASN B 456      21.391  18.652 106.254  1.00111.02           N  
ATOM   5356  CA  ASN B 456      21.941  18.506 107.607  1.00113.57           C  
ATOM   5357  C   ASN B 456      23.340  19.117 107.784  1.00115.68           C  
ATOM   5358  O   ASN B 456      24.074  18.758 108.708  1.00115.51           O  
ATOM   5359  CB  ASN B 456      21.907  17.038 108.062  1.00113.49           C  
ATOM   5360  CG  ASN B 456      20.521  16.426 107.962  1.00113.67           C  
ATOM   5361  OD1 ASN B 456      19.693  16.581 108.860  1.00114.55           O  
ATOM   5362  ND2 ASN B 456      20.268  15.714 106.872  1.00113.00           N  
ATOM   5363  N   GLY B 457      23.686  20.056 106.901  1.00118.62           N  
ATOM   5364  CA  GLY B 457      24.974  20.750 106.941  1.00120.89           C  
ATOM   5365  C   GLY B 457      26.154  19.837 106.666  1.00123.09           C  
ATOM   5366  O   GLY B 457      26.276  19.278 105.571  1.00121.45           O  
ATOM   5367  N   LYS B 458      27.021  19.693 107.671  1.00126.47           N  
ATOM   5368  CA  LYS B 458      28.176  18.795 107.612  1.00128.84           C  
ATOM   5369  C   LYS B 458      27.698  17.348 107.629  1.00131.20           C  
ATOM   5370  O   LYS B 458      27.950  16.608 108.583  1.00131.42           O  
ATOM   5371  CB  LYS B 458      29.238  19.232 108.392  0.00 20.00           C  
ATOM   5372  CG  LYS B 458      30.316  20.146 107.833  0.00 20.00           C  
ATOM   5373  CD  LYS B 458      31.468  20.305 108.812  0.00 20.00           C  
ATOM   5374  CE  LYS B 458      32.267  21.565 108.523  0.00 20.00           C  
ATOM   5375  NZ  LYS B 458      33.345  21.781 109.528  0.00 20.00           N  
ATOM   5376  N   ASN B 459      27.010  16.970 106.552  1.00133.07           N  
ATOM   5377  CA  ASN B 459      26.335  15.683 106.408  1.00133.84           C  
ATOM   5378  C   ASN B 459      25.911  15.524 104.946  1.00133.32           C  
ATOM   5379  O   ASN B 459      25.671  16.523 104.261  1.00132.26           O  
ATOM   5380  CB  ASN B 459      25.117  15.623 107.338  1.00134.14           C  
ATOM   5381  CG  ASN B 459      24.551  14.223 107.484  1.00134.46           C  
ATOM   5382  OD1 ASN B 459      24.072  13.626 106.517  1.00135.37           O  
ATOM   5383  ND2 ASN B 459      24.583  13.698 108.703  1.00133.73           N  
ATOM   5384  N   ARG B 460      25.822  14.276 104.480  1.00133.60           N  
ATOM   5385  CA  ARG B 460      25.538  13.959 103.070  1.00134.10           C  
ATOM   5386  C   ARG B 460      24.187  14.470 102.555  1.00133.99           C  
ATOM   5387  O   ARG B 460      24.068  15.633 102.157  1.00133.97           O  
ATOM   5388  CB  ARG B 460      25.506  12.682 103.332  0.00 20.00           C  
ATOM   5389  CG  ARG B 460      26.905  12.098 103.431  0.00 20.00           C  
ATOM   5390  CD  ARG B 460      26.985  11.040 104.520  0.00 20.00           C  
ATOM   5391  NE  ARG B 460      28.348  10.868 105.016  0.00 20.00           N  
ATOM   5392  CZ  ARG B 460      28.811   9.745 105.555  0.00 20.00           C  
ATOM   5393  NH1 ARG B 460      28.019   8.687 105.669  0.00 20.00           N  
ATOM   5394  NH2 ARG B 460      30.065   9.679 105.980  0.00 20.00           N  
ATOM   5395  N   SER B 461      23.189  13.584 102.542  1.00132.99           N  
ATOM   5396  CA  SER B 461      21.808  13.937 102.180  1.00131.05           C  
ATOM   5397  C   SER B 461      20.824  12.828 102.550  1.00128.17           C  
ATOM   5398  O   SER B 461      20.791  11.772 101.909  1.00128.13           O  
ATOM   5399  CB  SER B 461      21.687  14.258 100.687  1.00132.79           C  
ATOM   5400  OG  SER B 461      20.381  14.711 100.370  1.00133.95           O  
ATOM   5401  N   SER B 462      20.022  13.087 103.580  1.00124.60           N  
ATOM   5402  CA  SER B 462      19.019  12.139 104.058  1.00121.19           C  
ATOM   5403  C   SER B 462      17.606  12.656 103.800  1.00117.80           C  
ATOM   5404  O   SER B 462      17.401  13.858 103.652  1.00117.68           O  
ATOM   5405  CB  SER B 462      19.212  11.886 105.551  1.00121.84           C  
ATOM   5406  OG  SER B 462      19.001  13.079 106.287  1.00122.56           O  
ATOM   5407  N   ALA B 463      16.637  11.744 103.752  1.00115.21           N  
ATOM   5408  CA  ALA B 463      15.231  12.106 103.549  1.00112.23           C  
ATOM   5409  C   ALA B 463      14.392  11.925 104.814  1.00109.44           C  
ATOM   5410  O   ALA B 463      14.722  11.115 105.684  1.00109.10           O  
ATOM   5411  CB  ALA B 463      14.635  11.304 102.404  1.00112.36           C  
ATOM   5412  N   ARG B 464      13.310  12.694 104.904  1.00105.99           N  
ATOM   5413  CA  ARG B 464      12.373  12.624 106.025  1.00103.70           C  
ATOM   5414  C   ARG B 464      10.951  12.631 105.485  1.00103.11           C  
ATOM   5415  O   ARG B 464      10.667  13.272 104.470  1.00106.50           O  
ATOM   5416  CB  ARG B 464      12.573  13.801 106.983  1.00103.21           C  
ATOM   5417  CG  ARG B 464      14.028  14.133 107.251  1.00104.78           C  
ATOM   5418  CD  ARG B 464      14.216  15.017 108.466  1.00106.68           C  
ATOM   5419  NE  ARG B 464      15.631  15.113 108.819  1.00109.10           N  
ATOM   5420  CZ  ARG B 464      16.293  14.212 109.543  1.00110.72           C  
ATOM   5421  NH1 ARG B 464      15.675  13.132 110.014  1.00110.24           N  
ATOM   5422  NH2 ARG B 464      17.582  14.393 109.799  1.00111.35           N  
ATOM   5423  N   ILE B 465      10.055  11.924 106.163  1.00 99.73           N  
ATOM   5424  CA  ILE B 465       8.684  11.792 105.684  1.00 98.25           C  
ATOM   5425  C   ILE B 465       7.658  11.963 106.805  1.00 99.04           C  
ATOM   5426  O   ILE B 465       7.738  11.311 107.855  1.00 99.66           O  
ATOM   5427  CB  ILE B 465       8.475  10.456 104.915  1.00 96.64           C  
ATOM   5428  CG1 ILE B 465       7.013  10.296 104.476  1.00 97.39           C  
ATOM   5429  CG2 ILE B 465       8.948   9.283 105.751  1.00 95.68           C  
ATOM   5430  CD1 ILE B 465       6.749   9.110 103.570  1.00 98.19           C  
ATOM   5431  N   LEU B 466       6.700  12.853 106.569  1.00 98.30           N  
ATOM   5432  CA  LEU B 466       5.609  13.075 107.499  1.00 99.62           C  
ATOM   5433  C   LEU B 466       4.283  12.647 106.878  1.00102.60           C  
ATOM   5434  O   LEU B 466       3.966  13.038 105.753  1.00104.97           O  
ATOM   5435  CB  LEU B 466       5.563  14.546 107.905  1.00 99.06           C  
ATOM   5436  CG  LEU B 466       4.620  14.947 109.039  1.00100.07           C  
ATOM   5437  CD1 LEU B 466       5.001  14.262 110.349  1.00100.28           C  
ATOM   5438  CD2 LEU B 466       4.623  16.460 109.204  1.00 99.87           C  
ATOM   5439  N   GLN B 467       3.529  11.828 107.608  1.00104.81           N  
ATOM   5440  CA  GLN B 467       2.178  11.436 107.207  1.00107.95           C  
ATOM   5441  C   GLN B 467       1.191  11.829 108.288  1.00111.89           C  
ATOM   5442  O   GLN B 467       1.432  11.576 109.471  1.00112.16           O  
ATOM   5443  CB  GLN B 467       2.090   9.936 106.959  1.00108.77           C  
ATOM   5444  CG  GLN B 467       2.620   9.498 105.609  1.00111.65           C  
ATOM   5445  CD  GLN B 467       1.970   8.219 105.104  1.00112.87           C  
ATOM   5446  OE1 GLN B 467       1.524   7.372 105.885  1.00112.32           O  
ATOM   5447  NE2 GLN B 467       1.913   8.074 103.783  1.00113.38           N  
ATOM   5448  N   ILE B 468       0.081  12.442 107.885  1.00116.84           N  
ATOM   5449  CA  ILE B 468      -0.890  12.964 108.850  1.00122.78           C  
ATOM   5450  C   ILE B 468      -2.075  12.025 109.092  1.00127.11           C  
ATOM   5451  O   ILE B 468      -2.923  12.295 109.953  1.00129.35           O  
ATOM   5452  CB  ILE B 468      -1.413  14.368 108.461  1.00123.58           C  
ATOM   5453  CG1 ILE B 468      -2.430  14.264 107.318  1.00126.69           C  
ATOM   5454  CG2 ILE B 468      -0.249  15.308 108.125  1.00121.61           C  
ATOM   5455  CD1 ILE B 468      -3.713  15.055 107.551  1.00128.44           C  
ATOM   5456  N   ILE B 469      -2.113  10.921 108.344  1.00129.70           N  
ATOM   5457  CA  ILE B 469      -3.195   9.916 108.418  1.00130.78           C  
ATOM   5458  C   ILE B 469      -4.560  10.545 108.078  1.00131.90           C  
ATOM   5459  O   ILE B 469      -4.621  11.691 107.621  1.00134.70           O  
ATOM   5460  CB  ILE B 469      -3.207   9.118 109.771  1.00129.57           C  
ATOM   5461  CG1 ILE B 469      -1.779   8.773 110.217  1.00129.21           C  
ATOM   5462  CG2 ILE B 469      -4.021   7.823 109.636  1.00129.67           C  
ATOM   5463  CD1 ILE B 469      -1.666   8.247 111.641  1.00129.93           C  
ATOM   5464  N   LYS B 470      -5.642   9.799 108.280  1.00129.67           N  
ATOM   5465  CA  LYS B 470      -6.957  10.232 107.823  1.00128.61           C  
ATOM   5466  C   LYS B 470      -7.876  10.601 108.988  1.00127.83           C  
ATOM   5467  O   LYS B 470      -8.497   9.726 109.602  1.00127.22           O  
ATOM   5468  CB  LYS B 470      -7.594   9.159 106.926  1.00129.44           C  
ATOM   5469  CG  LYS B 470      -6.806   8.848 105.646  1.00129.02           C  
ATOM   5470  CD  LYS B 470      -7.423   7.685 104.871  1.00128.11           C  
ATOM   5471  CE  LYS B 470      -6.634   7.363 103.609  1.00125.76           C  
ATOM   5472  NZ  LYS B 470      -7.313   6.335 102.775  1.00123.56           N  
ATOM   5473  N   GLY B 471      -7.941  11.900 109.286  1.00126.49           N  
ATOM   5474  CA  GLY B 471      -8.815  12.444 110.334  1.00124.32           C  
ATOM   5475  C   GLY B 471      -8.660  11.771 111.687  1.00122.12           C  
ATOM   5476  O   GLY B 471      -9.542  11.031 112.126  1.00121.12           O  
ATOM   5477  N   LYS B 472      -7.531  12.033 112.342  1.00120.28           N  
ATOM   5478  CA  LYS B 472      -7.189  11.411 113.620  1.00116.23           C  
ATOM   5479  C   LYS B 472      -6.695  12.463 114.615  1.00115.59           C  
ATOM   5480  O   LYS B 472      -5.819  13.270 114.291  1.00116.68           O  
ATOM   5481  CB  LYS B 472      -6.141  10.304 113.404  1.00114.65           C  
ATOM   5482  CG  LYS B 472      -5.226  10.014 114.592  1.00114.36           C  
ATOM   5483  CD  LYS B 472      -4.406   8.744 114.391  1.00115.19           C  
ATOM   5484  CE  LYS B 472      -5.162   7.503 114.868  1.00114.67           C  
ATOM   5485  NZ  LYS B 472      -4.317   6.276 114.829  1.00113.54           N  
ATOM   5486  N   ASP B 473      -7.275  12.457 115.814  1.00114.26           N  
ATOM   5487  CA  ASP B 473      -6.842  13.343 116.895  1.00113.17           C  
ATOM   5488  C   ASP B 473      -5.483  12.932 117.442  1.00111.77           C  
ATOM   5489  O   ASP B 473      -5.334  11.854 118.020  1.00113.21           O  
ATOM   5490  CB  ASP B 473      -7.873  13.383 118.028  1.00114.16           C  
ATOM   5491  CG  ASP B 473      -8.503  14.754 118.198  1.00115.25           C  
ATOM   5492  OD1 ASP B 473      -8.814  15.408 117.180  1.00117.09           O  
ATOM   5493  OD2 ASP B 473      -8.691  15.178 119.359  1.00114.78           O  
ATOM   5494  N   TYR B 474      -4.496  13.800 117.245  1.00109.77           N  
ATOM   5495  CA  TYR B 474      -3.146  13.561 117.733  1.00108.02           C  
ATOM   5496  C   TYR B 474      -2.992  14.087 119.152  1.00108.90           C  
ATOM   5497  O   TYR B 474      -3.413  15.206 119.454  1.00109.42           O  
ATOM   5498  CB  TYR B 474      -2.117  14.218 116.811  1.00105.32           C  
ATOM   5499  CG  TYR B 474      -1.915  13.497 115.500  1.00104.09           C  
ATOM   5500  CD1 TYR B 474      -2.471  13.984 114.317  1.00102.62           C  
ATOM   5501  CD2 TYR B 474      -1.166  12.324 115.443  1.00104.70           C  
ATOM   5502  CE1 TYR B 474      -2.282  13.318 113.111  1.00102.76           C  
ATOM   5503  CE2 TYR B 474      -0.975  11.652 114.249  1.00104.58           C  
ATOM   5504  CZ  TYR B 474      -1.530  12.152 113.089  1.00104.04           C  
ATOM   5505  OH  TYR B 474      -1.324  11.470 111.916  1.00103.74           O  
ATOM   5506  N   GLU B 475      -2.399  13.267 120.018  1.00109.73           N  
ATOM   5507  CA  GLU B 475      -2.149  13.655 121.403  1.00109.95           C  
ATOM   5508  C   GLU B 475      -0.647  13.722 121.679  1.00110.04           C  
ATOM   5509  O   GLU B 475      -0.202  14.447 122.572  1.00109.97           O  
ATOM   5510  CB  GLU B 475      -2.840  12.693 122.371  1.00110.25           C  
ATOM   5511  CG  GLU B 475      -3.853  13.356 123.312  1.00110.71           C  
ATOM   5512  CD  GLU B 475      -3.252  14.439 124.203  1.00110.65           C  
ATOM   5513  OE1 GLU B 475      -2.814  15.487 123.673  1.00109.58           O  
ATOM   5514  OE2 GLU B 475      -3.241  14.245 125.440  1.00109.78           O  
ATOM   5515  N   SER B 476       0.117  12.953 120.905  1.00109.94           N  
ATOM   5516  CA  SER B 476       1.574  13.040 120.876  1.00109.46           C  
ATOM   5517  C   SER B 476       2.032  13.081 119.419  1.00109.39           C  
ATOM   5518  O   SER B 476       1.491  12.356 118.580  1.00109.93           O  
ATOM   5519  CB  SER B 476       2.204  11.851 121.600  1.00109.91           C  
ATOM   5520  OG  SER B 476       1.897  10.634 120.942  1.00110.63           O  
ATOM   5521  N   GLU B 477       3.025  13.928 119.137  1.00108.49           N  
ATOM   5522  CA  GLU B 477       3.524  14.193 117.775  1.00106.40           C  
ATOM   5523  C   GLU B 477       3.739  12.949 116.911  1.00105.55           C  
ATOM   5524  O   GLU B 477       4.225  11.928 117.406  1.00106.37           O  
ATOM   5525  CB  GLU B 477       4.858  14.946 117.834  1.00106.44           C  
ATOM   5526  CG  GLU B 477       4.797  16.388 118.313  1.00106.42           C  
ATOM   5527  CD  GLU B 477       6.165  17.061 118.309  1.00106.29           C  
ATOM   5528  OE1 GLU B 477       7.012  16.687 117.471  1.00107.22           O  
ATOM   5529  OE2 GLU B 477       6.398  17.966 119.137  1.00105.36           O  
ATOM   5530  N   PRO B 478       3.378  13.028 115.614  1.00104.28           N  
ATOM   5531  CA  PRO B 478       3.862  12.040 114.653  1.00103.39           C  
ATOM   5532  C   PRO B 478       5.370  12.177 114.481  1.00103.12           C  
ATOM   5533  O   PRO B 478       5.914  13.277 114.620  1.00100.90           O  
ATOM   5534  CB  PRO B 478       3.153  12.428 113.352  1.00102.56           C  
ATOM   5535  CG  PRO B 478       2.019  13.279 113.762  1.00103.21           C  
ATOM   5536  CD  PRO B 478       2.479  14.004 114.979  1.00104.30           C  
ATOM   5537  N   SER B 479       6.033  11.062 114.191  1.00105.04           N  
ATOM   5538  CA  SER B 479       7.481  11.050 114.027  1.00107.29           C  
ATOM   5539  C   SER B 479       7.908  11.598 112.670  1.00109.53           C  
ATOM   5540  O   SER B 479       7.093  11.748 111.753  1.00109.28           O  
ATOM   5541  CB  SER B 479       8.039   9.640 114.233  1.00107.32           C  
ATOM   5542  OG  SER B 479       7.950   9.254 115.594  1.00107.72           O  
ATOM   5543  N   LEU B 480       9.195  11.898 112.559  1.00111.61           N  
ATOM   5544  CA  LEU B 480       9.766  12.404 111.327  1.00113.30           C  
ATOM   5545  C   LEU B 480      10.674  11.333 110.726  1.00116.58           C  
ATOM   5546  O   LEU B 480      11.894  11.514 110.632  1.00117.32           O  
ATOM   5547  CB  LEU B 480      10.542  13.682 111.626  1.00112.78           C  
ATOM   5548  CG  LEU B 480      10.430  14.846 110.646  1.00112.72           C  
ATOM   5549  CD1 LEU B 480       8.980  15.274 110.434  1.00112.58           C  
ATOM   5550  CD2 LEU B 480      11.242  15.994 111.189  1.00112.76           C  
ATOM   5551  N   LEU B 481      10.060  10.219 110.324  1.00119.83           N  
ATOM   5552  CA  LEU B 481      10.778   9.012 109.903  1.00119.63           C  
ATOM   5553  C   LEU B 481      11.890   9.319 108.909  1.00119.60           C  
ATOM   5554  O   LEU B 481      11.657   9.937 107.874  1.00119.38           O  
ATOM   5555  CB  LEU B 481       9.806   7.968 109.328  1.00120.25           C  
ATOM   5556  CG  LEU B 481      10.264   6.518 109.062  1.00122.94           C  
ATOM   5557  CD1 LEU B 481      11.195   6.393 107.839  1.00123.78           C  
ATOM   5558  CD2 LEU B 481      10.880   5.820 110.299  1.00123.69           C  
ATOM   5559  N   GLU B 482      13.098   8.875 109.245  1.00120.97           N  
ATOM   5560  CA  GLU B 482      14.283   9.129 108.437  1.00122.77           C  
ATOM   5561  C   GLU B 482      14.648   7.923 107.575  1.00122.96           C  
ATOM   5562  O   GLU B 482      14.592   6.780 108.033  1.00123.34           O  
ATOM   5563  CB  GLU B 482      15.458   9.503 109.343  1.00123.42           C  
ATOM   5564  CG  GLU B 482      16.663  10.099 108.620  1.00124.24           C  
ATOM   5565  CD  GLU B 482      17.833  10.371 109.552  1.00124.34           C  
ATOM   5566  OE1 GLU B 482      18.094   9.538 110.452  1.00124.76           O  
ATOM   5567  OE2 GLU B 482      18.498  11.418 109.378  1.00124.03           O  
ATOM   5568  N   PHE B 483      15.016   8.195 106.325  1.00123.92           N  
ATOM   5569  CA  PHE B 483      15.497   7.172 105.392  1.00125.65           C  
ATOM   5570  C   PHE B 483      16.388   7.794 104.312  1.00125.69           C  
ATOM   5571  O   PHE B 483      16.263   8.978 104.006  1.00125.06           O  
ATOM   5572  CB  PHE B 483      14.334   6.367 104.783  1.00126.88           C  
ATOM   5573  CG  PHE B 483      13.416   7.170 103.897  1.00126.97           C  
ATOM   5574  CD1 PHE B 483      12.514   8.083 104.437  1.00127.59           C  
ATOM   5575  CD2 PHE B 483      13.430   6.986 102.522  1.00127.03           C  
ATOM   5576  CE1 PHE B 483      11.663   8.819 103.615  1.00127.80           C  
ATOM   5577  CE2 PHE B 483      12.580   7.717 101.694  1.00127.86           C  
ATOM   5578  CZ  PHE B 483      11.694   8.632 102.242  1.00127.49           C  
ATOM   5579  N   LYS B 484      17.291   6.994 103.749  1.00126.63           N  
ATOM   5580  CA  LYS B 484      18.327   7.511 102.847  1.00126.71           C  
ATOM   5581  C   LYS B 484      18.347   6.825 101.472  1.00128.27           C  
ATOM   5582  O   LYS B 484      19.168   5.933 101.232  1.00128.99           O  
ATOM   5583  CB  LYS B 484      19.711   7.420 103.515  1.00126.14           C  
ATOM   5584  CG  LYS B 484      19.822   8.164 104.839  1.00125.01           C  
ATOM   5585  CD  LYS B 484      21.180   7.977 105.484  1.00123.98           C  
ATOM   5586  CE  LYS B 484      21.178   8.534 106.897  1.00121.94           C  
ATOM   5587  NZ  LYS B 484      22.551   8.718 107.423  1.00120.42           N  
ATOM   5588  N   PRO B 485      17.435   7.230 100.565  1.00128.73           N  
ATOM   5589  CA  PRO B 485      17.453   6.708  99.204  1.00129.68           C  
ATOM   5590  C   PRO B 485      18.165   7.645  98.216  1.00131.21           C  
ATOM   5591  O   PRO B 485      17.812   7.676  97.033  1.00130.39           O  
ATOM   5592  CB  PRO B 485      15.964   6.618  98.870  1.00128.90           C  
ATOM   5593  CG  PRO B 485      15.341   7.752  99.654  1.00128.22           C  
ATOM   5594  CD  PRO B 485      16.306   8.157 100.755  1.00128.33           C  
ATOM   5595  N   PHE B 486      19.150   8.399  98.702  1.00133.28           N  
ATOM   5596  CA  PHE B 486      19.889   9.351  97.867  1.00135.14           C  
ATOM   5597  C   PHE B 486      21.398   9.146  97.977  1.00137.75           C  
ATOM   5598  O   PHE B 486      21.927   8.939  99.073  1.00139.06           O  
ATOM   5599  CB  PHE B 486      19.511  10.793  98.225  1.00133.79           C  
ATOM   5600  CG  PHE B 486      18.027  11.056  98.203  1.00133.18           C  
ATOM   5601  CD1 PHE B 486      17.307  10.976  97.013  1.00133.23           C  
ATOM   5602  CD2 PHE B 486      17.348  11.381  99.368  1.00132.18           C  
ATOM   5603  CE1 PHE B 486      15.931  11.214  96.985  1.00131.62           C  
ATOM   5604  CE2 PHE B 486      15.976  11.622  99.346  1.00131.68           C  
ATOM   5605  CZ  PHE B 486      15.268  11.538  98.153  1.00131.56           C  
ATOM   5606  N   SER B 487      22.083   9.214  96.837  1.00139.23           N  
ATOM   5607  CA  SER B 487      23.511   8.902  96.772  1.00140.51           C  
ATOM   5608  C   SER B 487      24.336  10.001  96.104  1.00141.65           C  
ATOM   5609  O   SER B 487      25.477  10.255  96.501  1.00141.96           O  
ATOM   5610  CB  SER B 487      23.724   7.580  96.033  1.00139.99           C  
ATOM   5611  OG  SER B 487      22.789   6.606  96.458  1.00139.98           O  
ATOM   5612  N   ASN B 488      23.747  10.648  95.098  1.00142.30           N  
ATOM   5613  CA  ASN B 488      24.445  11.627  94.253  1.00142.55           C  
ATOM   5614  C   ASN B 488      24.923  12.902  94.962  1.00140.71           C  
ATOM   5615  O   ASN B 488      25.775  13.626  94.435  1.00141.21           O  
ATOM   5616  CB  ASN B 488      23.578  11.994  93.039  1.00143.90           C  
ATOM   5617  CG  ASN B 488      22.275  12.679  93.431  1.00144.95           C  
ATOM   5618  OD1 ASN B 488      21.604  12.277  94.387  1.00145.34           O  
ATOM   5619  ND2 ASN B 488      21.910  13.716  92.686  1.00144.53           N  
ATOM   5620  N   GLY B 489      24.371  13.173  96.145  1.00137.12           N  
ATOM   5621  CA  GLY B 489      24.739  14.356  96.924  1.00131.20           C  
ATOM   5622  C   GLY B 489      23.549  15.205  97.339  1.00125.39           C  
ATOM   5623  O   GLY B 489      22.450  14.675  97.529  1.00125.72           O  
ATOM   5624  N   PRO B 490      23.754  16.534  97.467  1.00119.49           N  
ATOM   5625  CA  PRO B 490      22.711  17.408  98.001  1.00114.12           C  
ATOM   5626  C   PRO B 490      21.653  17.757  96.963  1.00110.84           C  
ATOM   5627  O   PRO B 490      21.973  18.112  95.827  1.00112.23           O  
ATOM   5628  CB  PRO B 490      23.482  18.655  98.440  1.00113.44           C  
ATOM   5629  CG  PRO B 490      24.686  18.689  97.574  1.00115.01           C  
ATOM   5630  CD  PRO B 490      24.970  17.286  97.099  1.00117.57           C  
ATOM   5631  N   LEU B 491      20.395  17.646  97.367  1.00106.30           N  
ATOM   5632  CA  LEU B 491      19.271  17.928  96.491  1.00101.41           C  
ATOM   5633  C   LEU B 491      18.749  19.346  96.709  1.00 98.79           C  
ATOM   5634  O   LEU B 491      18.931  19.925  97.782  1.00 99.14           O  
ATOM   5635  CB  LEU B 491      18.159  16.917  96.755  1.00101.27           C  
ATOM   5636  CG  LEU B 491      18.147  15.557  96.054  1.00102.23           C  
ATOM   5637  CD1 LEU B 491      19.510  14.886  95.979  1.00104.12           C  
ATOM   5638  CD2 LEU B 491      17.170  14.663  96.779  1.00103.18           C  
ATOM   5639  N   VAL B 492      18.111  19.905  95.685  1.00 95.44           N  
ATOM   5640  CA  VAL B 492      17.447  21.199  95.806  1.00 93.17           C  
ATOM   5641  C   VAL B 492      16.092  20.963  96.449  1.00 93.84           C  
ATOM   5642  O   VAL B 492      15.613  21.780  97.249  1.00 92.17           O  
ATOM   5643  CB  VAL B 492      17.287  21.896  94.427  1.00 93.77           C  
ATOM   5644  CG1 VAL B 492      16.151  22.940  94.444  1.00 95.35           C  
ATOM   5645  CG2 VAL B 492      18.596  22.544  94.002  1.00 91.70           C  
ATOM   5646  N   GLY B 493      15.493  19.825  96.095  1.00 94.41           N  
ATOM   5647  CA  GLY B 493      14.164  19.445  96.566  1.00 94.20           C  
ATOM   5648  C   GLY B 493      13.392  18.634  95.543  1.00 92.09           C  
ATOM   5649  O   GLY B 493      13.965  18.129  94.575  1.00 93.27           O  
ATOM   5650  N   GLY B 494      12.086  18.511  95.756  1.00 88.97           N  
ATOM   5651  CA  GLY B 494      11.254  17.680  94.901  1.00 87.91           C  
ATOM   5652  C   GLY B 494       9.781  18.022  94.900  1.00 89.43           C  
ATOM   5653  O   GLY B 494       9.332  18.913  95.629  1.00 89.54           O  
ATOM   5654  N   PHE B 495       9.032  17.304  94.067  1.00 89.47           N  
ATOM   5655  CA  PHE B 495       7.596  17.505  93.910  1.00 90.21           C  
ATOM   5656  C   PHE B 495       6.935  16.185  93.560  1.00 93.15           C  
ATOM   5657  O   PHE B 495       7.608  15.234  93.153  1.00 98.47           O  
ATOM   5658  CB  PHE B 495       7.317  18.536  92.812  1.00 89.39           C  
ATOM   5659  CG  PHE B 495       8.002  18.239  91.513  1.00 88.30           C  
ATOM   5660  CD1 PHE B 495       9.230  18.817  91.216  1.00 87.10           C  
ATOM   5661  CD2 PHE B 495       7.419  17.376  90.583  1.00 88.43           C  
ATOM   5662  CE1 PHE B 495       9.871  18.534  90.012  1.00 89.50           C  
ATOM   5663  CE2 PHE B 495       8.048  17.091  89.371  1.00 86.47           C  
ATOM   5664  CZ  PHE B 495       9.277  17.664  89.086  1.00 88.11           C  
ATOM   5665  N   VAL B 496       5.619  16.124  93.720  1.00 92.79           N  
ATOM   5666  CA  VAL B 496       4.840  14.953  93.315  1.00 89.87           C  
ATOM   5667  C   VAL B 496       4.070  15.323  92.053  1.00 90.08           C  
ATOM   5668  O   VAL B 496       3.090  16.063  92.125  1.00 92.95           O  
ATOM   5669  CB  VAL B 496       3.838  14.535  94.419  1.00 87.96           C  
ATOM   5670  CG1 VAL B 496       2.950  13.401  93.940  1.00 90.44           C  
ATOM   5671  CG2 VAL B 496       4.566  14.146  95.699  1.00 87.55           C  
ATOM   5672  N   TYR B 497       4.508  14.823  90.901  1.00 90.04           N  
ATOM   5673  CA  TYR B 497       3.825  15.122  89.640  1.00 89.48           C  
ATOM   5674  C   TYR B 497       2.404  14.583  89.603  1.00 89.38           C  
ATOM   5675  O   TYR B 497       2.178  13.371  89.643  1.00 87.58           O  
ATOM   5676  CB  TYR B 497       4.599  14.594  88.435  1.00 91.52           C  
ATOM   5677  CG  TYR B 497       3.915  14.882  87.115  1.00 91.26           C  
ATOM   5678  CD1 TYR B 497       3.951  16.160  86.556  1.00 88.70           C  
ATOM   5679  CD2 TYR B 497       3.232  13.879  86.426  1.00 90.85           C  
ATOM   5680  CE1 TYR B 497       3.330  16.437  85.351  1.00 88.29           C  
ATOM   5681  CE2 TYR B 497       2.603  14.142  85.214  1.00 91.62           C  
ATOM   5682  CZ  TYR B 497       2.660  15.429  84.681  1.00 92.35           C  
ATOM   5683  OH  TYR B 497       2.044  15.707  83.477  1.00 93.98           O  
ATOM   5684  N   ARG B 498       1.452  15.501  89.511  1.00 92.78           N  
ATOM   5685  CA  ARG B 498       0.042  15.138  89.447  1.00 96.16           C  
ATOM   5686  C   ARG B 498      -0.646  15.860  88.289  1.00 96.12           C  
ATOM   5687  O   ARG B 498      -1.842  16.157  88.335  1.00 98.44           O  
ATOM   5688  CB  ARG B 498      -0.639  15.416  90.790  1.00 97.17           C  
ATOM   5689  CG  ARG B 498      -0.446  14.310  91.814  1.00 96.09           C  
ATOM   5690  CD  ARG B 498      -1.730  13.529  92.018  1.00 98.47           C  
ATOM   5691  NE  ARG B 498      -1.496  12.101  92.247  1.00101.67           N  
ATOM   5692  CZ  ARG B 498      -1.027  11.581  93.379  1.00102.69           C  
ATOM   5693  NH1 ARG B 498      -0.722  12.373  94.399  1.00103.34           N  
ATOM   5694  NH2 ARG B 498      -0.857  10.269  93.488  1.00103.12           N  
ATOM   5695  N   GLY B 499       0.130  16.124  87.242  1.00 94.12           N  
ATOM   5696  CA  GLY B 499      -0.376  16.761  86.043  1.00 93.27           C  
ATOM   5697  C   GLY B 499      -1.119  15.811  85.129  1.00 93.60           C  
ATOM   5698  O   GLY B 499      -1.349  14.648  85.461  1.00 95.05           O  
ATOM   5699  N   CYS B 500      -1.483  16.325  83.961  1.00 93.41           N  
ATOM   5700  CA  CYS B 500      -2.282  15.600  82.996  1.00 90.10           C  
ATOM   5701  C   CYS B 500      -1.456  15.228  81.764  1.00 87.74           C  
ATOM   5702  O   CYS B 500      -1.762  14.248  81.082  1.00 87.36           O  
ATOM   5703  CB  CYS B 500      -3.487  16.461  82.605  1.00 93.13           C  
ATOM   5704  SG  CYS B 500      -4.590  15.802  81.321  1.00 97.25           S  
ATOM   5705  N   GLN B 501      -0.409  16.003  81.484  1.00 86.04           N  
ATOM   5706  CA  GLN B 501       0.319  15.854  80.227  1.00 85.32           C  
ATOM   5707  C   GLN B 501       1.080  14.528  80.143  1.00 84.85           C  
ATOM   5708  O   GLN B 501       1.006  13.845  79.126  1.00 82.44           O  
ATOM   5709  CB  GLN B 501       1.237  17.054  79.952  1.00 83.94           C  
ATOM   5710  CG  GLN B 501       1.720  17.152  78.492  1.00 84.93           C  
ATOM   5711  CD  GLN B 501       3.046  16.428  78.236  1.00 87.70           C  
ATOM   5712  OE1 GLN B 501       4.009  16.587  78.984  1.00 90.44           O  
ATOM   5713  NE2 GLN B 501       3.101  15.649  77.165  1.00 88.30           N  
ATOM   5714  N   SER B 502       1.810  14.177  81.199  1.00 84.42           N  
ATOM   5715  CA  SER B 502       2.471  12.880  81.261  1.00 85.93           C  
ATOM   5716  C   SER B 502       1.594  11.874  81.996  1.00 88.28           C  
ATOM   5717  O   SER B 502       0.984  12.191  83.019  1.00 94.77           O  
ATOM   5718  CB  SER B 502       3.841  12.981  81.941  1.00 84.48           C  
ATOM   5719  OG  SER B 502       4.543  11.741  81.887  1.00 80.57           O  
ATOM   5720  N   GLU B 503       1.520  10.661  81.471  1.00 86.20           N  
ATOM   5721  CA  GLU B 503       0.874   9.603  82.215  1.00 88.75           C  
ATOM   5722  C   GLU B 503       1.901   8.817  83.021  1.00 88.28           C  
ATOM   5723  O   GLU B 503       1.682   8.530  84.200  1.00 89.08           O  
ATOM   5724  CB  GLU B 503       0.059   8.698  81.293  1.00 92.14           C  
ATOM   5725  CG  GLU B 503      -1.203   9.382  80.793  1.00 94.67           C  
ATOM   5726  CD  GLU B 503      -2.171   8.442  80.118  1.00 93.99           C  
