PDB Full entry for 3L73
HEADER    OXIDOREDUCTASE                          27-DEC-09   3L73              
TITLE     CYTOCHROME BC1 COMPLEX FROM CHICKEN WITH TRIAZOLONE INHIBITOR         
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
COMPND   3 PROTEIN I;                                                           
COMPND   4 CHAIN: A, N;                                                         
COMPND   5 EC: 1.10.2.2;                                                        
COMPND   6 MOL_ID: 2;                                                           
COMPND   7 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
COMPND   8 PROTEIN 2;                                                           
COMPND   9 CHAIN: B, O;                                                         
COMPND  10 EC: 1.10.2.2;                                                        
COMPND  11 MOL_ID: 3;                                                           
COMPND  12 MOLECULE: CYTOCHROME B;                                              
COMPND  13 CHAIN: C, P;                                                         
COMPND  14 SYNONYM: UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CYTOCHROME B       
COMPND  15 SUBUNIT, CYTOCHROME B-C1 COMPLEX SUBUNIT 3, COMPLEX III SUBUNIT 3,   
COMPND  16 COMPLEX III SUBUNIT III;                                             
COMPND  17 EC: 1.10.2.2;                                                        
COMPND  18 MOL_ID: 4;                                                           
COMPND  19 MOLECULE: MITOCHONDRIAL CYTOCHROME C1, HEME PROTEIN;                 
COMPND  20 CHAIN: D, Q;                                                         
COMPND  21 EC: 1.10.2.2;                                                        
COMPND  22 MOL_ID: 5;                                                           
COMPND  23 MOLECULE: CYTOCHROME B-C1 COMPLEX SUBUNIT 5, RIESKE IRONSULFUR       
COMPND  24 PROTEIN, MITOCHONDRIAL;                                              
COMPND  25 CHAIN: E, R;                                                         
COMPND  26 FRAGMENT: UNP RESIDUES 77-272;                                       
COMPND  27 SYNONYM: UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR SUBUNIT, RIESKE
COMPND  28 IRON-SULFUR PROTEIN, RISP, COMPLEX III SUBUNIT 5;                    
COMPND  29 EC: 1.10.2.2;                                                        
COMPND  30 MOL_ID: 6;                                                           
COMPND  31 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 14 KDA      
COMPND  32 PROTEIN;                                                             
COMPND  33 CHAIN: F, S;                                                         
COMPND  34 EC: 1.10.2.2;                                                        
COMPND  35 MOL_ID: 7;                                                           
COMPND  36 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE UBIQUINONE- 
COMPND  37 BINDING PROTEIN QP-C;                                                
COMPND  38 CHAIN: G, T;                                                         
COMPND  39 EC: 1.10.2.2;                                                        
COMPND  40 MOL_ID: 8;                                                           
COMPND  41 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 11 KDA      
COMPND  42 PROTEIN, COMPLEX III SUBUNIT VIII;                                   
COMPND  43 CHAIN: H, U;                                                         
COMPND  44 EC: 1.10.2.2;                                                        
COMPND  45 MOL_ID: 9;                                                           
COMPND  46 MOLECULE: CYTOCHROME B-C1 COMPLEX SUBUNIT RIESKE, MITOCHONDRIAL;     
COMPND  47 CHAIN: I, V;                                                         
COMPND  48 FRAGMENT: UNP RESIDUES 45-76;                                        
COMPND  49 SYNONYM: UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR SUBUNIT, RIESKE
COMPND  50 IRON-SULFUR PROTEIN, RISP, COMPLEX III SUBUNIT 5;                    
COMPND  51 EC: 1.10.2.2;                                                        
COMPND  52 MOL_ID: 10;                                                          
COMPND  53 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 7.2 KDA     
COMPND  54 PROTEIN;                                                             
COMPND  55 CHAIN: J, W;                                                         
COMPND  56 EC: 1.10.2.2                                                         
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: GALLUS GALLUS;                                  
SOURCE   3 ORGANISM_COMMON: CHICKEN;                                            
SOURCE   4 ORGANISM_TAXID: 9031;                                                
SOURCE   5 MOL_ID: 2;                                                           
SOURCE   6 ORGANISM_SCIENTIFIC: GALLUS GALLUS;                                  
SOURCE   7 ORGANISM_COMMON: CHICKEN;                                            
SOURCE   8 ORGANISM_TAXID: 9031;                                                
SOURCE   9 MOL_ID: 3;                                                           
SOURCE  10 ORGANISM_SCIENTIFIC: GALLUS GALLUS;                                  
SOURCE  11 ORGANISM_COMMON: CHICKEN;                                            
SOURCE  12 ORGANISM_TAXID: 9031;                                                
SOURCE  13 MOL_ID: 4;                                                           
SOURCE  14 ORGANISM_SCIENTIFIC: GALLUS GALLUS;                                  
SOURCE  15 ORGANISM_COMMON: CHICKEN;                                            
SOURCE  16 ORGANISM_TAXID: 9031;                                                
SOURCE  17 MOL_ID: 5;                                                           
SOURCE  18 ORGANISM_SCIENTIFIC: GALLUS GALLUS;                                  
SOURCE  19 ORGANISM_COMMON: CHICKEN;                                            
SOURCE  20 ORGANISM_TAXID: 9031;                                                
SOURCE  21 MOL_ID: 6;                                                           
SOURCE  22 ORGANISM_SCIENTIFIC: GALLUS GALLUS;                                  
SOURCE  23 ORGANISM_COMMON: CHICKEN;                                            
SOURCE  24 ORGANISM_TAXID: 9031;                                                
SOURCE  25 MOL_ID: 7;                                                           
SOURCE  26 ORGANISM_SCIENTIFIC: GALLUS GALLUS;                                  
SOURCE  27 ORGANISM_COMMON: CHICKEN;                                            
SOURCE  28 ORGANISM_TAXID: 9031;                                                
SOURCE  29 MOL_ID: 8;                                                           
SOURCE  30 ORGANISM_SCIENTIFIC: GALLUS GALLUS;                                  
SOURCE  31 ORGANISM_COMMON: CHICKEN;                                            
SOURCE  32 ORGANISM_TAXID: 9031;                                                
SOURCE  33 MOL_ID: 9;                                                           
SOURCE  34 ORGANISM_SCIENTIFIC: GALLUS GALLUS;                                  
SOURCE  35 ORGANISM_COMMON: CHICKEN;                                            
SOURCE  36 ORGANISM_TAXID: 9031;                                                
SOURCE  37 MOL_ID: 10;                                                          
SOURCE  38 ORGANISM_SCIENTIFIC: GALLUS GALLUS;                                  
SOURCE  39 ORGANISM_COMMON: CHICKEN;                                            
SOURCE  40 ORGANISM_TAXID: 9031                                                 
KEYWDS    CYTOCHROME BC1, MEMBRANE PROTEIN, HEME PROTEIN, RIESKE IRON SULFUR    
KEYWDS   2 PROTEIN, CYTOCHROME B, CYTOCHROME C1, COMPLEX III, MITOCHONDRIAL     
KEYWDS   3 PROCESSING PROTEIN, UBIQUINONE, AZOXYSTROBIN OXIDOREDUCTASE, REDOX   
KEYWDS   4 ENZYME RESPIRATORY CHAIN, ELECTRON TRANSPORT, HEME, INNER MEMBRANE,  
KEYWDS   5 MEMBRANE, STROBILURINS BINDING, MITOCHONDRION, TRANSMEMBRANE,        
KEYWDS   6 STIGMATELLIN, IRON, MITOCHONDRIAL INNER MEMBRANE, RESPIRATORY CHAIN, 
KEYWDS   7 IRON-SULFUR, TRANSIT PEPTIDE, METAL-BINDING, MITOCHONDRION INNER     
KEYWDS   8 MEMBRANE, TRANSPORT, DISULFIDE BOND, OXIDOREDUCTASE                  
EXPDTA    X-RAY DIFFRACTION                                                     
AUTHOR    L.HUANG,E.A.BERRY                                                     
REVDAT   4   29-JUL-20 3L73    1       COMPND REMARK HETNAM SITE                
REVDAT   3   01-NOV-17 3L73    1       REMARK                                   
REVDAT   2   29-OCT-14 3L73    1       HETNAM HETSYN VERSN                      
REVDAT   1   02-FEB-10 3L73    0                                                
JRNL        AUTH   L.HUANG,E.A.BERRY                                            
JRNL        TITL   FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE 
JRNL        TITL 2 INHIBITORS IN THE QO SITE OF THE BC1 COMPL AND FIX THE       
JRNL        TITL 3 RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT         
JRNL        TITL 4 DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" 
JRNL        TITL 5 QO INHIBITORS.                                               
JRNL        REF    TO BE PUBLISHED                                              
JRNL        REFN                                                                
REMARK   2                                                                      
REMARK   2 RESOLUTION.    3.04 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   PROGRAM     : CNS                                                  
REMARK   3   AUTHORS     : BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-              
REMARK   3               : KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,              
REMARK   3               : READ,RICE,SIMONSON,WARREN                            
REMARK   3                                                                      
REMARK   3  REFINEMENT TARGET : ENGH & HUBER                                    
REMARK   3                                                                      
REMARK   3  DATA USED IN REFINEMENT.                                            
REMARK   3   RESOLUTION RANGE HIGH (ANGSTROMS) : 3.04                           
REMARK   3   RESOLUTION RANGE LOW  (ANGSTROMS) : 24.97                          
REMARK   3   DATA CUTOFF            (SIGMA(F)) : 0.000                          
REMARK   3   DATA CUTOFF HIGH         (ABS(F)) : 3513358.570                    
REMARK   3   DATA CUTOFF LOW          (ABS(F)) : 0.0000                         
REMARK   3   COMPLETENESS (WORKING+TEST)   (%) : 99.7                           
REMARK   3   NUMBER OF REFLECTIONS             : 145117                         
REMARK   3                                                                      
REMARK   3  FIT TO DATA USED IN REFINEMENT.                                     
REMARK   3   CROSS-VALIDATION METHOD          : THROUGHOUT                      
REMARK   3   FREE R VALUE TEST SET SELECTION  : RANDOM                          
REMARK   3   R VALUE            (WORKING SET) : 0.259                           
REMARK   3   FREE R VALUE                     : 0.293                           
REMARK   3   FREE R VALUE TEST SET SIZE   (%) : 2.000                           
REMARK   3   FREE R VALUE TEST SET COUNT      : 2854                            
REMARK   3   ESTIMATED ERROR OF FREE R VALUE  : 0.005                           
REMARK   3                                                                      
REMARK   3  FIT IN THE HIGHEST RESOLUTION BIN.                                  
REMARK   3   TOTAL NUMBER OF BINS USED           : 7                            
REMARK   3   BIN RESOLUTION RANGE HIGH       (A) : 3.04                         
REMARK   3   BIN RESOLUTION RANGE LOW        (A) : 3.20                         
REMARK   3   BIN COMPLETENESS (WORKING+TEST) (%) : 99.80                        
REMARK   3   REFLECTIONS IN BIN    (WORKING SET) : 20157                        
REMARK   3   BIN R VALUE           (WORKING SET) : 0.3850                       
REMARK   3   BIN FREE R VALUE                    : 0.4220                       
REMARK   3   BIN FREE R VALUE TEST SET SIZE  (%) : 1.90                         
REMARK   3   BIN FREE R VALUE TEST SET COUNT     : 384                          
REMARK   3   ESTIMATED ERROR OF BIN FREE R VALUE : 0.022                        
REMARK   3                                                                      
REMARK   3  NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT.                    
REMARK   3   PROTEIN ATOMS            : 31794                                   
REMARK   3   NUCLEIC ACID ATOMS       : 0                                       
REMARK   3   HETEROGEN ATOMS          : 832                                     
REMARK   3   SOLVENT ATOMS            : 19                                      
REMARK   3                                                                      
REMARK   3  B VALUES.                                                           
REMARK   3   FROM WILSON PLOT           (A**2) : 80.80                          
REMARK   3   MEAN B VALUE      (OVERALL, A**2) : 86.50                          
REMARK   3   OVERALL ANISOTROPIC B VALUE.                                       
REMARK   3    B11 (A**2) : 42.00000                                             
REMARK   3    B22 (A**2) : -22.51000                                            
REMARK   3    B33 (A**2) : -19.49000                                            
REMARK   3    B12 (A**2) : 0.00000                                              
REMARK   3    B13 (A**2) : 0.00000                                              
REMARK   3    B23 (A**2) : 0.00000                                              
REMARK   3                                                                      
REMARK   3  ESTIMATED COORDINATE ERROR.                                         
REMARK   3   ESD FROM LUZZATI PLOT        (A) : 0.48                            
REMARK   3   ESD FROM SIGMAA              (A) : 0.75                            
REMARK   3   LOW RESOLUTION CUTOFF        (A) : 5.00                            
REMARK   3                                                                      
REMARK   3  CROSS-VALIDATED ESTIMATED COORDINATE ERROR.                         
REMARK   3   ESD FROM C-V LUZZATI PLOT    (A) : 0.57                            
REMARK   3   ESD FROM C-V SIGMAA          (A) : 0.94                            
REMARK   3                                                                      
REMARK   3  RMS DEVIATIONS FROM IDEAL VALUES.                                   
REMARK   3   BOND LENGTHS                 (A) : 0.009                           
REMARK   3   BOND ANGLES            (DEGREES) : 1.400                           
REMARK   3   DIHEDRAL ANGLES        (DEGREES) : 21.40                           
REMARK   3   IMPROPER ANGLES        (DEGREES) : 0.920                           
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL MODEL : RESTRAINED                                
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL FACTOR RESTRAINTS.    RMS    SIGMA                
REMARK   3   MAIN-CHAIN BOND              (A**2) : 1.250 ; 1.500                
REMARK   3   MAIN-CHAIN ANGLE             (A**2) : 2.200 ; 2.000                
REMARK   3   SIDE-CHAIN BOND              (A**2) : 1.660 ; 2.000                
REMARK   3   SIDE-CHAIN ANGLE             (A**2) : 2.730 ; 2.500                
REMARK   3                                                                      
REMARK   3  BULK SOLVENT MODELING.                                              
REMARK   3   METHOD USED : FLAT MODEL                                           
REMARK   3   KSOL        : 0.24                                                 
REMARK   3   BSOL        : 21.52                                                
REMARK   3                                                                      
REMARK   3  NCS MODEL : CONSTR                                                  
REMARK   3                                                                      
REMARK   3  NCS RESTRAINTS.                         RMS   SIGMA/WEIGHT          
REMARK   3   GROUP  1  POSITIONAL            (A) : NULL  ; NULL                 
REMARK   3   GROUP  1  B-FACTOR           (A**2) : NULL  ; NULL                 
REMARK   3                                                                      
REMARK   3  PARAMETER FILE  1  : PROTEIN_REP.PARAM                              
REMARK   3  PARAMETER FILE  2  : HETERO10.PAR                                   
REMARK   3  PARAMETER FILE  3  : PRR.PAR                                        
REMARK   3  PARAMETER FILE  4  : WATER.PARAM                                    
REMARK   3  PARAMETER FILE  5  : PROSTH3.PAR                                    
REMARK   3  PARAMETER FILE  6  : NULL                                           
REMARK   3  TOPOLOGY FILE  1   : &_1_TOPOLOGY_INFILE_1                          
REMARK   3  TOPOLOGY FILE  2   : &_1_TOPOLOGY_INFILE_2                          
REMARK   3  TOPOLOGY FILE  3   : &_1_TOPOLOGY_INFILE_3                          
REMARK   3  TOPOLOGY FILE  4   : &_1_TOPOLOGY_INFILE_4                          
REMARK   3  TOPOLOGY FILE  5   : &_1_TOPOLOGY_INFILE_5                          
REMARK   3  TOPOLOGY FILE  6   : NULL                                           
REMARK   3                                                                      
REMARK   3  OTHER REFINEMENT REMARKS: NULL                                      
REMARK   4                                                                      
REMARK   4 3L73 COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 21-JAN-10.                  
REMARK 100 THE DEPOSITION ID IS D_1000056915.                                   
REMARK 200                                                                      
REMARK 200 EXPERIMENTAL DETAILS                                                 
REMARK 200  EXPERIMENT TYPE                : X-RAY DIFFRACTION                  
REMARK 200  DATE OF DATA COLLECTION        : 26-AUG-06                          
REMARK 200  TEMPERATURE           (KELVIN) : 100.0                              
REMARK 200  PH                             : 6.77                               
REMARK 200  NUMBER OF CRYSTALS USED        : 1                                  
REMARK 200                                                                      
REMARK 200  SYNCHROTRON              (Y/N) : Y                                  
REMARK 200  RADIATION SOURCE               : ALS                                
REMARK 200  BEAMLINE                       : 5.0.2                              
REMARK 200  X-RAY GENERATOR MODEL          : NULL                               
REMARK 200  MONOCHROMATIC OR LAUE    (M/L) : M                                  
REMARK 200  WAVELENGTH OR RANGE        (A) : 1.00                               
REMARK 200  MONOCHROMATOR                  : DOUBLE CRYSTAL SI(111)             
REMARK 200  OPTICS                         : NULL                               
REMARK 200                                                                      
REMARK 200  DETECTOR TYPE                  : CCD                                
REMARK 200  DETECTOR MANUFACTURER          : ADSC QUANTUM 315                   
REMARK 200  INTENSITY-INTEGRATION SOFTWARE : DENZO                              
REMARK 200  DATA SCALING SOFTWARE          : SCALEPACK                          
REMARK 200                                                                      
REMARK 200  NUMBER OF UNIQUE REFLECTIONS   : 167200                             
REMARK 200  RESOLUTION RANGE HIGH      (A) : 2.900                              
REMARK 200  RESOLUTION RANGE LOW       (A) : 25.000                             
REMARK 200  REJECTION CRITERIA  (SIGMA(I)) : -3.000                             
REMARK 200                                                                      
REMARK 200 OVERALL.                                                             
REMARK 200  COMPLETENESS FOR RANGE     (%) : 99.9                               
REMARK 200  DATA REDUNDANCY                : 4.300                              
REMARK 200  R MERGE                    (I) : NULL                               
REMARK 200  R SYM                      (I) : 0.08500                            
REMARK 200  <I/SIGMA(I)> FOR THE DATA SET  : 19.3800                            
REMARK 200                                                                      
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.                                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 2.90                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE LOW  (A) : 2.95                     
REMARK 200  COMPLETENESS FOR SHELL     (%) : 99.7                               
REMARK 200  DATA REDUNDANCY IN SHELL       : 3.90                               
REMARK 200  R MERGE FOR SHELL          (I) : NULL                               
REMARK 200  R SYM FOR SHELL            (I) : NULL                               
REMARK 200  <I/SIGMA(I)> FOR SHELL         : 1.072                              
REMARK 200                                                                      
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH                              
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: RIGID BODY REFINEMENT        
REMARK 200 SOFTWARE USED: CNS                                                   
REMARK 200 STARTING MODEL: PDB ENTRY 3H1H                                       
REMARK 200                                                                      
REMARK 200 REMARK: NULL                                                         
REMARK 280                                                                      
REMARK 280 CRYSTAL                                                              
REMARK 280 SOLVENT CONTENT, VS   (%): 69.38                                     
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 4.02                     
REMARK 280                                                                      
REMARK 280 CRYSTALLIZATION CONDITIONS: FINAL CONCENTRATIONS BEFORE DIFFUSION:   
REMARK 280  50 MM CACODYLATE, 9.4 MM TRISHCL, 10 MM MGCL2, 50 G/L GLYCEROL,     
REMARK 280  30 G/L PEG 3350DA, 0.23 MM EDTA, 0.47 G/L UNDECYL MALTOSIDE, 31     
REMARK 280  MM OCTYL GLUCOSIDE, PH 6.77, VAPOR DIFFUSION, SITTING DROP,         
REMARK 280  TEMPERATURE 277K                                                    
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY                                            
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 21 21 21                       
REMARK 290                                                                      
REMARK 290      SYMOP   SYMMETRY                                                
REMARK 290     NNNMMM   OPERATOR                                                
REMARK 290       1555   X,Y,Z                                                   
REMARK 290       2555   -X+1/2,-Y,Z+1/2                                         
REMARK 290       3555   -X,Y+1/2,-Z+1/2                                         
REMARK 290       4555   X+1/2,-Y+1/2,-Z                                         
REMARK 290                                                                      
REMARK 290     WHERE NNN -> OPERATOR NUMBER                                     
REMARK 290           MMM -> TRANSLATION VECTOR                                  
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS                            
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM             
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY                
REMARK 290 RELATED MOLECULES.                                                   
REMARK 290   SMTRY1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   2 -1.000000  0.000000  0.000000       85.74950            
REMARK 290   SMTRY2   2  0.000000 -1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   2  0.000000  0.000000  1.000000      120.51400            
REMARK 290   SMTRY1   3 -1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   3  0.000000  1.000000  0.000000       91.46700            
REMARK 290   SMTRY3   3  0.000000  0.000000 -1.000000      120.51400            
REMARK 290   SMTRY1   4  1.000000  0.000000  0.000000       85.74950            
REMARK 290   SMTRY2   4  0.000000 -1.000000  0.000000       91.46700            
REMARK 290   SMTRY3   4  0.000000  0.000000 -1.000000        0.00000            
REMARK 290                                                                      
REMARK 290 REMARK: NULL                                                         
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 300 REMARK: THE DEPOSITED COORDINATES (20 CHAINS PLUS HETERO GROUPS)     
REMARK 300 MAKE UP THE ASYMMETRIC UNIT WHICH IS THE BIOLOGICAL ASSEMBLY. ONE    
REMARK 300 OTHER SUBUNIT OF THE BIOLOGICAL ASSEMBLY (SUBUNIT 11) IS LOST        
REMARK 300 DURING PURIFICATION OR CRYSTALLIZATION AND IS NOT PRESENT IN THE     
REMARK 300 DEPOSITED STRUCTURE.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: EICOSAMERIC                       
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: EICOSAMERIC                
REMARK 350 SOFTWARE USED: PISA                                                  
REMARK 350 TOTAL BURIED SURFACE AREA: 101720 ANGSTROM**2                        
REMARK 350 SURFACE AREA OF THE COMPLEX: 156520 ANGSTROM**2                      
REMARK 350 CHANGE IN SOLVENT FREE ENERGY: -689.0 KCAL/MOL                       
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, C, D, E, F, G, H, I, J,         
REMARK 350                    AND CHAINS: N, O, P, Q, R, S, T, U, V, W          
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     ARG A   445                                                      
REMARK 465     PHE A   446                                                      
REMARK 465     SER B    -1                                                      
REMARK 465     LEU B     0                                                      
REMARK 465     LYS B     1                                                      
REMARK 465     VAL B     2                                                      
REMARK 465     ALA B     3                                                      
REMARK 465     PRO B     4                                                      
REMARK 465     LYS B     5                                                      
REMARK 465     VAL B     6                                                      
REMARK 465     ALA B     7                                                      
REMARK 465     VAL B     8                                                      
REMARK 465     SER B     9                                                      
REMARK 465     ALA B    10                                                      
REMARK 465     ALA B    11                                                      
REMARK 465     ALA B    12                                                      
REMARK 465     GLU B    13                                                      
REMARK 465     ARG B    14                                                      
REMARK 465     VAL B    15                                                      
REMARK 465     LYS B    16                                                      
REMARK 465     LEU B    17                                                      
REMARK 465     CYS B    18                                                      
REMARK 465     PRO B    19                                                      
REMARK 465     ALA F     1                                                      
REMARK 465     ALA F     2                                                      
REMARK 465     ARG F     3                                                      
REMARK 465     ALA F     4                                                      
REMARK 465     THR F     5                                                      
REMARK 465     VAL F     6                                                      
REMARK 465     ALA F     7                                                      
REMARK 465     GLY F     8                                                      
REMARK 465     GLY F     9                                                      
REMARK 465     GLY G     1                                                      
REMARK 465     LEU H     2                                                      
REMARK 465     ARG H     3                                                      
REMARK 465     GLY H     4                                                      
REMARK 465     SER H     5                                                      
REMARK 465     GLY H     6                                                      
REMARK 465     GLU H     7                                                      
REMARK 465     GLU H     8                                                      
REMARK 465     TYR I    78                                                      
REMARK 465     ALA N     1                                                      
REMARK 465     ALA N     2                                                      
REMARK 465     ARG N   445                                                      
REMARK 465     PHE N   446                                                      
REMARK 465     SER O    -1                                                      
REMARK 465     LEU O     0                                                      
REMARK 465     LYS O     1                                                      
REMARK 465     VAL O     2                                                      
REMARK 465     ALA O     3                                                      
REMARK 465     PRO O     4                                                      
REMARK 465     LYS O     5                                                      
REMARK 465     VAL O     6                                                      
REMARK 465     ALA O     7                                                      
REMARK 465     VAL O     8                                                      
REMARK 465     SER O     9                                                      
REMARK 465     ALA O    10                                                      
REMARK 465     ALA O    11                                                      
REMARK 465     ALA O    12                                                      
REMARK 465     GLU O    13                                                      
REMARK 465     ARG O    14                                                      
REMARK 465     VAL O    15                                                      
REMARK 465     LYS O    16                                                      
REMARK 465     LEU O    17                                                      
REMARK 465     MET P     1                                                      
REMARK 465     ALA S     1                                                      
REMARK 465     ALA S     2                                                      
REMARK 465     ARG S     3                                                      
REMARK 465     ALA S     4                                                      
REMARK 465     THR S     5                                                      
REMARK 465     VAL S     6                                                      
REMARK 465     ALA S     7                                                      
REMARK 465     GLY S     8                                                      
REMARK 465     GLY S     9                                                      
REMARK 465     GLY T     1                                                      
REMARK 465     GLN T    81                                                      
REMARK 465     LEU U     2                                                      
REMARK 465     ARG U     3                                                      
REMARK 465     GLY U     4                                                      
REMARK 465     SER U     5                                                      
REMARK 465     GLY U     6                                                      
REMARK 465     GLU U     7                                                      
REMARK 465     GLU U     8                                                      
REMARK 465     GLU U     9                                                      
REMARK 465     GLU U    10                                                      
REMARK 465     GLU U    11                                                      
REMARK 465     UNK V    25                                                      
REMARK 465     UNK V    26                                                      
REMARK 465     UNK V    27                                                      
REMARK 465     TYR V    78                                                      
REMARK 465     GLU W    64                                                      
REMARK 470                                                                      
REMARK 470 MISSING ATOM                                                         
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 470 I=INSERTION CODE):                                                   
REMARK 470   M RES CSSEQI  ATOMS                                                
REMARK 470     ILE A 444    O    CG1  CG2  CD1                                  
REMARK 470     ALA B  21    CB                                                  
REMARK 470     MET C   1    CG   SD   CE                                        
REMARK 470     GLU H   9    N    CB   CG   CD   OE1  OE2                        
REMARK 470     ARG I  47    N    CB   CG   CD   NE   CZ   NH1                   
REMARK 470     ARG I  47    NH2                                                 
REMARK 470     ARG I  61    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE N 444    O    CG1  CG2  CD1                                  
REMARK 470     GLU R 111    CG   CD   OE1  OE2                                  
REMARK 470     ARG V  47    N    CB   CG   CD   NE   CZ   NH1                   
REMARK 470     ARG V  47    NH2                                                 
REMARK 470     ARG V  61    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU W  63    CA   C    O    CB   CG   CD   OE1                   
REMARK 470     GLU W  63    OE2                                                 
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   SG   CYS D    40     CAC  HEC D   501              1.78            
REMARK 500   SG   CYS Q    37     CAB  HEC Q   501              1.81            
REMARK 500   SG   CYS Q    40     CAC  HEC Q   501              1.82            
REMARK 500   SG   CYS D    37     CAB  HEC D   501              1.82            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500    PRO A  33   C   -  N   -  CA  ANGL. DEV. =  10.1 DEGREES          
REMARK 500    PRO N  33   C   -  N   -  CA  ANGL. DEV. =  10.9 DEGREES          
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    ASN A  10       11.64    -68.83                                   
REMARK 500    LYS A  65       32.40    -85.94                                   
REMARK 500    ARG A  70      103.25   -160.17                                   
REMARK 500    PRO A  71      173.96    -52.85                                   
REMARK 500    CYS A  72      -79.15    -36.07                                   
REMARK 500    THR A  90      115.28   -162.87                                   
REMARK 500    SER A  91     -158.54   -104.44                                   
REMARK 500    LEU A 113      -70.58    -51.07                                   
REMARK 500    ALA A 155      -14.96    -45.06                                   
REMARK 500    SER A 217      -63.79    -95.77                                   
REMARK 500    PHE A 221      -60.58   -101.53                                   
REMARK 500    ASP A 226       43.11   -106.63                                   
REMARK 500    TRP A 262      -56.50    -20.57                                   
REMARK 500    ASP A 281      126.67   -179.61                                   
REMARK 500    ARG A 282      -17.83    -31.28                                   
REMARK 500    LYS A 288        2.76    -59.29                                   
REMARK 500    SER A 306      162.80    176.51                                   
REMARK 500    THR A 317     -150.98   -147.24                                   
REMARK 500    SER A 348       44.53   -146.67                                   
REMARK 500    ASP A 370       77.96   -106.18                                   
REMARK 500    ARG A 388      174.07    170.41                                   
REMARK 500    ALA A 404      -72.99    -45.65                                   
REMARK 500    ASP A 433      113.28     47.59                                   
REMARK 500    TRP A 443      105.86     65.27                                   
REMARK 500    ALA B  21       88.68    160.26                                   
REMARK 500    GLU B  22      149.02   -177.55                                   
REMARK 500    ASP B  23     -168.18     66.30                                   
REMARK 500    LEU B  24       72.50    173.20                                   
REMARK 500    ILE B  26       81.08   -170.19                                   
REMARK 500    LYS B  28       61.33   -151.46                                   
REMARK 500    LEU B  29      162.45    -15.77                                   
REMARK 500    PHE B  41       28.19     47.56                                   
REMARK 500    PRO B  43       -0.49    -59.32                                   
REMARK 500    ARG B  46       87.86   -164.27                                   
REMARK 500    SER B  55       -6.30    -51.17                                   
REMARK 500    LEU B  96      117.39   -171.68                                   
REMARK 500    THR B 101     -167.14   -101.36                                   
REMARK 500    CYS B 111      167.83    171.77                                   
REMARK 500    PHE B 152       11.45    -64.79                                   
REMARK 500    HIS B 164      -14.44    -49.42                                   
REMARK 500    ALA B 171      -73.96     35.86                                   
REMARK 500    CYS B 178      123.40    -36.87                                   
REMARK 500    GLU B 189      -71.65    -63.90                                   
REMARK 500    ASN B 198      -37.24   -134.71                                   
REMARK 500    SER B 201      -32.93    -36.78                                   
REMARK 500    GLU B 221      -92.35    -73.45                                   
REMARK 500    LEU B 224       92.99    -47.82                                   
REMARK 500    ASN B 225      -79.63    -73.48                                   
REMARK 500    ILE B 226       92.71    -28.25                                   
REMARK 500    SER B 228      160.66    -24.72                                   
REMARK 500                                                                      
REMARK 500 THIS ENTRY HAS     253 RAMACHANDRAN OUTLIERS.                        
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 610                                                                      
REMARK 610 MISSING HETEROATOM                                                   
REMARK 610 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 610 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 610 I=INSERTION CODE):                                                   
REMARK 610   M RES C SSEQI                                                      
REMARK 610     PEE A 2008                                                       
REMARK 610      UQ C 2002                                                       
REMARK 610     PEE C 2007                                                       
REMARK 610     CDL D 2003                                                       
REMARK 610     BOG D 2091                                                       
REMARK 610     PEE E 2005                                                       
REMARK 610     CDL G 2004                                                       
REMARK 610     BOG P 2010                                                       
REMARK 610      UQ P 3002                                                       
REMARK 610     PEE P 3007                                                       
REMARK 610     PEE P 3008                                                       
REMARK 610     CDL Q 3003                                                       
REMARK 610     BOG Q 3091                                                       
REMARK 610     PEE R 3005                                                       
REMARK 610     CDL T 3004                                                       
REMARK 620                                                                      
REMARK 620 METAL COORDINATION                                                   
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):                             
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                             HEM C 501  FE                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HIS C  84   NE2                                                    
REMARK 620 2 HEM C 501   NA   91.6                                              
REMARK 620 3 HEM C 501   NB   91.1  89.0                                        
REMARK 620 4 HEM C 501   NC   89.6 178.5  91.9                                  
REMARK 620 5 HEM C 501   ND   92.7  89.9 176.0  89.1                            
REMARK 620 6 HIS C 183   NE2 175.2  92.5  86.6  86.3  89.7                      
REMARK 620 N                    1     2     3     4     5                       
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                             HEM C 502  FE                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HIS C  98   NE2                                                    
REMARK 620 2 HEM C 502   NA   87.6                                              
REMARK 620 3 HEM C 502   NB   87.4  89.3                                        
REMARK 620 4 HEM C 502   NC   88.1 175.7  91.0                                  
REMARK 620 5 HEM C 502   ND   90.0  89.2 177.1  90.2                            
REMARK 620 6 HIS C 197   NE2 173.9  97.8  95.4  86.5  87.3                      
REMARK 620 N                    1     2     3     4     5                       
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                             HEC D 501  FE                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HIS D  41   NE2                                                    
REMARK 620 2 HEC D 501   NA   87.4                                              
REMARK 620 3 HEC D 501   NB   88.9  90.7                                        
REMARK 620 4 HEC D 501   NC   91.8 178.9  89.9                                  
REMARK 620 5 HEC D 501   ND   92.4  89.8 178.7  89.5                            
REMARK 620 6 MET D 160   SD  177.3  94.6  89.3  86.3  89.5                      
REMARK 620 N                    1     2     3     4     5                       
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                             FES E 501  FE1                           
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 CYS E 139   SG                                                     
REMARK 620 2 FES E 501   S1  111.1                                              
REMARK 620 3 FES E 501   S2  110.5 105.0                                        
REMARK 620 4 CYS E 158   SG  110.0 110.4 109.7                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                             FES E 501  FE2                           
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HIS E 141   ND1                                                    
REMARK 620 2 FES E 501   S1  114.4                                              
REMARK 620 3 FES E 501   S2  116.3 105.4                                        
REMARK 620 4 HIS E 161   ND1  89.9 116.3 114.6                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                             HEM P 501  FE                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HIS P  84   NE2                                                    
REMARK 620 2 HEM P 501   NA   90.6                                              
REMARK 620 3 HEM P 501   NB   88.0  89.1                                        
REMARK 620 4 HEM P 501   NC   93.7 175.6  90.9                                  
REMARK 620 5 HEM P 501   ND   92.7  90.5 179.2  89.4                            
REMARK 620 6 HIS P 183   NE2 175.4  91.4  87.9  84.2  91.4                      
REMARK 620 N                    1     2     3     4     5                       
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                             HEM P 502  FE                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HIS P  98   NE2                                                    
REMARK 620 2 HEM P 502   NA   86.9                                              
REMARK 620 3 HEM P 502   NB   89.7  88.6                                        
REMARK 620 4 HEM P 502   NC   89.2 175.9  92.9                                  
REMARK 620 5 HEM P 502   ND   90.3  88.3 176.9  90.2                            
REMARK 620 6 HIS P 197   NE2 174.5  96.4  94.7  87.3  85.5                      
REMARK 620 N                    1     2     3     4     5                       
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                             HEC Q 501  FE                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HIS Q  41   NE2                                                    
REMARK 620 2 HEC Q 501   NA   88.6                                              
REMARK 620 3 HEC Q 501   NB   88.1  91.2                                        
REMARK 620 4 HEC Q 501   NC   92.9 178.5  88.4                                  
REMARK 620 5 HEC Q 501   ND   92.3  88.7 179.5  91.6                            
REMARK 620 6 MET Q 160   SD  177.5  93.5  93.2  85.1  86.4                      
REMARK 620 N                    1     2     3     4     5                       
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                             FES R 501  FE1                           
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 CYS R 139   SG                                                     
REMARK 620 2 FES R 501   S1  112.7                                              
REMARK 620 3 FES R 501   S2  108.4 104.7                                        
REMARK 620 4 CYS R 158   SG  109.6 110.3 111.0                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                             FES R 501  FE2                           
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HIS R 141   ND1                                                    
REMARK 620 2 FES R 501   S1  115.1                                              
REMARK 620 3 FES R 501   S2  114.6 105.4                                        
REMARK 620 4 HIS R 161   ND1  94.2 114.8 113.0                                  
REMARK 620 N                    1     2     3                                   
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: 3L70   RELATED DB: PDB                                   
REMARK 900 RELATED ID: 3L71   RELATED DB: PDB                                   
REMARK 900 RELATED ID: 3L72   RELATED DB: PDB                                   
REMARK 900 RELATED ID: 3L74   RELATED DB: PDB                                   
REMARK 900 RELATED ID: 3L75   RELATED DB: PDB                                   
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 THE COMPLETE SEQUENCE OF CHAIN I AND V IS                            
REMARK 999 MLSVAARSGPFAPYLSAAAHAVPGPLKALAPAALRAEKVVLDLKRPLLCRESMSGRSARRDLVAGISL 
REMARK 999 NAPASVRY, UNP RESIDUES 1-76. THE N-TERMINUS IS DISORDERED.           
DBREF  3L73 A    1   446  UNP    D0VX31   D0VX31_CHICK     1    446             
DBREF  3L73 B   -1   439  UNP    D0VX29   D0VX29_CHICK     1    441             
DBREF  3L73 C    1   380  UNP    P18946   CYB_CHICK        1    380             
DBREF  3L73 D    1   241  UNP    D0VX26   D0VX26_CHICK     1    241             
DBREF  3L73 E    1   196  UNP    Q5ZLR5   UCRI_CHICK      77    272             
DBREF  3L73 F    1   110  UNP    D0VX30   D0VX30_CHICK     1    110             
DBREF  3L73 G    1    81  UNP    D0VX32   D0VX32_CHICK     1     81             
DBREF  3L73 H    2    78  UNP    D0VX28   D0VX28_CHICK     1     77             
DBREF  3L73 I   47    78  UNP    Q5ZLR5   UCRI_CHICK      45     76             
DBREF  3L73 J    4    64  UNP    D0VX27   D0VX27_CHICK     1     61             
DBREF  3L73 N    1   446  UNP    D0VX31   D0VX31_CHICK     1    446             
DBREF  3L73 O   -1   439  UNP    D0VX29   D0VX29_CHICK     1    441             
DBREF  3L73 P    1   380  UNP    P18946   CYB_CHICK        1    380             
DBREF  3L73 Q    1   241  UNP    D0VX26   D0VX26_CHICK     1    241             
DBREF  3L73 R    1   196  UNP    Q5ZLR5   UCRI_CHICK      77    272             
DBREF  3L73 S    1   110  UNP    D0VX30   D0VX30_CHICK     1    110             
DBREF  3L73 T    1    81  UNP    D0VX32   D0VX32_CHICK     1     81             
DBREF  3L73 U    2    78  UNP    D0VX28   D0VX28_CHICK     1     77             
DBREF  3L73 V   47    78  UNP    Q5ZLR5   UCRI_CHICK      45     76             
DBREF  3L73 W    4    64  UNP    D0VX27   D0VX27_CHICK     1     61             
SEQRES   1 A  446  ALA ALA THR TYR ALA GLN THR LEU GLN ASN ILE PRO GLU          
SEQRES   2 A  446  THR ASN VAL THR THR LEU ASP ASN GLY LEU ARG VAL ALA          
SEQRES   3 A  446  SER GLU GLU SER SER GLN PRO THR CYS THR VAL GLY VAL          
SEQRES   4 A  446  TRP ILE GLY ALA GLY SER ARG TYR GLU ASN GLU LYS ASN          
SEQRES   5 A  446  ASN GLY ALA GLY TYR PHE VAL GLU HIS LEU ALA PHE LYS          
SEQRES   6 A  446  GLY THR LYS LYS ARG PRO CYS ALA ALA PHE GLU LYS GLU          
SEQRES   7 A  446  VAL GLU SER MET GLY ALA HIS PHE ASN GLY TYR THR SER          
SEQRES   8 A  446  ARG GLU GLN THR ALA PHE TYR ILE LYS ALA LEU SER LYS          
SEQRES   9 A  446  ASP MET PRO LYS VAL VAL GLU LEU LEU ALA ASP VAL VAL          
SEQRES  10 A  446  GLN ASN CYS ALA LEU GLU GLU SER GLN ILE GLU LYS GLU          
SEQRES  11 A  446  ARG GLY VAL ILE LEU GLN GLU LEU LYS GLU MET ASP ASN          
SEQRES  12 A  446  ASP MET THR ASN VAL THR PHE ASP TYR LEU HIS ALA THR          
SEQRES  13 A  446  ALA PHE GLN GLY THR ALA LEU ALA ARG THR VAL GLU GLY          
SEQRES  14 A  446  THR THR GLU ASN ILE LYS HIS LEU THR ARG ALA ASP LEU          
SEQRES  15 A  446  ALA SER TYR ILE ASP THR HIS PHE LYS ALA PRO ARG MET          
SEQRES  16 A  446  VAL LEU ALA ALA ALA GLY GLY ILE SER HIS LYS GLU LEU          
SEQRES  17 A  446  VAL ASP ALA ALA ARG GLN HIS PHE SER GLY VAL SER PHE          
SEQRES  18 A  446  THR TYR LYS GLU ASP ALA VAL PRO ILE LEU PRO ARG CYS          
SEQRES  19 A  446  ARG PHE THR GLY SER GLU ILE ARG ALA ARG ASP ASP ALA          
SEQRES  20 A  446  LEU PRO VAL ALA HIS VAL ALA LEU ALA VAL GLU GLY PRO          
SEQRES  21 A  446  GLY TRP ALA ASP PRO ASP ASN VAL VAL LEU HIS VAL ALA          
SEQRES  22 A  446  ASN ALA ILE ILE GLY ARG TYR ASP ARG THR PHE GLY GLY          
SEQRES  23 A  446  GLY LYS HIS LEU SER SER ARG LEU ALA ALA LEU ALA VAL          
SEQRES  24 A  446  GLU HIS LYS LEU CYS HIS SER PHE GLN THR PHE ASN THR          
SEQRES  25 A  446  SER TYR SER ASP THR GLY LEU PHE GLY PHE HIS PHE VAL          
SEQRES  26 A  446  ALA ASP PRO LEU SER ILE ASP ASP MET MET PHE CYS ALA          
SEQRES  27 A  446  GLN GLY GLU TRP MET ARG LEU CYS THR SER THR THR GLU          
SEQRES  28 A  446  SER GLU VAL LYS ARG ALA LYS ASN HIS LEU ARG SER ALA          
SEQRES  29 A  446  MET VAL ALA GLN LEU ASP GLY THR THR PRO VAL CYS GLU          
SEQRES  30 A  446  THR ILE GLY SER HIS LEU LEU ASN TYR GLY ARG ARG ILE          
SEQRES  31 A  446  SER LEU GLU GLU TRP ASP SER ARG ILE SER ALA VAL ASP          
SEQRES  32 A  446  ALA ARG MET VAL ARG ASP VAL CYS SER LYS TYR ILE TYR          
SEQRES  33 A  446  ASP LYS CYS PRO ALA LEU ALA ALA VAL GLY PRO ILE GLU          
SEQRES  34 A  446  GLN LEU LEU ASP TYR ASN ARG ILE ARG SER GLY MET TYR          
SEQRES  35 A  446  TRP ILE ARG PHE                                              
SEQRES   1 B  441  SER LEU LYS VAL ALA PRO LYS VAL ALA VAL SER ALA ALA          
SEQRES   2 B  441  ALA GLU ARG VAL LYS LEU CYS PRO GLY ALA GLU ASP LEU          
SEQRES   3 B  441  GLU ILE THR LYS LEU PRO ASN GLY LEU ILE ILE ALA SER          
SEQRES   4 B  441  LEU GLU ASN PHE SER PRO ALA SER ARG ILE GLY VAL PHE          
SEQRES   5 B  441  ILE LYS ALA GLY SER ARG TYR GLU THR THR ALA ASN LEU          
SEQRES   6 B  441  GLY THR ALA HIS LEU LEU ARG LEU ALA SER PRO LEU THR          
SEQRES   7 B  441  THR LYS GLY ALA SER SER PHE ARG ILE THR ARG GLY ILE          
SEQRES   8 B  441  GLU ALA VAL GLY GLY SER LEU SER VAL TYR SER THR ARG          
SEQRES   9 B  441  GLU LYS MET THR TYR CYS VAL GLU CYS LEU ARG ASP HIS          
SEQRES  10 B  441  VAL ASP THR VAL MET GLU TYR LEU LEU ASN VAL THR THR          
SEQRES  11 B  441  ALA PRO GLU PHE ARG PRO TRP GLU VAL THR ASP LEU GLN          
SEQRES  12 B  441  PRO GLN LEU LYS VAL ASP LYS ALA VAL ALA PHE GLN SER          
SEQRES  13 B  441  PRO GLN VAL GLY VAL LEU GLU ASN LEU HIS ALA ALA ALA          
SEQRES  14 B  441  TYR LYS THR ALA LEU ALA ASN PRO LEU TYR CYS PRO ASP          
SEQRES  15 B  441  TYR ARG ILE GLY LYS ILE THR SER GLU GLN LEU HIS HIS          
SEQRES  16 B  441  PHE VAL GLN ASN ASN PHE THR SER ALA ARG MET ALA LEU          
SEQRES  17 B  441  VAL GLY ILE GLY VAL LYS HIS SER ASP LEU LYS GLN VAL          
SEQRES  18 B  441  ALA GLU GLN PHE LEU ASN ILE ARG SER GLY ALA GLY THR          
SEQRES  19 B  441  SER SER ALA LYS ALA THR TYR TRP GLY GLY GLU ILE ARG          
SEQRES  20 B  441  GLU GLN ASN GLY HIS SER LEU VAL HIS ALA ALA VAL VAL          
SEQRES  21 B  441  THR GLU GLY ALA ALA VAL GLY SER ALA GLU ALA ASN ALA          
SEQRES  22 B  441  PHE SER VAL LEU GLN HIS VAL LEU GLY ALA GLY PRO LEU          
SEQRES  23 B  441  ILE LYS ARG GLY SER SER VAL THR SER LYS LEU TYR GLN          
SEQRES  24 B  441  GLY VAL ALA LYS ALA THR THR GLN PRO PHE ASP ALA SER          
SEQRES  25 B  441  ALA PHE ASN VAL ASN TYR SER ASP SER GLY LEU PHE GLY          
SEQRES  26 B  441  PHE TYR THR ILE SER GLN ALA ALA HIS ALA GLY GLU VAL          
SEQRES  27 B  441  ILE ARG ALA ALA MET ASN GLN LEU LYS ALA ALA ALA GLN          
SEQRES  28 B  441  GLY GLY VAL THR GLU GLU ASP VAL THR LYS ALA LYS ASN          
SEQRES  29 B  441  GLN LEU LYS ALA THR TYR LEU MET SER VAL GLU THR ALA          
SEQRES  30 B  441  GLN GLY LEU LEU ASN GLU ILE GLY SER GLU ALA LEU LEU          
SEQRES  31 B  441  SER GLY THR HIS THR ALA PRO SER VAL VAL ALA GLN LYS          
SEQRES  32 B  441  ILE ASP SER VAL THR SER ALA ASP VAL VAL ASN ALA ALA          
SEQRES  33 B  441  LYS LYS PHE VAL SER GLY LYS LYS SER MET ALA ALA SER          
SEQRES  34 B  441  GLY ASP LEU GLY SER THR PRO PHE LEU ASP GLU LEU              
SEQRES   1 C  380  MET ALA PRO ASN ILE ARG LYS SER HIS PRO LEU LEU LYS          
SEQRES   2 C  380  MET ILE ASN ASN SER LEU ILE ASP LEU PRO ALA PRO SER          
SEQRES   3 C  380  ASN ILE SER ALA TRP TRP ASN PHE GLY SER LEU LEU ALA          
SEQRES   4 C  380  VAL CYS LEU MET THR GLN ILE LEU THR GLY LEU LEU LEU          
SEQRES   5 C  380  ALA MET HIS TYR THR ALA ASP THR SER LEU ALA PHE SER          
SEQRES   6 C  380  SER VAL ALA HIS THR CYS ARG ASN VAL GLN TYR GLY TRP          
SEQRES   7 C  380  LEU ILE ARG ASN LEU HIS ALA ASN GLY ALA SER PHE PHE          
SEQRES   8 C  380  PHE ILE CYS ILE PHE LEU HIS ILE GLY ARG GLY LEU TYR          
SEQRES   9 C  380  TYR GLY SER TYR LEU TYR LYS GLU THR TRP ASN THR GLY          
SEQRES  10 C  380  VAL ILE LEU LEU LEU THR LEU MET ALA THR ALA PHE VAL          
SEQRES  11 C  380  GLY TYR VAL LEU PRO TRP GLY GLN MET SER PHE TRP GLY          
SEQRES  12 C  380  ALA THR VAL ILE THR ASN LEU PHE SER ALA ILE PRO TYR          
SEQRES  13 C  380  ILE GLY HIS THR LEU VAL GLU TRP ALA TRP GLY GLY PHE          
SEQRES  14 C  380  SER VAL ASP ASN PRO THR LEU THR ARG PHE PHE ALA LEU          
SEQRES  15 C  380  HIS PHE LEU LEU PRO PHE ALA ILE ALA GLY ILE THR ILE          
SEQRES  16 C  380  ILE HIS LEU THR PHE LEU HIS GLU SER GLY SER ASN ASN          
SEQRES  17 C  380  PRO LEU GLY ILE SER SER ASP SER ASP LYS ILE PRO PHE          
SEQRES  18 C  380  HIS PRO TYR TYR SER PHE LYS ASP ILE LEU GLY LEU THR          
SEQRES  19 C  380  LEU MET LEU THR PRO PHE LEU THR LEU ALA LEU PHE SER          
SEQRES  20 C  380  PRO ASN LEU LEU GLY ASP PRO GLU ASN PHE THR PRO ALA          
SEQRES  21 C  380  ASN PRO LEU VAL THR PRO PRO HIS ILE LYS PRO GLU TRP          
SEQRES  22 C  380  TYR PHE LEU PHE ALA TYR ALA ILE LEU ARG SER ILE PRO          
SEQRES  23 C  380  ASN LYS LEU GLY GLY VAL LEU ALA LEU ALA ALA SER VAL          
SEQRES  24 C  380  LEU ILE LEU PHE LEU ILE PRO PHE LEU HIS LYS SER LYS          
SEQRES  25 C  380  GLN ARG THR MET THR PHE ARG PRO LEU SER GLN THR LEU          
SEQRES  26 C  380  PHE TRP LEU LEU VAL ALA ASN LEU LEU ILE LEU THR TRP          
SEQRES  27 C  380  ILE GLY SER GLN PRO VAL GLU HIS PRO PHE ILE ILE ILE          
SEQRES  28 C  380  GLY GLN MET ALA SER LEU SER TYR PHE THR ILE LEU LEU          
SEQRES  29 C  380  ILE LEU PHE PRO THR ILE GLY THR LEU GLU ASN LYS MET          
SEQRES  30 C  380  LEU ASN TYR                                                  
SEQRES   1 D  241  GLY GLU LEU GLU LEU HIS PRO PRO ALA PHE PRO TRP SER          
SEQRES   2 D  241  HIS GLY GLY PRO LEU SER ALA LEU ASP HIS SER SER VAL          
SEQRES   3 D  241  ARG ARG GLY PHE GLN VAL TYR LYS GLN VAL CYS SER ALA          
SEQRES   4 D  241  CYS HIS SER MET ASP TYR VAL ALA PHE ARG ASN LEU ILE          
SEQRES   5 D  241  GLY VAL THR HIS THR GLU ALA GLU ALA LYS ALA LEU ALA          
SEQRES   6 D  241  GLU GLU VAL GLU VAL GLN ASP GLY PRO ASP GLU ASN GLY          
SEQRES   7 D  241  GLU LEU PHE MET ARG PRO GLY LYS ILE SER ASP TYR PHE          
SEQRES   8 D  241  PRO LYS PRO TYR PRO ASN PRO GLU ALA ALA ARG ALA ALA          
SEQRES   9 D  241  ASN ASN GLY ALA LEU PRO PRO ASP LEU SER TYR ILE VAL          
SEQRES  10 D  241  ASN ALA ARG HIS GLY GLY GLU ASP TYR VAL PHE SER LEU          
SEQRES  11 D  241  LEU THR GLY TYR CYS ASP PRO PRO ALA GLY VAL VAL VAL          
SEQRES  12 D  241  ARG GLU GLY LEU HIS TYR ASN PRO TYR PHE PRO GLY GLN          
SEQRES  13 D  241  ALA ILE GLY MET ALA PRO PRO ILE TYR ASN GLU ILE LEU          
SEQRES  14 D  241  GLU TYR ASP ASP GLY THR PRO ALA THR MET SER GLN ILE          
SEQRES  15 D  241  ALA LYS ASP VAL CYS THR PHE LEU ARG TRP ALA ALA GLU          
SEQRES  16 D  241  PRO GLU HIS ASP GLN ARG LYS ARG MET GLY LEU LYS MET          
SEQRES  17 D  241  LEU LEU ILE SER ALA LEU LEU THR SER LEU LEU TYR TYR          
SEQRES  18 D  241  MET LYS ARG HIS LYS TRP SER VAL LEU LYS SER ARG LYS          
SEQRES  19 D  241  MET ALA TYR ARG PRO PRO LYS                                  
SEQRES   1 E  196  VAL HIS ASN ASP VAL THR VAL PRO ASP PHE SER ALA TYR          
SEQRES   2 E  196  ARG ARG GLU ASP VAL MET ASP ALA THR THR SER SER GLN          
SEQRES   3 E  196  THR SER SER GLU ASP ARG LYS GLY PHE SER TYR LEU VAL          
SEQRES   4 E  196  THR ALA THR ALA CYS VAL ALA THR ALA TYR ALA ALA LYS          
SEQRES   5 E  196  ASN VAL VAL THR GLN PHE ILE SER SER LEU SER ALA SER          
SEQRES   6 E  196  ALA ASP VAL LEU ALA LEU SER LYS ILE GLU ILE LYS LEU          
SEQRES   7 E  196  SER ASP ILE PRO GLU GLY LYS ASN VAL ALA PHE LYS TRP          
SEQRES   8 E  196  ARG GLY LYS PRO LEU PHE VAL ARG HIS ARG THR GLN ALA          
SEQRES   9 E  196  GLU ILE ASN GLN GLU ALA GLU VAL ASP VAL SER LYS LEU          
SEQRES  10 E  196  ARG ASP PRO GLN HIS ASP LEU ASP ARG VAL LYS LYS PRO          
SEQRES  11 E  196  GLU TRP VAL ILE LEU VAL GLY VAL CYS THR HIS LEU GLY          
SEQRES  12 E  196  CYS VAL PRO ILE ALA ASN SER GLY ASP PHE GLY GLY TYR          
SEQRES  13 E  196  TYR CYS PRO CYS HIS GLY SER HIS TYR ASP ALA SER GLY          
SEQRES  14 E  196  ARG ILE ARG LYS GLY PRO ALA PRO TYR ASN LEU GLU VAL          
SEQRES  15 E  196  PRO THR TYR GLN PHE VAL GLY ASP ASP LEU VAL VAL VAL          
SEQRES  16 E  196  GLY                                                          
SEQRES   1 F  110  ALA ALA ARG ALA THR VAL ALA GLY GLY GLY ARG LEU MET          
SEQRES   2 F  110  ASP ARG ILE ARG LYS TRP TYR TYR ASN ALA ALA GLY PHE          
SEQRES   3 F  110  ASN LYS TYR GLY LEU MET ARG ASP ASP THR LEU TYR GLU          
SEQRES   4 F  110  ASP ASP ASP VAL LYS GLU ALA LEU LYS ARG LEU PRO GLU          
SEQRES   5 F  110  ASP LEU TYR ASN GLU ARG MET PHE ARG ILE LYS ARG ALA          
SEQRES   6 F  110  LEU ASP LEU SER LEU LYS HIS ARG ILE LEU PRO LYS GLU          
SEQRES   7 F  110  GLN TRP VAL LYS TYR GLU GLU ASP LYS PRO TYR LEU GLU          
SEQRES   8 F  110  PRO TYR LEU LYS GLU VAL ILE ARG GLU ARG LEU GLU ARG          
SEQRES   9 F  110  GLU ALA TRP ASN LYS LYS                                      
SEQRES   1 G   81  GLY ILE HIS PHE GLY ASN LEU ALA ARG VAL ARG HIS ILE          
SEQRES   2 G   81  ILE THR TYR SER LEU SER PRO PHE GLU GLN ARG ALA ILE          
SEQRES   3 G   81  PRO ASN ILE PHE SER ASP ALA LEU PRO ASN VAL TRP ARG          
SEQRES   4 G   81  ARG PHE SER SER GLN VAL PHE LYS VAL ALA PRO PRO PHE          
SEQRES   5 G   81  LEU GLY ALA TYR LEU LEU TYR SER TRP GLY THR GLN GLU          
SEQRES   6 G   81  PHE GLU ARG LEU LYS ARG LYS ASN PRO ALA ASP TYR GLU          
SEQRES   7 G   81  ASN ASP GLN                                                  
SEQRES   1 H   77  LEU ARG GLY SER GLY GLU GLU GLU GLU GLU GLU LEU VAL          
SEQRES   2 H   77  ASP PRO LEU THR THR ILE ARG GLU HIS CYS GLU GLN THR          
SEQRES   3 H   77  GLU LYS CYS VAL LYS ALA ARG GLU ARG LEU GLU LEU CYS          
SEQRES   4 H   77  ASP ALA ARG VAL SER SER ARG SER HIS THR GLU GLU GLN          
SEQRES   5 H   77  CYS THR GLU GLU LEU PHE ASP PHE LEU HIS ALA ARG ASP          
SEQRES   6 H   77  HIS CYS VAL ALA HIS LYS LEU PHE ASN LYS LEU LYS              
SEQRES   1 I   47  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 I   47  UNK UNK ARG PRO LEU LEU CYS ARG GLU SER MET SER GLY          
SEQRES   3 I   47  ARG SER ALA ARG ARG ASP LEU VAL ALA GLY ILE SER LEU          
SEQRES   4 I   47  ASN ALA PRO ALA SER VAL ARG TYR                              
SEQRES   1 J   61  ALA LEU LEU ARG GLN ALA TYR SER ALA LEU PHE ARG ARG          
SEQRES   2 J   61  THR SER THR PHE ALA LEU THR VAL VAL LEU GLY ALA VAL          
SEQRES   3 J   61  LEU PHE GLU ARG ALA PHE ASP GLN GLY ALA ASP ALA ILE          
SEQRES   4 J   61  PHE GLU HIS LEU ASN GLU GLY LYS LEU TRP LYS HIS ILE          
SEQRES   5 J   61  LYS HIS LYS TYR GLU ALA SER GLU GLU                          
SEQRES   1 N  446  ALA ALA THR TYR ALA GLN THR LEU GLN ASN ILE PRO GLU          
SEQRES   2 N  446  THR ASN VAL THR THR LEU ASP ASN GLY LEU ARG VAL ALA          
SEQRES   3 N  446  SER GLU GLU SER SER GLN PRO THR CYS THR VAL GLY VAL          
SEQRES   4 N  446  TRP ILE GLY ALA GLY SER ARG TYR GLU ASN GLU LYS ASN          
SEQRES   5 N  446  ASN GLY ALA GLY TYR PHE VAL GLU HIS LEU ALA PHE LYS          
SEQRES   6 N  446  GLY THR LYS LYS ARG PRO CYS ALA ALA PHE GLU LYS GLU          
SEQRES   7 N  446  VAL GLU SER MET GLY ALA HIS PHE ASN GLY TYR THR SER          
SEQRES   8 N  446  ARG GLU GLN THR ALA PHE TYR ILE LYS ALA LEU SER LYS          
SEQRES   9 N  446  ASP MET PRO LYS VAL VAL GLU LEU LEU ALA ASP VAL VAL          
SEQRES  10 N  446  GLN ASN CYS ALA LEU GLU GLU SER GLN ILE GLU LYS GLU          
SEQRES  11 N  446  ARG GLY VAL ILE LEU GLN GLU LEU LYS GLU MET ASP ASN          
SEQRES  12 N  446  ASP MET THR ASN VAL THR PHE ASP TYR LEU HIS ALA THR          
SEQRES  13 N  446  ALA PHE GLN GLY THR ALA LEU ALA ARG THR VAL GLU GLY          
SEQRES  14 N  446  THR THR GLU ASN ILE LYS HIS LEU THR ARG ALA ASP LEU          
SEQRES  15 N  446  ALA SER TYR ILE ASP THR HIS PHE LYS ALA PRO ARG MET          
SEQRES  16 N  446  VAL LEU ALA ALA ALA GLY GLY ILE SER HIS LYS GLU LEU          
SEQRES  17 N  446  VAL ASP ALA ALA ARG GLN HIS PHE SER GLY VAL SER PHE          
SEQRES  18 N  446  THR TYR LYS GLU ASP ALA VAL PRO ILE LEU PRO ARG CYS          
SEQRES  19 N  446  ARG PHE THR GLY SER GLU ILE ARG ALA ARG ASP ASP ALA          
SEQRES  20 N  446  LEU PRO VAL ALA HIS VAL ALA LEU ALA VAL GLU GLY PRO          
SEQRES  21 N  446  GLY TRP ALA ASP PRO ASP ASN VAL VAL LEU HIS VAL ALA          
SEQRES  22 N  446  ASN ALA ILE ILE GLY ARG TYR ASP ARG THR PHE GLY GLY          
SEQRES  23 N  446  GLY LYS HIS LEU SER SER ARG LEU ALA ALA LEU ALA VAL          
SEQRES  24 N  446  GLU HIS LYS LEU CYS HIS SER PHE GLN THR PHE ASN THR          
SEQRES  25 N  446  SER TYR SER ASP THR GLY LEU PHE GLY PHE HIS PHE VAL          
SEQRES  26 N  446  ALA ASP PRO LEU SER ILE ASP ASP MET MET PHE CYS ALA          
SEQRES  27 N  446  GLN GLY GLU TRP MET ARG LEU CYS THR SER THR THR GLU          
SEQRES  28 N  446  SER GLU VAL LYS ARG ALA LYS ASN HIS LEU ARG SER ALA          
SEQRES  29 N  446  MET VAL ALA GLN LEU ASP GLY THR THR PRO VAL CYS GLU          
SEQRES  30 N  446  THR ILE GLY SER HIS LEU LEU ASN TYR GLY ARG ARG ILE          
SEQRES  31 N  446  SER LEU GLU GLU TRP ASP SER ARG ILE SER ALA VAL ASP          
SEQRES  32 N  446  ALA ARG MET VAL ARG ASP VAL CYS SER LYS TYR ILE TYR          
SEQRES  33 N  446  ASP LYS CYS PRO ALA LEU ALA ALA VAL GLY PRO ILE GLU          
SEQRES  34 N  446  GLN LEU LEU ASP TYR ASN ARG ILE ARG SER GLY MET TYR          
SEQRES  35 N  446  TRP ILE ARG PHE                                              
SEQRES   1 O  441  SER LEU LYS VAL ALA PRO LYS VAL ALA VAL SER ALA ALA          
SEQRES   2 O  441  ALA GLU ARG VAL LYS LEU CYS PRO GLY ALA GLU ASP LEU          
SEQRES   3 O  441  GLU ILE THR LYS LEU PRO ASN GLY LEU ILE ILE ALA SER          
SEQRES   4 O  441  LEU GLU ASN PHE SER PRO ALA SER ARG ILE GLY VAL PHE          
SEQRES   5 O  441  ILE LYS ALA GLY SER ARG TYR GLU THR THR ALA ASN LEU          
SEQRES   6 O  441  GLY THR ALA HIS LEU LEU ARG LEU ALA SER PRO LEU THR          
SEQRES   7 O  441  THR LYS GLY ALA SER SER PHE ARG ILE THR ARG GLY ILE          
SEQRES   8 O  441  GLU ALA VAL GLY GLY SER LEU SER VAL TYR SER THR ARG          
SEQRES   9 O  441  GLU LYS MET THR TYR CYS VAL GLU CYS LEU ARG ASP HIS          
SEQRES  10 O  441  VAL ASP THR VAL MET GLU TYR LEU LEU ASN VAL THR THR          
SEQRES  11 O  441  ALA PRO GLU PHE ARG PRO TRP GLU VAL THR ASP LEU GLN          
SEQRES  12 O  441  PRO GLN LEU LYS VAL ASP LYS ALA VAL ALA PHE GLN SER          
SEQRES  13 O  441  PRO GLN VAL GLY VAL LEU GLU ASN LEU HIS ALA ALA ALA          
SEQRES  14 O  441  TYR LYS THR ALA LEU ALA ASN PRO LEU TYR CYS PRO ASP          
SEQRES  15 O  441  TYR ARG ILE GLY LYS ILE THR SER GLU GLN LEU HIS HIS          
SEQRES  16 O  441  PHE VAL GLN ASN ASN PHE THR SER ALA ARG MET ALA LEU          
SEQRES  17 O  441  VAL GLY ILE GLY VAL LYS HIS SER ASP LEU LYS GLN VAL          
SEQRES  18 O  441  ALA GLU GLN PHE LEU ASN ILE ARG SER GLY ALA GLY THR          
SEQRES  19 O  441  SER SER ALA LYS ALA THR TYR TRP GLY GLY GLU ILE ARG          
SEQRES  20 O  441  GLU GLN ASN GLY HIS SER LEU VAL HIS ALA ALA VAL VAL          
SEQRES  21 O  441  THR GLU GLY ALA ALA VAL GLY SER ALA GLU ALA ASN ALA          
SEQRES  22 O  441  PHE SER VAL LEU GLN HIS VAL LEU GLY ALA GLY PRO LEU          
SEQRES  23 O  441  ILE LYS ARG GLY SER SER VAL THR SER LYS LEU TYR GLN          
SEQRES  24 O  441  GLY VAL ALA LYS ALA THR THR GLN PRO PHE ASP ALA SER          
SEQRES  25 O  441  ALA PHE ASN VAL ASN TYR SER ASP SER GLY LEU PHE GLY          
SEQRES  26 O  441  PHE TYR THR ILE SER GLN ALA ALA HIS ALA GLY GLU VAL          
SEQRES  27 O  441  ILE ARG ALA ALA MET ASN GLN LEU LYS ALA ALA ALA GLN          
SEQRES  28 O  441  GLY GLY VAL THR GLU GLU ASP VAL THR LYS ALA LYS ASN          
SEQRES  29 O  441  GLN LEU LYS ALA THR TYR LEU MET SER VAL GLU THR ALA          
SEQRES  30 O  441  GLN GLY LEU LEU ASN GLU ILE GLY SER GLU ALA LEU LEU          
SEQRES  31 O  441  SER GLY THR HIS THR ALA PRO SER VAL VAL ALA GLN LYS          
SEQRES  32 O  441  ILE ASP SER VAL THR SER ALA ASP VAL VAL ASN ALA ALA          
SEQRES  33 O  441  LYS LYS PHE VAL SER GLY LYS LYS SER MET ALA ALA SER          
SEQRES  34 O  441  GLY ASP LEU GLY SER THR PRO PHE LEU ASP GLU LEU              
SEQRES   1 P  380  MET ALA PRO ASN ILE ARG LYS SER HIS PRO LEU LEU LYS          
SEQRES   2 P  380  MET ILE ASN ASN SER LEU ILE ASP LEU PRO ALA PRO SER          
SEQRES   3 P  380  ASN ILE SER ALA TRP TRP ASN PHE GLY SER LEU LEU ALA          
SEQRES   4 P  380  VAL CYS LEU MET THR GLN ILE LEU THR GLY LEU LEU LEU          
SEQRES   5 P  380  ALA MET HIS TYR THR ALA ASP THR SER LEU ALA PHE SER          
SEQRES   6 P  380  SER VAL ALA HIS THR CYS ARG ASN VAL GLN TYR GLY TRP          
SEQRES   7 P  380  LEU ILE ARG ASN LEU HIS ALA ASN GLY ALA SER PHE PHE          
SEQRES   8 P  380  PHE ILE CYS ILE PHE LEU HIS ILE GLY ARG GLY LEU TYR          
SEQRES   9 P  380  TYR GLY SER TYR LEU TYR LYS GLU THR TRP ASN THR GLY          
SEQRES  10 P  380  VAL ILE LEU LEU LEU THR LEU MET ALA THR ALA PHE VAL          
SEQRES  11 P  380  GLY TYR VAL LEU PRO TRP GLY GLN MET SER PHE TRP GLY          
SEQRES  12 P  380  ALA THR VAL ILE THR ASN LEU PHE SER ALA ILE PRO TYR          
SEQRES  13 P  380  ILE GLY HIS THR LEU VAL GLU TRP ALA TRP GLY GLY PHE          
SEQRES  14 P  380  SER VAL ASP ASN PRO THR LEU THR ARG PHE PHE ALA LEU          
SEQRES  15 P  380  HIS PHE LEU LEU PRO PHE ALA ILE ALA GLY ILE THR ILE          
SEQRES  16 P  380  ILE HIS LEU THR PHE LEU HIS GLU SER GLY SER ASN ASN          
SEQRES  17 P  380  PRO LEU GLY ILE SER SER ASP SER ASP LYS ILE PRO PHE          
SEQRES  18 P  380  HIS PRO TYR TYR SER PHE LYS ASP ILE LEU GLY LEU THR          
SEQRES  19 P  380  LEU MET LEU THR PRO PHE LEU THR LEU ALA LEU PHE SER          
SEQRES  20 P  380  PRO ASN LEU LEU GLY ASP PRO GLU ASN PHE THR PRO ALA          
SEQRES  21 P  380  ASN PRO LEU VAL THR PRO PRO HIS ILE LYS PRO GLU TRP          
SEQRES  22 P  380  TYR PHE LEU PHE ALA TYR ALA ILE LEU ARG SER ILE PRO          
SEQRES  23 P  380  ASN LYS LEU GLY GLY VAL LEU ALA LEU ALA ALA SER VAL          
SEQRES  24 P  380  LEU ILE LEU PHE LEU ILE PRO PHE LEU HIS LYS SER LYS          
SEQRES  25 P  380  GLN ARG THR MET THR PHE ARG PRO LEU SER GLN THR LEU          
SEQRES  26 P  380  PHE TRP LEU LEU VAL ALA ASN LEU LEU ILE LEU THR TRP          
SEQRES  27 P  380  ILE GLY SER GLN PRO VAL GLU HIS PRO PHE ILE ILE ILE          
SEQRES  28 P  380  GLY GLN MET ALA SER LEU SER TYR PHE THR ILE LEU LEU          
SEQRES  29 P  380  ILE LEU PHE PRO THR ILE GLY THR LEU GLU ASN LYS MET          
SEQRES  30 P  380  LEU ASN TYR                                                  
SEQRES   1 Q  241  GLY GLU LEU GLU LEU HIS PRO PRO ALA PHE PRO TRP SER          
SEQRES   2 Q  241  HIS GLY GLY PRO LEU SER ALA LEU ASP HIS SER SER VAL          
SEQRES   3 Q  241  ARG ARG GLY PHE GLN VAL TYR LYS GLN VAL CYS SER ALA          
SEQRES   4 Q  241  CYS HIS SER MET ASP TYR VAL ALA PHE ARG ASN LEU ILE          
SEQRES   5 Q  241  GLY VAL THR HIS THR GLU ALA GLU ALA LYS ALA LEU ALA          
SEQRES   6 Q  241  GLU GLU VAL GLU VAL GLN ASP GLY PRO ASP GLU ASN GLY          
SEQRES   7 Q  241  GLU LEU PHE MET ARG PRO GLY LYS ILE SER ASP TYR PHE          
SEQRES   8 Q  241  PRO LYS PRO TYR PRO ASN PRO GLU ALA ALA ARG ALA ALA          
SEQRES   9 Q  241  ASN ASN GLY ALA LEU PRO PRO ASP LEU SER TYR ILE VAL          
SEQRES  10 Q  241  ASN ALA ARG HIS GLY GLY GLU ASP TYR VAL PHE SER LEU          
SEQRES  11 Q  241  LEU THR GLY TYR CYS ASP PRO PRO ALA GLY VAL VAL VAL          
SEQRES  12 Q  241  ARG GLU GLY LEU HIS TYR ASN PRO TYR PHE PRO GLY GLN          
SEQRES  13 Q  241  ALA ILE GLY MET ALA PRO PRO ILE TYR ASN GLU ILE LEU          
SEQRES  14 Q  241  GLU TYR ASP ASP GLY THR PRO ALA THR MET SER GLN ILE          
SEQRES  15 Q  241  ALA LYS ASP VAL CYS THR PHE LEU ARG TRP ALA ALA GLU          
SEQRES  16 Q  241  PRO GLU HIS ASP GLN ARG LYS ARG MET GLY LEU LYS MET          
SEQRES  17 Q  241  LEU LEU ILE SER ALA LEU LEU THR SER LEU LEU TYR TYR          
SEQRES  18 Q  241  MET LYS ARG HIS LYS TRP SER VAL LEU LYS SER ARG LYS          
SEQRES  19 Q  241  MET ALA TYR ARG PRO PRO LYS                                  
SEQRES   1 R  196  VAL HIS ASN ASP VAL THR VAL PRO ASP PHE SER ALA TYR          
SEQRES   2 R  196  ARG ARG GLU ASP VAL MET ASP ALA THR THR SER SER GLN          
SEQRES   3 R  196  THR SER SER GLU ASP ARG LYS GLY PHE SER TYR LEU VAL          
SEQRES   4 R  196  THR ALA THR ALA CYS VAL ALA THR ALA TYR ALA ALA LYS          
SEQRES   5 R  196  ASN VAL VAL THR GLN PHE ILE SER SER LEU SER ALA SER          
SEQRES   6 R  196  ALA ASP VAL LEU ALA LEU SER LYS ILE GLU ILE LYS LEU          
SEQRES   7 R  196  SER ASP ILE PRO GLU GLY LYS ASN VAL ALA PHE LYS TRP          
SEQRES   8 R  196  ARG GLY LYS PRO LEU PHE VAL ARG HIS ARG THR GLN ALA          
SEQRES   9 R  196  GLU ILE ASN GLN GLU ALA GLU VAL ASP VAL SER LYS LEU          
SEQRES  10 R  196  ARG ASP PRO GLN HIS ASP LEU ASP ARG VAL LYS LYS PRO          
SEQRES  11 R  196  GLU TRP VAL ILE LEU VAL GLY VAL CYS THR HIS LEU GLY          
SEQRES  12 R  196  CYS VAL PRO ILE ALA ASN SER GLY ASP PHE GLY GLY TYR          
SEQRES  13 R  196  TYR CYS PRO CYS HIS GLY SER HIS TYR ASP ALA SER GLY          
SEQRES  14 R  196  ARG ILE ARG LYS GLY PRO ALA PRO TYR ASN LEU GLU VAL          
SEQRES  15 R  196  PRO THR TYR GLN PHE VAL GLY ASP ASP LEU VAL VAL VAL          
SEQRES  16 R  196  GLY                                                          
SEQRES   1 S  110  ALA ALA ARG ALA THR VAL ALA GLY GLY GLY ARG LEU MET          
SEQRES   2 S  110  ASP ARG ILE ARG LYS TRP TYR TYR ASN ALA ALA GLY PHE          
SEQRES   3 S  110  ASN LYS TYR GLY LEU MET ARG ASP ASP THR LEU TYR GLU          
SEQRES   4 S  110  ASP ASP ASP VAL LYS GLU ALA LEU LYS ARG LEU PRO GLU          
SEQRES   5 S  110  ASP LEU TYR ASN GLU ARG MET PHE ARG ILE LYS ARG ALA          
SEQRES   6 S  110  LEU ASP LEU SER LEU LYS HIS ARG ILE LEU PRO LYS GLU          
SEQRES   7 S  110  GLN TRP VAL LYS TYR GLU GLU ASP LYS PRO TYR LEU GLU          
SEQRES   8 S  110  PRO TYR LEU LYS GLU VAL ILE ARG GLU ARG LEU GLU ARG          
SEQRES   9 S  110  GLU ALA TRP ASN LYS LYS                                      
SEQRES   1 T   81  GLY ILE HIS PHE GLY ASN LEU ALA ARG VAL ARG HIS ILE          
SEQRES   2 T   81  ILE THR TYR SER LEU SER PRO PHE GLU GLN ARG ALA ILE          
SEQRES   3 T   81  PRO ASN ILE PHE SER ASP ALA LEU PRO ASN VAL TRP ARG          
SEQRES   4 T   81  ARG PHE SER SER GLN VAL PHE LYS VAL ALA PRO PRO PHE          
SEQRES   5 T   81  LEU GLY ALA TYR LEU LEU TYR SER TRP GLY THR GLN GLU          
SEQRES   6 T   81  PHE GLU ARG LEU LYS ARG LYS ASN PRO ALA ASP TYR GLU          
SEQRES   7 T   81  ASN ASP GLN                                                  
SEQRES   1 U   77  LEU ARG GLY SER GLY GLU GLU GLU GLU GLU GLU LEU VAL          
SEQRES   2 U   77  ASP PRO LEU THR THR ILE ARG GLU HIS CYS GLU GLN THR          
SEQRES   3 U   77  GLU LYS CYS VAL LYS ALA ARG GLU ARG LEU GLU LEU CYS          
SEQRES   4 U   77  ASP ALA ARG VAL SER SER ARG SER HIS THR GLU GLU GLN          
SEQRES   5 U   77  CYS THR GLU GLU LEU PHE ASP PHE LEU HIS ALA ARG ASP          
SEQRES   6 U   77  HIS CYS VAL ALA HIS LYS LEU PHE ASN LYS LEU LYS              
SEQRES   1 V   47  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 V   47  UNK UNK ARG PRO LEU LEU CYS ARG GLU SER MET SER GLY          
SEQRES   3 V   47  ARG SER ALA ARG ARG ASP LEU VAL ALA GLY ILE SER LEU          
SEQRES   4 V   47  ASN ALA PRO ALA SER VAL ARG TYR                              
SEQRES   1 W   61  ALA LEU LEU ARG GLN ALA TYR SER ALA LEU PHE ARG ARG          
SEQRES   2 W   61  THR SER THR PHE ALA LEU THR VAL VAL LEU GLY ALA VAL          
SEQRES   3 W   61  LEU PHE GLU ARG ALA PHE ASP GLN GLY ALA ASP ALA ILE          
SEQRES   4 W   61  PHE GLU HIS LEU ASN GLU GLY LYS LEU TRP LYS HIS ILE          
SEQRES   5 W   61  LYS HIS LYS TYR GLU ALA SER GLU GLU                          
HET    PEE  A2008      21                                                       
HET    HEM  C 501      43                                                       
HET    HEM  C 502      43                                                       
HET    JZZ  C2001      25                                                       
HET     UQ  C2002      19                                                       
HET    PEE  C2007      49                                                       
HET    GOL  C2011       6                                                       
HET    HEC  D 501      43                                                       
HET    CDL  D2003      42                                                       
HET    BOG  D2009      20                                                       
HET    BOG  D2091      13                                                       
HET    FES  E 501       4                                                       
HET    PEE  E2005      50                                                       
HET    CDL  G2004      40                                                       
HET    HEM  P 501      43                                                       
HET    HEM  P 502      43                                                       
HET    BOG  P2010      12                                                       
HET    JZZ  P3001      25                                                       
HET     UQ  P3002      19                                                       
HET    PEE  P3007      49                                                       
HET    PEE  P3008       5                                                       
HET    GOL  P3011       6                                                       
HET    HEC  Q 501      43                                                       
HET    CDL  Q3003      42                                                       
HET    BOG  Q3009      20                                                       
HET    BOG  Q3091      13                                                       
HET    FES  R 501       4                                                       
HET    PEE  R3005      50                                                       
HET    CDL  T3004      40                                                       
HETNAM     PEE 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOETHANOLAMINE                    
HETNAM     HEM PROTOPORPHYRIN IX CONTAINING FE                                  
HETNAM     JZZ 4-[7-(3,3-DIMETHYLBUT-1-YN-1-YL)NAPHTHALEN-1-YL]-5-              
HETNAM   2 JZZ  METHOXY-2-METHYL-2,4-DIHYDRO-3H-1,2,4-TRIAZOL-3-ONE             
HETNAM      UQ COENZYME Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-ISOMER                 
HETNAM     GOL GLYCEROL                                                         
HETNAM     HEC HEME C                                                           
HETNAM     CDL CARDIOLIPIN                                                      
HETNAM     BOG OCTYL BETA-D-GLUCOPYRANOSIDE                                     
HETNAM     FES FE2/S2 (INORGANIC) CLUSTER                                       
HETSYN     PEE DOPE                                                             
HETSYN     HEM HEME                                                             
HETSYN     GOL GLYCERIN; PROPANE-1,2,3-TRIOL                                    
HETSYN     CDL DIPHOSPHATIDYL GLYCEROL; BIS-(1,2-DIACYL-SN-GLYCERO-3-           
HETSYN   2 CDL  PHOSPHO)-1',3'-SN-GLYCEROL                                      
FORMUL  21  PEE    6(C41 H83 N O8 P 1+)                                         
FORMUL  22  HEM    4(C34 H32 FE N4 O4)                                          
FORMUL  24  JZZ    2(C20 H21 N3 O2)                                             
FORMUL  25   UQ    2(C59 H90 O4)                                                
FORMUL  27  GOL    2(C3 H8 O3)                                                  
FORMUL  28  HEC    2(C34 H34 FE N4 O4)                                          
FORMUL  29  CDL    4(C81 H156 O17 P2 2-)                                        
FORMUL  30  BOG    5(C14 H28 O6)                                                
FORMUL  32  FES    2(FE2 S2)                                                    
FORMUL  50  HOH   *19(H2 O)                                                     
HELIX    1   1 THR A    3  LEU A    8  1                                   6    
HELIX    2   2 GLY A   44  GLU A   48  5                                   5    
HELIX    3   3 GLY A   54  HIS A   61  1                                   8    
HELIX    4   4 PRO A   71  SER A   81  1                                  11    
HELIX    5   5 ASP A  105  CYS A  120  1                                  16    
HELIX    6   6 GLU A  123  ASP A  142  1                                  20    
HELIX    7   7 ASP A  144  PHE A  158  1                                  15    
HELIX    8   8 THR A  161  ARG A  165  5                                   5    
HELIX    9   9 THR A  170  LEU A  177  1                                   8    
HELIX   10  10 THR A  178  PHE A  190  1                                  13    
HELIX   11  11 LYS A  191  PRO A  193  5                                   3    
HELIX   12  12 SER A  204  PHE A  216  1                                  13    
HELIX   13  13 TYR A  223  ALA A  227  5                                   5    
HELIX   14  14 PRO A  265  GLY A  278  1                                  14    
HELIX   15  15 GLY A  286  LEU A  290  5                                   5    
HELIX   16  16 SER A  292  HIS A  301  1                                  10    
HELIX   17  17 ASP A  327  LEU A  329  5                                   3    
HELIX   18  18 SER A  330  SER A  348  1                                  19    
HELIX   19  19 THR A  350  GLN A  368  1                                  19    
HELIX   20  20 GLY A  371  GLY A  387  1                                  17    
HELIX   21  21 SER A  391  VAL A  402  1                                  12    
HELIX   22  22 ASP A  403  ILE A  415  1                                  13    
HELIX   23  23 ASP A  433  SER A  439  1                                   7    
HELIX   24  24 GLY A  440  TYR A  442  5                                   3    
HELIX   25  25 GLY B   54  GLU B   58  5                                   5    
HELIX   26  26 GLY B   64  ALA B   72  1                                   9    
HELIX   27  27 SER B   81  ALA B   91  1                                  11    
HELIX   28  28 HIS B  115  ALA B  129  1                                  15    
HELIX   29  29 ARG B  133  GLN B  141  1                                   9    
HELIX   30  30 GLN B  141  PHE B  152  1                                  12    
HELIX   31  31 SER B  154  ALA B  167  1                                  14    
HELIX   32  32 THR B  170  ASN B  174  5                                   5    
HELIX   33  33 PRO B  179  ILE B  183  5                                   5    
HELIX   34  34 THR B  187  PHE B  199  1                                  13    
HELIX   35  35 LYS B  212  PHE B  223  1                                  12    
HELIX   36  36 GLU B  268  GLY B  280  1                                  13    
HELIX   37  37 SER B  293  THR B  303  1                                  11    
HELIX   38  38 HIS B  332  GLN B  349  1                                  18    
HELIX   39  39 GLU B  355  SER B  371  1                                  17    
HELIX   40  40 THR B  374  SER B  389  1                                  16    
HELIX   41  41 ALA B  394  SER B  404  1                                  11    
HELIX   42  42 THR B  406  GLY B  420  1                                  15    
HELIX   43  43 ASP B  429  THR B  433  5                                   5    
HELIX   44  44 PHE B  435  LEU B  439  5                                   5    
HELIX   45  45 ASN C    4  HIS C    9  1                                   6    
HELIX   46  46 LEU C   11  ILE C   20  1                                  10    
HELIX   47  47 SER C   29  TRP C   32  5                                   4    
HELIX   48  48 ASN C   33  MET C   54  1                                  22    
HELIX   49  49 LEU C   62  ASN C   73  1                                  12    
HELIX   50  50 TYR C   76  TYR C  105  1                                  30    
HELIX   51  51 GLY C  106  LEU C  109  5                                   4    
HELIX   52  52 TYR C  110  LEU C  134  1                                  25    
HELIX   53  53 GLY C  137  ASN C  149  1                                  13    
HELIX   54  54 LEU C  150  ILE C  154  5                                   5    
HELIX   55  55 ILE C  157  GLY C  167  1                                  11    
HELIX   56  56 ASP C  172  GLY C  205  1                                  34    
HELIX   57  57 PHE C  221  SER C  247  1                                  27    
HELIX   58  58 ASP C  253  THR C  258  5                                   6    
HELIX   59  59 GLU C  272  ILE C  285  1                                  14    
HELIX   60  60 ASN C  287  ILE C  301  1                                  15    
HELIX   61  61 LEU C  302  HIS C  309  5                                   8    
HELIX   62  62 ARG C  319  SER C  341  1                                  23    
HELIX   63  63 PRO C  347  ILE C  365  1                                  19    
HELIX   64  64 ILE C  365  LEU C  378  1                                  14    
HELIX   65  65 ASP D   22  VAL D   36  1                                  15    
HELIX   66  66 CYS D   37  CYS D   40  5                                   4    
HELIX   67  67 ALA D   47  ILE D   52  5                                   6    
HELIX   68  68 THR D   57  GLU D   67  1                                  11    
HELIX   69  69 ASN D   97  ALA D  104  1                                   8    
HELIX   70  70 TYR D  115  ARG D  120  1                                   6    
HELIX   71  71 GLY D  123  THR D  132  1                                  10    
HELIX   72  72 THR D  178  GLU D  195  1                                  18    
HELIX   73  73 GLU D  197  SER D  232  1                                  36    
HELIX   74  74 VAL E    1  VAL E    5  5                                   5    
HELIX   75  75 ARG E   15  MET E   19  5                                   5    
HELIX   76  76 SER E   24  LEU E   62  1                                  39    
HELIX   77  77 SER E   65  ALA E   70  1                                   6    
HELIX   78  78 ARG F   11  GLY F   25  1                                  15    
HELIX   79  79 PHE F   26  GLY F   30  5                                   5    
HELIX   80  80 MET F   32  LEU F   37  5                                   6    
HELIX   81  81 ASP F   40  LEU F   50  1                                  11    
HELIX   82  82 PRO F   51  HIS F   72  1                                  22    
HELIX   83  83 PRO F   76  TRP F   80  5                                   5    
HELIX   84  84 LYS F   82  ASP F   86  5                                   5    
HELIX   85  85 LEU F   90  ASN F  108  1                                  19    
HELIX   86  86 ASP G   32  LEU G   69  1                                  38    
HELIX   87  87 ASN G   73  TYR G   77  5                                   5    
HELIX   88  88 ASP H   15  GLN H   26  1                                  12    
HELIX   89  89 THR H   27  SER H   46  1                                  20    
HELIX   90  90 CYS H   54  LEU H   77  1                                  24    
HELIX   91  91 CYS I   51  SER I   56  1                                   6    
HELIX   92  92 ALA J    4  LEU J   13  1                                  10    
HELIX   93  93 ARG J   16  LEU J   46  1                                  31    
HELIX   94  94 LEU J   51  LYS J   56  1                                   6    
HELIX   95  95 HIS J   57  TYR J   59  5                                   3    
HELIX   96  96 THR N    3  ASN N   10  1                                   8    
HELIX   97  97 GLY N   54  HIS N   61  1                                   8    
HELIX   98  98 PRO N   71  SER N   81  1                                  11    
HELIX   99  99 ASP N  105  CYS N  120  1                                  16    
HELIX  100 100 GLU N  123  ASP N  142  1                                  20    
HELIX  101 101 ASP N  144  PHE N  158  1                                  15    
HELIX  102 102 THR N  161  ARG N  165  5                                   5    
HELIX  103 103 THR N  170  LEU N  177  1                                   8    
HELIX  104 104 THR N  178  PHE N  190  1                                  13    
HELIX  105 105 LYS N  191  PRO N  193  5                                   3    
HELIX  106 106 SER N  204  PHE N  216  1                                  13    
HELIX  107 107 TYR N  223  ALA N  227  5                                   5    
HELIX  108 108 PRO N  265  GLY N  278  1                                  14    
HELIX  109 109 GLY N  286  LEU N  290  5                                   5    
HELIX  110 110 SER N  292  HIS N  301  1                                  10    
HELIX  111 111 ASP N  327  LEU N  329  5                                   3    
HELIX  112 112 SER N  330  SER N  348  1                                  19    
HELIX  113 113 THR N  350  ALA N  367  1                                  18    
HELIX  114 114 GLN N  368  ASP N  370  5                                   3    
HELIX  115 115 GLY N  371  GLY N  387  1                                  17    
HELIX  116 116 SER N  391  VAL N  402  1                                  12    
HELIX  117 117 ASP N  403  ILE N  415  1                                  13    
HELIX  118 118 ASP N  433  GLY N  440  1                                   8    
HELIX  119 119 GLY O   54  GLU O   58  5                                   5    
HELIX  120 120 GLY O   64  ALA O   72  1                                   9    
HELIX  121 121 SER O   81  ALA O   91  1                                  11    
HELIX  122 122 HIS O  115  ALA O  129  1                                  15    
HELIX  123 123 ARG O  133  GLN O  141  1                                   9    
HELIX  124 124 GLN O  141  PHE O  152  1                                  12    
HELIX  125 125 SER O  154  ALA O  167  1                                  14    
HELIX  126 126 THR O  170  ASN O  174  5                                   5    
HELIX  127 127 PRO O  179  ILE O  183  5                                   5    
HELIX  128 128 THR O  187  PHE O  199  1                                  13    
HELIX  129 129 LYS O  212  GLN O  222  1                                  11    
HELIX  130 130 SER O  266  GLY O  280  1                                  15    
HELIX  131 131 SER O  293  THR O  303  1                                  11    
HELIX  132 132 HIS O  332  GLN O  349  1                                  18    
HELIX  133 133 GLU O  355  SER O  371  1                                  17    
HELIX  134 134 THR O  374  SER O  389  1                                  16    
HELIX  135 135 ALA O  394  SER O  404  1                                  11    
HELIX  136 136 THR O  406  GLY O  420  1                                  15    
HELIX  137 137 ASP O  429  THR O  433  5                                   5    
HELIX  138 138 PHE O  435  LEU O  439  5                                   5    
HELIX  139 139 ASN P    4  HIS P    9  1                                   6    
HELIX  140 140 LEU P   11  ILE P   20  1                                  10    
HELIX  141 141 SER P   29  TRP P   32  5                                   4    
HELIX  142 142 ASN P   33  MET P   54  1                                  22    
HELIX  143 143 LEU P   62  VAL P   74  1                                  13    
HELIX  144 144 TYR P   76  TYR P  105  1                                  30    
HELIX  145 145 GLY P  106  LEU P  109  5                                   4    
HELIX  146 146 TYR P  110  LEU P  134  1                                  25    
HELIX  147 147 GLY P  137  ASN P  149  1                                  13    
HELIX  148 148 LEU P  150  ILE P  154  5                                   5    
HELIX  149 149 ILE P  157  GLY P  167  1                                  11    
HELIX  150 150 ASP P  172  GLY P  205  1                                  34    
HELIX  151 151 PHE P  221  SER P  247  1                                  27    
HELIX  152 152 ASP P  253  THR P  258  5                                   6    
HELIX  153 153 GLU P  272  ILE P  285  1                                  14    
HELIX  154 154 ASN P  287  ILE P  301  1                                  15    
HELIX  155 155 LEU P  302  HIS P  309  5                                   8    
HELIX  156 156 ARG P  319  SER P  341  1                                  23    
HELIX  157 157 PRO P  347  ILE P  365  1                                  19    
HELIX  158 158 ILE P  365  MET P  377  1                                  13    
HELIX  159 159 ASP Q   22  VAL Q   36  1                                  15    
HELIX  160 160 CYS Q   37  CYS Q   40  5                                   4    
HELIX  161 161 ALA Q   47  ILE Q   52  5                                   6    
HELIX  162 162 THR Q   57  GLU Q   67  1                                  11    
HELIX  163 163 ASN Q   97  ALA Q  104  1                                   8    
HELIX  164 164 TYR Q  115  ARG Q  120  1                                   6    
HELIX  165 165 GLY Q  123  THR Q  132  1                                  10    
HELIX  166 166 THR Q  178  GLU Q  195  1                                  18    
HELIX  167 167 GLU Q  197  SER Q  232  1                                  36    
HELIX  168 168 VAL R    1  VAL R    5  5                                   5    
HELIX  169 169 ARG R   15  MET R   19  5                                   5    
HELIX  170 170 SER R   25  LEU R   62  1                                  38    
HELIX  171 171 SER R   65  ALA R   70  1                                   6    
HELIX  172 172 SER R   79  ILE R   81  5                                   3    
HELIX  173 173 ALA R  104  GLU R  111  1                                   8    
HELIX  174 174 HIS R  122  VAL R  127  1                                   6    
HELIX  175 175 LEU S   12  GLY S   25  1                                  14    
HELIX  176 176 PHE S   26  GLY S   30  5                                   5    
HELIX  177 177 MET S   32  LEU S   37  5                                   6    
HELIX  178 178 ASP S   40  LEU S   50  1                                  11    
HELIX  179 179 PRO S   51  HIS S   72  1                                  22    
HELIX  180 180 PRO S   76  TRP S   80  5                                   5    
HELIX  181 181 LYS S   82  ASP S   86  5                                   5    
HELIX  182 182 LEU S   90  LYS S  110  1                                  21    
HELIX  183 183 ASP T   32  LEU T   69  1                                  38    
HELIX  184 184 ASN T   73  TYR T   77  5                                   5    
HELIX  185 185 ASP U   15  GLN U   26  1                                  12    
HELIX  186 186 THR U   27  SER U   46  1                                  20    
HELIX  187 187 CYS U   54  LEU U   77  1                                  24    
HELIX  188 188 ALA W    4  LEU W   13  1                                  10    
HELIX  189 189 ARG W   16  LEU W   46  1                                  31    
HELIX  190 190 LEU W   51  LYS W   56  1                                   6    
HELIX  191 191 HIS W   57  TYR W   59  5                                   3    
SHEET    1   A 6 ASN A  15  THR A  18  0                                        
SHEET    2   A 6 ARG A  24  GLU A  29 -1  O  VAL A  25   N  THR A  17           
SHEET    3   A 6 MET A 195  GLY A 201  1  O  LEU A 197   N  ALA A  26           
SHEET    4   A 6 THR A  34  ILE A  41 -1  N  GLY A  38   O  ALA A 198           
SHEET    5   A 6 THR A  95  LEU A 102 -1  O  ILE A  99   N  VAL A  37           
SHEET    6   A 6 HIS A  85  THR A  90 -1  N  ASN A  87   O  TYR A  98           
SHEET    1   B 8 ARG A 279  ASP A 281  0                                        
SHEET    2   B 8 SER A 306  SER A 313 -1  O  PHE A 307   N  TYR A 280           
SHEET    3   B 8 GLY A 318  ALA A 326 -1  O  LEU A 319   N  THR A 312           
SHEET    4   B 8 ALA A 251  GLU A 258 -1  N  ALA A 251   O  ALA A 326           
SHEET    5   B 8 ALA A 421  GLY A 426 -1  O  VAL A 425   N  HIS A 252           
SHEET    6   B 8 SER A 239  ASP A 245  1  N  SER A 239   O  LEU A 422           
SHEET    7   B 8 ARG G  11  LEU G  18 -1  O  SER G  17   N  GLU A 240           
SHEET    8   B 8 LYS D 234  TYR D 237 -1  N  LYS D 234   O  TYR G  16           
SHEET    1   C 2 ILE B  26  LYS B  28  0                                        
SHEET    2   C 2 ILE B  34  ALA B  36 -1  O  ILE B  35   N  THR B  27           
SHEET    1   D 6 MET B 204  ILE B 209  0                                        
SHEET    2   D 6 ALA B  44  ILE B  51 -1  N  PHE B  50   O  ALA B 205           
SHEET    3   D 6 MET B 105  LEU B 112 -1  O  TYR B 107   N  VAL B  49           
SHEET    4   D 6 SER B  97  SER B 100 -1  N  TYR B  99   O  THR B 106           
SHEET    5   D 6 VAL I  65  SER I  69 -1  O  ALA I  66   N  SER B 100           
SHEET    6   D 6 SER I  75  ARG I  77 -1  O  SER I  75   N  GLY I  67           
SHEET    1   E 5 GLU B 243  GLN B 247  0                                        
SHEET    2   E 5 SER B 423  GLY B 428  1  O  ALA B 426   N  GLU B 246           
SHEET    3   E 5 LEU B 252  GLU B 260 -1  N  ALA B 256   O  ALA B 425           
SHEET    4   E 5 SER B 319  GLN B 329 -1  O  THR B 326   N  ALA B 255           
SHEET    5   E 5 PHE B 307  TYR B 316 -1  N  PHE B 312   O  GLY B 323           
SHEET    1   F 2 PRO C  23  PRO C  25  0                                        
SHEET    2   F 2 LYS C 218  PRO C 220 -1  O  ILE C 219   N  ALA C  24           
SHEET    1   G 2 GLU D  69  ASP D  72  0                                        
SHEET    2   G 2 PHE D  81  PRO D  84 -1  O  ARG D  83   N  VAL D  70           
SHEET    1   H 2 HIS D 148  TYR D 149  0                                        
SHEET    2   H 2 ALA D 157  ILE D 158 -1  O  ILE D 158   N  HIS D 148           
SHEET    1   I 2 ILE E  74  ILE E  76  0                                        
SHEET    2   I 2 VAL E 193  VAL E 195 -1  O  VAL E 193   N  ILE E  76           
SHEET    1   J 3 ASN E  86  TRP E  91  0                                        
SHEET    2   J 3 LYS E  94  HIS E 100 -1  O  LEU E  96   N  PHE E  89           
SHEET    3   J 3 TRP E 132  VAL E 136 -1  O  LEU E 135   N  PHE E  97           
SHEET    1   K 2 TYR E 156  CYS E 158  0                                        
SHEET    2   K 2 GLY E 162  TYR E 165 -1  O  TYR E 165   N  TYR E 156           
SHEET    1   L 6 ASN N  15  THR N  18  0                                        
SHEET    2   L 6 ARG N  24  GLU N  29 -1  O  VAL N  25   N  THR N  17           
SHEET    3   L 6 MET N 195  GLY N 201  1  O  LEU N 197   N  ALA N  26           
SHEET    4   L 6 THR N  34  ILE N  41 -1  N  THR N  36   O  ALA N 200           
SHEET    5   L 6 THR N  95  LEU N 102 -1  O  ILE N  99   N  VAL N  37           
SHEET    6   L 6 HIS N  85  THR N  90 -1  N  ASN N  87   O  TYR N  98           
SHEET    1   M 8 ARG N 279  ASP N 281  0                                        
SHEET    2   M 8 SER N 306  SER N 313 -1  O  PHE N 307   N  TYR N 280           