ATOM   5727  OE1 GLU B 503      -1.742   7.681  79.225  1.00 94.23           O  
ATOM   5728  OE2 GLU B 503      -3.370   8.487  80.475  1.00 93.96           O  
ATOM   5729  N   ARG B 504       3.032   8.505  82.390  1.00 86.09           N  
ATOM   5730  CA  ARG B 504       4.080   7.702  83.019  1.00 84.39           C  
ATOM   5731  C   ARG B 504       4.694   8.336  84.256  1.00 86.44           C  
ATOM   5732  O   ARG B 504       5.234   7.636  85.111  1.00 90.13           O  
ATOM   5733  CB  ARG B 504       5.180   7.365  82.019  1.00 82.72           C  
ATOM   5734  CG  ARG B 504       5.743   8.537  81.257  1.00 80.86           C  
ATOM   5735  CD  ARG B 504       6.318   8.043  79.952  1.00 81.40           C  
ATOM   5736  NE  ARG B 504       7.178   9.034  79.329  1.00 82.92           N  
ATOM   5737  CZ  ARG B 504       8.484   9.124  79.536  1.00 85.68           C  
ATOM   5738  NH1 ARG B 504       9.095   8.274  80.347  1.00 85.74           N  
ATOM   5739  NH2 ARG B 504       9.181  10.069  78.922  1.00 89.52           N  
ATOM   5740  N   LEU B 505       4.612   9.657  84.349  1.00 85.72           N  
ATOM   5741  CA  LEU B 505       5.209  10.372  85.464  1.00 86.36           C  
ATOM   5742  C   LEU B 505       4.208  10.553  86.598  1.00 89.02           C  
ATOM   5743  O   LEU B 505       4.594  10.821  87.736  1.00 92.83           O  
ATOM   5744  CB  LEU B 505       5.706  11.743  85.007  1.00 83.91           C  
ATOM   5745  CG  LEU B 505       7.086  12.261  85.416  1.00 81.53           C  
ATOM   5746  CD1 LEU B 505       6.975  13.758  85.681  1.00 81.18           C  
ATOM   5747  CD2 LEU B 505       7.685  11.547  86.613  1.00 78.67           C  
ATOM   5748  N   TYR B 506       2.923  10.416  86.282  1.00 88.19           N  
ATOM   5749  CA  TYR B 506       1.858  10.722  87.233  1.00 84.98           C  
ATOM   5750  C   TYR B 506       2.012   9.910  88.503  1.00 83.96           C  
ATOM   5751  O   TYR B 506       2.248   8.710  88.447  1.00 85.03           O  
ATOM   5752  CB  TYR B 506       0.486  10.478  86.604  1.00 82.92           C  
ATOM   5753  CG  TYR B 506      -0.654  10.789  87.531  1.00 81.21           C  
ATOM   5754  CD1 TYR B 506      -1.101  12.097  87.702  1.00 83.54           C  
ATOM   5755  CD2 TYR B 506      -1.279   9.780  88.250  1.00 76.35           C  
ATOM   5756  CE1 TYR B 506      -2.154  12.383  88.565  1.00 84.99           C  
ATOM   5757  CE2 TYR B 506      -2.321  10.053  89.112  1.00 76.16           C  
ATOM   5758  CZ  TYR B 506      -2.759  11.343  89.265  1.00 81.98           C  
ATOM   5759  OH  TYR B 506      -3.794  11.600  90.127  1.00 83.35           O  
ATOM   5760  N   GLY B 507       1.899  10.577  89.644  1.00 84.14           N  
ATOM   5761  CA  GLY B 507       2.012   9.914  90.938  1.00 84.77           C  
ATOM   5762  C   GLY B 507       3.434   9.766  91.451  1.00 87.00           C  
ATOM   5763  O   GLY B 507       3.638   9.475  92.632  1.00 87.99           O  
ATOM   5764  N   SER B 508       4.416   9.967  90.573  1.00 87.86           N  
ATOM   5765  CA  SER B 508       5.826   9.854  90.945  1.00 88.88           C  
ATOM   5766  C   SER B 508       6.316  11.029  91.775  1.00 93.34           C  
ATOM   5767  O   SER B 508       5.889  12.176  91.581  1.00 94.42           O  
ATOM   5768  CB  SER B 508       6.709   9.742  89.706  1.00 86.28           C  
ATOM   5769  OG  SER B 508       6.325   8.647  88.902  1.00 88.64           O  
ATOM   5770  N   TYR B 509       7.220  10.729  92.702  1.00 95.16           N  
ATOM   5771  CA  TYR B 509       8.012  11.758  93.355  1.00 97.30           C  
ATOM   5772  C   TYR B 509       9.192  12.070  92.451  1.00 94.76           C  
ATOM   5773  O   TYR B 509       9.815  11.162  91.914  1.00 95.61           O  
ATOM   5774  CB  TYR B 509       8.521  11.264  94.704  1.00100.83           C  
ATOM   5775  CG  TYR B 509       7.482  11.217  95.799  1.00102.85           C  
ATOM   5776  CD1 TYR B 509       6.423  10.311  95.751  1.00103.53           C  
ATOM   5777  CD2 TYR B 509       7.573  12.064  96.904  1.00104.89           C  
ATOM   5778  CE1 TYR B 509       5.475  10.255  96.768  1.00104.95           C  
ATOM   5779  CE2 TYR B 509       6.628  12.018  97.928  1.00105.56           C  
ATOM   5780  CZ  TYR B 509       5.585  11.109  97.854  1.00104.87           C  
ATOM   5781  OH  TYR B 509       4.651  11.053  98.865  1.00104.53           O  
ATOM   5782  N   VAL B 510       9.487  13.348  92.261  1.00 93.85           N  
ATOM   5783  CA  VAL B 510      10.678  13.736  91.506  1.00 94.81           C  
ATOM   5784  C   VAL B 510      11.546  14.641  92.369  1.00 95.87           C  
ATOM   5785  O   VAL B 510      11.055  15.613  92.946  1.00 94.78           O  
ATOM   5786  CB  VAL B 510      10.339  14.466  90.175  1.00 93.05           C  
ATOM   5787  CG1 VAL B 510      11.542  14.488  89.268  1.00 92.06           C  
ATOM   5788  CG2 VAL B 510       9.182  13.793  89.452  1.00 94.37           C  
ATOM   5789  N   PHE B 511      12.829  14.303  92.472  1.00 95.99           N  
ATOM   5790  CA  PHE B 511      13.800  15.167  93.145  1.00 96.34           C  
ATOM   5791  C   PHE B 511      14.970  15.450  92.217  1.00 96.43           C  
ATOM   5792  O   PHE B 511      15.418  14.561  91.491  1.00 98.61           O  
ATOM   5793  CB  PHE B 511      14.291  14.537  94.449  1.00 95.44           C  
ATOM   5794  CG  PHE B 511      13.267  14.539  95.547  1.00 95.51           C  
ATOM   5795  CD1 PHE B 511      12.280  13.553  95.603  1.00 95.19           C  
ATOM   5796  CD2 PHE B 511      13.291  15.522  96.530  1.00 96.02           C  
ATOM   5797  CE1 PHE B 511      11.326  13.553  96.617  1.00 95.09           C  
ATOM   5798  CE2 PHE B 511      12.341  15.538  97.550  1.00 96.28           C  
ATOM   5799  CZ  PHE B 511      11.356  14.549  97.592  1.00 96.79           C  
ATOM   5800  N   GLY B 512      15.450  16.691  92.231  1.00 93.37           N  
ATOM   5801  CA  GLY B 512      16.554  17.093  91.368  1.00 90.49           C  
ATOM   5802  C   GLY B 512      17.610  17.885  92.102  1.00 89.49           C  
ATOM   5803  O   GLY B 512      17.317  18.534  93.108  1.00 90.78           O  
ATOM   5804  N   ASP B 513      18.840  17.837  91.601  1.00 88.56           N  
ATOM   5805  CA  ASP B 513      19.917  18.615  92.194  1.00 92.14           C  
ATOM   5806  C   ASP B 513      20.185  19.909  91.431  1.00 95.77           C  
ATOM   5807  O   ASP B 513      19.709  20.104  90.314  1.00 95.73           O  
ATOM   5808  CB  ASP B 513      21.195  17.778  92.354  1.00 94.40           C  
ATOM   5809  CG  ASP B 513      21.937  17.550  91.043  1.00 96.60           C  
ATOM   5810  OD1 ASP B 513      23.069  17.021  91.089  1.00 94.91           O  
ATOM   5811  OD2 ASP B 513      21.407  17.891  89.967  1.00101.04           O  
ATOM   5812  N   ARG B 514      20.955  20.784  92.066  1.00100.39           N  
ATOM   5813  CA  ARG B 514      21.344  22.086  91.532  1.00102.82           C  
ATOM   5814  C   ARG B 514      21.627  22.085  90.028  1.00103.10           C  
ATOM   5815  O   ARG B 514      21.232  23.007  89.318  1.00105.19           O  
ATOM   5816  CB  ARG B 514      22.573  22.573  92.304  1.00106.19           C  
ATOM   5817  CG  ARG B 514      22.961  23.999  92.058  1.00109.94           C  
ATOM   5818  CD  ARG B 514      23.738  24.561  93.234  1.00116.24           C  
ATOM   5819  NE  ARG B 514      23.340  25.949  93.459  1.00121.96           N  
ATOM   5820  CZ  ARG B 514      24.011  27.009  93.021  1.00122.98           C  
ATOM   5821  NH1 ARG B 514      25.151  26.852  92.347  1.00122.03           N  
ATOM   5822  NH2 ARG B 514      23.538  28.229  93.269  1.00122.84           N  
ATOM   5823  N   ASN B 515      22.295  21.040  89.551  1.00102.40           N  
ATOM   5824  CA  ASN B 515      22.778  20.990  88.175  1.00101.61           C  
ATOM   5825  C   ASN B 515      21.884  20.207  87.205  1.00102.86           C  
ATOM   5826  O   ASN B 515      22.274  19.965  86.058  1.00105.01           O  
ATOM   5827  CB  ASN B 515      24.211  20.454  88.149  1.00100.01           C  
ATOM   5828  CG  ASN B 515      24.910  20.703  86.831  1.00 99.38           C  
ATOM   5829  OD1 ASN B 515      25.525  19.800  86.273  1.00 99.28           O  
ATOM   5830  ND2 ASN B 515      24.822  21.930  86.327  1.00100.47           N  
ATOM   5831  N   GLY B 516      20.695  19.812  87.668  1.00100.91           N  
ATOM   5832  CA  GLY B 516      19.676  19.203  86.807  1.00 98.14           C  
ATOM   5833  C   GLY B 516      19.636  17.684  86.725  1.00 99.10           C  
ATOM   5834  O   GLY B 516      18.998  17.132  85.829  1.00101.07           O  
ATOM   5835  N   ASN B 517      20.320  17.003  87.640  1.00 97.29           N  
ATOM   5836  CA  ASN B 517      20.250  15.549  87.722  1.00 97.13           C  
ATOM   5837  C   ASN B 517      18.979  15.135  88.441  1.00 95.90           C  
ATOM   5838  O   ASN B 517      18.820  15.438  89.620  1.00 96.35           O  
ATOM   5839  CB  ASN B 517      21.456  15.000  88.480  1.00100.16           C  
ATOM   5840  CG  ASN B 517      22.771  15.425  87.869  1.00104.74           C  
ATOM   5841  OD1 ASN B 517      23.078  15.085  86.727  1.00107.72           O  
ATOM   5842  ND2 ASN B 517      23.566  16.161  88.635  1.00105.80           N  
ATOM   5843  N   PHE B 518      18.077  14.443  87.747  1.00 94.95           N  
ATOM   5844  CA  PHE B 518      16.793  14.067  88.351  1.00 95.01           C  
ATOM   5845  C   PHE B 518      16.679  12.613  88.831  1.00 97.55           C  
ATOM   5846  O   PHE B 518      17.358  11.721  88.317  1.00 99.88           O  
ATOM   5847  CB  PHE B 518      15.633  14.448  87.434  1.00 91.77           C  
ATOM   5848  CG  PHE B 518      15.435  15.931  87.311  1.00 92.96           C  
ATOM   5849  CD1 PHE B 518      15.957  16.630  86.225  1.00 93.29           C  
ATOM   5850  CD2 PHE B 518      14.743  16.639  88.287  1.00 92.14           C  
ATOM   5851  CE1 PHE B 518      15.786  18.012  86.105  1.00 89.51           C  
ATOM   5852  CE2 PHE B 518      14.563  18.023  88.173  1.00 91.28           C  
ATOM   5853  CZ  PHE B 518      15.088  18.706  87.081  1.00 90.36           C  
ATOM   5854  N   LEU B 519      15.831  12.405  89.841  1.00 97.89           N  
ATOM   5855  CA  LEU B 519      15.517  11.085  90.398  1.00 95.98           C  
ATOM   5856  C   LEU B 519      14.010  10.900  90.420  1.00 98.60           C  
ATOM   5857  O   LEU B 519      13.255  11.880  90.423  1.00100.77           O  
ATOM   5858  CB  LEU B 519      16.012  10.969  91.837  1.00 93.40           C  
ATOM   5859  CG  LEU B 519      17.406  11.476  92.176  1.00 96.43           C  
ATOM   5860  CD1 LEU B 519      17.432  11.920  93.614  1.00 97.13           C  
ATOM   5861  CD2 LEU B 519      18.469  10.409  91.909  1.00100.32           C  
ATOM   5862  N   THR B 520      13.574   9.646  90.460  1.00 98.18           N  
ATOM   5863  CA  THR B 520      12.165   9.339  90.645  1.00100.43           C  
ATOM   5864  C   THR B 520      12.011   8.283  91.723  1.00104.15           C  
ATOM   5865  O   THR B 520      12.365   7.121  91.515  1.00109.03           O  
ATOM   5866  CB  THR B 520      11.496   8.890  89.324  1.00100.97           C  
ATOM   5867  OG1 THR B 520      11.345  10.023  88.467  1.00103.03           O  
ATOM   5868  CG2 THR B 520      10.119   8.298  89.568  1.00100.64           C  
ATOM   5869  N   LEU B 521      11.502   8.695  92.881  1.00105.95           N  
ATOM   5870  CA  LEU B 521      11.147   7.756  93.941  1.00107.89           C  
ATOM   5871  C   LEU B 521       9.811   7.102  93.616  1.00111.85           C  
ATOM   5872  O   LEU B 521       8.750   7.632  93.941  1.00110.05           O  
ATOM   5873  CB  LEU B 521      11.105   8.442  95.312  1.00105.51           C  
ATOM   5874  CG  LEU B 521      12.433   8.846  95.965  1.00104.73           C  
ATOM   5875  CD1 LEU B 521      12.186   9.579  97.267  1.00104.29           C  
ATOM   5876  CD2 LEU B 521      13.330   7.640  96.211  1.00106.30           C  
ATOM   5877  N   GLN B 522       9.876   5.958  92.944  1.00119.90           N  
ATOM   5878  CA  GLN B 522       8.677   5.207  92.607  1.00128.00           C  
ATOM   5879  C   GLN B 522       8.321   4.249  93.737  1.00133.13           C  
ATOM   5880  O   GLN B 522       9.102   3.362  94.100  1.00133.75           O  
ATOM   5881  CB  GLN B 522       8.838   4.455  91.279  1.00129.59           C  
ATOM   5882  CG  GLN B 522       7.520   3.947  90.691  1.00129.51           C  
ATOM   5883  CD  GLN B 522       6.499   5.057  90.509  1.00128.58           C  
ATOM   5884  OE1 GLN B 522       6.751   6.038  89.808  1.00127.57           O  
ATOM   5885  NE2 GLN B 522       5.342   4.910  91.146  1.00127.72           N  
ATOM   5886  N   GLN B 523       7.131   4.453  94.291  1.00137.82           N  
ATOM   5887  CA  GLN B 523       6.619   3.640  95.382  1.00141.02           C  
ATOM   5888  C   GLN B 523       6.077   2.319  94.834  1.00141.34           C  
ATOM   5889  O   GLN B 523       4.928   2.247  94.388  1.00140.77           O  
ATOM   5890  CB  GLN B 523       5.529   4.418  96.123  1.00141.94           C  
ATOM   5891  CG  GLN B 523       5.058   3.783  97.411  1.00142.57           C  
ATOM   5892  CD  GLN B 523       4.093   4.658  98.185  1.00142.83           C  
ATOM   5893  OE1 GLN B 523       4.217   5.883  98.200  1.00144.66           O  
ATOM   5894  NE2 GLN B 523       3.122   4.030  98.837  1.00142.69           N  
ATOM   5895  N   SER B 524       6.915   1.285  94.853  1.00142.25           N  
ATOM   5896  CA  SER B 524       6.519  -0.032  94.362  1.00144.37           C  
ATOM   5897  C   SER B 524       5.394  -0.598  95.232  1.00145.62           C  
ATOM   5898  O   SER B 524       5.582  -0.799  96.432  1.00144.90           O  
ATOM   5899  CB  SER B 524       7.717  -0.988  94.320  1.00145.05           C  
ATOM   5900  OG  SER B 524       7.375  -2.220  93.703  1.00144.70           O  
ATOM   5901  N   PRO B 525       4.211  -0.833  94.630  1.00147.07           N  
ATOM   5902  CA  PRO B 525       3.042  -1.289  95.388  1.00148.36           C  
ATOM   5903  C   PRO B 525       3.109  -2.765  95.795  1.00150.30           C  
ATOM   5904  O   PRO B 525       2.625  -3.129  96.871  1.00150.43           O  
ATOM   5905  CB  PRO B 525       1.878  -1.040  94.422  1.00147.63           C  
ATOM   5906  CG  PRO B 525       2.482  -1.112  93.065  1.00146.87           C  
ATOM   5907  CD  PRO B 525       3.915  -0.676  93.191  1.00146.92           C  
ATOM   5908  N   VAL B 526       3.704  -3.597  94.942  1.00151.79           N  
ATOM   5909  CA  VAL B 526       3.856  -5.028  95.216  1.00153.24           C  
ATOM   5910  C   VAL B 526       4.921  -5.318  96.278  1.00153.10           C  
ATOM   5911  O   VAL B 526       4.845  -6.329  96.982  1.00153.51           O  
ATOM   5912  CB  VAL B 526       4.158  -5.850  93.926  1.00154.28           C  
ATOM   5913  CG1 VAL B 526       2.877  -6.117  93.145  1.00154.80           C  
ATOM   5914  CG2 VAL B 526       5.200  -5.150  93.047  1.00154.92           C  
ATOM   5915  N   THR B 527       5.910  -4.429  96.382  1.00152.29           N  
ATOM   5916  CA  THR B 527       7.020  -4.595  97.321  1.00151.30           C  
ATOM   5917  C   THR B 527       7.295  -3.296  98.061  1.00151.44           C  
ATOM   5918  O   THR B 527       7.570  -2.268  97.438  1.00151.95           O  
ATOM   5919  CB  THR B 527       8.316  -5.049  96.609  1.00150.72           C  
ATOM   5920  OG1 THR B 527       8.853  -3.968  95.836  1.00149.80           O  
ATOM   5921  CG2 THR B 527       8.039  -6.226  95.696  1.00150.97           C  
ATOM   5922  N   LYS B 528       7.224  -3.348  99.388  1.00151.55           N  
ATOM   5923  CA  LYS B 528       7.451  -2.171 100.220  1.00152.34           C  
ATOM   5924  C   LYS B 528       8.902  -1.706 100.084  1.00152.36           C  
ATOM   5925  O   LYS B 528       9.805  -2.291 100.689  1.00153.22           O  
ATOM   5926  CB  LYS B 528       7.111  -2.480 101.681  1.00152.70           C  
ATOM   5927  CG  LYS B 528       6.407  -1.348 102.420  1.00153.32           C  
ATOM   5928  CD  LYS B 528       4.908  -1.350 102.139  1.00153.52           C  
ATOM   5929  CE  LYS B 528       4.180  -0.295 102.956  1.00153.64           C  
ATOM   5930  NZ  LYS B 528       2.759  -0.133 102.539  1.00153.67           N  
ATOM   5931  N   GLN B 529       9.116  -0.672  99.268  1.00150.79           N  
ATOM   5932  CA  GLN B 529      10.459  -0.163  98.974  1.00150.03           C  
ATOM   5933  C   GLN B 529      10.423   1.215  98.323  1.00149.05           C  
ATOM   5934  O   GLN B 529       9.707   1.426  97.338  1.00149.64           O  
ATOM   5935  CB  GLN B 529      11.210  -1.125  98.045  1.00151.44           C  
ATOM   5936  CG  GLN B 529      12.728  -1.073  98.176  1.00151.87           C  
ATOM   5937  CD  GLN B 529      13.265  -2.085  99.171  1.00151.82           C  
ATOM   5938  OE1 GLN B 529      13.067  -3.291  99.016  1.00151.41           O  
ATOM   5939  NE2 GLN B 529      13.958  -1.599 100.194  1.00152.07           N  
ATOM   5940  N   TRP B 530      11.198   2.145  98.880  1.00147.18           N  
ATOM   5941  CA  TRP B 530      11.435   3.442  98.248  1.00144.43           C  
ATOM   5942  C   TRP B 530      12.559   3.293  97.220  1.00141.51           C  
ATOM   5943  O   TRP B 530      13.710   3.666  97.480  1.00141.62           O  
ATOM   5944  CB  TRP B 530      11.797   4.521  99.282  1.00145.00           C  
ATOM   5945  CG  TRP B 530      10.627   5.220  99.957  1.00145.80           C  
ATOM   5946  CD1 TRP B 530      10.442   5.381 101.302  1.00146.04           C  
ATOM   5947  CD2 TRP B 530       9.507   5.862  99.322  1.00145.70           C  
ATOM   5948  NE1 TRP B 530       9.282   6.078 101.545  1.00145.85           N  
ATOM   5949  CE2 TRP B 530       8.686   6.382 100.350  1.00145.07           C  
ATOM   5950  CE3 TRP B 530       9.112   6.040  97.988  1.00145.78           C  
ATOM   5951  CZ2 TRP B 530       7.496   7.065 100.087  1.00144.56           C  
ATOM   5952  CZ3 TRP B 530       7.928   6.723  97.728  1.00145.40           C  
ATOM   5953  CH2 TRP B 530       7.136   7.226  98.774  1.00145.27           C  
ATOM   5954  N   GLN B 531      12.220   2.730  96.061  1.00137.03           N  
ATOM   5955  CA  GLN B 531      13.193   2.492  94.994  1.00131.70           C  
ATOM   5956  C   GLN B 531      13.339   3.683  94.047  1.00126.52           C  
ATOM   5957  O   GLN B 531      12.412   4.031  93.311  1.00126.05           O  
ATOM   5958  CB  GLN B 531      12.850   1.217  94.214  1.00132.27           C  
ATOM   5959  CG  GLN B 531      13.513  -0.048  94.758  1.00133.39           C  
ATOM   5960  CD  GLN B 531      15.021  -0.082  94.532  1.00134.24           C  
ATOM   5961  OE1 GLN B 531      15.524   0.409  93.519  1.00135.33           O  
ATOM   5962  NE2 GLN B 531      15.746  -0.670  95.479  1.00133.80           N  
ATOM   5963  N   GLU B 532      14.514   4.303  94.079  1.00120.61           N  
ATOM   5964  CA  GLU B 532      14.816   5.408  93.181  1.00116.35           C  
ATOM   5965  C   GLU B 532      15.211   4.910  91.789  1.00113.27           C  
ATOM   5966  O   GLU B 532      15.975   3.949  91.653  1.00114.89           O  
ATOM   5967  CB  GLU B 532      15.900   6.328  93.770  1.00116.34           C  
ATOM   5968  CG  GLU B 532      17.228   5.652  94.134  1.00117.29           C  
ATOM   5969  CD  GLU B 532      18.400   6.628  94.207  1.00116.82           C  
ATOM   5970  OE1 GLU B 532      19.430   6.280  94.826  1.00116.70           O  
ATOM   5971  OE2 GLU B 532      18.297   7.740  93.646  1.00116.42           O  
ATOM   5972  N   LYS B 533      14.655   5.555  90.765  1.00108.42           N  
ATOM   5973  CA  LYS B 533      15.063   5.346  89.375  1.00104.38           C  
ATOM   5974  C   LYS B 533      15.401   6.702  88.771  1.00101.15           C  
ATOM   5975  O   LYS B 533      14.651   7.667  88.962  1.00102.85           O  
ATOM   5976  CB  LYS B 533      13.958   4.671  88.549  1.00105.57           C  
ATOM   5977  CG  LYS B 533      13.388   3.408  89.172  1.00108.54           C  
ATOM   5978  CD  LYS B 533      12.939   2.407  88.125  1.00110.09           C  
ATOM   5979  CE  LYS B 533      13.016   0.993  88.696  1.00111.69           C  
ATOM   5980  NZ  LYS B 533      12.913  -0.054  87.642  1.00112.24           N  
ATOM   5981  N   PRO B 534      16.525   6.790  88.037  1.00 96.15           N  
ATOM   5982  CA  PRO B 534      16.898   8.068  87.423  1.00 92.96           C  
ATOM   5983  C   PRO B 534      15.868   8.557  86.402  1.00 88.55           C  
ATOM   5984  O   PRO B 534      15.098   7.771  85.864  1.00 86.54           O  
ATOM   5985  CB  PRO B 534      18.229   7.753  86.731  1.00 93.90           C  
ATOM   5986  CG  PRO B 534      18.230   6.274  86.551  1.00 94.07           C  
ATOM   5987  CD  PRO B 534      17.499   5.729  87.733  1.00 94.58           C  
ATOM   5988  N   LEU B 535      15.851   9.857  86.161  1.00 88.78           N  
ATOM   5989  CA  LEU B 535      14.976  10.445  85.162  1.00 89.34           C  
ATOM   5990  C   LEU B 535      15.876  11.237  84.240  1.00 89.66           C  
ATOM   5991  O   LEU B 535      16.524  12.187  84.671  1.00 93.15           O  
ATOM   5992  CB  LEU B 535      13.936  11.352  85.828  1.00 88.44           C  
ATOM   5993  CG  LEU B 535      12.810  11.974  84.998  1.00 89.61           C  
ATOM   5994  CD1 LEU B 535      11.685  12.454  85.912  1.00 90.67           C  
ATOM   5995  CD2 LEU B 535      13.313  13.123  84.133  1.00 90.35           C  
ATOM   5996  N   CYS B 536      15.933  10.836  82.978  1.00 90.27           N  
ATOM   5997  CA  CYS B 536      16.876  11.442  82.050  1.00 93.60           C  
ATOM   5998  C   CYS B 536      16.233  12.547  81.228  1.00 92.43           C  
ATOM   5999  O   CYS B 536      15.041  12.507  80.937  1.00 93.27           O  
ATOM   6000  CB  CYS B 536      17.505  10.387  81.136  1.00 96.51           C  
ATOM   6001  SG  CYS B 536      16.324   9.539  80.059  1.00101.18           S  
ATOM   6002  N   LEU B 537      17.035  13.544  80.875  1.00 91.02           N  
ATOM   6003  CA  LEU B 537      16.611  14.573  79.940  1.00 87.20           C  
ATOM   6004  C   LEU B 537      17.157  14.255  78.555  1.00 86.53           C  
ATOM   6005  O   LEU B 537      18.315  13.840  78.407  1.00 85.22           O  
ATOM   6006  CB  LEU B 537      17.074  15.946  80.411  1.00 83.57           C  
ATOM   6007  CG  LEU B 537      16.145  16.737  81.336  1.00 83.80           C  
ATOM   6008  CD1 LEU B 537      15.014  15.901  81.953  1.00 82.19           C  
ATOM   6009  CD2 LEU B 537      16.958  17.468  82.406  1.00 82.56           C  
ATOM   6010  N   GLY B 538      16.307  14.431  77.551  1.00 83.59           N  
ATOM   6011  CA  GLY B 538      16.666  14.147  76.173  1.00 84.02           C  
ATOM   6012  C   GLY B 538      16.009  15.150  75.259  1.00 86.51           C  
ATOM   6013  O   GLY B 538      14.864  15.541  75.477  1.00 92.69           O  
ATOM   6014  N   THR B 539      16.736  15.569  74.233  1.00 86.12           N  
ATOM   6015  CA  THR B 539      16.260  16.603  73.319  1.00 86.66           C  
ATOM   6016  C   THR B 539      15.451  16.003  72.164  1.00 83.63           C  
ATOM   6017  O   THR B 539      15.935  15.151  71.424  1.00 85.48           O  
ATOM   6018  CB  THR B 539      17.441  17.446  72.786  1.00 88.20           C  
ATOM   6019  OG1 THR B 539      16.995  18.301  71.728  1.00 88.39           O  
ATOM   6020  CG2 THR B 539      18.521  16.532  72.261  1.00 91.25           C  
ATOM   6021  N   SER B 540      14.206  16.437  72.033  1.00 81.85           N  
ATOM   6022  CA  SER B 540      13.358  16.014  70.926  1.00 80.27           C  
ATOM   6023  C   SER B 540      12.625  17.217  70.398  1.00 78.59           C  
ATOM   6024  O   SER B 540      11.874  17.865  71.132  1.00 77.25           O  
ATOM   6025  CB  SER B 540      12.379  14.911  71.341  1.00 81.51           C  
ATOM   6026  OG  SER B 540      12.170  14.892  72.741  1.00 84.60           O  
ATOM   6027  N   GLY B 541      12.864  17.515  69.125  1.00 79.78           N  
ATOM   6028  CA  GLY B 541      12.395  18.749  68.518  1.00 86.37           C  
ATOM   6029  C   GLY B 541      13.219  19.916  69.029  1.00 92.70           C  
ATOM   6030  O   GLY B 541      14.446  19.844  69.079  1.00 96.56           O  
ATOM   6031  N   SER B 542      12.537  20.990  69.410  1.00 94.51           N  
ATOM   6032  CA  SER B 542      13.183  22.159  69.979  1.00 95.69           C  
ATOM   6033  C   SER B 542      12.969  22.128  71.486  1.00 97.60           C  
ATOM   6034  O   SER B 542      13.199  23.122  72.195  1.00103.17           O  
ATOM   6035  CB  SER B 542      12.578  23.430  69.389  1.00 96.81           C  
ATOM   6036  OG  SER B 542      11.256  23.608  69.868  1.00100.34           O  
ATOM   6037  N   CYS B 543      12.487  20.986  71.964  1.00 93.04           N  
ATOM   6038  CA  CYS B 543      12.321  20.749  73.382  1.00 89.53           C  
ATOM   6039  C   CYS B 543      13.552  19.937  73.777  1.00 90.90           C  
ATOM   6040  O   CYS B 543      13.792  18.837  73.263  1.00 92.52           O  
ATOM   6041  CB  CYS B 543      11.005  20.022  73.638  1.00 88.91           C  
ATOM   6042  SG  CYS B 543      10.663  19.569  75.342  1.00 94.90           S  
ATOM   6043  N   ARG B 544      14.356  20.504  74.667  1.00 87.21           N  
ATOM   6044  CA  ARG B 544      15.757  20.117  74.736  1.00 85.58           C  
ATOM   6045  C   ARG B 544      16.107  19.354  76.001  1.00 88.89           C  
ATOM   6046  O   ARG B 544      15.373  19.416  76.981  1.00 94.12           O  
ATOM   6047  CB  ARG B 544      16.646  21.347  74.516  1.00 78.02           C  
ATOM   6048  CG  ARG B 544      16.125  22.218  73.387  1.00 72.54           C  
ATOM   6049  CD  ARG B 544      17.205  22.779  72.558  1.00 76.52           C  
ATOM   6050  NE  ARG B 544      17.310  22.147  71.242  1.00 81.44           N  
ATOM   6051  CZ  ARG B 544      16.899  22.700  70.102  1.00 83.82           C  
ATOM   6052  NH1 ARG B 544      16.338  23.902  70.095  1.00 91.07           N  
ATOM   6053  NH2 ARG B 544      17.064  22.061  68.958  1.00 82.60           N  
ATOM   6054  N   GLY B 545      17.212  18.609  75.956  1.00 87.91           N  
ATOM   6055  CA  GLY B 545      17.640  17.777  77.075  1.00 88.59           C  
ATOM   6056  C   GLY B 545      18.557  18.502  78.040  1.00 90.38           C  
ATOM   6057  O   GLY B 545      19.406  17.884  78.686  1.00 92.05           O  
ATOM   6058  N   TYR B 546      18.385  19.818  78.128  1.00 88.61           N  
ATOM   6059  CA  TYR B 546      19.162  20.665  79.029  1.00 85.28           C  
ATOM   6060  C   TYR B 546      18.416  21.972  79.267  1.00 84.35           C  
ATOM   6061  O   TYR B 546      17.425  22.270  78.594  1.00 86.08           O  
ATOM   6062  CB  TYR B 546      20.551  20.960  78.452  1.00 80.22           C  
ATOM   6063  CG  TYR B 546      20.505  21.537  77.058  1.00 80.73           C  
ATOM   6064  CD1 TYR B 546      20.741  20.734  75.942  1.00 81.82           C  
ATOM   6065  CD2 TYR B 546      20.222  22.883  76.848  1.00 80.69           C  
ATOM   6066  CE1 TYR B 546      20.697  21.256  74.652  1.00 80.23           C  
ATOM   6067  CE2 TYR B 546      20.168  23.411  75.560  1.00 80.31           C  
ATOM   6068  CZ  TYR B 546      20.400  22.592  74.476  1.00 79.65           C  
ATOM   6069  OH  TYR B 546      20.345  23.125  73.220  1.00 80.99           O  
ATOM   6070  N   PHE B 547      18.905  22.740  80.233  1.00 81.77           N  
ATOM   6071  CA  PHE B 547      18.399  24.067  80.539  1.00 80.74           C  
ATOM   6072  C   PHE B 547      19.608  24.866  81.031  1.00 79.01           C  
ATOM   6073  O   PHE B 547      20.614  24.278  81.442  1.00 74.52           O  
ATOM   6074  CB  PHE B 547      17.311  23.980  81.610  1.00 81.31           C  
ATOM   6075  CG  PHE B 547      17.784  23.364  82.892  1.00 82.34           C  
ATOM   6076  CD1 PHE B 547      17.881  21.990  83.021  1.00 80.77           C  
ATOM   6077  CD2 PHE B 547      18.169  24.170  83.964  1.00 85.50           C  
ATOM   6078  CE1 PHE B 547      18.339  21.420  84.200  1.00 86.91           C  
ATOM   6079  CE2 PHE B 547      18.634  23.616  85.147  1.00 84.75           C  
ATOM   6080  CZ  PHE B 547      18.717  22.234  85.268  1.00 86.00           C  
ATOM   6081  N   SER B 548      19.533  26.191  80.997  1.00 78.46           N  
ATOM   6082  CA  SER B 548      20.676  26.971  81.447  1.00 84.28           C  
ATOM   6083  C   SER B 548      20.620  27.276  82.959  1.00 86.64           C  
ATOM   6084  O   SER B 548      19.543  27.277  83.565  1.00 84.50           O  
ATOM   6085  CB  SER B 548      20.835  28.233  80.607  1.00 84.86           C  
ATOM   6086  OG  SER B 548      19.694  29.044  80.753  1.00 91.26           O  
ATOM   6087  N   GLY B 549      21.795  27.488  83.558  1.00 86.77           N  
ATOM   6088  CA  GLY B 549      21.906  27.843  84.975  1.00 87.58           C  
ATOM   6089  C   GLY B 549      21.786  26.698  85.972  1.00 89.10           C  
ATOM   6090  O   GLY B 549      21.875  25.522  85.602  1.00 88.46           O  
ATOM   6091  N   HIS B 550      21.590  27.067  87.242  1.00 86.99           N  
ATOM   6092  CA  HIS B 550      21.390  26.136  88.349  1.00 82.83           C  
ATOM   6093  C   HIS B 550      19.936  26.197  88.822  1.00 85.07           C  
ATOM   6094  O   HIS B 550      19.349  27.278  88.867  1.00 86.98           O  
ATOM   6095  CB  HIS B 550      22.285  26.524  89.518  1.00 81.82           C  
ATOM   6096  CG  HIS B 550      23.736  26.617  89.173  1.00 87.22           C  
ATOM   6097  ND1 HIS B 550      24.494  25.517  88.828  1.00 90.99           N  