SHEET    3   M 8 GLY N 318  ALA N 326 -1  O  LEU N 319   N  THR N 312           
SHEET    4   M 8 ALA N 251  GLU N 258 -1  N  ALA N 251   O  ALA N 326           
SHEET    5   M 8 ALA N 421  GLY N 426 -1  O  ALA N 421   N  ALA N 256           
SHEET    6   M 8 SER N 239  ASP N 245  1  N  SER N 239   O  LEU N 422           
SHEET    7   M 8 ARG T  11  LEU T  18 -1  O  ILE T  13   N  ARG N 244           
SHEET    8   M 8 LYS Q 234  TYR Q 237 -1  N  ALA Q 236   O  ILE T  14           
SHEET    1   N 2 ILE O  26  LYS O  28  0                                        
SHEET    2   N 2 ILE O  34  ALA O  36 -1  O  ILE O  35   N  THR O  27           
SHEET    1   O 6 MET O 204  ILE O 209  0                                        
SHEET    2   O 6 ALA O  44  ILE O  51 -1  N  PHE O  50   O  ALA O 205           
SHEET    3   O 6 MET O 105  LEU O 112 -1  O  CYS O 111   N  SER O  45           
SHEET    4   O 6 SER O  97  SER O 100 -1  N  TYR O  99   O  THR O 106           
SHEET    5   O 6 ALA V  66  SER V  69 -1  O  ALA V  66   N  SER O 100           
SHEET    6   O 6 SER V  75  VAL V  76 -1  O  SER V  75   N  GLY V  67           
SHEET    1   P 5 GLU O 243  GLN O 247  0                                        
SHEET    2   P 5 SER O 423  GLY O 428  1  O  ALA O 426   N  GLU O 246           
SHEET    3   P 5 LEU O 252  GLU O 260 -1  N  VAL O 258   O  SER O 423           
SHEET    4   P 5 SER O 319  GLN O 329 -1  O  THR O 326   N  ALA O 255           
SHEET    5   P 5 PHE O 307  TYR O 316 -1  N  PHE O 312   O  GLY O 323           
SHEET    1   Q 2 PRO P  23  PRO P  25  0                                        
SHEET    2   Q 2 LYS P 218  PRO P 220 -1  O  ILE P 219   N  ALA P  24           
SHEET    1   R 2 GLU Q  69  ASP Q  72  0                                        
SHEET    2   R 2 PHE Q  81  PRO Q  84 -1  O  ARG Q  83   N  VAL Q  70           
SHEET    1   S 2 HIS Q 148  TYR Q 149  0                                        
SHEET    2   S 2 ALA Q 157  ILE Q 158 -1  O  ILE Q 158   N  HIS Q 148           
SHEET    1   T 3 ILE R  74  LYS R  77  0                                        
SHEET    2   T 3 LEU R 192  VAL R 195 -1  O  VAL R 193   N  ILE R  76           
SHEET    3   T 3 PHE R 187  VAL R 188 -1  N  VAL R 188   O  LEU R 192           
SHEET    1   U 3 ASN R  86  TRP R  91  0                                        
SHEET    2   U 3 LYS R  94  HIS R 100 -1  O  LEU R  96   N  PHE R  89           
SHEET    3   U 3 TRP R 132  VAL R 136 -1  O  LEU R 135   N  PHE R  97           
SHEET    1   V 2 TYR R 156  CYS R 158  0                                        
SHEET    2   V 2 GLY R 162  TYR R 165 -1  O  TYR R 165   N  TYR R 156           
SSBOND   1 CYS E  144    CYS E  160                          1555   1555  2.03  
SSBOND   2 CYS H   24    CYS H   68                          1555   1555  2.06  
SSBOND   3 CYS H   40    CYS H   54                          1555   1555  2.06  
SSBOND   4 CYS R  144    CYS R  160                          1555   1555  2.04  
SSBOND   5 CYS U   24    CYS U   68                          1555   1555  2.05  
SSBOND   6 CYS U   40    CYS U   54                          1555   1555  2.04  
LINK         NE2 HIS C  84                FE   HEM C 501     1555   1555  2.00  
LINK         NE2 HIS C  98                FE   HEM C 502     1555   1555  2.01  
LINK         NE2 HIS C 183                FE   HEM C 501     1555   1555  2.00  
LINK         NE2 HIS C 197                FE   HEM C 502     1555   1555  2.01  
LINK         NE2 HIS D  41                FE   HEC D 501     1555   1555  2.00  
LINK         SD  MET D 160                FE   HEC D 501     1555   1555  2.16  
LINK         SG  CYS E 139                FE1  FES E 501     1555   1555  2.27  
LINK         ND1 HIS E 141                FE2  FES E 501     1555   1555  2.16  
LINK         SG  CYS E 158                FE1  FES E 501     1555   1555  2.26  
LINK         ND1 HIS E 161                FE2  FES E 501     1555   1555  2.15  
LINK         NE2 HIS P  84                FE   HEM P 501     1555   1555  2.01  
LINK         NE2 HIS P  98                FE   HEM P 502     1555   1555  2.02  
LINK         NE2 HIS P 183                FE   HEM P 501     1555   1555  2.00  
LINK         NE2 HIS P 197                FE   HEM P 502     1555   1555  2.01  
LINK         NE2 HIS Q  41                FE   HEC Q 501     1555   1555  2.00  
LINK         SD  MET Q 160                FE   HEC Q 501     1555   1555  2.12  
LINK         SG  CYS R 139                FE1  FES R 501     1555   1555  2.24  
LINK         ND1 HIS R 141                FE2  FES R 501     1555   1555  2.13  
LINK         SG  CYS R 158                FE1  FES R 501     1555   1555  2.27  
LINK         ND1 HIS R 161                FE2  FES R 501     1555   1555  2.13  
CISPEP   1 HIS C  222    PRO C  223          0         0.52                     
CISPEP   2 HIS C  346    PRO C  347          0        -0.20                     
CISPEP   3 GLY D   73    PRO D   74          0         0.10                     
CISPEP   4 HIS P  222    PRO P  223          0         0.34                     
CISPEP   5 HIS P  346    PRO P  347          0         0.02                     
CISPEP   6 GLY Q   73    PRO Q   74          0         0.12                     
CRYST1  171.499  182.934  241.028  90.00  90.00  90.00 P 21 21 21    8          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.005831  0.000000  0.000000        0.00000                         
SCALE2      0.000000  0.005466  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.004149        0.00000                         
ATOM      1  N   ALA A   1      91.887  83.631  57.917  1.00114.63           N  
ATOM      2  CA  ALA A   1      92.189  82.932  56.629  1.00115.65           C  
ATOM      3  C   ALA A   1      91.647  83.723  55.430  1.00116.27           C  
ATOM      4  O   ALA A   1      91.949  84.913  55.259  1.00116.55           O  
ATOM      5  CB  ALA A   1      91.588  81.514  56.652  1.00114.65           C  
ATOM      6  N   ALA A   2      90.856  83.055  54.594  1.00116.34           N  
ATOM      7  CA  ALA A   2      90.264  83.701  53.432  1.00115.53           C  
ATOM      8  C   ALA A   2      89.102  84.577  53.906  1.00115.57           C  
ATOM      9  O   ALA A   2      88.503  84.327  54.965  1.00114.88           O  
ATOM     10  CB  ALA A   2      89.771  82.646  52.446  1.00115.17           C  
ATOM     11  N   THR A   3      88.791  85.609  53.126  1.00115.47           N  
ATOM     12  CA  THR A   3      87.703  86.515  53.478  1.00115.04           C  
ATOM     13  C   THR A   3      86.345  86.092  52.913  1.00115.15           C  
ATOM     14  O   THR A   3      86.247  85.253  52.008  1.00114.31           O  
ATOM     15  CB  THR A   3      87.977  87.982  53.009  1.00114.06           C  
ATOM     16  OG1 THR A   3      88.345  87.990  51.624  1.00112.93           O  
ATOM     17  CG2 THR A   3      89.068  88.623  53.842  1.00112.87           C  
ATOM     18  N   TYR A   4      85.304  86.687  53.490  1.00115.30           N  
ATOM     19  CA  TYR A   4      83.927  86.463  53.082  1.00115.15           C  
ATOM     20  C   TYR A   4      83.872  86.851  51.609  1.00114.60           C  
ATOM     21  O   TYR A   4      83.273  86.158  50.792  1.00114.06           O  
ATOM     22  CB  TYR A   4      83.000  87.360  53.928  1.00115.70           C  
ATOM     23  CG  TYR A   4      81.574  87.512  53.427  1.00115.29           C  
ATOM     24  CD1 TYR A   4      80.679  86.443  53.453  1.00115.15           C  
ATOM     25  CD2 TYR A   4      81.130  88.727  52.911  1.00114.79           C  
ATOM     26  CE1 TYR A   4      79.379  86.581  52.974  1.00114.38           C  
ATOM     27  CE2 TYR A   4      79.837  88.873  52.431  1.00114.80           C  
ATOM     28  CZ  TYR A   4      78.967  87.798  52.464  1.00114.40           C  
ATOM     29  OH  TYR A   4      77.686  87.949  51.978  1.00114.78           O  
ATOM     30  N   ALA A   5      84.528  87.959  51.282  1.00114.56           N  
ATOM     31  CA  ALA A   5      84.572  88.454  49.914  1.00115.00           C  
ATOM     32  C   ALA A   5      85.041  87.370  48.948  1.00115.77           C  
ATOM     33  O   ALA A   5      84.420  87.143  47.906  1.00115.81           O  
ATOM     34  CB  ALA A   5      85.500  89.666  49.832  1.00114.62           C  
ATOM     35  N   GLN A   6      86.129  86.693  49.305  1.00116.55           N  
ATOM     36  CA  GLN A   6      86.697  85.649  48.462  1.00116.99           C  
ATOM     37  C   GLN A   6      85.930  84.328  48.463  1.00116.38           C  
ATOM     38  O   GLN A   6      85.652  83.780  47.392  1.00115.84           O  
ATOM     39  CB  GLN A   6      88.149  85.424  48.859  1.00118.53           C  
ATOM     40  CG  GLN A   6      88.942  86.711  48.814  1.00122.09           C  
ATOM     41  CD  GLN A   6      90.331  86.572  49.392  1.00124.28           C  
ATOM     42  OE1 GLN A   6      90.502  86.143  50.539  1.00126.17           O  
ATOM     43  NE2 GLN A   6      91.336  86.945  48.607  1.00124.33           N  
ATOM     44  N   THR A   7      85.587  83.811  49.642  1.00115.58           N  
ATOM     45  CA  THR A   7      84.838  82.559  49.707  1.00115.11           C  
ATOM     46  C   THR A   7      83.616  82.671  48.800  1.00115.76           C  
ATOM     47  O   THR A   7      83.115  81.668  48.283  1.00115.48           O  
ATOM     48  CB  THR A   7      84.362  82.245  51.140  1.00114.33           C  
ATOM     49  OG1 THR A   7      83.753  83.408  51.706  1.00115.06           O  
ATOM     50  CG2 THR A   7      85.519  81.820  52.008  1.00113.78           C  
ATOM     51  N   LEU A   8      83.154  83.907  48.605  1.00116.42           N  
ATOM     52  CA  LEU A   8      81.989  84.200  47.769  1.00117.02           C  
ATOM     53  C   LEU A   8      82.257  84.104  46.279  1.00117.55           C  
ATOM     54  O   LEU A   8      81.336  83.883  45.493  1.00118.29           O  
ATOM     55  CB  LEU A   8      81.440  85.602  48.059  1.00116.33           C  
ATOM     56  CG  LEU A   8      80.418  85.780  49.183  1.00115.27           C  
ATOM     57  CD1 LEU A   8      79.855  87.196  49.119  1.00114.05           C  
ATOM     58  CD2 LEU A   8      79.302  84.752  49.035  1.00114.69           C  
ATOM     59  N   GLN A   9      83.509  84.292  45.887  1.00117.70           N  
ATOM     60  CA  GLN A   9      83.866  84.218  44.480  1.00118.16           C  
ATOM     61  C   GLN A   9      84.187  82.786  44.077  1.00118.25           C  
ATOM     62  O   GLN A   9      83.761  82.315  43.019  1.00117.63           O  
ATOM     63  CB  GLN A   9      85.058  85.123  44.213  1.00118.71           C  
ATOM     64  CG  GLN A   9      84.765  86.570  44.529  1.00119.79           C  
ATOM     65  CD  GLN A   9      86.017  87.414  44.620  1.00120.02           C  
ATOM     66  OE1 GLN A   9      86.811  87.270  45.554  1.00119.34           O  
ATOM     67  NE2 GLN A   9      86.205  88.301  43.646  1.00120.99           N  
ATOM     68  N   ASN A  10      84.927  82.089  44.932  1.00118.80           N  
ATOM     69  CA  ASN A  10      85.304  80.708  44.650  1.00119.80           C  
ATOM     70  C   ASN A  10      84.151  79.719  44.684  1.00119.06           C  
ATOM     71  O   ASN A  10      84.374  78.502  44.685  1.00119.26           O  
ATOM     72  CB  ASN A  10      86.391  80.235  45.616  1.00121.33           C  
ATOM     73  CG  ASN A  10      87.752  80.791  45.268  1.00123.03           C  
ATOM     74  OD1 ASN A  10      87.970  82.006  45.324  1.00123.75           O  
ATOM     75  ND2 ASN A  10      88.679  79.905  44.896  1.00123.54           N  
ATOM     76  N   ILE A  11      82.924  80.226  44.723  1.00117.49           N  
ATOM     77  CA  ILE A  11      81.772  79.337  44.736  1.00115.65           C  
ATOM     78  C   ILE A  11      81.518  78.858  43.303  1.00113.51           C  
ATOM     79  O   ILE A  11      81.293  79.663  42.389  1.00112.30           O  
ATOM     80  CB  ILE A  11      80.510  80.037  45.328  1.00116.33           C  
ATOM     81  CG1 ILE A  11      80.763  80.396  46.802  1.00116.07           C  
ATOM     82  CG2 ILE A  11      79.285  79.122  45.203  1.00116.03           C  
ATOM     83  CD1 ILE A  11      79.576  81.038  47.511  1.00116.20           C  
ATOM     84  N   PRO A  12      81.580  77.530  43.090  1.00111.73           N  
ATOM     85  CA  PRO A  12      81.359  76.946  41.766  1.00110.05           C  
ATOM     86  C   PRO A  12      80.161  77.564  41.083  1.00108.64           C  
ATOM     87  O   PRO A  12      79.128  77.770  41.706  1.00109.28           O  
ATOM     88  CB  PRO A  12      81.171  75.452  42.061  1.00110.13           C  
ATOM     89  CG  PRO A  12      80.799  75.405  43.519  1.00111.09           C  
ATOM     90  CD  PRO A  12      81.666  76.477  44.116  1.00111.50           C  
ATOM     91  N   GLU A  13      80.307  77.866  39.802  1.00107.17           N  
ATOM     92  CA  GLU A  13      79.230  78.480  39.052  1.00106.01           C  
ATOM     93  C   GLU A  13      78.088  77.532  38.718  1.00104.93           C  
ATOM     94  O   GLU A  13      78.225  76.308  38.796  1.00103.51           O  
ATOM     95  CB  GLU A  13      79.778  79.088  37.774  1.00106.92           C  
ATOM     96  CG  GLU A  13      78.919  80.206  37.243  1.00109.96           C  
ATOM     97  CD  GLU A  13      79.717  81.181  36.406  1.00111.43           C  
ATOM     98  OE1 GLU A  13      80.109  80.814  35.274  1.00112.86           O  
ATOM     99  OE2 GLU A  13      79.961  82.310  36.890  1.00111.23           O  
ATOM    100  N   THR A  14      76.950  78.117  38.355  1.00104.35           N  
ATOM    101  CA  THR A  14      75.774  77.337  38.010  1.00103.59           C  
ATOM    102  C   THR A  14      75.642  77.255  36.495  1.00102.40           C  
ATOM    103  O   THR A  14      75.566  78.277  35.809  1.00101.35           O  
ATOM    104  CB  THR A  14      74.490  77.958  38.612  1.00103.87           C  
ATOM    105  OG1 THR A  14      74.661  78.131  40.028  1.00103.40           O  
ATOM    106  CG2 THR A  14      73.282  77.045  38.357  1.00102.90           C  
ATOM    107  N   ASN A  15      75.631  76.025  35.989  1.00101.50           N  
ATOM    108  CA  ASN A  15      75.521  75.766  34.560  1.00100.50           C  
ATOM    109  C   ASN A  15      74.077  75.641  34.152  1.00 98.47           C  
ATOM    110  O   ASN A  15      73.278  75.016  34.845  1.00 97.55           O  
ATOM    111  CB  ASN A  15      76.222  74.457  34.176  1.00102.47           C  
ATOM    112  CG  ASN A  15      77.697  74.463  34.493  1.00102.84           C  
ATOM    113  OD1 ASN A  15      78.442  75.339  34.032  1.00101.14           O  
ATOM    114  ND2 ASN A  15      78.135  73.474  35.284  1.00103.34           N  
ATOM    115  N   VAL A  16      73.759  76.218  33.005  1.00 96.97           N  
ATOM    116  CA  VAL A  16      72.412  76.158  32.485  1.00 96.83           C  
ATOM    117  C   VAL A  16      72.473  75.909  30.994  1.00 96.41           C  
ATOM    118  O   VAL A  16      73.096  76.673  30.256  1.00 96.79           O  
ATOM    119  CB  VAL A  16      71.653  77.483  32.727  1.00 97.56           C  
ATOM    120  CG1 VAL A  16      70.216  77.365  32.218  1.00 96.56           C  
ATOM    121  CG2 VAL A  16      71.677  77.837  34.210  1.00 98.25           C  
ATOM    122  N   THR A  17      71.843  74.828  30.553  1.00 96.21           N  
ATOM    123  CA  THR A  17      71.800  74.517  29.131  1.00 96.33           C  
ATOM    124  C   THR A  17      70.368  74.141  28.754  1.00 96.79           C  
ATOM    125  O   THR A  17      69.756  73.244  29.347  1.00 95.92           O  
ATOM    126  CB  THR A  17      72.773  73.360  28.739  1.00 95.89           C  
ATOM    127  OG1 THR A  17      72.329  72.123  29.314  1.00 93.90           O  
ATOM    128  CG2 THR A  17      74.194  73.673  29.212  1.00 95.14           C  
ATOM    129  N   THR A  18      69.829  74.862  27.780  1.00 96.92           N  
ATOM    130  CA  THR A  18      68.475  74.617  27.311  1.00 96.65           C  
ATOM    131  C   THR A  18      68.514  73.455  26.329  1.00 96.90           C  
ATOM    132  O   THR A  18      69.512  73.265  25.629  1.00 96.51           O  
ATOM    133  CB  THR A  18      67.920  75.855  26.569  1.00 96.51           C  
ATOM    134  OG1 THR A  18      68.018  77.004  27.420  1.00 95.84           O  
ATOM    135  CG2 THR A  18      66.463  75.636  26.152  1.00 94.95           C  
ATOM    136  N   LEU A  19      67.443  72.667  26.292  1.00 96.68           N  
ATOM    137  CA  LEU A  19      67.371  71.569  25.344  1.00 96.61           C  
ATOM    138  C   LEU A  19      66.698  72.123  24.103  1.00 97.86           C  
ATOM    139  O   LEU A  19      66.656  73.341  23.898  1.00 97.45           O  
ATOM    140  CB  LEU A  19      66.558  70.393  25.885  1.00 94.73           C  
ATOM    141  CG  LEU A  19      67.132  69.662  27.099  1.00 94.61           C  
ATOM    142  CD1 LEU A  19      66.496  68.279  27.222  1.00 94.01           C  
ATOM    143  CD2 LEU A  19      68.627  69.534  26.953  1.00 94.90           C  
ATOM    144  N   ASP A  20      66.167  71.235  23.276  1.00 99.53           N  
ATOM    145  CA  ASP A  20      65.511  71.669  22.057  1.00101.12           C  
ATOM    146  C   ASP A  20      64.018  71.789  22.283  1.00100.91           C  
ATOM    147  O   ASP A  20      63.355  72.637  21.688  1.00101.09           O  
ATOM    148  CB  ASP A  20      65.820  70.693  20.918  1.00103.12           C  
ATOM    149  CG  ASP A  20      67.307  70.651  20.577  1.00104.59           C  
ATOM    150  OD1 ASP A  20      67.905  71.735  20.391  1.00105.09           O  
ATOM    151  OD2 ASP A  20      67.878  69.538  20.493  1.00105.69           O  
ATOM    152  N   ASN A  21      63.489  70.945  23.155  1.00100.60           N  
ATOM    153  CA  ASN A  21      62.071  70.991  23.460  1.00101.21           C  
ATOM    154  C   ASN A  21      61.758  72.145  24.418  1.00101.01           C  
ATOM    155  O   ASN A  21      60.623  72.278  24.891  1.00101.95           O  
ATOM    156  CB  ASN A  21      61.623  69.657  24.053  1.00101.59           C  
ATOM    157  CG  ASN A  21      62.557  69.162  25.129  1.00101.45           C  
ATOM    158  OD1 ASN A  21      63.742  69.501  25.143  1.00101.65           O  
ATOM    159  ND2 ASN A  21      62.035  68.340  26.027  1.00101.56           N  
ATOM    160  N   GLY A  22      62.770  72.970  24.700  1.00 99.48           N  
ATOM    161  CA  GLY A  22      62.589  74.127  25.566  1.00 97.41           C  
ATOM    162  C   GLY A  22      62.968  73.981  27.030  1.00 96.22           C  
ATOM    163  O   GLY A  22      63.118  74.985  27.741  1.00 95.52           O  
ATOM    164  N   LEU A  23      63.119  72.742  27.488  1.00 95.21           N  
ATOM    165  CA  LEU A  23      63.470  72.494  28.880  1.00 94.59           C  
ATOM    166  C   LEU A  23      64.854  73.031  29.207  1.00 94.38           C  
ATOM    167  O   LEU A  23      65.762  72.990  28.377  1.00 94.23           O  
ATOM    168  CB  LEU A  23      63.396  70.995  29.189  1.00 94.24           C  
ATOM    169  CG  LEU A  23      63.601  70.571  30.648  1.00 94.45           C  
ATOM    170  CD1 LEU A  23      62.917  69.232  30.880  1.00 94.16           C  
ATOM    171  CD2 LEU A  23      65.086  70.493  30.980  1.00 93.41           C  
ATOM    172  N   ARG A  24      65.002  73.549  30.422  1.00 94.97           N  
ATOM    173  CA  ARG A  24      66.276  74.101  30.882  1.00 95.17           C  
ATOM    174  C   ARG A  24      66.890  73.224  31.970  1.00 94.32           C  
ATOM    175  O   ARG A  24      66.233  72.861  32.946  1.00 94.12           O  
ATOM    176  CB  ARG A  24      66.075  75.527  31.408  1.00 95.83           C  
ATOM    177  CG  ARG A  24      65.947  76.598  30.317  1.00 97.54           C  
ATOM    178  CD  ARG A  24      65.267  77.853  30.849  1.00 98.03           C  
ATOM    179  NE  ARG A  24      63.850  77.603  31.102  1.00 98.41           N  
ATOM    180  CZ  ARG A  24      63.060  78.400  31.813  1.00 96.99           C  
ATOM    181  NH1 ARG A  24      63.547  79.509  32.356  1.00 95.27           N  
ATOM    182  NH2 ARG A  24      61.781  78.084  31.974  1.00 96.58           N  
ATOM    183  N   VAL A  25      68.156  72.874  31.792  1.00 93.33           N  
ATOM    184  CA  VAL A  25      68.834  72.039  32.765  1.00 91.60           C  
ATOM    185  C   VAL A  25      69.934  72.840  33.430  1.00 91.00           C  
ATOM    186  O   VAL A  25      70.757  73.462  32.754  1.00 90.26           O  
ATOM    187  CB  VAL A  25      69.431  70.795  32.104  1.00 91.27           C  
ATOM    188  CG1 VAL A  25      70.208  70.000  33.123  1.00 90.50           C  
ATOM    189  CG2 VAL A  25      68.321  69.946  31.504  1.00 90.62           C  
ATOM    190  N   ALA A  26      69.934  72.826  34.760  1.00 90.40           N  
ATOM    191  CA  ALA A  26      70.914  73.571  35.534  1.00 89.77           C  
ATOM    192  C   ALA A  26      71.346  72.831  36.783  1.00 89.56           C  
ATOM    193  O   ALA A  26      70.616  71.983  37.305  1.00 87.98           O  
ATOM    194  CB  ALA A  26      70.347  74.929  35.909  1.00 90.89           C  
ATOM    195  N   SER A  27      72.531  73.181  37.279  1.00 90.46           N  
ATOM    196  CA  SER A  27      73.067  72.519  38.460  1.00 91.73           C  
ATOM    197  C   SER A  27      74.327  73.161  39.002  1.00 91.90           C  
ATOM    198  O   SER A  27      75.024  73.879  38.293  1.00 91.53           O  
ATOM    199  CB  SER A  27      73.408  71.077  38.114  1.00 93.11           C  
ATOM    200  OG  SER A  27      74.496  71.057  37.197  1.00 93.95           O  
ATOM    201  N   GLU A  28      74.614  72.881  40.267  1.00 93.16           N  
ATOM    202  CA  GLU A  28      75.819  73.381  40.907  1.00 95.98           C  
ATOM    203  C   GLU A  28      76.532  72.175  41.466  1.00 97.17           C  
ATOM    204  O   GLU A  28      76.036  71.521  42.392  1.00 96.36           O  
ATOM    205  CB  GLU A  28      75.514  74.350  42.044  1.00 97.73           C  
ATOM    206  CG  GLU A  28      76.763  74.720  42.844  1.00100.61           C  
ATOM    207  CD  GLU A  28      76.538  75.850  43.844  1.00102.72           C  
ATOM    208  OE1 GLU A  28      76.311  77.006  43.410  1.00103.46           O  
ATOM    209  OE2 GLU A  28      76.595  75.578  45.067  1.00103.64           O  
ATOM    210  N   GLU A  29      77.704  71.900  40.895  1.00 98.97           N  
ATOM    211  CA  GLU A  29      78.519  70.756  41.269  1.00100.53           C  
ATOM    212  C   GLU A  29      79.413  70.988  42.469  1.00100.99           C  
ATOM    213  O   GLU A  29      80.237  71.902  42.487  1.00100.15           O  
ATOM    214  CB  GLU A  29      79.354  70.303  40.066  1.00101.78           C  
ATOM    215  CG  GLU A  29      80.259  69.103  40.333  1.00104.31           C  
ATOM    216  CD  GLU A  29      80.746  68.433  39.051  1.00105.64           C  
ATOM    217  OE1 GLU A  29      81.016  69.154  38.060  1.00106.00           O  
ATOM    218  OE2 GLU A  29      80.868  67.185  39.042  1.00106.32           O  
ATOM    219  N   SER A  30      79.227  70.134  43.469  1.00102.48           N  
ATOM    220  CA  SER A  30      79.987  70.186  44.709  1.00104.74           C  
ATOM    221  C   SER A  30      80.837  68.938  44.817  1.00105.29           C  
ATOM    222  O   SER A  30      80.833  68.084  43.926  1.00106.31           O  
ATOM    223  CB  SER A  30      79.052  70.238  45.924  1.00106.49           C  
ATOM    224  OG  SER A  30      78.443  68.975  46.178  1.00107.64           O  
ATOM    225  N   SER A  31      81.544  68.829  45.932  1.00104.68           N  
ATOM    226  CA  SER A  31      82.402  67.694  46.179  1.00104.14           C  
ATOM    227  C   SER A  31      81.624  66.595  46.914  1.00103.78           C  
ATOM    228  O   SER A  31      82.170  65.542  47.221  1.00104.67           O  
ATOM    229  CB  SER A  31      83.591  68.164  47.016  1.00104.02           C  
ATOM    230  OG  SER A  31      84.579  67.161  47.125  1.00105.75           O  
ATOM    231  N   GLN A  32      80.338  66.835  47.165  1.00103.10           N  
ATOM    232  CA  GLN A  32      79.497  65.894  47.911  1.00101.67           C  
ATOM    233  C   GLN A  32      79.000  64.603  47.261  1.00 98.74           C  
ATOM    234  O   GLN A  32      78.515  64.593  46.134  1.00 98.19           O  
ATOM    235  CB  GLN A  32      78.318  66.656  48.516  1.00104.39           C  
ATOM    236  CG  GLN A  32      78.779  67.628  49.595  1.00107.82           C  
ATOM    237  CD  GLN A  32      77.641  68.223  50.389  1.00109.96           C  
ATOM    238  OE1 GLN A  32      76.923  69.101  49.901  1.00111.36           O  
ATOM    239  NE2 GLN A  32      77.459  67.741  51.624  1.00110.46           N  
ATOM    240  N   PRO A  33      79.096  63.492  48.010  1.00 96.59           N  
ATOM    241  CA  PRO A  33      78.719  62.111  47.682  1.00 96.37           C  
ATOM    242  C   PRO A  33      77.216  61.914  47.520  1.00 96.98           C  
ATOM    243  O   PRO A  33      76.742  60.984  46.850  1.00 97.02           O  
ATOM    244  CB  PRO A  33      79.260  61.331  48.871  1.00 95.64           C  
ATOM    245  CG  PRO A  33      79.022  62.272  49.996  1.00 94.90           C  
ATOM    246  CD  PRO A  33      79.505  63.586  49.424  1.00 95.68           C  
ATOM    247  N   THR A  34      76.475  62.796  48.177  1.00 96.81           N  
ATOM    248  CA  THR A  34      75.029  62.784  48.153  1.00 93.89           C  
ATOM    249  C   THR A  34      74.615  63.979  47.286  1.00 92.51           C  
ATOM    250  O   THR A  34      75.439  64.853  46.982  1.00 91.24           O  
ATOM    251  CB  THR A  34      74.481  62.883  49.607  1.00 93.28           C  
ATOM    252  OG1 THR A  34      73.075  63.116  49.572  1.00 96.28           O  
ATOM    253  CG2 THR A  34      75.167  64.002  50.387  1.00 93.10           C  
ATOM    254  N   CYS A  35      73.357  64.004  46.859  1.00 91.53           N  
ATOM    255  CA  CYS A  35      72.874  65.099  46.023  1.00 89.96           C  
ATOM    256  C   CYS A  35      71.350  65.211  46.025  1.00 90.13           C  
ATOM    257  O   CYS A  35      70.642  64.428  46.672  1.00 89.19           O  
ATOM    258  CB  CYS A  35      73.336  64.899  44.589  1.00 87.90           C  
ATOM    259  SG  CYS A  35      72.441  63.529  43.812  1.00 86.79           S  
ATOM    260  N   THR A  36      70.863  66.199  45.278  1.00 90.14           N  
ATOM    261  CA  THR A  36      69.434  66.455  45.140  1.00 89.57           C  
ATOM    262  C   THR A  36      69.151  66.949  43.729  1.00 88.44           C  
ATOM    263  O   THR A  36      69.832  67.845  43.225  1.00 87.96           O  
ATOM    264  CB  THR A  36      68.940  67.560  46.107  1.00 90.22           C  
ATOM    265  OG1 THR A  36      69.315  67.239  47.451  1.00 91.41           O  
ATOM    266  CG2 THR A  36      67.423  67.688  46.029  1.00 91.06           C  
ATOM    267  N   VAL A  37      68.157  66.354  43.084  1.00 87.31           N  
ATOM    268  CA  VAL A  37      67.772  66.787  41.751  1.00 86.05           C  
ATOM    269  C   VAL A  37      66.261  66.667  41.629  1.00 85.35           C  
ATOM    270  O   VAL A  37      65.637  65.751  42.182  1.00 83.16           O  
ATOM    271  CB  VAL A  37      68.448  65.957  40.624  1.00 85.64           C  
ATOM    272  CG1 VAL A  37      69.929  65.877  40.870  1.00 85.34           C  
ATOM    273  CG2 VAL A  37      67.835  64.568  40.532  1.00 86.30           C  
ATOM    274  N   GLY A  38      65.681  67.625  40.920  1.00 85.03           N  
ATOM    275  CA  GLY A  38      64.251  67.632  40.723  1.00 84.48           C  
ATOM    276  C   GLY A  38      63.853  68.619  39.647  1.00 84.61           C  
ATOM    277  O   GLY A  38      64.692  69.325  39.064  1.00 82.92           O  
ATOM    278  N   VAL A  39      62.553  68.657  39.386  1.00 85.47           N  
ATOM    279  CA  VAL A  39      61.993  69.549  38.387  1.00 86.19           C  
ATOM    280  C   VAL A  39      61.057  70.606  39.003  1.00 85.75           C  
ATOM    281  O   VAL A  39      60.049  70.280  39.635  1.00 85.91           O  
ATOM    282  CB  VAL A  39      61.233  68.740  37.289  1.00 86.07           C  
ATOM    283  CG1 VAL A  39      60.204  67.819  37.923  1.00 85.81           C  
ATOM    284  CG2 VAL A  39      60.549  69.692  36.320  1.00 86.89           C  
ATOM    285  N   TRP A  40      61.425  71.872  38.825  1.00 84.87           N  
ATOM    286  CA  TRP A  40      60.649  73.006  39.304  1.00 82.93           C  
ATOM    287  C   TRP A  40      59.781  73.465  38.138  1.00 80.96           C  
ATOM    288  O   TRP A  40      60.292  73.868  37.094  1.00 81.01           O  
ATOM    289  CB  TRP A  40      61.591  74.128  39.760  1.00 84.46           C  
ATOM    290  CG  TRP A  40      62.007  73.981  41.189  1.00 87.91           C  
ATOM    291  CD1 TRP A  40      61.477  74.636  42.262  1.00 89.73           C  
ATOM    292  CD2 TRP A  40      62.943  73.035  41.725  1.00 89.69           C  
ATOM    293  NE1 TRP A  40      62.014  74.154  43.434  1.00 90.10           N  
ATOM    294  CE2 TRP A  40      62.916  73.169  43.134  1.00 90.21           C  
ATOM    295  CE3 TRP A  40      63.798  72.083  41.155  1.00 90.23           C  
ATOM    296  CZ2 TRP A  40      63.711  72.386  43.980  1.00 90.24           C  
ATOM    297  CZ3 TRP A  40      64.591  71.302  42.002  1.00 90.34           C  
ATOM    298  CH2 TRP A  40      64.538  71.460  43.398  1.00 89.66           C  
ATOM    299  N   ILE A  41      58.468  73.387  38.315  1.00 78.68           N  
ATOM    300  CA  ILE A  41      57.526  73.781  37.276  1.00 75.88           C  
ATOM    301  C   ILE A  41      56.825  75.111  37.548  1.00 75.38           C  
ATOM    302  O   ILE A  41      56.478  75.426  38.686  1.00 75.05           O  
ATOM    303  CB  ILE A  41      56.440  72.730  37.116  1.00 74.41           C  
ATOM    304  CG1 ILE A  41      57.069  71.346  37.127  1.00 74.73           C  
ATOM    305  CG2 ILE A  41      55.681  72.958  35.826  1.00 72.98           C  
ATOM    306  CD1 ILE A  41      56.055  70.223  36.986  1.00 76.16           C  
ATOM    307  N   GLY A  42      56.614  75.883  36.491  1.00 74.70           N  
ATOM    308  CA  GLY A  42      55.919  77.148  36.618  1.00 74.63           C  
ATOM    309  C   GLY A  42      54.413  76.928  36.517  1.00 75.52           C  
ATOM    310  O   GLY A  42      53.761  77.414  35.584  1.00 75.87           O  
ATOM    311  N   ALA A  43      53.867  76.173  37.471  1.00 75.39           N  
ATOM    312  CA  ALA A  43      52.435  75.886  37.537  1.00 75.17           C  
ATOM    313  C   ALA A  43      51.933  75.994  38.987  1.00 75.77           C  
ATOM    314  O   ALA A  43      52.708  75.871  39.940  1.00 76.21           O  
ATOM    315  CB  ALA A  43      52.158  74.507  36.995  1.00 74.26           C  
ATOM    316  N   GLY A  44      50.636  76.232  39.153  1.00 75.78           N  
ATOM    317  CA  GLY A  44      50.078  76.353  40.489  1.00 74.97           C  
ATOM    318  C   GLY A  44      48.609  76.729  40.465  1.00 73.98           C  
ATOM    319  O   GLY A  44      48.000  76.786  39.396  1.00 74.61           O  
ATOM    320  N   SER A  45      48.040  77.004  41.635  1.00 71.93           N  
ATOM    321  CA  SER A  45      46.634  77.354  41.712  1.00 69.06           C  
ATOM    322  C   SER A  45      46.346  78.622  40.935  1.00 67.56           C  
ATOM    323  O   SER A  45      45.233  78.812  40.458  1.00 68.84           O  
ATOM    324  CB  SER A  45      46.188  77.511  43.166  1.00 68.41           C  
ATOM    325  OG  SER A  45      46.833  78.604  43.779  1.00 68.76           O  
ATOM    326  N   ARG A  46      47.332  79.493  40.780  1.00 65.97           N  
ATOM    327  CA  ARG A  46      47.068  80.717  40.025  1.00 66.37           C  
ATOM    328  C   ARG A  46      46.714  80.375  38.584  1.00 67.56           C  
ATOM    329  O   ARG A  46      45.925  81.075  37.946  1.00 68.53           O  
ATOM    330  CB  ARG A  46      48.266  81.673  40.021  1.00 64.44           C  
ATOM    331  CG  ARG A  46      47.950  82.953  39.259  1.00 62.12           C  
ATOM    332  CD  ARG A  46      49.073  83.973  39.267  1.00 60.91           C  
ATOM    333  NE  ARG A  46      48.652  85.192  38.580  1.00 60.00           N  
ATOM    334  CZ  ARG A  46      49.404  86.281  38.439  1.00 59.30           C  
ATOM    335  NH1 ARG A  46      50.634  86.298  38.943  1.00 57.41           N  
ATOM    336  NH2 ARG A  46      48.912  87.357  37.815  1.00 57.02           N  
ATOM    337  N   TYR A  47      47.310  79.298  38.077  1.00 68.27           N  
ATOM    338  CA  TYR A  47      47.058  78.865  36.714  1.00 68.30           C  
ATOM    339  C   TYR A  47      45.739  78.132  36.620  1.00 69.81           C  
ATOM    340  O   TYR A  47      45.255  77.858  35.524  1.00 70.73           O  
ATOM    341  CB  TYR A  47      48.177  77.956  36.212  1.00 66.36           C  
ATOM    342  CG  TYR A  47      49.509  78.646  36.073  1.00 64.31           C  
ATOM    343  CD1 TYR A  47      50.335  78.826  37.176  1.00 63.09           C  
ATOM    344  CD2 TYR A  47      49.921  79.162  34.847  1.00 62.74           C  
ATOM    345  CE1 TYR A  47      51.538  79.510  37.065  1.00 63.67           C  
ATOM    346  CE2 TYR A  47      51.124  79.848  34.722  1.00 62.09           C  
ATOM    347  CZ  TYR A  47      51.930  80.026  35.838  1.00 63.18           C  
ATOM    348  OH  TYR A  47      53.106  80.755  35.756  1.00 63.00           O  
ATOM    349  N   GLU A  48      45.150  77.810  37.761  1.00 71.28           N  
ATOM    350  CA  GLU A  48      43.881  77.114  37.735  1.00 73.76           C  
ATOM    351  C   GLU A  48      42.766  78.094  37.389  1.00 75.52           C  
ATOM    352  O   GLU A  48      42.982  79.306  37.307  1.00 75.06           O  
ATOM    353  CB  GLU A  48      43.608  76.459  39.088  1.00 73.54           C  
ATOM    354  CG  GLU A  48      44.705  75.530  39.535  1.00 75.60           C  
ATOM    355  CD  GLU A  48      44.422  74.895  40.869  1.00 78.62           C  
ATOM    356  OE1 GLU A  48      44.004  75.622  41.795  1.00 80.01           O  
ATOM    357  OE2 GLU A  48      44.630  73.669  41.001  1.00 81.45           O  
ATOM    358  N   ASN A  49      41.579  77.548  37.164  1.00 78.00           N  
ATOM    359  CA  ASN A  49      40.400  78.333  36.849  1.00 79.90           C  
ATOM    360  C   ASN A  49      39.401  77.991  37.945  1.00 80.86           C  
ATOM    361  O   ASN A  49      39.706  77.209  38.845  1.00 80.04           O  
ATOM    362  CB  ASN A  49      39.870  77.956  35.453  1.00 82.27           C  
ATOM    363  CG  ASN A  49      38.760  76.901  35.488  1.00 85.09           C  
ATOM    364  OD1 ASN A  49      38.908  75.826  36.080  1.00 86.14           O  
ATOM    365  ND2 ASN A  49      37.642  77.208  34.829  1.00 86.83           N  
ATOM    366  N   GLU A  50      38.211  78.564  37.877  1.00 83.63           N  
ATOM    367  CA  GLU A  50      37.199  78.318  38.900  1.00 86.94           C  
ATOM    368  C   GLU A  50      36.717  76.859  39.020  1.00 85.36           C  
ATOM    369  O   GLU A  50      36.238  76.439  40.080  1.00 84.55           O  
ATOM    370  CB  GLU A  50      36.005  79.255  38.655  1.00 92.21           C  
ATOM    371  CG  GLU A  50      34.866  79.144  39.673  1.00 99.03           C  
ATOM    372  CD  GLU A  50      33.536  78.760  39.021  1.00103.62           C  
ATOM    373  OE1 GLU A  50      33.141  79.444  38.042  1.00105.78           O  
ATOM    374  OE2 GLU A  50      32.889  77.785  39.487  1.00105.08           O  
ATOM    375  N   LYS A  51      36.864  76.083  37.952  1.00 83.92           N  
ATOM    376  CA  LYS A  51      36.396  74.701  37.969  1.00 83.11           C  
ATOM    377  C   LYS A  51      37.437  73.608  38.166  1.00 81.02           C  
ATOM    378  O   LYS A  51      37.085  72.459  38.427  1.00 80.27           O  
ATOM    379  CB  LYS A  51      35.585  74.424  36.703  1.00 85.34           C  
ATOM    380  CG  LYS A  51      34.237  75.157  36.672  1.00 88.69           C  
ATOM    381  CD  LYS A  51      33.724  75.339  35.248  1.00 91.45           C  
ATOM    382  CE  LYS A  51      34.658  76.239  34.419  1.00 92.84           C  
ATOM    383  NZ  LYS A  51      34.359  76.190  32.951  1.00 92.74           N  
ATOM    384  N   ASN A  52      38.712  73.943  38.036  1.00 79.07           N  
ATOM    385  CA  ASN A  52      39.747  72.944  38.247  1.00 76.97           C  
ATOM    386  C   ASN A  52      40.610  73.309  39.462  1.00 76.68           C  
ATOM    387  O   ASN A  52      41.632  72.670  39.720  1.00 77.59           O  
ATOM    388  CB  ASN A  52      40.615  72.784  36.992  1.00 75.11           C  
ATOM    389  CG  ASN A  52      41.476  73.988  36.720  1.00 74.31           C  
ATOM    390  OD1 ASN A  52      41.456  74.953  37.476  1.00 74.86           O  
ATOM    391  ND2 ASN A  52      42.247  73.938  35.635  1.00 74.10           N  
ATOM    392  N   ASN A  53      40.183  74.331  40.208  1.00 75.02           N  
ATOM    393  CA  ASN A  53      40.889  74.786  41.409  1.00 72.86           C  
ATOM    394  C   ASN A  53      41.192  73.597  42.316  1.00 71.70           C  
ATOM    395  O   ASN A  53      40.273  72.949  42.829  1.00 71.00           O  
ATOM    396  CB  ASN A  53      40.024  75.788  42.183  1.00 73.53           C  
ATOM    397  CG  ASN A  53      40.758  76.426  43.375  1.00 74.86           C  
ATOM    398  OD1 ASN A  53      40.128  76.855  44.356  1.00 74.53           O  
ATOM    399  ND2 ASN A  53      42.086  76.511  43.282  1.00 73.84           N  
ATOM    400  N   GLY A  54      42.480  73.317  42.504  1.00 69.91           N  
ATOM    401  CA  GLY A  54      42.885  72.220  43.358  1.00 69.05           C  
ATOM    402  C   GLY A  54      43.350  70.996  42.606  1.00 68.62           C  
ATOM    403  O   GLY A  54      43.712  69.988  43.211  1.00 68.27           O  
ATOM    404  N   ALA A  55      43.319  71.065  41.282  1.00 69.40           N  
ATOM    405  CA  ALA A  55      43.768  69.942  40.464  1.00 70.19           C  
ATOM    406  C   ALA A  55      45.288  69.787  40.666  1.00 70.62           C  
ATOM    407  O   ALA A  55      45.788  68.699  40.965  1.00 69.13           O  
ATOM    408  CB  ALA A  55      43.442  70.202  39.001  1.00 69.37           C  
ATOM    409  N   GLY A  56      46.016  70.887  40.520  1.00 70.77           N  
ATOM    410  CA  GLY A  56      47.448  70.827  40.713  1.00 71.37           C  
ATOM    411  C   GLY A  56      47.817  70.214  42.053  1.00 71.85           C  
ATOM    412  O   GLY A  56      48.922  69.699  42.221  1.00 74.57           O  
ATOM    413  N   TYR A  57      46.908  70.284  43.018  1.00 70.93           N  
ATOM    414  CA  TYR A  57      47.160  69.723  44.344  1.00 69.53           C  
ATOM    415  C   TYR A  57      46.784  68.252  44.300  1.00 69.44           C  
ATOM    416  O   TYR A  57      47.497  67.398  44.815  1.00 70.53           O  
ATOM    417  CB  TYR A  57      46.310  70.453  45.398  1.00 68.92           C  
ATOM    418  CG  TYR A  57      46.640  70.128  46.849  1.00 66.63           C  
ATOM    419  CD1 TYR A  57      47.903  70.408  47.378  1.00 66.41           C  
ATOM    420  CD2 TYR A  57      45.684  69.569  47.696  1.00 65.16           C  
ATOM    421  CE1 TYR A  57      48.208  70.142  48.708  1.00 64.79           C  
ATOM    422  CE2 TYR A  57      45.975  69.299  49.032  1.00 64.18           C  
ATOM    423  CZ  TYR A  57      47.238  69.590  49.531  1.00 65.11           C  
ATOM    424  OH  TYR A  57      47.534  69.348  50.858  1.00 66.64           O  
ATOM    425  N   PHE A  58      45.651  67.969  43.671  1.00 69.86           N  
ATOM    426  CA  PHE A  58      45.141  66.612  43.523  1.00 69.44           C  
ATOM    427  C   PHE A  58      46.193  65.791  42.768  1.00 70.51           C  
ATOM    428  O   PHE A  58      46.301  64.579  42.946  1.00 70.23           O  
ATOM    429  CB  PHE A  58      43.838  66.668  42.731  1.00 68.00           C  
ATOM    430  CG  PHE A  58      42.861  65.600  43.082  1.00 67.82           C  
ATOM    431  CD1 PHE A  58      41.525  65.919  43.299  1.00 69.00           C  
ATOM    432  CD2 PHE A  58      43.255  64.282  43.191  1.00 68.67           C  
ATOM    433  CE1 PHE A  58      40.585  64.937  43.622  1.00 69.11           C  
ATOM    434  CE2 PHE A  58      42.322  63.286  43.515  1.00 70.28           C  
ATOM    435  CZ  PHE A  58      40.982  63.620  43.733  1.00 68.98           C  
ATOM    436  N   VAL A  59      46.963  66.472  41.921  1.00 71.58           N  
ATOM    437  CA  VAL A  59      48.018  65.841  41.133  1.00 72.31           C  
ATOM    438  C   VAL A  59      49.214  65.539  42.023  1.00 73.15           C  
ATOM    439  O   VAL A  59      49.798  64.468  41.942  1.00 75.00           O  
ATOM    440  CB  VAL A  59      48.466  66.756  39.960  1.00 72.47           C  
ATOM    441  CG1 VAL A  59      49.870  66.390  39.490  1.00 70.89           C  
ATOM    442  CG2 VAL A  59      47.480  66.629  38.811  1.00 71.74           C  
ATOM    443  N   GLU A  60      49.581  66.489  42.867  1.00 73.43           N  
ATOM    444  CA  GLU A  60      50.695  66.299  43.774  1.00 74.63           C  
ATOM    445  C   GLU A  60      50.466  65.043  44.616  1.00 74.13           C  
ATOM    446  O   GLU A  60      51.415  64.388  45.048  1.00 74.96           O  
ATOM    447  CB  GLU A  60      50.814  67.506  44.690  1.00 77.39           C  
ATOM    448  CG  GLU A  60      52.069  67.527  45.512  1.00 81.65           C  
ATOM    449  CD  GLU A  60      51.909  68.365  46.750  1.00 83.91           C  
ATOM    450  OE1 GLU A  60      51.279  67.869  47.707  1.00 84.25           O  
ATOM    451  OE2 GLU A  60      52.398  69.518  46.763  1.00 87.05           O  
ATOM    452  N   HIS A  61      49.199  64.715  44.844  1.00 73.21           N  
ATOM    453  CA  HIS A  61      48.829  63.535  45.624  1.00 73.36           C  
ATOM    454  C   HIS A  61      48.959  62.215  44.865  1.00 73.90           C  
ATOM    455  O   HIS A  61      49.051  61.161  45.476  1.00 74.57           O  
ATOM    456  CB  HIS A  61      47.386  63.657  46.107  1.00 72.35           C  
ATOM    457  CG  HIS A  61      47.234  64.437  47.368  1.00 71.23           C  
ATOM    458  ND1 HIS A  61      46.902  63.847  48.569  1.00 71.55           N  
ATOM    459  CD2 HIS A  61      47.379  65.757  47.625  1.00 70.44           C  
ATOM    460  CE1 HIS A  61      46.848  64.771  49.511  1.00 70.29           C  
ATOM    461  NE2 HIS A  61      47.133  65.938  48.963  1.00 70.33           N  
ATOM    462  N   LEU A  62      48.938  62.271  43.538  1.00 73.96           N  
ATOM    463  CA  LEU A  62      49.034  61.076  42.719  1.00 72.83           C  
ATOM    464  C   LEU A  62      50.407  60.950  42.098  1.00 74.39           C  
ATOM    465  O   LEU A  62      50.827  59.862  41.716  1.00 74.45           O  
ATOM    466  CB  LEU A  62      47.982  61.126  41.624  1.00 71.03           C  
ATOM    467  CG  LEU A  62      46.562  61.055  42.163  1.00 70.27           C  
ATOM    468  CD1 LEU A  62      45.591  61.232  41.038  1.00 70.53           C  
ATOM    469  CD2 LEU A  62      46.338  59.716  42.838  1.00 70.25           C  
ATOM    470  N   ALA A  63      51.104  62.073  41.999  1.00 76.35           N  
ATOM    471  CA  ALA A  63      52.439  62.108  41.423  1.00 79.57           C  
ATOM    472  C   ALA A  63      53.310  60.948  41.905  1.00 81.86           C  
ATOM    473  O   ALA A  63      54.145  60.432  41.160  1.00 83.09           O  
ATOM    474  CB  ALA A  63      53.110  63.438  41.762  1.00 79.26           C  
ATOM    475  N   PHE A  64      53.102  60.526  43.145  1.00 84.06           N  
ATOM    476  CA  PHE A  64      53.897  59.450  43.716  1.00 86.26           C  
ATOM    477  C   PHE A  64      53.206  58.097  43.791  1.00 86.95           C  
ATOM    478  O   PHE A  64      53.817  57.112  44.183  1.00 87.20           O  
ATOM    479  CB  PHE A  64      54.360  59.861  45.111  1.00 87.78           C  
ATOM    480  CG  PHE A  64      55.270  61.058  45.115  1.00 88.63           C  
ATOM    481  CD1 PHE A  64      55.099  62.077  46.051  1.00 90.43           C  
ATOM    482  CD2 PHE A  64      56.291  61.170  44.182  1.00 87.88           C  
ATOM    483  CE1 PHE A  64      55.937  63.200  46.059  1.00 90.60           C  
ATOM    484  CE2 PHE A  64      57.123  62.273  44.180  1.00 89.14           C  
ATOM    485  CZ  PHE A  64      56.951  63.296  45.121  1.00 90.37           C  
ATOM    486  N   LYS A  65      51.934  58.040  43.425  1.00 88.45           N  
ATOM    487  CA  LYS A  65      51.221  56.773  43.487  1.00 90.30           C  
ATOM    488  C   LYS A  65      51.413  55.935  42.221  1.00 91.08           C  
ATOM    489  O   LYS A  65      50.507  55.199  41.797  1.00 90.21           O  
ATOM    490  CB  LYS A  65      49.729  57.005  43.761  1.00 91.55           C  
ATOM    491  CG  LYS A  65      49.429  57.873  44.997  1.00 92.51           C  
ATOM    492  CD  LYS A  65      50.245  57.465  46.226  1.00 92.92           C  
ATOM    493  CE  LYS A  65      50.174  58.523  47.335  1.00 93.79           C  
ATOM    494  NZ  LYS A  65      51.400  58.551  48.201  1.00 93.12           N  
ATOM    495  N   GLY A  66      52.599  56.075  41.621  1.00 91.46           N  
ATOM    496  CA  GLY A  66      52.951  55.310  40.436  1.00 91.50           C  
ATOM    497  C   GLY A  66      52.672  55.858  39.048  1.00 91.83           C  
ATOM    498  O   GLY A  66      51.715  56.604  38.828  1.00 91.01           O  
ATOM    499  N   THR A  67      53.526  55.455  38.106  1.00 93.04           N  
ATOM    500  CA  THR A  67      53.429  55.852  36.704  1.00 94.83           C  
ATOM    501  C   THR A  67      53.015  54.631  35.898  1.00 96.97           C  
ATOM    502  O   THR A  67      52.824  53.553  36.459  1.00 97.18           O  
ATOM    503  CB  THR A  67      54.780  56.321  36.144  1.00 94.46           C  
ATOM    504  OG1 THR A  67      55.594  55.180  35.855  1.00 93.86           O  
ATOM    505  CG2 THR A  67      55.503  57.204  37.153  1.00 95.38           C  
ATOM    506  N   LYS A  68      52.896  54.790  34.581  1.00 99.72           N  
ATOM    507  CA  LYS A  68      52.493  53.684  33.710  1.00101.92           C  
ATOM    508  C   LYS A  68      53.592  52.645  33.521  1.00102.60           C  
ATOM    509  O   LYS A  68      53.337  51.440  33.601  1.00102.94           O  
ATOM    510  CB  LYS A  68      52.044  54.210  32.343  1.00103.21           C  
ATOM    511  CG  LYS A  68      50.656  54.822  32.352  1.00105.33           C  
ATOM    512  CD  LYS A  68      50.273  55.368  30.989  1.00107.89           C  
ATOM    513  CE  LYS A  68      48.864  55.947  31.015  1.00109.74           C  
ATOM    514  NZ  LYS A  68      48.430  56.435  29.673  1.00112.11           N  
ATOM    515  N   LYS A  69      54.815  53.103  33.276  1.00102.77           N  
ATOM    516  CA  LYS A  69      55.925  52.179  33.084  1.00102.79           C  
ATOM    517  C   LYS A  69      56.139  51.307  34.335  1.00102.12           C  
ATOM    518  O   LYS A  69      56.712  50.219  34.247  1.00102.59           O  
ATOM    519  CB  LYS A  69      57.215  52.948  32.750  1.00104.19           C  
ATOM    520  CG  LYS A  69      58.297  52.105  32.045  1.00104.93           C  
ATOM    521  CD  LYS A  69      59.676  52.786  32.042  1.00105.97           C  
ATOM    522  CE  LYS A  69      59.699  54.124  31.282  1.00106.56           C  
ATOM    523  NZ  LYS A  69      60.972  54.914  31.495  1.00104.79           N  
ATOM    524  N   ARG A  70      55.675  51.776  35.494  1.00100.68           N  
ATOM    525  CA  ARG A  70      55.836  51.019  36.738  1.00 98.81           C  
ATOM    526  C   ARG A  70      54.857  51.451  37.832  1.00 98.25           C  
ATOM    527  O   ARG A  70      55.047  52.477  38.481  1.00 97.03           O  
ATOM    528  CB  ARG A  70      57.280  51.141  37.237  1.00 97.62           C  
ATOM    529  CG  ARG A  70      57.686  52.518  37.715  1.00 94.94           C  
ATOM    530  CD  ARG A  70      59.180  52.707  37.595  1.00 92.62           C  
ATOM    531  NE  ARG A  70      59.553  53.147  36.255  1.00 92.00           N  
ATOM    532  CZ  ARG A  70      60.792  53.473  35.892  1.00 92.54           C  
ATOM    533  NH1 ARG A  70      61.784  53.402  36.766  1.00 92.97           N  
ATOM    534  NH2 ARG A  70      61.041  53.889  34.658  1.00 92.51           N  
ATOM    535  N   PRO A  71      53.802  50.647  38.058  1.00 98.88           N  
ATOM    536  CA  PRO A  71      52.761  50.906  39.058  1.00 99.85           C  
ATOM    537  C   PRO A  71      53.241  51.176  40.487  1.00100.45           C  
ATOM    538  O   PRO A  71      54.433  51.074  40.785  1.00100.80           O  
ATOM    539  CB  PRO A  71      51.846  49.680  38.940  1.00 99.15           C  
ATOM    540  CG  PRO A  71      52.761  48.617  38.464  1.00 99.10           C  
ATOM    541  CD  PRO A  71      53.588  49.334  37.427  1.00 99.42           C  
ATOM    542  N   CYS A  72      52.285  51.532  41.348  1.00100.85           N  
ATOM    543  CA  CYS A  72      52.516  51.885  42.747  1.00100.63           C  
ATOM    544  C   CYS A  72      53.609  51.103  43.469  1.00 99.98           C  
ATOM    545  O   CYS A  72      54.721  51.608  43.647  1.00100.07           O  
ATOM    546  CB  CYS A  72      51.200  51.776  43.524  1.00101.19           C  
ATOM    547  SG  CYS A  72      51.173  52.748  45.044  1.00104.21           S  
ATOM    548  N   ALA A  73      53.282  49.883  43.894  1.00 98.94           N  
ATOM    549  CA  ALA A  73      54.219  49.010  44.605  1.00 97.40           C  
ATOM    550  C   ALA A  73      55.641  49.102  44.052  1.00 96.28           C  
ATOM    551  O   ALA A  73      56.595  49.384  44.782  1.00 95.46           O  
ATOM    552  CB  ALA A  73      53.732  47.569  44.534  1.00 97.27           C  
ATOM    553  N   ALA A  74      55.766  48.858  42.753  1.00 95.29           N  
ATOM    554  CA  ALA A  74      57.052  48.906  42.068  1.00 94.37           C  
ATOM    555  C   ALA A  74      57.771  50.232  42.273  1.00 93.75           C  
ATOM    556  O   ALA A  74      58.913  50.273  42.737  1.00 92.86           O  
ATOM    557  CB  ALA A  74      56.845  48.663  40.577  1.00 94.10           C  
ATOM    558  N   PHE A  75      57.093  51.314  41.908  1.00 93.62           N  
ATOM    559  CA  PHE A  75      57.663  52.640  42.029  1.00 93.66           C  
ATOM    560  C   PHE A  75      58.232  52.881  43.419  1.00 93.83           C  
ATOM    561  O   PHE A  75      59.430  53.121  43.572  1.00 94.19           O  
ATOM    562  CB  PHE A  75      56.612  53.711  41.701  1.00 93.70           C  
ATOM    563  CG  PHE A  75      57.148  55.121  41.762  1.00 94.49           C  
ATOM    564  CD1 PHE A  75      58.091  55.561  40.843  1.00 95.43           C  
ATOM    565  CD2 PHE A  75      56.754  55.992  42.773  1.00 94.32           C  
ATOM    566  CE1 PHE A  75      58.637  56.846  40.933  1.00 95.03           C  
ATOM    567  CE2 PHE A  75      57.294  57.274  42.868  1.00 93.04           C  
ATOM    568  CZ  PHE A  75      58.237  57.697  41.946  1.00 93.81           C  
ATOM    569  N   GLU A  76      57.379  52.804  44.433  1.00 94.04           N  
ATOM    570  CA  GLU A  76      57.815  53.048  45.804  1.00 94.38           C  
ATOM    571  C   GLU A  76      59.013  52.186  46.185  1.00 94.17           C  
ATOM    572  O   GLU A  76      60.074  52.691  46.573  1.00 93.25           O  
ATOM    573  CB  GLU A  76      56.658  52.791  46.775  1.00 94.69           C  
ATOM    574  CG  GLU A  76      55.451  53.687  46.555  1.00 95.12           C  
ATOM    575  CD  GLU A  76      54.363  53.464  47.583  1.00 95.83           C  
ATOM    576  OE1 GLU A  76      53.717  52.393  47.562  1.00 94.96           O  
ATOM    577  OE2 GLU A  76      54.161  54.367  48.417  1.00 97.33           O  
ATOM    578  N   LYS A  77      58.827  50.877  46.065  1.00 94.45           N  
ATOM    579  CA  LYS A  77      59.868  49.918  46.393  1.00 94.18           C  
ATOM    580  C   LYS A  77      61.175  50.244  45.682  1.00 93.41           C  
ATOM    581  O   LYS A  77      62.238  50.163  46.281  1.00 93.32           O  
ATOM    582  CB  LYS A  77      59.399  48.509  46.024  1.00 94.41           C  
ATOM    583  CG  LYS A  77      60.371  47.410  46.394  1.00 94.45           C  
ATOM    584  CD  LYS A  77      59.787  46.043  46.067  1.00 95.29           C  
ATOM    585  CE  LYS A  77      60.805  44.938  46.289  1.00 96.20           C  
ATOM    586  NZ  LYS A  77      60.257  43.610  45.905  1.00 96.93           N  
ATOM    587  N   GLU A  78      61.101  50.615  44.409  1.00 93.00           N  
ATOM    588  CA  GLU A  78      62.308  50.945  43.669  1.00 92.87           C  
ATOM    589  C   GLU A  78      63.027  52.152  44.263  1.00 93.96           C  
ATOM    590  O   GLU A  78      64.257  52.182  44.322  1.00 94.00           O  
ATOM    591  CB  GLU A  78      61.987  51.225  42.198  1.00 91.85           C  
ATOM    592  CG  GLU A  78      63.179  51.821  41.450  1.00 91.51           C  
ATOM    593  CD  GLU A  78      62.984  51.898  39.948  1.00 91.02           C  
ATOM    594  OE1 GLU A  78      63.941  52.329  39.257  1.00 89.99           O  
ATOM    595  OE2 GLU A  78      61.887  51.527  39.467  1.00 89.93           O  
ATOM    596  N   VAL A  79      62.258  53.145  44.705  1.00 95.58           N  
ATOM    597  CA  VAL A  79      62.829  54.366  45.278  1.00 96.61           C  
ATOM    598  C   VAL A  79      63.374  54.138  46.675  1.00 96.87           C  
ATOM    599  O   VAL A  79      64.499  54.532  46.997  1.00 96.08           O  
ATOM    600  CB  VAL A  79      61.787  55.488  45.366  1.00 96.39           C  
ATOM    601  CG1 VAL A  79      62.472  56.784  45.798  1.00 97.12           C  
ATOM    602  CG2 VAL A  79      61.085  55.655  44.025  1.00 96.16           C  
ATOM    603  N   GLU A  80      62.552  53.517  47.510  1.00 97.57           N  
ATOM    604  CA  GLU A  80      62.950  53.221  48.871  1.00 98.81           C  
ATOM    605  C   GLU A  80      64.256  52.432  48.846  1.00 99.30           C  
ATOM    606  O   GLU A  80      65.275  52.861  49.391  1.00 99.43           O  
ATOM    607  CB  GLU A  80      61.863  52.396  49.571  1.00 98.62           C  
ATOM    608  CG  GLU A  80      60.626  53.174  49.957  1.00 99.51           C  
ATOM    609  CD  GLU A  80      59.483  52.276  50.377  1.00100.33           C  
ATOM    610  OE1 GLU A  80      59.672  51.451  51.290  1.00100.80           O  
ATOM    611  OE2 GLU A  80      58.388  52.396  49.795  1.00101.45           O  
ATOM    612  N   SER A  81      64.212  51.282  48.179  1.00 99.87           N  
ATOM    613  CA  SER A  81      65.352  50.378  48.084  1.00 99.56           C  
ATOM    614  C   SER A  81      66.689  51.007  47.715  1.00 99.75           C  
ATOM    615  O   SER A  81      67.737  50.418  47.969  1.00100.90           O  
ATOM    616  CB  SER A  81      65.027  49.241  47.115  1.00 98.36           C  
ATOM    617  OG  SER A  81      64.622  49.759  45.867  1.00 97.99           O  
ATOM    618  N   MET A  82      66.674  52.191  47.119  1.00 99.80           N  
ATOM    619  CA  MET A  82      67.933  52.832  46.764  1.00100.11           C  
ATOM    620  C   MET A  82      68.307  53.936  47.750  1.00100.11           C  
ATOM    621  O   MET A  82      69.236  54.717  47.512  1.00 99.90           O  
ATOM    622  CB  MET A  82      67.864  53.375  45.341  1.00100.63           C  
ATOM    623  CG  MET A  82      66.687  54.266  45.058  1.00101.09           C  
ATOM    624  SD  MET A  82      66.605  54.588  43.298  1.00103.93           S  
ATOM    625  CE  MET A  82      68.196  55.426  43.032  1.00100.90           C  
ATOM    626  N   GLY A  83      67.574  53.972  48.864  1.00100.12           N  
ATOM    627  CA  GLY A  83      67.809  54.945  49.919  1.00 99.86           C  
ATOM    628  C   GLY A  83      67.516  56.385  49.555  1.00100.09           C  
ATOM    629  O   GLY A  83      67.901  57.296  50.293  1.00 99.70           O  
ATOM    630  N   ALA A  84      66.824  56.590  48.433  1.00100.29           N  
ATOM    631  CA  ALA A  84      66.490  57.929  47.951  1.00100.59           C  
ATOM    632  C   ALA A  84      65.210  58.498  48.561  1.00101.02           C  
ATOM    633  O   ALA A  84      64.279  57.758  48.880  1.00101.41           O  
ATOM    634  CB  ALA A  84      66.374  57.914  46.431  1.00 99.90           C  
ATOM    635  N   HIS A  85      65.173  59.823  48.711  1.00100.89           N  
ATOM    636  CA  HIS A  85      64.022  60.526  49.273  1.00 99.22           C  
ATOM    637  C   HIS A  85      63.257  61.278  48.209  1.00 97.55           C  
ATOM    638  O   HIS A  85      63.819  62.148  47.530  1.00 96.01           O  
ATOM    639  CB  HIS A  85      64.468  61.538  50.321  1.00101.18           C  
ATOM    640  CG  HIS A  85      64.932  60.920  51.599  1.00103.71           C  
ATOM    641  ND1 HIS A  85      65.563  61.644  52.588  1.00104.79           N  
ATOM    642  CD2 HIS A  85      64.854  59.648  52.054  1.00104.69           C  
ATOM    643  CE1 HIS A  85      65.856  60.842  53.597  1.00105.74           C  
ATOM    644  NE2 HIS A  85      65.437  59.626  53.298  1.00105.49           N  
ATOM    645  N   PHE A  86      61.977  60.948  48.068  1.00 96.12           N  
ATOM    646  CA  PHE A  86      61.150  61.639  47.094  1.00 95.48           C  
ATOM    647  C   PHE A  86      60.159  62.553  47.805  1.00 94.12           C  
ATOM    648  O   PHE A  86      59.408  62.118  48.681  1.00 93.59           O  
ATOM    649  CB  PHE A  86      60.385  60.664  46.190  1.00 95.64           C  
ATOM    650  CG  PHE A  86      60.149  61.201  44.798  1.00 96.99           C  
ATOM    651  CD1 PHE A  86      60.254  62.571  44.535  1.00 98.42           C  
ATOM    652  CD2 PHE A  86      59.829  60.349  43.749  1.00 98.06           C  
ATOM    653  CE1 PHE A  86      60.043  63.086  43.244  1.00 99.10           C  
ATOM    654  CE2 PHE A  86      59.614  60.853  42.452  1.00 99.20           C  
ATOM    655  CZ  PHE A  86      59.722  62.225  42.203  1.00 99.09           C  
ATOM    656  N   ASN A  87      60.181  63.827  47.418  1.00 92.30           N  
ATOM    657  CA  ASN A  87      59.301  64.834  47.988  1.00 90.17           C  
ATOM    658  C   ASN A  87      59.019  65.917  46.946  1.00 88.27           C  
ATOM    659  O   ASN A  87      59.629  65.952  45.873  1.00 88.82           O  
ATOM    660  CB  ASN A  87      59.951  65.453  49.235  1.00 90.76           C  
ATOM    661  CG  ASN A  87      58.987  66.312  50.040  1.00 90.58           C  
ATOM    662  OD1 ASN A  87      58.039  65.812  50.656  1.00 89.07           O  
ATOM    663  ND2 ASN A  87      59.225  67.616  50.036  1.00 91.50           N  
ATOM    664  N   GLY A  88      58.084  66.798  47.275  1.00 85.92           N  
ATOM    665  CA  GLY A  88      57.721  67.874  46.375  1.00 83.04           C  
ATOM    666  C   GLY A  88      56.600  68.721  46.946  1.00 80.26           C  
ATOM    667  O   GLY A  88      56.083  68.433  48.027  1.00 79.37           O  
ATOM    668  N   TYR A  89      56.216  69.761  46.216  1.00 78.08           N  
ATOM    669  CA  TYR A  89      55.156  70.643  46.668  1.00 76.02           C  
ATOM    670  C   TYR A  89      54.443  71.375  45.534  1.00 76.64           C  
ATOM    671  O   TYR A  89      54.701  71.135  44.349  1.00 77.31           O  
ATOM    672  CB  TYR A  89      55.731  71.654  47.646  1.00 73.07           C  
ATOM    673  CG  TYR A  89      56.707  72.629  47.028  1.00 69.95           C  
ATOM    674  CD1 TYR A  89      56.263  73.645  46.182  1.00 67.86           C  
ATOM    675  CD2 TYR A  89      58.068  72.552  47.311  1.00 67.61           C  
ATOM    676  CE1 TYR A  89      57.138  74.551  45.644  1.00 67.23           C  
ATOM    677  CE2 TYR A  89      58.954  73.456  46.774  1.00 66.74           C  
ATOM    678  CZ  TYR A  89      58.483  74.456  45.940  1.00 67.25           C  
ATOM    679  OH  TYR A  89      59.352  75.372  45.393  1.00 68.57           O  
ATOM    680  N   THR A  90      53.545  72.278  45.909  1.00 76.37           N  
ATOM    681  CA  THR A  90      52.798  73.037  44.926  1.00 75.83           C  
ATOM    682  C   THR A  90      52.165  74.271  45.573  1.00 75.99           C  
ATOM    683  O   THR A  90      51.322  74.148  46.458  1.00 76.63           O  
ATOM    684  CB  THR A  90      51.716  72.129  44.245  1.00 75.11           C  
ATOM    685  OG1 THR A  90      50.998  72.890  43.276  1.00 76.12           O  
ATOM    686  CG2 THR A  90      50.748  71.549  45.256  1.00 72.78           C  
ATOM    687  N   SER A  91      52.602  75.457  45.146  1.00 75.47           N  
ATOM    688  CA  SER A  91      52.074  76.726  45.660  1.00 74.25           C  
ATOM    689  C   SER A  91      51.128  77.374  44.635  1.00 73.27           C  
ATOM    690  O   SER A  91      50.594  76.706  43.744  1.00 72.98           O  
ATOM    691  CB  SER A  91      53.217  77.703  45.952  1.00 75.71           C  
ATOM    692  OG  SER A  91      53.525  78.510  44.810  1.00 76.41           O  
ATOM    693  N   ARG A  92      50.935  78.684  44.761  1.00 71.50           N  
ATOM    694  CA  ARG A  92      50.068  79.415  43.851  1.00 69.20           C  
ATOM    695  C   ARG A  92      50.681  79.576  42.457  1.00 68.49           C  
ATOM    696  O   ARG A  92      49.982  79.444  41.450  1.00 68.77           O  
ATOM    697  CB  ARG A  92      49.734  80.794  44.435  1.00 68.35           C  
ATOM    698  CG  ARG A  92      48.876  80.742  45.693  1.00 67.46           C  
ATOM    699  CD  ARG A  92      48.183  82.076  45.998  1.00 65.33           C  
ATOM    700  NE  ARG A  92      47.150  81.887  47.009  1.00 61.87           N  
ATOM    701  CZ  ARG A  92      47.398  81.696  48.300  1.00 61.88           C  
ATOM    702  NH1 ARG A  92      48.643  81.690  48.742  1.00 61.74           N  
ATOM    703  NH2 ARG A  92      46.405  81.464  49.145  1.00 63.25           N  
ATOM    704  N   GLU A  93      51.980  79.857  42.398  1.00 66.60           N  
ATOM    705  CA  GLU A  93      52.659  80.032  41.111  1.00 65.00           C  
ATOM    706  C   GLU A  93      53.865  79.111  40.873  1.00 64.69           C  
ATOM    707  O   GLU A  93      54.710  79.433  40.048  1.00 64.24           O  
ATOM    708  CB  GLU A  93      53.175  81.458  40.973  1.00 63.15           C  
ATOM    709  CG  GLU A  93      52.233  82.480  40.421  1.00 60.96           C  
ATOM    710  CD  GLU A  93      52.986  83.751  39.991  1.00 60.95           C  
ATOM    711  OE1 GLU A  93      54.078  84.039  40.546  1.00 60.26           O  
ATOM    712  OE2 GLU A  93      52.482  84.465  39.103  1.00 60.14           O  
ATOM    713  N   GLN A  94      53.966  77.980  41.563  1.00 64.11           N  
ATOM    714  CA  GLN A  94      55.140  77.130  41.377  1.00 63.30           C  
ATOM    715  C   GLN A  94      55.003  75.755  41.995  1.00 64.91           C  
ATOM    716  O   GLN A  94      54.681  75.636  43.173  1.00 67.09           O  
ATOM    717  CB  GLN A  94      56.357  77.826  41.987  1.00 60.02           C  
ATOM    718  CG  GLN A  94      57.653  77.072  41.886  1.00 58.34           C  
ATOM    719  CD  GLN A  94      58.848  77.899  42.368  1.00 59.12           C  
ATOM    720  OE1 GLN A  94      59.006  79.073  41.997  1.00 57.44           O  
ATOM    721  NE2 GLN A  94      59.703  77.282  43.188  1.00 56.06           N  
ATOM    722  N   THR A  95      55.245  74.712  41.204  1.00 66.19           N  
ATOM    723  CA  THR A  95      55.176  73.338  41.712  1.00 66.94           C  
ATOM    724  C   THR A  95      56.581  72.749  41.622  1.00 67.86           C  
ATOM    725  O   THR A  95      57.441  73.282  40.918  1.00 67.30           O  
ATOM    726  CB  THR A  95      54.226  72.431  40.885  1.00 66.19           C  
ATOM    727  OG1 THR A  95      52.902  72.980  40.867  1.00 66.93           O  
ATOM    728  CG2 THR A  95      54.171  71.038  41.499  1.00 63.86           C  
ATOM    729  N   ALA A  96      56.821  71.662  42.343  1.00 69.06           N  
ATOM    730  CA  ALA A  96      58.130  71.022  42.308  1.00 70.35           C  
ATOM    731  C   ALA A  96      58.132  69.597  42.877  1.00 71.51           C  
ATOM    732  O   ALA A  96      57.458  69.295  43.863  1.00 71.05           O  
ATOM    733  CB  ALA A  96      59.169  71.898  43.047  1.00 68.43           C  
ATOM    734  N   PHE A  97      58.871  68.717  42.208  1.00 73.39           N  
ATOM    735  CA  PHE A  97      59.035  67.335  42.639  1.00 75.14           C  
ATOM    736  C   PHE A  97      60.541  67.106  42.588  1.00 77.12           C  
ATOM    737  O   PHE A  97      61.164  67.285  41.541  1.00 77.38           O  
ATOM    738  CB  PHE A  97      58.334  66.386  41.685  1.00 73.91           C  
ATOM    739  CG  PHE A  97      56.876  66.659  41.531  1.00 73.73           C  
ATOM    740  CD1 PHE A  97      56.406  67.448  40.488  1.00 72.18           C  
ATOM    741  CD2 PHE A  97      55.962  66.109  42.427  1.00 74.20           C  
ATOM    742  CE1 PHE A  97      55.043  67.680  40.337  1.00 71.48           C  
ATOM    743  CE2 PHE A  97      54.594  66.335  42.288  1.00 73.33           C  
ATOM    744  CZ  PHE A  97      54.135  67.122  41.240  1.00 72.95           C  
ATOM    745  N   TYR A  98      61.138  66.734  43.711  1.00 78.99           N  
ATOM    746  CA  TYR A  98      62.576  66.536  43.725  1.00 82.34           C  
ATOM    747  C   TYR A  98      62.975  65.322  44.540  1.00 82.79           C  
ATOM    748  O   TYR A  98      62.195  64.836  45.361  1.00 81.75           O  
ATOM    749  CB  TYR A  98      63.264  67.788  44.267  1.00 85.92           C  
ATOM    750  CG  TYR A  98      62.815  68.152  45.660  1.00 90.21           C  
ATOM    751  CD1 TYR A  98      63.391  67.552  46.777  1.00 91.80           C  
ATOM    752  CD2 TYR A  98      61.774  69.059  45.862  1.00 90.67           C  
ATOM    753  CE1 TYR A  98      62.940  67.842  48.058  1.00 93.09           C  
ATOM    754  CE2 TYR A  98      61.314  69.355  47.138  1.00 91.22           C  
ATOM    755  CZ  TYR A  98      61.899  68.742  48.231  1.00 92.48           C  
ATOM    756  OH  TYR A  98      61.442  69.012  49.500  1.00 92.53           O  
ATOM    757  N   ILE A  99      64.197  64.840  44.303  1.00 83.73           N  
ATOM    758  CA  ILE A  99      64.711  63.666  44.997  1.00 83.42           C  
ATOM    759  C   ILE A  99      66.103  63.849  45.578  1.00 83.70           C  
ATOM    760  O   ILE A  99      66.955  64.546  45.018  1.00 82.59           O  
ATOM    761  CB  ILE A  99      64.745  62.439  44.069  1.00 82.76           C  
ATOM    762  CG1 ILE A  99      63.343  62.148  43.544  1.00 82.83           C  
ATOM    763  CG2 ILE A  99      65.248  61.230  44.825  1.00 83.62           C  
ATOM    764  CD1 ILE A  99      63.250  60.892  42.714  1.00 82.94           C  
ATOM    765  N   LYS A 100      66.307  63.210  46.722  1.00 84.39           N  
ATOM    766  CA  LYS A 100      67.577  63.242  47.420  1.00 86.27           C  
ATOM    767  C   LYS A 100      68.157  61.833  47.384  1.00 88.09           C  
ATOM    768  O   LYS A 100      67.569  60.903  47.947  1.00 87.68           O  
ATOM    769  CB  LYS A 100      67.379  63.643  48.879  1.00 86.08           C  
ATOM    770  CG  LYS A 100      66.900  65.057  49.112  1.00 86.05           C  
ATOM    771  CD  LYS A 100      66.691  65.309  50.605  1.00 86.07           C  
ATOM    772  CE  LYS A 100      67.985  65.217  51.405  1.00 85.50           C  
ATOM    773  NZ  LYS A 100      68.950  66.298  51.059  1.00 86.52           N  
ATOM    774  N   ALA A 101      69.308  61.678  46.730  1.00 89.95           N  
ATOM    775  CA  ALA A 101      69.972  60.377  46.633  1.00 89.76           C  
ATOM    776  C   ALA A 101      71.470  60.556  46.515  1.00 89.77           C  
ATOM    777  O   ALA A 101      71.986  61.664  46.655  1.00 89.05           O  
ATOM    778  CB  ALA A 101      69.454  59.609  45.430  1.00 89.05           C  
ATOM    779  N   LEU A 102      72.161  59.451  46.255  1.00 90.88           N  
ATOM    780  CA  LEU A 102      73.613  59.463  46.102  1.00 91.81           C  
ATOM    781  C   LEU A 102      73.957  59.958  44.693  1.00 92.08           C  
ATOM    782  O   LEU A 102      73.281  59.599  43.723  1.00 92.06           O  
ATOM    783  CB  LEU A 102      74.170  58.050  46.304  1.00 91.93           C  
ATOM    784  CG  LEU A 102      73.781  57.333  47.604  1.00 92.27           C  
ATOM    785  CD1 LEU A 102      74.133  55.846  47.527  1.00 90.89           C  
ATOM    786  CD2 LEU A 102      74.484  58.010  48.776  1.00 91.78           C  
ATOM    787  N   SER A 103      75.005  60.774  44.585  1.00 91.67           N  
ATOM    788  CA  SER A 103      75.434  61.321  43.297  1.00 91.22           C  
ATOM    789  C   SER A 103      75.538  60.220  42.241  1.00 92.54           C  
ATOM    790  O   SER A 103      75.475  60.479  41.041  1.00 91.85           O  
ATOM    791  CB  SER A 103      76.784  62.017  43.463  1.00 89.85           C  
ATOM    792  OG  SER A 103      76.730  63.003  44.482  1.00 87.36           O  
ATOM    793  N   LYS A 104      75.700  58.990  42.719  1.00 94.94           N  
ATOM    794  CA  LYS A 104      75.819  57.802  41.886  1.00 96.82           C  
ATOM    795  C   LYS A 104      74.546  57.558  41.085  1.00 97.62           C  
ATOM    796  O   LYS A 104      74.592  57.341  39.873  1.00 97.93           O  
ATOM    797  CB  LYS A 104      76.113  56.581  42.775  1.00 98.23           C  
ATOM    798  CG  LYS A 104      76.051  55.223  42.062  1.00101.52           C  
ATOM    799  CD  LYS A 104      76.264  54.024  43.016  1.00103.37           C  
ATOM    800  CE  LYS A 104      75.071  53.784  43.952  1.00104.68           C  
ATOM    801  NZ  LYS A 104      75.254  52.609  44.864  1.00104.67           N  
ATOM    802  N   ASP A 105      73.408  57.601  41.768  1.00 98.63           N  
ATOM    803  CA  ASP A 105      72.123  57.347  41.128  1.00 99.86           C  
ATOM    804  C   ASP A 105      71.576  58.528  40.332  1.00 99.10           C  
ATOM    805  O   ASP A 105      70.499  58.435  39.743  1.00 98.64           O  
ATOM    806  CB  ASP A 105      71.099  56.926  42.183  1.00102.89           C  
ATOM    807  CG  ASP A 105      71.659  55.912  43.171  1.00105.77           C  
ATOM    808  OD1 ASP A 105      72.330  54.958  42.713  1.00106.57           O  
ATOM    809  OD2 ASP A 105      71.422  56.066  44.397  1.00107.41           O  
ATOM    810  N   MET A 106      72.323  59.627  40.312  1.00 98.49           N  
ATOM    811  CA  MET A 106      71.917  60.834  39.599  1.00 98.21           C  
ATOM    812  C   MET A 106      71.163  60.554  38.300  1.00 97.85           C  
ATOM    813  O   MET A 106      70.122  61.153  38.042  1.00 97.87           O  
ATOM    814  CB  MET A 106      73.142  61.703  39.333  1.00 99.40           C  
ATOM    815  CG  MET A 106      72.881  62.914  38.479  1.00100.67           C  
ATOM    816  SD  MET A 106      73.261  62.572  36.771  1.00104.14           S  
ATOM    817  CE  MET A 106      71.676  62.682  36.033  1.00103.68           C  
ATOM    818  N   PRO A 107      71.679  59.647  37.459  1.00 97.55           N  
ATOM    819  CA  PRO A 107      70.995  59.331  36.202  1.00 96.71           C  
ATOM    820  C   PRO A 107      69.686  58.551  36.385  1.00 95.63           C  
ATOM    821  O   PRO A 107      68.678  58.872  35.759  1.00 95.06           O  
ATOM    822  CB  PRO A 107      72.046  58.535  35.432  1.00 97.16           C  
ATOM    823  CG  PRO A 107      72.822  57.861  36.529  1.00 97.75           C  
ATOM    824  CD  PRO A 107      73.000  58.994  37.507  1.00 97.76           C  
ATOM    825  N   LYS A 108      69.704  57.524  37.234  1.00 95.22           N  
ATOM    826  CA  LYS A 108      68.500  56.722  37.479  1.00 94.49           C  
ATOM    827  C   LYS A 108      67.434  57.606  38.113  1.00 93.38           C  
ATOM    828  O   LYS A 108      66.232  57.394  37.925  1.00 93.51           O  
ATOM    829  CB  LYS A 108      68.808  55.539  38.412  1.00 95.12           C  
ATOM    830  CG  LYS A 108      67.566  54.795  38.953  1.00 95.20           C  
ATOM    831  CD  LYS A 108      67.142  53.575  38.111  1.00 94.97           C  
ATOM    832  CE  LYS A 108      66.774  53.927  36.663  1.00 94.08           C  
ATOM    833  NZ  LYS A 108      66.276  52.739  35.894  1.00 91.74           N  
ATOM    834  N   VAL A 109      67.881  58.595  38.877  1.00 90.92           N  
ATOM    835  CA  VAL A 109      66.950  59.506  39.506  1.00 89.15           C  
ATOM    836  C   VAL A 109      66.237  60.220  38.364  1.00 87.97           C  
ATOM    837  O   VAL A 109      65.020  60.107  38.205  1.00 87.24           O  
ATOM    838  CB  VAL A 109      67.692  60.547  40.381  1.00 90.00           C  
ATOM    839  CG1 VAL A 109      66.697  61.458  41.087  1.00 90.24           C  
ATOM    840  CG2 VAL A 109      68.551  59.842  41.403  1.00 90.27           C  
ATOM    841  N   VAL A 110      67.018  60.924  37.549  1.00 86.17           N  
ATOM    842  CA  VAL A 110      66.481  61.675  36.429  1.00 84.82           C  
ATOM    843  C   VAL A 110      65.436  60.926  35.644  1.00 85.36           C  
ATOM    844  O   VAL A 110      64.478  61.525  35.166  1.00 85.56           O  
ATOM    845  CB  VAL A 110      67.567  62.085  35.453  1.00 83.68           C  
ATOM    846  CG1 VAL A 110      66.950  62.879  34.328  1.00 83.43           C  
ATOM    847  CG2 VAL A 110      68.616  62.912  36.160  1.00 83.52           C  
ATOM    848  N   GLU A 111      65.621  59.620  35.495  1.00 86.74           N  
ATOM    849  CA  GLU A 111      64.659  58.822  34.746  1.00 88.64           C  
ATOM    850  C   GLU A 111      63.344  58.770  35.510  1.00 88.76           C  
ATOM    851  O   GLU A 111      62.256  58.859  34.922  1.00 89.52           O  
ATOM    852  CB  GLU A 111      65.167  57.393  34.525  1.00 89.76           C  
ATOM    853  CG  GLU A 111      64.290  56.603  33.542  1.00 93.12           C  
ATOM    854  CD  GLU A 111      64.501  55.098  33.617  1.00 95.09           C  
ATOM    855  OE1 GLU A 111      65.671  54.658  33.628  1.00 96.66           O  
ATOM    856  OE2 GLU A 111      63.496  54.352  33.657  1.00 95.70           O  
ATOM    857  N   LEU A 112      63.452  58.614  36.827  1.00 87.65           N  
ATOM    858  CA  LEU A 112      62.273  58.554  37.675  1.00 85.87           C  
ATOM    859  C   LEU A 112      61.503  59.870  37.601  1.00 84.90           C  
ATOM    860  O   LEU A 112      60.283  59.872  37.412  1.00 84.62           O  
ATOM    861  CB  LEU A 112      62.685  58.244  39.110  1.00 84.53           C  
ATOM    862  CG  LEU A 112      63.150  56.804  39.288  1.00 82.86           C  
ATOM    863  CD1 LEU A 112      63.701  56.620  40.693  1.00 82.69           C  
ATOM    864  CD2 LEU A 112      61.979  55.864  39.017  1.00 80.46           C  
ATOM    865  N   LEU A 113      62.220  60.983  37.745  1.00 83.14           N  
ATOM    866  CA  LEU A 113      61.596  62.292  37.662  1.00 82.27           C  
ATOM    867  C   LEU A 113      60.784  62.321  36.374  1.00 82.55           C  
ATOM    868  O   LEU A 113      59.552  62.303  36.391  1.00 82.38           O  
ATOM    869  CB  LEU A 113      62.659  63.384  37.610  1.00 81.43           C  
ATOM    870  CG  LEU A 113      63.534  63.571  38.847  1.00 81.76           C  
ATOM    871  CD1 LEU A 113      64.597  64.627  38.545  1.00 81.41           C  
ATOM    872  CD2 LEU A 113      62.670  63.980  40.045  1.00 81.09           C  
ATOM    873  N   ALA A 114      61.498  62.352  35.257  1.00 82.59           N  
ATOM    874  CA  ALA A 114      60.882  62.376  33.943  1.00 83.24           C  
ATOM    875  C   ALA A 114      59.688  61.438  33.859  1.00 83.88           C  
ATOM    876  O   ALA A 114      58.692  61.738  33.210  1.00 84.25           O  
ATOM    877  CB  ALA A 114      61.903  61.996  32.898  1.00 83.02           C  
ATOM    878  N   ASP A 115      59.787  60.295  34.516  1.00 85.23           N  
ATOM    879  CA  ASP A 115      58.703  59.333  34.469  1.00 87.09           C  
ATOM    880  C   ASP A 115      57.467  59.831  35.221  1.00 87.33           C  
ATOM    881  O   ASP A 115      56.333  59.515  34.850  1.00 86.63           O  
ATOM    882  CB  ASP A 115      59.183  57.994  35.043  1.00 88.84           C  
ATOM    883  CG  ASP A 115      58.200  56.859  34.784  1.00 91.33           C  
ATOM    884  OD1 ASP A 115      57.786  56.676  33.620  1.00 93.47           O  
ATOM    885  OD2 ASP A 115      57.840  56.139  35.739  1.00 91.88           O  
ATOM    886  N   VAL A 116      57.688  60.627  36.261  1.00 87.50           N  
ATOM    887  CA  VAL A 116      56.593  61.144  37.074  1.00 88.25           C  
ATOM    888  C   VAL A 116      55.846  62.300  36.437  1.00 87.97           C  
ATOM    889  O   VAL A 116      54.615  62.275  36.337  1.00 87.53           O  
ATOM    890  CB  VAL A 116      57.097  61.618  38.446  1.00 89.25           C  
ATOM    891  CG1 VAL A 116      55.917  61.906  39.348  1.00 90.20           C  
ATOM    892  CG2 VAL A 116      58.012  60.566  39.066  1.00 90.26           C  
ATOM    893  N   VAL A 117      56.594  63.319  36.026  1.00 88.17           N  
ATOM    894  CA  VAL A 117      56.000  64.496  35.408  1.00 90.11           C  
ATOM    895  C   VAL A 117      55.363  64.154  34.066  1.00 91.74           C  
ATOM    896  O   VAL A 117      54.322  64.699  33.713  1.00 92.75           O  
ATOM    897  CB  VAL A 117      57.048  65.640  35.180  1.00 90.05           C  
ATOM    898  CG1 VAL A 117      57.765  65.979  36.465  1.00 90.61           C  
ATOM    899  CG2 VAL A 117      58.050  65.242  34.134  1.00 91.32           C  
ATOM    900  N   GLN A 118      55.982  63.235  33.329  1.00 93.68           N  
ATOM    901  CA  GLN A 118      55.500  62.834  32.012  1.00 94.99           C  
ATOM    902  C   GLN A 118      54.528  61.668  31.974  1.00 95.95           C  
ATOM    903  O   GLN A 118      53.612  61.670  31.154  1.00 96.44           O  
ATOM    904  CB  GLN A 118      56.681  62.501  31.101  1.00 96.18           C  
ATOM    905  CG  GLN A 118      57.455  63.711  30.607  1.00 99.60           C  
ATOM    906  CD  GLN A 118      58.722  63.345  29.831  1.00101.87           C  
ATOM    907  OE1 GLN A 118      59.288  64.182  29.113  1.00103.45           O  
ATOM    908  NE2 GLN A 118      59.179  62.101  29.982  1.00102.70           N  
ATOM    909  N   ASN A 119      54.711  60.682  32.853  1.00 97.10           N  
ATOM    910  CA  ASN A 119      53.851  59.488  32.846  1.00 98.36           C  
ATOM    911  C   ASN A 119      52.966  59.174  34.045  1.00 97.22           C  
ATOM    912  O   ASN A 119      52.744  58.003  34.340  1.00 96.87           O  
ATOM    913  CB  ASN A 119      54.707  58.242  32.572  1.00100.74           C  
ATOM    914  CG  ASN A 119      55.221  58.185  31.148  1.00102.00           C  
ATOM    915  OD1 ASN A 119      54.461  57.908  30.207  1.00101.90           O  
ATOM    916  ND2 ASN A 119      56.516  58.459  30.977  1.00101.90           N  
ATOM    917  N   CYS A 120      52.436  60.178  34.728  1.00 96.96           N  
ATOM    918  CA  CYS A 120      51.605  59.873  35.887  1.00 96.10           C  
ATOM    919  C   CYS A 120      50.509  58.859  35.558  1.00 93.69           C  
ATOM    920  O   CYS A 120      49.759  59.037  34.605  1.00 92.23           O  
ATOM    921  CB  CYS A 120      50.983  61.143  36.454  1.00 97.56           C  
ATOM    922  SG  CYS A 120      49.970  60.791  37.906  1.00101.46           S  
ATOM    923  N   ALA A 121      50.424  57.799  36.359  1.00 92.82           N  
ATOM    924  CA  ALA A 121      49.436  56.739  36.150  1.00 93.25           C  
ATOM    925  C   ALA A 121      47.988  57.212  36.195  1.00 93.71           C  
ATOM    926  O   ALA A 121      47.193  56.871  35.326  1.00 93.55           O  
ATOM    927  CB  ALA A 121      49.637  55.626  37.172  1.00 92.18           C  
ATOM    928  N   LEU A 122      47.645  57.991  37.214  1.00 94.39           N  
ATOM    929  CA  LEU A 122      46.283  58.495  37.362  1.00 94.05           C  
ATOM    930  C   LEU A 122      45.305  57.334  37.386  1.00 94.20           C  
ATOM    931  O   LEU A 122      44.307  57.331  36.668  1.00 94.48           O  
ATOM    932  CB  LEU A 122      45.926  59.440  36.214  1.00 93.75           C  
ATOM    933  CG  LEU A 122      46.805  60.681  36.028  1.00 93.93           C  
ATOM    934  CD1 LEU A 122      46.287  61.480  34.853  1.00 93.45           C  
ATOM    935  CD2 LEU A 122      46.799  61.537  37.285  1.00 93.63           C  
ATOM    936  N   GLU A 123      45.607  56.346  38.215  1.00 94.42           N  
ATOM    937  CA  GLU A 123      44.762  55.175  38.346  1.00 96.16           C  
ATOM    938  C   GLU A 123      43.388  55.573  38.876  1.00 95.87           C  
ATOM    939  O   GLU A 123      43.278  56.119  39.965  1.00 95.62           O  
ATOM    940  CB  GLU A 123      45.415  54.176  39.305  1.00 98.70           C  
ATOM    941  CG  GLU A 123      44.762  52.800  39.330  1.00101.03           C  
ATOM    942  CD  GLU A 123      45.010  52.005  38.055  1.00103.21           C  
ATOM    943  OE1 GLU A 123      44.446  50.893  37.941  1.00105.06           O  
ATOM    944  OE2 GLU A 123      45.767  52.480  37.171  1.00103.65           O  
ATOM    945  N   GLU A 124      42.345  55.286  38.105  1.00 96.17           N  
ATOM    946  CA  GLU A 124      40.976  55.618  38.493  1.00 96.89           C  
ATOM    947  C   GLU A 124      40.633  55.195  39.923  1.00 95.93           C  
ATOM    948  O   GLU A 124      39.815  55.833  40.588  1.00 95.86           O  
ATOM    949  CB  GLU A 124      39.984  54.962  37.525  1.00 99.71           C  
ATOM    950  CG  GLU A 124      38.537  55.457  37.654  1.00103.37           C  
ATOM    951  CD  GLU A 124      38.331  56.843  37.051  1.00106.69           C  
ATOM    952  OE1 GLU A 124      38.603  57.006  35.836  1.00108.22           O  
ATOM    953  OE2 GLU A 124      37.898  57.767  37.787  1.00107.87           O  
ATOM    954  N   SER A 125      41.251  54.117  40.392  1.00 94.74           N  
ATOM    955  CA  SER A 125      40.987  53.623  41.742  1.00 93.75           C  
ATOM    956  C   SER A 125      41.729  54.424  42.809  1.00 92.46           C  
ATOM    957  O   SER A 125      41.270  54.535  43.943  1.00 92.53           O  
ATOM    958  CB  SER A 125      41.364  52.135  41.850  1.00 94.25           C  
ATOM    959  OG  SER A 125      42.740  51.908  41.581  1.00 94.69           O  
ATOM    960  N   GLN A 126      42.878  54.977  42.432  1.00 90.85           N  
ATOM    961  CA  GLN A 126      43.703  55.770  43.334  1.00 89.25           C  
ATOM    962  C   GLN A 126      43.028  57.110  43.597  1.00 88.29           C  
ATOM    963  O   GLN A 126      43.009  57.611  44.717  1.00 88.76           O  
ATOM    964  CB  GLN A 126      45.070  56.019  42.699  1.00 89.69           C  
ATOM    965  CG  GLN A 126      46.114  56.569  43.649  1.00 90.19           C  
ATOM    966  CD  GLN A 126      46.640  55.512  44.603  1.00 90.99           C  
ATOM    967  OE1 GLN A 126      47.112  54.450  44.176  1.00 91.17           O  
ATOM    968  NE2 GLN A 126      46.567  55.796  45.901  1.00 90.98           N  
ATOM    969  N   ILE A 127      42.473  57.688  42.546  1.00 86.52           N  
ATOM    970  CA  ILE A 127      41.803  58.964  42.653  1.00 85.34           C  
ATOM    971  C   ILE A 127      40.687  58.977  43.685  1.00 85.87           C  
ATOM    972  O   ILE A 127      40.491  59.973  44.359  1.00 87.00           O  
ATOM    973  CB  ILE A 127      41.263  59.386  41.284  1.00 84.42           C  
ATOM    974  CG1 ILE A 127      42.452  59.726  40.384  1.00 84.12           C  
ATOM    975  CG2 ILE A 127      40.309  60.568  41.417  1.00 82.95           C  
ATOM    976  CD1 ILE A 127      42.097  59.990  38.950  1.00 83.53           C  
ATOM    977  N   GLU A 128      39.957  57.883  43.829  1.00 86.60           N  
ATOM    978  CA  GLU A 128      38.883  57.853  44.812  1.00 88.19           C  
ATOM    979  C   GLU A 128      39.403  57.716  46.238  1.00 89.56           C  
ATOM    980  O   GLU A 128      38.636  57.747  47.202  1.00 90.63           O  
ATOM    981  CB  GLU A 128      37.918  56.715  44.505  1.00 88.47           C  
ATOM    982  CG  GLU A 128      37.238  56.862  43.160  1.00 90.90           C  
ATOM    983  CD  GLU A 128      36.693  58.266  42.927  1.00 92.10           C  
ATOM    984  OE1 GLU A 128      35.955  58.773  43.804  1.00 92.60           O  
ATOM    985  OE2 GLU A 128      37.002  58.859  41.866  1.00 92.58           O  
ATOM    986  N   LYS A 129      40.714  57.571  46.380  1.00 90.62           N  
ATOM    987  CA  LYS A 129      41.309  57.430  47.702  1.00 91.02           C  
ATOM    988  C   LYS A 129      41.935  58.754  48.131  1.00 89.70           C  
ATOM    989  O   LYS A 129      41.735  59.199  49.261  1.00 90.45           O  
ATOM    990  CB  LYS A 129      42.360  56.315  47.692  1.00 93.32           C  
ATOM    991  CG  LYS A 129      42.967  56.011  49.052  1.00 96.42           C  
ATOM    992  CD  LYS A 129      44.053  54.949  48.938  1.00 98.60           C  
ATOM    993  CE  LYS A 129      44.800  54.780  50.254  1.00 99.99           C  
ATOM    994  NZ  LYS A 129      45.925  53.806  50.127  1.00100.65           N  
ATOM    995  N   GLU A 130      42.685  59.380  47.224  1.00 86.97           N  
ATOM    996  CA  GLU A 130      43.323  60.665  47.499  1.00 84.83           C  
ATOM    997  C   GLU A 130      42.264  61.762  47.689  1.00 82.97           C  
ATOM    998  O   GLU A 130      42.520  62.802  48.291  1.00 82.33           O  
ATOM    999  CB  GLU A 130      44.264  61.028  46.352  1.00 85.31           C  
ATOM   1000  CG  GLU A 130      45.319  59.970  46.088  1.00 87.14           C  
ATOM   1001  CD  GLU A 130      46.177  59.675  47.308  1.00 88.72           C  
ATOM   1002  OE1 GLU A 130      46.837  60.620  47.800  1.00 89.49           O  
ATOM   1003  OE2 GLU A 130      46.193  58.504  47.770  1.00 88.31           O  
ATOM   1004  N   ARG A 131      41.075  61.516  47.154  1.00 80.79           N  
ATOM   1005  CA  ARG A 131      39.951  62.430  47.271  1.00 77.77           C  
ATOM   1006  C   ARG A 131      39.539  62.449  48.733  1.00 76.89           C  
ATOM   1007  O   ARG A 131      39.312  63.507  49.307  1.00 76.21           O  
ATOM   1008  CB  ARG A 131      38.807  61.921  46.398  1.00 78.55           C  
ATOM   1009  CG  ARG A 131      37.401  62.402  46.750  1.00 77.36           C  
ATOM   1010  CD  ARG A 131      36.483  62.107  45.580  1.00 75.64           C  
ATOM   1011  NE  ARG A 131      37.030  62.696  44.355  1.00 73.84           N  
ATOM   1012  CZ  ARG A 131      36.597  62.430  43.128  1.00 72.98           C  
ATOM   1013  NH1 ARG A 131      35.603  61.578  42.938  1.00 72.39           N  
ATOM   1014  NH2 ARG A 131      37.160  63.024  42.088  1.00 74.01           N  
ATOM   1015  N   GLY A 132      39.442  61.264  49.326  1.00 76.30           N  
ATOM   1016  CA  GLY A 132      39.079  61.165  50.725  1.00 75.54           C  
ATOM   1017  C   GLY A 132      40.183  61.728  51.603  1.00 74.67           C  
ATOM   1018  O   GLY A 132      39.907  62.388  52.603  1.00 76.07           O  
ATOM   1019  N   VAL A 133      41.434  61.467  51.224  1.00 73.23           N  
ATOM   1020  CA  VAL A 133      42.605  61.945  51.966  1.00 70.87           C  
ATOM   1021  C   VAL A 133      42.731  63.458  51.911  1.00 69.67           C  
ATOM   1022  O   VAL A 133      42.961  64.113  52.930  1.00 68.68           O  
ATOM   1023  CB  VAL A 133      43.913  61.335  51.410  1.00 70.57           C  
ATOM   1024  CG1 VAL A 133      45.115  62.182  51.833  1.00 69.31           C  
ATOM   1025  CG2 VAL A 133      44.070  59.906  51.911  1.00 70.42           C  
ATOM   1026  N   ILE A 134      42.607  64.009  50.709  1.00 68.82           N  
ATOM   1027  CA  ILE A 134      42.695  65.446  50.546  1.00 68.61           C  
ATOM   1028  C   ILE A 134      41.632  66.089  51.421  1.00 69.16           C  
ATOM   1029  O   ILE A 134      41.926  67.019  52.165  1.00 70.11           O  
ATOM   1030  CB  ILE A 134      42.489  65.856  49.085  1.00 68.58           C  
ATOM   1031  CG1 ILE A 134      43.715  65.454  48.262  1.00 69.41           C  
ATOM   1032  CG2 ILE A 134      42.258  67.336  48.994  1.00 67.53           C  
ATOM   1033  CD1 ILE A 134      43.717  65.986  46.838  1.00 70.33           C  
ATOM   1034  N   LEU A 135      40.401  65.583  51.356  1.00 68.98           N  
ATOM   1035  CA  LEU A 135      39.321  66.123  52.178  1.00 68.94           C  
ATOM   1036  C   LEU A 135      39.666  66.104  53.670  1.00 69.73           C  
ATOM   1037  O   LEU A 135      39.126  66.879  54.456  1.00 69.98           O  
ATOM   1038  CB  LEU A 135      38.027  65.348  51.945  1.00 67.97           C  
ATOM   1039  CG  LEU A 135      37.239  65.611  50.658  1.00 67.04           C  
ATOM   1040  CD1 LEU A 135      35.847  65.024  50.840  1.00 66.68           C  
ATOM   1041  CD2 LEU A 135      37.130  67.097  50.364  1.00 64.97           C  
ATOM   1042  N   GLN A 136      40.558  65.201  54.053  1.00 71.22           N  
ATOM   1043  CA  GLN A 136      41.002  65.099  55.427  1.00 72.03           C  
ATOM   1044  C   GLN A 136      41.956  66.229  55.697  1.00 71.95           C  
ATOM   1045  O   GLN A 136      41.756  67.013  56.612  1.00 72.81           O  
ATOM   1046  CB  GLN A 136      41.730  63.788  55.658  1.00 75.26           C  
ATOM   1047  CG  GLN A 136      40.811  62.682  56.027  1.00 81.85           C  
ATOM   1048  CD  GLN A 136      39.866  63.121  57.121  1.00 87.35           C  
ATOM   1049  OE1 GLN A 136      40.302  63.507  58.216  1.00 89.97           O  
ATOM   1050  NE2 GLN A 136      38.559  63.083  56.833  1.00 89.37           N  
ATOM   1051  N   GLU A 137      43.001  66.316  54.889  1.00 70.98           N  
ATOM   1052  CA  GLU A 137      43.997  67.355  55.067  1.00 71.47           C  
ATOM   1053  C   GLU A 137      43.366  68.743  55.103  1.00 71.14           C  
ATOM   1054  O   GLU A 137      43.907  69.674  55.708  1.00 71.24           O  
ATOM   1055  CB  GLU A 137      45.024  67.276  53.949  1.00 72.58           C  
ATOM   1056  CG  GLU A 137      45.465  65.873  53.655  1.00 75.50           C  
ATOM   1057  CD  GLU A 137      46.655  65.843  52.732  1.00 78.10           C  
ATOM   1058  OE1 GLU A 137      46.711  66.723  51.843  1.00 77.88           O  
ATOM   1059  OE2 GLU A 137      47.516  64.941  52.891  1.00 79.20           O  
ATOM   1060  N   LEU A 138      42.219  68.888  54.451  1.00 69.75           N  
ATOM   1061  CA  LEU A 138      41.562  70.175  54.447  1.00 68.54           C  
ATOM   1062  C   LEU A 138      41.072  70.450  55.851  1.00 68.90           C  
ATOM   1063  O   LEU A 138      41.304  71.535  56.376  1.00 68.67           O  
ATOM   1064  CB  LEU A 138      40.381  70.201  53.472  1.00 66.84           C  
ATOM   1065  CG  LEU A 138      40.647  70.356  51.974  1.00 64.12           C  
ATOM   1066  CD1 LEU A 138      39.376  70.842  51.318  1.00 62.42           C  
ATOM   1067  CD2 LEU A 138      41.758  71.345  51.719  1.00 63.22           C  
ATOM   1068  N   LYS A 139      40.402  69.466  56.453  1.00 69.51           N  
ATOM   1069  CA  LYS A 139      39.876  69.609  57.810  1.00 70.88           C  
ATOM   1070  C   LYS A 139      40.986  69.824  58.802  1.00 70.82           C  
ATOM   1071  O   LYS A 139      40.782  70.491  59.806  1.00 70.98           O  
ATOM   1072  CB  LYS A 139      39.051  68.390  58.235  1.00 73.23           C  
ATOM   1073  CG  LYS A 139      37.671  68.324  57.583  1.00 78.16           C  
ATOM   1074  CD  LYS A 139      36.929  67.020  57.904  1.00 81.20           C  
ATOM   1075  CE  LYS A 139      35.735  66.806  56.953  1.00 82.88           C  
ATOM   1076  NZ  LYS A 139      35.185  65.406  56.984  1.00 81.54           N  
ATOM   1077  N   GLU A 140      42.155  69.248  58.536  1.00 71.91           N  
ATOM   1078  CA  GLU A 140      43.290  69.436  59.430  1.00 72.75           C  
ATOM   1079  C   GLU A 140      43.763  70.864  59.235  1.00 71.09           C  
ATOM   1080  O   GLU A 140      43.657  71.678  60.136  1.00 71.63           O  
ATOM   1081  CB  GLU A 140      44.446  68.496  59.094  1.00 77.02           C  
ATOM   1082  CG  GLU A 140      44.184  66.998  59.251  1.00 82.91           C  
ATOM   1083  CD  GLU A 140      45.408  66.147  58.846  1.00 86.71           C  
ATOM   1084  OE1 GLU A 140      45.977  66.364  57.741  1.00 87.43           O  
ATOM   1085  OE2 GLU A 140      45.801  65.259  59.633  1.00 88.54           O  
ATOM   1086  N   MET A 141      44.264  71.171  58.044  1.00 69.76           N  
ATOM   1087  CA  MET A 141      44.763  72.513  57.749  1.00 70.08           C  
ATOM   1088  C   MET A 141      43.824  73.631  58.179  1.00 69.36           C  
ATOM   1089  O   MET A 141      44.238  74.781  58.361  1.00 69.51           O  
ATOM   1090  CB  MET A 141      45.030  72.655  56.260  1.00 71.63           C  
ATOM   1091  CG  MET A 141      45.902  71.574  55.723  1.00 74.71           C  
ATOM   1092  SD  MET A 141      46.021  71.695  53.959  1.00 79.55           S  
ATOM   1093  CE  MET A 141      47.742  72.351  53.792  1.00 78.80           C  
ATOM   1094  N   ASP A 142      42.553  73.298  58.334  1.00 68.20           N  
ATOM   1095  CA  ASP A 142      41.572  74.290  58.725  1.00 66.42           C  
ATOM   1096  C   ASP A 142      41.853  74.716  60.145  1.00 65.15           C  
ATOM   1097  O   ASP A 142      41.489  75.806  60.553  1.00 66.03           O  
ATOM   1098  CB  ASP A 142      40.168  73.700  58.609  1.00 66.94           C  
ATOM   1099  CG  ASP A 142      39.107  74.754  58.394  1.00 67.10           C  
ATOM   1100  OD1 ASP A 142      39.366  75.741  57.670  1.00 68.51           O  
ATOM   1101  OD2 ASP A 142      38.001  74.585  58.940  1.00 68.42           O  
ATOM   1102  N   ASN A 143      42.519  73.858  60.901  1.00 64.45           N  
ATOM   1103  CA  ASN A 143      42.836  74.181  62.276  1.00 64.07           C  
ATOM   1104  C   ASN A 143      44.193  74.814  62.468  1.00 63.16           C  
ATOM   1105  O   ASN A 143      44.683  74.892  63.574  1.00 63.97           O  
ATOM   1106  CB  ASN A 143      42.702  72.944  63.159  1.00 65.71           C  
ATOM   1107  CG  ASN A 143      41.253  72.554  63.376  1.00 68.54           C  
ATOM   1108  OD1 ASN A 143      40.452  73.369  63.830  1.00 71.95           O  
ATOM   1109  ND2 ASN A 143      40.904  71.313  63.052  1.00 67.98           N  
ATOM   1110  N   ASP A 144      44.805  75.267  61.391  1.00 63.86           N  
ATOM   1111  CA  ASP A 144      46.082  75.934  61.503  1.00 66.88           C  
ATOM   1112  C   ASP A 144      45.884  77.421  61.163  1.00 67.75           C  
ATOM   1113  O   ASP A 144      46.095  77.860  60.020  1.00 67.73           O  
ATOM   1114  CB  ASP A 144      47.103  75.281  60.577  1.00 70.39           C  
ATOM   1115  CG  ASP A 144      48.361  76.116  60.420  1.00 75.34           C  
ATOM   1116  OD1 ASP A 144      48.642  76.951  61.317  1.00 77.51           O  
ATOM   1117  OD2 ASP A 144      49.073  75.934  59.403  1.00 77.93           O  
ATOM   1118  N   MET A 145      45.460  78.172  62.180  1.00 67.71           N  
ATOM   1119  CA  MET A 145      45.181  79.604  62.094  1.00 68.40           C  
ATOM   1120  C   MET A 145      46.101  80.414  61.198  1.00 67.77           C  
ATOM   1121  O   MET A 145      45.634  81.246  60.414  1.00 67.86           O  
ATOM   1122  CB  MET A 145      45.213  80.226  63.489  1.00 71.82           C  
ATOM   1123  CG  MET A 145      44.259  79.600  64.459  1.00 77.13           C  
ATOM   1124  SD  MET A 145      42.634  79.618  63.744  1.00 86.78           S  
ATOM   1125  CE  MET A 145      42.462  77.881  63.120  1.00 84.76           C  
ATOM   1126  N   THR A 146      47.405  80.185  61.327  1.00 66.54           N  
ATOM   1127  CA  THR A 146      48.391  80.922  60.546  1.00 64.25           C  
ATOM   1128  C   THR A 146      48.156  80.802  59.055  1.00 64.07           C  
ATOM   1129  O   THR A 146      48.376  81.757  58.306  1.00 63.30           O  
ATOM   1130  CB  THR A 146      49.786  80.441  60.840  1.00 62.46           C  
ATOM   1131  OG1 THR A 146      49.910  80.216  62.244  1.00 62.22           O  
ATOM   1132  CG2 THR A 146      50.787  81.489  60.421  1.00 60.54           C  
ATOM   1133  N   ASN A 147      47.717  79.629  58.611  1.00 63.59           N  
ATOM   1134  CA  ASN A 147      47.455  79.470  57.198  1.00 63.86           C  
ATOM   1135  C   ASN A 147      46.045  79.891  56.861  1.00 60.70           C  
ATOM   1136  O   ASN A 147      45.818  80.487  55.817  1.00 60.83           O  
ATOM   1137  CB  ASN A 147      47.782  78.050  56.732  1.00 70.07           C  
ATOM   1138  CG  ASN A 147      49.303  77.846  56.544  1.00 75.33           C  
ATOM   1139  OD1 ASN A 147      49.965  78.612  55.807  1.00 75.15           O  
ATOM   1140  ND2 ASN A 147      49.862  76.829  57.221  1.00 76.99           N  
ATOM   1141  N   VAL A 148      45.088  79.614  57.733  1.00 57.28           N  
ATOM   1142  CA  VAL A 148      43.742  80.095  57.460  1.00 53.96           C  
ATOM   1143  C   VAL A 148      43.850  81.610  57.258  1.00 53.64           C  
ATOM   1144  O   VAL A 148      43.166  82.204  56.425  1.00 52.96           O  
ATOM   1145  CB  VAL A 148      42.812  79.887  58.627  1.00 50.83           C  
ATOM   1146  CG1 VAL A 148      41.522  80.583  58.346  1.00 50.90           C  
ATOM   1147  CG2 VAL A 148      42.578  78.424  58.847  1.00 51.36           C  
ATOM   1148  N   THR A 149      44.733  82.228  58.030  1.00 53.58           N  
ATOM   1149  CA  THR A 149      44.934  83.667  57.961  1.00 53.96           C  
ATOM   1150  C   THR A 149      45.570  84.181  56.685  1.00 54.52           C  
ATOM   1151  O   THR A 149      45.089  85.159  56.099  1.00 54.43           O  
ATOM   1152  CB  THR A 149      45.770  84.156  59.128  1.00 53.56           C  
ATOM   1153  OG1 THR A 149      44.985  84.083  60.325  1.00 53.90           O  
ATOM   1154  CG2 THR A 149      46.223  85.590  58.889  1.00 52.08           C  
ATOM   1155  N   PHE A 150      46.661  83.548  56.267  1.00 54.66           N  
ATOM   1156  CA  PHE A 150      47.319  83.972  55.046  1.00 54.72           C  
ATOM   1157  C   PHE A 150      46.451  83.694  53.840  1.00 54.35           C  
ATOM   1158  O   PHE A 150      46.511  84.424  52.845  1.00 52.50           O  
ATOM   1159  CB  PHE A 150      48.664  83.290  54.890  1.00 55.52           C  
ATOM   1160  CG  PHE A 150      49.791  84.050  55.508  1.00 56.95           C  
ATOM   1161  CD1 PHE A 150      50.083  83.908  56.863  1.00 58.15           C  
ATOM   1162  CD2 PHE A 150      50.556  84.931  54.737  1.00 57.08           C  
ATOM   1163  CE1 PHE A 150      51.127  84.629  57.458  1.00 58.19           C  
ATOM   1164  CE2 PHE A 150      51.604  85.660  55.314  1.00 59.25           C  
ATOM   1165  CZ  PHE A 150      51.888  85.507  56.684  1.00 58.93           C  
ATOM   1166  N   ASP A 151      45.639  82.644  53.927  1.00 55.66           N  
ATOM   1167  CA  ASP A 151      44.746  82.313  52.820  1.00 58.78           C  
ATOM   1168  C   ASP A 151      43.738  83.452  52.718  1.00 58.44           C  
ATOM   1169  O   ASP A 151      43.496  83.998  51.636  1.00 59.65           O  
ATOM   1170  CB  ASP A 151      44.012  80.973  53.048  1.00 61.22           C  
ATOM   1171  CG  ASP A 151      44.852  79.750  52.644  1.00 63.12           C  
ATOM   1172  OD1 ASP A 151      45.710  79.893  51.735  1.00 67.52           O  
ATOM   1173  OD2 ASP A 151      44.645  78.647  53.214  1.00 60.85           O  
ATOM   1174  N   TYR A 152      43.160  83.808  53.860  1.00 56.23           N  
ATOM   1175  CA  TYR A 152      42.207  84.890  53.908  1.00 54.07           C  
ATOM   1176  C   TYR A 152      42.862  86.179  53.431  1.00 53.63           C  
ATOM   1177  O   TYR A 152      42.234  86.976  52.735  1.00 53.68           O  
ATOM   1178  CB  TYR A 152      41.709  85.070  55.328  1.00 52.40           C  