ATOM   6098  CD2 HIS B 550      24.578  27.677  89.144  1.00 88.03           C  
ATOM   6099  CE1 HIS B 550      25.738  25.897  88.593  1.00 90.04           C  
ATOM   6100  NE2 HIS B 550      25.816  27.204  88.779  1.00 88.18           N  
ATOM   6101  N   ILE B 551      19.364  25.050  89.196  1.00 83.74           N  
ATOM   6102  CA  ILE B 551      17.983  24.996  89.697  1.00 85.06           C  
ATOM   6103  C   ILE B 551      17.836  25.653  91.076  1.00 85.97           C  
ATOM   6104  O   ILE B 551      18.482  25.232  92.045  1.00 85.36           O  
ATOM   6105  CB  ILE B 551      17.449  23.542  89.778  1.00 84.88           C  
ATOM   6106  CG1 ILE B 551      17.415  22.905  88.387  1.00 84.64           C  
ATOM   6107  CG2 ILE B 551      16.056  23.513  90.432  1.00 81.24           C  
ATOM   6108  CD1 ILE B 551      17.181  21.404  88.388  1.00 84.71           C  
ATOM   6109  N   LEU B 552      16.989  26.679  91.165  1.00 83.92           N  
ATOM   6110  CA  LEU B 552      16.749  27.324  92.452  1.00 81.55           C  
ATOM   6111  C   LEU B 552      15.413  26.925  93.056  1.00 86.09           C  
ATOM   6112  O   LEU B 552      15.257  26.967  94.275  1.00 89.47           O  
ATOM   6113  CB  LEU B 552      16.848  28.839  92.364  1.00 77.61           C  
ATOM   6114  CG  LEU B 552      18.016  29.527  91.673  1.00 82.39           C  
ATOM   6115  CD1 LEU B 552      17.978  31.020  92.002  1.00 87.03           C  
ATOM   6116  CD2 LEU B 552      19.356  28.936  92.051  1.00 82.02           C  
ATOM   6117  N   GLY B 553      14.456  26.534  92.213  1.00 86.96           N  
ATOM   6118  CA  GLY B 553      13.158  26.058  92.700  1.00 84.87           C  
ATOM   6119  C   GLY B 553      12.288  25.388  91.657  1.00 85.21           C  
ATOM   6120  O   GLY B 553      12.670  25.270  90.492  1.00 87.97           O  
ATOM   6121  N   PHE B 554      11.101  24.969  92.081  1.00 84.39           N  
ATOM   6122  CA  PHE B 554      10.167  24.265  91.218  1.00 84.15           C  
ATOM   6123  C   PHE B 554       8.828  24.980  91.173  1.00 88.37           C  
ATOM   6124  O   PHE B 554       8.491  25.732  92.086  1.00 92.43           O  
ATOM   6125  CB  PHE B 554       9.974  22.843  91.730  1.00 85.48           C  
ATOM   6126  CG  PHE B 554      11.254  22.055  91.838  1.00 87.50           C  
ATOM   6127  CD1 PHE B 554      11.837  21.826  93.072  1.00 86.91           C  
ATOM   6128  CD2 PHE B 554      11.873  21.541  90.698  1.00 88.16           C  
ATOM   6129  CE1 PHE B 554      13.015  21.098  93.176  1.00 85.88           C  
ATOM   6130  CE2 PHE B 554      13.043  20.818  90.790  1.00 85.96           C  
ATOM   6131  CZ  PHE B 554      13.616  20.596  92.036  1.00 86.83           C  
ATOM   6132  N   GLY B 555       8.062  24.751  90.111  1.00 90.87           N  
ATOM   6133  CA  GLY B 555       6.762  25.399  89.959  1.00 92.75           C  
ATOM   6134  C   GLY B 555       5.663  24.401  89.673  1.00 96.17           C  
ATOM   6135  O   GLY B 555       5.948  23.252  89.359  1.00101.05           O  
ATOM   6136  N   GLU B 556       4.409  24.837  89.783  1.00 95.16           N  
ATOM   6137  CA  GLU B 556       3.271  24.001  89.418  1.00 96.23           C  
ATOM   6138  C   GLU B 556       2.060  24.793  88.883  1.00 97.22           C  
ATOM   6139  O   GLU B 556       1.642  25.798  89.461  1.00 97.51           O  
ATOM   6140  CB  GLU B 556       2.876  23.112  90.590  1.00 95.90           C  
ATOM   6141  CG  GLU B 556       1.749  22.136  90.291  1.00101.15           C  
ATOM   6142  CD  GLU B 556       1.196  21.467  91.549  1.00103.47           C  
ATOM   6143  OE1 GLU B 556       0.008  21.063  91.535  1.00107.07           O  
ATOM   6144  OE2 GLU B 556       1.942  21.351  92.550  1.00105.04           O  
ATOM   6145  N   ASP B 557       1.531  24.314  87.759  1.00 99.07           N  
ATOM   6146  CA  ASP B 557       0.304  24.787  87.120  1.00 98.38           C  
ATOM   6147  C   ASP B 557      -0.956  24.488  87.917  1.00102.35           C  
ATOM   6148  O   ASP B 557      -1.000  23.545  88.732  1.00103.05           O  
ATOM   6149  CB  ASP B 557       0.124  24.056  85.783  1.00 98.44           C  
ATOM   6150  CG  ASP B 557       0.872  24.701  84.673  1.00103.57           C  
ATOM   6151  OD1 ASP B 557       1.468  25.763  84.931  1.00111.06           O  
ATOM   6152  OD2 ASP B 557       0.863  24.169  83.544  1.00103.09           O  
ATOM   6153  N   GLU B 558      -2.005  25.256  87.628  1.00 97.79           N  
ATOM   6154  CA  GLU B 558      -3.348  24.865  88.017  1.00 92.51           C  
ATOM   6155  C   GLU B 558      -3.763  23.546  87.357  1.00 87.05           C  
ATOM   6156  O   GLU B 558      -4.683  22.886  87.812  1.00 90.98           O  
ATOM   6157  CB  GLU B 558      -4.338  25.964  87.665  1.00 95.71           C  
ATOM   6158  CG  GLU B 558      -5.590  25.937  88.515  1.00 98.58           C  
ATOM   6159  CD  GLU B 558      -6.336  27.248  88.499  1.00101.89           C  
ATOM   6160  OE1 GLU B 558      -7.430  27.294  89.107  1.00105.81           O  
ATOM   6161  OE2 GLU B 558      -5.836  28.224  87.889  1.00 98.78           O  
ATOM   6162  N   LEU B 559      -3.082  23.172  86.283  1.00 85.85           N  
ATOM   6163  CA  LEU B 559      -3.315  21.903  85.617  1.00 86.10           C  
ATOM   6164  C   LEU B 559      -2.339  20.861  86.140  1.00 88.91           C  
ATOM   6165  O   LEU B 559      -2.438  19.677  85.814  1.00 88.86           O  
ATOM   6166  CB  LEU B 559      -3.183  22.052  84.104  1.00 89.33           C  
ATOM   6167  CG  LEU B 559      -3.962  23.194  83.438  1.00 93.87           C  
ATOM   6168  CD1 LEU B 559      -3.692  23.200  81.939  1.00 97.82           C  
ATOM   6169  CD2 LEU B 559      -5.471  23.118  83.717  1.00 92.73           C  
ATOM   6170  N   GLY B 560      -1.396  21.305  86.962  1.00 91.05           N  
ATOM   6171  CA  GLY B 560      -0.532  20.380  87.683  1.00 89.76           C  
ATOM   6172  C   GLY B 560       0.736  20.023  86.945  1.00 88.11           C  
ATOM   6173  O   GLY B 560       1.467  19.129  87.371  1.00 89.84           O  
ATOM   6174  N   GLU B 561       1.001  20.715  85.841  1.00 85.70           N  
ATOM   6175  CA  GLU B 561       2.246  20.517  85.123  1.00 86.12           C  
ATOM   6176  C   GLU B 561       3.361  21.146  85.948  1.00 90.42           C  
ATOM   6177  O   GLU B 561       3.098  21.980  86.811  1.00 91.27           O  
ATOM   6178  CB  GLU B 561       2.179  21.098  83.711  1.00 83.23           C  
ATOM   6179  CG  GLU B 561       1.078  20.522  82.832  1.00 83.17           C  
ATOM   6180  CD  GLU B 561       1.002  18.992  82.865  1.00 90.05           C  
ATOM   6181  OE1 GLU B 561       2.051  18.334  83.038  1.00 93.08           O  
ATOM   6182  OE2 GLU B 561      -0.114  18.443  82.699  1.00 91.31           O  
ATOM   6183  N   VAL B 562       4.603  20.733  85.719  1.00 91.91           N  
ATOM   6184  CA  VAL B 562       5.660  21.143  86.630  1.00 89.81           C  
ATOM   6185  C   VAL B 562       6.728  22.017  85.964  1.00 90.34           C  
ATOM   6186  O   VAL B 562       6.854  22.050  84.735  1.00 92.82           O  
ATOM   6187  CB  VAL B 562       6.238  19.928  87.370  1.00 90.86           C  
ATOM   6188  CG1 VAL B 562       7.184  20.375  88.447  1.00 97.57           C  
ATOM   6189  CG2 VAL B 562       5.122  19.161  88.029  1.00 89.01           C  
ATOM   6190  N   TYR B 563       7.464  22.769  86.776  1.00 88.00           N  
ATOM   6191  CA  TYR B 563       8.477  23.676  86.252  1.00 88.87           C  
ATOM   6192  C   TYR B 563       9.772  23.579  87.029  1.00 89.38           C  
ATOM   6193  O   TYR B 563       9.777  23.127  88.175  1.00 89.70           O  
ATOM   6194  CB  TYR B 563       7.976  25.120  86.316  1.00 86.25           C  
ATOM   6195  CG  TYR B 563       6.745  25.389  85.482  1.00 86.06           C  
ATOM   6196  CD1 TYR B 563       6.858  25.881  84.183  1.00 84.70           C  
ATOM   6197  CD2 TYR B 563       5.463  25.150  85.993  1.00 85.48           C  
ATOM   6198  CE1 TYR B 563       5.734  26.134  83.407  1.00 83.38           C  
ATOM   6199  CE2 TYR B 563       4.342  25.386  85.228  1.00 86.02           C  
ATOM   6200  CZ  TYR B 563       4.481  25.886  83.935  1.00 84.97           C  
ATOM   6201  OH  TYR B 563       3.369  26.127  83.168  1.00 83.03           O  
ATOM   6202  N   ILE B 564      10.871  23.990  86.406  1.00 87.65           N  
ATOM   6203  CA  ILE B 564      12.052  24.332  87.180  1.00 93.15           C  
ATOM   6204  C   ILE B 564      12.297  25.815  87.003  1.00 94.94           C  
ATOM   6205  O   ILE B 564      11.951  26.393  85.964  1.00 98.14           O  
ATOM   6206  CB  ILE B 564      13.326  23.505  86.818  1.00 93.44           C  
ATOM   6207  CG1 ILE B 564      13.694  23.667  85.351  1.00 96.47           C  
ATOM   6208  CG2 ILE B 564      13.148  22.025  87.173  1.00 94.34           C  
ATOM   6209  CD1 ILE B 564      14.841  22.778  84.914  1.00 98.64           C  
ATOM   6210  N   LEU B 565      12.861  26.435  88.035  1.00 93.43           N  
ATOM   6211  CA  LEU B 565      13.311  27.819  87.949  1.00 91.21           C  
ATOM   6212  C   LEU B 565      14.822  27.852  88.159  1.00 90.33           C  
ATOM   6213  O   LEU B 565      15.348  27.222  89.090  1.00 91.27           O  
ATOM   6214  CB  LEU B 565      12.554  28.712  88.941  1.00 89.92           C  
ATOM   6215  CG  LEU B 565      11.050  28.765  88.616  1.00 91.11           C  
ATOM   6216  CD1 LEU B 565      10.235  27.784  89.451  1.00 90.79           C  
ATOM   6217  CD2 LEU B 565      10.491  30.135  88.787  1.00 90.83           C  
ATOM   6218  N   SER B 566      15.517  28.554  87.268  1.00 85.27           N  
ATOM   6219  CA  SER B 566      16.969  28.589  87.308  1.00 86.13           C  
ATOM   6220  C   SER B 566      17.572  29.987  87.160  1.00 89.48           C  
ATOM   6221  O   SER B 566      16.971  30.890  86.565  1.00 91.68           O  
ATOM   6222  CB  SER B 566      17.546  27.682  86.227  1.00 84.78           C  
ATOM   6223  OG  SER B 566      17.428  28.288  84.957  1.00 81.76           O  
ATOM   6224  N   SER B 567      18.774  30.135  87.710  1.00 89.38           N  
ATOM   6225  CA  SER B 567      19.594  31.320  87.543  1.00 88.95           C  
ATOM   6226  C   SER B 567      21.058  30.917  87.648  1.00 92.89           C  
ATOM   6227  O   SER B 567      21.381  29.800  88.053  1.00 96.44           O  
ATOM   6228  CB  SER B 567      19.254  32.365  88.607  1.00 89.22           C  
ATOM   6229  OG  SER B 567      19.729  33.652  88.236  1.00 89.07           O  
ATOM   6230  N   SER B 568      21.941  31.823  87.259  1.00 96.38           N  
ATOM   6231  CA  SER B 568      23.361  31.662  87.501  1.00101.12           C  
ATOM   6232  C   SER B 568      23.900  33.002  88.004  1.00103.43           C  
ATOM   6233  O   SER B 568      23.122  33.886  88.355  1.00103.30           O  
ATOM   6234  CB  SER B 568      24.075  31.193  86.231  1.00103.41           C  
ATOM   6235  OG  SER B 568      23.882  32.108  85.171  1.00107.17           O  
ATOM   6236  N   LYS B 569      25.220  33.152  88.066  1.00106.95           N  
ATOM   6237  CA  LYS B 569      25.792  34.435  88.448  1.00107.26           C  
ATOM   6238  C   LYS B 569      25.706  35.384  87.256  1.00109.38           C  
ATOM   6239  O   LYS B 569      25.346  36.553  87.422  1.00109.88           O  
ATOM   6240  CB  LYS B 569      27.213  34.284  88.996  1.00106.44           C  
ATOM   6241  CG  LYS B 569      27.295  33.301  90.162  1.00107.11           C  
ATOM   6242  CD  LYS B 569      28.058  33.864  91.347  1.00108.54           C  
ATOM   6243  CE  LYS B 569      27.728  33.086  92.616  1.00110.87           C  
ATOM   6244  NZ  LYS B 569      27.836  33.915  93.858  1.00112.50           N  
ATOM   6245  N   SER B 570      25.993  34.865  86.058  1.00109.94           N  
ATOM   6246  CA  SER B 570      25.726  35.585  84.809  1.00112.20           C  
ATOM   6247  C   SER B 570      24.261  35.975  84.706  1.00113.74           C  
ATOM   6248  O   SER B 570      23.935  37.037  84.189  1.00115.82           O  
ATOM   6249  CB  SER B 570      26.077  34.732  83.590  1.00114.93           C  
ATOM   6250  OG  SER B 570      27.470  34.720  83.332  1.00122.03           O  
ATOM   6251  N   MET B 571      23.382  35.105  85.200  1.00114.29           N  
ATOM   6252  CA  MET B 571      21.937  35.288  85.065  1.00113.79           C  
ATOM   6253  C   MET B 571      21.319  36.214  86.118  1.00114.84           C  
ATOM   6254  O   MET B 571      20.345  36.913  85.833  1.00116.19           O  
ATOM   6255  CB  MET B 571      21.232  33.931  85.076  1.00112.67           C  
ATOM   6256  CG  MET B 571      20.834  33.422  83.703  1.00113.29           C  
ATOM   6257  SD  MET B 571      20.451  31.650  83.686  1.00113.34           S  
ATOM   6258  CE  MET B 571      22.008  31.026  83.062  1.00117.16           C  
ATOM   6259  N   THR B 572      21.870  36.206  87.333  1.00114.14           N  
ATOM   6260  CA  THR B 572      21.363  37.051  88.420  1.00111.87           C  
ATOM   6261  C   THR B 572      21.676  38.507  88.113  1.00112.16           C  
ATOM   6262  O   THR B 572      20.799  39.367  88.151  1.00114.55           O  
ATOM   6263  CB  THR B 572      21.959  36.646  89.797  1.00108.28           C  
ATOM   6264  OG1 THR B 572      21.525  35.323  90.134  1.00107.77           O  
ATOM   6265  CG2 THR B 572      21.520  37.603  90.900  1.00104.85           C  
ATOM   6266  N   GLN B 573      22.935  38.753  87.775  1.00112.61           N  
ATOM   6267  CA  GLN B 573      23.433  40.080  87.464  1.00112.06           C  
ATOM   6268  C   GLN B 573      22.728  40.695  86.253  1.00108.55           C  
ATOM   6269  O   GLN B 573      22.521  41.900  86.203  1.00108.64           O  
ATOM   6270  CB  GLN B 573      24.936  39.994  87.208  1.00115.19           C  
ATOM   6271  CG  GLN B 573      25.683  41.284  87.433  1.00117.92           C  
ATOM   6272  CD  GLN B 573      26.662  41.579  86.317  1.00119.35           C  
ATOM   6273  OE1 GLN B 573      27.053  40.690  85.551  1.00118.20           O  
ATOM   6274  NE2 GLN B 573      27.055  42.843  86.207  1.00121.34           N  
ATOM   6275  N   THR B 574      22.358  39.856  85.291  1.00108.03           N  
ATOM   6276  CA  THR B 574      21.696  40.295  84.059  1.00107.71           C  
ATOM   6277  C   THR B 574      20.183  40.494  84.220  1.00104.93           C  
ATOM   6278  O   THR B 574      19.549  41.122  83.373  1.00105.75           O  
ATOM   6279  CB  THR B 574      21.978  39.293  82.898  1.00109.54           C  
ATOM   6280  OG1 THR B 574      23.384  39.261  82.642  1.00115.53           O  
ATOM   6281  CG2 THR B 574      21.273  39.696  81.607  1.00110.94           C  
ATOM   6282  N   HIS B 575      19.617  39.992  85.317  1.00102.93           N  
ATOM   6283  CA  HIS B 575      18.168  39.835  85.437  1.00102.84           C  
ATOM   6284  C   HIS B 575      17.717  38.981  84.276  1.00101.06           C  
ATOM   6285  O   HIS B 575      17.035  39.457  83.379  1.00104.02           O  
ATOM   6286  CB  HIS B 575      17.428  41.175  85.397  1.00106.56           C  
ATOM   6287  CG  HIS B 575      17.684  42.043  86.584  1.00111.34           C  
ATOM   6288  ND1 HIS B 575      18.774  42.883  86.671  1.00114.56           N  
ATOM   6289  CD2 HIS B 575      16.984  42.213  87.729  1.00112.39           C  
ATOM   6290  CE1 HIS B 575      18.738  43.528  87.823  1.00115.69           C  
ATOM   6291  NE2 HIS B 575      17.663  43.136  88.485  1.00115.67           N  
ATOM   6292  N   ASN B 576      18.138  37.726  84.278  1.00100.98           N  
ATOM   6293  CA  ASN B 576      17.788  36.805  83.209  1.00101.13           C  
ATOM   6294  C   ASN B 576      17.538  35.402  83.735  1.00 98.24           C  
ATOM   6295  O   ASN B 576      18.026  34.425  83.179  1.00 98.52           O  
ATOM   6296  CB  ASN B 576      18.876  36.790  82.139  1.00103.91           C  
ATOM   6297  CG  ASN B 576      18.346  36.407  80.773  1.00107.04           C  
ATOM   6298  OD1 ASN B 576      17.180  36.045  80.617  1.00109.86           O  
ATOM   6299  ND2 ASN B 576      19.205  36.497  79.769  1.00109.34           N  
ATOM   6300  N   GLY B 577      16.782  35.320  84.824  1.00 95.32           N  
ATOM   6301  CA  GLY B 577      16.372  34.046  85.387  1.00 92.71           C  
ATOM   6302  C   GLY B 577      15.319  33.480  84.473  1.00 89.17           C  
ATOM   6303  O   GLY B 577      14.621  34.231  83.799  1.00 87.19           O  
ATOM   6304  N   LYS B 578      15.214  32.157  84.438  1.00 86.36           N  
ATOM   6305  CA  LYS B 578      14.364  31.501  83.465  1.00 83.64           C  
ATOM   6306  C   LYS B 578      13.363  30.620  84.172  1.00 86.22           C  
ATOM   6307  O   LYS B 578      13.662  30.060  85.233  1.00 87.49           O  
ATOM   6308  CB  LYS B 578      15.188  30.632  82.511  1.00 84.81           C  
ATOM   6309  CG  LYS B 578      16.626  31.081  82.253  1.00 87.86           C  
ATOM   6310  CD  LYS B 578      16.711  32.156  81.195  1.00 89.07           C  
ATOM   6311  CE  LYS B 578      16.581  31.581  79.809  1.00 91.67           C  
ATOM   6312  NZ  LYS B 578      17.903  31.235  79.244  1.00 96.03           N  
ATOM   6313  N   LEU B 579      12.169  30.519  83.586  1.00 87.55           N  
ATOM   6314  CA  LEU B 579      11.202  29.491  83.950  1.00 88.12           C  
ATOM   6315  C   LEU B 579      11.190  28.431  82.864  1.00 89.62           C  
ATOM   6316  O   LEU B 579      11.062  28.746  81.673  1.00 89.87           O  
ATOM   6317  CB  LEU B 579       9.801  30.074  84.096  1.00 87.64           C  
ATOM   6318  CG  LEU B 579       8.701  29.045  84.371  1.00 85.26           C  
ATOM   6319  CD1 LEU B 579       8.847  28.502  85.769  1.00 87.53           C  
ATOM   6320  CD2 LEU B 579       7.342  29.670  84.209  1.00 84.46           C  
ATOM   6321  N   TYR B 580      11.324  27.177  83.276  1.00 90.74           N  
ATOM   6322  CA  TYR B 580      11.348  26.056  82.338  1.00 92.00           C  
ATOM   6323  C   TYR B 580      10.253  25.037  82.645  1.00 91.14           C  
ATOM   6324  O   TYR B 580      10.073  24.651  83.807  1.00 95.96           O  
ATOM   6325  CB  TYR B 580      12.693  25.345  82.417  1.00 88.62           C  
ATOM   6326  CG  TYR B 580      13.861  26.041  81.764  1.00 87.10           C  
ATOM   6327  CD1 TYR B 580      14.824  26.692  82.534  1.00 89.07           C  
ATOM   6328  CD2 TYR B 580      14.042  25.993  80.380  1.00 85.18           C  
ATOM   6329  CE1 TYR B 580      15.936  27.302  81.940  1.00 90.14           C  
ATOM   6330  CE2 TYR B 580      15.141  26.598  79.777  1.00 87.63           C  
ATOM   6331  CZ  TYR B 580      16.088  27.252  80.561  1.00 89.06           C  
ATOM   6332  OH  TYR B 580      17.168  27.864  79.966  1.00 86.43           O  
ATOM   6333  N   LYS B 581       9.539  24.588  81.617  1.00 86.10           N  
ATOM   6334  CA  LYS B 581       8.539  23.531  81.801  1.00 88.74           C  
ATOM   6335  C   LYS B 581       9.085  22.145  81.445  1.00 88.49           C  
ATOM   6336  O   LYS B 581       9.793  21.992  80.443  1.00 87.65           O  
ATOM   6337  CB  LYS B 581       7.274  23.816  80.990  1.00 88.47           C  
ATOM   6338  CG  LYS B 581       6.212  22.731  81.133  1.00 88.97           C  
ATOM   6339  CD  LYS B 581       4.980  23.004  80.295  1.00 91.68           C  
ATOM   6340  CE  LYS B 581       3.969  23.800  81.072  1.00 95.67           C  
ATOM   6341  NZ  LYS B 581       2.599  23.612  80.532  1.00101.64           N  
ATOM   6342  N   ILE B 582       8.756  21.153  82.275  1.00 84.61           N  
ATOM   6343  CA  ILE B 582       9.055  19.752  81.987  1.00 88.30           C  
ATOM   6344  C   ILE B 582       7.976  19.149  81.074  1.00 90.47           C  
ATOM   6345  O   ILE B 582       6.787  19.176  81.384  1.00 91.87           O  
ATOM   6346  CB  ILE B 582       9.217  18.908  83.282  1.00 89.40           C  
ATOM   6347  CG1 ILE B 582      10.507  19.299  84.014  1.00 91.41           C  
ATOM   6348  CG2 ILE B 582       9.208  17.406  82.971  1.00 87.05           C  
ATOM   6349  CD1 ILE B 582      10.779  18.519  85.303  1.00 89.93           C  
ATOM   6350  N   VAL B 583       8.410  18.607  79.944  1.00 90.53           N  
ATOM   6351  CA  VAL B 583       7.506  18.036  78.960  1.00 91.56           C  
ATOM   6352  C   VAL B 583       7.743  16.524  78.863  1.00 91.47           C  
ATOM   6353  O   VAL B 583       8.844  16.050  79.134  1.00 93.29           O  
ATOM   6354  CB  VAL B 583       7.720  18.721  77.584  1.00 92.06           C  
ATOM   6355  CG1 VAL B 583       7.092  17.925  76.457  1.00 95.62           C  
ATOM   6356  CG2 VAL B 583       7.160  20.114  77.601  1.00 88.80           C  
ATOM   6357  N   ASP B 584       6.706  15.770  78.509  1.00 89.75           N  
ATOM   6358  CA  ASP B 584       6.860  14.356  78.183  1.00 88.29           C  
ATOM   6359  C   ASP B 584       6.688  14.230  76.672  1.00 84.69           C  
ATOM   6360  O   ASP B 584       5.581  14.392  76.161  1.00 84.62           O  
ATOM   6361  CB  ASP B 584       5.842  13.491  78.942  1.00 90.62           C  
ATOM   6362  CG  ASP B 584       5.989  11.991  78.650  1.00 93.83           C  
ATOM   6363  OD1 ASP B 584       5.255  11.192  79.279  1.00 95.32           O  
ATOM   6364  OD2 ASP B 584       6.824  11.599  77.801  1.00 93.73           O  
ATOM   6365  N   PRO B 585       7.795  13.976  75.949  1.00 81.91           N  
ATOM   6366  CA  PRO B 585       7.746  13.934  74.486  1.00 79.77           C  
ATOM   6367  C   PRO B 585       7.023  12.719  73.915  1.00 79.44           C  
ATOM   6368  O   PRO B 585       6.759  12.674  72.715  1.00 78.92           O  
ATOM   6369  CB  PRO B 585       9.223  13.946  74.076  1.00 76.95           C  
ATOM   6370  CG  PRO B 585       9.956  13.443  75.241  1.00 78.59           C  
ATOM   6371  CD  PRO B 585       9.157  13.754  76.469  1.00 80.32           C  
ATOM   6372  N   LYS B 586       6.705  11.749  74.768  1.00 81.67           N  
ATOM   6373  CA  LYS B 586       5.946  10.570  74.355  1.00 80.34           C  
ATOM   6374  C   LYS B 586       4.449  10.851  74.294  1.00 78.81           C  
ATOM   6375  O   LYS B 586       3.723  10.138  73.606  1.00 79.98           O  
ATOM   6376  CB  LYS B 586       6.232   9.389  75.279  1.00 82.47           C  
ATOM   6377  CG  LYS B 586       7.484   8.615  74.911  1.00 87.74           C  
ATOM   6378  CD  LYS B 586       8.133   7.967  76.139  1.00 92.37           C  
ATOM   6379  CE  LYS B 586       7.529   6.611  76.482  1.00 93.57           C  
ATOM   6380  NZ  LYS B 586       7.894   5.589  75.467  1.00 94.46           N  
ATOM   6381  N   ARG B 587       3.996  11.882  75.010  1.00 77.70           N  
ATOM   6382  CA  ARG B 587       2.585  12.302  74.987  1.00 77.72           C  
ATOM   6383  C   ARG B 587       2.373  13.604  74.227  1.00 77.37           C  
ATOM   6384  O   ARG B 587       3.264  14.446  74.192  1.00 77.28           O  
ATOM   6385  CB  ARG B 587       2.023  12.457  76.401  1.00 77.25           C  
ATOM   6386  CG  ARG B 587       1.815  11.146  77.132  1.00 81.05           C  
ATOM   6387  CD  ARG B 587       0.662  11.248  78.099  1.00 81.71           C  
ATOM   6388  NE  ARG B 587      -0.613  10.915  77.474  1.00 83.06           N  
ATOM   6389  CZ  ARG B 587      -1.791  11.403  77.851  1.00 84.73           C  
ATOM   6390  NH1 ARG B 587      -1.875  12.280  78.844  1.00 84.88           N  
ATOM   6391  NH2 ARG B 587      -2.894  11.017  77.222  1.00 87.23           N  
ATOM   6392  N   PRO B 588       1.182  13.779  73.622  1.00 79.44           N  
ATOM   6393  CA  PRO B 588       0.858  15.020  72.926  1.00 81.00           C  
ATOM   6394  C   PRO B 588       1.005  16.216  73.844  1.00 82.46           C  
ATOM   6395  O   PRO B 588       0.857  16.069  75.057  1.00 84.86           O  
ATOM   6396  CB  PRO B 588      -0.616  14.833  72.564  1.00 80.38           C  
ATOM   6397  CG  PRO B 588      -0.788  13.381  72.460  1.00 77.20           C  
ATOM   6398  CD  PRO B 588       0.068  12.819  73.545  1.00 78.16           C  
ATOM   6399  N   LEU B 589       1.296  17.386  73.285  1.00 82.42           N  
ATOM   6400  CA  LEU B 589       1.354  18.598  74.100  1.00 85.25           C  
ATOM   6401  C   LEU B 589       0.023  18.913  74.775  1.00 88.76           C  
ATOM   6402  O   LEU B 589      -0.008  19.334  75.927  1.00 93.09           O  
ATOM   6403  CB  LEU B 589       1.832  19.792  73.287  1.00 85.51           C  
ATOM   6404  CG  LEU B 589       3.318  20.085  73.438  1.00 86.64           C  
ATOM   6405  CD1 LEU B 589       3.669  21.313  72.621  1.00 88.05           C  
ATOM   6406  CD2 LEU B 589       3.681  20.277  74.917  1.00 85.37           C  
ATOM   6407  N   MET B 590      -1.072  18.698  74.054  1.00 88.50           N  
ATOM   6408  CA  MET B 590      -2.390  18.832  74.625  1.00 88.96           C  
ATOM   6409  C   MET B 590      -3.229  17.600  74.281  1.00 92.86           C  
ATOM   6410  O   MET B 590      -3.842  17.538  73.212  1.00 96.33           O  
ATOM   6411  CB  MET B 590      -3.045  20.110  74.114  1.00 92.22           C  
ATOM   6412  CG  MET B 590      -4.326  20.509  74.835  1.00 96.93           C  
ATOM   6413  SD  MET B 590      -4.158  20.753  76.620  1.00 99.55           S  
ATOM   6414  CE  MET B 590      -2.694  21.779  76.749  1.00100.55           C  
ATOM   6415  N   PRO B 591      -3.225  16.588  75.166  1.00 92.61           N  
ATOM   6416  CA  PRO B 591      -4.167  15.485  75.013  1.00 90.86           C  
ATOM   6417  C   PRO B 591      -5.589  15.974  75.256  1.00 90.49           C  
ATOM   6418  O   PRO B 591      -5.777  16.902  76.049  1.00 91.40           O  
ATOM   6419  CB  PRO B 591      -3.750  14.508  76.126  1.00 89.73           C  
ATOM   6420  CG  PRO B 591      -2.370  14.889  76.490  1.00 90.86           C  
ATOM   6421  CD  PRO B 591      -2.335  16.382  76.321  1.00 92.44           C  
ATOM   6422  N   GLU B 592      -6.568  15.359  74.587  1.00 89.31           N  
ATOM   6423  CA  GLU B 592      -7.990  15.675  74.778  1.00 90.19           C  
ATOM   6424  C   GLU B 592      -8.344  15.902  76.248  1.00 85.34           C  
ATOM   6425  O   GLU B 592      -8.922  16.929  76.592  1.00 79.18           O  
ATOM   6426  CB  GLU B 592      -8.877  14.555  74.227  1.00 94.63           C  
ATOM   6427  CG  GLU B 592      -8.853  14.372  72.708  1.00 99.11           C  
ATOM   6428  CD  GLU B 592      -9.933  13.400  72.213  1.00 99.60           C  
ATOM   6429  OE1 GLU B 592     -11.065  13.422  72.755  1.00101.57           O  
ATOM   6430  OE2 GLU B 592      -9.652  12.616  71.275  1.00102.61           O  
ATOM   6431  N   GLU B 593      -7.986  14.937  77.102  1.00 86.28           N  
ATOM   6432  CA  GLU B 593      -8.274  14.974  78.546  1.00 87.44           C  
ATOM   6433  C   GLU B 593      -7.759  16.229  79.225  1.00 90.80           C  
ATOM   6434  O   GLU B 593      -8.364  16.724  80.177  1.00 92.02           O  
ATOM   6435  CB  GLU B 593      -7.650  13.779  79.274  1.00 85.88           C  
ATOM   6436  CG  GLU B 593      -7.581  12.501  78.471  1.00 89.51           C  
ATOM   6437  CD  GLU B 593      -6.214  12.262  77.873  1.00 87.63           C  
ATOM   6438  OE1 GLU B 593      -5.230  12.257  78.641  1.00 86.07           O  
ATOM   6439  OE2 GLU B 593      -6.131  12.064  76.641  1.00 87.54           O  
ATOM   6440  N   CYS B 594      -6.625  16.728  78.748  1.00 92.60           N  
ATOM   6441  CA  CYS B 594      -5.959  17.832  79.408  1.00 94.92           C  
ATOM   6442  C   CYS B 594      -6.580  19.168  79.081  1.00 96.24           C  
ATOM   6443  O   CYS B 594      -6.322  20.143  79.784  1.00 96.94           O  
ATOM   6444  CB  CYS B 594      -4.475  17.829  79.075  1.00 96.82           C  
ATOM   6445  SG  CYS B 594      -3.672  16.298  79.568  1.00 99.26           S  
ATOM   6446  N   ARG B 595      -7.406  19.197  78.032  1.00 99.52           N  
ATOM   6447  CA  ARG B 595      -8.034  20.430  77.551  1.00102.08           C  
ATOM   6448  C   ARG B 595      -8.573  21.250  78.704  1.00101.17           C  
ATOM   6449  O   ARG B 595      -9.387  20.794  79.497  1.00 94.22           O  
ATOM   6450  CB  ARG B 595      -9.126  20.157  76.515  1.00106.57           C  
ATOM   6451  CG  ARG B 595      -8.607  19.844  75.107  1.00110.52           C  
ATOM   6452  CD  ARG B 595      -9.724  19.276  74.237  1.00113.10           C  
ATOM   6453  NE  ARG B 595      -9.238  18.612  73.028  1.00115.08           N  
ATOM   6454  CZ  ARG B 595      -9.996  17.876  72.213  1.00117.68           C  
ATOM   6455  NH1 ARG B 595     -11.292  17.694  72.467  1.00118.17           N  
ATOM   6456  NH2 ARG B 595      -9.457  17.315  71.137  1.00117.60           N  
ATOM   6457  N   ALA B 596      -8.052  22.466  78.780  1.00108.73           N  
ATOM   6458  CA  ALA B 596      -8.294  23.410  79.861  1.00108.11           C  
ATOM   6459  C   ALA B 596      -9.576  24.162  79.584  1.00 98.87           C  
ATOM   6460  O   ALA B 596     -10.133  24.050  78.496  1.00104.21           O  
ATOM   6461  CB  ALA B 596      -7.103  24.409  79.906  1.00112.09           C  
ATOM   6462  N   THR B 597     -10.041  24.941  80.546  1.00 88.07           N  
ATOM   6463  CA  THR B 597     -10.931  26.050  80.202  1.00 89.57           C  
ATOM   6464  C   THR B 597     -10.861  27.181  81.217  1.00 92.06           C  
ATOM   6465  O   THR B 597     -11.399  27.089  82.325  1.00 93.09           O  
ATOM   6466  CB  THR B 597     -12.386  25.614  79.882  1.00 91.66           C  
ATOM   6467  OG1 THR B 597     -13.137  26.763  79.478  1.00 87.51           O  
ATOM   6468  CG2 THR B 597     -13.068  24.907  81.083  1.00 94.68           C  