ATOM   1179  CG  TYR A 152      40.626  84.108  55.750  1.00 51.01           C  
ATOM   1180  CD1 TYR A 152      40.368  83.893  57.100  1.00 50.79           C  
ATOM   1181  CD2 TYR A 152      39.835  83.445  54.818  1.00 50.33           C  
ATOM   1182  CE1 TYR A 152      39.357  83.050  57.520  1.00 50.76           C  
ATOM   1183  CE2 TYR A 152      38.807  82.592  55.234  1.00 50.98           C  
ATOM   1184  CZ  TYR A 152      38.579  82.405  56.593  1.00 50.99           C  
ATOM   1185  OH  TYR A 152      37.575  81.591  57.063  1.00 51.62           O  
ATOM   1186  N   LEU A 153      44.118  86.400  53.803  1.00 53.00           N  
ATOM   1187  CA  LEU A 153      44.780  87.620  53.365  1.00 54.47           C  
ATOM   1188  C   LEU A 153      44.758  87.694  51.852  1.00 57.14           C  
ATOM   1189  O   LEU A 153      44.481  88.749  51.291  1.00 58.72           O  
ATOM   1190  CB  LEU A 153      46.224  87.692  53.847  1.00 52.58           C  
ATOM   1191  CG  LEU A 153      47.000  88.913  53.334  1.00 49.89           C  
ATOM   1192  CD1 LEU A 153      46.418  90.187  53.913  1.00 47.22           C  
ATOM   1193  CD2 LEU A 153      48.467  88.792  53.722  1.00 49.03           C  
ATOM   1194  N   HIS A 154      45.057  86.579  51.189  1.00 59.14           N  
ATOM   1195  CA  HIS A 154      45.028  86.534  49.721  1.00 60.74           C  
ATOM   1196  C   HIS A 154      43.583  86.665  49.228  1.00 60.67           C  
ATOM   1197  O   HIS A 154      43.267  87.487  48.358  1.00 60.15           O  
ATOM   1198  CB  HIS A 154      45.600  85.210  49.201  1.00 61.97           C  
ATOM   1199  CG  HIS A 154      47.098  85.154  49.181  1.00 64.87           C  
ATOM   1200  ND1 HIS A 154      47.854  84.918  50.311  1.00 64.84           N  
ATOM   1201  CD2 HIS A 154      47.982  85.298  48.164  1.00 65.46           C  
ATOM   1202  CE1 HIS A 154      49.134  84.918  49.989  1.00 65.59           C  
ATOM   1203  NE2 HIS A 154      49.240  85.146  48.692  1.00 65.64           N  
ATOM   1204  N   ALA A 155      42.718  85.834  49.803  1.00 60.33           N  
ATOM   1205  CA  ALA A 155      41.306  85.807  49.469  1.00 60.04           C  
ATOM   1206  C   ALA A 155      40.692  87.192  49.379  1.00 61.35           C  
ATOM   1207  O   ALA A 155      39.588  87.340  48.844  1.00 63.58           O  
ATOM   1208  CB  ALA A 155      40.547  84.979  50.493  1.00 58.34           C  
ATOM   1209  N   THR A 156      41.387  88.204  49.897  1.00 60.44           N  
ATOM   1210  CA  THR A 156      40.859  89.557  49.864  1.00 60.64           C  
ATOM   1211  C   THR A 156      41.821  90.539  49.223  1.00 59.90           C  
ATOM   1212  O   THR A 156      41.417  91.363  48.413  1.00 59.95           O  
ATOM   1213  CB  THR A 156      40.480  90.044  51.300  1.00 63.23           C  
ATOM   1214  OG1 THR A 156      39.795  91.311  51.229  1.00 64.56           O  
ATOM   1215  CG2 THR A 156      41.723  90.167  52.178  1.00 61.90           C  
ATOM   1216  N   ALA A 157      43.092  90.463  49.587  1.00 59.50           N  
ATOM   1217  CA  ALA A 157      44.089  91.355  49.012  1.00 58.81           C  
ATOM   1218  C   ALA A 157      44.022  91.265  47.489  1.00 58.85           C  
ATOM   1219  O   ALA A 157      44.322  92.239  46.785  1.00 59.88           O  
ATOM   1220  CB  ALA A 157      45.469  90.960  49.482  1.00 59.94           C  
ATOM   1221  N   PHE A 158      43.645  90.085  46.990  1.00 57.22           N  
ATOM   1222  CA  PHE A 158      43.523  89.841  45.555  1.00 55.15           C  
ATOM   1223  C   PHE A 158      42.131  89.356  45.233  1.00 56.10           C  
ATOM   1224  O   PHE A 158      41.936  88.643  44.256  1.00 57.01           O  
ATOM   1225  CB  PHE A 158      44.525  88.784  45.086  1.00 50.97           C  
ATOM   1226  CG  PHE A 158      45.941  89.197  45.245  1.00 47.43           C  
ATOM   1227  CD1 PHE A 158      46.763  88.555  46.164  1.00 48.35           C  
ATOM   1228  CD2 PHE A 158      46.446  90.266  44.526  1.00 44.99           C  
ATOM   1229  CE1 PHE A 158      48.087  88.983  46.373  1.00 47.31           C  
ATOM   1230  CE2 PHE A 158      47.755  90.701  44.724  1.00 45.99           C  
ATOM   1231  CZ  PHE A 158      48.581  90.059  45.652  1.00 45.41           C  
ATOM   1232  N   GLN A 159      41.167  89.739  46.062  1.00 57.20           N  
ATOM   1233  CA  GLN A 159      39.776  89.328  45.862  1.00 57.99           C  
ATOM   1234  C   GLN A 159      39.332  89.477  44.406  1.00 57.10           C  
ATOM   1235  O   GLN A 159      39.704  90.448  43.725  1.00 54.60           O  
ATOM   1236  CB  GLN A 159      38.839  90.160  46.745  1.00 58.10           C  
ATOM   1237  CG  GLN A 159      38.807  91.625  46.362  1.00 59.65           C  
ATOM   1238  CD  GLN A 159      37.827  92.418  47.198  1.00 60.79           C  
ATOM   1239  OE1 GLN A 159      36.926  93.069  46.666  1.00 62.02           O  
ATOM   1240  NE2 GLN A 159      37.996  92.367  48.517  1.00 60.42           N  
ATOM   1241  N   GLY A 160      38.544  88.504  43.949  1.00 55.68           N  
ATOM   1242  CA  GLY A 160      38.024  88.530  42.598  1.00 56.97           C  
ATOM   1243  C   GLY A 160      38.982  88.139  41.491  1.00 58.62           C  
ATOM   1244  O   GLY A 160      38.679  88.309  40.310  1.00 58.52           O  
ATOM   1245  N   THR A 161      40.143  87.611  41.857  1.00 60.43           N  
ATOM   1246  CA  THR A 161      41.139  87.215  40.864  1.00 59.64           C  
ATOM   1247  C   THR A 161      41.688  85.821  41.134  1.00 60.15           C  
ATOM   1248  O   THR A 161      41.259  85.133  42.057  1.00 59.10           O  
ATOM   1249  CB  THR A 161      42.329  88.163  40.868  1.00 58.87           C  
ATOM   1250  OG1 THR A 161      43.105  87.901  42.038  1.00 57.07           O  
ATOM   1251  CG2 THR A 161      41.872  89.625  40.869  1.00 57.04           C  
ATOM   1252  N   ALA A 162      42.663  85.422  40.329  1.00 62.57           N  
ATOM   1253  CA  ALA A 162      43.267  84.097  40.462  1.00 64.89           C  
ATOM   1254  C   ALA A 162      44.062  83.933  41.747  1.00 64.98           C  
ATOM   1255  O   ALA A 162      43.941  82.911  42.420  1.00 66.45           O  
ATOM   1256  CB  ALA A 162      44.158  83.805  39.262  1.00 67.52           C  
ATOM   1257  N   LEU A 163      44.884  84.921  42.086  1.00 63.12           N  
ATOM   1258  CA  LEU A 163      45.664  84.830  43.304  1.00 62.22           C  
ATOM   1259  C   LEU A 163      44.787  84.770  44.553  1.00 62.77           C  
ATOM   1260  O   LEU A 163      45.283  84.589  45.660  1.00 63.09           O  
ATOM   1261  CB  LEU A 163      46.622  86.007  43.403  1.00 60.90           C  
ATOM   1262  CG  LEU A 163      47.940  85.816  42.658  1.00 59.93           C  
ATOM   1263  CD1 LEU A 163      48.843  87.021  42.892  1.00 59.59           C  
ATOM   1264  CD2 LEU A 163      48.625  84.557  43.157  1.00 58.81           C  
ATOM   1265  N   ALA A 164      43.480  84.903  44.377  1.00 63.16           N  
ATOM   1266  CA  ALA A 164      42.576  84.868  45.514  1.00 63.53           C  
ATOM   1267  C   ALA A 164      42.280  83.452  45.979  1.00 64.29           C  
ATOM   1268  O   ALA A 164      41.776  83.252  47.072  1.00 66.02           O  
ATOM   1269  CB  ALA A 164      41.277  85.583  45.167  1.00 62.35           C  
ATOM   1270  N   ARG A 165      42.608  82.461  45.165  1.00 65.87           N  
ATOM   1271  CA  ARG A 165      42.316  81.076  45.525  1.00 66.86           C  
ATOM   1272  C   ARG A 165      43.381  80.389  46.367  1.00 67.44           C  
ATOM   1273  O   ARG A 165      44.570  80.730  46.279  1.00 68.48           O  
ATOM   1274  CB  ARG A 165      42.082  80.242  44.261  1.00 68.00           C  
ATOM   1275  CG  ARG A 165      41.011  80.777  43.355  1.00 69.67           C  
ATOM   1276  CD  ARG A 165      40.656  79.771  42.289  1.00 73.20           C  
ATOM   1277  NE  ARG A 165      39.513  80.219  41.493  1.00 76.61           N  
ATOM   1278  CZ  ARG A 165      39.584  81.107  40.502  1.00 77.13           C  
ATOM   1279  NH1 ARG A 165      40.759  81.642  40.172  1.00 77.58           N  
ATOM   1280  NH2 ARG A 165      38.476  81.478  39.860  1.00 76.20           N  
ATOM   1281  N   THR A 166      42.938  79.411  47.163  1.00 66.78           N  
ATOM   1282  CA  THR A 166      43.810  78.602  48.018  1.00 66.50           C  
ATOM   1283  C   THR A 166      44.460  77.532  47.138  1.00 67.59           C  
ATOM   1284  O   THR A 166      43.891  77.145  46.110  1.00 69.29           O  
ATOM   1285  CB  THR A 166      43.009  77.865  49.101  1.00 66.37           C  
ATOM   1286  OG1 THR A 166      41.934  77.135  48.491  1.00 65.62           O  
ATOM   1287  CG2 THR A 166      42.462  78.846  50.119  1.00 67.08           C  
ATOM   1288  N   VAL A 167      45.632  77.036  47.528  1.00 66.30           N  
ATOM   1289  CA  VAL A 167      46.297  76.015  46.721  1.00 63.39           C  
ATOM   1290  C   VAL A 167      45.577  74.666  46.733  1.00 62.21           C  
ATOM   1291  O   VAL A 167      45.542  73.957  45.733  1.00 61.23           O  
ATOM   1292  CB  VAL A 167      47.742  75.836  47.175  1.00 62.01           C  
ATOM   1293  CG1 VAL A 167      48.379  74.687  46.451  1.00 62.94           C  
ATOM   1294  CG2 VAL A 167      48.510  77.088  46.879  1.00 62.68           C  
ATOM   1295  N   GLU A 168      44.991  74.320  47.865  1.00 62.50           N  
ATOM   1296  CA  GLU A 168      44.278  73.063  47.987  1.00 64.72           C  
ATOM   1297  C   GLU A 168      42.921  73.094  47.290  1.00 64.82           C  
ATOM   1298  O   GLU A 168      42.241  72.077  47.203  1.00 64.75           O  
ATOM   1299  CB  GLU A 168      44.060  72.715  49.455  1.00 67.53           C  
ATOM   1300  CG  GLU A 168      45.322  72.605  50.299  1.00 72.94           C  
ATOM   1301  CD  GLU A 168      46.050  73.938  50.499  1.00 77.11           C  
ATOM   1302  OE1 GLU A 168      45.378  74.986  50.649  1.00 80.05           O  
ATOM   1303  OE2 GLU A 168      47.303  73.935  50.533  1.00 79.63           O  
ATOM   1304  N   GLY A 169      42.508  74.260  46.817  1.00 65.01           N  
ATOM   1305  CA  GLY A 169      41.228  74.345  46.136  1.00 66.21           C  
ATOM   1306  C   GLY A 169      40.014  74.360  47.048  1.00 66.99           C  
ATOM   1307  O   GLY A 169      40.134  74.551  48.252  1.00 67.63           O  
ATOM   1308  N   THR A 170      38.842  74.140  46.461  1.00 67.58           N  
ATOM   1309  CA  THR A 170      37.569  74.137  47.170  1.00 67.91           C  
ATOM   1310  C   THR A 170      37.123  72.742  47.516  1.00 66.35           C  
ATOM   1311  O   THR A 170      37.728  71.774  47.094  1.00 66.40           O  
ATOM   1312  CB  THR A 170      36.478  74.710  46.285  1.00 71.30           C  
ATOM   1313  OG1 THR A 170      36.978  75.894  45.646  1.00 75.68           O  
ATOM   1314  CG2 THR A 170      35.214  75.033  47.112  1.00 73.80           C  
ATOM   1315  N   THR A 171      36.044  72.639  48.281  1.00 65.91           N  
ATOM   1316  CA  THR A 171      35.514  71.338  48.627  1.00 64.28           C  
ATOM   1317  C   THR A 171      34.849  70.764  47.390  1.00 66.24           C  
ATOM   1318  O   THR A 171      35.119  69.637  47.005  1.00 67.36           O  
ATOM   1319  CB  THR A 171      34.475  71.412  49.726  1.00 61.25           C  
ATOM   1320  OG1 THR A 171      35.118  71.587  50.991  1.00 59.82           O  
ATOM   1321  CG2 THR A 171      33.680  70.152  49.760  1.00 59.73           C  
ATOM   1322  N   GLU A 172      33.984  71.537  46.753  1.00 68.52           N  
ATOM   1323  CA  GLU A 172      33.317  71.034  45.566  1.00 70.89           C  
ATOM   1324  C   GLU A 172      34.305  70.535  44.539  1.00 71.49           C  
ATOM   1325  O   GLU A 172      34.229  69.384  44.112  1.00 72.23           O  
ATOM   1326  CB  GLU A 172      32.422  72.105  44.960  1.00 73.32           C  
ATOM   1327  CG  GLU A 172      31.213  72.363  45.822  1.00 77.75           C  
ATOM   1328  CD  GLU A 172      30.529  71.067  46.221  1.00 80.41           C  
ATOM   1329  OE1 GLU A 172      30.017  70.365  45.318  1.00 81.77           O  
ATOM   1330  OE2 GLU A 172      30.518  70.746  47.433  1.00 81.10           O  
ATOM   1331  N   ASN A 173      35.236  71.392  44.141  1.00 71.83           N  
ATOM   1332  CA  ASN A 173      36.236  70.991  43.165  1.00 71.76           C  
ATOM   1333  C   ASN A 173      36.846  69.619  43.507  1.00 71.71           C  
ATOM   1334  O   ASN A 173      36.978  68.745  42.654  1.00 71.76           O  
ATOM   1335  CB  ASN A 173      37.342  72.050  43.094  1.00 72.47           C  
ATOM   1336  CG  ASN A 173      36.968  73.217  42.220  1.00 73.36           C  
ATOM   1337  OD1 ASN A 173      35.829  73.664  42.228  1.00 75.47           O  
ATOM   1338  ND2 ASN A 173      37.930  73.724  41.460  1.00 73.96           N  
ATOM   1339  N   ILE A 174      37.203  69.424  44.765  1.00 71.42           N  
ATOM   1340  CA  ILE A 174      37.823  68.179  45.158  1.00 71.13           C  
ATOM   1341  C   ILE A 174      36.876  67.006  45.139  1.00 70.90           C  
ATOM   1342  O   ILE A 174      37.273  65.891  44.813  1.00 70.99           O  
ATOM   1343  CB  ILE A 174      38.516  68.347  46.532  1.00 71.85           C  
ATOM   1344  CG1 ILE A 174      39.944  68.856  46.287  1.00 72.78           C  
ATOM   1345  CG2 ILE A 174      38.505  67.044  47.318  1.00 71.58           C  
ATOM   1346  CD1 ILE A 174      40.571  69.535  47.447  1.00 73.75           C  
ATOM   1347  N   LYS A 175      35.616  67.258  45.459  1.00 71.40           N  
ATOM   1348  CA  LYS A 175      34.621  66.196  45.464  1.00 72.28           C  
ATOM   1349  C   LYS A 175      34.238  65.746  44.059  1.00 72.75           C  
ATOM   1350  O   LYS A 175      33.715  64.647  43.881  1.00 73.42           O  
ATOM   1351  CB  LYS A 175      33.361  66.657  46.194  1.00 72.56           C  
ATOM   1352  CG  LYS A 175      33.536  66.814  47.692  1.00 74.85           C  
ATOM   1353  CD  LYS A 175      32.356  67.544  48.336  1.00 75.93           C  
ATOM   1354  CE  LYS A 175      31.040  66.811  48.166  1.00 75.76           C  
ATOM   1355  NZ  LYS A 175      29.934  67.569  48.814  1.00 76.72           N  
ATOM   1356  N   HIS A 176      34.512  66.577  43.060  1.00 73.16           N  
ATOM   1357  CA  HIS A 176      34.116  66.238  41.706  1.00 74.62           C  
ATOM   1358  C   HIS A 176      35.205  66.185  40.655  1.00 75.37           C  
ATOM   1359  O   HIS A 176      34.978  65.640  39.580  1.00 75.11           O  
ATOM   1360  CB  HIS A 176      33.025  67.201  41.238  1.00 76.63           C  
ATOM   1361  CG  HIS A 176      31.872  67.312  42.186  1.00 79.47           C  
ATOM   1362  ND1 HIS A 176      31.179  66.212  42.646  1.00 81.12           N  
ATOM   1363  CD2 HIS A 176      31.314  68.388  42.792  1.00 80.69           C  
ATOM   1364  CE1 HIS A 176      30.248  66.603  43.500  1.00 81.49           C  
ATOM   1365  NE2 HIS A 176      30.309  67.918  43.606  1.00 82.92           N  
ATOM   1366  N   LEU A 177      36.375  66.749  40.941  1.00 76.69           N  
ATOM   1367  CA  LEU A 177      37.471  66.738  39.968  1.00 77.54           C  
ATOM   1368  C   LEU A 177      37.563  65.354  39.339  1.00 78.95           C  
ATOM   1369  O   LEU A 177      37.333  64.348  40.011  1.00 78.95           O  
ATOM   1370  CB  LEU A 177      38.802  67.120  40.637  1.00 76.39           C  
ATOM   1371  CG  LEU A 177      39.227  68.595  40.515  1.00 75.17           C  
ATOM   1372  CD1 LEU A 177      40.398  68.894  41.427  1.00 74.43           C  
ATOM   1373  CD2 LEU A 177      39.597  68.904  39.080  1.00 73.44           C  
ATOM   1374  N   THR A 178      37.896  65.304  38.050  1.00 80.76           N  
ATOM   1375  CA  THR A 178      37.969  64.031  37.326  1.00 81.88           C  
ATOM   1376  C   THR A 178      39.337  63.608  36.794  1.00 82.08           C  
ATOM   1377  O   THR A 178      40.268  64.416  36.681  1.00 81.46           O  
ATOM   1378  CB  THR A 178      36.979  64.031  36.132  1.00 81.63           C  
ATOM   1379  OG1 THR A 178      35.644  64.191  36.627  1.00 81.02           O  
ATOM   1380  CG2 THR A 178      37.082  62.728  35.333  1.00 82.95           C  
ATOM   1381  N   ARG A 179      39.427  62.317  36.474  1.00 82.72           N  
ATOM   1382  CA  ARG A 179      40.628  61.706  35.921  1.00 83.58           C  
ATOM   1383  C   ARG A 179      40.969  62.567  34.701  1.00 83.69           C  
ATOM   1384  O   ARG A 179      42.140  62.838  34.399  1.00 83.59           O  
ATOM   1385  CB  ARG A 179      40.318  60.247  35.509  1.00 84.52           C  
ATOM   1386  CG  ARG A 179      41.528  59.278  35.467  1.00 85.54           C  
ATOM   1387  CD  ARG A 179      41.930  58.873  34.046  1.00 87.12           C  
ATOM   1388  NE  ARG A 179      43.352  58.542  33.952  1.00 88.83           N  
ATOM   1389  CZ  ARG A 179      44.083  58.697  32.846  1.00 91.04           C  
ATOM   1390  NH1 ARG A 179      43.521  59.172  31.738  1.00 91.75           N  
ATOM   1391  NH2 ARG A 179      45.384  58.409  32.846  1.00 91.18           N  
ATOM   1392  N   ALA A 180      39.915  63.015  34.027  1.00 83.00           N  
ATOM   1393  CA  ALA A 180      40.037  63.850  32.848  1.00 82.29           C  
ATOM   1394  C   ALA A 180      40.703  65.179  33.179  1.00 82.47           C  
ATOM   1395  O   ALA A 180      41.699  65.564  32.563  1.00 81.45           O  
ATOM   1396  CB  ALA A 180      38.662  64.094  32.271  1.00 82.90           C  
ATOM   1397  N   ASP A 181      40.135  65.873  34.159  1.00 83.26           N  
ATOM   1398  CA  ASP A 181      40.631  67.179  34.584  1.00 83.90           C  
ATOM   1399  C   ASP A 181      42.066  67.103  35.066  1.00 82.73           C  
ATOM   1400  O   ASP A 181      42.897  67.951  34.724  1.00 82.71           O  
ATOM   1401  CB  ASP A 181      39.738  67.732  35.690  1.00 85.75           C  
ATOM   1402  CG  ASP A 181      38.266  67.660  35.329  1.00 88.22           C  
ATOM   1403  OD1 ASP A 181      37.728  66.533  35.238  1.00 89.45           O  
ATOM   1404  OD2 ASP A 181      37.649  68.726  35.124  1.00 88.57           O  
ATOM   1405  N   LEU A 182      42.352  66.086  35.870  1.00 80.99           N  
ATOM   1406  CA  LEU A 182      43.698  65.902  36.377  1.00 79.60           C  
ATOM   1407  C   LEU A 182      44.576  65.687  35.153  1.00 78.98           C  
ATOM   1408  O   LEU A 182      45.585  66.377  34.956  1.00 78.09           O  
ATOM   1409  CB  LEU A 182      43.744  64.686  37.305  1.00 79.27           C  
ATOM   1410  CG  LEU A 182      42.863  64.799  38.556  1.00 78.85           C  
ATOM   1411  CD1 LEU A 182      42.928  63.540  39.381  1.00 78.12           C  
ATOM   1412  CD2 LEU A 182      43.335  65.962  39.389  1.00 79.55           C  
ATOM   1413  N   ALA A 183      44.161  64.737  34.321  1.00 78.10           N  
ATOM   1414  CA  ALA A 183      44.879  64.425  33.100  1.00 78.07           C  
ATOM   1415  C   ALA A 183      45.152  65.729  32.361  1.00 79.11           C  
ATOM   1416  O   ALA A 183      46.309  66.095  32.115  1.00 79.28           O  
ATOM   1417  CB  ALA A 183      44.046  63.502  32.241  1.00 76.22           C  
ATOM   1418  N   SER A 184      44.074  66.438  32.033  1.00 79.48           N  
ATOM   1419  CA  SER A 184      44.175  67.698  31.321  1.00 79.44           C  
ATOM   1420  C   SER A 184      45.203  68.627  31.943  1.00 80.54           C  
ATOM   1421  O   SER A 184      46.125  69.083  31.264  1.00 80.59           O  
ATOM   1422  CB  SER A 184      42.826  68.403  31.290  1.00 78.31           C  
ATOM   1423  OG  SER A 184      42.964  69.663  30.655  1.00 78.00           O  
ATOM   1424  N   TYR A 185      45.041  68.900  33.236  1.00 81.72           N  
ATOM   1425  CA  TYR A 185      45.951  69.794  33.950  1.00 82.36           C  
ATOM   1426  C   TYR A 185      47.398  69.440  33.633  1.00 82.37           C  
ATOM   1427  O   TYR A 185      48.183  70.299  33.205  1.00 82.97           O  
ATOM   1428  CB  TYR A 185      45.706  69.714  35.467  1.00 82.58           C  
ATOM   1429  CG  TYR A 185      46.581  70.637  36.309  1.00 83.18           C  
ATOM   1430  CD1 TYR A 185      46.099  71.843  36.804  1.00 82.09           C  
ATOM   1431  CD2 TYR A 185      47.904  70.297  36.599  1.00 85.21           C  
ATOM   1432  CE1 TYR A 185      46.922  72.692  37.574  1.00 84.06           C  
ATOM   1433  CE2 TYR A 185      48.737  71.138  37.361  1.00 85.14           C  
ATOM   1434  CZ  TYR A 185      48.244  72.331  37.847  1.00 84.52           C  
ATOM   1435  OH  TYR A 185      49.082  73.143  38.595  1.00 82.98           O  
ATOM   1436  N   ILE A 186      47.733  68.166  33.819  1.00 81.48           N  
ATOM   1437  CA  ILE A 186      49.090  67.676  33.588  1.00 80.69           C  
ATOM   1438  C   ILE A 186      49.602  67.907  32.176  1.00 81.02           C  
ATOM   1439  O   ILE A 186      50.738  68.360  31.976  1.00 79.51           O  
ATOM   1440  CB  ILE A 186      49.176  66.187  33.888  1.00 79.10           C  
ATOM   1441  CG1 ILE A 186      48.487  65.894  35.223  1.00 78.84           C  
ATOM   1442  CG2 ILE A 186      50.626  65.772  33.936  1.00 78.35           C  
ATOM   1443  CD1 ILE A 186      48.388  64.431  35.580  1.00 77.20           C  
ATOM   1444  N   ASP A 187      48.750  67.589  31.206  1.00 82.18           N  
ATOM   1445  CA  ASP A 187      49.077  67.737  29.792  1.00 84.40           C  
ATOM   1446  C   ASP A 187      49.117  69.197  29.386  1.00 83.80           C  
ATOM   1447  O   ASP A 187      49.817  69.560  28.446  1.00 83.83           O  
ATOM   1448  CB  ASP A 187      48.042  67.011  28.927  1.00 88.78           C  
ATOM   1449  CG  ASP A 187      47.995  65.504  29.199  1.00 94.77           C  
ATOM   1450  OD1 ASP A 187      48.983  64.795  28.871  1.00 97.74           O  
ATOM   1451  OD2 ASP A 187      46.969  65.025  29.745  1.00 97.17           O  
ATOM   1452  N   THR A 188      48.363  70.027  30.105  1.00 82.32           N  
ATOM   1453  CA  THR A 188      48.288  71.455  29.823  1.00 79.21           C  
ATOM   1454  C   THR A 188      49.429  72.253  30.435  1.00 78.94           C  
ATOM   1455  O   THR A 188      49.967  73.159  29.799  1.00 77.46           O  
ATOM   1456  CB  THR A 188      46.982  72.064  30.360  1.00 77.51           C  
ATOM   1457  OG1 THR A 188      45.866  71.268  29.945  1.00 77.06           O  
ATOM   1458  CG2 THR A 188      46.811  73.478  29.837  1.00 74.94           C  
ATOM   1459  N   HIS A 189      49.806  71.909  31.665  1.00 79.09           N  
ATOM   1460  CA  HIS A 189      50.842  72.658  32.359  1.00 79.61           C  
ATOM   1461  C   HIS A 189      52.232  72.059  32.455  1.00 81.42           C  
ATOM   1462  O   HIS A 189      53.217  72.780  32.273  1.00 81.53           O  
ATOM   1463  CB  HIS A 189      50.349  73.028  33.758  1.00 78.67           C  
ATOM   1464  CG  HIS A 189      49.118  73.881  33.751  1.00 78.73           C  
ATOM   1465  ND1 HIS A 189      49.101  75.156  33.229  1.00 78.33           N  
ATOM   1466  CD2 HIS A 189      47.846  73.619  34.140  1.00 79.03           C  
ATOM   1467  CE1 HIS A 189      47.872  75.642  33.291  1.00 77.69           C  
ATOM   1468  NE2 HIS A 189      47.091  74.729  33.838  1.00 78.15           N  
ATOM   1469  N   PHE A 190      52.340  70.766  32.744  1.00 83.48           N  
ATOM   1470  CA  PHE A 190      53.668  70.152  32.860  1.00 86.04           C  
ATOM   1471  C   PHE A 190      54.345  70.020  31.501  1.00 87.70           C  
ATOM   1472  O   PHE A 190      54.263  68.965  30.869  1.00 88.85           O  
ATOM   1473  CB  PHE A 190      53.551  68.780  33.512  1.00 86.35           C  
ATOM   1474  CG  PHE A 190      53.085  68.828  34.938  1.00 86.96           C  
ATOM   1475  CD1 PHE A 190      52.571  67.688  35.552  1.00 87.53           C  
ATOM   1476  CD2 PHE A 190      53.145  70.009  35.664  1.00 86.28           C  
ATOM   1477  CE1 PHE A 190      52.120  67.721  36.867  1.00 87.22           C  
ATOM   1478  CE2 PHE A 190      52.699  70.053  36.974  1.00 86.70           C  
ATOM   1479  CZ  PHE A 190      52.182  68.903  37.579  1.00 87.20           C  
ATOM   1480  N   LYS A 191      55.026  71.083  31.066  1.00 88.85           N  
ATOM   1481  CA  LYS A 191      55.689  71.111  29.762  1.00 89.51           C  
ATOM   1482  C   LYS A 191      57.079  71.736  29.756  1.00 88.89           C  
ATOM   1483  O   LYS A 191      57.303  72.788  30.339  1.00 88.94           O  
ATOM   1484  CB  LYS A 191      54.802  71.845  28.763  1.00 91.69           C  
ATOM   1485  CG  LYS A 191      53.490  71.134  28.474  1.00 95.93           C  
ATOM   1486  CD  LYS A 191      52.693  71.897  27.421  1.00100.60           C  
ATOM   1487  CE  LYS A 191      51.587  71.034  26.793  1.00103.55           C  
ATOM   1488  NZ  LYS A 191      50.873  71.736  25.665  1.00103.31           N  
ATOM   1489  N   ALA A 192      57.995  71.086  29.048  1.00 88.91           N  
ATOM   1490  CA  ALA A 192      59.396  71.506  28.938  1.00 89.11           C  
ATOM   1491  C   ALA A 192      59.755  72.989  29.010  1.00 88.50           C  
ATOM   1492  O   ALA A 192      60.589  73.385  29.817  1.00 88.53           O  
ATOM   1493  CB  ALA A 192      60.010  70.907  27.677  1.00 90.41           C  
ATOM   1494  N   PRO A 193      59.164  73.828  28.154  1.00 88.77           N  
ATOM   1495  CA  PRO A 193      59.533  75.248  28.242  1.00 89.09           C  
ATOM   1496  C   PRO A 193      59.265  75.872  29.617  1.00 89.17           C  
ATOM   1497  O   PRO A 193      59.997  76.771  30.062  1.00 88.74           O  
ATOM   1498  CB  PRO A 193      58.712  75.890  27.121  1.00 89.26           C  
ATOM   1499  CG  PRO A 193      57.495  74.985  27.025  1.00 90.35           C  
ATOM   1500  CD  PRO A 193      58.108  73.607  27.149  1.00 89.70           C  
ATOM   1501  N   ARG A 194      58.221  75.366  30.280  1.00 89.15           N  
ATOM   1502  CA  ARG A 194      57.797  75.825  31.611  1.00 88.06           C  
ATOM   1503  C   ARG A 194      58.427  75.014  32.758  1.00 86.63           C  
ATOM   1504  O   ARG A 194      58.054  75.185  33.915  1.00 86.33           O  
ATOM   1505  CB  ARG A 194      56.256  75.762  31.715  1.00 88.25           C  
ATOM   1506  CG  ARG A 194      55.531  76.884  30.974  1.00 88.47           C  
ATOM   1507  CD  ARG A 194      54.050  76.606  30.781  1.00 88.42           C  
ATOM   1508  NE  ARG A 194      53.342  76.424  32.040  1.00 89.34           N  
ATOM   1509  CZ  ARG A 194      52.038  76.183  32.123  1.00 89.38           C  
ATOM   1510  NH1 ARG A 194      51.313  76.104  31.013  1.00 88.57           N  
ATOM   1511  NH2 ARG A 194      51.467  76.001  33.310  1.00 88.70           N  
ATOM   1512  N   MET A 195      59.379  74.138  32.436  1.00 85.93           N  
ATOM   1513  CA  MET A 195      60.047  73.304  33.442  1.00 83.65           C  
ATOM   1514  C   MET A 195      61.547  73.539  33.536  1.00 81.82           C  
ATOM   1515  O   MET A 195      62.178  74.069  32.618  1.00 81.53           O  
ATOM   1516  CB  MET A 195      59.808  71.822  33.152  1.00 83.87           C  
ATOM   1517  CG  MET A 195      58.348  71.460  33.058  1.00 85.91           C  
ATOM   1518  SD  MET A 195      58.032  69.707  33.276  1.00 91.41           S  
ATOM   1519  CE  MET A 195      57.531  69.208  31.645  1.00 90.55           C  
ATOM   1520  N   VAL A 196      62.112  73.143  34.663  1.00 79.97           N  
ATOM   1521  CA  VAL A 196      63.536  73.285  34.866  1.00 79.82           C  
ATOM   1522  C   VAL A 196      64.063  72.118  35.665  1.00 80.97           C  
ATOM   1523  O   VAL A 196      63.542  71.793  36.732  1.00 80.10           O  
ATOM   1524  CB  VAL A 196      63.874  74.567  35.605  1.00 79.05           C  
ATOM   1525  CG1 VAL A 196      65.361  74.614  35.928  1.00 78.51           C  
ATOM   1526  CG2 VAL A 196      63.497  75.734  34.755  1.00 79.96           C  
ATOM   1527  N   LEU A 197      65.091  71.469  35.130  1.00 82.23           N  
ATOM   1528  CA  LEU A 197      65.694  70.344  35.822  1.00 82.74           C  
ATOM   1529  C   LEU A 197      66.863  70.919  36.606  1.00 83.19           C  
ATOM   1530  O   LEU A 197      67.873  71.339  36.022  1.00 83.01           O  
ATOM   1531  CB  LEU A 197      66.194  69.301  34.829  1.00 82.25           C  
ATOM   1532  CG  LEU A 197      66.544  67.949  35.456  1.00 81.03           C  
ATOM   1533  CD1 LEU A 197      65.274  67.180  35.781  1.00 78.72           C  
ATOM   1534  CD2 LEU A 197      67.406  67.159  34.490  1.00 81.93           C  
ATOM   1535  N   ALA A 198      66.707  70.970  37.926  1.00 82.76           N  
ATOM   1536  CA  ALA A 198      67.752  71.509  38.776  1.00 82.50           C  
ATOM   1537  C   ALA A 198      68.408  70.384  39.537  1.00 83.04           C  
ATOM   1538  O   ALA A 198      67.739  69.442  39.987  1.00 82.26           O  
ATOM   1539  CB  ALA A 198      67.180  72.522  39.738  1.00 81.90           C  
ATOM   1540  N   ALA A 199      69.726  70.490  39.673  1.00 83.08           N  
ATOM   1541  CA  ALA A 199      70.492  69.485  40.380  1.00 83.17           C  
ATOM   1542  C   ALA A 199      71.590  70.140  41.194  1.00 83.48           C  
ATOM   1543  O   ALA A 199      72.180  71.135  40.777  1.00 82.44           O  
ATOM   1544  CB  ALA A 199      71.087  68.508  39.390  1.00 82.85           C  
ATOM   1545  N   ALA A 200      71.853  69.577  42.366  1.00 85.17           N  
ATOM   1546  CA  ALA A 200      72.899  70.093  43.234  1.00 87.78           C  
ATOM   1547  C   ALA A 200      73.556  68.962  44.029  1.00 89.51           C  
ATOM   1548  O   ALA A 200      72.887  68.021  44.484  1.00 88.17           O  
ATOM   1549  CB  ALA A 200      72.331  71.142  44.171  1.00 89.04           C  
ATOM   1550  N   GLY A 201      74.875  69.070  44.182  1.00 91.71           N  
ATOM   1551  CA  GLY A 201      75.649  68.067  44.897  1.00 94.64           C  
ATOM   1552  C   GLY A 201      76.849  67.623  44.073  1.00 96.19           C  
ATOM   1553  O   GLY A 201      77.504  68.445  43.426  1.00 95.98           O  
ATOM   1554  N   GLY A 202      77.148  66.327  44.094  1.00 97.41           N  
ATOM   1555  CA  GLY A 202      78.267  65.821  43.316  1.00 98.11           C  
ATOM   1556  C   GLY A 202      77.754  65.275  41.998  1.00 98.80           C  
ATOM   1557  O   GLY A 202      77.454  64.090  41.880  1.00 98.02           O  
ATOM   1558  N   ILE A 203      77.645  66.141  40.998  1.00 99.88           N  
ATOM   1559  CA  ILE A 203      77.143  65.718  39.704  1.00101.53           C  
ATOM   1560  C   ILE A 203      77.747  66.484  38.539  1.00102.72           C  
ATOM   1561  O   ILE A 203      77.946  67.698  38.607  1.00102.34           O  
ATOM   1562  CB  ILE A 203      75.614  65.875  39.645  1.00102.09           C  
ATOM   1563  CG1 ILE A 203      74.967  64.951  40.669  1.00102.36           C  
ATOM   1564  CG2 ILE A 203      75.103  65.548  38.251  1.00102.70           C  
ATOM   1565  CD1 ILE A 203      73.482  65.115  40.759  1.00103.04           C  
ATOM   1566  N   SER A 204      78.029  65.759  37.461  1.00104.25           N  
ATOM   1567  CA  SER A 204      78.590  66.360  36.255  1.00105.74           C  
ATOM   1568  C   SER A 204      77.459  66.986  35.449  1.00105.30           C  
ATOM   1569  O   SER A 204      76.539  66.292  35.006  1.00104.84           O  
ATOM   1570  CB  SER A 204      79.303  65.294  35.402  1.00107.29           C  
ATOM   1571  OG  SER A 204      79.738  65.819  34.151  1.00108.31           O  
ATOM   1572  N   HIS A 205      77.526  68.299  35.266  1.00104.87           N  
ATOM   1573  CA  HIS A 205      76.501  68.992  34.503  1.00104.97           C  
ATOM   1574  C   HIS A 205      76.225  68.215  33.223  1.00104.41           C  
ATOM   1575  O   HIS A 205      75.080  67.947  32.860  1.00103.14           O  
ATOM   1576  CB  HIS A 205      76.978  70.404  34.156  1.00105.88           C  
ATOM   1577  CG  HIS A 205      76.022  71.164  33.293  1.00106.44           C  
ATOM   1578  ND1 HIS A 205      74.718  71.402  33.666  1.00106.84           N  
ATOM   1579  CD2 HIS A 205      76.174  71.728  32.071  1.00106.57           C  
ATOM   1580  CE1 HIS A 205      74.107  72.079  32.711  1.00107.21           C  
ATOM   1581  NE2 HIS A 205      74.968  72.290  31.731  1.00106.20           N  
ATOM   1582  N   LYS A 206      77.315  67.852  32.563  1.00105.39           N  
ATOM   1583  CA  LYS A 206      77.291  67.128  31.307  1.00105.79           C  
ATOM   1584  C   LYS A 206      76.639  65.765  31.438  1.00104.74           C  
ATOM   1585  O   LYS A 206      75.888  65.360  30.561  1.00104.01           O  
ATOM   1586  CB  LYS A 206      78.726  67.021  30.782  1.00107.74           C  
ATOM   1587  CG  LYS A 206      79.468  68.345  30.997  1.00111.25           C  
ATOM   1588  CD  LYS A 206      80.819  68.474  30.298  1.00113.57           C  
ATOM   1589  CE  LYS A 206      81.326  69.927  30.451  1.00115.03           C  
ATOM   1590  NZ  LYS A 206      82.636  70.217  29.789  1.00114.92           N  
ATOM   1591  N   GLU A 207      76.911  65.055  32.527  1.00104.25           N  
ATOM   1592  CA  GLU A 207      76.297  63.743  32.716  1.00104.94           C  
ATOM   1593  C   GLU A 207      74.793  63.930  32.889  1.00104.51           C  
ATOM   1594  O   GLU A 207      73.975  63.109  32.450  1.00103.56           O  
ATOM   1595  CB  GLU A 207      76.866  63.046  33.956  1.00106.32           C  
ATOM   1596  CG  GLU A 207      78.253  62.453  33.769  1.00107.87           C  
ATOM   1597  CD  GLU A 207      78.474  61.218  34.632  1.00109.00           C  
ATOM   1598  OE1 GLU A 207      77.725  60.229  34.462  1.00109.29           O  
ATOM   1599  OE2 GLU A 207      79.393  61.235  35.479  1.00109.49           O  
ATOM   1600  N   LEU A 208      74.456  65.037  33.543  1.00104.17           N  
ATOM   1601  CA  LEU A 208      73.078  65.423  33.831  1.00102.31           C  
ATOM   1602  C   LEU A 208      72.321  65.720  32.551  1.00101.12           C  
ATOM   1603  O   LEU A 208      71.330  65.066  32.234  1.00100.84           O  
ATOM   1604  CB  LEU A 208      73.075  66.665  34.723  1.00101.30           C  
ATOM   1605  CG  LEU A 208      71.723  67.231  35.148  1.00 99.34           C  
ATOM   1606  CD1 LEU A 208      70.934  66.174  35.898  1.00 98.30           C  
ATOM   1607  CD2 LEU A 208      71.950  68.458  36.015  1.00 98.38           C  
ATOM   1608  N   VAL A 209      72.794  66.719  31.821  1.00100.21           N  
ATOM   1609  CA  VAL A 209      72.158  67.091  30.576  1.00100.37           C  
ATOM   1610  C   VAL A 209      72.071  65.891  29.632  1.00100.91           C  
ATOM   1611  O   VAL A 209      71.140  65.795  28.833  1.00100.43           O  
ATOM   1612  CB  VAL A 209      72.915  68.255  29.895  1.00 99.94           C  
ATOM   1613  CG1 VAL A 209      74.392  67.923  29.764  1.00100.88           C  
ATOM   1614  CG2 VAL A 209      72.304  68.538  28.538  1.00 98.98           C  
ATOM   1615  N   ASP A 210      73.031  64.973  29.726  1.00102.14           N  
ATOM   1616  CA  ASP A 210      73.020  63.785  28.867  1.00103.41           C  
ATOM   1617  C   ASP A 210      71.821  62.936  29.228  1.00102.51           C  
ATOM   1618  O   ASP A 210      70.962  62.666  28.392  1.00102.64           O  
ATOM   1619  CB  ASP A 210      74.301  62.944  29.031  1.00105.21           C  
ATOM   1620  CG  ASP A 210      75.437  63.409  28.121  1.00106.66           C  
ATOM   1621  OD1 ASP A 210      75.182  63.628  26.912  1.00107.45           O  
ATOM   1622  OD2 ASP A 210      76.582  63.541  28.614  1.00107.50           O  
ATOM   1623  N   ALA A 211      71.775  62.520  30.485  1.00101.90           N  
ATOM   1624  CA  ALA A 211      70.675  61.711  30.980  1.00101.70           C  
ATOM   1625  C   ALA A 211      69.360  62.450  30.736  1.00101.44           C  
ATOM   1626  O   ALA A 211      68.295  61.837  30.605  1.00100.39           O  
ATOM   1627  CB  ALA A 211      70.863  61.451  32.461  1.00101.81           C  
ATOM   1628  N   ALA A 212      69.450  63.774  30.674  1.00101.67           N  
ATOM   1629  CA  ALA A 212      68.283  64.611  30.449  1.00102.70           C  
ATOM   1630  C   ALA A 212      67.722  64.424  29.036  1.00103.43           C  
ATOM   1631  O   ALA A 212      66.538  64.105  28.868  1.00103.65           O  
ATOM   1632  CB  ALA A 212      68.647  66.069  30.683  1.00103.32           C  
ATOM   1633  N   ARG A 213      68.581  64.630  28.035  1.00103.27           N  
ATOM   1634  CA  ARG A 213      68.216  64.494  26.622  1.00102.47           C  
ATOM   1635  C   ARG A 213      67.511  63.189  26.368  1.00102.42           C  
ATOM   1636  O   ARG A 213      66.521  63.126  25.635  1.00101.26           O  
ATOM   1637  CB  ARG A 213      69.467  64.540  25.747  1.00101.99           C  
ATOM   1638  CG  ARG A 213      69.750  65.890  25.144  1.00102.33           C  
ATOM   1639  CD  ARG A 213      71.220  66.052  24.841  1.00102.58           C  
ATOM   1640  NE  ARG A 213      71.511  67.409  24.396  1.00103.71           N  
ATOM   1641  CZ  ARG A 213      72.730  67.936  24.364  1.00104.43           C  
ATOM   1642  NH1 ARG A 213      73.773  67.210  24.757  1.00104.48           N  
ATOM   1643  NH2 ARG A 213      72.904  69.183  23.937  1.00103.77           N  
ATOM   1644  N   GLN A 214      68.044  62.151  26.998  1.00103.12           N  
ATOM   1645  CA  GLN A 214      67.546  60.797  26.859  1.00104.50           C  
ATOM   1646  C   GLN A 214      66.170  60.528  27.445  1.00104.84           C  
ATOM   1647  O   GLN A 214      65.439  59.698  26.907  1.00103.86           O  
ATOM   1648  CB  GLN A 214      68.558  59.824  27.470  1.00106.17           C  
ATOM   1649  CG  GLN A 214      68.390  58.370  27.033  1.00108.73           C  
ATOM   1650  CD  GLN A 214      69.496  57.467  27.560  1.00110.33           C  
ATOM   1651  OE1 GLN A 214      69.586  57.207  28.761  1.00111.15           O  
ATOM   1652  NE2 GLN A 214      70.351  56.991  26.658  1.00112.35           N  
ATOM   1653  N   HIS A 215      65.805  61.215  28.529  1.00105.98           N  
ATOM   1654  CA  HIS A 215      64.503  60.966  29.152  1.00107.10           C  
ATOM   1655  C   HIS A 215      63.402  62.000  28.943  1.00107.98           C  
ATOM   1656  O   HIS A 215      62.211  61.679  29.062  1.00106.92           O  
ATOM   1657  CB  HIS A 215      64.686  60.697  30.641  1.00106.65           C  
ATOM   1658  CG  HIS A 215      65.483  59.464  30.926  1.00105.73           C  
ATOM   1659  ND1 HIS A 215      66.839  59.494  31.164  1.00105.13           N  
ATOM   1660  CD2 HIS A 215      65.117  58.160  30.971  1.00105.34           C  
ATOM   1661  CE1 HIS A 215      67.277  58.260  31.346  1.00105.57           C  
ATOM   1662  NE2 HIS A 215      66.253  57.433  31.234  1.00105.64           N  
ATOM   1663  N   PHE A 216      63.796  63.233  28.644  1.00109.28           N  
ATOM   1664  CA  PHE A 216      62.837  64.297  28.373  1.00110.85           C  
ATOM   1665  C   PHE A 216      62.829  64.427  26.860  1.00112.77           C  
ATOM   1666  O   PHE A 216      63.649  65.148  26.283  1.00113.10           O  
ATOM   1667  CB  PHE A 216      63.294  65.596  29.030  1.00110.02           C  
ATOM   1668  CG  PHE A 216      63.205  65.573  30.528  1.00108.82           C  
ATOM   1669  CD1 PHE A 216      64.290  65.949  31.308  1.00108.13           C  
ATOM   1670  CD2 PHE A 216      62.032  65.162  31.158  1.00107.61           C  
ATOM   1671  CE1 PHE A 216      64.209  65.912  32.689  1.00107.93           C  
ATOM   1672  CE2 PHE A 216      61.944  65.123  32.535  1.00106.72           C  
ATOM   1673  CZ  PHE A 216      63.033  65.496  33.304  1.00107.67           C  
ATOM   1674  N   SER A 217      61.909  63.703  26.223  1.00115.22           N  
ATOM   1675  CA  SER A 217      61.808  63.686  24.762  1.00117.55           C  
ATOM   1676  C   SER A 217      60.791  64.647  24.146  1.00118.94           C  
ATOM   1677  O   SER A 217      61.174  65.559  23.404  1.00118.95           O  
ATOM   1678  CB  SER A 217      61.534  62.250  24.267  1.00117.29           C  
ATOM   1679  OG  SER A 217      60.455  61.637  24.955  1.00116.88           O  
ATOM   1680  N   GLY A 218      59.509  64.429  24.451  1.00120.12           N  
ATOM   1681  CA  GLY A 218      58.434  65.261  23.928  1.00120.65           C  
ATOM   1682  C   GLY A 218      58.856  66.524  23.191  1.00121.08           C  
ATOM   1683  O   GLY A 218      59.027  67.582  23.813  1.00121.34           O  
ATOM   1684  N   VAL A 219      59.030  66.414  21.869  1.00120.53           N  
ATOM   1685  CA  VAL A 219      59.426  67.556  21.039  1.00119.62           C  
ATOM   1686  C   VAL A 219      58.222  68.224  20.368  1.00118.44           C  
ATOM   1687  O   VAL A 219      57.457  67.589  19.633  1.00118.29           O  
ATOM   1688  CB  VAL A 219      60.455  67.152  19.951  1.00119.79           C  
ATOM   1689  CG1 VAL A 219      60.774  68.360  19.070  1.00119.97           C  
ATOM   1690  CG2 VAL A 219      61.734  66.636  20.608  1.00119.48           C  
ATOM   1691  N   SER A 220      58.080  69.517  20.636  1.00116.77           N  
ATOM   1692  CA  SER A 220      56.990  70.330  20.121  1.00114.94           C  
ATOM   1693  C   SER A 220      56.997  70.514  18.602  1.00113.67           C  
ATOM   1694  O   SER A 220      58.053  70.600  17.975  1.00112.98           O  
ATOM   1695  CB  SER A 220      57.008  71.693  20.833  1.00115.06           C  
ATOM   1696  OG  SER A 220      58.335  72.160  21.046  1.00115.35           O  
ATOM   1697  N   PHE A 221      55.799  70.568  18.026  1.00112.27           N  
ATOM   1698  CA  PHE A 221      55.623  70.744  16.591  1.00111.22           C  
ATOM   1699  C   PHE A 221      55.254  72.182  16.247  1.00110.99           C  
ATOM   1700  O   PHE A 221      55.969  72.862  15.508  1.00110.99           O  
ATOM   1701  CB  PHE A 221      54.528  69.810  16.088  1.00111.28           C  
ATOM   1702  CG  PHE A 221      54.905  68.361  16.129  1.00112.29           C  
ATOM   1703  CD1 PHE A 221      54.157  67.449  16.869  1.00112.56           C  
ATOM   1704  CD2 PHE A 221      56.013  67.900  15.422  1.00112.98           C  
ATOM   1705  CE1 PHE A 221      54.505  66.096  16.907  1.00111.99           C  
ATOM   1706  CE2 PHE A 221      56.370  66.554  15.455  1.00112.96           C  
ATOM   1707  CZ  PHE A 221      55.610  65.650  16.201  1.00112.10           C  
ATOM   1708  N   THR A 222      54.124  72.631  16.782  1.00110.46           N  
ATOM   1709  CA  THR A 222      53.639  73.985  16.550  1.00109.82           C  
ATOM   1710  C   THR A 222      54.362  74.978  17.466  1.00110.51           C  
ATOM   1711  O   THR A 222      55.127  74.573  18.341  1.00110.54           O  
ATOM   1712  CB  THR A 222      52.119  74.062  16.803  1.00108.78           C  
ATOM   1713  OG1 THR A 222      51.821  73.520  18.094  1.00108.66           O  
ATOM   1714  CG2 THR A 222      51.367  73.269  15.756  1.00107.79           C  
ATOM   1715  N   TYR A 223      54.128  76.274  17.254  1.00111.17           N  
ATOM   1716  CA  TYR A 223      54.745  77.329  18.063  1.00110.99           C  
ATOM   1717  C   TYR A 223      54.041  77.393  19.426  1.00110.41           C  
ATOM   1718  O   TYR A 223      54.671  77.606  20.461  1.00108.45           O  
ATOM   1719  CB  TYR A 223      54.621  78.679  17.346  1.00111.78           C  
ATOM   1720  CG  TYR A 223      53.188  79.170  17.203  1.00113.49           C  
ATOM   1721  CD1 TYR A 223      52.799  80.404  17.734  1.00114.44           C  
ATOM   1722  CD2 TYR A 223      52.211  78.387  16.567  1.00113.15           C  
ATOM   1723  CE1 TYR A 223      51.473  80.851  17.644  1.00115.10           C  
ATOM   1724  CE2 TYR A 223      50.881  78.821  16.469  1.00113.85           C  
ATOM   1725  CZ  TYR A 223      50.519  80.057  17.012  1.00115.14           C  
ATOM   1726  OH  TYR A 223      49.215  80.511  16.939  1.00115.34           O  
ATOM   1727  N   LYS A 224      52.726  77.201  19.409  1.00110.95           N  
ATOM   1728  CA  LYS A 224      51.938  77.223  20.626  1.00112.08           C  
ATOM   1729  C   LYS A 224      52.576  76.363  21.708  1.00113.27           C  
ATOM   1730  O   LYS A 224      52.670  76.777  22.864  1.00113.75           O  
ATOM   1731  CB  LYS A 224      50.518  76.721  20.354  1.00111.53           C  
ATOM   1732  CG  LYS A 224      49.606  77.748  19.721  1.00112.30           C  
ATOM   1733  CD  LYS A 224      48.154  77.295  19.768  1.00113.74           C  
ATOM   1734  CE  LYS A 224      47.211  78.422  19.354  1.00115.13           C  
ATOM   1735  NZ  LYS A 224      45.766  78.056  19.472  1.00115.02           N  
ATOM   1736  N   GLU A 225      53.025  75.172  21.327  1.00114.13           N  
ATOM   1737  CA  GLU A 225      53.627  74.247  22.275  1.00114.89           C  
ATOM   1738  C   GLU A 225      54.823  74.790  23.053  1.00115.11           C  
ATOM   1739  O   GLU A 225      54.920  74.570  24.265  1.00115.17           O  
ATOM   1740  CB  GLU A 225      54.003  72.942  21.568  1.00115.42           C  
ATOM   1741  CG  GLU A 225      52.814  72.253  20.895  1.00117.01           C  
ATOM   1742  CD  GLU A 225      53.057  70.769  20.606  1.00118.48           C  
ATOM   1743  OE1 GLU A 225      53.995  70.437  19.850  1.00119.20           O  
ATOM   1744  OE2 GLU A 225      52.303  69.926  21.138  1.00119.29           O  
ATOM   1745  N   ASP A 226      55.738  75.493  22.391  1.00115.41           N  
ATOM   1746  CA  ASP A 226      56.879  76.019  23.134  1.00116.43           C  
ATOM   1747  C   ASP A 226      56.849  77.527  23.378  1.00115.64           C  
ATOM   1748  O   ASP A 226      57.857  78.232  23.249  1.00115.09           O  
ATOM   1749  CB  ASP A 226      58.221  75.578  22.508  1.00118.70           C  
ATOM   1750  CG  ASP A 226      58.314  75.870  21.031  1.00120.29           C  
ATOM   1751  OD1 ASP A 226      57.448  75.369  20.284  1.00122.80           O  
ATOM   1752  OD2 ASP A 226      59.259  76.587  20.619  1.00120.32           O  
ATOM   1753  N   ALA A 227      55.661  77.995  23.745  1.00115.00           N  
ATOM   1754  CA  ALA A 227      55.410  79.387  24.094  1.00113.56           C  
ATOM   1755  C   ALA A 227      54.936  79.370  25.550  1.00112.74           C  
ATOM   1756  O   ALA A 227      54.023  78.618  25.909  1.00112.49           O  
ATOM   1757  CB  ALA A 227      54.330  79.982  23.198  1.00112.94           C  
ATOM   1758  N   VAL A 228      55.586  80.176  26.386  1.00112.07           N  
ATOM   1759  CA  VAL A 228      55.246  80.289  27.804  1.00110.36           C  
ATOM   1760  C   VAL A 228      54.136  81.343  27.945  1.00109.55           C  
ATOM   1761  O   VAL A 228      54.359  82.535  27.698  1.00109.44           O  
ATOM   1762  CB  VAL A 228      56.492  80.696  28.635  1.00109.76           C  
ATOM   1763  CG1 VAL A 228      57.261  81.814  27.922  1.00109.48           C  
ATOM   1764  CG2 VAL A 228      56.068  81.134  30.028  1.00109.74           C  
ATOM   1765  N   PRO A 229      52.924  80.907  28.346  1.00108.12           N  
ATOM   1766  CA  PRO A 229      51.762  81.783  28.518  1.00106.59           C  
ATOM   1767  C   PRO A 229      51.919  82.872  29.574  1.00104.90           C  
ATOM   1768  O   PRO A 229      52.382  82.609  30.689  1.00104.87           O  
ATOM   1769  CB  PRO A 229      50.654  80.801  28.878  1.00107.10           C  
ATOM   1770  CG  PRO A 229      51.389  79.804  29.717  1.00107.23           C  
ATOM   1771  CD  PRO A 229      52.631  79.563  28.881  1.00108.15           C  
ATOM   1772  N   ILE A 230      51.537  84.093  29.201  1.00102.57           N  
ATOM   1773  CA  ILE A 230      51.582  85.241  30.102  1.00 98.83           C  
ATOM   1774  C   ILE A 230      50.253  85.203  30.846  1.00 96.49           C  
ATOM   1775  O   ILE A 230      49.195  85.007  30.236  1.00 96.49           O  
ATOM   1776  CB  ILE A 230      51.677  86.569  29.328  1.00 99.02           C  
ATOM   1777  CG1 ILE A 230      52.991  86.621  28.546  1.00100.09           C  
ATOM   1778  CG2 ILE A 230      51.563  87.739  30.290  1.00 98.57           C  
ATOM   1779  CD1 ILE A 230      53.165  87.879  27.697  1.00100.07           C  
ATOM   1780  N   LEU A 231      50.308  85.375  32.162  1.00 92.77           N  
ATOM   1781  CA  LEU A 231      49.105  85.340  32.980  1.00 88.33           C  
ATOM   1782  C   LEU A 231      48.380  86.682  33.088  1.00 86.79           C  
ATOM   1783  O   LEU A 231      49.005  87.751  33.058  1.00 86.97           O  
ATOM   1784  CB  LEU A 231      49.460  84.843  34.377  1.00 85.36           C  
ATOM   1785  CG  LEU A 231      49.491  83.332  34.558  1.00 83.57           C  
ATOM   1786  CD1 LEU A 231      50.271  82.991  35.817  1.00 82.45           C  
ATOM   1787  CD2 LEU A 231      48.068  82.796  34.611  1.00 81.85           C  
ATOM   1788  N   PRO A 232      47.040  86.643  33.186  1.00 84.37           N  
ATOM   1789  CA  PRO A 232      46.284  87.888  33.309  1.00 82.50           C  
ATOM   1790  C   PRO A 232      46.610  88.444  34.700  1.00 81.61           C  
ATOM   1791  O   PRO A 232      46.683  87.694  35.688  1.00 82.00           O  
ATOM   1792  CB  PRO A 232      44.837  87.425  33.174  1.00 81.66           C  
ATOM   1793  CG  PRO A 232      44.876  86.057  33.766  1.00 82.11           C  
ATOM   1794  CD  PRO A 232      46.138  85.479  33.180  1.00 83.38           C  
ATOM   1795  N   ARG A 233      46.828  89.750  34.773  1.00 79.62           N  
ATOM   1796  CA  ARG A 233      47.179  90.393  36.027  1.00 77.89           C  
ATOM   1797  C   ARG A 233      46.101  90.386  37.115  1.00 76.21           C  
ATOM   1798  O   ARG A 233      44.895  90.456  36.834  1.00 75.81           O  
ATOM   1799  CB  ARG A 233      47.631  91.822  35.743  1.00 79.81           C  
ATOM   1800  CG  ARG A 233      47.685  92.702  36.957  1.00 82.76           C  
ATOM   1801  CD  ARG A 233      48.580  93.873  36.696  1.00 85.94           C  
ATOM   1802  NE  ARG A 233      49.966  93.560  37.019  1.00 88.96           N  
ATOM   1803  CZ  ARG A 233      51.000  94.302  36.640  1.00 90.70           C  
ATOM   1804  NH1 ARG A 233      50.803  95.401  35.916  1.00 91.56           N  
ATOM   1805  NH2 ARG A 233      52.230  93.954  36.995  1.00 92.00           N  
ATOM   1806  N   CYS A 234      46.565  90.298  38.364  1.00 73.92           N  
ATOM   1807  CA  CYS A 234      45.696  90.284  39.543  1.00 71.14           C  
ATOM   1808  C   CYS A 234      45.634  91.662  40.216  1.00 69.74           C  
ATOM   1809  O   CYS A 234      46.668  92.270  40.517  1.00 70.93           O  
ATOM   1810  CB  CYS A 234      46.195  89.245  40.554  1.00 70.28           C  
ATOM   1811  SG  CYS A 234      45.768  87.523  40.164  1.00 68.96           S  
ATOM   1812  N   ARG A 235      44.420  92.141  40.464  1.00 65.94           N  
ATOM   1813  CA  ARG A 235      44.239  93.448  41.075  1.00 62.27           C  
ATOM   1814  C   ARG A 235      44.204  93.439  42.590  1.00 61.80           C  
ATOM   1815  O   ARG A 235      43.400  92.726  43.208  1.00 61.69           O  
ATOM   1816  CB  ARG A 235      42.948  94.080  40.567  1.00 60.66           C  
ATOM   1817  CG  ARG A 235      42.481  95.281  41.383  1.00 55.86           C  
ATOM   1818  CD  ARG A 235      40.995  95.468  41.257  1.00 51.27           C  
ATOM   1819  NE  ARG A 235      40.273  94.248  41.601  1.00 47.67           N  
ATOM   1820  CZ  ARG A 235      38.964  94.113  41.454  1.00 44.34           C  
ATOM   1821  NH1 ARG A 235      38.267  95.125  40.981  1.00 45.48           N  
ATOM   1822  NH2 ARG A 235      38.356  92.980  41.749  1.00 41.51           N  
ATOM   1823  N   PHE A 236      45.064  94.266  43.184  1.00 60.03           N  
ATOM   1824  CA  PHE A 236      45.127  94.395  44.638  1.00 56.51           C  
ATOM   1825  C   PHE A 236      44.026  95.321  45.178  1.00 57.30           C  
ATOM   1826  O   PHE A 236      43.692  96.354  44.585  1.00 57.23           O  
ATOM   1827  CB  PHE A 236      46.468  94.962  45.045  1.00 51.69           C  
ATOM   1828  CG  PHE A 236      46.664  95.020  46.512  1.00 47.00           C  
ATOM   1829  CD1 PHE A 236      46.995  93.877  47.217  1.00 46.08           C  
ATOM   1830  CD2 PHE A 236      46.538  96.221  47.194  1.00 45.23           C  
ATOM   1831  CE1 PHE A 236      47.205  93.929  48.585  1.00 45.58           C  
ATOM   1832  CE2 PHE A 236      46.745  96.288  48.563  1.00 44.25           C  
ATOM   1833  CZ  PHE A 236      47.082  95.141  49.263  1.00 45.09           C  
ATOM   1834  N   THR A 237      43.476  94.965  46.324  1.00 57.40           N  
ATOM   1835  CA  THR A 237      42.432  95.777  46.914  1.00 57.22           C  
ATOM   1836  C   THR A 237      42.675  96.040  48.388  1.00 57.27           C  
ATOM   1837  O   THR A 237      42.914  95.112  49.168  1.00 57.01           O  
ATOM   1838  CB  THR A 237      41.077  95.090  46.756  1.00 57.22           C  
ATOM   1839  OG1 THR A 237      40.763  95.021  45.366  1.00 58.91           O  
ATOM   1840  CG2 THR A 237      39.988  95.847  47.506  1.00 57.26           C  
ATOM   1841  N   GLY A 238      42.636  97.312  48.765  1.00 57.24           N  
ATOM   1842  CA  GLY A 238      42.797  97.636  50.169  1.00 57.82           C  
ATOM   1843  C   GLY A 238      41.480  97.199  50.790  1.00 58.48           C  
ATOM   1844  O   GLY A 238      40.408  97.654  50.370  1.00 59.47           O  
ATOM   1845  N   SER A 239      41.531  96.291  51.757  1.00 56.73           N  
ATOM   1846  CA  SER A 239      40.301  95.843  52.376  1.00 55.74           C  
ATOM   1847  C   SER A 239      40.567  94.891  53.517  1.00 55.56           C  
ATOM   1848  O   SER A 239      41.704  94.539  53.784  1.00 56.07           O  
ATOM   1849  CB  SER A 239      39.410  95.177  51.333  1.00 55.42           C  
ATOM   1850  OG  SER A 239      40.064  94.078  50.743  1.00 57.17           O  
ATOM   1851  N   GLU A 240      39.516  94.477  54.206  1.00 55.82           N  
ATOM   1852  CA  GLU A 240      39.696  93.570  55.315  1.00 57.17           C  
ATOM   1853  C   GLU A 240      38.674  92.461  55.271  1.00 56.54           C  
ATOM   1854  O   GLU A 240      37.690  92.525  54.530  1.00 57.18           O  
ATOM   1855  CB  GLU A 240      39.587  94.311  56.660  1.00 60.50           C  
ATOM   1856  CG  GLU A 240      38.241  94.996  56.909  1.00 65.66           C  
ATOM   1857  CD  GLU A 240      38.126  95.641  58.295  1.00 68.16           C  
ATOM   1858  OE1 GLU A 240      39.041  96.383  58.705  1.00 69.87           O  
ATOM   1859  OE2 GLU A 240      37.103  95.423  58.974  1.00 70.85           O  
ATOM   1860  N   ILE A 241      38.949  91.431  56.059  1.00 54.44           N  
ATOM   1861  CA  ILE A 241      38.084  90.285  56.206  1.00 53.68           C  
ATOM   1862  C   ILE A 241      38.325  89.878  57.647  1.00 53.68           C  
ATOM   1863  O   ILE A 241      39.474  89.708  58.069  1.00 52.86           O  
ATOM   1864  CB  ILE A 241      38.478  89.155  55.279  1.00 54.57           C  
ATOM   1865  CG1 ILE A 241      37.727  87.890  55.685  1.00 53.94           C  
ATOM   1866  CG2 ILE A 241      39.984  88.967  55.312  1.00 55.39           C  
ATOM   1867  CD1 ILE A 241      38.009  86.722  54.812  1.00 55.21           C  
ATOM   1868  N   ARG A 242      37.236  89.763  58.403  1.00 53.09           N  
ATOM   1869  CA  ARG A 242      37.307  89.438  59.815  1.00 52.86           C  
ATOM   1870  C   ARG A 242      36.542  88.176  60.128  1.00 55.32           C  
ATOM   1871  O   ARG A 242      35.312  88.172  60.096  1.00 58.31           O  
ATOM   1872  CB  ARG A 242      36.720  90.579  60.638  1.00 50.09           C  
ATOM   1873  CG  ARG A 242      37.329  91.922  60.329  1.00 50.79           C  
ATOM   1874  CD  ARG A 242      37.066  92.973  61.406  1.00 50.68           C  
ATOM   1875  NE  ARG A 242      37.980  94.108  61.258  1.00 51.81           N  
ATOM   1876  CZ  ARG A 242      38.403  94.869  62.265  1.00 52.32           C  
ATOM   1877  NH1 ARG A 242      37.988  94.622  63.509  1.00 50.93           N  
ATOM   1878  NH2 ARG A 242      39.264  95.857  62.031  1.00 51.77           N  
ATOM   1879  N   ALA A 243      37.263  87.104  60.428  1.00 55.23           N  
ATOM   1880  CA  ALA A 243      36.624  85.849  60.768  1.00 56.02           C  
ATOM   1881  C   ALA A 243      36.740  85.771  62.274  1.00 58.46           C  
ATOM   1882  O   ALA A 243      37.787  85.405  62.827  1.00 58.69           O  
ATOM   1883  CB  ALA A 243      37.348  84.716  60.129  1.00 57.21           C  
ATOM   1884  N   ARG A 244      35.658  86.122  62.948  1.00 59.31           N  
ATOM   1885  CA  ARG A 244      35.682  86.134  64.391  1.00 59.92           C  
ATOM   1886  C   ARG A 244      35.136  84.900  65.041  1.00 60.83           C  
ATOM   1887  O   ARG A 244      34.141  84.339  64.603  1.00 61.74           O  
ATOM   1888  CB  ARG A 244      34.930  87.342  64.914  1.00 59.94           C  
ATOM   1889  CG  ARG A 244      34.957  87.449  66.415  1.00 59.95           C  
ATOM   1890  CD  ARG A 244      34.465  88.804  66.859  1.00 59.82           C  
ATOM   1891  NE  ARG A 244      34.215  88.835  68.292  1.00 57.91           N  
ATOM   1892  CZ  ARG A 244      33.595  89.830  68.900  1.00 56.20           C  
ATOM   1893  NH1 ARG A 244      33.172  90.864  68.190  1.00 56.43           N  
ATOM   1894  NH2 ARG A 244      33.395  89.789  70.203  1.00 55.89           N  
ATOM   1895  N   ASP A 245      35.812  84.495  66.107  1.00 61.96           N  
ATOM   1896  CA  ASP A 245      35.449  83.328  66.892  1.00 62.77           C  
ATOM   1897  C   ASP A 245      36.073  83.553  68.246  1.00 62.41           C  
ATOM   1898  O   ASP A 245      37.242  83.244  68.442  1.00 63.22           O  
ATOM   1899  CB  ASP A 245      36.023  82.053  66.268  1.00 63.88           C  
ATOM   1900  CG  ASP A 245      35.649  80.810  67.049  1.00 67.06           C  
ATOM   1901  OD1 ASP A 245      34.695  80.886  67.855  1.00 68.86           O  
ATOM   1902  OD2 ASP A 245      36.293  79.756  66.857  1.00 68.30           O  
ATOM   1903  N   ASP A 246      35.311  84.106  69.178  1.00 61.86           N  
ATOM   1904  CA  ASP A 246      35.873  84.366  70.488  1.00 63.36           C  
ATOM   1905  C   ASP A 246      36.266  83.081  71.227  1.00 63.83           C  
ATOM   1906  O   ASP A 246      36.983  83.120  72.240  1.00 63.94           O  
ATOM   1907  CB  ASP A 246      34.907  85.206  71.328  1.00 64.11           C  
ATOM   1908  CG  ASP A 246      34.804  86.647  70.835  1.00 67.29           C  
ATOM   1909  OD1 ASP A 246      35.804  87.197  70.315  1.00 68.25           O  
ATOM   1910  OD2 ASP A 246      33.719  87.246  70.984  1.00 69.81           O  
ATOM   1911  N   ALA A 247      35.828  81.940  70.696  1.00 63.11           N  
ATOM   1912  CA  ALA A 247      36.129  80.653  71.312  1.00 61.44           C  
ATOM   1913  C   ALA A 247      37.572  80.207  71.097  1.00 60.61           C  
ATOM   1914  O   ALA A 247      38.016  79.253  71.731  1.00 60.68           O  
ATOM   1915  CB  ALA A 247      35.173  79.592  70.800  1.00 60.76           C  
ATOM   1916  N   LEU A 248      38.303  80.883  70.206  1.00 59.71           N  
ATOM   1917  CA  LEU A 248      39.712  80.540  69.958  1.00 57.01           C  
ATOM   1918  C   LEU A 248      40.568  81.245  70.994  1.00 57.55           C  
ATOM   1919  O   LEU A 248      40.332  82.416  71.312  1.00 56.71           O  
ATOM   1920  CB  LEU A 248      40.182  80.970  68.564  1.00 53.19           C  
ATOM   1921  CG  LEU A 248      39.535  80.315  67.348  1.00 50.69           C  
ATOM   1922  CD1 LEU A 248      40.328  80.645  66.113  1.00 47.39           C  
ATOM   1923  CD2 LEU A 248      39.469  78.822  67.548  1.00 49.80           C  
ATOM   1924  N   PRO A 249      41.584  80.538  71.523  1.00 58.28           N  
ATOM   1925  CA  PRO A 249      42.552  80.966  72.537  1.00 56.68           C  
ATOM   1926  C   PRO A 249      43.264  82.247  72.209  1.00 55.95           C  
ATOM   1927  O   PRO A 249      43.329  83.144  73.041  1.00 56.39           O  
ATOM   1928  CB  PRO A 249      43.511  79.794  72.614  1.00 56.28           C  
ATOM   1929  CG  PRO A 249      43.486  79.275  71.228  1.00 59.80           C  
ATOM   1930  CD  PRO A 249      42.012  79.258  70.934  1.00 59.48           C  
ATOM   1931  N   VAL A 250      43.821  82.336  71.012  1.00 55.98           N  
ATOM   1932  CA  VAL A 250      44.502  83.567  70.644  1.00 58.00           C  
ATOM   1933  C   VAL A 250      44.046  84.052  69.279  1.00 57.95           C  
ATOM   1934  O   VAL A 250      43.386  83.325  68.534  1.00 59.10           O  
ATOM   1935  CB  VAL A 250      46.039  83.396  70.653  1.00 59.06           C  
ATOM   1936  CG1 VAL A 250      46.471  82.780  71.971  1.00 59.00           C  
ATOM   1937  CG2 VAL A 250      46.496  82.545  69.481  1.00 58.85           C  
ATOM   1938  N   ALA A 251      44.405  85.281  68.950  1.00 56.56           N  
ATOM   1939  CA  ALA A 251      43.997  85.840  67.687  1.00 55.75           C  
ATOM   1940  C   ALA A 251      45.187  86.073  66.746  1.00 55.79           C  
ATOM   1941  O   ALA A 251      46.315  86.347  67.186  1.00 53.41           O  
ATOM   1942  CB  ALA A 251      43.227  87.145  67.943  1.00 54.90           C  
ATOM   1943  N   HIS A 252      44.917  85.939  65.448  1.00 55.73           N  
ATOM   1944  CA  HIS A 252      45.922  86.141  64.414  1.00 55.28           C  
ATOM   1945  C   HIS A 252      45.522  87.319  63.544  1.00 54.94           C  
ATOM   1946  O   HIS A 252      44.365  87.434  63.140  1.00 54.46           O  
ATOM   1947  CB  HIS A 252      46.036  84.916  63.510  1.00 55.95           C  
ATOM   1948  CG  HIS A 252      46.725  83.742  64.139  1.00 57.63           C  
ATOM   1949  ND1 HIS A 252      47.871  83.184  63.612  1.00 57.24           N  
ATOM   1950  CD2 HIS A 252      46.393  82.976  65.206  1.00 57.25           C  
ATOM   1951  CE1 HIS A 252      48.211  82.126  64.324  1.00 55.47           C  
ATOM   1952  NE2 HIS A 252      47.331  81.977  65.298  1.00 55.05           N  
ATOM   1953  N   VAL A 253      46.485  88.184  63.249  1.00 54.24           N  
ATOM   1954  CA  VAL A 253      46.241  89.340  62.402  1.00 53.82           C  
ATOM   1955  C   VAL A 253      47.392  89.457  61.416  1.00 54.74           C  
ATOM   1956  O   VAL A 253      48.541  89.254  61.789  1.00 56.02           O  
ATOM   1957  CB  VAL A 253      46.165  90.637  63.220  1.00 51.99           C  
ATOM   1958  CG1 VAL A 253      46.115  91.815  62.291  1.00 49.82           C  
ATOM   1959  CG2 VAL A 253      44.930  90.632  64.097  1.00 51.69           C  
ATOM   1960  N   ALA A 254      47.072  89.780  60.165  1.00 54.80           N  
ATOM   1961  CA  ALA A 254      48.065  89.939  59.106  1.00 54.11           C  
ATOM   1962  C   ALA A 254      47.679  91.168  58.289  1.00 55.49           C  
ATOM   1963  O   ALA A 254      46.520  91.298  57.876  1.00 57.47           O  
ATOM   1964  CB  ALA A 254      48.064  88.728  58.232  1.00 53.24           C  
ATOM   1965  N   LEU A 255      48.640  92.060  58.048  1.00 54.93           N  
ATOM   1966  CA  LEU A 255      48.392  93.292  57.295  1.00 55.06           C  
ATOM   1967  C   LEU A 255      49.436  93.465  56.197  1.00 57.38           C  
ATOM   1968  O   LEU A 255      50.635  93.301  56.453  1.00 58.46           O  
ATOM   1969  CB  LEU A 255      48.489  94.482  58.222  1.00 53.54           C  
ATOM   1970  CG  LEU A 255      48.021  95.808  57.640  1.00 53.14           C  
ATOM   1971  CD1 LEU A 255      46.509  95.950  57.937  1.00 53.17           C  
ATOM   1972  CD2 LEU A 255      48.819  96.960  58.242  1.00 47.92           C  
ATOM   1973  N   ALA A 256      49.006  93.836  54.991  1.00 57.73           N  
ATOM   1974  CA  ALA A 256      49.968  93.974  53.909  1.00 58.99           C  
ATOM   1975  C   ALA A 256      49.624  94.947  52.798  1.00 59.90           C  
ATOM   1976  O   ALA A 256      48.461  95.232  52.550  1.00 61.28           O  
ATOM   1977  CB  ALA A 256      50.230  92.615  53.312  1.00 59.00           C  
ATOM   1978  N   VAL A 257      50.663  95.438  52.126  1.00 60.02           N  
ATOM   1979  CA  VAL A 257      50.520  96.365  51.015  1.00 61.18           C  
ATOM   1980  C   VAL A 257      50.906  95.593  49.769  1.00 63.29           C  
ATOM   1981  O   VAL A 257      51.413  94.481  49.889  1.00 63.34           O  
ATOM   1982  CB  VAL A 257      51.467  97.545  51.172  1.00 60.02           C  
ATOM   1983  CG1 VAL A 257      51.048  98.388  52.347  1.00 60.70           C  
ATOM   1984  CG2 VAL A 257      52.856  97.045  51.386  1.00 58.08           C  
ATOM   1985  N   GLU A 258      50.688  96.159  48.579  1.00 65.76           N  
ATOM   1986  CA  GLU A 258      51.046  95.429  47.357  1.00 67.02           C  
ATOM   1987  C   GLU A 258      52.538  95.485  47.063  1.00 67.59           C  
ATOM   1988  O   GLU A 258      53.165  96.549  47.147  1.00 64.83           O  
ATOM   1989  CB  GLU A 258      50.283  95.947  46.135  1.00 67.85           C  
ATOM   1990  CG  GLU A 258      50.280  94.940  44.988  1.00 70.45           C  
ATOM   1991  CD  GLU A 258      49.769  95.511  43.666  1.00 73.65           C  
ATOM   1992  OE1 GLU A 258      48.650  96.083  43.636  1.00 74.93           O  
ATOM   1993  OE2 GLU A 258      50.494  95.375  42.647  1.00 74.65           O  
ATOM   1994  N   GLY A 259      53.077  94.316  46.708  1.00 70.39           N  
ATOM   1995  CA  GLY A 259      54.496  94.152  46.399  1.00 73.50           C  
ATOM   1996  C   GLY A 259      54.864  94.329  44.930  1.00 74.86           C  
ATOM   1997  O   GLY A 259      53.993  94.246  44.055  1.00 75.59           O  
ATOM   1998  N   PRO A 260      56.155  94.553  44.627  1.00 75.01           N  
ATOM   1999  CA  PRO A 260      56.648  94.753  43.263  1.00 75.56           C  
ATOM   2000  C   PRO A 260      56.776  93.550  42.317  1.00 75.87           C  
ATOM   2001  O   PRO A 260      56.703  93.726  41.094  1.00 77.25           O  
ATOM   2002  CB  PRO A 260      57.979  95.457  43.493  1.00 75.59           C  
ATOM   2003  CG  PRO A 260      58.469  94.777  44.724  1.00 76.72           C  
ATOM   2004  CD  PRO A 260      57.236  94.773  45.601  1.00 75.64           C  
ATOM   2005  N   GLY A 261      56.963  92.344  42.842  1.00 74.79           N  
ATOM   2006  CA  GLY A 261      57.103  91.209  41.940  1.00 74.07           C  
ATOM   2007  C   GLY A 261      58.567  90.870  41.681  1.00 73.63           C  
ATOM   2008  O   GLY A 261      59.407  91.751  41.484  1.00 72.72           O  
ATOM   2009  N   TRP A 262      58.860  89.573  41.675  1.00 72.93           N  
ATOM   2010  CA  TRP A 262      60.207  89.024  41.496  1.00 71.15           C  
ATOM   2011  C   TRP A 262      61.279  89.877  40.849  1.00 71.90           C  
ATOM   2012  O   TRP A 262      62.337  90.110  41.439  1.00 71.39           O  
ATOM   2013  CB  TRP A 262      60.109  87.692  40.759  1.00 67.39           C  
ATOM   2014  CG  TRP A 262      59.596  86.594  41.642  1.00 64.73           C  
ATOM   2015  CD1 TRP A 262      58.519  85.779  41.415  1.00 64.83           C  
ATOM   2016  CD2 TRP A 262      60.133  86.202  42.901  1.00 62.55           C  
ATOM   2017  NE1 TRP A 262      58.355  84.904  42.462  1.00 62.94           N  
ATOM   2018  CE2 TRP A 262      59.334  85.144  43.387  1.00 62.14           C  
ATOM   2019  CE3 TRP A 262      61.213  86.642  43.668  1.00 63.05           C  
ATOM   2020  CZ2 TRP A 262      59.584  84.521  44.604  1.00 63.52           C  
ATOM   2021  CZ3 TRP A 262      61.464  86.021  44.881  1.00 63.68           C  
ATOM   2022  CH2 TRP A 262      60.653  84.971  45.338  1.00 64.10           C  
ATOM   2023  N   ALA A 263      60.988  90.342  39.642  1.00 72.77           N  
ATOM   2024  CA  ALA A 263      61.911  91.140  38.844  1.00 74.03           C  
ATOM   2025  C   ALA A 263      62.423  92.486  39.388  1.00 76.02           C  
ATOM   2026  O   ALA A 263      63.519  92.921  39.026  1.00 77.82           O  
ATOM   2027  CB  ALA A 263      61.295  91.356  37.463  1.00 72.48           C  
ATOM   2028  N   ASP A 264      61.657  93.148  40.249  1.00 77.14           N  
ATOM   2029  CA  ASP A 264      62.057  94.464  40.745  1.00 76.48           C  
ATOM   2030  C   ASP A 264      63.205  94.468  41.745  1.00 75.46           C  
ATOM   2031  O   ASP A 264      63.176  93.768  42.745  1.00 74.11           O  
ATOM   2032  CB  ASP A 264      60.845  95.184  41.352  1.00 77.16           C  
ATOM   2033  CG  ASP A 264      60.890  96.684  41.139  1.00 77.73           C  
ATOM   2034  OD1 ASP A 264      61.866  97.337  41.576  1.00 77.55           O  
ATOM   2035  OD2 ASP A 264      59.936  97.205  40.526  1.00 78.06           O  
ATOM   2036  N   PRO A 265      64.228  95.288  41.484  1.00 75.95           N  
ATOM   2037  CA  PRO A 265      65.419  95.429  42.330  1.00 76.65           C  
ATOM   2038  C   PRO A 265      65.047  95.866  43.743  1.00 77.73           C  
ATOM   2039  O   PRO A 265      65.732  95.550  44.720  1.00 78.47           O  
ATOM   2040  CB  PRO A 265      66.224  96.515  41.623  1.00 76.30           C  
ATOM   2041  CG  PRO A 265      65.754  96.439  40.205  1.00 76.86           C  
ATOM   2042  CD  PRO A 265      64.289  96.205  40.332  1.00 76.56           C  
ATOM   2043  N   ASP A 266      63.956  96.613  43.839  1.00 77.86           N  
ATOM   2044  CA  ASP A 266      63.504  97.116  45.119  1.00 77.52           C  
ATOM   2045  C   ASP A 266      63.329  95.995  46.138  1.00 76.14           C  
ATOM   2046  O   ASP A 266      63.571  96.191  47.330  1.00 75.08           O  
ATOM   2047  CB  ASP A 266      62.199  97.904  44.936  1.00 80.25           C  
ATOM   2048  CG  ASP A 266      62.399  99.209  44.138  1.00 83.09           C  
ATOM   2049  OD1 ASP A 266      63.539  99.738  44.121  1.00 84.17           O  
ATOM   2050  OD2 ASP A 266      61.415  99.720  43.543  1.00 82.96           O  
ATOM   2051  N   ASN A 267      62.932  94.815  45.669  1.00 74.61           N  
ATOM   2052  CA  ASN A 267      62.731  93.686  46.567  1.00 73.51           C  
ATOM   2053  C   ASN A 267      63.910  93.471  47.498  1.00 73.22           C  
ATOM   2054  O   ASN A 267      63.767  92.918  48.593  1.00 71.94           O  
ATOM   2055  CB  ASN A 267      62.451  92.414  45.776  1.00 72.76           C  
ATOM   2056  CG  ASN A 267      60.979  92.237  45.476  1.00 72.86           C  
ATOM   2057  OD1 ASN A 267      60.169  92.140  46.385  1.00 73.04           O  
ATOM   2058  ND2 ASN A 267      60.626  92.192  44.197  1.00 73.18           N  
ATOM   2059  N   VAL A 268      65.083  93.915  47.069  1.00 74.32           N  
ATOM   2060  CA  VAL A 268      66.262  93.760  47.913  1.00 75.09           C  
ATOM   2061  C   VAL A 268      66.079  94.701  49.114  1.00 74.32           C  
ATOM   2062  O   VAL A 268      66.150  94.278  50.272  1.00 74.46           O  
ATOM   2063  CB  VAL A 268      67.598  94.111  47.147  1.00 74.53           C  
ATOM   2064  CG1 VAL A 268      68.806  93.819  48.045  1.00 71.77           C  
ATOM   2065  CG2 VAL A 268      67.691  93.313  45.850  1.00 71.97           C  
ATOM   2066  N   VAL A 269      65.818  95.974  48.829  1.00 72.92           N  
ATOM   2067  CA  VAL A 269      65.638  96.953  49.888  1.00 70.58           C  
ATOM   2068  C   VAL A 269      64.508  96.524  50.809  1.00 69.71           C  
ATOM   2069  O   VAL A 269      64.638  96.610  52.026  1.00 68.76           O  
ATOM   2070  CB  VAL A 269      65.318  98.344  49.323  1.00 70.41           C  
ATOM   2071  CG1 VAL A 269      65.283  99.350  50.455  1.00 69.96           C  
ATOM   2072  CG2 VAL A 269      66.356  98.745  48.282  1.00 68.61           C  
ATOM   2073  N   LEU A 270      63.403  96.052  50.229  1.00 68.71           N  
ATOM   2074  CA  LEU A 270      62.262  95.611  51.032  1.00 67.31           C  
ATOM   2075  C   LEU A 270      62.703  94.577  52.053  1.00 67.67           C  
ATOM   2076  O   LEU A 270      62.341  94.663  53.227  1.00 68.12           O  
ATOM   2077  CB  LEU A 270      61.142  95.023  50.157  1.00 64.85           C  
ATOM   2078  CG  LEU A 270      60.389  95.976  49.216  1.00 62.13           C  
ATOM   2079  CD1 LEU A 270      59.146  95.299  48.715  1.00 60.22           C  
ATOM   2080  CD2 LEU A 270      60.015  97.238  49.937  1.00 60.85           C  
ATOM   2081  N   HIS A 271      63.493  93.602  51.612  1.00 68.77           N  
ATOM   2082  CA  HIS A 271      63.986  92.559  52.518  1.00 68.75           C  
ATOM   2083  C   HIS A 271      64.915  93.112  53.603  1.00 67.36           C  
ATOM   2084  O   HIS A 271      64.930  92.614  54.728  1.00 65.54           O  
ATOM   2085  CB  HIS A 271      64.683  91.464  51.718  1.00 69.11           C  
ATOM   2086  CG  HIS A 271      63.734  90.506  51.081  1.00 71.63           C  
ATOM   2087  ND1 HIS A 271      63.796  90.173  49.746  1.00 73.27           N  
ATOM   2088  CD2 HIS A 271      62.688  89.814  51.596  1.00 73.80           C  
ATOM   2089  CE1 HIS A 271      62.827  89.317  49.462  1.00 74.41           C  
ATOM   2090  NE2 HIS A 271      62.140  89.083  50.567  1.00 74.80           N  
ATOM   2091  N   VAL A 272      65.680  94.141  53.250  1.00 66.64           N  
ATOM   2092  CA  VAL A 272      66.586  94.797  54.183  1.00 67.67           C  
ATOM   2093  C   VAL A 272      65.727  95.458  55.251  1.00 68.75           C  
ATOM   2094  O   VAL A 272      66.086  95.481  56.440  1.00 67.93           O  
ATOM   2095  CB  VAL A 272      67.420  95.903  53.481  1.00 67.74           C  
ATOM   2096  CG1 VAL A 272      68.199  96.708  54.503  1.00 65.86           C  
ATOM   2097  CG2 VAL A 272      68.361  95.276  52.476  1.00 68.36           C  
ATOM   2098  N   ALA A 273      64.591  96.000  54.800  1.00 69.46           N  
ATOM   2099  CA  ALA A 273      63.631  96.677  55.665  1.00 67.99           C  
ATOM   2100  C   ALA A 273      63.029  95.685  56.651  1.00 68.15           C  
ATOM   2101  O   ALA A 273      62.995  95.947  57.852  1.00 68.51           O  
ATOM   2102  CB  ALA A 273      62.535  97.314  54.834  1.00 67.04           C  
ATOM   2103  N   ASN A 274      62.549  94.548  56.156  1.00 67.43           N  
ATOM   2104  CA  ASN A 274      61.980  93.559  57.054  1.00 68.57           C  
ATOM   2105  C   ASN A 274      63.052  93.089  58.026  1.00 70.10           C  
ATOM   2106  O   ASN A 274      62.748  92.598  59.116  1.00 71.29           O  
ATOM   2107  CB  ASN A 274      61.449  92.372  56.265  1.00 69.01           C  
ATOM   2108  CG  ASN A 274      60.094  92.635  55.669  1.00 69.74           C  
ATOM   2109  OD1 ASN A 274      59.677  91.961  54.725  1.00 70.73           O  
ATOM   2110  ND2 ASN A 274      59.383  93.606  56.223  1.00 70.92           N  
ATOM   2111  N   ALA A 275      64.313  93.243  57.628  1.00 70.59           N  
ATOM   2112  CA  ALA A 275      65.427  92.825  58.470  1.00 69.36           C  
ATOM   2113  C   ALA A 275      65.508  93.716  59.681  1.00 68.55           C  
ATOM   2114  O   ALA A 275      65.842  93.260  60.767  1.00 69.71           O  
ATOM   2115  CB  ALA A 275      66.717  92.892  57.698  1.00 69.73           C  
ATOM   2116  N   ILE A 276      65.207  94.992  59.486  1.00 68.13           N  
ATOM   2117  CA  ILE A 276      65.229  95.966  60.569  1.00 68.59           C  
ATOM   2118  C   ILE A 276      64.118  95.693  61.585  1.00 69.98           C  
ATOM   2119  O   ILE A 276      64.350  95.749  62.797  1.00 71.07           O  
ATOM   2120  CB  ILE A 276      65.065  97.385  60.025  1.00 67.07           C  
ATOM   2121  CG1 ILE A 276      66.129  97.652  58.968  1.00 66.39           C  
ATOM   2122  CG2 ILE A 276      65.199  98.381  61.139  1.00 65.70           C  
ATOM   2123  CD1 ILE A 276      66.150  99.073  58.470  1.00 67.61           C  
ATOM   2124  N   ILE A 277      62.915  95.401  61.095  1.00 71.00           N  
ATOM   2125  CA  ILE A 277      61.789  95.101  61.970  1.00 72.21           C  
ATOM   2126  C   ILE A 277      61.940  93.697  62.539  1.00 72.62           C  
ATOM   2127  O   ILE A 277      61.645  93.458  63.707  1.00 73.48           O  
ATOM   2128  CB  ILE A 277      60.461  95.192  61.217  1.00 73.10           C  
ATOM   2129  CG1 ILE A 277      60.255  96.630  60.750  1.00 74.33           C  
ATOM   2130  CG2 ILE A 277      59.314  94.747  62.112  1.00 73.40           C  
ATOM   2131  CD1 ILE A 277      58.962  96.851  60.037  1.00 75.16           C  
ATOM   2132  N   GLY A 278      62.386  92.770  61.697  1.00 72.48           N  
ATOM   2133  CA  GLY A 278      62.612  91.396  62.125  1.00 73.18           C  
ATOM   2134  C   GLY A 278      61.432  90.510  62.492  1.00 73.19           C  
ATOM   2135  O   GLY A 278      60.387  90.504  61.837  1.00 73.69           O  
ATOM   2136  N   ARG A 279      61.623  89.717  63.536  1.00 72.94           N  
ATOM   2137  CA  ARG A 279      60.577  88.828  64.003  1.00 73.52           C  
ATOM   2138  C   ARG A 279      60.827  88.454  65.463  1.00 72.89           C  
ATOM   2139  O   ARG A 279      61.950  88.569  65.960  1.00 73.81           O  
ATOM   2140  CB  ARG A 279      60.518  87.584  63.130  1.00 75.40           C  
ATOM   2141  CG  ARG A 279      61.788  86.774  63.110  1.00 79.76           C  
ATOM   2142  CD  ARG A 279      61.575  85.498  62.323  1.00 84.28           C  
ATOM   2143  NE  ARG A 279      62.699  84.589  62.489  1.00 89.84           N  
ATOM   2144  CZ  ARG A 279      62.596  83.262  62.509  1.00 93.01           C  
ATOM   2145  NH1 ARG A 279      61.407  82.675  62.373  1.00 93.28           N  
ATOM   2146  NH2 ARG A 279      63.688  82.522  62.681  1.00 94.88           N  
ATOM   2147  N   TYR A 280      59.777  88.028  66.152  1.00 70.82           N  
ATOM   2148  CA  TYR A 280      59.897  87.671  67.548  1.00 69.92           C  
ATOM   2149  C   TYR A 280      59.043  86.467  67.830  1.00 69.93           C  
ATOM   2150  O   TYR A 280      58.250  86.050  67.008  1.00 69.20           O  
ATOM   2151  CB  TYR A 280      59.446  88.836  68.429  1.00 70.71           C  
ATOM   2152  CG  TYR A 280      59.349  88.512  69.908  1.00 72.58           C  
ATOM   2153  CD1 TYR A 280      60.486  88.423  70.704  1.00 73.25           C  
ATOM   2154  CD2 TYR A 280      58.111  88.273  70.509  1.00 74.07           C  
ATOM   2155  CE1 TYR A 280      60.393  88.103  72.060  1.00 74.39           C  
ATOM   2156  CE2 TYR A 280      58.007  87.952  71.863  1.00 74.36           C  
ATOM   2157  CZ  TYR A 280      59.150  87.868  72.629  1.00 75.12           C  
ATOM   2158  OH  TYR A 280      59.050  87.537  73.958  1.00 76.69           O  
ATOM   2159  N   ASP A 281      59.218  85.910  69.011  1.00 71.96           N  
ATOM   2160  CA  ASP A 281      58.465  84.754  69.436  1.00 74.66           C  
ATOM   2161  C   ASP A 281      58.968  84.445  70.854  1.00 76.28           C  
ATOM   2162  O   ASP A 281      60.176  84.341  71.087  1.00 77.39           O  
ATOM   2163  CB  ASP A 281      58.698  83.614  68.442  1.00 75.72           C  
ATOM   2164  CG  ASP A 281      59.033  82.317  69.114  1.00 79.16           C  
ATOM   2165  OD1 ASP A 281      58.238  81.876  69.969  1.00 80.90           O  
ATOM   2166  OD2 ASP A 281      60.094  81.740  68.784  1.00 81.71           O  
ATOM   2167  N   ARG A 282      58.029  84.349  71.796  1.00 77.10           N  
ATOM   2168  CA  ARG A 282      58.309  84.096  73.211  1.00 76.88           C  
ATOM   2169  C   ARG A 282      59.520  83.253  73.616  1.00 75.87           C  
ATOM   2170  O   ARG A 282      59.939  83.301  74.772  1.00 76.62           O  
ATOM   2171  CB  ARG A 282      57.072  83.508  73.885  1.00 79.62           C  
ATOM   2172  CG  ARG A 282      56.051  84.545  74.306  1.00 84.40           C  
ATOM   2173  CD  ARG A 282      55.005  83.939  75.233  1.00 87.83           C  
ATOM   2174  NE  ARG A 282      54.340  82.799  74.610  1.00 91.40           N  
ATOM   2175  CZ  ARG A 282      53.519  81.975  75.255  1.00 93.73           C  
ATOM   2176  NH1 ARG A 282      53.263  82.167  76.551  1.00 93.23           N  
ATOM   2177  NH2 ARG A 282      52.955  80.958  74.607  1.00 94.49           N  
ATOM   2178  N   THR A 283      60.088  82.475  72.705  1.00 73.20           N  
ATOM   2179  CA  THR A 283      61.238  81.674  73.083  1.00 69.88           C  
ATOM   2180  C   THR A 283      62.573  82.372  72.815  1.00 68.02           C  
ATOM   2181  O   THR A 283      63.603  81.955  73.325  1.00 68.74           O  
ATOM   2182  CB  THR A 283      61.224  80.351  72.374  1.00 69.96           C  
ATOM   2183  OG1 THR A 283      61.480  80.571  70.981  1.00 71.80           O  
ATOM   2184  CG2 THR A 283      59.879  79.662  72.588  1.00 66.10           C  
ATOM   2185  N   PHE A 284      62.565  83.421  72.006  1.00 64.66           N  
ATOM   2186  CA  PHE A 284      63.792  84.160  71.759  1.00 63.62           C  
ATOM   2187  C   PHE A 284      64.369  84.531  73.117  1.00 66.14           C  
ATOM   2188  O   PHE A 284      63.715  85.220  73.906  1.00 69.08           O  
ATOM   2189  CB  PHE A 284      63.482  85.431  70.982  1.00 59.63           C  
ATOM   2190  CG  PHE A 284      63.159  85.189  69.546  1.00 54.63           C  
ATOM   2191  CD1 PHE A 284      62.365  84.104  69.177  1.00 50.97           C  
ATOM   2192  CD2 PHE A 284      63.689  86.015  68.559  1.00 51.41           C  
ATOM   2193  CE1 PHE A 284      62.109  83.836  67.859  1.00 48.46           C  
ATOM   2194  CE2 PHE A 284      63.439  85.760  67.238  1.00 50.74           C  
ATOM   2195  CZ  PHE A 284      62.645  84.661  66.881  1.00 51.02           C  
ATOM   2196  N   GLY A 285      65.590  84.091  73.397  1.00 66.72           N  
ATOM   2197  CA  GLY A 285      66.191  84.392  74.689  1.00 65.95           C  
ATOM   2198  C   GLY A 285      66.694  85.811  74.823  1.00 64.62           C  
ATOM   2199  O   GLY A 285      66.747  86.355  75.918  1.00 63.03           O  
ATOM   2200  N   GLY A 286      67.066  86.407  73.700  1.00 65.41           N  
ATOM   2201  CA  GLY A 286      67.567  87.764  73.716  1.00 69.29           C  
ATOM   2202  C   GLY A 286      66.690  88.714  74.504  1.00 72.13           C  
ATOM   2203  O   GLY A 286      67.185  89.722  75.020  1.00 74.57           O  
ATOM   2204  N   GLY A 287      65.392  88.404  74.581  1.00 73.12           N  
ATOM   2205  CA  GLY A 287      64.440  89.221  75.326  1.00 71.79           C  
ATOM   2206  C   GLY A 287      64.417  90.720  75.067  1.00 71.26           C  
ATOM   2207  O   GLY A 287      64.565  91.186  73.939  1.00 70.25           O  
ATOM   2208  N   LYS A 288      64.238  91.473  76.142  1.00 71.23           N  
ATOM   2209  CA  LYS A 288      64.157  92.929  76.088  1.00 73.28           C  
ATOM   2210  C   LYS A 288      65.374  93.638  75.515  1.00 73.76           C  
ATOM   2211  O   LYS A 288      65.433  94.878  75.485  1.00 73.30           O  
ATOM   2212  CB  LYS A 288      63.933  93.461  77.489  1.00 75.73           C  
ATOM   2213  CG  LYS A 288      65.010  92.996  78.443  1.00 77.12           C  
ATOM   2214  CD  LYS A 288      64.884  93.666  79.785  1.00 79.66           C  
ATOM   2215  CE  LYS A 288      65.920  93.124  80.737  1.00 81.30           C  
ATOM   2216  NZ  LYS A 288      65.655  93.602  82.114  1.00 84.41           N  
ATOM   2217  N   HIS A 289      66.353  92.865  75.074  1.00 74.55           N  
ATOM   2218  CA  HIS A 289      67.571  93.455  74.543  1.00 74.67           C  
ATOM   2219  C   HIS A 289      67.709  93.258  73.051  1.00 75.56           C  
ATOM   2220  O   HIS A 289      68.702  93.681  72.443  1.00 76.18           O  
ATOM   2221  CB  HIS A 289      68.774  92.879  75.285  1.00 72.57           C  
ATOM   2222  CG  HIS A 289      68.849  93.320  76.711  1.00 71.18           C  
ATOM   2223  ND1 HIS A 289      68.891  92.433  77.766  1.00 69.60           N  
ATOM   2224  CD2 HIS A 289      68.843  94.561  77.258  1.00 69.17           C  
ATOM   2225  CE1 HIS A 289      68.906  93.109  78.902  1.00 69.95           C  
ATOM   2226  NE2 HIS A 289      68.877  94.401  78.622  1.00 69.66           N  
ATOM   2227  N   LEU A 290      66.707  92.616  72.461  1.00 75.12           N  
ATOM   2228  CA  LEU A 290      66.727  92.394  71.036  1.00 75.28           C  
ATOM   2229  C   LEU A 290      66.878  93.760  70.374  1.00 76.97           C  
ATOM   2230  O   LEU A 290      66.497  94.787  70.948  1.00 77.74           O  
ATOM   2231  CB  LEU A 290      65.448  91.689  70.609  1.00 73.66           C  
ATOM   2232  CG  LEU A 290      65.349  90.279  71.205  1.00 72.38           C  
ATOM   2233  CD1 LEU A 290      64.028  89.650  70.868  1.00 73.38           C  
ATOM   2234  CD2 LEU A 290      66.454  89.425  70.650  1.00 73.28           C  
ATOM   2235  N   SER A 291      67.467  93.779  69.184  1.00 78.53           N  
ATOM   2236  CA  SER A 291      67.691  95.029  68.468  1.00 79.48           C  
ATOM   2237  C   SER A 291      66.417  95.512  67.783  1.00 79.86           C  
ATOM   2238  O   SER A 291      66.248  96.715  67.544  1.00 80.02           O  
ATOM   2239  CB  SER A 291      68.814  94.843  67.449  1.00 80.48           C  
ATOM   2240  OG  SER A 291      70.004  94.405  68.092  1.00 81.41           O  
ATOM   2241  N   SER A 292      65.531  94.563  67.468  1.00 79.53           N  
ATOM   2242  CA  SER A 292      64.246  94.870  66.836  1.00 77.18           C  
ATOM   2243  C   SER A 292      63.371  95.606  67.835  1.00 74.70           C  
ATOM   2244  O   SER A 292      62.931  95.033  68.839  1.00 72.07           O  
ATOM   2245  CB  SER A 292      63.536  93.590  66.410  1.00 78.49           C  
ATOM   2246  OG  SER A 292      62.168  93.851  66.150  1.00 80.08           O  
ATOM   2247  N   ARG A 293      63.118  96.877  67.551  1.00 72.90           N  
ATOM   2248  CA  ARG A 293      62.310  97.705  68.430  1.00 71.89           C  
ATOM   2249  C   ARG A 293      60.960  97.077  68.738  1.00 69.67           C  
ATOM   2250  O   ARG A 293      60.551  97.016  69.905  1.00 68.12           O  
ATOM   2251  CB  ARG A 293      62.102  99.066  67.793  1.00 73.83           C  
ATOM   2252  CG  ARG A 293      63.381  99.724  67.359  1.00 78.34           C  
ATOM   2253  CD  ARG A 293      63.076 100.798  66.350  1.00 82.50           C  
ATOM   2254  NE  ARG A 293      62.032 101.683  66.855  1.00 85.69           N  
ATOM   2255  CZ  ARG A 293      62.212 102.572  67.824  1.00 87.78           C  
ATOM   2256  NH1 ARG A 293      63.407 102.704  68.392  1.00 88.69           N  
ATOM   2257  NH2 ARG A 293      61.191 103.315  68.235  1.00 88.58           N  
ATOM   2258  N   LEU A 294      60.275  96.625  67.686  1.00 66.69           N  
ATOM   2259  CA  LEU A 294      58.975  96.010  67.844  1.00 64.39           C  
ATOM   2260  C   LEU A 294      59.088  94.811  68.767  1.00 64.79           C  
ATOM   2261  O   LEU A 294      58.196  94.565  69.592  1.00 65.53           O  
ATOM   2262  CB  LEU A 294      58.415  95.592  66.491  1.00 63.48           C  
ATOM   2263  CG  LEU A 294      57.018  94.944  66.514  1.00 64.47           C  
ATOM   2264  CD1 LEU A 294      56.052  95.805  67.321  1.00 63.64           C  
ATOM   2265  CD2 LEU A 294      56.496  94.755  65.091  1.00 63.41           C  
ATOM   2266  N   ALA A 295      60.191  94.076  68.640  1.00 64.40           N  
ATOM   2267  CA  ALA A 295      60.436  92.901  69.479  1.00 64.06           C  
ATOM   2268  C   ALA A 295      60.619  93.314  70.945  1.00 64.53           C  
ATOM   2269  O   ALA A 295      60.083  92.678  71.859  1.00 63.12           O  
ATOM   2270  CB  ALA A 295      61.655  92.165  68.989  1.00 63.36           C  
ATOM   2271  N   ALA A 296      61.385  94.383  71.162  1.00 65.27           N  
ATOM   2272  CA  ALA A 296      61.613  94.894  72.508  1.00 65.12           C  
ATOM   2273  C   ALA A 296      60.263  95.266  73.125  1.00 65.27           C  
ATOM   2274  O   ALA A 296      59.943  94.816  74.231  1.00 65.91           O  
ATOM   2275  CB  ALA A 296      62.521  96.115  72.462  1.00 64.00           C  
ATOM   2276  N   LEU A 297      59.484  96.086  72.411  1.00 63.39           N  
ATOM   2277  CA  LEU A 297      58.173  96.501  72.885  1.00 61.12           C  
ATOM   2278  C   LEU A 297      57.339  95.260  73.130  1.00 61.77           C  
ATOM   2279  O   LEU A 297      56.714  95.105  74.187  1.00 62.86           O  
ATOM   2280  CB  LEU A 297      57.483  97.380  71.852  1.00 59.67           C  
ATOM   2281  CG  LEU A 297      58.096  98.763  71.658  1.00 58.79           C  
ATOM   2282  CD1 LEU A 297      57.471  99.497  70.464  1.00 56.90           C  
ATOM   2283  CD2 LEU A 297      57.882  99.532  72.938  1.00 58.40           C  
ATOM   2284  N   ALA A 298      57.330  94.367  72.151  1.00 60.61           N  
ATOM   2285  CA  ALA A 298      56.572  93.143  72.297  1.00 61.52           C  
ATOM   2286  C   ALA A 298      56.897  92.509  73.650  1.00 62.64           C  
ATOM   2287  O   ALA A 298      56.014  92.074  74.378  1.00 62.40           O  
ATOM   2288  CB  ALA A 298      56.916  92.201  71.179  1.00 59.71           C  
ATOM   2289  N   VAL A 299      58.181  92.480  73.982  1.00 65.68           N  
ATOM   2290  CA  VAL A 299      58.666  91.900  75.242  1.00 67.36           C  
ATOM   2291  C   VAL A 299      58.218  92.736  76.455  1.00 68.45           C  
ATOM   2292  O   VAL A 299      57.497  92.250  77.340  1.00 66.75           O  
ATOM   2293  CB  VAL A 299      60.232  91.808  75.228  1.00 66.14           C  
ATOM   2294  CG1 VAL A 299      60.730  91.166  76.488  1.00 63.65           C  
ATOM   2295  CG2 VAL A 299      60.703  91.009  74.022  1.00 66.37           C  
ATOM   2296  N   GLU A 300      58.668  93.993  76.469  1.00 69.87           N  
ATOM   2297  CA  GLU A 300      58.373  94.963  77.519  1.00 71.34           C  
ATOM   2298  C   GLU A 300      56.896  95.026  77.887  1.00 71.61           C  
ATOM   2299  O   GLU A 300      56.550  94.968  79.062  1.00 72.95           O  
ATOM   2300  CB  GLU A 300      58.868  96.347  77.079  1.00 72.74           C  
ATOM   2301  CG  GLU A 300      58.417  97.530  77.933  1.00 78.59           C  
ATOM   2302  CD  GLU A 300      58.958  98.893  77.409  1.00 83.96           C  
ATOM   2303  OE1 GLU A 300      59.073  99.061  76.167  1.00 86.26           O  
ATOM   2304  OE2 GLU A 300      59.255  99.805  78.231  1.00 85.44           O  
ATOM   2305  N   HIS A 301      56.024  95.124  76.891  1.00 70.53           N  
ATOM   2306  CA  HIS A 301      54.601  95.222  77.158  1.00 69.30           C  
ATOM   2307  C   HIS A 301      53.790  93.965  76.928  1.00 70.77           C  
ATOM   2308  O   HIS A 301      52.564  94.037  76.829  1.00 71.99           O  
ATOM   2309  CB  HIS A 301      54.003  96.322  76.319  1.00 67.28           C  
ATOM   2310  CG  HIS A 301      54.666  97.641  76.508  1.00 67.71           C  
ATOM   2311  ND1 HIS A 301      54.618  98.331  77.699  1.00 68.06           N  
ATOM   2312  CD2 HIS A 301      55.382  98.409  75.651  1.00 68.17           C  
ATOM   2313  CE1 HIS A 301      55.275  99.471  77.566  1.00 68.84           C  
ATOM   2314  NE2 HIS A 301      55.748  99.543  76.333  1.00 68.36           N  
ATOM   2315  N   LYS A 302      54.453  92.817  76.847  1.00 71.90           N  
ATOM   2316  CA  LYS A 302      53.753  91.549  76.618  1.00 71.26           C  
ATOM   2317  C   LYS A 302      52.728  91.748  75.503  1.00 69.41           C  
ATOM   2318  O   LYS A 302      51.542  91.454  75.671  1.00 70.25           O  
ATOM   2319  CB  LYS A 302      53.053  91.099  77.908  1.00 73.90           C  
ATOM   2320  CG  LYS A 302      53.978  90.968  79.128  1.00 77.64           C  
ATOM   2321  CD  LYS A 302      54.950  89.780  78.980  1.00 82.17           C  
ATOM   2322  CE  LYS A 302      56.054  89.785  80.047  1.00 83.11           C  
ATOM   2323  NZ  LYS A 302      56.947  90.995  79.964  1.00 82.88           N  
ATOM   2324  N   LEU A 303      53.208  92.258  74.370  1.00 67.08           N  
ATOM   2325  CA  LEU A 303      52.374  92.546  73.210  1.00 64.88           C  
ATOM   2326  C   LEU A 303      51.882  91.354  72.400  1.00 65.48           C  
ATOM   2327  O   LEU A 303      50.781  91.385  71.862  1.00 65.37           O  
ATOM   2328  CB  LEU A 303      53.107  93.512  72.281  1.00 60.90           C  
ATOM   2329  CG  LEU A 303      53.291  94.900  72.887  1.00 58.86           C  
ATOM   2330  CD1 LEU A 303      53.944  95.836  71.894  1.00 57.98           C  
ATOM   2331  CD2 LEU A 303      51.934  95.445  73.279  1.00 59.37           C  
ATOM   2332  N   CYS A 304      52.676  90.297  72.314  1.00 66.71           N  
ATOM   2333  CA  CYS A 304      52.257  89.151  71.521  1.00 67.63           C  
ATOM   2334  C   CYS A 304      52.996  87.871  71.863  1.00 67.56           C  
ATOM   2335  O   CYS A 304      53.899  87.863  72.696  1.00 69.09           O  
ATOM   2336  CB  CYS A 304      52.488  89.455  70.047  1.00 68.23           C  
ATOM   2337  SG  CYS A 304      54.219  89.845  69.717  1.00 68.03           S  
ATOM   2338  N   HIS A 305      52.591  86.794  71.201  1.00 66.29           N  
ATOM   2339  CA  HIS A 305      53.199  85.483  71.360  1.00 64.77           C  
ATOM   2340  C   HIS A 305      54.260  85.325  70.261  1.00 64.99           C  
ATOM   2341  O   HIS A 305      55.169  84.490  70.374  1.00 64.75           O  
ATOM   2342  CB  HIS A 305      52.152  84.391  71.162  1.00 63.81           C  
ATOM   2343  CG  HIS A 305      51.169  84.268  72.279  1.00 62.46           C  
ATOM   2344  ND1 HIS A 305      51.187  83.217  73.170  1.00 62.88           N  
ATOM   2345  CD2 HIS A 305      50.119  85.042  72.634  1.00 62.73           C  
ATOM   2346  CE1 HIS A 305      50.191  83.348  74.026  1.00 61.73           C  
ATOM   2347  NE2 HIS A 305      49.526  84.447  73.722  1.00 62.64           N  
ATOM   2348  N   SER A 306      54.118  86.121  69.197  1.00 63.68           N  
ATOM   2349  CA  SER A 306      55.024  86.066  68.054  1.00 63.25           C  
ATOM   2350  C   SER A 306      54.602  87.009  66.940  1.00 62.96           C  
ATOM   2351  O   SER A 306      53.463  87.456  66.900  1.00 65.07           O  
ATOM   2352  CB  SER A 306      55.043  84.658  67.470  1.00 63.40           C  
ATOM   2353  OG  SER A 306      53.818  84.384  66.811  1.00 62.08           O  
ATOM   2354  N   PHE A 307      55.522  87.298  66.028  1.00 61.42           N  
ATOM   2355  CA  PHE A 307      55.225  88.154  64.897  1.00 61.04           C  
ATOM   2356  C   PHE A 307      56.310  87.983  63.859  1.00 61.48           C  
ATOM   2357  O   PHE A 307      57.442  87.672  64.192  1.00 61.39           O  
ATOM   2358  CB  PHE A 307      55.088  89.620  65.330  1.00 60.17           C  
ATOM   2359  CG  PHE A 307      56.384  90.387  65.383  1.00 60.41           C  
ATOM   2360  CD1 PHE A 307      57.038  90.772  64.216  1.00 60.03           C  
ATOM   2361  CD2 PHE A 307      56.916  90.793  66.601  1.00 61.08           C  
ATOM   2362  CE1 PHE A 307      58.198  91.559  64.258  1.00 57.63           C  
ATOM   2363  CE2 PHE A 307      58.073  91.578  66.652  1.00 59.68           C  
ATOM   2364  CZ  PHE A 307      58.711  91.959  65.474  1.00 58.41           C  
ATOM   2365  N   GLN A 308      55.952  88.182  62.595  1.00 62.87           N  
ATOM   2366  CA  GLN A 308      56.880  88.025  61.490  1.00 63.41           C  
ATOM   2367  C   GLN A 308      56.597  88.999  60.370  1.00 64.34           C  
ATOM   2368  O   GLN A 308      55.450  89.339  60.106  1.00 64.87           O  
ATOM   2369  CB  GLN A 308      56.782  86.614  60.929  1.00 64.41           C  
ATOM   2370  CG  GLN A 308      55.354  86.188  60.580  1.00 66.55           C  
ATOM   2371  CD  GLN A 308      55.267  84.742  60.082  1.00 69.75           C  
ATOM   2372  OE1 GLN A 308      54.192  84.133  60.074  1.00 69.97           O  
ATOM   2373  NE2 GLN A 308      56.404  84.189  59.658  1.00 72.83           N  
ATOM   2374  N   THR A 309      57.663  89.451  59.721  1.00 65.00           N  
ATOM   2375  CA  THR A 309      57.557  90.354  58.587  1.00 64.71           C  
ATOM   2376  C   THR A 309      57.683  89.411  57.403  1.00 64.48           C  
ATOM   2377  O   THR A 309      58.085  88.261  57.569  1.00 64.87           O  
ATOM   2378  CB  THR A 309      58.727  91.357  58.544  1.00 65.07           C  
ATOM   2379  OG1 THR A 309      59.961  90.635  58.504  1.00 66.19           O  
ATOM   2380  CG2 THR A 309      58.719  92.260  59.769  1.00 64.38           C  
ATOM   2381  N   PHE A 310      57.330  89.868  56.214  1.00 64.65           N  
ATOM   2382  CA  PHE A 310      57.447  89.007  55.051  1.00 65.62           C  
ATOM   2383  C   PHE A 310      57.363  89.804  53.777  1.00 65.19           C  
ATOM   2384  O   PHE A 310      56.779  90.885  53.745  1.00 64.91           O  
ATOM   2385  CB  PHE A 310      56.362  87.908  55.052  1.00 67.72           C  
ATOM   2386  CG  PHE A 310      54.937  88.431  55.011  1.00 70.14           C  
ATOM   2387  CD1 PHE A 310      54.151  88.437  56.157  1.00 70.04           C  
ATOM   2388  CD2 PHE A 310      54.396  88.943  53.836  1.00 70.27           C  
ATOM   2389  CE1 PHE A 310      52.855  88.945  56.136  1.00 69.80           C  
ATOM   2390  CE2 PHE A 310      53.102  89.451  53.815  1.00 70.91           C  
ATOM   2391  CZ  PHE A 310      52.332  89.452  54.971  1.00 70.04           C  
ATOM   2392  N   ASN A 311      57.973  89.272  52.727  1.00 65.23           N  
ATOM   2393  CA  ASN A 311      57.937  89.921  51.435  1.00 64.59           C  
ATOM   2394  C   ASN A 311      57.690  88.856  50.396  1.00 62.66           C  
ATOM   2395  O   ASN A 311      58.578  88.496  49.634  1.00 63.75           O  
ATOM   2396  CB  ASN A 311      59.242  90.646  51.141  1.00 67.64           C  
ATOM   2397  CG  ASN A 311      59.222  91.325  49.784  1.00 71.45           C  
ATOM   2398  OD1 ASN A 311      58.155  91.686  49.277  1.00 74.28           O  
ATOM   2399  ND2 ASN A 311      60.397  91.510  49.188  1.00 73.13           N  
ATOM   2400  N   THR A 312      56.471  88.339  50.392  1.00 60.66           N  
ATOM   2401  CA  THR A 312      56.086  87.303  49.458  1.00 59.83           C  
ATOM   2402  C   THR A 312      55.938  87.850  48.057  1.00 61.08           C  
ATOM   2403  O   THR A 312      55.032  88.647  47.788  1.00 62.64           O  
ATOM   2404  CB  THR A 312      54.781  86.673  49.871  1.00 58.10           C  
ATOM   2405  OG1 THR A 312      55.005  85.857  51.026  1.00 59.07           O  
ATOM   2406  CG2 THR A 312      54.216  85.836  48.737  1.00 58.14           C  
ATOM   2407  N   SER A 313      56.823  87.408  47.161  1.00 60.79           N  
ATOM   2408  CA  SER A 313      56.806  87.874  45.782  1.00 58.80           C  
ATOM   2409  C   SER A 313      56.136  86.924  44.822  1.00 57.64           C  
ATOM   2410  O   SER A 313      55.961  85.754  45.122  1.00 56.34           O  
ATOM   2411  CB  SER A 313      58.230  88.165  45.312  1.00 57.25           C  
ATOM   2412  OG  SER A 313      58.663  89.423  45.802  1.00 56.90           O  
ATOM   2413  N   TYR A 314      55.732  87.467  43.680  1.00 57.94           N  
ATOM   2414  CA  TYR A 314      55.107  86.707  42.605  1.00 59.53           C  
ATOM   2415  C   TYR A 314      55.597  87.307  41.280  1.00 60.36           C  
ATOM   2416  O   TYR A 314      56.253  88.359  41.253  1.00 59.89           O  
ATOM   2417  CB  TYR A 314      53.579  86.801  42.680  1.00 60.40           C  
ATOM   2418  CG  TYR A 314      52.948  86.015  43.806  1.00 61.16           C  
ATOM   2419  CD1 TYR A 314      51.871  86.532  44.516  1.00 63.07           C  
ATOM   2420  CD2 TYR A 314      53.444  84.777  44.184  1.00 60.63           C  
ATOM   2421  CE1 TYR A 314      51.308  85.839  45.591  1.00 63.82           C  
ATOM   2422  CE2 TYR A 314      52.890  84.073  45.250  1.00 62.80           C  
ATOM   2423  CZ  TYR A 314      51.824  84.610  45.959  1.00 63.69           C  
ATOM   2424  OH  TYR A 314      51.313  83.938  47.059  1.00 63.33           O  
ATOM   2425  N   SER A 315      55.277  86.646  40.182  1.00 60.48           N  