ATOM   6469  N   VAL B 598     -10.182  28.252  80.814  1.00 95.39           N  
ATOM   6470  CA  VAL B 598      -9.768  29.308  81.743  1.00 97.20           C  
ATOM   6471  C   VAL B 598     -10.915  30.231  82.145  1.00 96.11           C  
ATOM   6472  O   VAL B 598     -11.613  30.768  81.295  1.00 94.57           O  
ATOM   6473  CB  VAL B 598      -8.503  30.097  81.237  1.00 96.60           C  
ATOM   6474  CG1 VAL B 598      -8.357  30.009  79.721  1.00101.42           C  
ATOM   6475  CG2 VAL B 598      -8.517  31.548  81.707  1.00 95.21           C  
ATOM   6476  N   GLN B 599     -11.105  30.370  83.456  1.00 98.30           N  
ATOM   6477  CA  GLN B 599     -12.069  31.297  84.029  1.00101.04           C  
ATOM   6478  C   GLN B 599     -11.309  32.472  84.631  1.00 97.90           C  
ATOM   6479  O   GLN B 599     -10.708  32.338  85.705  1.00 95.67           O  
ATOM   6480  CB  GLN B 599     -12.908  30.605  85.099  1.00107.68           C  
ATOM   6481  CG  GLN B 599     -13.824  29.520  84.563  1.00113.09           C  
ATOM   6482  CD  GLN B 599     -13.847  28.302  85.456  1.00117.40           C  
ATOM   6483  OE1 GLN B 599     -13.863  28.411  86.688  1.00118.80           O  
ATOM   6484  NE2 GLN B 599     -13.837  27.126  84.840  1.00119.46           N  
ATOM   6485  N   PRO B 600     -11.343  33.634  83.944  1.00 94.45           N  
ATOM   6486  CA  PRO B 600     -10.485  34.772  84.266  1.00 89.79           C  
ATOM   6487  C   PRO B 600     -10.739  35.290  85.671  1.00 89.48           C  
ATOM   6488  O   PRO B 600     -11.883  35.301  86.126  1.00 88.52           O  
ATOM   6489  CB  PRO B 600     -10.894  35.820  83.228  1.00 86.03           C  
ATOM   6490  CG  PRO B 600     -11.491  35.042  82.124  1.00 86.79           C  
ATOM   6491  CD  PRO B 600     -12.231  33.944  82.811  1.00 90.13           C  
ATOM   6492  N   ALA B 601      -9.671  35.703  86.347  1.00 90.63           N  
ATOM   6493  CA  ALA B 601      -9.764  36.230  87.707  1.00 91.15           C  
ATOM   6494  C   ALA B 601     -10.778  37.366  87.809  1.00 91.73           C  
ATOM   6495  O   ALA B 601     -10.870  38.208  86.913  1.00 89.89           O  
ATOM   6496  CB  ALA B 601      -8.406  36.689  88.189  1.00 89.30           C  
ATOM   6497  N   GLN B 602     -11.532  37.369  88.908  1.00 94.37           N  
ATOM   6498  CA  GLN B 602     -12.634  38.308  89.118  1.00 93.28           C  
ATOM   6499  C   GLN B 602     -12.467  39.023  90.454  1.00 91.32           C  
ATOM   6500  O   GLN B 602     -11.961  38.440  91.414  1.00 92.70           O  
ATOM   6501  CB  GLN B 602     -13.956  37.548  89.099  1.00 95.02           C  
ATOM   6502  CG  GLN B 602     -14.974  38.104  88.127  1.00100.97           C  
ATOM   6503  CD  GLN B 602     -14.557  37.922  86.678  1.00103.71           C  
ATOM   6504  OE1 GLN B 602     -14.458  38.890  85.930  1.00106.94           O  
ATOM   6505  NE2 GLN B 602     -14.298  36.680  86.280  1.00104.07           N  
ATOM   6506  N   THR B 603     -12.890  40.281  90.523  1.00 89.90           N  
ATOM   6507  CA  THR B 603     -12.737  41.060  91.753  1.00 92.49           C  
ATOM   6508  C   THR B 603     -13.534  40.438  92.885  1.00 96.53           C  
ATOM   6509  O   THR B 603     -14.587  39.840  92.653  1.00 99.10           O  
ATOM   6510  CB  THR B 603     -13.178  42.532  91.592  1.00 91.41           C  
ATOM   6511  OG1 THR B 603     -14.512  42.593  91.067  1.00 94.00           O  
ATOM   6512  CG2 THR B 603     -12.229  43.283  90.677  1.00 90.70           C  
ATOM   6513  N   LEU B 604     -13.015  40.575  94.103  1.00 98.85           N  
ATOM   6514  CA  LEU B 604     -13.693  40.114  95.315  1.00 99.28           C  
ATOM   6515  C   LEU B 604     -15.123  40.641  95.420  1.00104.05           C  
ATOM   6516  O   LEU B 604     -15.365  41.834  95.222  1.00105.78           O  
ATOM   6517  CB  LEU B 604     -12.896  40.553  96.543  1.00 94.76           C  
ATOM   6518  CG  LEU B 604     -12.089  39.520  97.317  1.00 92.38           C  
ATOM   6519  CD1 LEU B 604     -11.458  38.486  96.411  1.00 95.43           C  
ATOM   6520  CD2 LEU B 604     -11.041  40.231  98.113  1.00 93.90           C  
ATOM   6521  N   THR B 605     -16.067  39.747  95.711  1.00107.74           N  
ATOM   6522  CA  THR B 605     -17.462  40.147  95.932  1.00109.57           C  
ATOM   6523  C   THR B 605     -18.068  39.505  97.184  1.00111.87           C  
ATOM   6524  O   THR B 605     -19.292  39.543  97.373  1.00113.47           O  
ATOM   6525  CB  THR B 605     -18.377  39.836  94.717  1.00108.44           C  
ATOM   6526  OG1 THR B 605     -18.505  38.420  94.565  1.00110.54           O  
ATOM   6527  CG2 THR B 605     -17.833  40.441  93.428  1.00108.76           C  
ATOM   6528  N   SER B 606     -17.220  38.918  98.030  1.00112.00           N  
ATOM   6529  CA  SER B 606     -17.681  38.306  99.274  1.00112.00           C  
ATOM   6530  C   SER B 606     -18.202  39.397 100.197  1.00112.84           C  
ATOM   6531  O   SER B 606     -17.566  40.442 100.329  1.00114.07           O  
ATOM   6532  CB  SER B 606     -16.555  37.535  99.955  1.00111.32           C  
ATOM   6533  OG  SER B 606     -15.585  38.416 100.486  1.00111.48           O  
ATOM   6534  N   GLU B 607     -19.357  39.152 100.821  1.00111.27           N  
ATOM   6535  CA  GLU B 607     -20.011  40.141 101.687  1.00107.92           C  
ATOM   6536  C   GLU B 607     -19.014  40.936 102.535  1.00104.24           C  
ATOM   6537  O   GLU B 607     -19.056  42.169 102.546  1.00102.11           O  
ATOM   6538  CB  GLU B 607     -21.064  39.476 102.581  1.00108.22           C  
ATOM   6539  CG  GLU B 607     -22.001  40.461 103.292  1.00109.70           C  
ATOM   6540  CD  GLU B 607     -22.972  39.779 104.249  1.00110.61           C  
ATOM   6541  OE1 GLU B 607     -22.515  38.991 105.106  1.00112.09           O  
ATOM   6542  OE2 GLU B 607     -24.192  40.039 104.151  1.00110.46           O  
ATOM   6543  N   CYS B 608     -18.113  40.228 103.220  1.00101.76           N  
ATOM   6544  CA  CYS B 608     -17.134  40.867 104.097  1.00100.67           C  
ATOM   6545  C   CYS B 608     -16.163  41.771 103.338  1.00 99.37           C  
ATOM   6546  O   CYS B 608     -15.775  42.824 103.841  1.00101.25           O  
ATOM   6547  CB  CYS B 608     -16.368  39.831 104.925  1.00101.80           C  
ATOM   6548  SG  CYS B 608     -15.178  40.534 106.130  1.00104.40           S  
ATOM   6549  N   SER B 609     -15.775  41.369 102.133  1.00 96.66           N  
ATOM   6550  CA  SER B 609     -14.886  42.190 101.320  1.00 97.54           C  
ATOM   6551  C   SER B 609     -15.485  43.565 101.110  1.00 96.01           C  
ATOM   6552  O   SER B 609     -14.813  44.571 101.309  1.00 93.63           O  
ATOM   6553  CB  SER B 609     -14.602  41.523  99.970  1.00103.01           C  
ATOM   6554  OG  SER B 609     -14.342  42.484  98.957  1.00107.28           O  
ATOM   6555  N   ARG B 610     -16.761  43.591 100.732  1.00100.40           N  
ATOM   6556  CA  ARG B 610     -17.449  44.828 100.343  1.00103.91           C  
ATOM   6557  C   ARG B 610     -17.876  45.727 101.494  1.00102.76           C  
ATOM   6558  O   ARG B 610     -17.921  46.940 101.329  1.00102.11           O  
ATOM   6559  CB  ARG B 610     -18.641  44.546  99.410  1.00105.63           C  
ATOM   6560  CG  ARG B 610     -19.136  43.099  99.402  1.00107.48           C  
ATOM   6561  CD  ARG B 610     -20.040  42.794  98.205  1.00106.70           C  
ATOM   6562  NE  ARG B 610     -21.342  43.450  98.323  1.00110.04           N  
ATOM   6563  CZ  ARG B 610     -22.385  42.965  98.997  1.00110.79           C  
ATOM   6564  NH1 ARG B 610     -22.303  41.801  99.633  1.00110.98           N  
ATOM   6565  NH2 ARG B 610     -23.520  43.652  99.035  1.00110.94           N  
ATOM   6566  N   LEU B 611     -18.163  45.140 102.654  1.00105.99           N  
ATOM   6567  CA  LEU B 611     -18.780  45.879 103.766  1.00108.27           C  
ATOM   6568  C   LEU B 611     -17.873  46.176 104.960  1.00109.66           C  
ATOM   6569  O   LEU B 611     -18.063  47.185 105.643  1.00111.16           O  
ATOM   6570  CB  LEU B 611     -20.044  45.158 104.245  1.00107.96           C  
ATOM   6571  CG  LEU B 611     -21.406  45.454 103.596  1.00108.06           C  
ATOM   6572  CD1 LEU B 611     -21.362  45.696 102.079  1.00106.16           C  
ATOM   6573  CD2 LEU B 611     -22.364  44.315 103.919  1.00109.15           C  
ATOM   6574  N   CYS B 612     -16.901  45.304 105.212  1.00109.95           N  
ATOM   6575  CA  CYS B 612     -16.055  45.419 106.398  1.00111.06           C  
ATOM   6576  C   CYS B 612     -14.886  46.372 106.207  1.00114.52           C  
ATOM   6577  O   CYS B 612     -13.835  45.989 105.687  1.00118.49           O  
ATOM   6578  CB  CYS B 612     -15.539  44.044 106.826  1.00110.74           C  
ATOM   6579  SG  CYS B 612     -14.335  44.074 108.173  1.00110.23           S  
ATOM   6580  N   ARG B 613     -15.077  47.618 106.626  1.00116.22           N  
ATOM   6581  CA  ARG B 613     -13.984  48.586 106.684  1.00118.97           C  
ATOM   6582  C   ARG B 613     -13.902  49.129 108.106  1.00118.60           C  
ATOM   6583  O   ARG B 613     -14.900  49.117 108.837  1.00121.63           O  
ATOM   6584  CB  ARG B 613     -14.178  49.723 105.672  1.00123.13           C  
ATOM   6585  CG  ARG B 613     -14.797  49.313 104.323  1.00127.90           C  
ATOM   6586  CD  ARG B 613     -13.837  48.571 103.392  1.00128.75           C  
ATOM   6587  NE  ARG B 613     -14.561  48.002 102.253  1.00131.79           N  
ATOM   6588  CZ  ARG B 613     -14.104  47.959 101.001  1.00134.69           C  
ATOM   6589  NH1 ARG B 613     -12.913  48.463 100.695  1.00136.28           N  
ATOM   6590  NH2 ARG B 613     -14.848  47.422 100.041  1.00134.62           N  
ATOM   6591  N   ASN B 614     -12.720  49.617 108.481  1.00114.58           N  
ATOM   6592  CA  ASN B 614     -12.372  49.939 109.875  1.00110.49           C  
ATOM   6593  C   ASN B 614     -12.022  48.679 110.649  1.00110.33           C  
ATOM   6594  O   ASN B 614     -12.182  48.601 111.869  1.00109.91           O  
ATOM   6595  CB  ASN B 614     -13.466  50.734 110.595  1.00106.11           C  
ATOM   6596  CG  ASN B 614     -13.609  52.135 110.066  1.00103.78           C  
ATOM   6597  OD1 ASN B 614     -14.678  52.726 110.157  1.00103.68           O  
ATOM   6598  ND2 ASN B 614     -12.533  52.679 109.510  1.00102.79           N  
ATOM   6599  N   GLY B 615     -11.531  47.692 109.911  1.00110.99           N  
ATOM   6600  CA  GLY B 615     -11.066  46.445 110.484  1.00109.31           C  
ATOM   6601  C   GLY B 615     -10.514  45.537 109.409  1.00107.60           C  
ATOM   6602  O   GLY B 615     -10.554  45.862 108.220  1.00107.07           O  
ATOM   6603  N   TYR B 616      -9.975  44.403 109.832  1.00107.11           N  
ATOM   6604  CA  TYR B 616      -9.567  43.375 108.892  1.00103.56           C  
ATOM   6605  C   TYR B 616     -10.676  42.341 108.793  1.00103.44           C  
ATOM   6606  O   TYR B 616     -11.671  42.402 109.519  1.00104.18           O  
ATOM   6607  CB  TYR B 616      -8.227  42.748 109.289  1.00100.36           C  
ATOM   6608  CG  TYR B 616      -8.252  41.912 110.549  1.00 98.38           C  
ATOM   6609  CD1 TYR B 616      -8.008  42.485 111.792  1.00 96.29           C  
ATOM   6610  CD2 TYR B 616      -8.491  40.540 110.490  1.00 98.36           C  
ATOM   6611  CE1 TYR B 616      -8.012  41.717 112.950  1.00 98.46           C  
ATOM   6612  CE2 TYR B 616      -8.497  39.763 111.638  1.00 99.90           C  
ATOM   6613  CZ  TYR B 616      -8.260  40.356 112.867  1.00 99.84           C  
ATOM   6614  OH  TYR B 616      -8.274  39.584 114.010  1.00100.51           O  
ATOM   6615  N   CYS B 617     -10.490  41.387 107.897  1.00104.34           N  
ATOM   6616  CA  CYS B 617     -11.548  40.485 107.519  1.00103.72           C  
ATOM   6617  C   CYS B 617     -10.931  39.092 107.375  1.00102.56           C  
ATOM   6618  O   CYS B 617     -10.018  38.902 106.571  1.00103.33           O  
ATOM   6619  CB  CYS B 617     -12.168  41.025 106.224  1.00105.80           C  
ATOM   6620  SG  CYS B 617     -13.363  40.008 105.386  1.00110.16           S  
ATOM   6621  N   THR B 618     -11.398  38.143 108.192  1.00 99.98           N  
ATOM   6622  CA  THR B 618     -10.805  36.793 108.272  1.00 99.41           C  
ATOM   6623  C   THR B 618     -11.173  35.927 107.069  1.00 97.98           C  
ATOM   6624  O   THR B 618     -12.128  36.238 106.363  1.00 98.12           O  
ATOM   6625  CB  THR B 618     -11.229  36.020 109.551  1.00100.74           C  
ATOM   6626  OG1 THR B 618     -12.606  35.630 109.453  1.00102.77           O  
ATOM   6627  CG2 THR B 618     -10.997  36.842 110.813  1.00100.51           C  
ATOM   6628  N   PRO B 619     -10.416  34.833 106.832  1.00 97.09           N  
ATOM   6629  CA  PRO B 619     -10.724  33.939 105.708  1.00 97.05           C  
ATOM   6630  C   PRO B 619     -12.134  33.343 105.734  1.00 97.82           C  
ATOM   6631  O   PRO B 619     -12.613  32.901 104.691  1.00 98.69           O  
ATOM   6632  CB  PRO B 619      -9.668  32.834 105.836  1.00 94.36           C  
ATOM   6633  CG  PRO B 619      -8.565  33.454 106.599  1.00 92.53           C  
ATOM   6634  CD  PRO B 619      -9.212  34.387 107.559  1.00 95.02           C  
ATOM   6635  N   THR B 620     -12.786  33.324 106.898  1.00 96.83           N  
ATOM   6636  CA  THR B 620     -14.160  32.824 106.989  1.00 98.90           C  
ATOM   6637  C   THR B 620     -15.164  33.939 106.764  1.00100.17           C  
ATOM   6638  O   THR B 620     -16.378  33.718 106.801  1.00101.44           O  
ATOM   6639  CB  THR B 620     -14.474  32.161 108.345  1.00100.99           C  
ATOM   6640  OG1 THR B 620     -14.291  33.107 109.408  1.00101.56           O  
ATOM   6641  CG2 THR B 620     -13.600  30.936 108.566  1.00101.52           C  
ATOM   6642  N   GLY B 621     -14.652  35.143 106.547  1.00101.28           N  
ATOM   6643  CA  GLY B 621     -15.501  36.293 106.278  1.00103.45           C  
ATOM   6644  C   GLY B 621     -15.934  37.068 107.505  1.00105.34           C  
ATOM   6645  O   GLY B 621     -16.728  37.995 107.387  1.00107.82           O  
ATOM   6646  N   LYS B 622     -15.426  36.699 108.681  1.00106.19           N  
ATOM   6647  CA  LYS B 622     -15.731  37.454 109.893  1.00106.25           C  
ATOM   6648  C   LYS B 622     -14.970  38.770 109.920  1.00106.88           C  
ATOM   6649  O   LYS B 622     -13.751  38.795 109.763  1.00109.90           O  
ATOM   6650  CB  LYS B 622     -15.421  36.661 111.159  1.00106.82           C  
ATOM   6651  CG  LYS B 622     -16.265  37.132 112.332  1.00108.72           C  
ATOM   6652  CD  LYS B 622     -15.440  37.426 113.567  1.00109.51           C  
ATOM   6653  CE  LYS B 622     -16.273  38.149 114.628  1.00109.79           C  
ATOM   6654  NZ  LYS B 622     -17.419  37.333 115.128  1.00109.56           N  
ATOM   6655  N   CYS B 623     -15.700  39.861 110.116  1.00107.05           N  
ATOM   6656  CA  CYS B 623     -15.099  41.184 110.194  1.00106.18           C  
ATOM   6657  C   CYS B 623     -14.522  41.424 111.592  1.00103.55           C  
ATOM   6658  O   CYS B 623     -15.148  41.080 112.592  1.00104.43           O  
ATOM   6659  CB  CYS B 623     -16.133  42.251 109.829  1.00108.29           C  
ATOM   6660  SG  CYS B 623     -15.510  43.946 109.829  1.00111.26           S  
ATOM   6661  N   CYS B 624     -13.323  41.999 111.650  1.00100.27           N  
ATOM   6662  CA  CYS B 624     -12.626  42.237 112.915  1.00 96.94           C  
ATOM   6663  C   CYS B 624     -12.163  43.676 113.022  1.00 96.34           C  
ATOM   6664  O   CYS B 624     -11.432  44.168 112.165  1.00 96.38           O  
ATOM   6665  CB  CYS B 624     -11.425  41.316 113.038  1.00 95.02           C  
ATOM   6666  SG  CYS B 624     -11.838  39.593 113.164  1.00 93.23           S  
ATOM   6667  N   CYS B 625     -12.573  44.337 114.093  1.00 95.29           N  
ATOM   6668  CA  CYS B 625     -12.461  45.783 114.177  1.00 95.24           C  
ATOM   6669  C   CYS B 625     -11.128  46.257 114.724  1.00 94.40           C  
ATOM   6670  O   CYS B 625     -10.591  45.675 115.666  1.00 96.12           O  
ATOM   6671  CB  CYS B 625     -13.595  46.342 115.035  1.00 96.16           C  
ATOM   6672  SG  CYS B 625     -15.254  45.839 114.532  1.00 96.53           S  
ATOM   6673  N   SER B 626     -10.604  47.324 114.128  1.00 92.55           N  
ATOM   6674  CA  SER B 626      -9.442  48.019 114.676  1.00 92.91           C  
ATOM   6675  C   SER B 626      -9.854  48.864 115.884  1.00 92.07           C  
ATOM   6676  O   SER B 626     -10.997  49.313 115.952  1.00 94.07           O  
ATOM   6677  CB  SER B 626      -8.742  48.867 113.601  1.00 93.92           C  
ATOM   6678  OG  SER B 626      -9.625  49.278 112.573  1.00 92.74           O  
ATOM   6679  N   PRO B 627      -8.940  49.052 116.858  1.00 92.12           N  
ATOM   6680  CA  PRO B 627      -9.209  49.833 118.076  1.00 93.24           C  
ATOM   6681  C   PRO B 627     -10.223  50.985 117.930  1.00 93.15           C  
ATOM   6682  O   PRO B 627      -9.986  51.956 117.205  1.00 92.17           O  
ATOM   6683  CB  PRO B 627      -7.824  50.371 118.450  1.00 92.41           C  
ATOM   6684  CG  PRO B 627      -6.870  49.328 117.936  1.00 93.98           C  
ATOM   6685  CD  PRO B 627      -7.576  48.495 116.881  1.00 91.98           C  
ATOM   6686  N   GLY B 628     -11.352  50.855 118.621  1.00 93.88           N  
ATOM   6687  CA  GLY B 628     -12.352  51.918 118.672  1.00 94.90           C  
ATOM   6688  C   GLY B 628     -13.479  51.771 117.670  1.00 93.66           C  
ATOM   6689  O   GLY B 628     -14.049  52.761 117.220  1.00 93.64           O  
ATOM   6690  N   TRP B 629     -13.788  50.530 117.312  1.00 91.99           N  
ATOM   6691  CA  TRP B 629     -14.927  50.235 116.457  1.00 89.27           C  
ATOM   6692  C   TRP B 629     -15.623  48.951 116.915  1.00 88.98           C  
ATOM   6693  O   TRP B 629     -14.997  48.069 117.505  1.00 89.66           O  
ATOM   6694  CB  TRP B 629     -14.494  50.123 114.993  1.00 89.62           C  
ATOM   6695  CG  TRP B 629     -13.885  51.380 114.421  1.00 89.59           C  
ATOM   6696  CD1 TRP B 629     -12.566  51.708 114.402  1.00 90.78           C  
ATOM   6697  CD2 TRP B 629     -14.573  52.461 113.778  1.00 89.59           C  
ATOM   6698  NE1 TRP B 629     -12.383  52.924 113.795  1.00 90.10           N  
ATOM   6699  CE2 TRP B 629     -13.599  53.410 113.401  1.00 88.78           C  
ATOM   6700  CE3 TRP B 629     -15.918  52.722 113.484  1.00 91.27           C  
ATOM   6701  CZ2 TRP B 629     -13.922  54.599 112.745  1.00 89.56           C  
ATOM   6702  CZ3 TRP B 629     -16.241  53.912 112.836  1.00 90.83           C  
ATOM   6703  CH2 TRP B 629     -15.245  54.836 112.476  1.00 90.52           C  
ATOM   6704  N   GLU B 630     -16.923  48.865 116.654  1.00 88.60           N  
ATOM   6705  CA  GLU B 630     -17.710  47.676 116.968  1.00 90.14           C  
ATOM   6706  C   GLU B 630     -18.773  47.461 115.893  1.00 90.88           C  
ATOM   6707  O   GLU B 630     -18.835  48.213 114.917  1.00 90.12           O  
ATOM   6708  CB  GLU B 630     -18.343  47.781 118.367  1.00 90.69           C  
ATOM   6709  CG  GLU B 630     -19.154  49.057 118.636  1.00 90.44           C  
ATOM   6710  CD  GLU B 630     -19.559  49.216 120.102  1.00 92.61           C  
ATOM   6711  OE1 GLU B 630     -20.153  50.263 120.454  1.00 93.26           O  
ATOM   6712  OE2 GLU B 630     -19.288  48.299 120.909  1.00 94.81           O  
ATOM   6713  N   GLY B 631     -19.599  46.434 116.073  1.00 92.31           N  
ATOM   6714  CA  GLY B 631     -20.662  46.126 115.127  1.00 93.35           C  
ATOM   6715  C   GLY B 631     -20.268  45.099 114.087  1.00 98.01           C  
ATOM   6716  O   GLY B 631     -19.080  44.787 113.913  1.00 98.87           O  
ATOM   6717  N   ASP B 632     -21.273  44.587 113.382  1.00100.27           N  
ATOM   6718  CA  ASP B 632     -21.085  43.515 112.406  1.00102.31           C  
ATOM   6719  C   ASP B 632     -19.974  43.809 111.411  1.00103.54           C  
ATOM   6720  O   ASP B 632     -19.169  42.930 111.105  1.00107.25           O  
ATOM   6721  CB  ASP B 632     -22.387  43.228 111.657  1.00104.36           C  
ATOM   6722  CG  ASP B 632     -23.510  42.794 112.579  1.00106.42           C  
ATOM   6723  OD1 ASP B 632     -24.685  42.951 112.184  1.00107.89           O  
ATOM   6724  OD2 ASP B 632     -23.224  42.302 113.694  1.00106.57           O  
ATOM   6725  N   PHE B 633     -19.922  45.043 110.918  1.00102.25           N  
ATOM   6726  CA  PHE B 633     -18.928  45.406 109.908  1.00101.02           C  
ATOM   6727  C   PHE B 633     -18.049  46.592 110.309  1.00 99.77           C  
ATOM   6728  O   PHE B 633     -17.524  47.319 109.461  1.00 98.65           O  
ATOM   6729  CB  PHE B 633     -19.598  45.574 108.537  1.00102.17           C  
ATOM   6730  CG  PHE B 633     -20.248  44.308 108.037  1.00104.09           C  
ATOM   6731  CD1 PHE B 633     -21.633  44.163 108.066  1.00103.96           C  
ATOM   6732  CD2 PHE B 633     -19.466  43.240 107.578  1.00105.31           C  
ATOM   6733  CE1 PHE B 633     -22.234  42.984 107.623  1.00104.75           C  
ATOM   6734  CE2 PHE B 633     -20.050  42.058 107.136  1.00103.94           C  
ATOM   6735  CZ  PHE B 633     -21.439  41.929 107.158  1.00104.76           C  
ATOM   6736  N   CYS B 634     -17.882  46.753 111.622  1.00 99.60           N  
ATOM   6737  CA  CYS B 634     -17.016  47.773 112.209  1.00 98.48           C  
ATOM   6738  C   CYS B 634     -17.313  49.170 111.680  1.00 98.96           C  
ATOM   6739  O   CYS B 634     -16.404  49.893 111.276  1.00100.88           O  
ATOM   6740  CB  CYS B 634     -15.550  47.413 111.985  1.00 97.14           C  
ATOM   6741  SG  CYS B 634     -15.156  45.747 112.512  1.00 96.95           S  
ATOM   6742  N   ARG B 635     -18.591  49.536 111.683  1.00 98.01           N  
ATOM   6743  CA  ARG B 635     -19.015  50.845 111.206  1.00 96.96           C  
ATOM   6744  C   ARG B 635     -19.321  51.755 112.380  1.00 95.10           C  
ATOM   6745  O   ARG B 635     -19.338  52.976 112.227  1.00 98.54           O  
ATOM   6746  CB  ARG B 635     -20.242  50.740 110.297  1.00100.09           C  
ATOM   6747  CG  ARG B 635     -20.179  49.625 109.269  1.00104.95           C  
ATOM   6748  CD  ARG B 635     -21.024  49.950 108.050  1.00109.36           C  
ATOM   6749  NE  ARG B 635     -21.792  48.789 107.601  1.00112.50           N  
ATOM   6750  CZ  ARG B 635     -23.113  48.667 107.716  1.00112.81           C  
ATOM   6751  NH1 ARG B 635     -23.839  49.643 108.250  1.00113.05           N  
ATOM   6752  NH2 ARG B 635     -23.714  47.569 107.283  1.00113.32           N  
ATOM   6753  N   THR B 636     -19.564  51.157 113.547  1.00 89.52           N  
ATOM   6754  CA  THR B 636     -19.907  51.911 114.754  1.00 84.95           C  
ATOM   6755  C   THR B 636     -18.667  52.235 115.581  1.00 81.90           C  
ATOM   6756  O   THR B 636     -17.898  51.348 115.938  1.00 78.36           O  
ATOM   6757  CB  THR B 636     -20.965  51.170 115.620  1.00 83.56           C  
ATOM   6758  OG1 THR B 636     -22.230  51.209 114.959  1.00 83.41           O  
ATOM   6759  CG2 THR B 636     -21.124  51.821 116.979  1.00 81.23           C  
ATOM   6760  N   ALA B 637     -18.498  53.519 115.884  1.00 82.40           N  
ATOM   6761  CA  ALA B 637     -17.371  54.004 116.663  1.00 83.31           C  
ATOM   6762  C   ALA B 637     -17.642  53.986 118.167  1.00 86.12           C  
ATOM   6763  O   ALA B 637     -18.726  54.370 118.627  1.00 89.37           O  
ATOM   6764  CB  ALA B 637     -17.004  55.398 116.213  1.00 82.54           C  
ATOM   6765  N   LYS B 638     -16.644  53.536 118.923  1.00 87.42           N  
ATOM   6766  CA  LYS B 638     -16.693  53.533 120.387  1.00 90.60           C  
ATOM   6767  C   LYS B 638     -16.195  54.868 120.951  1.00 96.32           C  
ATOM   6768  O   LYS B 638     -15.259  55.465 120.418  1.00 98.26           O  
ATOM   6769  CB  LYS B 638     -15.838  52.391 120.957  1.00 88.28           C  
ATOM   6770  CG  LYS B 638     -16.258  50.989 120.541  1.00 84.69           C  
ATOM   6771  CD  LYS B 638     -15.364  49.947 121.186  1.00 85.73           C  
ATOM   6772  CE  LYS B 638     -16.057  48.598 121.265  1.00 85.74           C  
ATOM   6773  NZ  LYS B 638     -15.115  47.490 121.594  1.00 85.80           N  
ATOM   6774  N   CYS B 639     -16.829  55.339 122.019  1.00100.20           N  
ATOM   6775  CA  CYS B 639     -16.335  56.500 122.747  1.00102.93           C  
ATOM   6776  C   CYS B 639     -16.077  56.123 124.215  1.00106.45           C  
ATOM   6777  O   CYS B 639     -17.012  55.791 124.945  1.00105.78           O  
ATOM   6778  CB  CYS B 639     -17.303  57.671 122.606  1.00104.91           C  
ATOM   6779  SG  CYS B 639     -17.131  58.615 121.048  1.00109.49           S  
ATOM   6780  N   GLU B 640     -14.800  56.177 124.618  1.00108.94           N  
ATOM   6781  CA  GLU B 640     -14.297  55.598 125.879  1.00112.18           C  
ATOM   6782  C   GLU B 640     -14.952  56.172 127.127  1.00111.89           C  
ATOM   6783  O   GLU B 640     -15.405  55.406 127.978  1.00113.66           O  
ATOM   6784  CB  GLU B 640     -12.766  55.702 125.977  1.00115.91           C  
ATOM   6785  CG  GLU B 640     -11.980  54.798 125.010  1.00117.62           C  
ATOM   6786  CD  GLU B 640     -10.519  55.214 124.854  1.00117.94           C  
ATOM   6787  OE1 GLU B 640     -10.164  56.352 125.235  1.00120.34           O  
ATOM   6788  OE2 GLU B 640      -9.720  54.401 124.341  1.00120.89           O  
ATOM   6789  N   PRO B 641     -14.943  57.516 127.278  1.00111.83           N  
ATOM   6790  CA  PRO B 641     -16.025  58.155 128.030  1.00109.42           C  
ATOM   6791  C   PRO B 641     -17.127  58.546 127.041  1.00108.00           C  
ATOM   6792  O   PRO B 641     -16.870  59.282 126.087  1.00107.47           O  
ATOM   6793  CB  PRO B 641     -15.356  59.396 128.641  1.00107.86           C  
ATOM   6794  CG  PRO B 641     -14.032  59.561 127.913  1.00110.09           C  
ATOM   6795  CD  PRO B 641     -13.933  58.501 126.849  1.00111.23           C  
ATOM   6796  N   ALA B 642     -18.336  58.035 127.249  1.00107.95           N  
ATOM   6797  CA  ALA B 642     -19.429  58.211 126.288  1.00108.07           C  
ATOM   6798  C   ALA B 642     -19.787  59.677 126.045  1.00111.77           C  
ATOM   6799  O   ALA B 642     -19.569  60.524 126.912  1.00116.67           O  
ATOM   6800  CB  ALA B 642     -20.646  57.444 126.746  1.00106.44           C  
ATOM   6801  N   CYS B 643     -20.324  59.970 124.863  1.00112.50           N  
ATOM   6802  CA  CYS B 643     -20.830  61.304 124.554  1.00113.96           C  
ATOM   6803  C   CYS B 643     -22.105  61.554 125.347  1.00114.21           C  
ATOM   6804  O   CYS B 643     -22.988  60.703 125.387  1.00116.03           O  
ATOM   6805  CB  CYS B 643     -21.128  61.443 123.064  1.00117.08           C  
ATOM   6806  SG  CYS B 643     -19.832  60.821 121.963  1.00124.04           S  
ATOM   6807  N   ARG B 644     -22.187  62.721 125.978  1.00114.45           N  
ATOM   6808  CA  ARG B 644     -23.330  63.097 126.808  1.00110.52           C  
ATOM   6809  C   ARG B 644     -24.348  63.897 125.992  1.00109.77           C  
ATOM   6810  O   ARG B 644     -24.054  64.343 124.874  1.00108.24           O  
ATOM   6811  CB  ARG B 644     -22.866  63.946 127.995  1.00110.45           C  
ATOM   6812  CG  ARG B 644     -21.635  63.443 128.729  1.00109.63           C  
ATOM   6813  CD  ARG B 644     -21.996  62.801 130.047  1.00109.31           C  
ATOM   6814  NE  ARG B 644     -20.914  62.908 131.027  1.00109.60           N  
ATOM   6815  CZ  ARG B 644     -20.911  63.737 132.071  1.00108.89           C  
ATOM   6816  NH1 ARG B 644     -21.938  64.552 132.291  1.00109.01           N  
ATOM   6817  NH2 ARG B 644     -19.879  63.743 132.907  1.00107.94           N  
ATOM   6818  N   HIS B 645     -25.540  64.073 126.567  1.00111.24           N  
ATOM   6819  CA  HIS B 645     -26.611  64.910 125.997  1.00111.13           C  
ATOM   6820  C   HIS B 645     -26.938  64.575 124.538  1.00111.36           C  
ATOM   6821  O   HIS B 645     -26.928  65.439 123.661  1.00111.60           O  
ATOM   6822  CB  HIS B 645     -26.285  66.397 126.183  1.00109.76           C  
ATOM   6823  CG  HIS B 645     -25.811  66.735 127.563  1.00109.26           C  
ATOM   6824  ND1 HIS B 645     -26.517  66.394 128.697  1.00109.61           N  
ATOM   6825  CD2 HIS B 645     -24.702  67.377 127.992  1.00107.69           C  
ATOM   6826  CE1 HIS B 645     -25.865  66.817 129.765  1.00107.49           C  
ATOM   6827  NE2 HIS B 645     -24.761  67.417 129.363  1.00107.96           N  
ATOM   6828  N   GLY B 646     -27.204  63.295 124.301  1.00113.24           N  
ATOM   6829  CA  GLY B 646     -27.581  62.792 122.987  1.00114.64           C  
ATOM   6830  C   GLY B 646     -26.630  63.048 121.838  1.00114.07           C  
ATOM   6831  O   GLY B 646     -27.067  63.161 120.699  1.00112.32           O  
ATOM   6832  N   GLY B 647     -25.336  63.142 122.137  1.00118.55           N  
ATOM   6833  CA  GLY B 647     -24.300  63.346 121.116  1.00119.00           C  
ATOM   6834  C   GLY B 647     -23.887  62.038 120.459  1.00120.50           C  
ATOM   6835  O   GLY B 647     -23.886  60.986 121.104  1.00123.76           O  
ATOM   6836  N   VAL B 648     -23.539  62.093 119.177  1.00116.69           N  
ATOM   6837  CA  VAL B 648     -23.207  60.880 118.440  1.00113.13           C  
ATOM   6838  C   VAL B 648     -21.698  60.656 118.440  1.00115.34           C  
ATOM   6839  O   VAL B 648     -20.922  61.617 118.365  1.00114.39           O  
ATOM   6840  CB  VAL B 648     -23.715  60.941 116.987  1.00110.83           C  