ATOM   2426  CA  SER A 315      55.691  87.133  38.883  1.00 63.04           C  
ATOM   2427  C   SER A 315      55.476  88.637  38.657  1.00 65.33           C  
ATOM   2428  O   SER A 315      56.437  89.389  38.451  1.00 66.89           O  
ATOM   2429  CB  SER A 315      54.951  86.357  37.808  1.00 62.15           C  
ATOM   2430  OG  SER A 315      53.571  86.391  38.070  1.00 62.90           O  
ATOM   2431  N   ASP A 316      54.212  89.060  38.703  1.00 67.37           N  
ATOM   2432  CA  ASP A 316      53.812  90.450  38.462  1.00 68.28           C  
ATOM   2433  C   ASP A 316      53.391  91.276  39.700  1.00 68.78           C  
ATOM   2434  O   ASP A 316      53.166  92.486  39.594  1.00 69.71           O  
ATOM   2435  CB  ASP A 316      52.658  90.451  37.460  1.00 68.47           C  
ATOM   2436  CG  ASP A 316      51.458  89.697  37.982  1.00 70.64           C  
ATOM   2437  OD1 ASP A 316      51.593  88.491  38.248  1.00 70.78           O  
ATOM   2438  OD2 ASP A 316      50.382  90.303  38.151  1.00 74.21           O  
ATOM   2439  N   THR A 317      53.287  90.644  40.864  1.00 68.32           N  
ATOM   2440  CA  THR A 317      52.855  91.359  42.066  1.00 67.81           C  
ATOM   2441  C   THR A 317      53.522  90.800  43.327  1.00 66.64           C  
ATOM   2442  O   THR A 317      54.642  90.293  43.255  1.00 67.52           O  
ATOM   2443  CB  THR A 317      51.299  91.278  42.204  1.00 68.81           C  
ATOM   2444  OG1 THR A 317      50.859  92.131  43.269  1.00 70.23           O  
ATOM   2445  CG2 THR A 317      50.856  89.846  42.482  1.00 67.68           C  
ATOM   2446  N   GLY A 318      52.842  90.902  44.473  1.00 64.79           N  
ATOM   2447  CA  GLY A 318      53.382  90.396  45.735  1.00 62.45           C  
ATOM   2448  C   GLY A 318      52.685  90.955  46.970  1.00 61.04           C  
ATOM   2449  O   GLY A 318      51.781  91.779  46.841  1.00 63.35           O  
ATOM   2450  N   LEU A 319      53.085  90.513  48.162  1.00 58.00           N  
ATOM   2451  CA  LEU A 319      52.490  90.995  49.418  1.00 56.34           C  
ATOM   2452  C   LEU A 319      53.567  91.365  50.418  1.00 56.61           C  
ATOM   2453  O   LEU A 319      54.377  90.534  50.789  1.00 59.85           O  
ATOM   2454  CB  LEU A 319      51.604  89.928  50.054  1.00 54.00           C  
ATOM   2455  CG  LEU A 319      50.299  89.640  49.341  1.00 53.14           C  
ATOM   2456  CD1 LEU A 319      49.479  88.673  50.174  1.00 52.39           C  
ATOM   2457  CD2 LEU A 319      49.553  90.942  49.127  1.00 51.28           C  
ATOM   2458  N   PHE A 320      53.568  92.601  50.881  1.00 55.90           N  
ATOM   2459  CA  PHE A 320      54.588  93.045  51.816  1.00 55.96           C  
ATOM   2460  C   PHE A 320      53.874  93.378  53.095  1.00 55.78           C  
ATOM   2461  O   PHE A 320      53.006  94.243  53.101  1.00 56.28           O  
ATOM   2462  CB  PHE A 320      55.276  94.294  51.248  1.00 58.33           C  
ATOM   2463  CG  PHE A 320      56.352  94.863  52.124  1.00 61.10           C  
ATOM   2464  CD1 PHE A 320      57.695  94.640  51.837  1.00 63.75           C  
ATOM   2465  CD2 PHE A 320      56.027  95.602  53.251  1.00 61.87           C  
ATOM   2466  CE1 PHE A 320      58.700  95.144  52.671  1.00 64.51           C  
ATOM   2467  CE2 PHE A 320      57.025  96.108  54.087  1.00 63.79           C  
ATOM   2468  CZ  PHE A 320      58.362  95.877  53.796  1.00 63.14           C  
ATOM   2469  N   GLY A 321      54.217  92.702  54.181  1.00 55.77           N  
ATOM   2470  CA  GLY A 321      53.537  93.007  55.421  1.00 57.21           C  
ATOM   2471  C   GLY A 321      54.017  92.284  56.661  1.00 57.44           C  
ATOM   2472  O   GLY A 321      55.196  91.963  56.797  1.00 57.83           O  
ATOM   2473  N   PHE A 322      53.091  92.067  57.589  1.00 56.43           N  
ATOM   2474  CA  PHE A 322      53.410  91.383  58.824  1.00 55.55           C  
ATOM   2475  C   PHE A 322      52.206  90.601  59.371  1.00 55.89           C  
ATOM   2476  O   PHE A 322      51.051  90.811  58.970  1.00 55.20           O  
ATOM   2477  CB  PHE A 322      53.967  92.376  59.862  1.00 54.10           C  
ATOM   2478  CG  PHE A 322      53.024  93.490  60.228  1.00 53.80           C  
ATOM   2479  CD1 PHE A 322      51.973  93.278  61.127  1.00 53.71           C  
ATOM   2480  CD2 PHE A 322      53.197  94.759  59.695  1.00 53.49           C  
ATOM   2481  CE1 PHE A 322      51.109  94.313  61.491  1.00 50.98           C  
ATOM   2482  CE2 PHE A 322      52.339  95.805  60.050  1.00 53.24           C  
ATOM   2483  CZ  PHE A 322      51.292  95.576  60.953  1.00 52.05           C  
ATOM   2484  N   HIS A 323      52.503  89.677  60.277  1.00 54.70           N  
ATOM   2485  CA  HIS A 323      51.506  88.823  60.867  1.00 53.96           C  
ATOM   2486  C   HIS A 323      51.901  88.559  62.293  1.00 54.39           C  
ATOM   2487  O   HIS A 323      53.011  88.145  62.554  1.00 56.73           O  
ATOM   2488  CB  HIS A 323      51.442  87.509  60.088  1.00 53.87           C  
ATOM   2489  CG  HIS A 323      50.868  86.363  60.864  1.00 57.25           C  
ATOM   2490  ND1 HIS A 323      51.639  85.533  61.649  1.00 59.25           N  
ATOM   2491  CD2 HIS A 323      49.599  85.895  60.963  1.00 59.43           C  
ATOM   2492  CE1 HIS A 323      50.872  84.602  62.192  1.00 60.16           C  
ATOM   2493  NE2 HIS A 323      49.628  84.799  61.793  1.00 58.92           N  
ATOM   2494  N   PHE A 324      50.994  88.811  63.224  1.00 54.32           N  
ATOM   2495  CA  PHE A 324      51.292  88.565  64.612  1.00 52.99           C  
ATOM   2496  C   PHE A 324      50.192  87.761  65.262  1.00 54.47           C  
ATOM   2497  O   PHE A 324      49.063  87.708  64.772  1.00 54.41           O  
ATOM   2498  CB  PHE A 324      51.514  89.879  65.345  1.00 52.40           C  
ATOM   2499  CG  PHE A 324      50.306  90.783  65.396  1.00 52.64           C  
ATOM   2500  CD1 PHE A 324      49.230  90.487  66.229  1.00 52.32           C  
ATOM   2501  CD2 PHE A 324      50.282  91.978  64.674  1.00 52.03           C  
ATOM   2502  CE1 PHE A 324      48.151  91.368  66.350  1.00 51.81           C  
ATOM   2503  CE2 PHE A 324      49.208  92.866  64.785  1.00 53.01           C  
ATOM   2504  CZ  PHE A 324      48.140  92.560  65.628  1.00 52.78           C  
ATOM   2505  N   VAL A 325      50.550  87.122  66.368  1.00 56.02           N  
ATOM   2506  CA  VAL A 325      49.644  86.286  67.147  1.00 57.52           C  
ATOM   2507  C   VAL A 325      49.600  86.854  68.563  1.00 58.82           C  
ATOM   2508  O   VAL A 325      50.633  86.930  69.225  1.00 59.51           O  
ATOM   2509  CB  VAL A 325      50.169  84.838  67.224  1.00 56.53           C  
ATOM   2510  CG1 VAL A 325      49.175  83.960  67.971  1.00 57.64           C  
ATOM   2511  CG2 VAL A 325      50.427  84.305  65.825  1.00 55.26           C  
ATOM   2512  N   ALA A 326      48.421  87.255  69.031  1.00 59.64           N  
ATOM   2513  CA  ALA A 326      48.322  87.814  70.375  1.00 60.70           C  
ATOM   2514  C   ALA A 326      47.073  87.411  71.140  1.00 62.18           C  
ATOM   2515  O   ALA A 326      46.185  86.745  70.607  1.00 63.00           O  
ATOM   2516  CB  ALA A 326      48.408  89.309  70.309  1.00 59.85           C  
ATOM   2517  N   ASP A 327      47.029  87.807  72.405  1.00 63.00           N  
ATOM   2518  CA  ASP A 327      45.888  87.514  73.250  1.00 64.74           C  
ATOM   2519  C   ASP A 327      44.852  88.561  72.925  1.00 62.91           C  
ATOM   2520  O   ASP A 327      45.186  89.683  72.558  1.00 62.12           O  
ATOM   2521  CB  ASP A 327      46.273  87.629  74.718  1.00 70.97           C  
ATOM   2522  CG  ASP A 327      47.522  86.833  75.052  1.00 76.80           C  
ATOM   2523  OD1 ASP A 327      47.405  85.601  75.282  1.00 78.82           O  
ATOM   2524  OD2 ASP A 327      48.624  87.447  75.064  1.00 80.18           O  
ATOM   2525  N   PRO A 328      43.574  88.215  73.071  1.00 61.71           N  
ATOM   2526  CA  PRO A 328      42.519  89.166  72.771  1.00 61.51           C  
ATOM   2527  C   PRO A 328      42.737  90.596  73.248  1.00 62.34           C  
ATOM   2528  O   PRO A 328      42.494  91.532  72.487  1.00 64.96           O  
ATOM   2529  CB  PRO A 328      41.286  88.514  73.389  1.00 60.35           C  
ATOM   2530  CG  PRO A 328      41.848  87.627  74.422  1.00 60.59           C  
ATOM   2531  CD  PRO A 328      43.013  87.033  73.729  1.00 60.85           C  
ATOM   2532  N   LEU A 329      43.224  90.787  74.468  1.00 61.17           N  
ATOM   2533  CA  LEU A 329      43.378  92.148  74.972  1.00 61.94           C  
ATOM   2534  C   LEU A 329      44.678  92.909  74.694  1.00 63.30           C  
ATOM   2535  O   LEU A 329      44.912  93.990  75.244  1.00 64.51           O  
ATOM   2536  CB  LEU A 329      43.052  92.162  76.466  1.00 61.10           C  
ATOM   2537  CG  LEU A 329      41.653  91.569  76.680  1.00 61.00           C  
ATOM   2538  CD1 LEU A 329      41.379  91.310  78.133  1.00 61.42           C  
ATOM   2539  CD2 LEU A 329      40.632  92.512  76.118  1.00 61.16           C  
ATOM   2540  N   SER A 330      45.533  92.376  73.841  1.00 63.46           N  
ATOM   2541  CA  SER A 330      46.743  93.112  73.540  1.00 64.10           C  
ATOM   2542  C   SER A 330      46.823  93.341  72.035  1.00 63.86           C  
ATOM   2543  O   SER A 330      47.836  93.828  71.520  1.00 64.16           O  
ATOM   2544  CB  SER A 330      47.980  92.364  74.068  1.00 65.16           C  
ATOM   2545  OG  SER A 330      48.086  91.045  73.554  1.00 68.17           O  
ATOM   2546  N   ILE A 331      45.734  93.018  71.335  1.00 62.63           N  
ATOM   2547  CA  ILE A 331      45.708  93.179  69.888  1.00 60.74           C  
ATOM   2548  C   ILE A 331      45.891  94.599  69.466  1.00 60.25           C  
ATOM   2549  O   ILE A 331      46.662  94.864  68.563  1.00 60.55           O  
ATOM   2550  CB  ILE A 331      44.405  92.750  69.236  1.00 59.67           C  
ATOM   2551  CG1 ILE A 331      44.082  91.303  69.550  1.00 60.56           C  
ATOM   2552  CG2 ILE A 331      44.550  92.859  67.748  1.00 59.00           C  
ATOM   2553  CD1 ILE A 331      42.796  90.836  68.890  1.00 61.84           C  
ATOM   2554  N   ASP A 332      45.184  95.525  70.098  1.00 61.23           N  
ATOM   2555  CA  ASP A 332      45.324  96.903  69.661  1.00 63.97           C  
ATOM   2556  C   ASP A 332      46.727  97.491  69.857  1.00 63.15           C  
ATOM   2557  O   ASP A 332      47.322  98.020  68.915  1.00 61.88           O  
ATOM   2558  CB  ASP A 332      44.260  97.813  70.304  1.00 65.92           C  
ATOM   2559  CG  ASP A 332      44.326  99.261  69.757  1.00 69.58           C  
ATOM   2560  OD1 ASP A 332      44.374  99.430  68.504  1.00 72.47           O  
ATOM   2561  OD2 ASP A 332      44.339 100.230  70.564  1.00 68.18           O  
ATOM   2562  N   ASP A 333      47.266  97.390  71.060  1.00 63.24           N  
ATOM   2563  CA  ASP A 333      48.585  97.936  71.293  1.00 65.30           C  
ATOM   2564  C   ASP A 333      49.627  97.364  70.338  1.00 64.85           C  
ATOM   2565  O   ASP A 333      50.495  98.094  69.865  1.00 65.21           O  
ATOM   2566  CB  ASP A 333      49.005  97.672  72.729  1.00 70.40           C  
ATOM   2567  CG  ASP A 333      48.118  98.376  73.726  1.00 74.09           C  
ATOM   2568  OD1 ASP A 333      48.124  99.627  73.736  1.00 76.80           O  
ATOM   2569  OD2 ASP A 333      47.412  97.676  74.489  1.00 77.31           O  
ATOM   2570  N   MET A 334      49.552  96.064  70.055  1.00 62.87           N  
ATOM   2571  CA  MET A 334      50.505  95.431  69.148  1.00 60.53           C  
ATOM   2572  C   MET A 334      50.414  96.070  67.772  1.00 60.03           C  
ATOM   2573  O   MET A 334      51.406  96.552  67.235  1.00 60.47           O  
ATOM   2574  CB  MET A 334      50.227  93.933  69.035  1.00 60.12           C  
ATOM   2575  CG  MET A 334      51.116  93.185  68.032  1.00 61.62           C  
ATOM   2576  SD  MET A 334      52.875  93.035  68.503  1.00 63.89           S  
ATOM   2577  CE  MET A 334      53.695  93.361  66.993  1.00 63.22           C  
ATOM   2578  N   MET A 335      49.212  96.079  67.211  1.00 60.43           N  
ATOM   2579  CA  MET A 335      48.967  96.650  65.887  1.00 60.25           C  
ATOM   2580  C   MET A 335      49.473  98.084  65.838  1.00 59.65           C  
ATOM   2581  O   MET A 335      50.111  98.523  64.883  1.00 58.20           O  
ATOM   2582  CB  MET A 335      47.472  96.609  65.591  1.00 59.56           C  
ATOM   2583  CG  MET A 335      47.050  97.367  64.358  1.00 61.02           C  
ATOM   2584  SD  MET A 335      47.619  96.699  62.797  1.00 64.36           S  
ATOM   2585  CE  MET A 335      46.479  95.352  62.569  1.00 61.79           C  
ATOM   2586  N   PHE A 336      49.169  98.808  66.896  1.00 59.55           N  
ATOM   2587  CA  PHE A 336      49.588 100.185  67.027  1.00 60.37           C  
ATOM   2588  C   PHE A 336      51.111 100.336  66.868  1.00 59.77           C  
ATOM   2589  O   PHE A 336      51.593 101.138  66.068  1.00 58.28           O  
ATOM   2590  CB  PHE A 336      49.168 100.692  68.407  1.00 62.38           C  
ATOM   2591  CG  PHE A 336      49.668 102.061  68.717  1.00 64.07           C  
ATOM   2592  CD1 PHE A 336      49.018 103.187  68.200  1.00 64.55           C  
ATOM   2593  CD2 PHE A 336      50.816 102.234  69.492  1.00 64.62           C  
ATOM   2594  CE1 PHE A 336      49.499 104.474  68.448  1.00 64.63           C  
ATOM   2595  CE2 PHE A 336      51.310 103.512  69.746  1.00 65.06           C  
ATOM   2596  CZ  PHE A 336      50.646 104.639  69.218  1.00 64.94           C  
ATOM   2597  N   CYS A 337      51.853  99.563  67.658  1.00 59.27           N  
ATOM   2598  CA  CYS A 337      53.307  99.589  67.650  1.00 58.49           C  
ATOM   2599  C   CYS A 337      53.878  99.136  66.323  1.00 57.37           C  
ATOM   2600  O   CYS A 337      54.828  99.720  65.798  1.00 57.01           O  
ATOM   2601  CB  CYS A 337      53.838  98.685  68.748  1.00 59.16           C  
ATOM   2602  SG  CYS A 337      53.398  99.223  70.403  1.00 66.22           S  
ATOM   2603  N   ALA A 338      53.301  98.072  65.794  1.00 56.02           N  
ATOM   2604  CA  ALA A 338      53.743  97.537  64.530  1.00 55.62           C  
ATOM   2605  C   ALA A 338      53.675  98.622  63.462  1.00 56.54           C  
ATOM   2606  O   ALA A 338      54.703  99.035  62.938  1.00 56.78           O  
ATOM   2607  CB  ALA A 338      52.879  96.359  64.148  1.00 55.49           C  
ATOM   2608  N   GLN A 339      52.465  99.088  63.148  1.00 58.58           N  
ATOM   2609  CA  GLN A 339      52.280 100.125  62.135  1.00 59.07           C  
ATOM   2610  C   GLN A 339      53.232 101.259  62.439  1.00 59.95           C  
ATOM   2611  O   GLN A 339      53.726 101.936  61.539  1.00 60.27           O  
ATOM   2612  CB  GLN A 339      50.853 100.674  62.145  1.00 60.20           C  
ATOM   2613  CG  GLN A 339      49.745  99.654  61.954  1.00 62.68           C  
ATOM   2614  CD  GLN A 339      48.429 100.312  61.555  1.00 63.98           C  
ATOM   2615  OE1 GLN A 339      48.228 100.672  60.396  1.00 62.84           O  
ATOM   2616  NE2 GLN A 339      47.536 100.491  62.522  1.00 65.39           N  
ATOM   2617  N   GLY A 340      53.483 101.467  63.724  1.00 61.16           N  
ATOM   2618  CA  GLY A 340      54.391 102.521  64.125  1.00 62.87           C  
ATOM   2619  C   GLY A 340      55.750 102.301  63.507  1.00 64.20           C  
ATOM   2620  O   GLY A 340      56.353 103.220  62.949  1.00 64.94           O  
ATOM   2621  N   GLU A 341      56.230 101.067  63.592  1.00 65.01           N  
ATOM   2622  CA  GLU A 341      57.526 100.738  63.040  1.00 65.83           C  
ATOM   2623  C   GLU A 341      57.590 100.937  61.533  1.00 66.44           C  
ATOM   2624  O   GLU A 341      58.625 101.336  60.989  1.00 68.02           O  
ATOM   2625  CB  GLU A 341      57.901  99.320  63.441  1.00 65.59           C  
ATOM   2626  CG  GLU A 341      58.205  99.222  64.933  1.00 68.35           C  
ATOM   2627  CD  GLU A 341      59.191 100.304  65.409  1.00 69.92           C  
ATOM   2628  OE1 GLU A 341      60.250 100.475  64.754  1.00 71.63           O  
ATOM   2629  OE2 GLU A 341      58.912 100.978  66.433  1.00 69.43           O  
ATOM   2630  N   TRP A 342      56.489 100.678  60.848  1.00 65.89           N  
ATOM   2631  CA  TRP A 342      56.479 100.884  59.416  1.00 66.50           C  
ATOM   2632  C   TRP A 342      56.682 102.368  59.148  1.00 66.76           C  
ATOM   2633  O   TRP A 342      57.444 102.756  58.267  1.00 66.39           O  
ATOM   2634  CB  TRP A 342      55.147 100.453  58.834  1.00 68.00           C  
ATOM   2635  CG  TRP A 342      55.112  99.055  58.351  1.00 70.11           C  
ATOM   2636  CD1 TRP A 342      56.054  98.096  58.543  1.00 71.20           C  
ATOM   2637  CD2 TRP A 342      54.062  98.444  57.598  1.00 71.12           C  
ATOM   2638  NE1 TRP A 342      55.658  96.919  57.957  1.00 71.86           N  
ATOM   2639  CE2 TRP A 342      54.436  97.108  57.370  1.00 71.54           C  
ATOM   2640  CE3 TRP A 342      52.838  98.898  57.097  1.00 70.90           C  
ATOM   2641  CZ2 TRP A 342      53.629  96.216  56.662  1.00 72.87           C  
ATOM   2642  CZ3 TRP A 342      52.039  98.016  56.399  1.00 72.07           C  
ATOM   2643  CH2 TRP A 342      52.438  96.684  56.186  1.00 72.12           C  
ATOM   2644  N   MET A 343      55.994 103.204  59.915  1.00 66.76           N  
ATOM   2645  CA  MET A 343      56.117 104.637  59.717  1.00 67.99           C  
ATOM   2646  C   MET A 343      57.535 105.096  59.966  1.00 68.50           C  
ATOM   2647  O   MET A 343      57.991 106.042  59.328  1.00 68.77           O  
ATOM   2648  CB  MET A 343      55.137 105.418  60.613  1.00 68.08           C  
ATOM   2649  CG  MET A 343      53.666 105.313  60.183  1.00 65.02           C  
ATOM   2650  SD  MET A 343      53.434 105.643  58.409  1.00 62.95           S  
ATOM   2651  CE  MET A 343      53.333 103.973  57.769  1.00 61.15           C  
ATOM   2652  N   ARG A 344      58.231 104.434  60.892  1.00 69.66           N  
ATOM   2653  CA  ARG A 344      59.624 104.788  61.178  1.00 71.16           C  
ATOM   2654  C   ARG A 344      60.479 104.472  59.952  1.00 70.99           C  
ATOM   2655  O   ARG A 344      61.337 105.263  59.561  1.00 70.94           O  
ATOM   2656  CB  ARG A 344      60.154 104.016  62.382  1.00 72.64           C  
ATOM   2657  CG  ARG A 344      59.985 104.720  63.717  1.00 75.50           C  
ATOM   2658  CD  ARG A 344      60.840 104.043  64.805  1.00 80.79           C  
ATOM   2659  NE  ARG A 344      62.293 104.234  64.622  1.00 84.26           N  
ATOM   2660  CZ  ARG A 344      63.143 103.362  64.060  1.00 84.60           C  
ATOM   2661  NH1 ARG A 344      62.733 102.177  63.594  1.00 82.95           N  
ATOM   2662  NH2 ARG A 344      64.427 103.693  63.955  1.00 83.95           N  
ATOM   2663  N   LEU A 345      60.223 103.319  59.344  1.00 70.73           N  
ATOM   2664  CA  LEU A 345      60.937 102.894  58.142  1.00 71.26           C  
ATOM   2665  C   LEU A 345      60.892 103.943  57.040  1.00 70.85           C  
ATOM   2666  O   LEU A 345      61.879 104.194  56.366  1.00 71.84           O  
ATOM   2667  CB  LEU A 345      60.322 101.613  57.573  1.00 71.39           C  
ATOM   2668  CG  LEU A 345      60.566 100.325  58.337  1.00 71.67           C  
ATOM   2669  CD1 LEU A 345      59.824  99.175  57.686  1.00 69.96           C  
ATOM   2670  CD2 LEU A 345      62.060 100.081  58.356  1.00 72.48           C  
ATOM   2671  N   CYS A 346      59.729 104.541  56.842  1.00 70.87           N  
ATOM   2672  CA  CYS A 346      59.562 105.531  55.794  1.00 70.95           C  
ATOM   2673  C   CYS A 346      60.136 106.889  56.162  1.00 71.42           C  
ATOM   2674  O   CYS A 346      60.574 107.644  55.290  1.00 71.46           O  
ATOM   2675  CB  CYS A 346      58.070 105.716  55.473  1.00 69.70           C  
ATOM   2676  SG  CYS A 346      57.111 104.204  55.250  1.00 69.56           S  
ATOM   2677  N   THR A 347      60.154 107.197  57.451  1.00 71.67           N  
ATOM   2678  CA  THR A 347      60.589 108.516  57.855  1.00 74.07           C  
ATOM   2679  C   THR A 347      61.875 108.713  58.618  1.00 75.87           C  
ATOM   2680  O   THR A 347      62.456 109.794  58.543  1.00 75.97           O  
ATOM   2681  CB  THR A 347      59.493 109.219  58.682  1.00 74.45           C  
ATOM   2682  OG1 THR A 347      59.274 108.499  59.899  1.00 74.57           O  
ATOM   2683  CG2 THR A 347      58.192 109.276  57.913  1.00 76.24           C  
ATOM   2684  N   SER A 348      62.336 107.709  59.349  1.00 77.61           N  
ATOM   2685  CA  SER A 348      63.530 107.939  60.135  1.00 80.15           C  
ATOM   2686  C   SER A 348      64.489 106.778  60.335  1.00 82.08           C  
ATOM   2687  O   SER A 348      64.989 106.557  61.447  1.00 83.42           O  
ATOM   2688  CB  SER A 348      63.110 108.515  61.497  1.00 80.69           C  
ATOM   2689  OG  SER A 348      62.147 107.696  62.147  1.00 81.40           O  
ATOM   2690  N   THR A 349      64.771 106.046  59.265  1.00 83.27           N  
ATOM   2691  CA  THR A 349      65.687 104.926  59.382  1.00 84.75           C  
ATOM   2692  C   THR A 349      67.096 105.461  59.625  1.00 86.33           C  
ATOM   2693  O   THR A 349      67.445 106.554  59.170  1.00 86.05           O  
ATOM   2694  CB  THR A 349      65.646 104.054  58.125  1.00 84.66           C  
ATOM   2695  OG1 THR A 349      64.306 103.599  57.919  1.00 86.67           O  
ATOM   2696  CG2 THR A 349      66.532 102.832  58.286  1.00 84.89           C  
ATOM   2697  N   THR A 350      67.888 104.686  60.364  1.00 88.46           N  
ATOM   2698  CA  THR A 350      69.263 105.047  60.716  1.00 90.23           C  
ATOM   2699  C   THR A 350      70.272 104.148  60.008  1.00 90.54           C  
ATOM   2700  O   THR A 350      70.014 102.961  59.806  1.00 90.64           O  
ATOM   2701  CB  THR A 350      69.506 104.878  62.235  1.00 91.13           C  
ATOM   2702  OG1 THR A 350      68.381 105.390  62.958  1.00 91.78           O  
ATOM   2703  CG2 THR A 350      70.779 105.626  62.666  1.00 92.91           C  
ATOM   2704  N   GLU A 351      71.424 104.703  59.644  1.00 90.81           N  
ATOM   2705  CA  GLU A 351      72.446 103.898  58.992  1.00 90.89           C  
ATOM   2706  C   GLU A 351      72.771 102.702  59.883  1.00 90.75           C  
ATOM   2707  O   GLU A 351      72.986 101.597  59.394  1.00 90.40           O  
ATOM   2708  CB  GLU A 351      73.701 104.725  58.754  1.00 91.04           C  
ATOM   2709  CG  GLU A 351      73.530 105.832  57.728  1.00 92.77           C  
ATOM   2710  CD  GLU A 351      73.164 105.310  56.345  1.00 94.42           C  
ATOM   2711  OE1 GLU A 351      73.434 104.116  56.068  1.00 95.07           O  
ATOM   2712  OE2 GLU A 351      72.621 106.100  55.532  1.00 94.38           O  
ATOM   2713  N   SER A 352      72.799 102.932  61.192  1.00 90.80           N  
ATOM   2714  CA  SER A 352      73.080 101.871  62.152  1.00 92.46           C  
ATOM   2715  C   SER A 352      72.130 100.706  61.936  1.00 93.68           C  
ATOM   2716  O   SER A 352      72.553  99.550  61.920  1.00 95.17           O  
ATOM   2717  CB  SER A 352      72.902 102.381  63.576  1.00 92.55           C  
ATOM   2718  OG  SER A 352      73.444 103.682  63.705  1.00 95.87           O  
ATOM   2719  N   GLU A 353      70.844 101.024  61.780  1.00 94.57           N  
ATOM   2720  CA  GLU A 353      69.793 100.027  61.567  1.00 94.13           C  
ATOM   2721  C   GLU A 353      69.964  99.244  60.263  1.00 93.10           C  
ATOM   2722  O   GLU A 353      69.841  98.016  60.257  1.00 92.00           O  
ATOM   2723  CB  GLU A 353      68.414 100.699  61.569  1.00 96.20           C  
ATOM   2724  CG  GLU A 353      68.013 101.341  62.893  1.00 98.71           C  
ATOM   2725  CD  GLU A 353      66.567 101.827  62.898  1.00100.25           C  
ATOM   2726  OE1 GLU A 353      66.220 102.683  62.052  1.00101.08           O  
ATOM   2727  OE2 GLU A 353      65.777 101.355  63.750  1.00100.82           O  
ATOM   2728  N   VAL A 354      70.228  99.952  59.163  1.00 92.22           N  
ATOM   2729  CA  VAL A 354      70.417  99.299  57.867  1.00 91.84           C  
ATOM   2730  C   VAL A 354      71.698  98.481  57.881  1.00 91.51           C  
ATOM   2731  O   VAL A 354      71.732  97.353  57.390  1.00 91.42           O  
ATOM   2732  CB  VAL A 354      70.505 100.317  56.706  1.00 91.60           C  
ATOM   2733  CG1 VAL A 354      69.225 101.130  56.633  1.00 93.03           C  
ATOM   2734  CG2 VAL A 354      71.707 101.223  56.889  1.00 91.66           C  
ATOM   2735  N   LYS A 355      72.748  99.058  58.456  1.00 91.10           N  
ATOM   2736  CA  LYS A 355      74.037  98.394  58.552  1.00 90.19           C  
ATOM   2737  C   LYS A 355      73.838  97.006  59.148  1.00 88.99           C  
ATOM   2738  O   LYS A 355      74.287  96.002  58.589  1.00 88.93           O  
ATOM   2739  CB  LYS A 355      74.970  99.219  59.431  1.00 91.16           C  
ATOM   2740  CG  LYS A 355      76.439  98.919  59.225  1.00 94.25           C  
ATOM   2741  CD  LYS A 355      77.049  98.221  60.429  1.00 96.58           C  
ATOM   2742  CE  LYS A 355      78.572  98.143  60.294  1.00 98.55           C  
ATOM   2743  NZ  LYS A 355      79.215  99.495  60.110  1.00 98.98           N  
ATOM   2744  N   ARG A 356      73.148  96.955  60.280  1.00 87.72           N  
ATOM   2745  CA  ARG A 356      72.876  95.692  60.946  1.00 87.34           C  
ATOM   2746  C   ARG A 356      71.907  94.843  60.134  1.00 86.37           C  
ATOM   2747  O   ARG A 356      72.108  93.641  59.960  1.00 85.93           O  
ATOM   2748  CB  ARG A 356      72.271  95.939  62.323  1.00 89.44           C  
ATOM   2749  CG  ARG A 356      71.965  94.660  63.086  1.00 92.38           C  
ATOM   2750  CD  ARG A 356      71.102  94.926  64.307  1.00 95.31           C  
ATOM   2751  NE  ARG A 356      69.678  95.027  63.976  1.00 99.14           N  
ATOM   2752  CZ  ARG A 356      68.949  96.141  64.062  1.00101.23           C  
ATOM   2753  NH1 ARG A 356      69.496  97.288  64.469  1.00100.71           N  
ATOM   2754  NH2 ARG A 356      67.655  96.103  63.755  1.00102.30           N  
ATOM   2755  N   ALA A 357      70.843  95.474  59.652  1.00 85.46           N  
ATOM   2756  CA  ALA A 357      69.838  94.778  58.864  1.00 84.40           C  
ATOM   2757  C   ALA A 357      70.465  94.032  57.686  1.00 83.51           C  
ATOM   2758  O   ALA A 357      70.013  92.943  57.329  1.00 83.83           O  
ATOM   2759  CB  ALA A 357      68.796  95.768  58.364  1.00 85.71           C  
ATOM   2760  N   LYS A 358      71.502  94.623  57.091  1.00 82.07           N  
ATOM   2761  CA  LYS A 358      72.211  94.024  55.957  1.00 79.55           C  
ATOM   2762  C   LYS A 358      72.982  92.778  56.364  1.00 78.77           C  
ATOM   2763  O   LYS A 358      72.975  91.782  55.649  1.00 77.00           O  
ATOM   2764  CB  LYS A 358      73.165  95.043  55.344  1.00 78.55           C  
ATOM   2765  CG  LYS A 358      72.445  96.113  54.550  1.00 78.59           C  
ATOM   2766  CD  LYS A 358      73.226  97.421  54.474  1.00 77.75           C  
ATOM   2767  CE  LYS A 358      74.466  97.333  53.606  1.00 76.74           C  
ATOM   2768  NZ  LYS A 358      75.160  98.653  53.558  1.00 75.46           N  
ATOM   2769  N   ASN A 359      73.649  92.833  57.514  1.00 79.39           N  
ATOM   2770  CA  ASN A 359      74.398  91.672  57.993  1.00 80.26           C  
ATOM   2771  C   ASN A 359      73.449  90.530  58.270  1.00 80.71           C  
ATOM   2772  O   ASN A 359      73.773  89.369  58.012  1.00 81.20           O  
ATOM   2773  CB  ASN A 359      75.168  91.983  59.278  1.00 79.83           C  
ATOM   2774  CG  ASN A 359      76.237  93.016  59.070  1.00 79.10           C  
ATOM   2775  OD1 ASN A 359      76.791  93.142  57.975  1.00 78.39           O  
ATOM   2776  ND2 ASN A 359      76.549  93.758  60.126  1.00 78.40           N  
ATOM   2777  N   HIS A 360      72.280  90.857  58.814  1.00 81.49           N  
ATOM   2778  CA  HIS A 360      71.292  89.832  59.099  1.00 82.14           C  
ATOM   2779  C   HIS A 360      70.873  89.210  57.771  1.00 81.23           C  
ATOM   2780  O   HIS A 360      70.939  87.993  57.602  1.00 80.99           O  
ATOM   2781  CB  HIS A 360      70.060  90.420  59.800  1.00 84.27           C  
ATOM   2782  CG  HIS A 360      68.960  89.421  60.003  1.00 87.04           C  
ATOM   2783  ND1 HIS A 360      69.022  88.425  60.956  1.00 87.53           N  
ATOM   2784  CD2 HIS A 360      67.812  89.208  59.311  1.00 88.15           C  
ATOM   2785  CE1 HIS A 360      67.965  87.639  60.841  1.00 88.27           C  
ATOM   2786  NE2 HIS A 360      67.215  88.091  59.849  1.00 89.50           N  
ATOM   2787  N   LEU A 361      70.456  90.058  56.831  1.00 80.04           N  
ATOM   2788  CA  LEU A 361      70.017  89.606  55.520  1.00 79.12           C  
ATOM   2789  C   LEU A 361      71.045  88.754  54.794  1.00 79.99           C  
ATOM   2790  O   LEU A 361      70.667  87.815  54.094  1.00 80.71           O  
ATOM   2791  CB  LEU A 361      69.640  90.795  54.641  1.00 78.30           C  
ATOM   2792  CG  LEU A 361      69.227  90.421  53.213  1.00 78.07           C  
ATOM   2793  CD1 LEU A 361      68.021  89.492  53.243  1.00 78.68           C  
ATOM   2794  CD2 LEU A 361      68.910  91.680  52.432  1.00 76.71           C  
ATOM   2795  N   ARG A 362      72.335  89.078  54.937  1.00 80.58           N  
ATOM   2796  CA  ARG A 362      73.392  88.291  54.289  1.00 79.68           C  
ATOM   2797  C   ARG A 362      73.379  86.890  54.862  1.00 79.95           C  
ATOM   2798  O   ARG A 362      73.118  85.919  54.154  1.00 79.99           O  
ATOM   2799  CB  ARG A 362      74.769  88.897  54.527  1.00 79.11           C  
ATOM   2800  CG  ARG A 362      74.985  90.222  53.841  1.00 80.00           C  
ATOM   2801  CD  ARG A 362      76.458  90.518  53.662  1.00 78.55           C  
ATOM   2802  NE  ARG A 362      76.667  91.883  53.202  1.00 79.18           N  
ATOM   2803  CZ  ARG A 362      76.653  92.953  53.997  1.00 80.25           C  
ATOM   2804  NH1 ARG A 362      76.447  92.815  55.304  1.00 79.77           N  
ATOM   2805  NH2 ARG A 362      76.833  94.168  53.481  1.00 80.90           N  
ATOM   2806  N   SER A 363      73.645  86.787  56.157  1.00 80.42           N  
ATOM   2807  CA  SER A 363      73.644  85.489  56.815  1.00 82.58           C  
ATOM   2808  C   SER A 363      72.391  84.696  56.417  1.00 83.66           C  
ATOM   2809  O   SER A 363      72.404  83.463  56.359  1.00 84.61           O  
ATOM   2810  CB  SER A 363      73.687  85.681  58.329  1.00 82.96           C  
ATOM   2811  OG  SER A 363      74.786  86.501  58.696  1.00 84.44           O  
ATOM   2812  N   ALA A 364      71.315  85.419  56.130  1.00 84.24           N  
ATOM   2813  CA  ALA A 364      70.054  84.809  55.742  1.00 83.70           C  
ATOM   2814  C   ALA A 364      70.145  84.140  54.376  1.00 83.69           C  
ATOM   2815  O   ALA A 364      69.807  82.964  54.234  1.00 82.27           O  
ATOM   2816  CB  ALA A 364      68.946  85.867  55.736  1.00 83.04           C  
ATOM   2817  N   MET A 365      70.603  84.891  53.375  1.00 85.06           N  
ATOM   2818  CA  MET A 365      70.704  84.366  52.014  1.00 87.44           C  
ATOM   2819  C   MET A 365      71.654  83.197  51.974  1.00 88.09           C  
ATOM   2820  O   MET A 365      71.443  82.236  51.231  1.00 88.47           O  
ATOM   2821  CB  MET A 365      71.189  85.442  51.045  1.00 88.76           C  
ATOM   2822  CG  MET A 365      72.502  86.059  51.453  1.00 92.75           C  
ATOM   2823  SD  MET A 365      73.242  87.123  50.199  1.00 98.43           S  
ATOM   2824  CE  MET A 365      75.004  86.641  50.332  1.00 97.72           C  
ATOM   2825  N   VAL A 366      72.708  83.291  52.780  1.00 88.74           N  
ATOM   2826  CA  VAL A 366      73.710  82.241  52.852  1.00 88.14           C  
ATOM   2827  C   VAL A 366      73.058  81.007  53.443  1.00 88.69           C  
ATOM   2828  O   VAL A 366      73.181  79.917  52.896  1.00 88.41           O  
ATOM   2829  CB  VAL A 366      74.923  82.680  53.717  1.00 87.08           C  
ATOM   2830  CG1 VAL A 366      75.808  81.483  54.031  1.00 86.01           C  
ATOM   2831  CG2 VAL A 366      75.729  83.751  52.969  1.00 85.09           C  
ATOM   2832  N   ALA A 367      72.333  81.189  54.541  1.00 90.30           N  
ATOM   2833  CA  ALA A 367      71.656  80.073  55.198  1.00 92.29           C  
ATOM   2834  C   ALA A 367      70.620  79.367  54.305  1.00 93.16           C  
ATOM   2835  O   ALA A 367      70.115  78.298  54.662  1.00 92.45           O  
ATOM   2836  CB  ALA A 367      70.996  80.553  56.489  1.00 92.11           C  
ATOM   2837  N   GLN A 368      70.307  79.958  53.152  1.00 94.23           N  
ATOM   2838  CA  GLN A 368      69.342  79.363  52.224  1.00 94.96           C  
ATOM   2839  C   GLN A 368      70.027  78.404  51.242  1.00 95.00           C  
ATOM   2840  O   GLN A 368      69.374  77.795  50.385  1.00 95.03           O  
ATOM   2841  CB  GLN A 368      68.633  80.444  51.413  1.00 96.10           C  
ATOM   2842  CG  GLN A 368      67.970  81.537  52.212  1.00 97.06           C  
ATOM   2843  CD  GLN A 368      67.151  82.447  51.318  1.00 97.84           C  
ATOM   2844  OE1 GLN A 368      67.542  82.734  50.180  1.00 97.84           O  
ATOM   2845  NE2 GLN A 368      66.015  82.916  51.827  1.00 97.52           N  
ATOM   2846  N   LEU A 369      71.345  78.283  51.367  1.00 93.99           N  
ATOM   2847  CA  LEU A 369      72.126  77.414  50.501  1.00 92.65           C  
ATOM   2848  C   LEU A 369      72.920  76.467  51.388  1.00 92.54           C  
ATOM   2849  O   LEU A 369      74.079  76.158  51.139  1.00 93.51           O  
ATOM   2850  CB  LEU A 369      73.057  78.274  49.667  1.00 91.84           C  
ATOM   2851  CG  LEU A 369      72.347  79.507  49.116  1.00 90.61           C  
ATOM   2852  CD1 LEU A 369      73.323  80.402  48.401  1.00 90.40           C  
ATOM   2853  CD2 LEU A 369      71.256  79.060  48.179  1.00 91.81           C  
ATOM   2854  N   ASP A 370      72.267  76.013  52.441  1.00 92.27           N  
ATOM   2855  CA  ASP A 370      72.880  75.125  53.398  1.00 92.00           C  
ATOM   2856  C   ASP A 370      72.323  73.720  53.206  1.00 91.30           C  
ATOM   2857  O   ASP A 370      71.457  73.255  53.961  1.00 91.17           O  
ATOM   2858  CB  ASP A 370      72.600  75.655  54.804  1.00 94.09           C  
ATOM   2859  CG  ASP A 370      73.168  74.777  55.874  1.00 96.60           C  
ATOM   2860  OD1 ASP A 370      74.370  74.440  55.777  1.00 99.01           O  
ATOM   2861  OD2 ASP A 370      72.413  74.427  56.809  1.00 98.25           O  
ATOM   2862  N   GLY A 371      72.832  73.048  52.178  1.00 90.75           N  
ATOM   2863  CA  GLY A 371      72.391  71.698  51.865  1.00 90.58           C  
ATOM   2864  C   GLY A 371      72.212  71.566  50.364  1.00 90.16           C  
ATOM   2865  O   GLY A 371      72.288  72.562  49.645  1.00 90.49           O  
ATOM   2866  N   THR A 372      71.975  70.355  49.876  1.00 89.31           N  
ATOM   2867  CA  THR A 372      71.808  70.188  48.442  1.00 88.54           C  
ATOM   2868  C   THR A 372      70.396  70.523  48.011  1.00 87.29           C  
ATOM   2869  O   THR A 372      70.197  71.114  46.952  1.00 87.84           O  
ATOM   2870  CB  THR A 372      72.181  68.759  47.973  1.00 89.43           C  
ATOM   2871  OG1 THR A 372      71.556  67.776  48.813  1.00 90.21           O  
ATOM   2872  CG2 THR A 372      73.693  68.585  48.010  1.00 89.52           C  
ATOM   2873  N   THR A 373      69.415  70.166  48.833  1.00 85.15           N  
ATOM   2874  CA  THR A 373      68.036  70.475  48.489  1.00 82.88           C  
ATOM   2875  C   THR A 373      67.863  71.994  48.462  1.00 80.80           C  
ATOM   2876  O   THR A 373      67.411  72.559  47.466  1.00 78.23           O  
ATOM   2877  CB  THR A 373      67.055  69.851  49.493  1.00 83.70           C  
ATOM   2878  OG1 THR A 373      67.376  68.466  49.666  1.00 85.15           O  
ATOM   2879  CG2 THR A 373      65.620  69.962  48.979  1.00 83.70           C  
ATOM   2880  N   PRO A 374      68.241  72.684  49.551  1.00 80.33           N  
ATOM   2881  CA  PRO A 374      68.088  74.144  49.550  1.00 81.23           C  
ATOM   2882  C   PRO A 374      68.866  74.915  48.466  1.00 81.83           C  
ATOM   2883  O   PRO A 374      68.535  76.066  48.156  1.00 82.32           O  
ATOM   2884  CB  PRO A 374      68.473  74.546  50.983  1.00 79.02           C  
ATOM   2885  CG  PRO A 374      69.302  73.429  51.458  1.00 80.56           C  
ATOM   2886  CD  PRO A 374      68.643  72.205  50.881  1.00 80.44           C  
ATOM   2887  N   VAL A 375      69.886  74.297  47.883  1.00 82.19           N  
ATOM   2888  CA  VAL A 375      70.638  74.968  46.831  1.00 82.33           C  
ATOM   2889  C   VAL A 375      69.946  74.658  45.521  1.00 81.95           C  
ATOM   2890  O   VAL A 375      70.014  75.417  44.562  1.00 81.53           O  
ATOM   2891  CB  VAL A 375      72.086  74.468  46.740  1.00 82.17           C  
ATOM   2892  CG1 VAL A 375      72.791  75.144  45.576  1.00 82.24           C  
ATOM   2893  CG2 VAL A 375      72.818  74.778  48.030  1.00 83.28           C  
ATOM   2894  N   CYS A 376      69.274  73.523  45.498  1.00 82.44           N  
ATOM   2895  CA  CYS A 376      68.563  73.093  44.314  1.00 84.02           C  
ATOM   2896  C   CYS A 376      67.279  73.914  44.205  1.00 84.68           C  
ATOM   2897  O   CYS A 376      66.874  74.317  43.107  1.00 85.14           O  
ATOM   2898  CB  CYS A 376      68.247  71.608  44.437  1.00 84.71           C  
ATOM   2899  SG  CYS A 376      67.682  70.821  42.929  1.00 88.48           S  
ATOM   2900  N   GLU A 377      66.652  74.160  45.356  1.00 84.20           N  
ATOM   2901  CA  GLU A 377      65.417  74.945  45.431  1.00 83.21           C  
ATOM   2902  C   GLU A 377      65.676  76.326  44.872  1.00 82.26           C  
ATOM   2903  O   GLU A 377      64.839  76.892  44.181  1.00 82.19           O  
ATOM   2904  CB  GLU A 377      64.952  75.076  46.891  1.00 84.06           C  
ATOM   2905  CG  GLU A 377      63.721  75.965  47.111  1.00 82.47           C  
ATOM   2906  CD  GLU A 377      62.452  75.409  46.468  1.00 81.24           C  
ATOM   2907  OE1 GLU A 377      62.073  74.255  46.783  1.00 79.91           O  
ATOM   2908  OE2 GLU A 377      61.833  76.132  45.655  1.00 79.44           O  
ATOM   2909  N   THR A 378      66.845  76.862  45.196  1.00 82.06           N  
ATOM   2910  CA  THR A 378      67.256  78.179  44.737  1.00 82.47           C  
ATOM   2911  C   THR A 378      67.398  78.216  43.215  1.00 82.26           C  
ATOM   2912  O   THR A 378      66.857  79.104  42.537  1.00 82.50           O  
ATOM   2913  CB  THR A 378      68.594  78.563  45.384  1.00 82.24           C  
ATOM   2914  OG1 THR A 378      68.408  78.686  46.797  1.00 83.18           O  
ATOM   2915  CG2 THR A 378      69.120  79.873  44.816  1.00 82.15           C  
ATOM   2916  N   ILE A 379      68.135  77.245  42.689  1.00 81.21           N  
ATOM   2917  CA  ILE A 379      68.357  77.143  41.262  1.00 80.66           C  
ATOM   2918  C   ILE A 379      67.038  77.014  40.520  1.00 79.91           C  
ATOM   2919  O   ILE A 379      66.739  77.832  39.643  1.00 79.07           O  
ATOM   2920  CB  ILE A 379      69.271  75.948  40.956  1.00 81.50           C  
ATOM   2921  CG1 ILE A 379      70.685  76.282  41.444  1.00 82.82           C  
ATOM   2922  CG2 ILE A 379      69.259  75.625  39.468  1.00 80.62           C  
ATOM   2923  CD1 ILE A 379      71.703  75.194  41.231  1.00 83.22           C  
ATOM   2924  N   GLY A 380      66.250  76.001  40.881  1.00 79.29           N  
ATOM   2925  CA  GLY A 380      64.953  75.800  40.246  1.00 79.90           C  
ATOM   2926  C   GLY A 380      64.135  77.086  40.179  1.00 81.04           C  
ATOM   2927  O   GLY A 380      63.553  77.423  39.137  1.00 81.87           O  
ATOM   2928  N   SER A 381      64.109  77.813  41.299  1.00 80.79           N  
ATOM   2929  CA  SER A 381      63.388  79.072  41.424  1.00 78.18           C  
ATOM   2930  C   SER A 381      64.023  80.210  40.653  1.00 77.52           C  
ATOM   2931  O   SER A 381      63.359  80.815  39.828  1.00 78.72           O  
ATOM   2932  CB  SER A 381      63.266  79.455  42.890  1.00 77.26           C  
ATOM   2933  OG  SER A 381      62.435  78.519  43.545  1.00 78.47           O  
ATOM   2934  N   HIS A 382      65.292  80.514  40.905  1.00 76.02           N  
ATOM   2935  CA  HIS A 382      65.929  81.600  40.169  1.00 75.57           C  
ATOM   2936  C   HIS A 382      65.652  81.553  38.668  1.00 76.47           C  
ATOM   2937  O   HIS A 382      65.200  82.538  38.079  1.00 76.06           O  
ATOM   2938  CB  HIS A 382      67.429  81.580  40.365  1.00 74.40           C  
ATOM   2939  CG  HIS A 382      67.875  82.247  41.614  1.00 72.99           C  
ATOM   2940  ND1 HIS A 382      68.903  83.162  41.634  1.00 74.11           N  
ATOM   2941  CD2 HIS A 382      67.462  82.109  42.894  1.00 72.71           C  
ATOM   2942  CE1 HIS A 382      69.108  83.559  42.879  1.00 74.66           C  
ATOM   2943  NE2 HIS A 382      68.247  82.935  43.663  1.00 73.56           N  
ATOM   2944  N   LEU A 383      65.949  80.416  38.047  1.00 76.59           N  
ATOM   2945  CA  LEU A 383      65.729  80.279  36.618  1.00 77.37           C  
ATOM   2946  C   LEU A 383      64.298  80.616  36.317  1.00 76.84           C  
ATOM   2947  O   LEU A 383      64.002  81.533  35.555  1.00 77.38           O  
ATOM   2948  CB  LEU A 383      66.010  78.849  36.157  1.00 79.54           C  
ATOM   2949  CG  LEU A 383      67.482  78.443  36.064  1.00 80.71           C  
ATOM   2950  CD1 LEU A 383      67.575  77.006  35.560  1.00 79.56           C  
ATOM   2951  CD2 LEU A 383      68.227  79.412  35.136  1.00 79.85           C  
ATOM   2952  N   LEU A 384      63.411  79.861  36.943  1.00 76.41           N  
ATOM   2953  CA  LEU A 384      61.982  80.039  36.769  1.00 75.92           C  
ATOM   2954  C   LEU A 384      61.517  81.504  36.956  1.00 76.10           C  
ATOM   2955  O   LEU A 384      60.693  81.993  36.183  1.00 76.90           O  
ATOM   2956  CB  LEU A 384      61.268  79.092  37.740  1.00 73.88           C  
ATOM   2957  CG  LEU A 384      59.929  78.468  37.346  1.00 73.47           C  
ATOM   2958  CD1 LEU A 384      59.889  78.187  35.873  1.00 73.17           C  
ATOM   2959  CD2 LEU A 384      59.727  77.180  38.126  1.00 72.97           C  
ATOM   2960  N   ASN A 385      62.077  82.209  37.942  1.00 75.75           N  
ATOM   2961  CA  ASN A 385      61.683  83.590  38.240  1.00 75.93           C  
ATOM   2962  C   ASN A 385      62.501  84.724  37.650  1.00 76.92           C  
ATOM   2963  O   ASN A 385      61.931  85.690  37.150  1.00 77.02           O  
ATOM   2964  CB  ASN A 385      61.605  83.800  39.755  1.00 75.50           C  
ATOM   2965  CG  ASN A 385      60.534  82.943  40.404  1.00 76.61           C  
ATOM   2966  OD1 ASN A 385      59.385  82.882  39.938  1.00 77.38           O  
ATOM   2967  ND2 ASN A 385      60.897  82.278  41.490  1.00 76.61           N  
ATOM   2968  N   TYR A 386      63.826  84.633  37.734  1.00 77.98           N  
ATOM   2969  CA  TYR A 386      64.692  85.679  37.198  1.00 78.20           C  
ATOM   2970  C   TYR A 386      65.214  85.313  35.818  1.00 79.23           C  
ATOM   2971  O   TYR A 386      65.858  86.133  35.166  1.00 79.68           O  
ATOM   2972  CB  TYR A 386      65.886  85.910  38.110  1.00 77.59           C  
ATOM   2973  CG  TYR A 386      65.541  86.261  39.540  1.00 80.22           C  
ATOM   2974  CD1 TYR A 386      64.899  87.457  39.861  1.00 80.37           C  
ATOM   2975  CD2 TYR A 386      65.908  85.416  40.588  1.00 81.32           C  
ATOM   2976  CE1 TYR A 386      64.638  87.807  41.204  1.00 81.53           C  
ATOM   2977  CE2 TYR A 386      65.652  85.754  41.931  1.00 81.10           C  
ATOM   2978  CZ  TYR A 386      65.022  86.945  42.233  1.00 81.98           C  
ATOM   2979  OH  TYR A 386      64.788  87.266  43.560  1.00 82.22           O  
ATOM   2980  N   GLY A 387      64.939  84.084  35.378  1.00 80.60           N  
ATOM   2981  CA  GLY A 387      65.414  83.621  34.075  1.00 81.49           C  
ATOM   2982  C   GLY A 387      66.923  83.389  34.066  1.00 81.92           C  
ATOM   2983  O   GLY A 387      67.583  83.500  33.029  1.00 81.07           O  
ATOM   2984  N   ARG A 388      67.460  83.068  35.242  1.00 81.60           N  
ATOM   2985  CA  ARG A 388      68.878  82.836  35.426  1.00 80.80           C  
ATOM   2986  C   ARG A 388      69.187  82.727  36.913  1.00 81.79           C  
ATOM   2987  O   ARG A 388      68.327  82.949  37.762  1.00 82.35           O  
ATOM   2988  CB  ARG A 388      69.682  83.995  34.849  1.00 79.75           C  
ATOM   2989  CG  ARG A 388      69.563  85.291  35.625  1.00 79.99           C  
ATOM   2990  CD  ARG A 388      70.544  86.311  35.075  1.00 81.82           C  
ATOM   2991  NE  ARG A 388      70.494  87.634  35.716  1.00 83.19           N  
ATOM   2992  CZ  ARG A 388      70.933  87.911  36.945  1.00 81.84           C  
ATOM   2993  NH1 ARG A 388      70.844  89.144  37.425  1.00 80.93           N  
ATOM   2994  NH2 ARG A 388      71.456  86.955  37.697  1.00 82.94           N  
ATOM   2995  N   ARG A 389      70.430  82.393  37.226  1.00 82.86           N  
ATOM   2996  CA  ARG A 389      70.844  82.275  38.611  1.00 82.84           C  
ATOM   2997  C   ARG A 389      71.509  83.555  39.058  1.00 83.28           C  
ATOM   2998  O   ARG A 389      72.162  84.236  38.272  1.00 82.21           O  
ATOM   2999  CB  ARG A 389      71.822  81.115  38.789  1.00 82.01           C  
ATOM   3000  CG  ARG A 389      72.476  81.047  40.164  1.00 80.90           C  
ATOM   3001  CD  ARG A 389      71.458  80.846  41.265  1.00 81.28           C  
ATOM   3002  NE  ARG A 389      72.075  80.784  42.589  1.00 83.80           N  
ATOM   3003  CZ  ARG A 389      72.703  79.715  43.080  1.00 85.04           C  
ATOM   3004  NH1 ARG A 389      72.800  78.604  42.356  1.00 84.73           N  
ATOM   3005  NH2 ARG A 389      73.230  79.752  44.300  1.00 84.48           N  
ATOM   3006  N   ILE A 390      71.312  83.877  40.328  1.00 85.16           N  
ATOM   3007  CA  ILE A 390      71.913  85.050  40.932  1.00 87.46           C  
ATOM   3008  C   ILE A 390      72.768  84.520  42.078  1.00 89.42           C  
ATOM   3009  O   ILE A 390      72.260  83.924  43.043  1.00 88.76           O  
ATOM   3010  CB  ILE A 390      70.850  86.041  41.463  1.00 86.92           C  
ATOM   3011  CG1 ILE A 390      69.907  86.444  40.317  1.00 86.61           C  
ATOM   3012  CG2 ILE A 390      71.542  87.271  42.066  1.00 86.13           C  
ATOM   3013  CD1 ILE A 390      68.876  87.503  40.682  1.00 85.58           C  
ATOM   3014  N   SER A 391      74.077  84.721  41.936  1.00 91.48           N  
ATOM   3015  CA  SER A 391      75.066  84.261  42.909  1.00 92.14           C  
ATOM   3016  C   SER A 391      75.063  85.091  44.171  1.00 91.49           C  
ATOM   3017  O   SER A 391      74.712  86.269  44.150  1.00 91.41           O  
ATOM   3018  CB  SER A 391      76.463  84.345  42.310  1.00 92.77           C  
ATOM   3019  OG  SER A 391      76.872  85.706  42.229  1.00 93.18           O  
ATOM   3020  N   LEU A 392      75.479  84.481  45.269  1.00 91.06           N  
ATOM   3021  CA  LEU A 392      75.537  85.219  46.505  1.00 92.57           C  
ATOM   3022  C   LEU A 392      76.437  86.424  46.264  1.00 93.77           C  
ATOM   3023  O   LEU A 392      76.200  87.510  46.801  1.00 93.84           O  
ATOM   3024  CB  LEU A 392      76.102  84.345  47.625  1.00 93.33           C  
ATOM   3025  CG  LEU A 392      75.222  83.183  48.093  1.00 93.67           C  
ATOM   3026  CD1 LEU A 392      75.877  82.458  49.259  1.00 93.35           C  
ATOM   3027  CD2 LEU A 392      73.870  83.724  48.522  1.00 95.20           C  
ATOM   3028  N   GLU A 393      77.465  86.241  45.439  1.00 95.25           N  
ATOM   3029  CA  GLU A 393      78.375  87.340  45.157  1.00 96.28           C  
ATOM   3030  C   GLU A 393      77.604  88.541  44.639  1.00 95.09           C  
ATOM   3031  O   GLU A 393      77.961  89.687  44.934  1.00 95.04           O  
ATOM   3032  CB  GLU A 393      79.444  86.942  44.133  1.00 99.64           C  
ATOM   3033  CG  GLU A 393      80.168  88.168  43.537  1.00104.09           C  
ATOM   3034  CD  GLU A 393      81.550  87.867  42.970  1.00105.82           C  
ATOM   3035  OE1 GLU A 393      81.666  86.955  42.119  1.00106.42           O  
ATOM   3036  OE2 GLU A 393      82.515  88.561  43.373  1.00105.95           O  
ATOM   3037  N   GLU A 394      76.551  88.275  43.866  1.00 93.28           N  
ATOM   3038  CA  GLU A 394      75.728  89.351  43.313  1.00 90.69           C  
ATOM   3039  C   GLU A 394      74.824  89.931  44.394  1.00 88.35           C  
ATOM   3040  O   GLU A 394      74.853  91.133  44.667  1.00 86.95           O  
ATOM   3041  CB  GLU A 394      74.863  88.844  42.158  1.00 90.25           C  
ATOM   3042  CG  GLU A 394      74.316  89.978  41.311  1.00 90.74           C  
ATOM   3043  CD  GLU A 394      73.322  89.507  40.277  1.00 91.67           C  
ATOM   3044  OE1 GLU A 394      73.539  88.421  39.699  1.00 92.28           O  
ATOM   3045  OE2 GLU A 394      72.331  90.228  40.035  1.00 91.47           O  
ATOM   3046  N   TRP A 395      74.018  89.063  44.999  1.00 86.25           N  
ATOM   3047  CA  TRP A 395      73.114  89.478  46.059  1.00 84.12           C  
ATOM   3048  C   TRP A 395      73.857  90.432  46.967  1.00 83.95           C  
ATOM   3049  O   TRP A 395      73.382  91.530  47.267  1.00 84.37           O  