ATOM   6841  CG1 VAL B 648     -23.494  59.612 116.286  1.00111.28           C  
ATOM   6842  CG2 VAL B 648     -25.182  61.314 116.944  1.00110.71           C  
ATOM   6843  N   CYS B 649     -21.294  59.386 118.523  1.00113.94           N  
ATOM   6844  CA  CYS B 649     -19.887  59.001 118.416  1.00111.97           C  
ATOM   6845  C   CYS B 649     -19.526  58.695 116.947  1.00110.79           C  
ATOM   6846  O   CYS B 649     -19.564  57.542 116.514  1.00110.25           O  
ATOM   6847  CB  CYS B 649     -19.599  57.812 119.351  1.00110.86           C  
ATOM   6848  SG  CYS B 649     -17.844  57.372 119.590  1.00114.28           S  
ATOM   6849  N   VAL B 650     -19.193  59.741 116.190  1.00109.48           N  
ATOM   6850  CA  VAL B 650     -18.892  59.622 114.751  1.00111.75           C  
ATOM   6851  C   VAL B 650     -17.587  58.897 114.439  1.00109.93           C  
ATOM   6852  O   VAL B 650     -17.509  58.103 113.497  1.00108.11           O  
ATOM   6853  CB  VAL B 650     -18.845  60.996 114.043  1.00115.84           C  
ATOM   6854  CG1 VAL B 650     -20.088  61.203 113.179  1.00119.12           C  
ATOM   6855  CG2 VAL B 650     -18.645  62.128 115.052  1.00116.35           C  
ATOM   6856  N   ARG B 651     -16.561  59.208 115.221  1.00109.02           N  
ATOM   6857  CA  ARG B 651     -15.265  58.556 115.118  1.00106.79           C  
ATOM   6858  C   ARG B 651     -14.879  58.089 116.519  1.00102.75           C  
ATOM   6859  O   ARG B 651     -15.538  58.478 117.493  1.00102.56           O  
ATOM   6860  CB  ARG B 651     -14.234  59.516 114.532  1.00108.75           C  
ATOM   6861  CG  ARG B 651     -14.308  59.618 113.024  1.00113.92           C  
ATOM   6862  CD  ARG B 651     -13.660  60.887 112.513  1.00119.80           C  
ATOM   6863  NE  ARG B 651     -14.502  62.057 112.755  1.00125.29           N  
ATOM   6864  CZ  ARG B 651     -14.395  63.216 112.106  1.00129.47           C  
ATOM   6865  NH1 ARG B 651     -13.477  63.384 111.154  1.00129.60           N  
ATOM   6866  NH2 ARG B 651     -15.216  64.215 112.413  1.00130.98           N  
ATOM   6867  N   PRO B 652     -13.863  57.208 116.628  1.00 96.45           N  
ATOM   6868  CA  PRO B 652     -13.443  56.743 117.946  1.00 96.32           C  
ATOM   6869  C   PRO B 652     -13.033  57.897 118.854  1.00 99.60           C  
ATOM   6870  O   PRO B 652     -12.139  58.661 118.512  1.00100.46           O  
ATOM   6871  CB  PRO B 652     -12.259  55.834 117.633  1.00 93.59           C  
ATOM   6872  CG  PRO B 652     -12.510  55.373 116.249  1.00 91.91           C  
ATOM   6873  CD  PRO B 652     -13.090  56.557 115.558  1.00 91.80           C  
ATOM   6874  N   ASN B 653     -13.726  58.028 119.984  1.00103.80           N  
ATOM   6875  CA  ASN B 653     -13.514  59.109 120.953  1.00105.37           C  
ATOM   6876  C   ASN B 653     -13.750  60.530 120.440  1.00107.63           C  
ATOM   6877  O   ASN B 653     -13.457  61.498 121.141  1.00111.34           O  
ATOM   6878  CB  ASN B 653     -12.150  58.983 121.635  1.00105.28           C  
ATOM   6879  CG  ASN B 653     -12.102  57.836 122.615  1.00105.84           C  
ATOM   6880  OD1 ASN B 653     -12.362  56.684 122.265  1.00104.06           O  
ATOM   6881  ND2 ASN B 653     -11.762  58.145 123.858  1.00108.76           N  
ATOM   6882  N   LYS B 654     -14.286  60.655 119.229  1.00108.60           N  
ATOM   6883  CA  LYS B 654     -14.780  61.940 118.739  1.00111.35           C  
ATOM   6884  C   LYS B 654     -16.298  61.974 118.882  1.00114.63           C  
ATOM   6885  O   LYS B 654     -16.990  61.031 118.470  1.00116.00           O  
ATOM   6886  CB  LYS B 654     -14.395  62.148 117.277  1.00111.36           C  
ATOM   6887  CG  LYS B 654     -13.875  63.541 116.966  1.00112.89           C  
ATOM   6888  CD  LYS B 654     -14.007  63.870 115.491  1.00113.35           C  
ATOM   6889  CE  LYS B 654     -12.725  64.478 114.924  1.00114.75           C  
ATOM   6890  NZ  LYS B 654     -11.711  63.447 114.507  1.00113.38           N  
ATOM   6891  N   CYS B 655     -16.813  63.047 119.479  1.00115.83           N  
ATOM   6892  CA  CYS B 655     -18.261  63.213 119.646  1.00115.23           C  
ATOM   6893  C   CYS B 655     -18.789  64.345 118.789  1.00116.47           C  
ATOM   6894  O   CYS B 655     -18.204  65.419 118.740  1.00120.16           O  
ATOM   6895  CB  CYS B 655     -18.628  63.485 121.101  1.00114.60           C  
ATOM   6896  SG  CYS B 655     -18.279  62.126 122.225  1.00122.04           S  
ATOM   6897  N   LEU B 656     -19.889  64.092 118.096  1.00118.08           N  
ATOM   6898  CA  LEU B 656     -20.635  65.151 117.453  1.00117.29           C  
ATOM   6899  C   LEU B 656     -21.713  65.527 118.453  1.00120.92           C  
ATOM   6900  O   LEU B 656     -22.519  64.675 118.860  1.00120.71           O  
ATOM   6901  CB  LEU B 656     -21.274  64.649 116.165  1.00116.05           C  
ATOM   6902  CG  LEU B 656     -21.534  65.587 114.986  1.00113.91           C  
ATOM   6903  CD1 LEU B 656     -22.702  65.029 114.188  1.00114.31           C  
ATOM   6904  CD2 LEU B 656     -21.821  67.015 115.404  1.00113.93           C  
ATOM   6905  N   CYS B 657     -21.713  66.796 118.857  1.00122.68           N  
ATOM   6906  CA  CYS B 657     -22.638  67.300 119.875  1.00120.09           C  
ATOM   6907  C   CYS B 657     -23.857  68.003 119.285  1.00116.86           C  
ATOM   6908  O   CYS B 657     -23.844  68.434 118.129  1.00114.58           O  
ATOM   6909  CB  CYS B 657     -21.904  68.254 120.814  1.00119.03           C  
ATOM   6910  SG  CYS B 657     -20.529  67.491 121.680  1.00119.79           S  
ATOM   6911  N   LYS B 658     -24.906  68.123 120.093  1.00115.28           N  
ATOM   6912  CA  LYS B 658     -26.070  68.907 119.700  1.00115.41           C  
ATOM   6913  C   LYS B 658     -25.971  70.335 120.234  1.00114.50           C  
ATOM   6914  O   LYS B 658     -25.316  70.585 121.246  1.00116.43           O  
ATOM   6915  CB  LYS B 658     -27.352  68.220 120.149  1.00117.30           C  
ATOM   6916  CG  LYS B 658     -27.424  66.787 119.678  1.00119.58           C  
ATOM   6917  CD  LYS B 658     -28.748  66.482 119.009  1.00122.96           C  
ATOM   6918  CE  LYS B 658     -28.604  65.345 118.013  1.00123.79           C  
ATOM   6919  NZ  LYS B 658     -27.688  64.281 118.503  1.00122.11           N  
ATOM   6920  N   LYS B 659     -26.610  71.269 119.538  1.00113.29           N  
ATOM   6921  CA  LYS B 659     -26.517  72.699 119.869  1.00111.45           C  
ATOM   6922  C   LYS B 659     -26.725  72.966 121.363  1.00110.20           C  
ATOM   6923  O   LYS B 659     -27.654  72.429 121.991  1.00110.53           O  
ATOM   6924  CB  LYS B 659     -27.522  73.495 119.037  1.00110.72           C  
ATOM   6925  CG  LYS B 659     -27.140  74.916 118.723  1.00112.01           C  
ATOM   6926  CD  LYS B 659     -28.060  75.426 117.626  1.00117.31           C  
ATOM   6927  CE  LYS B 659     -28.194  76.938 117.636  1.00121.16           C  
ATOM   6928  NZ  LYS B 659     -29.388  77.360 116.847  1.00123.41           N  
ATOM   6929  N   GLY B 660     -25.834  73.779 121.925  1.00106.20           N  
ATOM   6930  CA  GLY B 660     -25.878  74.122 123.340  1.00101.31           C  
ATOM   6931  C   GLY B 660     -25.114  73.181 124.253  1.00 98.77           C  
ATOM   6932  O   GLY B 660     -25.209  73.299 125.473  1.00 96.19           O  
ATOM   6933  N   TYR B 661     -24.368  72.240 123.678  1.00 99.63           N  
ATOM   6934  CA  TYR B 661     -23.548  71.333 124.481  1.00100.63           C  
ATOM   6935  C   TYR B 661     -22.125  71.248 123.981  1.00106.38           C  
ATOM   6936  O   TYR B 661     -21.844  70.555 123.007  1.00111.36           O  
ATOM   6937  CB  TYR B 661     -24.173  69.951 124.566  1.00 98.35           C  
ATOM   6938  CG  TYR B 661     -25.554  69.985 125.166  1.00 99.57           C  
ATOM   6939  CD1 TYR B 661     -26.680  70.090 124.353  1.00 99.83           C  
ATOM   6940  CD2 TYR B 661     -25.736  69.948 126.548  1.00 98.59           C  
ATOM   6941  CE1 TYR B 661     -27.952  70.134 124.899  1.00102.10           C  
ATOM   6942  CE2 TYR B 661     -27.002  69.986 127.106  1.00 99.68           C  
ATOM   6943  CZ  TYR B 661     -28.110  70.084 126.277  1.00101.17           C  
ATOM   6944  OH  TYR B 661     -29.380  70.132 126.812  1.00100.13           O  
ATOM   6945  N   LEU B 662     -21.240  71.974 124.663  1.00108.91           N  
ATOM   6946  CA  LEU B 662     -19.816  72.033 124.338  1.00108.61           C  
ATOM   6947  C   LEU B 662     -19.022  71.007 125.149  1.00107.75           C  
ATOM   6948  O   LEU B 662     -19.533  70.433 126.112  1.00106.64           O  
ATOM   6949  CB  LEU B 662     -19.280  73.439 124.618  1.00109.39           C  
ATOM   6950  CG  LEU B 662     -20.044  74.636 124.040  1.00110.70           C  
ATOM   6951  CD1 LEU B 662     -20.080  75.778 125.045  1.00110.46           C  
ATOM   6952  CD2 LEU B 662     -19.461  75.099 122.703  1.00111.16           C  
ATOM   6953  N   GLY B 663     -17.773  70.781 124.752  1.00108.46           N  
ATOM   6954  CA  GLY B 663     -16.883  69.881 125.479  1.00110.48           C  
ATOM   6955  C   GLY B 663     -16.597  68.592 124.736  1.00113.70           C  
ATOM   6956  O   GLY B 663     -17.389  68.186 123.879  1.00116.77           O  
ATOM   6957  N   PRO B 664     -15.468  67.930 125.067  1.00114.11           N  
ATOM   6958  CA  PRO B 664     -15.020  66.688 124.428  1.00114.15           C  
ATOM   6959  C   PRO B 664     -16.115  65.630 124.289  1.00114.65           C  
ATOM   6960  O   PRO B 664     -16.160  64.945 123.270  1.00118.09           O  
ATOM   6961  CB  PRO B 664     -13.917  66.194 125.365  1.00113.78           C  
ATOM   6962  CG  PRO B 664     -13.359  67.428 125.953  1.00114.99           C  
ATOM   6963  CD  PRO B 664     -14.527  68.365 126.117  1.00114.88           C  
ATOM   6964  N   GLN B 665     -16.978  65.505 125.299  1.00112.38           N  
ATOM   6965  CA  GLN B 665     -18.106  64.566 125.258  1.00109.73           C  
ATOM   6966  C   GLN B 665     -19.456  65.275 125.368  1.00110.24           C  
ATOM   6967  O   GLN B 665     -20.432  64.687 125.839  1.00106.42           O  
ATOM   6968  CB  GLN B 665     -18.001  63.531 126.379  1.00106.40           C  
ATOM   6969  CG  GLN B 665     -16.826  62.597 126.269  1.00105.67           C  
ATOM   6970  CD  GLN B 665     -15.655  63.012 127.131  1.00102.56           C  
ATOM   6971  OE1 GLN B 665     -15.774  63.144 128.352  1.00100.75           O  
ATOM   6972  NE2 GLN B 665     -14.509  63.198 126.501  1.00101.98           N  
ATOM   6973  N   CYS B 666     -19.512  66.533 124.931  1.00111.38           N  
ATOM   6974  CA  CYS B 666     -20.714  67.352 125.088  1.00113.49           C  
ATOM   6975  C   CYS B 666     -21.094  67.433 126.571  1.00112.60           C  
ATOM   6976  O   CYS B 666     -22.268  67.400 126.936  1.00111.19           O  
ATOM   6977  CB  CYS B 666     -21.869  66.766 124.273  1.00116.14           C  
ATOM   6978  SG  CYS B 666     -21.366  65.978 122.745  1.00119.49           S  
ATOM   6979  N   GLU B 667     -20.077  67.536 127.419  1.00110.45           N  
ATOM   6980  CA  GLU B 667     -20.251  67.434 128.859  1.00108.36           C  
ATOM   6981  C   GLU B 667     -20.920  68.663 129.471  1.00105.73           C  
ATOM   6982  O   GLU B 667     -21.742  68.523 130.367  1.00104.31           O  
ATOM   6983  CB  GLU B 667     -18.902  67.133 129.525  1.00110.56           C  
ATOM   6984  CG  GLU B 667     -17.753  67.998 129.001  1.00113.98           C  
ATOM   6985  CD  GLU B 667     -16.383  67.386 129.213  1.00114.65           C  
ATOM   6986  OE1 GLU B 667     -15.646  67.861 130.109  1.00111.54           O  
ATOM   6987  OE2 GLU B 667     -16.045  66.434 128.474  1.00116.28           O  
ATOM   6988  N   HIS B 668     -20.579  69.855 128.975  1.00106.72           N  
ATOM   6989  CA  HIS B 668     -21.076  71.122 129.540  1.00107.99           C  
ATOM   6990  C   HIS B 668     -22.115  71.798 128.644  1.00107.22           C  
ATOM   6991  O   HIS B 668     -22.195  71.507 127.458  1.00107.57           O  
ATOM   6992  CB  HIS B 668     -19.922  72.100 129.811  1.00108.69           C  
ATOM   6993  CG  HIS B 668     -18.755  71.488 130.520  1.00109.22           C  
ATOM   6994  ND1 HIS B 668     -18.739  71.265 131.880  1.00109.35           N  
ATOM   6995  CD2 HIS B 668     -17.556  71.063 130.055  1.00109.97           C  
ATOM   6996  CE1 HIS B 668     -17.584  70.722 132.221  1.00110.80           C  
ATOM   6997  NE2 HIS B 668     -16.849  70.586 131.132  1.00111.37           N  
ATOM   6998  N   HIS B 669     -22.880  72.726 129.215  1.00108.55           N  
ATOM   6999  CA  HIS B 669     -23.984  73.376 128.505  1.00110.56           C  
ATOM   7000  C   HIS B 669     -23.940  74.926 128.532  1.00114.04           C  
ATOM   7001  O   HIS B 669     -23.647  75.567 127.514  1.00112.95           O  
ATOM   7002  CB  HIS B 669     -25.321  72.806 129.025  1.00108.70           C  
ATOM   7003  CG  HIS B 669     -26.488  73.736 128.885  1.00108.18           C  
ATOM   7004  ND1 HIS B 669     -27.129  73.961 127.685  1.00109.00           N  
ATOM   7005  CD2 HIS B 669     -27.139  74.488 129.804  1.00107.13           C  
ATOM   7006  CE1 HIS B 669     -28.115  74.822 127.869  1.00106.87           C  
ATOM   7007  NE2 HIS B 669     -28.143  75.156 129.146  1.00106.29           N  
ATOM   7008  N   HIS B 670     -24.225  75.509 129.698  1.00118.67           N  
ATOM   7009  CA  HIS B 670     -24.329  76.969 129.892  1.00122.77           C  
ATOM   7010  C   HIS B 670     -25.389  77.660 129.036  1.00121.61           C  
ATOM   7011  O   HIS B 670     -26.132  78.509 129.534  1.00119.74           O  
ATOM   7012  CB  HIS B 670     -22.969  77.656 129.726  1.00127.81           C  
ATOM   7013  CG  HIS B 670     -21.902  77.084 130.605  1.00132.15           C  
ATOM   7014  ND1 HIS B 670     -22.091  76.860 131.953  1.00133.28           N  
ATOM   7015  CD2 HIS B 670     -20.636  76.687 130.331  1.00132.90           C  
ATOM   7016  CE1 HIS B 670     -20.989  76.349 132.470  1.00133.79           C  
ATOM   7017  NE2 HIS B 670     -20.090  76.234 131.508  1.00133.94           N  
TER    7018      HIS B 670                                                      
ATOM   7019  N   LYS H  38      -1.501  21.641 145.570  1.00 96.99           N  
ATOM   7020  CA  LYS H  38      -0.945  22.820 146.293  1.00 96.55           C  
ATOM   7021  C   LYS H  38      -0.034  23.645 145.380  1.00 95.85           C  
ATOM   7022  O   LYS H  38      -0.204  24.861 145.264  1.00 96.41           O  
ATOM   7023  CB  LYS H  38      -0.200  22.369 147.558  1.00 96.95           C  
ATOM   7024  CG  LYS H  38      -0.088  23.429 148.655  1.00 97.16           C  
ATOM   7025  CD  LYS H  38       1.205  24.239 148.550  1.00 97.12           C  
ATOM   7026  CE  LYS H  38       1.252  25.365 149.581  1.00 96.95           C  
ATOM   7027  NZ  LYS H  38       1.301  24.870 150.988  1.00 96.59           N  
ATOM   7028  N   LEU H  39       0.926  22.978 144.738  1.00 94.40           N  
ATOM   7029  CA  LEU H  39       1.868  23.634 143.828  1.00 92.60           C  
ATOM   7030  C   LEU H  39       1.657  23.201 142.378  1.00 91.53           C  
ATOM   7031  O   LEU H  39       2.159  22.155 141.953  1.00 91.52           O  
ATOM   7032  CB  LEU H  39       3.319  23.354 144.247  1.00 91.75           C  
ATOM   7033  CG  LEU H  39       3.846  23.822 145.607  1.00 90.95           C  
ATOM   7034  CD1 LEU H  39       5.229  23.236 145.845  1.00 90.47           C  
ATOM   7035  CD2 LEU H  39       3.881  25.343 145.707  1.00 90.74           C  
ATOM   7036  N   THR H  40       0.912  24.008 141.626  1.00 90.30           N  
ATOM   7037  CA  THR H  40       0.682  23.748 140.203  1.00 89.41           C  
ATOM   7038  C   THR H  40       1.810  24.331 139.346  1.00 87.20           C  
ATOM   7039  O   THR H  40       2.252  25.456 139.592  1.00 87.28           O  
ATOM   7040  CB  THR H  40      -0.688  24.293 139.719  1.00 90.20           C  
ATOM   7041  OG1 THR H  40      -0.939  25.573 140.314  1.00 91.33           O  
ATOM   7042  CG2 THR H  40      -1.814  23.333 140.092  1.00 90.06           C  
ATOM   7043  N   PRO H  41       2.284  23.562 138.344  1.00 84.75           N  
ATOM   7044  CA  PRO H  41       3.353  24.033 137.465  1.00 82.35           C  
ATOM   7045  C   PRO H  41       2.871  25.139 136.533  1.00 80.22           C  
ATOM   7046  O   PRO H  41       1.716  25.121 136.099  1.00 79.92           O  
ATOM   7047  CB  PRO H  41       3.720  22.782 136.659  1.00 82.28           C  
ATOM   7048  CG  PRO H  41       2.494  21.955 136.659  1.00 82.70           C  
ATOM   7049  CD  PRO H  41       1.841  22.200 137.986  1.00 84.25           C  
ATOM   7050  N   LEU H  42       3.749  26.096 136.245  1.00 78.24           N  
ATOM   7051  CA  LEU H  42       3.443  27.155 135.289  1.00 76.23           C  
ATOM   7052  C   LEU H  42       3.280  26.594 133.880  1.00 75.34           C  
ATOM   7053  O   LEU H  42       4.007  25.683 133.474  1.00 75.66           O  
ATOM   7054  CB  LEU H  42       4.522  28.243 135.303  1.00 75.00           C  
ATOM   7055  CG  LEU H  42       4.279  29.472 136.184  1.00 74.26           C  
ATOM   7056  CD1 LEU H  42       4.535  29.175 137.654  1.00 72.79           C  
ATOM   7057  CD2 LEU H  42       5.144  30.632 135.713  1.00 74.61           C  
ATOM   7058  N   ALA H  43       2.306  27.132 133.152  1.00 73.49           N  
ATOM   7059  CA  ALA H  43       2.097  26.778 131.757  1.00 71.23           C  
ATOM   7060  C   ALA H  43       3.154  27.469 130.907  1.00 70.68           C  
ATOM   7061  O   ALA H  43       3.755  28.459 131.335  1.00 69.19           O  
ATOM   7062  CB  ALA H  43       0.704  27.187 131.314  1.00 71.19           C  
ATOM   7063  N   TYR H  44       3.383  26.931 129.711  1.00 71.12           N  
ATOM   7064  CA  TYR H  44       4.329  27.505 128.762  1.00 71.03           C  
ATOM   7065  C   TYR H  44       3.939  28.947 128.430  1.00 69.88           C  
ATOM   7066  O   TYR H  44       2.761  29.241 128.201  1.00 68.14           O  
ATOM   7067  CB  TYR H  44       4.400  26.635 127.500  1.00 74.05           C  
ATOM   7068  CG  TYR H  44       5.312  27.156 126.408  1.00 75.75           C  
ATOM   7069  CD1 TYR H  44       6.684  27.315 126.626  1.00 77.09           C  
ATOM   7070  CD2 TYR H  44       4.805  27.473 125.148  1.00 74.51           C  
ATOM   7071  CE1 TYR H  44       7.521  27.795 125.618  1.00 76.73           C  
ATOM   7072  CE2 TYR H  44       5.631  27.946 124.138  1.00 74.87           C  
ATOM   7073  CZ  TYR H  44       6.983  28.109 124.379  1.00 75.34           C  
ATOM   7074  OH  TYR H  44       7.795  28.578 123.372  1.00 76.42           O  
ATOM   7075  N   LYS H  45       4.937  29.834 128.445  1.00 69.86           N  
ATOM   7076  CA  LYS H  45       4.772  31.274 128.163  1.00 70.78           C  
ATOM   7077  C   LYS H  45       3.939  32.031 129.199  1.00 72.53           C  
ATOM   7078  O   LYS H  45       3.476  33.145 128.934  1.00 73.19           O  
ATOM   7079  CB  LYS H  45       4.223  31.524 126.749  1.00 69.76           C  
ATOM   7080  CG  LYS H  45       5.141  31.082 125.614  1.00 69.59           C  
ATOM   7081  CD  LYS H  45       6.322  32.021 125.410  1.00 69.31           C  
ATOM   7082  CE  LYS H  45       7.031  31.706 124.108  1.00 69.77           C  
ATOM   7083  NZ  LYS H  45       8.180  32.611 123.853  1.00 71.01           N  
ATOM   7084  N   GLN H  46       3.754  31.426 130.372  1.00 73.35           N  
ATOM   7085  CA  GLN H  46       3.064  32.087 131.475  1.00 72.84           C  
ATOM   7086  C   GLN H  46       4.070  32.842 132.323  1.00 73.74           C  
ATOM   7087  O   GLN H  46       5.154  32.336 132.616  1.00 74.38           O  
ATOM   7088  CB  GLN H  46       2.299  31.081 132.342  1.00 72.80           C  
ATOM   7089  CG  GLN H  46       1.389  31.731 133.393  1.00 71.98           C  
ATOM   7090  CD  GLN H  46       0.833  30.750 134.416  1.00 70.92           C  
ATOM   7091  OE1 GLN H  46       1.292  29.614 134.530  1.00 69.50           O  
ATOM   7092  NE2 GLN H  46      -0.161  31.196 135.172  1.00 70.18           N  
ATOM   7093  N   PHE H  47       3.702  34.059 132.709  1.00 74.88           N  
ATOM   7094  CA  PHE H  47       4.502  34.838 133.643  1.00 76.69           C  
ATOM   7095  C   PHE H  47       3.722  35.204 134.908  1.00 78.11           C  
ATOM   7096  O   PHE H  47       2.553  35.591 134.844  1.00 80.15           O  
ATOM   7097  CB  PHE H  47       5.115  36.077 132.970  1.00 76.71           C  
ATOM   7098  CG  PHE H  47       4.157  36.853 132.098  1.00 77.70           C  
ATOM   7099  CD1 PHE H  47       3.962  36.501 130.763  1.00 77.68           C  
ATOM   7100  CD2 PHE H  47       3.475  37.955 132.602  1.00 77.97           C  
ATOM   7101  CE1 PHE H  47       3.087  37.222 129.953  1.00 77.13           C  
ATOM   7102  CE2 PHE H  47       2.598  38.684 131.796  1.00 77.51           C  
ATOM   7103  CZ  PHE H  47       2.406  38.316 130.471  1.00 77.02           C  
ATOM   7104  N   ILE H  48       4.375  35.046 136.056  1.00 77.05           N  
ATOM   7105  CA  ILE H  48       3.784  35.382 137.347  1.00 76.18           C  
ATOM   7106  C   ILE H  48       4.726  36.322 138.108  1.00 76.22           C  
ATOM   7107  O   ILE H  48       5.896  35.985 138.317  1.00 76.95           O  
ATOM   7108  CB  ILE H  48       3.450  34.112 138.172  1.00 76.29           C  
ATOM   7109  CG1 ILE H  48       2.318  33.327 137.496  1.00 76.11           C  
ATOM   7110  CG2 ILE H  48       3.078  34.474 139.615  1.00 76.44           C  
ATOM   7111  CD1 ILE H  48       2.062  31.944 138.082  1.00 76.04           C  
ATOM   7112  N   PRO H  49       4.223  37.507 138.519  1.00 75.62           N  
ATOM   7113  CA  PRO H  49       2.841  37.981 138.378  1.00 74.62           C  
ATOM   7114  C   PRO H  49       2.443  38.242 136.928  1.00 73.36           C  
ATOM   7115  O   PRO H  49       3.301  38.534 136.091  1.00 72.65           O  
ATOM   7116  CB  PRO H  49       2.839  39.293 139.168  1.00 74.88           C  
ATOM   7117  CG  PRO H  49       4.244  39.759 139.120  1.00 75.61           C  
ATOM   7118  CD  PRO H  49       5.071  38.512 139.187  1.00 76.04           C  
ATOM   7119  N   ASN H  50       1.146  38.137 136.649  1.00 72.10           N  
ATOM   7120  CA  ASN H  50       0.621  38.312 135.299  1.00 71.09           C  
ATOM   7121  C   ASN H  50       0.620  39.777 134.847  1.00 70.53           C  
ATOM   7122  O   ASN H  50      -0.396  40.305 134.393  1.00 69.33           O  
ATOM   7123  CB  ASN H  50      -0.773  37.685 135.182  1.00 72.47           C  
ATOM   7124  CG  ASN H  50      -1.104  37.237 133.762  1.00 74.14           C  
ATOM   7125  OD1 ASN H  50      -0.322  37.433 132.827  1.00 74.78           O  
ATOM   7126  ND2 ASN H  50      -2.272  36.627 133.598  1.00 74.91           N  
ATOM   7127  N   VAL H  51       1.778  40.418 134.989  1.00 71.11           N  
ATOM   7128  CA  VAL H  51       2.033  41.769 134.480  1.00 71.40           C  
ATOM   7129  C   VAL H  51       3.413  41.812 133.819  1.00 71.83           C  
ATOM   7130  O   VAL H  51       4.189  40.857 133.932  1.00 71.73           O  
ATOM   7131  CB  VAL H  51       1.951  42.854 135.594  1.00 71.17           C  
ATOM   7132  CG1 VAL H  51       0.503  43.154 135.959  1.00 71.23           C  
ATOM   7133  CG2 VAL H  51       2.761  42.450 136.828  1.00 71.19           C  
ATOM   7134  N   ALA H  52       3.714  42.914 133.132  1.00 72.34           N  
ATOM   7135  CA  ALA H  52       5.017  43.099 132.491  1.00 73.07           C  
ATOM   7136  C   ALA H  52       6.137  43.106 133.527  1.00 75.47           C  
ATOM   7137  O   ALA H  52       5.928  43.508 134.672  1.00 76.94           O  
ATOM   7138  CB  ALA H  52       5.036  44.382 131.679  1.00 72.04           C  
ATOM   7139  N   GLU H  53       7.318  42.655 133.111  1.00 77.01           N  
ATOM   7140  CA  GLU H  53       8.492  42.545 133.983  1.00 77.86           C  
ATOM   7141  C   GLU H  53       8.870  43.867 134.658  1.00 78.24           C  
ATOM   7142  O   GLU H  53       9.189  43.899 135.848  1.00 77.39           O  
ATOM   7143  CB  GLU H  53       9.681  42.015 133.171  1.00 78.08           C  
ATOM   7144  CG  GLU H  53      10.957  41.773 133.969  1.00 78.15           C  
ATOM   7145  CD  GLU H  53      12.045  41.112 133.143  1.00 78.03           C  
ATOM   7146  OE1 GLU H  53      12.409  41.654 132.077  1.00 77.46           O  
ATOM   7147  OE2 GLU H  53      12.545  40.050 133.568  1.00 78.06           O  
ATOM   7148  N   LYS H  54       8.817  44.950 133.886  1.00 80.04           N  
ATOM   7149  CA  LYS H  54       9.302  46.263 134.316  1.00 81.00           C  
ATOM   7150  C   LYS H  54       8.278  47.077 135.118  1.00 80.70           C  
ATOM   7151  O   LYS H  54       8.568  48.203 135.531  1.00 80.05           O  
ATOM   7152  CB  LYS H  54       9.775  47.082 133.103  1.00 82.64           C  
ATOM   7153  CG  LYS H  54      10.676  46.338 132.114  1.00 83.63           C  
ATOM   7154  CD  LYS H  54      12.140  46.326 132.548  1.00 83.43           C  
ATOM   7155  CE  LYS H  54      13.010  45.593 131.531  1.00 82.82           C  
ATOM   7156  NZ  LYS H  54      13.049  46.270 130.199  1.00 80.92           N  
ATOM   7157  N   THR H  55       7.089  46.515 135.331  1.00 80.72           N  
ATOM   7158  CA  THR H  55       6.043  47.201 136.096  1.00 80.58           C  
ATOM   7159  C   THR H  55       6.328  47.163 137.599  1.00 81.48           C  
ATOM   7160  O   THR H  55       7.158  46.375 138.066  1.00 81.92           O  
ATOM   7161  CB  THR H  55       4.628  46.643 135.808  1.00 79.87           C  
ATOM   7162  OG1 THR H  55       4.578  45.247 136.128  1.00 79.58           O  
ATOM   7163  CG2 THR H  55       4.251  46.849 134.347  1.00 79.69           C  
ATOM   7164  N   LEU H  56       5.631  48.021 138.341  1.00 81.69           N  
ATOM   7165  CA  LEU H  56       5.854  48.204 139.775  1.00 81.79           C  
ATOM   7166  C   LEU H  56       5.539  46.944 140.584  1.00 81.28           C  
ATOM   7167  O   LEU H  56       6.190  46.672 141.594  1.00 81.48           O  
ATOM   7168  CB  LEU H  56       5.026  49.392 140.280  1.00 82.33           C  
ATOM   7169  CG  LEU H  56       5.647  50.336 141.315  1.00 83.02           C  
ATOM   7170  CD1 LEU H  56       5.164  51.766 141.097  1.00 82.70           C  
ATOM   7171  CD2 LEU H  56       5.382  49.878 142.750  1.00 83.73           C  
ATOM   7172  N   GLY H  57       4.550  46.178 140.126  1.00 80.60           N  
ATOM   7173  CA  GLY H  57       4.138  44.944 140.795  1.00 79.46           C  
ATOM   7174  C   GLY H  57       5.069  43.766 140.567  1.00 78.47           C  
ATOM   7175  O   GLY H  57       5.015  42.776 141.300  1.00 77.87           O  
ATOM   7176  N   ALA H  58       5.925  43.875 139.552  1.00 78.17           N  
ATOM   7177  CA  ALA H  58       6.837  42.794 139.189  1.00 77.82           C  
ATOM   7178  C   ALA H  58       8.276  43.062 139.643  1.00 77.66           C  
ATOM   7179  O   ALA H  58       8.581  42.937 140.830  1.00 78.20           O  
ATOM   7180  CB  ALA H  58       6.771  42.518 137.692  1.00 77.33           C  
ATOM   7181  N   SER H  59       9.145  43.441 138.706  1.00 76.90           N  
ATOM   7182  CA  SER H  59      10.578  43.567 138.986  1.00 76.91           C  
ATOM   7183  C   SER H  59      11.147  44.979 138.810  1.00 77.39           C  
ATOM   7184  O   SER H  59      12.365  45.172 138.854  1.00 76.84           O  
ATOM   7185  CB  SER H  59      11.372  42.560 138.149  1.00 76.63           C  
ATOM   7186  OG  SER H  59      11.154  41.237 138.608  1.00 75.83           O  
ATOM   7187  N   GLY H  60      10.267  45.959 138.613  1.00 78.81           N  
ATOM   7188  CA  GLY H  60      10.674  47.366 138.539  1.00 80.64           C  
ATOM   7189  C   GLY H  60      11.403  47.758 137.266  1.00 81.77           C  
ATOM   7190  O   GLY H  60      11.709  46.910 136.426  1.00 82.89           O  
ATOM   7191  N   ARG H  61      11.694  49.051 137.139  1.00 82.21           N  
ATOM   7192  CA  ARG H  61      12.283  49.612 135.920  1.00 83.45           C  
ATOM   7193  C   ARG H  61      13.749  49.248 135.697  1.00 83.35           C  
ATOM   7194  O   ARG H  61      14.520  49.104 136.648  1.00 83.60           O  
ATOM   7195  CB  ARG H  61      12.132  51.134 135.897  1.00 84.63           C  
ATOM   7196  CG  ARG H  61      10.782  51.621 135.394  1.00 86.21           C  
ATOM   7197  CD  ARG H  61      10.795  53.123 135.136  1.00 86.59           C  
ATOM   7198  NE  ARG H  61      11.124  53.884 136.342  1.00 85.94           N  
ATOM   7199  CZ  ARG H  61      11.327  55.198 136.374  1.00 85.36           C  
ATOM   7200  NH1 ARG H  61      11.236  55.923 135.265  1.00 85.28           N  
ATOM   7201  NH2 ARG H  61      11.623  55.791 137.522  1.00 84.90           N  
ATOM   7202  N   TYR H  62      14.108  49.113 134.421  1.00 82.81           N  
ATOM   7203  CA  TYR H  62      15.489  48.936 133.980  1.00 81.73           C  
ATOM   7204  C   TYR H  62      16.272  50.210 134.300  1.00 81.49           C  
ATOM   7205  O   TYR H  62      15.912  51.298 133.844  1.00 82.31           O  
ATOM   7206  CB  TYR H  62      15.500  48.631 132.474  1.00 80.24           C  
ATOM   7207  CG  TYR H  62      16.863  48.546 131.813  1.00 79.72           C  
ATOM   7208  CD1 TYR H  62      17.636  47.387 131.899  1.00 79.67           C  
ATOM   7209  CD2 TYR H  62      17.361  49.616 131.069  1.00 79.45           C  
ATOM   7210  CE1 TYR H  62      18.882  47.305 131.277  1.00 79.71           C  
ATOM   7211  CE2 TYR H  62      18.602  49.545 130.445  1.00 79.82           C  
ATOM   7212  CZ  TYR H  62      19.357  48.389 130.553  1.00 79.83           C  
ATOM   7213  OH  TYR H  62      20.583  48.326 129.932  1.00 79.71           O  
ATOM   7214  N   GLU H  63      17.326  50.073 135.100  1.00 80.45           N  
ATOM   7215  CA  GLU H  63      18.098  51.230 135.556  1.00 79.72           C  
ATOM   7216  C   GLU H  63      19.294  51.557 134.664  1.00 78.96           C  
ATOM   7217  O   GLU H  63      19.755  52.699 134.638  1.00 79.77           O  
ATOM   7218  CB  GLU H  63      18.549  51.044 137.007  1.00 79.72           C  
ATOM   7219  CG  GLU H  63      17.432  51.227 138.026  1.00 79.95           C  
ATOM   7220  CD  GLU H  63      17.884  50.972 139.453  1.00 80.34           C  
ATOM   7221  OE1 GLU H  63      18.675  50.030 139.678  1.00 80.54           O  
ATOM   7222  OE2 GLU H  63      17.439  51.712 140.354  1.00 80.86           O  
ATOM   7223  N   GLY H  64      19.788  50.561 133.935  1.00 77.92           N  
ATOM   7224  CA  GLY H  64      20.921  50.756 133.035  1.00 76.53           C  
ATOM   7225  C   GLY H  64      21.835  49.550 132.955  1.00 75.68           C  
ATOM   7226  O   GLY H  64      21.882  48.728 133.876  1.00 74.53           O  
ATOM   7227  N   LYS H  65      22.562  49.455 131.844  1.00 75.52           N  
ATOM   7228  CA  LYS H  65      23.486  48.351 131.602  1.00 75.61           C  
ATOM   7229  C   LYS H  65      24.711  48.462 132.503  1.00 75.13           C  
ATOM   7230  O   LYS H  65      25.269  49.548 132.668  1.00 75.28           O  
ATOM   7231  CB  LYS H  65      23.908  48.325 130.128  1.00 75.34           C  
ATOM   7232  CG  LYS H  65      24.638  47.055 129.697  1.00 75.77           C  
ATOM   7233  CD  LYS H  65      24.777  46.950 128.178  1.00 76.53           C  
ATOM   7234  CE  LYS H  65      26.080  47.561 127.665  1.00 77.24           C  
ATOM   7235  NZ  LYS H  65      26.040  49.049 127.591  1.00 77.21           N  
ATOM   7236  N   ILE H  66      25.115  47.337 133.087  1.00 74.71           N  
ATOM   7237  CA  ILE H  66      26.313  47.289 133.920  1.00 74.95           C  
ATOM   7238  C   ILE H  66      27.431  46.524 133.207  1.00 74.28           C  
ATOM   7239  O   ILE H  66      27.448  45.291 133.192  1.00 72.41           O  
ATOM   7240  CB  ILE H  66      26.020  46.695 135.324  1.00 75.49           C  
ATOM   7241  CG1 ILE H  66      24.984  47.558 136.057  1.00 75.68           C  
ATOM   7242  CG2 ILE H  66      27.305  46.595 136.140  1.00 75.88           C  
ATOM   7243  CD1 ILE H  66      24.594  47.059 137.445  1.00 75.85           C  
ATOM   7244  N   SER H  67      28.352  47.277 132.608  1.00 75.65           N  
ATOM   7245  CA  SER H  67      29.477  46.706 131.871  1.00 77.27           C  
ATOM   7246  C   SER H  67      30.626  46.343 132.812  1.00 79.19           C  
ATOM   7247  O   SER H  67      30.640  46.754 133.973  1.00 79.25           O  
ATOM   7248  CB  SER H  67      29.954  47.674 130.784  1.00 76.95           C  
ATOM   7249  OG  SER H  67      30.429  48.885 131.347  1.00 76.85           O  
ATOM   7250  N   ARG H  68      31.583  45.575 132.294  1.00 81.36           N  
ATOM   7251  CA  ARG H  68      32.716  45.064 133.072  1.00 82.55           C  
ATOM   7252  C   ARG H  68      33.612  46.168 133.647  1.00 83.70           C  
ATOM   7253  O   ARG H  68      34.105  46.054 134.774  1.00 83.60           O  
ATOM   7254  CB  ARG H  68      33.540  44.096 132.210  1.00 82.54           C  
ATOM   7255  CG  ARG H  68      34.618  43.323 132.958  1.00 82.78           C  
ATOM   7256  CD  ARG H  68      35.168  42.177 132.118  1.00 82.62           C  
ATOM   7257  NE  ARG H  68      34.235  41.053 132.038  1.00 82.69           N  
ATOM   7258  CZ  ARG H  68      34.148  40.074 132.937  1.00 82.81           C  
ATOM   7259  NH1 ARG H  68      34.938  40.064 134.005  1.00 82.46           N  
ATOM   7260  NH2 ARG H  68      33.263  39.101 132.768  1.00 82.92           N  
ATOM   7261  N   ASN H  69      33.804  47.234 132.872  1.00 84.96           N  
ATOM   7262  CA  ASN H  69      34.703  48.331 133.244  1.00 85.52           C  
ATOM   7263  C   ASN H  69      34.048  49.412 134.115  1.00 84.10           C  
ATOM   7264  O   ASN H  69      34.659  50.447 134.395  1.00 83.33           O  
ATOM   7265  CB  ASN H  69      35.306  48.971 131.983  1.00 87.37           C  
ATOM   7266  CG  ASN H  69      36.402  48.119 131.342  1.00 88.81           C  
ATOM   7267  OD1 ASN H  69      37.230  48.634 130.590  1.00 89.43           O  
ATOM   7268  ND2 ASN H  69      36.405  46.818 131.627  1.00 89.27           N  
ATOM   7269  N   SER H  70      32.813  49.161 134.548  1.00 83.02           N  
ATOM   7270  CA  SER H  70      32.026  50.153 135.283  1.00 81.22           C  
ATOM   7271  C   SER H  70      32.245  50.085 136.791  1.00 79.75           C  
ATOM   7272  O   SER H  70      32.825  49.127 137.304  1.00 78.79           O  
ATOM   7273  CB  SER H  70      30.534  50.000 134.965  1.00 81.55           C  
ATOM   7274  OG  SER H  70      29.988  48.845 135.580  1.00 81.36           O  
ATOM   7275  N   GLU H  71      31.769  51.116 137.486  1.00 79.39           N  
ATOM   7276  CA  GLU H  71      31.822  51.175 138.943  1.00 79.16           C  
ATOM   7277  C   GLU H  71      30.736  50.287 139.554  1.00 79.46           C  
ATOM   7278  O   GLU H  71      30.948  49.664 140.595  1.00 79.30           O  
ATOM   7279  CB  GLU H  71      31.672  52.625 139.426  1.00 78.53           C  
ATOM   7280  CG  GLU H  71      32.099  52.871 140.878  1.00 77.71           C  
ATOM   7281  CD  GLU H  71      33.594  52.698 141.105  1.00 77.28           C  
ATOM   7282  OE1 GLU H  71      34.391  53.187 140.276  1.00 77.67           O  
ATOM   7283  OE2 GLU H  71      33.971  52.080 142.123  1.00 76.61           O  
ATOM   7284  N   ARG H  72      29.582  50.226 138.891  1.00 80.39           N  
ATOM   7285  CA  ARG H  72      28.457  49.400 139.343  1.00 81.50           C  
ATOM   7286  C   ARG H  72      28.698  47.897 139.170  1.00 82.71           C  
ATOM   7287  O   ARG H  72      27.929  47.077 139.682  1.00 82.43           O  
ATOM   7288  CB  ARG H  72      27.166  49.809 138.631  1.00 81.23           C  
ATOM   7289  CG  ARG H  72      26.524  51.076 139.173  1.00 81.22           C  
ATOM   7290  CD  ARG H  72      25.073  51.173 138.735  1.00 81.46           C  
ATOM   7291  NE  ARG H  72      24.944  51.417 137.298  1.00 81.93           N  
ATOM   7292  CZ  ARG H  72      23.938  50.979 136.545  1.00 82.12           C  
ATOM   7293  NH1 ARG H  72      22.962  50.254 137.077  1.00 82.29           N  
ATOM   7294  NH2 ARG H  72      23.913  51.258 135.249  1.00 82.22           N  
ATOM   7295  N   PHE H  73      29.758  47.548 138.443  1.00 84.35           N  
ATOM   7296  CA  PHE H  73      30.185  46.157 138.275  1.00 85.64           C  
ATOM   7297  C   PHE H  73      30.727  45.584 139.586  1.00 86.53           C  
ATOM   7298  O   PHE H  73      30.623  44.381 139.838  1.00 86.87           O  
ATOM   7299  CB  PHE H  73      31.240  46.061 137.166  1.00 85.81           C  
ATOM   7300  CG  PHE H  73      31.726  44.663 136.900  1.00 85.81           C  
ATOM   7301  CD1 PHE H  73      30.960  43.775 136.151  1.00 86.13           C  
ATOM   7302  CD2 PHE H  73      32.958  44.238 137.390  1.00 85.91           C  
ATOM   7303  CE1 PHE H  73      31.409  42.480 135.902  1.00 86.51           C  
ATOM   7304  CE2 PHE H  73      33.417  42.946 137.147  1.00 86.28           C  
ATOM   7305  CZ  PHE H  73      32.642  42.065 136.400  1.00 86.38           C  
ATOM   7306  N   LYS H  74      31.296  46.460 140.412  1.00 86.88           N  
ATOM   7307  CA  LYS H  74      31.844  46.083 141.715  1.00 87.66           C  
ATOM   7308  C   LYS H  74      30.765  45.668 142.714  1.00 88.10           C  
ATOM   7309  O   LYS H  74      31.047  44.928 143.661  1.00 88.56           O  
ATOM   7310  CB  LYS H  74      32.677  47.229 142.295  1.00 87.97           C  
ATOM   7311  CG  LYS H  74      34.014  47.455 141.596  1.00 87.81           C  
ATOM   7312  CD  LYS H  74      34.710  48.715 142.100  1.00 87.50           C  
ATOM   7313  CE  LYS H  74      35.291  48.529 143.496  1.00 87.32           C  
ATOM   7314  NZ  LYS H  74      35.909  49.784 143.998  1.00 87.33           N  
ATOM   7315  N   GLU H  75      29.541  46.150 142.503  1.00 88.16           N  
ATOM   7316  CA  GLU H  75      28.397  45.784 143.340  1.00 88.67           C  
ATOM   7317  C   GLU H  75      28.058  44.302 143.191  1.00 86.46           C  
ATOM   7318  O   GLU H  75      27.576  43.670 144.133  1.00 86.19           O  
ATOM   7319  CB  GLU H  75      27.172  46.634 142.988  1.00 90.06           C  
ATOM   7320  CG  GLU H  75      27.305  48.118 143.324  1.00 90.81           C  
ATOM   7321  CD  GLU H  75      26.145  48.955 142.798  1.00 91.06           C  
ATOM   7322  OE1 GLU H  75      25.449  48.512 141.854  1.00 92.38           O  
ATOM   7323  OE2 GLU H  75      25.935  50.066 143.332  1.00 91.15           O  
ATOM   7324  N   LEU H  76      28.320  43.762 142.004  1.00 84.34           N  
ATOM   7325  CA  LEU H  76      28.039  42.365 141.690  1.00 82.23           C  
ATOM   7326  C   LEU H  76      29.069  41.441 142.333  1.00 80.67           C  
ATOM   7327  O   LEU H  76      30.269  41.720 142.302  1.00 80.87           O  
ATOM   7328  CB  LEU H  76      28.021  42.156 140.173  1.00 81.75           C  
ATOM   7329  CG  LEU H  76      27.197  43.141 139.339  1.00 80.91           C  
ATOM   7330  CD1 LEU H  76      27.704  43.184 137.909  1.00 80.48           C  
ATOM   7331  CD2 LEU H  76      25.714  42.800 139.384  1.00 81.38           C  
ATOM   7332  N   THR H  77      28.587  40.344 142.912  1.00 79.13           N  
ATOM   7333  CA  THR H  77      29.445  39.364 143.582  1.00 77.93           C  
ATOM   7334  C   THR H  77      29.094  37.932 143.139  1.00 75.41           C  
ATOM   7335  O   THR H  77      27.913  37.578 143.084  1.00 74.96           O  
ATOM   7336  CB  THR H  77      29.411  39.534 145.137  1.00 79.01           C  
ATOM   7337  OG1 THR H  77      30.201  38.516 145.765  1.00 79.42           O  
ATOM   7338  CG2 THR H  77      27.980  39.491 145.686  1.00 79.39           C  
ATOM   7339  N   PRO H  78      30.118  37.112 142.812  1.00 73.26           N  
ATOM   7340  CA  PRO H  78      29.876  35.792 142.219  1.00 71.65           C  
ATOM   7341  C   PRO H  78      29.175  34.836 143.173  1.00 70.38           C  
ATOM   7342  O   PRO H  78      29.530  34.764 144.350  1.00 70.27           O  
ATOM   7343  CB  PRO H  78      31.287  35.273 141.904  1.00 71.48           C  
ATOM   7344  CG  PRO H  78      32.184  36.458 141.988  1.00 71.43           C  
ATOM   7345  CD  PRO H  78      31.559  37.372 142.984  1.00 71.95           C  
ATOM   7346  N   ASN H  79      28.180  34.121 142.660  1.00 69.85           N  
ATOM   7347  CA  ASN H  79      27.473  33.115 143.437  1.00 70.14           C  
ATOM   7348  C   ASN H  79      28.233  31.791 143.374  1.00 70.44           C  
ATOM   7349  O   ASN H  79      28.314  31.164 142.315  1.00 71.27           O  
ATOM   7350  CB  ASN H  79      26.041  32.951 142.915  1.00 70.04           C  
ATOM   7351  CG  ASN H  79      25.086  32.378 143.956  1.00 70.56           C  
ATOM   7352  OD1 ASN H  79      23.907  32.727 143.977  1.00 71.57           O  
ATOM   7353  ND2 ASN H  79      25.586  31.498 144.818  1.00 70.61           N  
ATOM   7354  N   TYR H  80      28.797  31.378 144.508  1.00 70.11           N  
ATOM   7355  CA  TYR H  80      29.589  30.148 144.572  1.00 69.28           C  
ATOM   7356  C   TYR H  80      28.884  29.000 145.297  1.00 68.10           C  
ATOM   7357  O   TYR H  80      29.535  28.075 145.785  1.00 66.66           O  
ATOM   7358  CB  TYR H  80      30.966  30.418 145.189  1.00 70.47           C  
ATOM   7359  CG  TYR H  80      31.907  31.198 144.293  1.00 71.35           C  
ATOM   7360  CD1 TYR H  80      32.201  30.757 142.999  1.00 71.50           C  
ATOM   7361  CD2 TYR H  80      32.520  32.367 144.743  1.00 72.18           C  
ATOM   7362  CE1 TYR H  80      33.070  31.469 142.173  1.00 71.42           C  
ATOM   7363  CE2 TYR H  80      33.394  33.085 143.924  1.00 72.31           C  
ATOM   7364  CZ  TYR H  80      33.662  32.630 142.641  1.00 71.37           C  
ATOM   7365  OH  TYR H  80      34.522  33.332 141.827  1.00 70.84           O  
ATOM   7366  N   ASN H  81      27.555  29.063 145.347  1.00 68.98           N  
ATOM   7367  CA  ASN H  81      26.726  28.009 145.934  1.00 69.99           C  
ATOM   7368  C   ASN H  81      27.039  26.638 145.324  1.00 70.48           C  
ATOM   7369  O   ASN H  81      26.863  26.445 144.117  1.00 72.11           O  
ATOM   7370  CB  ASN H  81      25.240  28.351 145.747  1.00 70.14           C  
ATOM   7371  CG  ASN H  81      24.314  27.523 146.635  1.00 70.45           C  
ATOM   7372  OD1 ASN H  81      24.624  26.392 147.015  1.00 70.20           O  
ATOM   7373  ND2 ASN H  81      23.156  28.090 146.957  1.00 70.52           N  
ATOM   7374  N   PRO H  82      27.515  25.689 146.156  1.00 70.28           N  
ATOM   7375  CA  PRO H  82      27.851  24.334 145.702  1.00 70.45           C  
ATOM   7376  C   PRO H  82      26.637  23.504 145.269  1.00 71.00           C  
ATOM   7377  O   PRO H  82      26.802  22.451 144.651  1.00 70.90           O  
ATOM   7378  CB  PRO H  82      28.508  23.706 146.936  1.00 70.61           C  
ATOM   7379  CG  PRO H  82      27.947  24.457 148.087  1.00 70.27           C  
ATOM   7380  CD  PRO H  82      27.777  25.861 147.598  1.00 70.42           C  
ATOM   7381  N   ASP H  83      25.436  23.979 145.594  1.00 72.06           N  
ATOM   7382  CA  ASP H  83      24.197  23.294 145.222  1.00 74.08           C  
ATOM   7383  C   ASP H  83      23.580  23.846 143.926  1.00 74.92           C  
ATOM   7384  O   ASP H  83      22.431  23.531 143.587  1.00 74.46           O  
ATOM   7385  CB  ASP H  83      23.186  23.356 146.376  1.00 75.32           C  
ATOM   7386  CG  ASP H  83      23.642  22.577 147.604  1.00 77.23           C  
ATOM   7387  OD1 ASP H  83      24.264  21.503 147.448  1.00 78.16           O  
ATOM   7388  OD2 ASP H  83      23.366  23.035 148.734  1.00 77.55           O  
ATOM   7389  N   ILE H  84      24.346  24.669 143.210  1.00 75.09           N  
ATOM   7390  CA  ILE H  84      23.901  25.241 141.938  1.00 75.16           C  
ATOM   7391  C   ILE H  84      24.945  25.018 140.838  1.00 74.22           C  
ATOM   7392  O   ILE H  84      26.113  25.392 140.988  1.00 74.26           O  
ATOM   7393  CB  ILE H  84      23.543  26.756 142.060  1.00 75.48           C  
ATOM   7394  CG1 ILE H  84      22.572  26.993 143.225  1.00 75.21           C  
ATOM   7395  CG2 ILE H  84      22.954  27.288 140.741  1.00 75.28           C  
ATOM   7396  CD1 ILE H  84      22.320  28.453 143.564  1.00 75.46           C  
ATOM   7397  N   ILE H  85      24.509  24.394 139.746  1.00 72.45           N  
ATOM   7398  CA  ILE H  85      25.343  24.201 138.567  1.00 71.72           C  
ATOM   7399  C   ILE H  85      25.273  25.457 137.707  1.00 72.95           C  
ATOM   7400  O   ILE H  85      24.197  25.850 137.260  1.00 73.46           O  
ATOM   7401  CB  ILE H  85      24.887  22.967 137.729  1.00 70.74           C  
ATOM   7402  CG1 ILE H  85      24.775  21.705 138.600  1.00 71.07           C  
ATOM   7403  CG2 ILE H  85      25.805  22.740 136.519  1.00 69.63           C  
ATOM   7404  CD1 ILE H  85      26.088  21.221 139.222  1.00 71.92           C  
ATOM   7405  N   PHE H  86      26.420  26.095 137.499  1.00 74.01           N  
ATOM   7406  CA  PHE H  86      26.519  27.211 136.563  1.00 75.81           C  
ATOM   7407  C   PHE H  86      27.154  26.701 135.277  1.00 78.40           C  
ATOM   7408  O   PHE H  86      28.263  26.159 135.305  1.00 80.32           O  
ATOM   7409  CB  PHE H  86      27.340  28.359 137.158  1.00 75.11           C  
ATOM   7410  CG  PHE H  86      26.676  29.042 138.320  1.00 75.44           C  
ATOM   7411  CD1 PHE H  86      25.874  30.160 138.120  1.00 75.73           C  
ATOM   7412  CD2 PHE H  86      26.854  28.570 139.618  1.00 75.71           C  
ATOM   7413  CE1 PHE H  86      25.252  30.797 139.193  1.00 75.25           C  
ATOM   7414  CE2 PHE H  86      26.238  29.200 140.697  1.00 75.62           C  
ATOM   7415  CZ  PHE H  86      25.435  30.316 140.481  1.00 75.25           C  
ATOM   7416  N   LYS H  87      26.443  26.859 134.160  1.00 79.54           N  
ATOM   7417  CA  LYS H  87      26.897  26.341 132.867  1.00 79.63           C  
ATOM   7418  C   LYS H  87      28.232  26.956 132.461  1.00 80.13           C  
ATOM   7419  O   LYS H  87      29.137  26.244 132.019  1.00 79.60           O  
ATOM   7420  CB  LYS H  87      25.842  26.572 131.778  1.00 80.12           C  
ATOM   7421  CG  LYS H  87      26.060  25.756 130.507  1.00 79.66           C  
ATOM   7422  CD  LYS H  87      25.005  26.067 129.458  1.00 79.29           C  
ATOM   7423  CE  LYS H  87      25.129  25.136 128.262  1.00 78.99           C  
ATOM   7424  NZ  LYS H  87      24.126  25.450 127.210  1.00 78.15           N  
ATOM   7425  N   ASP H  88      28.346  28.274 132.635  1.00 81.54           N  
ATOM   7426  CA  ASP H  88      29.551  29.026 132.282  1.00 84.86           C  
ATOM   7427  C   ASP H  88      30.141  28.577 130.938  1.00 86.78           C  
ATOM   7428  O   ASP H  88      31.278  28.098 130.866  1.00 86.03           O  
ATOM   7429  CB  ASP H  88      30.593  28.947 133.407  1.00 86.86           C  
ATOM   7430  CG  ASP H  88      31.646  30.046 133.319  1.00 87.96           C  
ATOM   7431  OD1 ASP H  88      31.493  30.972 132.487  1.00 88.44           O  
ATOM   7432  OD2 ASP H  88      32.628  29.983 134.092  1.00 87.40           O  
ATOM   7433  N   GLU H  89      29.338  28.722 129.884  1.00 88.72           N  
ATOM   7434  CA  GLU H  89      29.767  28.454 128.513  1.00 89.50           C  
ATOM   7435  C   GLU H  89      30.738  29.541 128.044  1.00 89.16           C  
ATOM   7436  O   GLU H  89      31.642  29.281 127.245  1.00 87.93           O  
ATOM   7437  CB  GLU H  89      28.550  28.355 127.573  1.00 90.79           C  
ATOM   7438  CG  GLU H  89      27.874  29.692 127.186  1.00 91.38           C  
ATOM   7439  CD  GLU H  89      26.923  30.255 128.252  1.00 91.93           C  
ATOM   7440  OE1 GLU H  89      26.858  29.723 129.383  1.00 91.36           O  
ATOM   7441  OE2 GLU H  89      26.237  31.258 127.958  1.00 91.45           O  
ATOM   7442  N   GLU H  90      30.537  30.751 128.569  1.00 90.03           N  
ATOM   7443  CA  GLU H  90      31.350  31.925 128.254  1.00 91.27           C  
ATOM   7444  C   GLU H  90      32.795  31.757 128.731  1.00 92.55           C  
ATOM   7445  O   GLU H  90      33.709  32.401 128.203  1.00 92.36           O  
ATOM   7446  CB  GLU H  90      30.740  33.188 128.887  1.00 91.07           C  
ATOM   7447  CG  GLU H  90      29.284  33.504 128.496  1.00 90.93           C  
ATOM   7448  CD  GLU H  90      28.245  33.014 129.514  1.00 91.33           C  
ATOM   7449  OE1 GLU H  90      28.406  31.912 130.077  1.00 91.76           O  
ATOM   7450  OE2 GLU H  90      27.240  33.727 129.742  1.00 91.24           O  
ATOM   7451  N   ASN H  91      32.980  30.888 129.729  1.00 94.02           N  
ATOM   7452  CA  ASN H  91      34.273  30.627 130.380  1.00 95.05           C  
ATOM   7453  C   ASN H  91      34.865  31.863 131.074  1.00 96.04           C  
ATOM   7454  O   ASN H  91      36.078  31.964 131.282  1.00 96.06           O  
ATOM   7455  CB  ASN H  91      35.271  29.981 129.404  1.00 94.82           C  
ATOM   7456  CG  ASN H  91      36.359  29.189 130.112  1.00 95.35           C  
ATOM   7457  OD1 ASN H  91      37.531  29.269 129.746  1.00 96.17           O  
ATOM   7458  ND2 ASN H  91      35.975  28.422 131.131  1.00 94.95           N  
ATOM   7459  N   THR H  92      33.983  32.791 131.444  1.00 97.12           N  
ATOM   7460  CA  THR H  92      34.368  34.044 132.097  1.00 97.37           C  
ATOM   7461  C   THR H  92      33.875  34.115 133.546  1.00 96.58           C  
ATOM   7462  O   THR H  92      34.305  34.979 134.314  1.00 96.58           O  
ATOM   7463  CB  THR H  92      33.844  35.281 131.316  1.00 97.98           C  
ATOM   7464  OG1 THR H  92      32.433  35.154 131.090  1.00 98.15           O  
ATOM   7465  CG2 THR H  92      34.566  35.429 129.977  1.00 98.04           C  
ATOM   7466  N   GLY H  93      32.979  33.200 133.911  1.00 95.54           N  
ATOM   7467  CA  GLY H  93      32.349  33.202 135.230  1.00 94.02           C  
ATOM   7468  C   GLY H  93      31.249  34.243 135.329  1.00 93.06           C  
ATOM   7469  O   GLY H  93      30.838  34.620 136.428  1.00 93.04           O  
ATOM   7470  N   ALA H  94      30.772  34.699 134.171  1.00 92.23           N  
ATOM   7471  CA  ALA H  94      29.758  35.746 134.087  1.00 91.02           C  
ATOM   7472  C   ALA H  94      28.424  35.308 134.687  1.00 90.39           C  
ATOM   7473  O   ALA H  94      27.754  36.098 135.358  1.00 89.95           O  
ATOM   7474  CB  ALA H  94      29.576  36.190 132.639  1.00 90.99           C  
ATOM   7475  N   ASP H  95      28.057  34.047 134.453  1.00 89.98           N  
ATOM   7476  CA  ASP H  95      26.772  33.497 134.901  1.00 89.40           C  
ATOM   7477  C   ASP H  95      26.598  33.530 136.422  1.00 87.69           C  
ATOM   7478  O   ASP H  95      25.470  33.526 136.918  1.00 88.40           O  
ATOM   7479  CB  ASP H  95      26.576  32.063 134.383  1.00 90.51           C  
ATOM   7480  CG  ASP H  95      26.456  31.984 132.861  1.00 90.95           C  
ATOM   7481  OD1 ASP H  95      26.097  32.992 132.210  1.00 90.99           O  
ATOM   7482  OD2 ASP H  95      26.715  30.893 132.309  1.00 91.17           O  
ATOM   7483  N   ARG H  96      27.714  33.566 137.149  1.00 85.36           N  
ATOM   7484  CA  ARG H  96      27.699  33.576 138.617  1.00 83.31           C  
ATOM   7485  C   ARG H  96      27.364  34.942 139.210  1.00 82.28           C  
ATOM   7486  O   ARG H  96      26.800  35.024 140.304  1.00 82.00           O  
ATOM   7487  CB  ARG H  96      29.041  33.095 139.178  1.00 82.19           C  
ATOM   7488  CG  ARG H  96      29.357  31.646 138.880  1.00 80.94           C  
ATOM   7489  CD  ARG H  96      30.726  31.265 139.406  1.00 80.56           C  
ATOM   7490  NE  ARG H  96      31.088  29.905 139.016  1.00 80.88           N  
ATOM   7491  CZ  ARG H  96      30.728  28.805 139.674  1.00 81.33           C  
ATOM   7492  NH1 ARG H  96      29.990  28.883 140.776  1.00 82.00           N  
ATOM   7493  NH2 ARG H  96      31.110  27.618 139.224  1.00 81.19           N  
ATOM   7494  N   LEU H  97      27.720  36.005 138.491  1.00 81.51           N  
ATOM   7495  CA  LEU H  97      27.532  37.375 138.975  1.00 80.80           C  
ATOM   7496  C   LEU H  97      26.063  37.795 138.985  1.00 80.23           C  
ATOM   7497  O   LEU H  97      25.348  37.625 137.992  1.00 80.96           O  
ATOM   7498  CB  LEU H  97      28.369  38.364 138.156  1.00 80.52           C  
ATOM   7499  CG  LEU H  97      29.895  38.304 138.287  1.00 80.25           C  
ATOM   7500  CD1 LEU H  97      30.556  39.044 137.134  1.00 80.36           C  
ATOM   7501  CD2 LEU H  97      30.371  38.859 139.625  1.00 79.84           C  
ATOM   7502  N   MET H  98      25.632  38.340 140.122  1.00 78.70           N  
ATOM   7503  CA  MET H  98      24.253  38.785 140.335  1.00 78.34           C  
ATOM   7504  C   MET H  98      24.169  39.733 141.536  1.00 78.50           C  
ATOM   7505  O   MET H  98      25.114  39.828 142.326  1.00 79.23           O  
ATOM   7506  CB  MET H  98      23.309  37.583 140.522  1.00 78.23           C  
ATOM   7507  CG  MET H  98      23.754  36.565 141.576  1.00 78.86           C  
ATOM   7508  SD  MET H  98      22.769  35.046 141.613  1.00 78.90           S  
ATOM   7509  CE  MET H  98      23.378  34.200 140.153  1.00 78.16           C  
ATOM   7510  N   THR H  99      23.044  40.437 141.665  1.00 77.74           N  
ATOM   7511  CA  THR H  99      22.809  41.307 142.822  1.00 77.00           C  
ATOM   7512  C   THR H  99      22.547  40.464 144.072  1.00 77.36           C  
ATOM   7513  O   THR H  99      22.224  39.277 143.968  1.00 77.47           O  
ATOM   7514  CB  THR H  99      21.635  42.304 142.595  1.00 75.69           C  
ATOM   7515  OG1 THR H  99      20.415  41.586 142.377  1.00 75.50           O  
ATOM   7516  CG2 THR H  99      21.910  43.224 141.410  1.00 74.30           C  
ATOM   7517  N   GLN H 100      22.693  41.079 145.244  1.00 77.36           N  
ATOM   7518  CA  GLN H 100      22.461  40.397 146.520  1.00 78.78           C  
ATOM   7519  C   GLN H 100      21.065  39.773 146.598  1.00 81.03           C  
ATOM   7520  O   GLN H 100      20.904  38.676 147.139  1.00 81.92           O  
ATOM   7521  CB  GLN H 100      22.695  41.357 147.698  1.00 77.49           C  
ATOM   7522  CG  GLN H 100      22.604  40.719 149.090  1.00 75.36           C  
ATOM   7523  CD  GLN H 100      23.597  39.586 149.298  1.00 74.74           C  
ATOM   7524  OE1 GLN H 100      24.773  39.700 148.951  1.00 74.96           O  
ATOM   7525  NE2 GLN H 100      23.123  38.487 149.873  1.00 74.06           N  
ATOM   7526  N   ARG H 101      20.071  40.470 146.046  1.00 82.81           N  
ATOM   7527  CA  ARG H 101      18.686  39.991 146.032  1.00 84.12           C  
ATOM   7528  C   ARG H 101      18.526  38.730 145.179  1.00 82.73           C  
ATOM   7529  O   ARG H 101      17.890  37.764 145.608  1.00 82.97           O  
ATOM   7530  CB  ARG H 101      17.723  41.092 145.566  1.00 85.00           C  
ATOM   7531  CG  ARG H 101      16.249  40.713 145.690  1.00 86.15           C  
ATOM   7532  CD  ARG H 101      15.317  41.897 145.475  1.00 86.33           C  
ATOM   7533  NE  ARG H 101      13.912  41.486 145.508  1.00 87.25           N  
ATOM   7534  CZ  ARG H 101      13.164  41.420 146.608  1.00 87.00           C  
ATOM   7535  NH1 ARG H 101      13.671  41.743 147.793  1.00 86.70           N  
ATOM   7536  NH2 ARG H 101      11.900  41.029 146.522  1.00 87.01           N  
ATOM   7537  N   CYS H 102      19.110  38.747 143.982  1.00 81.25           N  
ATOM   7538  CA  CYS H 102      19.078  37.595 143.080  1.00 80.13           C  
ATOM   7539  C   CYS H 102      19.728  36.365 143.720  1.00 79.30           C  
ATOM   7540  O   CYS H 102      19.263  35.242 143.521  1.00 78.20           O  
ATOM   7541  CB  CYS H 102      19.755  37.936 141.751  1.00 80.22           C  
ATOM   7542  SG  CYS H 102      19.532  36.702 140.451  1.00 80.32           S  
ATOM   7543  N   LYS H 103      20.794  36.592 144.490  1.00 79.03           N  
ATOM   7544  CA  LYS H 103      21.458  35.535 145.257  1.00 78.66           C  
ATOM   7545  C   LYS H 103      20.476  34.865 146.207  1.00 77.61           C  
ATOM   7546  O   LYS H 103      20.281  33.649 146.154  1.00 76.81           O  
ATOM   7547  CB  LYS H 103      22.631  36.098 146.070  1.00 78.19           C  
ATOM   7548  CG  LYS H 103      23.832  36.542 145.254  1.00 78.88           C  
ATOM   7549  CD  LYS H 103      24.972  37.012 146.148  1.00 79.41           C  
ATOM   7550  CE  LYS H 103      25.921  35.875 146.527  1.00 80.84           C  
ATOM   7551  NZ  LYS H 103      25.320  34.878 147.457  1.00 81.31           N  
ATOM   7552  N   ASP H 104      19.856  35.679 147.060  1.00 77.77           N  
ATOM   7553  CA  ASP H 104      18.964  35.203 148.119  1.00 78.25           C  
ATOM   7554  C   ASP H 104      17.827  34.337 147.580  1.00 77.90           C  
ATOM   7555  O   ASP H 104      17.543  33.270 148.127  1.00 78.09           O  
ATOM   7556  CB  ASP H 104      18.402  36.382 148.933  1.00 78.08           C  
ATOM   7557  CG  ASP H 104      19.486  37.178 149.658  1.00 77.15           C  
ATOM   7558  OD1 ASP H 104      20.513  36.589 150.063  1.00 76.33           O  
ATOM   7559  OD2 ASP H 104      19.302  38.402 149.831  1.00 76.58           O  
ATOM   7560  N   LYS H 105      17.193  34.793 146.504  1.00 77.29           N  
ATOM   7561  CA  LYS H 105      16.090  34.057 145.895  1.00 77.35           C  
ATOM   7562  C   LYS H 105      16.576  32.768 145.234  1.00 78.73           C  
ATOM   7563  O   LYS H 105      15.925  31.726 145.352  1.00 78.60           O  
ATOM   7564  CB  LYS H 105      15.333  34.932 144.885  1.00 76.36           C  
ATOM   7565  CG  LYS H 105      14.832  36.271 145.434  1.00 75.39           C  
ATOM   7566  CD  LYS H 105      13.925  36.092 146.643  1.00 75.15           C  
ATOM   7567  CE  LYS H 105      13.572  37.424 147.273  1.00 74.90           C  
ATOM   7568  NZ  LYS H 105      12.769  37.236 148.510  1.00 75.46           N  
ATOM   7569  N   LEU H 106      17.726  32.846 144.558  1.00 79.97           N  
ATOM   7570  CA  LEU H 106      18.298  31.705 143.831  1.00 80.52           C  
ATOM   7571  C   LEU H 106      18.807  30.614 144.770  1.00 80.50           C  
ATOM   7572  O   LEU H 106      18.647  29.423 144.488  1.00 81.12           O  
ATOM   7573  CB  LEU H 106      19.427  32.156 142.892  1.00 80.20           C  
ATOM   7574  CG  LEU H 106      19.885  31.175 141.803  1.00 79.24           C  
ATOM   7575  CD1 LEU H 106      18.952  31.217 140.602  1.00 78.87           C  
ATOM   7576  CD2 LEU H 106      21.311  31.465 141.372  1.00 78.69           C  
ATOM   7577  N   ASN H 107      19.424  31.023 145.875  1.00 79.52           N  
ATOM   7578  CA  ASN H 107      19.903  30.075 146.870  1.00 80.16           C  
ATOM   7579  C   ASN H 107      18.748  29.381 147.583  1.00 79.97           C  
ATOM   7580  O   ASN H 107      18.847  28.203 147.926  1.00 80.26           O  
ATOM   7581  CB  ASN H 107      20.838  30.757 147.870  1.00 81.68           C  
ATOM   7582  CG  ASN H 107      22.124  31.254 147.226  1.00 82.46           C  
ATOM   7583  OD1 ASN H 107      22.504  30.814 146.139  1.00 82.37           O  
ATOM   7584  ND2 ASN H 107      22.801  32.176 147.898  1.00 83.01           N  
ATOM   7585  N   ALA H 108      17.657  30.119 147.788  1.00 79.79           N  
ATOM   7586  CA  ALA H 108      16.429  29.568 148.363  1.00 80.06           C  
ATOM   7587  C   ALA H 108      15.803  28.551 147.415  1.00 79.74           C  
ATOM   7588  O   ALA H 108      15.273  27.527 147.852  1.00 81.35           O  
ATOM   7589  CB  ALA H 108      15.439  30.682 148.677  1.00 80.09           C  
ATOM   7590  N   LEU H 109      15.878  28.850 146.119  1.00 77.59           N  
ATOM   7591  CA  LEU H 109      15.381  27.973 145.063  1.00 75.42           C  
ATOM   7592  C   LEU H 109      16.190  26.677 144.970  1.00 75.01           C  
ATOM   7593  O   LEU H 109      15.627  25.606 144.731  1.00 75.01           O  
ATOM   7594  CB  LEU H 109      15.388  28.721 143.723  1.00 74.13           C  
ATOM   7595  CG  LEU H 109      14.966  28.043 142.416  1.00 73.09           C  
ATOM   7596  CD1 LEU H 109      13.620  27.346 142.522  1.00 71.45           C  
ATOM   7597  CD2 LEU H 109      14.941  29.080 141.310  1.00 74.46           C  
ATOM   7598  N   ALA H 110      17.504  26.783 145.168  1.00 73.98           N  
ATOM   7599  CA  ALA H 110      18.396  25.624 145.155  1.00 72.00           C  
ATOM   7600  C   ALA H 110      17.929  24.557 146.140  1.00 70.58           C  
ATOM   7601  O   ALA H 110      17.873  23.373 145.800  1.00 70.05           O  
ATOM   7602  CB  ALA H 110      19.822  26.049 145.468  1.00 71.62           C  
ATOM   7603  N   ILE H 111      17.578  25.001 147.347  1.00 69.93           N  
ATOM   7604  CA  ILE H 111      17.131  24.127 148.436  1.00 69.82           C  
ATOM   7605  C   ILE H 111      15.826  23.399 148.091  1.00 70.56           C  
ATOM   7606  O   ILE H 111      15.691  22.203 148.359  1.00 71.35           O  
ATOM   7607  CB  ILE H 111      16.957  24.909 149.775  1.00 68.38           C  
ATOM   7608  CG1 ILE H 111      18.155  25.830 150.035  1.00 66.76           C  
ATOM   7609  CG2 ILE H 111      16.763  23.944 150.948  1.00 68.31           C  
ATOM   7610  CD1 ILE H 111      17.847  27.023 150.925  1.00 65.36           C  
ATOM   7611  N   SER H 112      14.879  24.122 147.495  1.00 70.92           N  
ATOM   7612  CA  SER H 112      13.578  23.551 147.138  1.00 70.73           C  
ATOM   7613  C   SER H 112      13.637  22.598 145.937  1.00 70.29           C  
ATOM   7614  O   SER H 112      12.860  21.643 145.873  1.00 70.07           O  
ATOM   7615  CB  SER H 112      12.531  24.651 146.914  1.00 70.84           C  
ATOM   7616  OG  SER H 112      12.884  25.503 145.838  1.00 71.04           O  
ATOM   7617  N   VAL H 113      14.550  22.854 144.999  1.00 69.84           N  
ATOM   7618  CA  VAL H 113      14.731  21.972 143.839  1.00 70.69           C  
ATOM   7619  C   VAL H 113      15.310  20.621 144.279  1.00 71.09           C  
ATOM   7620  O   VAL H 113      14.843  19.568 143.842  1.00 71.11           O  
ATOM   7621  CB  VAL H 113      15.582  22.632 142.704  1.00 70.92           C  
ATOM   7622  CG1 VAL H 113      15.902  21.631 141.589  1.00 69.88           C  
ATOM   7623  CG2 VAL H 113      14.854  23.830 142.113  1.00 70.19           C  
ATOM   7624  N   MET H 114      16.304  20.660 145.163  1.00 72.07           N  
ATOM   7625  CA  MET H 114      16.872  19.446 145.753  1.00 73.72           C  
ATOM   7626  C   MET H 114      15.855  18.662 146.590  1.00 75.66           C  
ATOM   7627  O   MET H 114      15.980  17.445 146.751  1.00 74.99           O  
ATOM   7628  CB  MET H 114      18.095  19.789 146.600  1.00 73.49           C  
ATOM   7629  CG  MET H 114      19.375  19.950 145.799  1.00 73.41           C  
ATOM   7630  SD  MET H 114      20.757  20.546 146.791  1.00 73.29           S  
ATOM   7631  CE  MET H 114      21.024  19.175 147.921  1.00 73.65           C  
ATOM   7632  N   ASN H 115      14.857  19.371 147.117  1.00 78.41           N  
ATOM   7633  CA  ASN H 115      13.772  18.765 147.892  1.00 80.37           C  
ATOM   7634  C   ASN H 115      12.672  18.170 147.006  1.00 80.57           C  
ATOM   7635  O   ASN H 115      12.133  17.104 147.309  1.00 80.98           O  
ATOM   7636  CB  ASN H 115      13.174  19.792 148.863  1.00 81.52           C  
ATOM   7637  CG  ASN H 115      12.067  19.210 149.728  1.00 82.72           C  
ATOM   7638  OD1 ASN H 115      12.319  18.397 150.620  1.00 83.35           O  
ATOM   7639  ND2 ASN H 115      10.834  19.633 149.472  1.00 83.03           N  
ATOM   7640  N   GLN H 116      12.346  18.867 145.919  1.00 80.29           N  
ATOM   7641  CA  GLN H 116      11.332  18.415 144.967  1.00 80.47           C  
ATOM   7642  C   GLN H 116      11.796  17.167 144.218  1.00 79.40           C  
ATOM   7643  O   GLN H 116      11.056  16.188 144.104  1.00 77.75           O  
ATOM   7644  CB  GLN H 116      10.997  19.540 143.978  1.00 82.10           C  
ATOM   7645  CG  GLN H 116       9.791  19.276 143.075  1.00 83.10           C  
ATOM   7646  CD  GLN H 116       8.463  19.290 143.819  1.00 83.66           C  
ATOM   7647  OE1 GLN H 116       8.328  19.908 144.879  1.00 83.44           O  
ATOM   7648  NE2 GLN H 116       7.470  18.609 143.257  1.00 84.01           N  
ATOM   7649  N   TRP H 117      13.025  17.219 143.709  1.00 79.86           N  
ATOM   7650  CA  TRP H 117      13.632  16.093 143.012  1.00 80.40           C  
ATOM   7651  C   TRP H 117      14.978  15.749 143.655  1.00 80.06           C  
ATOM   7652  O   TRP H 117      15.941  16.513 143.533  1.00 80.02           O  
ATOM   7653  CB  TRP H 117      13.816  16.406 141.520  1.00 81.32           C  
ATOM   7654  CG  TRP H 117      12.575  16.898 140.827  1.00 81.70           C  
ATOM   7655  CD1 TRP H 117      11.482  16.156 140.478  1.00 81.90           C  
ATOM   7656  CD2 TRP H 117      12.308  18.237 140.385  1.00 81.85           C  
ATOM   7657  NE1 TRP H 117      10.549  16.951 139.852  1.00 81.98           N  
ATOM   7658  CE2 TRP H 117      11.029  18.232 139.783  1.00 81.81           C  
ATOM   7659  CE3 TRP H 117      13.023  19.442 140.444  1.00 81.64           C  
ATOM   7660  CZ2 TRP H 117      10.448  19.384 139.241  1.00 81.33           C  
ATOM   7661  CZ3 TRP H 117      12.444  20.590 139.904  1.00 81.65           C  
ATOM   7662  CH2 TRP H 117      11.168  20.550 139.311  1.00 81.48           C  
ATOM   7663  N   PRO H 118      15.040  14.610 144.372  1.00 79.73           N  
ATOM   7664  CA  PRO H 118      16.301  14.126 144.935  1.00 79.27           C  
ATOM   7665  C   PRO H 118      17.328  13.815 143.846  1.00 78.92           C  
ATOM   7666  O   PRO H 118      16.967  13.328 142.769  1.00 78.44           O  
ATOM   7667  CB  PRO H 118      15.891  12.839 145.663  1.00 79.21           C  
ATOM   7668  CG  PRO H 118      14.425  12.979 145.901  1.00 79.02           C  
ATOM   7669  CD  PRO H 118      13.913  13.722 144.714  1.00 79.58           C  
ATOM   7670  N   GLY H 119      18.594  14.112 144.129  1.00 78.51           N  
ATOM   7671  CA  GLY H 119      19.682  13.883 143.181  1.00 78.25           C  
ATOM   7672  C   GLY H 119      19.691  14.862 142.022  1.00 78.34           C  
ATOM   7673  O   GLY H 119      20.434  14.680 141.058  1.00 78.33           O  
ATOM   7674  N   VAL H 120      18.860  15.898 142.120  1.00 78.66           N  
ATOM   7675  CA  VAL H 120      18.751  16.925 141.084  1.00 79.47           C  
ATOM   7676  C   VAL H 120      18.976  18.316 141.686  1.00 79.78           C  
ATOM   7677  O   VAL H 120      18.468  18.627 142.769  1.00 79.05           O  
ATOM   7678  CB  VAL H 120      17.385  16.840 140.332  1.00 79.40           C  
ATOM   7679  CG1 VAL H 120      17.086  18.121 139.554  1.00 78.68           C  
ATOM   7680  CG2 VAL H 120      17.364  15.631 139.395  1.00 79.33           C  
ATOM   7681  N   LYS H 121      19.752  19.133 140.976  1.00 80.34           N  
ATOM   7682  CA  LYS H 121      20.089  20.486 141.413  1.00 80.15           C  
ATOM   7683  C   LYS H 121      19.604  21.543 140.420  1.00 80.13           C  
ATOM   7684  O   LYS H 121      19.292  21.235 139.267  1.00 79.33           O  
ATOM   7685  CB  LYS H 121      21.602  20.619 141.616  1.00 79.59           C  
ATOM   7686  CG  LYS H 121      22.161  19.756 142.734  1.00 80.24           C  
ATOM   7687  CD  LYS H 121      23.679  19.833 142.799  1.00 80.38           C  
ATOM   7688  CE  LYS H 121      24.223  18.936 143.901  1.00 80.49           C  
ATOM   7689  NZ  LYS H 121      25.711  18.941 143.941  1.00 80.59           N  
ATOM   7690  N   LEU H 122      19.541  22.787 140.888  1.00 80.31           N  
ATOM   7691  CA  LEU H 122      19.213  23.932 140.048  1.00 79.64           C  
ATOM   7692  C   LEU H 122      20.412  24.300 139.174  1.00 79.66           C  
ATOM   7693  O   LEU H 122      21.530  24.453 139.670  1.00 79.47           O  
ATOM   7694  CB  LEU H 122      18.800  25.119 140.923  1.00 79.49           C  
ATOM   7695  CG  LEU H 122      18.500  26.476 140.281  1.00 80.12           C  
ATOM   7696  CD1 LEU H 122      17.113  26.501 139.654  1.00 79.47           C  
ATOM   7697  CD2 LEU H 122      18.632  27.576 141.320  1.00 80.62           C  
ATOM   7698  N   ARG H 123      20.166  24.437 137.874  1.00 79.85           N  
ATOM   7699  CA  ARG H 123      21.213  24.753 136.905  1.00 79.19           C  
ATOM   7700  C   ARG H 123      21.004  26.143 136.301  1.00 78.83           C  
ATOM   7701  O   ARG H 123      19.882  26.513 135.950  1.00 78.78           O  
ATOM   7702  CB  ARG H 123      21.255  23.680 135.814  1.00 78.99           C  
ATOM   7703  CG  ARG H 123      22.395  23.811 134.822  1.00 80.09           C  
ATOM   7704  CD  ARG H 123      22.508  22.554 133.983  1.00 81.89           C  
ATOM   7705  NE  ARG H 123      23.238  22.778 132.737  1.00 84.70           N  
ATOM   7706  CZ  ARG H 123      22.677  23.146 131.585  1.00 87.39           C  
ATOM   7707  NH1 ARG H 123      21.365  23.342 131.499  1.00 87.86           N  
ATOM   7708  NH2 ARG H 123      23.431  23.318 130.510  1.00 88.23           N  
ATOM   7709  N   VAL H 124      22.093  26.904 136.195  1.00 78.04           N  
ATOM   7710  CA  VAL H 124      22.066  28.253 135.631  1.00 77.76           C  
ATOM   7711  C   VAL H 124      22.785  28.268 134.282  1.00 79.03           C  
ATOM   7712  O   VAL H 124      23.911  27.781 134.169  1.00 78.83           O  
ATOM   7713  CB  VAL H 124      22.698  29.288 136.604  1.00 76.17           C  
ATOM   7714  CG1 VAL H 124      22.920  30.636 135.921  1.00 75.21           C  
ATOM   7715  CG2 VAL H 124      21.829  29.458 137.841  1.00 75.96           C  
ATOM   7716  N   THR H 125      22.118  28.816 133.265  1.00 80.13           N  
ATOM   7717  CA  THR H 125      22.685  28.938 131.916  1.00 80.61           C  
ATOM   7718  C   THR H 125      23.126  30.376 131.642  1.00 81.76           C  
ATOM   7719  O   THR H 125      24.144  30.622 130.968  1.00 85.25           O  
ATOM   7720  CB  THR H 125      21.681  28.484 130.831  1.00 80.28           C  
ATOM   7721  OG1 THR H 125      20.397  29.069 131.083  1.00 80.86           O  
ATOM   7722  CG2 THR H 125      21.543  26.966 130.823  1.00 79.78           C  
ATOM   7723  N   GLU H 126      22.350  31.318 132.174  1.00 81.38           N  
ATOM   7724  CA  GLU H 126      22.677  32.736 132.108  1.00 82.53           C  
ATOM   7725  C   GLU H 126      22.405  33.435 133.433  1.00 81.75           C  
ATOM   7726  O   GLU H 126      21.457  33.097 134.146  1.00 81.08           O  
ATOM   7727  CB  GLU H 126      21.893  33.430 130.988  1.00 84.83           C  
ATOM   7728  CG  GLU H 126      22.422  33.191 129.577  1.00 87.51           C  
ATOM   7729  CD  GLU H 126      23.689  33.976 129.258  1.00 89.57           C  
ATOM   7730  OE1 GLU H 126      23.607  34.934 128.457  1.00 90.02           O  
ATOM   7731  OE2 GLU H 126      24.768  33.634 129.799  1.00 91.38           O  
ATOM   7732  N   GLY H 127      23.257  34.405 133.753  1.00 81.38           N  
ATOM   7733  CA  GLY H 127      23.044  35.314 134.874  1.00 80.97           C  
ATOM   7734  C   GLY H 127      23.248  36.727 134.369  1.00 79.72           C  
ATOM   7735  O   GLY H 127      22.409  37.260 133.640  1.00 78.47           O  
ATOM   7736  N   TRP H 128      24.368  37.332 134.755  1.00 78.87           N  
ATOM   7737  CA  TRP H 128      24.803  38.586 134.154  1.00 76.90           C  
ATOM   7738  C   TRP H 128      25.296  38.288 132.740  1.00 77.18           C  
ATOM   7739  O   TRP H 128      25.898  37.241 132.489  1.00 76.59           O  
ATOM   7740  CB  TRP H 128      25.894  39.249 135.001  1.00 74.23           C  
ATOM   7741  CG  TRP H 128      26.438  40.524 134.416  1.00 73.39           C  
ATOM   7742  CD1 TRP H 128      25.811  41.737 134.357  1.00 73.04           C  
ATOM   7743  CD2 TRP H 128      27.724  40.708 133.811  1.00 73.55           C  
ATOM   7744  NE1 TRP H 128      26.626  42.663 133.749  1.00 72.65           N  
ATOM   7745  CE2 TRP H 128      27.806  42.059 133.405  1.00 73.08           C  
ATOM   7746  CE3 TRP H 128      28.816  39.861 133.571  1.00 74.15           C  
ATOM   7747  CZ2 TRP H 128      28.939  42.584 132.770  1.00 73.58           C  
ATOM   7748  CZ3 TRP H 128      29.943  40.385 132.940  1.00 73.71           C  
ATOM   7749  CH2 TRP H 128      29.993  41.734 132.548  1.00 73.71           C  
ATOM   7750  N   ASP H 129      25.019  39.201 131.815  1.00 78.07           N  
ATOM   7751  CA  ASP H 129      25.372  39.003 130.416  1.00 79.19           C  
ATOM   7752  C   ASP H 129      26.115  40.207 129.855  1.00 79.25           C  
ATOM   7753  O   ASP H 129      25.730  41.355 130.090  1.00 78.07           O  
ATOM   7754  CB  ASP H 129      24.114  38.722 129.586  1.00 81.39           C  
ATOM   7755  CG  ASP H 129      24.426  38.352 128.140  1.00 82.73           C  
ATOM   7756  OD1 ASP H 129      24.990  37.261 127.907  1.00 85.90           O  
ATOM   7757  OD2 ASP H 129      24.087  39.145 127.233  1.00 81.35           O  
ATOM   7758  N   GLU H 130      27.184  39.928 129.117  1.00 80.88           N  
ATOM   7759  CA  GLU H 130      27.937  40.959 128.405  1.00 82.86           C  
ATOM   7760  C   GLU H 130      27.955  40.694 126.899  1.00 83.15           C  
ATOM   7761  O   GLU H 130      28.396  41.540 126.117  1.00 83.15           O  
ATOM   7762  CB  GLU H 130      29.366  41.078 128.960  1.00 83.90           C  
ATOM   7763  CG  GLU H 130      30.171  39.772 129.001  1.00 84.01           C  
ATOM   7764  CD  GLU H 130      31.539  39.936 129.654  1.00 83.66           C  
ATOM   7765  OE1 GLU H 130      32.040  41.079 129.730  1.00 83.60           O  
ATOM   7766  OE2 GLU H 130      32.117  38.916 130.089  1.00 83.72           O  
ATOM   7767  N   ASP H 131      27.462  39.517 126.510  1.00 83.94           N  
ATOM   7768  CA  ASP H 131      27.450  39.067 125.113  1.00 83.13           C  
ATOM   7769  C   ASP H 131      26.411  39.814 124.274  1.00 81.15           C  
ATOM   7770  O   ASP H 131      26.557  39.927 123.056  1.00 79.62           O  
ATOM   7771  CB  ASP H 131      27.176  37.557 125.034  1.00 85.12           C  
ATOM   7772  CG  ASP H 131      27.964  36.751 126.064  1.00 87.18           C  
ATOM   7773  OD1 ASP H 131      29.213  36.821 126.059  1.00 87.46           O  
ATOM   7774  OD2 ASP H 131      27.326  36.037 126.874  1.00 89.59           O  
ATOM   7775  N   GLY H 132      25.369  40.318 124.935  1.00 80.37           N  
ATOM   7776  CA  GLY H 132      24.250  40.981 124.263  1.00 77.73           C  
ATOM   7777  C   GLY H 132      23.217  39.986 123.766  1.00 75.98           C  
ATOM   7778  O   GLY H 132      22.492  40.261 122.812  1.00 75.89           O  
ATOM   7779  N   HIS H 133      23.143  38.835 124.430  1.00 75.41           N  
ATOM   7780  CA  HIS H 133      22.294  37.721 124.002  1.00 73.95           C  
ATOM   7781  C   HIS H 133      20.863  37.793 124.544  1.00 74.57           C  
ATOM   7782  O   HIS H 133      20.186  36.770 124.666  1.00 74.19           O  
ATOM   7783  CB  HIS H 133      22.939  36.383 124.394  1.00 71.72           C  
ATOM   7784  CG  HIS H 133      24.078  35.972 123.512  1.00 69.47           C  
ATOM   7785  ND1 HIS H 133      25.050  35.084 123.920  1.00 67.88           N  
ATOM   7786  CD2 HIS H 133      24.402  36.329 122.246  1.00 69.03           C  
ATOM   7787  CE1 HIS H 133      25.920  34.908 122.943  1.00 68.81           C  
ATOM   7788  NE2 HIS H 133      25.551  35.653 121.916  1.00 69.58           N  
ATOM   7789  N   HIS H 134      20.402  38.998 124.865  1.00 76.06           N  
ATOM   7790  CA  HIS H 134      19.075  39.181 125.453  1.00 76.96           C  
ATOM   7791  C   HIS H 134      18.343  40.385 124.843  1.00 77.48           C  
ATOM   7792  O   HIS H 134      18.779  40.924 123.817  1.00 77.55           O  
ATOM   7793  CB  HIS H 134      19.181  39.292 126.978  1.00 76.83           C  
ATOM   7794  CG  HIS H 134      19.813  38.099 127.629  1.00 78.03           C  
ATOM   7795  ND1 HIS H 134      19.083  37.027 128.096  1.00 78.52           N  
ATOM   7796  CD2 HIS H 134      21.110  37.806 127.885  1.00 79.10           C  
ATOM   7797  CE1 HIS H 134      19.901  36.129 128.615  1.00 78.36           C  
ATOM   7798  NE2 HIS H 134      21.137  36.577 128.500  1.00 79.38           N  
ATOM   7799  N   SER H 135      17.230  40.790 125.460  1.00 76.69           N  
ATOM   7800  CA  SER H 135      16.411  41.901 124.951  1.00 75.62           C  
ATOM   7801  C   SER H 135      17.120  43.244 125.114  1.00 75.84           C  
ATOM   7802  O   SER H 135      18.003  43.375 125.960  1.00 77.37           O  
ATOM   7803  CB  SER H 135      15.031  41.924 125.624  1.00 73.46           C  
ATOM   7804  OG  SER H 135      15.129  42.095 127.023  1.00 71.75           O  
ATOM   7805  N   GLU H 136      16.731  44.232 124.306  1.00 74.74           N  
ATOM   7806  CA  GLU H 136      17.377  45.556 124.286  1.00 74.33           C  
ATOM   7807  C   GLU H 136      17.694  46.148 125.662  1.00 71.73           C  
ATOM   7808  O   GLU H 136      18.739  46.774 125.847  1.00 71.82           O  
ATOM   7809  CB  GLU H 136      16.549  46.556 123.474  1.00 76.66           C  
ATOM   7810  CG  GLU H 136      16.980  46.697 122.018  1.00 80.25           C  
ATOM   7811  CD  GLU H 136      18.111  47.695 121.828  1.00 82.46           C  
ATOM   7812  OE1 GLU H 136      19.238  47.437 122.324  1.00 83.23           O  
ATOM   7813  OE2 GLU H 136      17.871  48.738 121.168  1.00 83.58           O  
ATOM   7814  N   GLU H 137      16.786  45.954 126.614  1.00 68.23           N  
ATOM   7815  CA  GLU H 137      16.986  46.430 127.978  1.00 65.10           C  
ATOM   7816  C   GLU H 137      16.715  45.315 128.981  1.00 63.56           C  
ATOM   7817  O   GLU H 137      15.777  45.387 129.776  1.00 63.20           O  
ATOM   7818  CB  GLU H 137      16.104  47.646 128.257  1.00 64.43           C  
ATOM   7819  CG  GLU H 137      16.543  48.902 127.525  1.00 64.83           C  
ATOM   7820  CD  GLU H 137      15.628  50.083 127.772  1.00 65.25           C  
ATOM   7821  OE1 GLU H 137      14.638  49.936 128.522  1.00 65.26           O  
ATOM   7822  OE2 GLU H 137      15.900  51.165 127.212  1.00 65.94           O  
ATOM   7823  N   SER H 138      17.554  44.285 128.934  1.00 62.09           N  
ATOM   7824  CA  SER H 138      17.383  43.105 129.768  1.00 61.45           C  
ATOM   7825  C   SER H 138      17.913  43.313 131.179  1.00 63.80           C  
ATOM   7826  O   SER H 138      18.930  43.979 131.382  1.00 64.28           O  
ATOM   7827  CB  SER H 138      18.078  41.905 129.132  1.00 59.50           C  
ATOM   7828  OG  SER H 138      17.846  40.730 129.886  1.00 58.66           O  
ATOM   7829  N   LEU H 139      17.219  42.725 132.149  1.00 66.09           N  
ATOM   7830  CA  LEU H 139      17.650  42.771 133.543  1.00 68.31           C  
ATOM   7831  C   LEU H 139      18.833  41.833 133.771  1.00 71.26           C  
ATOM   7832  O   LEU H 139      19.397  41.778 134.871  1.00 72.61           O  
ATOM   7833  CB  LEU H 139      16.491  42.437 134.494  1.00 67.94           C  
ATOM   7834  CG  LEU H 139      15.210  43.284 134.466  1.00 66.70           C  
ATOM   7835  CD1 LEU H 139      14.257  42.821 135.553  1.00 65.56           C  
ATOM   7836  CD2 LEU H 139      15.491  44.778 134.608  1.00 65.62           C  
ATOM   7837  N   HIS H 140      19.199  41.094 132.724  1.00 72.97           N  
ATOM   7838  CA  HIS H 140      20.435  40.319 132.710  1.00 75.45           C  
ATOM   7839  C   HIS H 140      21.647  41.247 132.725  1.00 76.49           C  
ATOM   7840  O   HIS H 140      22.642  40.966 133.397  1.00 76.19           O  
ATOM   7841  CB  HIS H 140      20.494  39.411 131.479  1.00 75.40           C  
ATOM   7842  CG  HIS H 140      19.641  38.186 131.588  1.00 75.96           C  
ATOM   7843  ND1 HIS H 140      20.011  37.087 132.334  1.00 76.49           N  
ATOM   7844  CD2 HIS H 140      18.441  37.882 131.041  1.00 75.96           C  
ATOM   7845  CE1 HIS H 140      19.073  36.161 132.245  1.00 76.68           C  
ATOM   7846  NE2 HIS H 140      18.111  36.617 131.463  1.00 76.72           N  
ATOM   7847  N   TYR H 141      21.539  42.360 131.999  1.00 78.05           N  
ATOM   7848  CA  TYR H 141      22.654  43.287 131.799  1.00 80.21           C  
ATOM   7849  C   TYR H 141      23.071  44.033 133.065  1.00 80.71           C  
ATOM   7850  O   TYR H 141      24.170  44.594 133.127  1.00 81.40           O  
ATOM   7851  CB  TYR H 141      22.344  44.280 130.673  1.00 82.69           C  
ATOM   7852  CG  TYR H 141      22.009  43.638 129.338  1.00 84.07           C  
ATOM   7853  CD1 TYR H 141      22.677  42.488 128.899  1.00 84.82           C  
ATOM   7854  CD2 TYR H 141      21.040  44.193 128.504  1.00 84.00           C  
ATOM   7855  CE1 TYR H 141      22.373  41.899 127.672  1.00 85.01           C  
ATOM   7856  CE2 TYR H 141      20.734  43.616 127.274  1.00 84.59           C  
ATOM   7857  CZ  TYR H 141      21.401  42.469 126.865  1.00 84.47           C  
ATOM   7858  OH  TYR H 141      21.097  41.897 125.651  1.00 83.90           O  
ATOM   7859  N   GLU H 142      22.196  44.037 134.069  1.00 80.18           N  
ATOM   7860  CA  GLU H 142      22.526  44.623 135.369  1.00 78.48           C  
ATOM   7861  C   GLU H 142      22.556  43.593 136.502  1.00 78.84           C  
ATOM   7862  O   GLU H 142      22.645  43.948 137.681  1.00 78.39           O  
ATOM   7863  CB  GLU H 142      21.608  45.811 135.696  1.00 77.57           C  
ATOM   7864  CG  GLU H 142      20.122  45.512 135.710  1.00 76.41           C  
ATOM   7865  CD  GLU H 142      19.298  46.749 136.000  1.00 76.37           C  
ATOM   7866  OE1 GLU H 142      19.391  47.280 137.126  1.00 75.92           O  
ATOM   7867  OE2 GLU H 142      18.548  47.188 135.104  1.00 75.63           O  
ATOM   7868  N   GLY H 143      22.496  42.316 136.125  1.00 79.36           N  
ATOM   7869  CA  GLY H 143      22.647  41.207 137.063  1.00 80.27           C  
ATOM   7870  C   GLY H 143      21.457  40.981 137.976  1.00 81.24           C  
ATOM   7871  O   GLY H 143      21.617  40.565 139.125  1.00 81.01           O  
ATOM   7872  N   ARG H 144      20.260  41.255 137.464  1.00 81.55           N  
ATOM   7873  CA  ARG H 144      19.029  41.030 138.219  1.00 80.67           C  
ATOM   7874  C   ARG H 144      18.289  39.781 137.747  1.00 80.28           C  
ATOM   7875  O   ARG H 144      17.388  39.291 138.432  1.00 80.75           O  
ATOM   7876  CB  ARG H 144      18.110  42.248 138.125  1.00 80.00           C  
ATOM   7877  CG  ARG H 144      18.487  43.380 139.051  1.00 79.48           C  
ATOM   7878  CD  ARG H 144      17.322  44.329 139.220  1.00 79.73           C  
ATOM   7879  NE  ARG H 144      17.282  45.366 138.192  1.00 79.41           N  
ATOM   7880  CZ  ARG H 144      16.197  46.069 137.874  1.00 79.40           C  
ATOM   7881  NH1 ARG H 144      15.040  45.843 138.486  1.00 79.40           N  
ATOM   7882  NH2 ARG H 144      16.266  46.998 136.931  1.00 79.28           N  
ATOM   7883  N   ALA H 145      18.682  39.265 136.584  1.00 79.04           N  
ATOM   7884  CA  ALA H 145      17.985  38.146 135.957  1.00 77.91           C  
ATOM   7885  C   ALA H 145      18.835  36.880 135.847  1.00 77.13           C  
ATOM   7886  O   ALA H 145      20.066  36.947 135.786  1.00 77.09           O  
ATOM   7887  CB  ALA H 145      17.462  38.558 134.585  1.00 77.48           C  
ATOM   7888  N   VAL H 146      18.159  35.733 135.833  1.00 76.46           N  
ATOM   7889  CA  VAL H 146      18.800  34.437 135.595  1.00 77.17           C  
ATOM   7890  C   VAL H 146      17.973  33.560 134.656  1.00 78.17           C  
ATOM   7891  O   VAL H 146      16.741  33.615 134.665  1.00 80.48           O  
ATOM   7892  CB  VAL H 146      19.058  33.652 136.903  1.00 76.80           C  
ATOM   7893  CG1 VAL H 146      20.219  34.259 137.679  1.00 77.83           C  
ATOM   7894  CG2 VAL H 146      17.796  33.569 137.760  1.00 76.49           C  
ATOM   7895  N   ASP H 147      18.659  32.762 133.841  1.00 76.31           N  
ATOM   7896  CA  ASP H 147      18.002  31.758 133.011  1.00 74.53           C  
ATOM   7897  C   ASP H 147      18.327  30.384 133.569  1.00 74.01           C  
ATOM   7898  O   ASP H 147      19.483  29.952 133.564  1.00 73.85           O  
ATOM   7899  CB  ASP H 147      18.424  31.881 131.545  1.00 72.81           C  
ATOM   7900  CG  ASP H 147      17.978  33.187 130.920  1.00 71.60           C  
ATOM   7901  OD1 ASP H 147      16.944  33.751 131.350  1.00 72.68           O  
ATOM   7902  OD2 ASP H 147      18.671  33.651 129.995  1.00 69.97           O  
ATOM   7903  N   ILE H 148      17.296  29.710 134.064  1.00 74.40           N  
ATOM   7904  CA  ILE H 148      17.478  28.511 134.876  1.00 73.53           C  
ATOM   7905  C   ILE H 148      16.924  27.249 134.225  1.00 74.72           C  
ATOM   7906  O   ILE H 148      15.979  27.304 133.434  1.00 75.27           O  
ATOM   7907  CB  ILE H 148      16.888  28.685 136.308  1.00 72.11           C  
ATOM   7908  CG1 ILE H 148      15.378  28.964 136.259  1.00 71.61           C  
ATOM   7909  CG2 ILE H 148      17.618  29.805 137.047  1.00 71.99           C  
ATOM   7910  CD1 ILE H 148      14.623  28.611 137.537  1.00 71.86           C  
ATOM   7911  N   THR H 149      17.554  26.122 134.554  1.00 75.11           N  
ATOM   7912  CA  THR H 149      17.093  24.789 134.172  1.00 74.72           C  
ATOM   7913  C   THR H 149      17.358  23.850 135.345  1.00 74.64           C  
ATOM   7914  O   THR H 149      17.906  24.271 136.366  1.00 74.71           O  
ATOM   7915  CB  THR H 149      17.825  24.243 132.917  1.00 74.27           C  
ATOM   7916  OG1 THR H 149      19.223  24.100 133.194  1.00 74.36           O  
ATOM   7917  CG2 THR H 149      17.633  25.156 131.709  1.00 72.77           C  
ATOM   7918  N   THR H 150      16.958  22.589 135.209  1.00 74.83           N  
ATOM   7919  CA  THR H 150      17.362  21.556 136.160  1.00 74.12           C  
ATOM   7920  C   THR H 150      18.651  20.912 135.658  1.00 74.46           C  
ATOM   7921  O   THR H 150      18.942  20.949 134.458  1.00 74.24           O  
ATOM   7922  CB  THR H 150      16.269  20.480 136.372  1.00 73.68           C  
ATOM   7923  OG1 THR H 150      15.948  19.858 135.123  1.00 74.90           O  
ATOM   7924  CG2 THR H 150      15.010  21.096 136.971  1.00 73.04           C  
ATOM   7925  N   SER H 151      19.417  20.332 136.580  1.00 75.48           N  
ATOM   7926  CA  SER H 151      20.732  19.753 136.280  1.00 76.24           C  
ATOM   7927  C   SER H 151      20.715  18.711 135.158  1.00 77.56           C  
ATOM   7928  O   SER H 151      21.626  18.670 134.328  1.00 77.14           O  
ATOM   7929  CB  SER H 151      21.352  19.152 137.549  1.00 74.93           C  
ATOM   7930  OG  SER H 151      20.511  18.161 138.114  1.00 72.74           O  
ATOM   7931  N   ASP H 152      19.675  17.880 135.139  1.00 80.19           N  
ATOM   7932  CA  ASP H 152      19.548  16.800 134.157  1.00 82.76           C  
ATOM   7933  C   ASP H 152      19.065  17.287 132.790  1.00 84.91           C  
ATOM   7934  O   ASP H 152      19.184  16.567 131.792  1.00 85.84           O  
ATOM   7935  CB  ASP H 152      18.631  15.685 134.688  1.00 83.01           C  
ATOM   7936  CG  ASP H 152      17.204  16.162 134.969  1.00 82.80           C  
ATOM   7937  OD1 ASP H 152      16.971  17.385 135.096  1.00 82.58           O  
ATOM   7938  OD2 ASP H 152      16.310  15.296 135.073  1.00 82.54           O  
ATOM   7939  N   ARG H 153      18.527  18.507 132.760  1.00 86.08           N  
ATOM   7940  CA  ARG H 153      17.993  19.130 131.541  1.00 86.81           C  
ATOM   7941  C   ARG H 153      16.756  18.393 131.023  1.00 87.33           C  
ATOM   7942  O   ARG H 153      16.619  18.126 129.825  1.00 87.00           O  
ATOM   7943  CB  ARG H 153      19.078  19.265 130.462  1.00 87.18           C  
ATOM   7944  CG  ARG H 153      20.279  20.083 130.914  1.00 88.13           C  
ATOM   7945  CD  ARG H 153      21.469  19.898 129.998  1.00 88.15           C  
ATOM   7946  NE  ARG H 153      21.315  20.630 128.743  1.00 87.35           N  
ATOM   7947  CZ  ARG H 153      22.279  20.781 127.840  1.00 87.72           C  
ATOM   7948  NH1 ARG H 153      22.043  21.464 126.730  1.00 87.47           N  
ATOM   7949  NH2 ARG H 153      23.480  20.252 128.042  1.00 88.69           N  
ATOM   7950  N   ASP H 154      15.864  18.065 131.956  1.00 88.24           N  
ATOM   7951  CA  ASP H 154      14.582  17.442 131.644  1.00 88.84           C  
ATOM   7952  C   ASP H 154      13.529  18.532 131.459  1.00 88.76           C  
ATOM   7953  O   ASP H 154      13.110  19.181 132.423  1.00 88.71           O  
ATOM   7954  CB  ASP H 154      14.176  16.466 132.759  1.00 88.50           C  
ATOM   7955  CG  ASP H 154      12.879  15.725 132.459  1.00 87.62           C  
ATOM   7956  OD1 ASP H 154      12.606  15.415 131.278  1.00 88.16           O  
ATOM   7957  OD2 ASP H 154      12.132  15.442 133.418  1.00 86.39           O  
ATOM   7958  N   ARG H 155      13.112  18.724 130.209  1.00 87.86           N  
ATOM   7959  CA  ARG H 155      12.185  19.795 129.839  1.00 87.12           C  
ATOM   7960  C   ARG H 155      10.817  19.688 130.514  1.00 86.87           C  
ATOM   7961  O   ARG H 155      10.131  20.696 130.707  1.00 86.96           O  
ATOM   7962  CB  ARG H 155      12.018  19.846 128.320  1.00 86.32           C  
ATOM   7963  CG  ARG H 155      13.259  20.311 127.585  1.00 85.72           C  
ATOM   7964  CD  ARG H 155      12.940  20.590 126.139  1.00 85.78           C  
ATOM   7965  NE  ARG H 155      13.959  21.419 125.503  1.00 85.78           N  
ATOM   7966  CZ  ARG H 155      13.880  21.873 124.256  1.00 86.24           C  
ATOM   7967  NH1 ARG H 155      12.827  21.581 123.502  1.00 86.40           N  
ATOM   7968  NH2 ARG H 155      14.856  22.620 123.761  1.00 86.94           N  
ATOM   7969  N   SER H 156      10.434  18.464 130.874  1.00 86.37           N  
ATOM   7970  CA  SER H 156       9.149  18.197 131.523  1.00 85.14           C  
ATOM   7971  C   SER H 156       9.093  18.664 132.982  1.00 84.07           C  
ATOM   7972  O   SER H 156       8.019  18.686 133.587  1.00 83.45           O  
ATOM   7973  CB  SER H 156       8.798  16.707 131.426  1.00 83.98           C  
ATOM   7974  OG  SER H 156       9.801  15.901 132.018  1.00 82.37           O  
ATOM   7975  N   LYS H 157      10.244  19.042 133.535  1.00 83.53           N  
ATOM   7976  CA  LYS H 157      10.332  19.502 134.921  1.00 83.88           C  
ATOM   7977  C   LYS H 157      10.296  21.024 135.072  1.00 83.88           C  
ATOM   7978  O   LYS H 157      10.072  21.534 136.174  1.00 83.52           O  
ATOM   7979  CB  LYS H 157      11.599  18.955 135.583  1.00 84.71           C  
ATOM   7980  CG  LYS H 157      11.508  17.499 135.998  1.00 85.96           C  
ATOM   7981  CD  LYS H 157      12.746  17.070 136.770  1.00 86.88           C  
ATOM   7982  CE  LYS H 157      12.665  15.609 137.190  1.00 87.82           C  
ATOM   7983  NZ  LYS H 157      12.696  14.677 136.024  1.00 88.68           N  
ATOM   7984  N   TYR H 158      10.509  21.737 133.966  1.00 83.99           N  
ATOM   7985  CA  TYR H 158      10.689  23.193 133.994  1.00 83.84           C  
ATOM   7986  C   TYR H 158       9.457  23.973 134.468  1.00 84.40           C  
ATOM   7987  O   TYR H 158       9.595  25.022 135.101  1.00 85.40           O  
ATOM   7988  CB  TYR H 158      11.151  23.724 132.632  1.00 83.57           C  
ATOM   7989  CG  TYR H 158      12.486  23.204 132.124  1.00 83.15           C  
ATOM   7990  CD1 TYR H 158      13.346  22.460 132.935  1.00 83.23           C  
ATOM   7991  CD2 TYR H 158      12.901  23.495 130.831  1.00 83.42           C  
ATOM   7992  CE1 TYR H 158      14.571  21.998 132.452  1.00 83.42           C  
ATOM   7993  CE2 TYR H 158      14.122  23.043 130.343  1.00 83.60           C  
ATOM   7994  CZ  TYR H 158      14.950  22.298 131.153  1.00 83.56           C  
ATOM   7995  OH  TYR H 158      16.154  21.860 130.649  1.00 83.52           O  
ATOM   7996  N   GLY H 159       8.266  23.464 134.152  1.00 83.63           N  
ATOM   7997  CA  GLY H 159       7.004  24.064 134.598  1.00 81.97           C  
ATOM   7998  C   GLY H 159       6.885  24.106 136.110  1.00 81.40           C  
ATOM   7999  O   GLY H 159       6.508  25.131 136.684  1.00 81.37           O  
ATOM   8000  N   MET H 160       7.206  22.982 136.749  1.00 80.41           N  
ATOM   8001  CA  MET H 160       7.263  22.891 138.208  1.00 79.70           C  
ATOM   8002  C   MET H 160       8.462  23.678 138.743  1.00 77.43           C  
ATOM   8003  O   MET H 160       8.417  24.222 139.850  1.00 77.49           O  
ATOM   8004  CB  MET H 160       7.332  21.421 138.647  1.00 81.93           C  
ATOM   8005  CG  MET H 160       7.417  21.187 140.162  1.00 83.51           C  
ATOM   8006  SD  MET H 160       5.930  21.639 141.083  1.00 85.11           S  
ATOM   8007  CE  MET H 160       4.885  20.213 140.783  1.00 85.12           C  
ATOM   8008  N   LEU H 161       9.527  23.731 137.945  1.00 74.40           N  
ATOM   8009  CA  LEU H 161      10.722  24.500 138.277  1.00 71.71           C  
ATOM   8010  C   LEU H 161      10.416  25.996 138.324  1.00 71.61           C  
ATOM   8011  O   LEU H 161      10.992  26.730 139.129  1.00 70.10           O  
ATOM   8012  CB  LEU H 161      11.835  24.199 137.269  1.00 70.64           C  
ATOM   8013  CG  LEU H 161      13.092  25.067 137.200  1.00 70.40           C  
ATOM   8014  CD1 LEU H 161      13.909  24.979 138.479  1.00 70.32           C  
ATOM   8015  CD2 LEU H 161      13.921  24.645 136.009  1.00 70.22           C  
ATOM   8016  N   ALA H 162       9.503  26.433 137.458  1.00 73.24           N  
ATOM   8017  CA  ALA H 162       9.046  27.822 137.434  1.00 75.27           C  
ATOM   8018  C   ALA H 162       8.261  28.165 138.696  1.00 76.91           C  
ATOM   8019  O   ALA H 162       8.478  29.219 139.295  1.00 78.94           O  
ATOM   8020  CB  ALA H 162       8.209  28.092 136.194  1.00 74.54           C  
ATOM   8021  N   ARG H 163       7.359  27.266 139.095  1.00 76.57           N  
ATOM   8022  CA  ARG H 163       6.561  27.437 140.312  1.00 75.61           C  
ATOM   8023  C   ARG H 163       7.449  27.507 141.555  1.00 74.94           C  
ATOM   8024  O   ARG H 163       7.185  28.290 142.468  1.00 74.41           O  
ATOM   8025  CB  ARG H 163       5.506  26.323 140.433  1.00 75.67           C  
ATOM   8026  CG  ARG H 163       4.685  26.302 141.736  1.00 76.41           C  
ATOM   8027  CD  ARG H 163       3.940  27.612 142.024  1.00 77.10           C  
ATOM   8028  NE  ARG H 163       2.870  27.891 141.067  1.00 77.77           N  
ATOM   8029  CZ  ARG H 163       2.074  28.959 141.110  1.00 78.03           C  
ATOM   8030  NH1 ARG H 163       2.214  29.869 142.068  1.00 78.10           N  
ATOM   8031  NH2 ARG H 163       1.131  29.121 140.190  1.00 77.65           N  
ATOM   8032  N   LEU H 164       8.507  26.698 141.572  1.00 75.12           N  
ATOM   8033  CA  LEU H 164       9.478  26.713 142.665  1.00 75.25           C  
ATOM   8034  C   LEU H 164      10.240  28.032 142.730  1.00 74.56           C  
ATOM   8035  O   LEU H 164      10.659  28.457 143.805  1.00 75.05           O  
ATOM   8036  CB  LEU H 164      10.454  25.538 142.551  1.00 75.81           C  
ATOM   8037  CG  LEU H 164       9.971  24.151 142.986  1.00 76.17           C  
ATOM   8038  CD1 LEU H 164      10.979  23.088 142.580  1.00 76.11           C  
ATOM   8039  CD2 LEU H 164       9.709  24.093 144.490  1.00 76.52           C  
ATOM   8040  N   ALA H 165      10.416  28.669 141.575  1.00 74.36           N  
ATOM   8041  CA  ALA H 165      11.044  29.985 141.499  1.00 74.60           C  
ATOM   8042  C   ALA H 165      10.099  31.080 141.998  1.00 74.94           C  
ATOM   8043  O   ALA H 165      10.547  32.084 142.559  1.00 74.29           O  
ATOM   8044  CB  ALA H 165      11.500  30.273 140.077  1.00 74.51           C  
ATOM   8045  N   VAL H 166       8.798  30.873 141.789  1.00 75.44           N  
ATOM   8046  CA  VAL H 166       7.754  31.793 142.258  1.00 75.85           C  
ATOM   8047  C   VAL H 166       7.686  31.813 143.788  1.00 75.18           C  
ATOM   8048  O   VAL H 166       7.654  32.886 144.397  1.00 74.98           O  
ATOM   8049  CB  VAL H 166       6.359  31.437 141.663  1.00 76.97           C  
ATOM   8050  CG1 VAL H 166       5.237  32.204 142.371  1.00 77.72           C  
ATOM   8051  CG2 VAL H 166       6.323  31.706 140.165  1.00 77.11           C  
ATOM   8052  N   GLU H 167       7.670  30.624 144.392  1.00 74.81           N  
ATOM   8053  CA  GLU H 167       7.648  30.472 145.851  1.00 73.79           C  
ATOM   8054  C   GLU H 167       8.969  30.884 146.497  1.00 72.08           C  
ATOM   8055  O   GLU H 167       8.984  31.334 147.644  1.00 71.85           O  
ATOM   8056  CB  GLU H 167       7.301  29.033 146.250  1.00 74.93           C  
ATOM   8057  CG  GLU H 167       5.937  28.543 145.762  1.00 76.58           C  
ATOM   8058  CD  GLU H 167       4.774  29.380 146.276  1.00 76.70           C  
ATOM   8059  OE1 GLU H 167       4.664  29.570 147.510  1.00 74.51           O  
ATOM   8060  OE2 GLU H 167       3.966  29.840 145.438  1.00 77.54           O  
ATOM   8061  N   ALA H 168      10.067  30.730 145.755  1.00 71.23           N  
ATOM   8062  CA  ALA H 168      11.396  31.159 146.201  1.00 70.75           C  
ATOM   8063  C   ALA H 168      11.452  32.662 146.479  1.00 70.63           C  
ATOM   8064  O   ALA H 168      12.261  33.121 147.289  1.00 70.61           O  
ATOM   8065  CB  ALA H 168      12.453  30.771 145.180  1.00 70.49           C  
ATOM   8066  N   GLY H 169      10.593  33.417 145.798  1.00 70.66           N  
ATOM   8067  CA  GLY H 169      10.453  34.850 146.042  1.00 71.11           C  
ATOM   8068  C   GLY H 169      10.890  35.742 144.896  1.00 71.51           C  
ATOM   8069  O   GLY H 169      11.009  36.958 145.068  1.00 71.08           O  
ATOM   8070  N   PHE H 170      11.137  35.144 143.731  1.00 71.97           N  
ATOM   8071  CA  PHE H 170      11.500  35.906 142.540  1.00 72.73           C  
ATOM   8072  C   PHE H 170      10.360  36.839 142.148  1.00 73.82           C  
ATOM   8073  O   PHE H 170       9.202  36.422 142.068  1.00 73.93           O  
ATOM   8074  CB  PHE H 170      11.865  34.980 141.376  1.00 72.89           C  
ATOM   8075  CG  PHE H 170      13.282  34.476 141.415  1.00 72.58           C  
ATOM   8076  CD1 PHE H 170      14.333  35.282 140.982  1.00 72.38           C  
ATOM   8077  CD2 PHE H 170      13.566  33.193 141.872  1.00 72.16           C  
ATOM   8078  CE1 PHE H 170      15.646  34.821 141.013  1.00 72.50           C  
ATOM   8079  CE2 PHE H 170      14.877  32.722 141.906  1.00 72.12           C  
ATOM   8080  CZ  PHE H 170      15.918  33.537 141.477  1.00 72.39           C  
ATOM   8081  N   ASP H 171      10.702  38.103 141.913  1.00 74.75           N  
ATOM   8082  CA  ASP H 171       9.716  39.157 141.658  1.00 74.90           C  
ATOM   8083  C   ASP H 171       8.998  39.031 140.310  1.00 75.38           C  
ATOM   8084  O   ASP H 171       7.954  39.654 140.105  1.00 74.67           O  
ATOM   8085  CB  ASP H 171      10.371  40.534 141.796  1.00 74.21           C  
ATOM   8086  CG  ASP H 171      10.843  40.818 143.210  1.00 73.33           C  
ATOM   8087  OD1 ASP H 171      10.026  40.696 144.147  1.00 73.28           O  
ATOM   8088  OD2 ASP H 171      12.030  41.166 143.385  1.00 72.58           O  
ATOM   8089  N   TRP H 172       9.564  38.232 139.405  1.00 76.41           N  
ATOM   8090  CA  TRP H 172       8.941  37.921 138.116  1.00 77.92           C  
ATOM   8091  C   TRP H 172       9.525  36.631 137.545  1.00 78.72           C  
ATOM   8092  O   TRP H 172      10.736  36.529 137.325  1.00 79.77           O  
ATOM   8093  CB  TRP H 172       9.130  39.076 137.128  1.00 79.01           C  
ATOM   8094  CG  TRP H 172       8.177  39.073 135.959  1.00 79.36           C  
ATOM   8095  CD1 TRP H 172       6.833  39.327 135.993  1.00 79.44           C  
ATOM   8096  CD2 TRP H 172       8.504  38.835 134.585  1.00 79.43           C  
ATOM   8097  NE1 TRP H 172       6.302  39.249 134.728  1.00 78.41           N  
ATOM   8098  CE2 TRP H 172       7.304  38.949 133.844  1.00 79.02           C  
ATOM   8099  CE3 TRP H 172       9.691  38.525 133.907  1.00 79.78           C  
ATOM   8100  CZ2 TRP H 172       7.259  38.770 132.458  1.00 79.30           C  
ATOM   8101  CZ3 TRP H 172       9.647  38.352 132.527  1.00 79.26           C  
ATOM   8102  CH2 TRP H 172       8.436  38.473 131.819  1.00 79.43           C  
ATOM   8103  N   VAL H 173       8.656  35.647 137.323  1.00 77.61           N  
ATOM   8104  CA  VAL H 173       9.051  34.353 136.761  1.00 75.68           C  
ATOM   8105  C   VAL H 173       8.313  34.145 135.444  1.00 75.47           C  
ATOM   8106  O   VAL H 173       7.096  34.326 135.378  1.00 77.55           O  
ATOM   8107  CB  VAL H 173       8.755  33.184 137.740  1.00 74.35           C  
ATOM   8108  CG1 VAL H 173       9.108  31.834 137.118  1.00 72.93           C  
ATOM   8109  CG2 VAL H 173       9.515  33.374 139.041  1.00 73.97           C  
ATOM   8110  N   TYR H 174       9.057  33.763 134.406  1.00 72.69           N  
ATOM   8111  CA  TYR H 174       8.524  33.639 133.053  1.00 68.57           C  
ATOM   8112  C   TYR H 174       9.025  32.363 132.385  1.00 67.53           C  
ATOM   8113  O   TYR H 174      10.230  32.157 132.243  1.00 67.89           O  
ATOM   8114  CB  TYR H 174       8.920  34.881 132.243  1.00 67.48           C  
ATOM   8115  CG  TYR H 174       8.525  34.907 130.773  1.00 68.00           C  
ATOM   8116  CD1 TYR H 174       7.278  34.444 130.340  1.00 68.21           C  
ATOM   8117  CD2 TYR H 174       9.390  35.447 129.819  1.00 67.86           C  
ATOM   8118  CE1 TYR H 174       6.919  34.488 128.990  1.00 67.10           C  
ATOM   8119  CE2 TYR H 174       9.037  35.502 128.470  1.00 68.09           C  
ATOM   8120  CZ  TYR H 174       7.803  35.020 128.066  1.00 67.52           C  
ATOM   8121  OH  TYR H 174       7.457  35.072 126.738  1.00 67.36           O  
ATOM   8122  N   TYR H 175       8.090  31.501 131.996  1.00 67.36           N  
ATOM   8123  CA  TYR H 175       8.403  30.315 131.206  1.00 69.74           C  
ATOM   8124  C   TYR H 175       8.657  30.783 129.767  1.00 71.66           C  
ATOM   8125  O   TYR H 175       7.777  30.680 128.905  1.00 70.11           O  
ATOM   8126  CB  TYR H 175       7.229  29.325 131.263  1.00 70.67           C  
ATOM   8127  CG  TYR H 175       7.555  27.868 130.955  1.00 71.57           C  
ATOM   8128  CD1 TYR H 175       8.437  27.515 129.929  1.00 73.01           C  
ATOM   8129  CD2 TYR H 175       6.943  26.838 131.670  1.00 71.53           C  
ATOM   8130  CE1 TYR H 175       8.721  26.176 129.649  1.00 72.08           C  
ATOM   8131  CE2 TYR H 175       7.217  25.499 131.388  1.00 71.28           C  
ATOM   8132  CZ  TYR H 175       8.106  25.177 130.380  1.00 70.75           C  
ATOM   8133  OH  TYR H 175       8.382  23.859 130.104  1.00 70.06           O  
ATOM   8134  N   GLU H 176       9.859  31.305 129.522  1.00 73.37           N  
ATOM   8135  CA  GLU H 176      10.191  31.952 128.249  1.00 76.80           C  
ATOM   8136  C   GLU H 176      10.200  31.011 127.046  1.00 77.43           C  
ATOM   8137  O   GLU H 176       9.547  31.279 126.036  1.00 76.12           O  
ATOM   8138  CB  GLU H 176      11.528  32.692 128.344  1.00 79.05           C  
ATOM   8139  CG  GLU H 176      12.064  33.173 126.988  1.00 81.23           C  
ATOM   8140  CD  GLU H 176      12.579  34.592 127.037  1.00 83.73           C  
ATOM   8141  OE1 GLU H 176      12.972  35.042 128.138  1.00 88.36           O  
ATOM   8142  OE2 GLU H 176      12.582  35.260 125.981  1.00 80.06           O  
ATOM   8143  N   SER H 177      10.959  29.926 127.159  1.00 78.13           N  
ATOM   8144  CA  SER H 177      11.089  28.943 126.092  1.00 78.81           C  
ATOM   8145  C   SER H 177      11.125  27.546 126.703  1.00 79.21           C  
ATOM   8146  O   SER H 177      11.112  27.412 127.927  1.00 77.94           O  
ATOM   8147  CB  SER H 177      12.352  29.218 125.266  1.00 79.19           C  
ATOM   8148  OG  SER H 177      13.462  29.514 126.098  1.00 79.54           O  
ATOM   8149  N   LYS H 178      11.159  26.513 125.860  1.00 80.42           N  
ATOM   8150  CA  LYS H 178      11.294  25.133 126.339  1.00 81.28           C  
ATOM   8151  C   LYS H 178      12.648  24.918 126.975  1.00 81.31           C  
ATOM   8152  O   LYS H 178      12.780  24.118 127.895  1.00 83.38           O  
ATOM   8153  CB  LYS H 178      11.170  24.119 125.207  1.00 83.14           C  
ATOM   8154  CG  LYS H 178      10.153  24.443 124.177  1.00 86.74           C  
ATOM   8155  CD  LYS H 178       8.760  24.084 124.618  1.00 89.46           C  
ATOM   8156  CE  LYS H 178       7.784  24.699 123.644  1.00 93.15           C  
ATOM   8157  NZ  LYS H 178       8.291  24.610 122.229  1.00 94.83           N  
ATOM   8158  N   ALA H 179      13.653  25.621 126.462  1.00 79.43           N  
ATOM   8159  CA  ALA H 179      15.030  25.430 126.888  1.00 79.00           C  
ATOM   8160  C   ALA H 179      15.326  25.967 128.288  1.00 79.81           C  
ATOM   8161  O   ALA H 179      16.225  25.453 128.959  1.00 81.19           O  
ATOM   8162  CB  ALA H 179      15.981  26.035 125.872  1.00 79.16           C  
ATOM   8163  N   HIS H 180      14.583  26.985 128.730  1.00 79.13           N  
ATOM   8164  CA  HIS H 180      14.848  27.608 130.033  1.00 79.42           C  
ATOM   8165  C   HIS H 180      13.686  28.400 130.642  1.00 78.25           C  
ATOM   8166  O   HIS H 180      12.720  28.735 129.956  1.00 79.19           O  
ATOM   8167  CB  HIS H 180      16.095  28.502 129.948  1.00 81.17           C  
ATOM   8168  CG  HIS H 180      15.859  29.815 129.269  1.00 81.41           C  
ATOM   8169  ND1 HIS H 180      16.018  29.990 127.911  1.00 81.43           N  
ATOM   8170  CD2 HIS H 180      15.490  31.020 129.764  1.00 81.96           C  
ATOM   8171  CE1 HIS H 180      15.748  31.244 127.598  1.00 82.72           C  
ATOM   8172  NE2 HIS H 180      15.425  31.891 128.705  1.00 83.27           N  
ATOM   8173  N   ILE H 181      13.812  28.696 131.938  1.00 76.35           N  
ATOM   8174  CA  ILE H 181      12.902  29.588 132.658  1.00 74.64           C  
ATOM   8175  C   ILE H 181      13.629  30.893 132.994  1.00 74.46           C  
ATOM   8176  O   ILE H 181      14.754  30.868 133.494  1.00 73.63           O  
ATOM   8177  CB  ILE H 181      12.380  28.935 133.970  1.00 73.84           C  
ATOM   8178  CG1 ILE H 181      11.825  27.526 133.713  1.00 74.07           C  
ATOM   8179  CG2 ILE H 181      11.354  29.833 134.671  1.00 73.22           C  
ATOM   8180  CD1 ILE H 181      10.615  27.466 132.785  1.00 75.14           C  
ATOM   8181  N   HIS H 182      12.988  32.025 132.705  1.00 74.97           N  
ATOM   8182  CA  HIS H 182      13.543  33.342 133.029  1.00 75.86           C  
ATOM   8183  C   HIS H 182      13.038  33.819 134.391  1.00 77.32           C  
ATOM   8184  O   HIS H 182      11.833  33.823 134.656  1.00 79.07           O  
ATOM   8185  CB  HIS H 182      13.204  34.367 131.934  1.00 74.78           C  
ATOM   8186  CG  HIS H 182      13.638  35.769 132.250  1.00 73.24           C  
ATOM   8187  ND1 HIS H 182      14.855  36.280 131.852  1.00 73.52           N  
ATOM   8188  CD2 HIS H 182      13.011  36.768 132.916  1.00 72.09           C  
ATOM   8189  CE1 HIS H 182      14.959  37.532 132.263  1.00 72.24           C  
ATOM   8190  NE2 HIS H 182      13.856  37.851 132.914  1.00 71.40           N  
ATOM   8191  N   CYS H 183      13.972  34.217 135.250  1.00 76.42           N  
ATOM   8192  CA  CYS H 183      13.641  34.754 136.559  1.00 75.91           C  
ATOM   8193  C   CYS H 183      14.341  36.094 136.750  1.00 74.82           C  
ATOM   8194  O   CYS H 183      15.442  36.297 136.237  1.00 72.74           O  
ATOM   8195  CB  CYS H 183      14.047  33.769 137.654  1.00 77.80           C  
ATOM   8196  SG  CYS H 183      13.427  32.089 137.395  1.00 80.48           S  
ATOM   8197  N   SER H 184      13.690  37.004 137.474  1.00 75.52           N  
ATOM   8198  CA  SER H 184      14.247  38.330 137.750  1.00 76.24           C  
ATOM   8199  C   SER H 184      13.817  38.876 139.111  1.00 77.03           C  
ATOM   8200  O   SER H 184      12.832  38.417 139.697  1.00 78.06           O  
ATOM   8201  CB  SER H 184      13.868  39.317 136.645  1.00 78.09           C  
ATOM   8202  OG  SER H 184      12.464  39.501 136.578  1.00 80.52           O  
ATOM   8203  N   VAL H 185      14.568  39.860 139.603  1.00 76.42           N  
ATOM   8204  CA  VAL H 185      14.305  40.482 140.901  1.00 75.29           C  
ATOM   8205  C   VAL H 185      14.252  42.008 140.792  1.00 75.01           C  
ATOM   8206  O   VAL H 185      14.614  42.574 139.759  1.00 74.00           O  
ATOM   8207  CB  VAL H 185      15.361  40.067 141.963  1.00 75.13           C  
ATOM   8208  CG1 VAL H 185      15.263  38.578 142.264  1.00 75.24           C  
ATOM   8209  CG2 VAL H 185      16.775  40.438 141.513  1.00 74.90           C  
ATOM   8210  N   LYS H 186      13.795  42.661 141.858  1.00 75.58           N  
ATOM   8211  CA  LYS H 186      13.780  44.121 141.931  1.00 76.32           C  
ATOM   8212  C   LYS H 186      15.189  44.661 142.172  1.00 77.68           C  
ATOM   8213  O   LYS H 186      16.070  43.932 142.638  1.00 77.02           O  
ATOM   8214  CB  LYS H 186      12.841  44.599 143.042  1.00 76.19           C  
ATOM   8215  CG  LYS H 186      11.357  44.397 142.766  1.00 75.91           C  
ATOM   8216  CD  LYS H 186      10.523  44.799 143.980  1.00 75.84           C  
ATOM   8217  CE  LYS H 186       9.052  44.442 143.809  1.00 74.84           C  
ATOM   8218  NZ  LYS H 186       8.374  45.302 142.802  1.00 73.90           N  
ATOM   8219  N   ALA H 187      15.390  45.939 141.856  1.00 80.37           N  
ATOM   8220  CA  ALA H 187      16.670  46.615 142.079  1.00 84.11           C  
ATOM   8221  C   ALA H 187      17.032  46.693 143.569  1.00 87.63           C  
ATOM   8222  O   ALA H 187      16.173  46.508 144.437  1.00 88.08           O  
ATOM   8223  CB  ALA H 187      16.644  48.005 141.454  1.00 83.60           C  
ATOM   8224  N   GLU H 188      18.304  46.962 143.855  1.00 91.04           N  
ATOM   8225  CA  GLU H 188      18.802  47.017 145.235  1.00 94.52           C  
ATOM   8226  C   GLU H 188      18.289  48.223 146.024  1.00 96.30           C  
ATOM   8227  O   GLU H 188      18.153  48.157 147.249  1.00 95.81           O  
ATOM   8228  CB  GLU H 188      20.335  46.981 145.259  1.00 95.52           C  
ATOM   8229  CG  GLU H 188      20.946  45.623 144.904  1.00 96.50           C  
ATOM   8230  CD  GLU H 188      20.651  44.543 145.938  1.00 97.01           C  
ATOM   8231  OE1 GLU H 188      20.676  44.845 147.152  1.00 96.66           O  
ATOM   8232  OE2 GLU H 188      20.400  43.388 145.533  1.00 97.44           O  
ATOM   8233  N   ASN H 189      18.008  49.315 145.315  1.00 98.87           N  
ATOM   8234  CA  ASN H 189      17.531  50.560 145.928  1.00100.83           C  
ATOM   8235  C   ASN H 189      16.004  50.664 146.062  1.00101.51           C  
ATOM   8236  O   ASN H 189      15.496  51.561 146.740  1.00101.39           O  
ATOM   8237  CB  ASN H 189      18.095  51.785 145.185  1.00101.73           C  
ATOM   8238  CG  ASN H 189      17.942  51.687 143.666  1.00102.69           C  
ATOM   8239  OD1 ASN H 189      17.047  51.010 143.153  1.00102.61           O  
ATOM   8240  ND2 ASN H 189      18.821  52.374 142.944  1.00103.06           N  
ATOM   8241  N   SER H 190      15.286  49.745 145.415  1.00102.26           N  
ATOM   8242  CA  SER H 190      13.821  49.699 145.481  1.00102.63           C  
ATOM   8243  C   SER H 190      13.313  48.936 146.707  1.00103.13           C  
ATOM   8244  O   SER H 190      12.138  49.045 147.069  1.00103.05           O  
ATOM   8245  CB  SER H 190      13.242  49.082 144.205  1.00102.47           C  
ATOM   8246  OG  SER H 190      13.493  49.905 143.080  1.00102.87           O  
ATOM   8247  N   VAL H 191      14.203  48.169 147.335  1.00103.58           N  
ATOM   8248  CA  VAL H 191      13.866  47.378 148.522  1.00103.30           C  
ATOM   8249  C   VAL H 191      14.553  47.918 149.774  1.00103.12           C  
ATOM   8250  O   VAL H 191      13.971  48.700 150.525  1.00103.07           O  
ATOM   8251  CB  VAL H 191      14.217  45.873 148.345  1.00103.26           C  
ATOM   8252  CG1 VAL H 191      13.262  45.209 147.357  1.00103.06           C  
ATOM   8253  CG2 VAL H 191      15.676  45.688 147.913  1.00103.16           C  
TER    8254      VAL H 191                                                      
HETATM 8255 ZN    ZN H 400      16.465  35.592 130.742  1.00 75.43          ZN  
HETATM 8256 CA    CA H 401      26.078  31.750 130.237  1.00 90.60          CA  
HETATM 8257 CA    CA H 402      25.912  35.229 128.547  1.00 91.80          CA  
HETATM 8258 ZN    ZN A 902      20.201  45.784  19.743  1.00151.98          ZN  
CONECT   24 2471                                                                
CONECT   41 2512                                                                
CONECT 1341 8258                                                                
CONECT 1482 3136                                                                
CONECT 1718 1804                                                                
CONECT 1804 1718                                                                
CONECT 2174 2915                                                                
CONECT 2471   24                                                                
CONECT 2512   41                                                                
CONECT 2915 2174                                                                
CONECT 3018 3090                                                                
CONECT 3049 3130                                                                
CONECT 3090 3018                                                                
CONECT 3130 3049                                                                
CONECT 3136 1482                                                                
CONECT 3142 3211                                                                
CONECT 3211 3142                                                                
CONECT 3249 3318                                                                
CONECT 3276 3366                                                                
CONECT 3318 3249                                                                
CONECT 3366 3276                                                                
CONECT 3380 3448                                                                
CONECT 3448 3380                                                                
CONECT 3512 6001                                                                
CONECT 3529 6042                                                                
CONECT 4848 8255                                                                
CONECT 4988 6666                                                                
CONECT 5248 5334                                                                
CONECT 5334 5248                                                                
CONECT 5704 6445                                                                
CONECT 6001 3512                                                                
CONECT 6042 3529                                                                
CONECT 6445 5704                                                                
CONECT 6548 6620                                                                
CONECT 6579 6660                                                                
CONECT 6620 6548                                                                
CONECT 6660 6579                                                                
CONECT 6666 4988                                                                
CONECT 6672 6741                                                                
CONECT 6741 6672                                                                
CONECT 6779 6848                                                                
CONECT 6806 6896                                                                
CONECT 6848 6779                                                                
CONECT 6896 6806                                                                
CONECT 6910 6978                                                                
CONECT 6978 6910                                                                
CONECT 7440 8256                                                                
CONECT 7441 8256                                                                
CONECT 7449 8256                                                                
CONECT 7450 8256 8257                                                           
CONECT 7481 8256                                                                
CONECT 7482 8256                                                                
CONECT 7719 8256                                                                
CONECT 7730 8257                                                                
CONECT 7731 8256 8257                                                           
CONECT 7756 8257                                                                
CONECT 7774 8257                                                                
CONECT 7846 8255                                                                
CONECT 7901 8255                                                                
CONECT 8187 8255                                                                
CONECT 8255 4848 7846 7901 8187                                                 
CONECT 8256 7440 7441 7449 7450                                                 
CONECT 8256 7481 7482 7719 7731                                                 
CONECT 8257 7450 7730 7731 7756                                                 
CONECT 8257 7774                                                                
CONECT 8258 1341                                                                
MASTER      691    0    4   14   66    0    5    6 8255    3   66   87          
END