ATOM   3050  CB  TRP A 395      72.633  88.265  46.868  1.00 80.17           C  
ATOM   3051  CG  TRP A 395      71.437  87.577  46.283  1.00 77.09           C  
ATOM   3052  CD1 TRP A 395      71.131  86.244  46.370  1.00 77.50           C  
ATOM   3053  CD2 TRP A 395      70.370  88.186  45.544  1.00 75.34           C  
ATOM   3054  NE1 TRP A 395      69.938  85.984  45.725  1.00 76.75           N  
ATOM   3055  CE2 TRP A 395      69.450  87.158  45.212  1.00 75.93           C  
ATOM   3056  CE3 TRP A 395      70.098  89.498  45.130  1.00 72.80           C  
ATOM   3057  CZ2 TRP A 395      68.279  87.408  44.485  1.00 74.76           C  
ATOM   3058  CZ3 TRP A 395      68.939  89.744  44.408  1.00 72.66           C  
ATOM   3059  CH2 TRP A 395      68.042  88.703  44.092  1.00 73.52           C  
ATOM   3060  N   ASP A 396      75.048  90.022  47.372  1.00 83.53           N  
ATOM   3061  CA  ASP A 396      75.841  90.838  48.264  1.00 84.08           C  
ATOM   3062  C   ASP A 396      76.212  92.215  47.721  1.00 83.77           C  
ATOM   3063  O   ASP A 396      76.300  93.185  48.482  1.00 81.99           O  
ATOM   3064  CB  ASP A 396      77.102  90.092  48.672  1.00 85.36           C  
ATOM   3065  CG  ASP A 396      77.825  90.792  49.788  1.00 87.11           C  
ATOM   3066  OD1 ASP A 396      78.491  91.821  49.525  1.00 88.83           O  
ATOM   3067  OD2 ASP A 396      77.702  90.323  50.937  1.00 87.09           O  
ATOM   3068  N   SER A 397      76.440  92.301  46.414  1.00 84.16           N  
ATOM   3069  CA  SER A 397      76.789  93.578  45.799  1.00 84.77           C  
ATOM   3070  C   SER A 397      75.620  94.550  45.909  1.00 85.12           C  
ATOM   3071  O   SER A 397      75.805  95.744  46.203  1.00 85.65           O  
ATOM   3072  CB  SER A 397      77.128  93.388  44.326  1.00 85.15           C  
ATOM   3073  OG  SER A 397      77.211  94.653  43.685  1.00 86.47           O  
ATOM   3074  N   ARG A 398      74.421  94.016  45.653  1.00 84.00           N  
ATOM   3075  CA  ARG A 398      73.175  94.769  45.710  1.00 80.13           C  
ATOM   3076  C   ARG A 398      72.852  95.141  47.148  1.00 78.22           C  
ATOM   3077  O   ARG A 398      72.551  96.296  47.435  1.00 78.28           O  
ATOM   3078  CB  ARG A 398      72.046  93.930  45.129  1.00 79.74           C  
ATOM   3079  CG  ARG A 398      72.210  93.639  43.662  1.00 79.90           C  
ATOM   3080  CD  ARG A 398      71.141  92.679  43.181  1.00 81.57           C  
ATOM   3081  NE  ARG A 398      71.079  92.600  41.721  1.00 82.22           N  
ATOM   3082  CZ  ARG A 398      70.666  93.586  40.923  1.00 82.82           C  
ATOM   3083  NH1 ARG A 398      70.264  94.751  41.428  1.00 82.63           N  
ATOM   3084  NH2 ARG A 398      70.664  93.406  39.608  1.00 82.71           N  
ATOM   3085  N   ILE A 399      72.920  94.159  48.045  1.00 75.13           N  
ATOM   3086  CA  ILE A 399      72.640  94.381  49.454  1.00 73.26           C  
ATOM   3087  C   ILE A 399      73.539  95.437  50.071  1.00 75.79           C  
ATOM   3088  O   ILE A 399      73.109  96.180  50.949  1.00 76.89           O  
ATOM   3089  CB  ILE A 399      72.834  93.109  50.267  1.00 70.28           C  
ATOM   3090  CG1 ILE A 399      71.809  92.075  49.849  1.00 70.49           C  
ATOM   3091  CG2 ILE A 399      72.718  93.403  51.747  1.00 67.85           C  
ATOM   3092  CD1 ILE A 399      71.848  90.821  50.697  1.00 72.32           C  
ATOM   3093  N   SER A 400      74.788  95.506  49.618  1.00 78.08           N  
ATOM   3094  CA  SER A 400      75.751  96.460  50.169  1.00 79.32           C  
ATOM   3095  C   SER A 400      75.527  97.887  49.699  1.00 79.74           C  
ATOM   3096  O   SER A 400      75.978  98.841  50.336  1.00 78.94           O  
ATOM   3097  CB  SER A 400      77.163  96.009  49.822  1.00 80.20           C  
ATOM   3098  OG  SER A 400      77.342  94.656  50.212  1.00 81.83           O  
ATOM   3099  N   ALA A 401      74.817  98.030  48.587  1.00 81.39           N  
ATOM   3100  CA  ALA A 401      74.517  99.349  48.026  1.00 83.66           C  
ATOM   3101  C   ALA A 401      73.364 100.058  48.766  1.00 84.54           C  
ATOM   3102  O   ALA A 401      73.195 101.278  48.651  1.00 83.88           O  
ATOM   3103  CB  ALA A 401      74.176  99.209  46.528  1.00 84.01           C  
ATOM   3104  N   VAL A 402      72.584  99.276  49.517  1.00 85.22           N  
ATOM   3105  CA  VAL A 402      71.435  99.762  50.278  1.00 84.86           C  
ATOM   3106  C   VAL A 402      71.859 100.556  51.501  1.00 85.61           C  
ATOM   3107  O   VAL A 402      72.710 100.114  52.265  1.00 85.48           O  
ATOM   3108  CB  VAL A 402      70.559  98.592  50.762  1.00 84.10           C  
ATOM   3109  CG1 VAL A 402      69.315  99.122  51.436  1.00 84.83           C  
ATOM   3110  CG2 VAL A 402      70.183  97.708  49.598  1.00 84.37           C  
ATOM   3111  N   ASP A 403      71.247 101.724  51.684  1.00 86.58           N  
ATOM   3112  CA  ASP A 403      71.545 102.595  52.815  1.00 87.27           C  
ATOM   3113  C   ASP A 403      70.257 103.210  53.350  1.00 88.00           C  
ATOM   3114  O   ASP A 403      69.195 103.073  52.736  1.00 89.24           O  
ATOM   3115  CB  ASP A 403      72.498 103.713  52.384  1.00 88.35           C  
ATOM   3116  CG  ASP A 403      71.814 104.792  51.540  1.00 89.93           C  
ATOM   3117  OD1 ASP A 403      71.394 104.520  50.389  1.00 89.79           O  
ATOM   3118  OD2 ASP A 403      71.703 105.930  52.042  1.00 91.65           O  
ATOM   3119  N   ALA A 404      70.353 103.895  54.487  1.00 87.82           N  
ATOM   3120  CA  ALA A 404      69.190 104.537  55.096  1.00 87.60           C  
ATOM   3121  C   ALA A 404      68.383 105.289  54.051  1.00 87.48           C  
ATOM   3122  O   ALA A 404      67.303 104.858  53.661  1.00 87.64           O  
ATOM   3123  CB  ALA A 404      69.634 105.494  56.173  1.00 88.61           C  
ATOM   3124  N   ARG A 405      68.920 106.414  53.601  1.00 87.56           N  
ATOM   3125  CA  ARG A 405      68.268 107.238  52.592  1.00 88.71           C  
ATOM   3126  C   ARG A 405      67.520 106.379  51.574  1.00 87.72           C  
ATOM   3127  O   ARG A 405      66.408 106.710  51.177  1.00 88.20           O  
ATOM   3128  CB  ARG A 405      69.320 108.096  51.879  1.00 91.58           C  
ATOM   3129  CG  ARG A 405      68.811 109.394  51.263  1.00 95.51           C  
ATOM   3130  CD  ARG A 405      68.177 109.195  49.899  1.00100.44           C  
ATOM   3131  NE  ARG A 405      67.662 110.452  49.345  1.00106.20           N  
ATOM   3132  CZ  ARG A 405      66.663 111.167  49.875  1.00108.99           C  
ATOM   3133  NH1 ARG A 405      66.048 110.760  50.986  1.00110.30           N  
ATOM   3134  NH2 ARG A 405      66.272 112.296  49.289  1.00109.71           N  
ATOM   3135  N   MET A 406      68.123 105.268  51.171  1.00 86.60           N  
ATOM   3136  CA  MET A 406      67.502 104.390  50.192  1.00 86.26           C  
ATOM   3137  C   MET A 406      66.298 103.644  50.739  1.00 85.09           C  
ATOM   3138  O   MET A 406      65.238 103.624  50.115  1.00 85.26           O  
ATOM   3139  CB  MET A 406      68.522 103.391  49.660  1.00 87.79           C  
ATOM   3140  CG  MET A 406      68.008 102.630  48.459  1.00 91.99           C  
ATOM   3141  SD  MET A 406      69.309 102.061  47.355  1.00 94.67           S  
ATOM   3142  CE  MET A 406      69.369 100.292  47.810  1.00 95.75           C  
ATOM   3143  N   VAL A 407      66.465 103.029  51.904  1.00 83.87           N  
ATOM   3144  CA  VAL A 407      65.382 102.281  52.545  1.00 82.14           C  
ATOM   3145  C   VAL A 407      64.160 103.164  52.738  1.00 80.34           C  
ATOM   3146  O   VAL A 407      63.030 102.742  52.504  1.00 80.02           O  
ATOM   3147  CB  VAL A 407      65.808 101.744  53.928  1.00 82.25           C  
ATOM   3148  CG1 VAL A 407      64.639 101.032  54.591  1.00 81.74           C  
ATOM   3149  CG2 VAL A 407      66.993 100.806  53.777  1.00 82.03           C  
ATOM   3150  N   ARG A 408      64.395 104.393  53.175  1.00 78.65           N  
ATOM   3151  CA  ARG A 408      63.310 105.321  53.383  1.00 77.81           C  
ATOM   3152  C   ARG A 408      62.555 105.584  52.091  1.00 77.80           C  
ATOM   3153  O   ARG A 408      61.331 105.520  52.064  1.00 79.15           O  
ATOM   3154  CB  ARG A 408      63.833 106.630  53.948  1.00 76.94           C  
ATOM   3155  CG  ARG A 408      64.202 106.552  55.413  1.00 79.56           C  
ATOM   3156  CD  ARG A 408      64.214 107.945  56.019  1.00 83.50           C  
ATOM   3157  NE  ARG A 408      65.197 108.801  55.362  1.00 86.81           N  
ATOM   3158  CZ  ARG A 408      66.494 108.793  55.650  1.00 88.29           C  
ATOM   3159  NH1 ARG A 408      66.951 107.974  56.596  1.00 88.97           N  
ATOM   3160  NH2 ARG A 408      67.331 109.582  54.979  1.00 87.83           N  
ATOM   3161  N   ASP A 409      63.269 105.865  51.011  1.00 77.23           N  
ATOM   3162  CA  ASP A 409      62.597 106.137  49.750  1.00 76.83           C  
ATOM   3163  C   ASP A 409      61.755 104.965  49.266  1.00 75.63           C  
ATOM   3164  O   ASP A 409      60.632 105.156  48.812  1.00 76.03           O  
ATOM   3165  CB  ASP A 409      63.601 106.519  48.663  1.00 79.00           C  
ATOM   3166  CG  ASP A 409      64.315 107.837  48.948  1.00 81.35           C  
ATOM   3167  OD1 ASP A 409      63.738 108.723  49.628  1.00 81.08           O  
ATOM   3168  OD2 ASP A 409      65.460 107.989  48.463  1.00 83.66           O  
ATOM   3169  N   VAL A 410      62.298 103.756  49.357  1.00 73.85           N  
ATOM   3170  CA  VAL A 410      61.575 102.569  48.916  1.00 72.71           C  
ATOM   3171  C   VAL A 410      60.323 102.309  49.749  1.00 72.41           C  
ATOM   3172  O   VAL A 410      59.226 102.160  49.210  1.00 72.67           O  
ATOM   3173  CB  VAL A 410      62.476 101.326  48.973  1.00 72.42           C  
ATOM   3174  CG1 VAL A 410      61.681 100.069  48.656  1.00 71.41           C  
ATOM   3175  CG2 VAL A 410      63.604 101.488  47.990  1.00 72.46           C  
ATOM   3176  N   CYS A 411      60.489 102.250  51.064  1.00 71.40           N  
ATOM   3177  CA  CYS A 411      59.364 102.012  51.957  1.00 70.37           C  
ATOM   3178  C   CYS A 411      58.248 103.041  51.769  1.00 69.68           C  
ATOM   3179  O   CYS A 411      57.074 102.688  51.716  1.00 69.72           O  
ATOM   3180  CB  CYS A 411      59.855 102.018  53.399  1.00 70.30           C  
ATOM   3181  SG  CYS A 411      60.993 100.673  53.740  1.00 71.00           S  
ATOM   3182  N   SER A 412      58.616 104.311  51.673  1.00 68.62           N  
ATOM   3183  CA  SER A 412      57.636 105.364  51.467  1.00 69.23           C  
ATOM   3184  C   SER A 412      56.850 105.043  50.205  1.00 69.94           C  
ATOM   3185  O   SER A 412      55.622 105.123  50.178  1.00 72.09           O  
ATOM   3186  CB  SER A 412      58.322 106.720  51.274  1.00 68.81           C  
ATOM   3187  OG  SER A 412      59.076 107.096  52.407  1.00 70.52           O  
ATOM   3188  N   LYS A 413      57.578 104.689  49.153  1.00 69.81           N  
ATOM   3189  CA  LYS A 413      56.980 104.372  47.868  1.00 68.69           C  
ATOM   3190  C   LYS A 413      56.008 103.204  47.929  1.00 68.19           C  
ATOM   3191  O   LYS A 413      55.001 103.205  47.221  1.00 69.49           O  
ATOM   3192  CB  LYS A 413      58.070 104.078  46.845  1.00 68.57           C  
ATOM   3193  CG  LYS A 413      57.559 103.544  45.516  1.00 70.36           C  
ATOM   3194  CD  LYS A 413      58.723 103.241  44.581  1.00 74.68           C  
ATOM   3195  CE  LYS A 413      58.359 102.320  43.413  1.00 74.88           C  
ATOM   3196  NZ  LYS A 413      59.593 101.830  42.703  1.00 75.13           N  
ATOM   3197  N   TYR A 414      56.285 102.218  48.776  1.00 66.62           N  
ATOM   3198  CA  TYR A 414      55.400 101.059  48.864  1.00 66.28           C  
ATOM   3199  C   TYR A 414      54.433 101.007  50.040  1.00 65.06           C  
ATOM   3200  O   TYR A 414      53.440 100.273  49.981  1.00 63.96           O  
ATOM   3201  CB  TYR A 414      56.211  99.746  48.857  1.00 67.06           C  
ATOM   3202  CG  TYR A 414      56.792  99.379  47.515  1.00 67.85           C  
ATOM   3203  CD1 TYR A 414      57.979  99.957  47.069  1.00 69.18           C  
ATOM   3204  CD2 TYR A 414      56.113  98.520  46.654  1.00 68.25           C  
ATOM   3205  CE1 TYR A 414      58.473  99.700  45.798  1.00 69.65           C  
ATOM   3206  CE2 TYR A 414      56.595  98.254  45.376  1.00 69.79           C  
ATOM   3207  CZ  TYR A 414      57.774  98.851  44.953  1.00 70.86           C  
ATOM   3208  OH  TYR A 414      58.241  98.621  43.677  1.00 72.48           O  
ATOM   3209  N   ILE A 415      54.707 101.773  51.092  1.00 64.17           N  
ATOM   3210  CA  ILE A 415      53.862 101.740  52.287  1.00 64.38           C  
ATOM   3211  C   ILE A 415      53.081 103.001  52.632  1.00 64.92           C  
ATOM   3212  O   ILE A 415      51.887 102.948  52.960  1.00 64.91           O  
ATOM   3213  CB  ILE A 415      54.686 101.417  53.542  1.00 64.20           C  
ATOM   3214  CG1 ILE A 415      55.579 100.205  53.289  1.00 64.06           C  
ATOM   3215  CG2 ILE A 415      53.749 101.191  54.722  1.00 63.71           C  
ATOM   3216  CD1 ILE A 415      56.441  99.824  54.473  1.00 63.42           C  
ATOM   3217  N   TYR A 416      53.762 104.137  52.572  1.00 64.90           N  
ATOM   3218  CA  TYR A 416      53.144 105.390  52.950  1.00 63.88           C  
ATOM   3219  C   TYR A 416      51.806 105.725  52.320  1.00 63.87           C  
ATOM   3220  O   TYR A 416      51.659 105.774  51.098  1.00 66.07           O  
ATOM   3221  CB  TYR A 416      54.103 106.549  52.735  1.00 61.73           C  
ATOM   3222  CG  TYR A 416      53.765 107.683  53.659  1.00 62.38           C  
ATOM   3223  CD1 TYR A 416      54.086 107.619  55.018  1.00 62.07           C  
ATOM   3224  CD2 TYR A 416      53.054 108.789  53.200  1.00 62.69           C  
ATOM   3225  CE1 TYR A 416      53.704 108.622  55.897  1.00 61.05           C  
ATOM   3226  CE2 TYR A 416      52.668 109.801  54.069  1.00 62.35           C  
ATOM   3227  CZ  TYR A 416      52.996 109.708  55.417  1.00 62.72           C  
ATOM   3228  OH  TYR A 416      52.597 110.704  56.285  1.00 67.05           O  
ATOM   3229  N   ASP A 417      50.838 105.968  53.190  1.00 61.94           N  
ATOM   3230  CA  ASP A 417      49.492 106.326  52.800  1.00 62.47           C  
ATOM   3231  C   ASP A 417      48.774 105.323  51.891  1.00 61.80           C  
ATOM   3232  O   ASP A 417      47.828 105.684  51.192  1.00 63.25           O  
ATOM   3233  CB  ASP A 417      49.481 107.706  52.148  1.00 62.18           C  
ATOM   3234  CG  ASP A 417      48.079 108.299  52.072  1.00 63.75           C  
ATOM   3235  OD1 ASP A 417      47.879 109.266  51.316  1.00 65.83           O  
ATOM   3236  OD2 ASP A 417      47.169 107.808  52.772  1.00 63.57           O  
ATOM   3237  N   LYS A 418      49.200 104.068  51.902  1.00 60.16           N  
ATOM   3238  CA  LYS A 418      48.537 103.065  51.076  1.00 59.91           C  
ATOM   3239  C   LYS A 418      47.338 102.505  51.813  1.00 58.45           C  
ATOM   3240  O   LYS A 418      47.253 102.617  53.017  1.00 58.40           O  
ATOM   3241  CB  LYS A 418      49.490 101.915  50.774  1.00 60.78           C  
ATOM   3242  CG  LYS A 418      50.643 102.295  49.877  1.00 62.76           C  
ATOM   3243  CD  LYS A 418      50.169 102.572  48.475  1.00 63.78           C  
ATOM   3244  CE  LYS A 418      51.325 102.892  47.566  1.00 65.04           C  
ATOM   3245  NZ  LYS A 418      50.828 102.970  46.171  1.00 67.63           N  
ATOM   3246  N   CYS A 419      46.408 101.898  51.091  1.00 57.70           N  
ATOM   3247  CA  CYS A 419      45.254 101.284  51.731  1.00 55.71           C  
ATOM   3248  C   CYS A 419      45.649  99.816  51.790  1.00 54.47           C  
ATOM   3249  O   CYS A 419      45.691  99.138  50.770  1.00 55.74           O  
ATOM   3250  CB  CYS A 419      44.001 101.442  50.872  1.00 55.67           C  
ATOM   3251  SG  CYS A 419      43.825 103.067  50.129  1.00 59.98           S  
ATOM   3252  N   PRO A 420      45.965  99.307  52.981  1.00 52.67           N  
ATOM   3253  CA  PRO A 420      46.363  97.904  53.122  1.00 51.72           C  
ATOM   3254  C   PRO A 420      45.244  96.857  53.104  1.00 51.07           C  
ATOM   3255  O   PRO A 420      44.057  97.174  53.094  1.00 51.46           O  
ATOM   3256  CB  PRO A 420      47.120  97.904  54.439  1.00 51.04           C  
ATOM   3257  CG  PRO A 420      46.360  98.898  55.228  1.00 51.20           C  
ATOM   3258  CD  PRO A 420      46.135 100.029  54.251  1.00 51.73           C  
ATOM   3259  N   ALA A 421      45.649  95.599  53.076  1.00 49.45           N  
ATOM   3260  CA  ALA A 421      44.713  94.504  53.084  1.00 49.30           C  
ATOM   3261  C   ALA A 421      44.913  93.884  54.456  1.00 51.70           C  
ATOM   3262  O   ALA A 421      46.048  93.614  54.879  1.00 53.22           O  
ATOM   3263  CB  ALA A 421      45.037  93.525  52.004  1.00 48.02           C  
ATOM   3264  N   LEU A 422      43.799  93.661  55.147  1.00 51.91           N  
ATOM   3265  CA  LEU A 422      43.819  93.141  56.493  1.00 50.75           C  
ATOM   3266  C   LEU A 422      43.049  91.850  56.678  1.00 50.50           C  
ATOM   3267  O   LEU A 422      41.908  91.730  56.233  1.00 52.75           O  
ATOM   3268  CB  LEU A 422      43.241  94.202  57.420  1.00 51.38           C  
ATOM   3269  CG  LEU A 422      43.022  93.698  58.840  1.00 53.10           C  
ATOM   3270  CD1 LEU A 422      44.368  93.516  59.496  1.00 54.97           C  
ATOM   3271  CD2 LEU A 422      42.178  94.678  59.629  1.00 55.10           C  
ATOM   3272  N   ALA A 423      43.664  90.879  57.342  1.00 48.85           N  
ATOM   3273  CA  ALA A 423      42.981  89.621  57.605  1.00 48.22           C  
ATOM   3274  C   ALA A 423      43.061  89.350  59.096  1.00 49.23           C  
ATOM   3275  O   ALA A 423      44.150  89.383  59.686  1.00 49.08           O  
ATOM   3276  CB  ALA A 423      43.623  88.515  56.848  1.00 48.81           C  
ATOM   3277  N   ALA A 424      41.909  89.106  59.717  1.00 48.60           N  
ATOM   3278  CA  ALA A 424      41.888  88.858  61.145  1.00 48.30           C  
ATOM   3279  C   ALA A 424      41.033  87.670  61.497  1.00 49.29           C  
ATOM   3280  O   ALA A 424      39.887  87.548  61.053  1.00 49.39           O  
ATOM   3281  CB  ALA A 424      41.394  90.076  61.879  1.00 47.37           C  
ATOM   3282  N   VAL A 425      41.606  86.796  62.314  1.00 49.75           N  
ATOM   3283  CA  VAL A 425      40.923  85.600  62.751  1.00 50.45           C  
ATOM   3284  C   VAL A 425      41.091  85.404  64.258  1.00 51.83           C  
ATOM   3285  O   VAL A 425      42.180  85.638  64.815  1.00 50.16           O  
ATOM   3286  CB  VAL A 425      41.481  84.363  62.025  1.00 51.06           C  
ATOM   3287  CG1 VAL A 425      40.640  83.134  62.363  1.00 50.36           C  
ATOM   3288  CG2 VAL A 425      41.525  84.616  60.523  1.00 50.52           C  
ATOM   3289  N   GLY A 426      40.000  84.970  64.898  1.00 52.56           N  
ATOM   3290  CA  GLY A 426      40.010  84.705  66.324  1.00 52.94           C  
ATOM   3291  C   GLY A 426      39.174  85.692  67.083  1.00 53.73           C  
ATOM   3292  O   GLY A 426      38.310  86.335  66.502  1.00 54.15           O  
ATOM   3293  N   PRO A 427      39.413  85.834  68.394  1.00 55.46           N  
ATOM   3294  CA  PRO A 427      38.729  86.735  69.334  1.00 56.68           C  
ATOM   3295  C   PRO A 427      39.236  88.151  69.090  1.00 58.08           C  
ATOM   3296  O   PRO A 427      39.848  88.764  69.962  1.00 60.45           O  
ATOM   3297  CB  PRO A 427      39.188  86.207  70.672  1.00 56.49           C  
ATOM   3298  CG  PRO A 427      40.617  85.871  70.368  1.00 56.61           C  
ATOM   3299  CD  PRO A 427      40.492  85.106  69.078  1.00 55.31           C  
ATOM   3300  N   ILE A 428      38.958  88.660  67.897  1.00 57.76           N  
ATOM   3301  CA  ILE A 428      39.435  89.962  67.456  1.00 56.84           C  
ATOM   3302  C   ILE A 428      38.661  91.248  67.790  1.00 58.12           C  
ATOM   3303  O   ILE A 428      38.913  92.302  67.187  1.00 57.29           O  
ATOM   3304  CB  ILE A 428      39.634  89.886  65.954  1.00 55.37           C  
ATOM   3305  CG1 ILE A 428      38.343  89.388  65.292  1.00 53.42           C  
ATOM   3306  CG2 ILE A 428      40.755  88.915  65.652  1.00 56.46           C  
ATOM   3307  CD1 ILE A 428      38.412  89.298  63.799  1.00 49.83           C  
ATOM   3308  N   GLU A 429      37.749  91.192  68.754  1.00 58.73           N  
ATOM   3309  CA  GLU A 429      36.973  92.376  69.083  1.00 59.50           C  
ATOM   3310  C   GLU A 429      37.753  93.626  69.383  1.00 58.76           C  
ATOM   3311  O   GLU A 429      37.287  94.706  69.061  1.00 59.18           O  
ATOM   3312  CB  GLU A 429      36.065  92.113  70.263  1.00 63.78           C  
ATOM   3313  CG  GLU A 429      35.230  93.314  70.668  1.00 69.46           C  
ATOM   3314  CD  GLU A 429      34.185  92.953  71.722  1.00 74.32           C  
ATOM   3315  OE1 GLU A 429      34.546  92.913  72.924  1.00 75.94           O  
ATOM   3316  OE2 GLU A 429      33.006  92.694  71.342  1.00 77.64           O  
ATOM   3317  N   GLN A 430      38.923  93.495  70.009  1.00 59.49           N  
ATOM   3318  CA  GLN A 430      39.724  94.672  70.370  1.00 58.63           C  
ATOM   3319  C   GLN A 430      40.464  95.338  69.214  1.00 57.04           C  
ATOM   3320  O   GLN A 430      40.929  96.465  69.350  1.00 56.62           O  
ATOM   3321  CB  GLN A 430      40.732  94.352  71.489  1.00 59.72           C  
ATOM   3322  CG  GLN A 430      41.199  95.630  72.238  1.00 63.59           C  
ATOM   3323  CD  GLN A 430      42.477  95.476  73.092  1.00 63.55           C  
ATOM   3324  OE1 GLN A 430      43.602  95.374  72.570  1.00 63.45           O  
ATOM   3325  NE2 GLN A 430      42.299  95.484  74.412  1.00 63.61           N  
ATOM   3326  N   LEU A 431      40.612  94.639  68.097  1.00 56.09           N  
ATOM   3327  CA  LEU A 431      41.278  95.230  66.935  1.00 57.43           C  
ATOM   3328  C   LEU A 431      40.146  95.833  66.160  1.00 58.35           C  
ATOM   3329  O   LEU A 431      39.228  95.096  65.795  1.00 61.61           O  
ATOM   3330  CB  LEU A 431      41.921  94.160  66.030  1.00 55.11           C  
ATOM   3331  CG  LEU A 431      42.143  94.625  64.574  1.00 52.43           C  
ATOM   3332  CD1 LEU A 431      43.337  95.527  64.543  1.00 51.37           C  
ATOM   3333  CD2 LEU A 431      42.352  93.471  63.624  1.00 50.34           C  
ATOM   3334  N   LEU A 432      40.143  97.127  65.882  1.00 57.43           N  
ATOM   3335  CA  LEU A 432      38.988  97.533  65.108  1.00 59.31           C  
ATOM   3336  C   LEU A 432      39.161  98.638  64.102  1.00 57.99           C  
ATOM   3337  O   LEU A 432      40.210  99.222  63.985  1.00 58.16           O  
ATOM   3338  CB  LEU A 432      37.749  97.806  66.026  1.00 61.02           C  
ATOM   3339  CG  LEU A 432      36.341  97.241  65.597  1.00 58.62           C  
ATOM   3340  CD1 LEU A 432      35.971  95.931  66.303  1.00 54.36           C  
ATOM   3341  CD2 LEU A 432      35.286  98.263  65.924  1.00 58.24           C  
ATOM   3342  N   ASP A 433      38.087  98.846  63.351  1.00 57.88           N  
ATOM   3343  CA  ASP A 433      37.957  99.823  62.300  1.00 56.58           C  
ATOM   3344  C   ASP A 433      39.071  99.935  61.255  1.00 54.72           C  
ATOM   3345  O   ASP A 433      40.190 100.344  61.555  1.00 53.02           O  
ATOM   3346  CB  ASP A 433      37.699 101.173  62.906  1.00 59.75           C  
ATOM   3347  CG  ASP A 433      37.334 102.181  61.867  1.00 65.53           C  
ATOM   3348  OD1 ASP A 433      37.241 103.381  62.196  1.00 73.33           O  
ATOM   3349  OD2 ASP A 433      37.132 101.777  60.706  1.00 66.56           O  
ATOM   3350  N   TYR A 434      38.733  99.579  60.016  1.00 53.09           N  
ATOM   3351  CA  TYR A 434      39.656  99.661  58.898  1.00 50.41           C  
ATOM   3352  C   TYR A 434      40.121 101.093  58.831  1.00 50.77           C  
ATOM   3353  O   TYR A 434      41.278 101.364  58.546  1.00 51.11           O  
ATOM   3354  CB  TYR A 434      38.956  99.327  57.591  1.00 49.68           C  
ATOM   3355  CG  TYR A 434      39.898  99.331  56.422  1.00 49.34           C  
ATOM   3356  CD1 TYR A 434      40.726  98.232  56.174  1.00 48.91           C  
ATOM   3357  CD2 TYR A 434      40.051 100.469  55.627  1.00 48.35           C  
ATOM   3358  CE1 TYR A 434      41.698  98.267  55.175  1.00 48.34           C  
ATOM   3359  CE2 TYR A 434      41.021 100.516  54.624  1.00 49.09           C  
ATOM   3360  CZ  TYR A 434      41.843  99.410  54.412  1.00 49.42           C  
ATOM   3361  OH  TYR A 434      42.842  99.459  53.475  1.00 52.04           O  
ATOM   3362  N   ASN A 435      39.197 102.010  59.096  1.00 51.57           N  
ATOM   3363  CA  ASN A 435      39.489 103.442  59.089  1.00 52.94           C  
ATOM   3364  C   ASN A 435      40.625 103.844  60.003  1.00 53.28           C  
ATOM   3365  O   ASN A 435      41.498 104.612  59.618  1.00 53.53           O  
ATOM   3366  CB  ASN A 435      38.255 104.241  59.477  1.00 51.82           C  
ATOM   3367  CG  ASN A 435      37.406 104.553  58.301  1.00 52.77           C  
ATOM   3368  OD1 ASN A 435      37.909 105.038  57.280  1.00 51.02           O  
ATOM   3369  ND2 ASN A 435      36.110 104.279  58.413  1.00 53.44           N  
ATOM   3370  N   ARG A 436      40.597 103.333  61.223  1.00 54.56           N  
ATOM   3371  CA  ARG A 436      41.630 103.631  62.192  1.00 56.71           C  
ATOM   3372  C   ARG A 436      42.974 103.053  61.753  1.00 58.41           C  
ATOM   3373  O   ARG A 436      44.033 103.681  61.950  1.00 59.18           O  
ATOM   3374  CB  ARG A 436      41.224 103.078  63.551  1.00 55.63           C  
ATOM   3375  CG  ARG A 436      40.045 103.827  64.132  1.00 56.12           C  
ATOM   3376  CD  ARG A 436      40.387 105.294  64.350  1.00 55.40           C  
ATOM   3377  NE  ARG A 436      41.143 105.481  65.582  1.00 56.93           N  
ATOM   3378  CZ  ARG A 436      40.602 105.486  66.797  1.00 58.50           C  
ATOM   3379  NH1 ARG A 436      39.290 105.321  66.947  1.00 60.02           N  
ATOM   3380  NH2 ARG A 436      41.369 105.642  67.865  1.00 57.99           N  
ATOM   3381  N   ILE A 437      42.927 101.864  61.149  1.00 58.01           N  
ATOM   3382  CA  ILE A 437      44.133 101.203  60.667  1.00 57.05           C  
ATOM   3383  C   ILE A 437      44.696 101.948  59.462  1.00 55.61           C  
ATOM   3384  O   ILE A 437      45.903 102.120  59.335  1.00 54.49           O  
ATOM   3385  CB  ILE A 437      43.838  99.750  60.280  1.00 56.89           C  
ATOM   3386  CG1 ILE A 437      43.261  99.018  61.489  1.00 55.57           C  
ATOM   3387  CG2 ILE A 437      45.115  99.058  59.839  1.00 58.06           C  
ATOM   3388  CD1 ILE A 437      42.950  97.570  61.230  1.00 55.91           C  
ATOM   3389  N   ARG A 438      43.806 102.406  58.595  1.00 54.80           N  
ATOM   3390  CA  ARG A 438      44.214 103.131  57.405  1.00 56.53           C  
ATOM   3391  C   ARG A 438      44.929 104.415  57.793  1.00 57.70           C  
ATOM   3392  O   ARG A 438      45.880 104.853  57.137  1.00 58.07           O  
ATOM   3393  CB  ARG A 438      42.989 103.460  56.562  1.00 55.86           C  
ATOM   3394  CG  ARG A 438      43.264 104.306  55.340  1.00 54.73           C  
ATOM   3395  CD  ARG A 438      43.928 103.508  54.257  1.00 55.30           C  
ATOM   3396  NE  ARG A 438      44.222 104.326  53.078  1.00 55.78           N  
ATOM   3397  CZ  ARG A 438      45.029 105.386  53.080  1.00 55.82           C  
ATOM   3398  NH1 ARG A 438      45.635 105.776  54.206  1.00 52.83           N  
ATOM   3399  NH2 ARG A 438      45.245 106.048  51.945  1.00 57.29           N  
ATOM   3400  N   SER A 439      44.462 105.014  58.874  1.00 59.09           N  
ATOM   3401  CA  SER A 439      45.038 106.259  59.356  1.00 61.02           C  
ATOM   3402  C   SER A 439      46.381 106.023  60.021  1.00 61.03           C  
ATOM   3403  O   SER A 439      47.129 106.964  60.276  1.00 60.76           O  
ATOM   3404  CB  SER A 439      44.076 106.913  60.333  1.00 61.98           C  
ATOM   3405  OG  SER A 439      42.792 106.991  59.739  1.00 63.90           O  
ATOM   3406  N   GLY A 440      46.677 104.762  60.304  1.00 60.50           N  
ATOM   3407  CA  GLY A 440      47.946 104.444  60.916  1.00 61.33           C  
ATOM   3408  C   GLY A 440      48.975 104.278  59.819  1.00 61.64           C  
ATOM   3409  O   GLY A 440      50.120 103.895  60.065  1.00 62.98           O  
ATOM   3410  N   MET A 441      48.557 104.567  58.596  1.00 60.60           N  
ATOM   3411  CA  MET A 441      49.431 104.445  57.453  1.00 60.01           C  
ATOM   3412  C   MET A 441      50.125 105.756  57.108  1.00 62.33           C  
ATOM   3413  O   MET A 441      50.732 105.875  56.049  1.00 62.14           O  
ATOM   3414  CB  MET A 441      48.636 103.961  56.256  1.00 57.91           C  
ATOM   3415  CG  MET A 441      48.010 102.615  56.440  1.00 55.93           C  
ATOM   3416  SD  MET A 441      49.217 101.327  56.680  1.00 57.33           S  
ATOM   3417  CE  MET A 441      49.724 100.938  54.985  1.00 55.37           C  
ATOM   3418  N   TYR A 442      50.024 106.756  57.975  1.00 65.60           N  
ATOM   3419  CA  TYR A 442      50.704 108.010  57.697  1.00 70.26           C  
ATOM   3420  C   TYR A 442      50.985 108.818  58.940  1.00 73.39           C  
ATOM   3421  O   TYR A 442      50.340 108.646  59.970  1.00 71.14           O  
ATOM   3422  CB  TYR A 442      49.954 108.845  56.664  1.00 70.48           C  
ATOM   3423  CG  TYR A 442      48.575 109.226  57.065  1.00 73.49           C  
ATOM   3424  CD1 TYR A 442      48.327 110.420  57.731  1.00 74.86           C  
ATOM   3425  CD2 TYR A 442      47.503 108.378  56.792  1.00 75.91           C  
ATOM   3426  CE1 TYR A 442      47.029 110.770  58.119  1.00 77.23           C  
ATOM   3427  CE2 TYR A 442      46.209 108.707  57.175  1.00 77.80           C  
ATOM   3428  CZ  TYR A 442      45.974 109.903  57.837  1.00 78.14           C  
ATOM   3429  OH  TYR A 442      44.687 110.224  58.207  1.00 79.78           O  
ATOM   3430  N   TRP A 443      51.987 109.687  58.797  1.00 79.82           N  
ATOM   3431  CA  TRP A 443      52.545 110.547  59.841  1.00 84.88           C  
ATOM   3432  C   TRP A 443      53.201 109.639  60.906  1.00 87.28           C  
ATOM   3433  O   TRP A 443      52.498 108.961  61.678  1.00 88.64           O  
ATOM   3434  CB  TRP A 443      51.478 111.461  60.455  1.00 88.73           C  
ATOM   3435  CG  TRP A 443      52.042 112.792  60.929  1.00 93.53           C  
ATOM   3436  CD1 TRP A 443      51.467 113.663  61.821  1.00 94.59           C  
ATOM   3437  CD2 TRP A 443      53.303 113.381  60.552  1.00 95.66           C  
ATOM   3438  NE1 TRP A 443      52.297 114.748  62.027  1.00 94.16           N  
ATOM   3439  CE2 TRP A 443      53.425 114.599  61.264  1.00 95.02           C  
ATOM   3440  CE3 TRP A 443      54.342 112.997  59.684  1.00 97.66           C  
ATOM   3441  CZ2 TRP A 443      54.542 115.430  61.135  1.00 95.66           C  
ATOM   3442  CZ3 TRP A 443      55.456 113.828  59.556  1.00 97.53           C  
ATOM   3443  CH2 TRP A 443      55.542 115.029  60.280  1.00 97.41           C  
ATOM   3444  N   ILE A 444      54.546 109.615  60.900  1.00 87.66           N  
ATOM   3445  CA  ILE A 444      55.393 108.807  61.802  1.00 87.21           C  
ATOM   3446  C   ILE A 444      54.889 108.582  63.222  1.00 86.29           C  
ATOM   3447  CB  ILE A 444      56.796 109.411  61.917  1.00 86.87           C  
TER    3448      ILE A 444                                                      
ATOM   3449  N   GLY B  20      90.216  75.019  46.730  1.00134.49           N  
ATOM   3450  CA  GLY B  20      90.224  74.521  48.135  1.00135.15           C  
ATOM   3451  C   GLY B  20      89.415  73.249  48.329  1.00135.23           C  
ATOM   3452  O   GLY B  20      88.370  73.061  47.704  1.00134.91           O  
ATOM   3453  N   ALA B  21      89.904  72.373  49.205  1.00135.30           N  
ATOM   3454  CA  ALA B  21      89.240  71.106  49.507  1.00134.96           C  
ATOM   3455  C   ALA B  21      90.237  70.132  50.137  1.00134.93           C  
ATOM   3456  O   ALA B  21      90.872  69.349  49.424  1.00134.42           O  
ATOM   3457  N   GLU B  22      90.368  70.171  51.469  1.00134.69           N  
ATOM   3458  CA  GLU B  22      91.322  69.289  52.149  1.00133.83           C  
ATOM   3459  C   GLU B  22      91.391  69.335  53.693  1.00132.57           C  
ATOM   3460  O   GLU B  22      91.172  70.382  54.315  1.00131.94           O  
ATOM   3461  CB  GLU B  22      92.717  69.589  51.613  1.00134.52           C  
ATOM   3462  CG  GLU B  22      93.185  70.978  52.017  1.00135.37           C  
ATOM   3463  CD  GLU B  22      94.155  71.585  51.032  1.00136.10           C  
ATOM   3464  OE1 GLU B  22      93.770  71.752  49.851  1.00136.27           O  
ATOM   3465  OE2 GLU B  22      95.296  71.899  51.442  1.00135.82           O  
ATOM   3466  N   ASP B  23      91.725  68.172  54.267  1.00130.80           N  
ATOM   3467  CA  ASP B  23      91.933  67.916  55.705  1.00128.35           C  
ATOM   3468  C   ASP B  23      90.793  68.002  56.717  1.00126.22           C  
ATOM   3469  O   ASP B  23      89.618  68.052  56.369  1.00126.79           O  
ATOM   3470  CB  ASP B  23      93.110  68.770  56.218  1.00129.10           C  
ATOM   3471  CG  ASP B  23      92.678  70.136  56.741  1.00129.67           C  
ATOM   3472  OD1 ASP B  23      92.097  70.198  57.848  1.00129.39           O  
ATOM   3473  OD2 ASP B  23      92.923  71.148  56.044  1.00129.68           O  
ATOM   3474  N   LEU B  24      91.197  67.988  57.984  1.00123.09           N  
ATOM   3475  CA  LEU B  24      90.341  68.065  59.163  1.00120.84           C  
ATOM   3476  C   LEU B  24      91.245  67.840  60.371  1.00119.93           C  
ATOM   3477  O   LEU B  24      91.197  66.781  60.995  1.00120.11           O  
ATOM   3478  CB  LEU B  24      89.245  66.985  59.134  1.00120.13           C  
ATOM   3479  CG  LEU B  24      88.497  66.614  60.431  1.00118.38           C  
ATOM   3480  CD1 LEU B  24      87.976  67.846  61.152  1.00118.25           C  
ATOM   3481  CD2 LEU B  24      87.358  65.695  60.083  1.00117.02           C  
ATOM   3482  N   GLU B  25      92.073  68.830  60.696  1.00118.43           N  
ATOM   3483  CA  GLU B  25      92.989  68.718  61.833  1.00117.44           C  
ATOM   3484  C   GLU B  25      92.274  68.567  63.181  1.00115.72           C  
ATOM   3485  O   GLU B  25      91.067  68.761  63.270  1.00116.13           O  
ATOM   3486  CB  GLU B  25      93.923  69.920  61.841  1.00118.72           C  
ATOM   3487  CG  GLU B  25      94.796  69.949  60.605  1.00120.93           C  
ATOM   3488  CD  GLU B  25      95.256  71.343  60.240  1.00122.25           C  
ATOM   3489  OE1 GLU B  25      96.043  71.941  61.010  1.00122.82           O  
ATOM   3490  OE2 GLU B  25      94.821  71.837  59.175  1.00122.59           O  
ATOM   3491  N   ILE B  26      93.013  68.227  64.233  1.00113.53           N  
ATOM   3492  CA  ILE B  26      92.385  68.012  65.529  1.00111.28           C  
ATOM   3493  C   ILE B  26      93.381  67.861  66.685  1.00112.01           C  
ATOM   3494  O   ILE B  26      93.689  66.748  67.108  1.00113.28           O  
ATOM   3495  CB  ILE B  26      91.460  66.758  65.441  1.00109.00           C  
ATOM   3496  CG1 ILE B  26      90.996  66.309  66.817  1.00107.60           C  
ATOM   3497  CG2 ILE B  26      92.188  65.619  64.771  1.00109.04           C  
ATOM   3498  CD1 ILE B  26      90.209  65.020  66.760  1.00107.08           C  
ATOM   3499  N   THR B  27      93.877  68.988  67.193  1.00111.98           N  
ATOM   3500  CA  THR B  27      94.829  69.012  68.314  1.00112.12           C  
ATOM   3501  C   THR B  27      94.174  68.495  69.606  1.00112.87           C  
ATOM   3502  O   THR B  27      92.989  68.173  69.620  1.00113.82           O  
ATOM   3503  CB  THR B  27      95.337  70.459  68.563  1.00111.20           C  
ATOM   3504  OG1 THR B  27      95.924  70.971  67.362  1.00110.33           O  
ATOM   3505  CG2 THR B  27      96.375  70.493  69.677  1.00110.74           C  
ATOM   3506  N   LYS B  28      94.944  68.391  70.683  1.00113.28           N  
ATOM   3507  CA  LYS B  28      94.378  67.947  71.949  1.00114.12           C  
ATOM   3508  C   LYS B  28      95.125  68.517  73.159  1.00115.35           C  
ATOM   3509  O   LYS B  28      95.676  67.775  73.978  1.00115.10           O  
ATOM   3510  CB  LYS B  28      94.330  66.421  72.036  1.00112.89           C  
ATOM   3511  CG  LYS B  28      93.562  65.956  73.266  1.00112.59           C  
ATOM   3512  CD  LYS B  28      93.699  64.475  73.522  1.00112.30           C  
ATOM   3513  CE  LYS B  28      92.986  64.085  74.808  1.00111.60           C  
ATOM   3514  NZ  LYS B  28      93.213  62.654  75.150  1.00110.46           N  
ATOM   3515  N   LEU B  29      95.110  69.846  73.248  1.00116.71           N  
ATOM   3516  CA  LEU B  29      95.737  70.632  74.313  1.00118.09           C  
ATOM   3517  C   LEU B  29      96.160  69.934  75.611  1.00118.75           C  
ATOM   3518  O   LEU B  29      95.700  68.830  75.934  1.00118.28           O  
ATOM   3519  CB  LEU B  29      94.826  71.812  74.685  1.00118.38           C  
ATOM   3520  CG  LEU B  29      94.614  72.929  73.660  1.00119.27           C  
ATOM   3521  CD1 LEU B  29      93.768  74.016  74.308  1.00119.46           C  
ATOM   3522  CD2 LEU B  29      95.952  73.505  73.190  1.00119.31           C  
ATOM   3523  N   PRO B  30      97.041  70.599  76.387  1.00119.38           N  
ATOM   3524  CA  PRO B  30      97.562  70.101  77.664  1.00119.56           C  
ATOM   3525  C   PRO B  30      96.493  69.467  78.567  1.00119.85           C  
ATOM   3526  O   PRO B  30      96.489  68.249  78.801  1.00119.28           O  
ATOM   3527  CB  PRO B  30      98.164  71.359  78.288  1.00119.72           C  
ATOM   3528  CG  PRO B  30      98.708  72.085  77.091  1.00119.14           C  
ATOM   3529  CD  PRO B  30      97.595  71.939  76.086  1.00119.22           C  
ATOM   3530  N   ASN B  31      95.589  70.317  79.055  1.00120.11           N  
ATOM   3531  CA  ASN B  31      94.500  69.932  79.960  1.00119.82           C  
ATOM   3532  C   ASN B  31      93.444  68.920  79.474  1.00119.31           C  
ATOM   3533  O   ASN B  31      92.538  68.558  80.229  1.00119.10           O  
ATOM   3534  CB  ASN B  31      93.796  71.200  80.470  1.00119.56           C  
ATOM   3535  CG  ASN B  31      93.503  72.208  79.361  1.00119.95           C  
ATOM   3536  OD1 ASN B  31      92.938  73.273  79.618  1.00119.83           O  
ATOM   3537  ND2 ASN B  31      93.886  71.881  78.128  1.00119.80           N  
ATOM   3538  N   GLY B  32      93.558  68.459  78.233  1.00118.70           N  
ATOM   3539  CA  GLY B  32      92.596  67.498  77.719  1.00117.56           C  
ATOM   3540  C   GLY B  32      91.533  68.124  76.840  1.00116.91           C  
ATOM   3541  O   GLY B  32      90.598  67.441  76.414  1.00117.28           O  
ATOM   3542  N   LEU B  33      91.678  69.420  76.567  1.00115.67           N  
ATOM   3543  CA  LEU B  33      90.724  70.147  75.734  1.00114.27           C  
ATOM   3544  C   LEU B  33      90.917  69.829  74.260  1.00112.62           C  
ATOM   3545  O   LEU B  33      91.915  70.225  73.666  1.00112.38           O  
ATOM   3546  CB  LEU B  33      90.877  71.658  75.925  1.00115.35           C  
ATOM   3547  CG  LEU B  33      89.949  72.496  75.033  1.00115.92           C  
ATOM   3548  CD1 LEU B  33      88.512  72.363  75.544  1.00115.45           C  
ATOM   3549  CD2 LEU B  33      90.396  73.960  75.029  1.00115.02           C  
ATOM   3550  N   ILE B  34      89.952  69.137  73.666  1.00110.66           N  
ATOM   3551  CA  ILE B  34      90.050  68.780  72.259  1.00108.48           C  
ATOM   3552  C   ILE B  34      89.596  69.900  71.326  1.00107.50           C  
ATOM   3553  O   ILE B  34      88.601  70.580  71.582  1.00107.71           O  
ATOM   3554  CB  ILE B  34      89.274  67.488  71.991  1.00107.63           C  
ATOM   3555  CG1 ILE B  34      89.982  66.344  72.724  1.00108.48           C  
ATOM   3556  CG2 ILE B  34      89.183  67.225  70.499  1.00106.24           C  
ATOM   3557  CD1 ILE B  34      89.312  64.990  72.628  1.00110.26           C  
ATOM   3558  N   ILE B  35      90.349  70.084  70.245  1.00105.72           N  
ATOM   3559  CA  ILE B  35      90.080  71.127  69.259  1.00104.39           C  
ATOM   3560  C   ILE B  35      89.973  70.578  67.834  1.00104.03           C  
ATOM   3561  O   ILE B  35      90.993  70.259  67.221  1.00105.01           O  
ATOM   3562  CB  ILE B  35      91.211  72.193  69.274  1.00103.97           C  
ATOM   3563  CG1 ILE B  35      91.278  72.865  70.647  1.00103.91           C  
ATOM   3564  CG2 ILE B  35      91.000  73.222  68.163  1.00102.11           C  
ATOM   3565  CD1 ILE B  35      92.349  73.935  70.737  1.00104.06           C  
ATOM   3566  N   ALA B  36      88.751  70.475  67.304  1.00102.76           N  
ATOM   3567  CA  ALA B  36      88.538  69.986  65.933  1.00100.83           C  
ATOM   3568  C   ALA B  36      88.486  71.180  64.984  1.00 99.60           C  
ATOM   3569  O   ALA B  36      88.288  72.309  65.421  1.00 99.46           O  
ATOM   3570  CB  ALA B  36      87.241  69.189  65.844  1.00100.36           C  
ATOM   3571  N   SER B  37      88.667  70.940  63.692  1.00 98.60           N  
ATOM   3572  CA  SER B  37      88.646  72.035  62.727  1.00 98.82           C  
ATOM   3573  C   SER B  37      88.603  71.574  61.274  1.00100.21           C  
ATOM   3574  O   SER B  37      89.099  70.505  60.932  1.00100.86           O  
ATOM   3575  CB  SER B  37      89.868  72.938  62.935  1.00 96.90           C  
ATOM   3576  OG  SER B  37      90.056  73.807  61.832  1.00 93.53           O  
ATOM   3577  N   LEU B  38      88.005  72.391  60.416  1.00101.21           N  
ATOM   3578  CA  LEU B  38      87.911  72.075  58.999  1.00102.02           C  
ATOM   3579  C   LEU B  38      87.513  73.300  58.206  1.00103.17           C  
ATOM   3580  O   LEU B  38      86.514  73.935  58.494  1.00104.27           O  
ATOM   3581  CB  LEU B  38      86.901  70.953  58.760  1.00100.52           C  
ATOM   3582  CG  LEU B  38      86.285  70.840  57.359  1.00 99.57           C  
ATOM   3583  CD1 LEU B  38      87.319  70.996  56.265  1.00 97.57           C  
ATOM   3584  CD2 LEU B  38      85.597  69.489  57.259  1.00 99.53           C  
ATOM   3585  N   GLU B  39      88.308  73.632  57.206  1.00104.84           N  
ATOM   3586  CA  GLU B  39      88.024  74.780  56.374  1.00107.16           C  
ATOM   3587  C   GLU B  39      87.366  74.325  55.072  1.00108.95           C  
ATOM   3588  O   GLU B  39      87.981  73.623  54.274  1.00109.63           O  
ATOM   3589  CB  GLU B  39      89.323  75.520  56.083  1.00107.69           C  
ATOM   3590  CG  GLU B  39      89.230  76.571  54.989  1.00110.87           C  
ATOM   3591  CD  GLU B  39      88.410  77.780  55.390  1.00112.64           C  
ATOM   3592  OE1 GLU B  39      87.162  77.677  55.416  1.00113.51           O  
ATOM   3593  OE2 GLU B  39      89.021  78.833  55.683  1.00113.67           O  
ATOM   3594  N   ASN B  40      86.107  74.704  54.866  1.00110.74           N  
ATOM   3595  CA  ASN B  40      85.397  74.345  53.640  1.00111.72           C  
ATOM   3596  C   ASN B  40      85.101  75.618  52.867  1.00112.27           C  
ATOM   3597  O   ASN B  40      84.271  75.633  51.958  1.00112.40           O  
ATOM   3598  CB  ASN B  40      84.086  73.608  53.944  1.00111.98           C  
ATOM   3599  CG  ASN B  40      83.183  74.377  54.890  1.00112.36           C  
ATOM   3600  OD1 ASN B  40      83.385  75.571  55.133  1.00111.54           O  
ATOM   3601  ND2 ASN B  40      82.170  73.695  55.426  1.00112.91           N  
ATOM   3602  N   PHE B  41      85.794  76.684  53.251  1.00113.01           N  
ATOM   3603  CA  PHE B  41      85.651  77.989  52.622  1.00114.59           C  
ATOM   3604  C   PHE B  41      84.220  78.467  52.420  1.00114.62           C  
ATOM   3605  O   PHE B  41      83.935  79.238  51.492  1.00114.92           O  
ATOM   3606  CB  PHE B  41      86.388  78.006  51.288  1.00116.41           C  
ATOM   3607  CG  PHE B  41      87.851  77.765  51.424  1.00119.06           C  
ATOM   3608  CD1 PHE B  41      88.359  76.469  51.370  1.00120.08           C  
ATOM   3609  CD2 PHE B  41      88.720  78.826  51.676  1.00119.57           C  
ATOM   3610  CE1 PHE B  41      89.712  76.227  51.569  1.00120.76           C  
ATOM   3611  CE2 PHE B  41      90.073  78.601  51.879  1.00120.70           C  
ATOM   3612  CZ  PHE B  41      90.573  77.295  51.825  1.00121.47           C  
ATOM   3613  N   SER B  42      83.322  78.006  53.291  1.00113.80           N  
ATOM   3614  CA  SER B  42      81.921  78.413  53.232  1.00111.12           C  
ATOM   3615  C   SER B  42      81.899  79.883  53.607  1.00108.80           C  
ATOM   3616  O   SER B  42      82.628  80.306  54.502  1.00108.97           O  
ATOM   3617  CB  SER B  42      81.081  77.626  54.235  1.00110.81           C  
ATOM   3618  OG  SER B  42      79.751  78.097  54.235  1.00111.16           O  
ATOM   3619  N   PRO B  43      81.067  80.682  52.928  1.00106.56           N  
ATOM   3620  CA  PRO B  43      81.013  82.110  53.250  1.00104.32           C  
ATOM   3621  C   PRO B  43      80.618  82.350  54.701  1.00102.32           C  
ATOM   3622  O   PRO B  43      80.559  83.492  55.160  1.00101.83           O  
ATOM   3623  CB  PRO B  43      79.989  82.648  52.252  1.00104.25           C  
ATOM   3624  CG  PRO B  43      79.079  81.473  52.048  1.00105.23           C  
ATOM   3625  CD  PRO B  43      80.039  80.321  51.936  1.00105.80           C  
ATOM   3626  N   ALA B  44      80.380  81.265  55.428  1.00100.48           N  
ATOM   3627  CA  ALA B  44      79.984  81.372  56.822  1.00 99.21           C  
ATOM   3628  C   ALA B  44      80.658  80.366  57.740  1.00 98.20           C  
ATOM   3629  O   ALA B  44      80.916  79.222  57.365  1.00 98.00           O  
ATOM   3630  CB  ALA B  44      78.481  81.231  56.936  1.00100.19           C  
ATOM   3631  N   SER B  45      80.926  80.813  58.958  1.00 96.88           N  
ATOM   3632  CA  SER B  45      81.551  79.983  59.969  1.00 95.64           C  
ATOM   3633  C   SER B  45      80.463  79.497  60.908  1.00 95.26           C  
ATOM   3634  O   SER B  45      79.328  79.948  60.842  1.00 96.28           O  
ATOM   3635  CB  SER B  45      82.579  80.794  60.758  1.00 94.99           C  
ATOM   3636  OG  SER B  45      83.502  81.425  59.888  1.00 95.44           O  
ATOM   3637  N   ARG B  46      80.822  78.573  61.781  1.00 94.80           N  
ATOM   3638  CA  ARG B  46      79.897  78.016  62.748  1.00 93.95           C  
ATOM   3639  C   ARG B  46      80.744  77.310  63.801  1.00 93.44           C  
ATOM   3640  O   ARG B  46      81.032  76.118  63.692  1.00 93.78           O  
ATOM   3641  CB  ARG B  46      78.930  77.036  62.065  1.00 94.78           C  
ATOM   3642  CG  ARG B  46      78.231  76.083  63.033  1.00 98.20           C  
ATOM   3643  CD  ARG B  46      76.701  76.133  62.983  1.00100.12           C  
ATOM   3644  NE  ARG B  46      76.114  75.135  63.882  1.00102.51           N  
ATOM   3645  CZ  ARG B  46      74.812  74.986  64.097  1.00103.01           C  
ATOM   3646  NH1 ARG B  46      73.950  75.782  63.477  1.00104.00           N  
ATOM   3647  NH2 ARG B  46      74.372  74.032  64.917  1.00102.00           N  
ATOM   3648  N   ILE B  47      81.157  78.064  64.813  1.00 92.06           N  
ATOM   3649  CA  ILE B  47      81.981  77.535  65.897  1.00 90.81           C  
ATOM   3650  C   ILE B  47      81.111  76.961  67.017  1.00 90.13           C  
ATOM   3651  O   ILE B  47      79.999  77.434  67.239  1.00 91.17           O  
ATOM   3652  CB  ILE B  47      82.850  78.643  66.474  1.00 89.81           C  
ATOM   3653  CG1 ILE B  47      83.644  79.282  65.351  1.00 89.52           C  
ATOM   3654  CG2 ILE B  47      83.791  78.091  67.514  1.00 89.71           C  
ATOM   3655  CD1 ILE B  47      84.326  80.535  65.769  1.00 90.02           C  
ATOM   3656  N   GLY B  48      81.615  75.951  67.723  1.00 88.38           N  
ATOM   3657  CA  GLY B  48      80.839  75.359  68.802  1.00 86.05           C  
ATOM   3658  C   GLY B  48      81.619  74.800  69.984  1.00 84.19           C  
ATOM   3659  O   GLY B  48      82.781  74.442  69.874  1.00 84.72           O  
ATOM   3660  N   VAL B  49      80.969  74.731  71.133  1.00 81.96           N  
ATOM   3661  CA  VAL B  49      81.591  74.196  72.327  1.00 79.67           C  
ATOM   3662  C   VAL B  49      80.736  73.028  72.784  1.00 80.64           C  
ATOM   3663  O   VAL B  49      79.621  73.218  73.277  1.00 81.10           O  
ATOM   3664  CB  VAL B  49      81.658  75.252  73.441  1.00 77.95           C  
ATOM   3665  CG1 VAL B  49      82.109  74.620  74.754  1.00 76.53           C  
ATOM   3666  CG2 VAL B  49      82.600  76.348  73.030  1.00 76.60           C  
ATOM   3667  N   PHE B  50      81.245  71.816  72.595  1.00 80.18           N  
ATOM   3668  CA  PHE B  50      80.512  70.625  73.001  1.00 79.86           C  
ATOM   3669  C   PHE B  50      80.937  70.249  74.412  1.00 80.91           C  
ATOM   3670  O   PHE B  50      82.092  70.429  74.777  1.00 83.14           O  
ATOM   3671  CB  PHE B  50      80.792  69.498  72.023  1.00 77.22           C  
ATOM   3672  CG  PHE B  50      80.384  69.815  70.621  1.00 76.56           C  
ATOM   3673  CD1 PHE B  50      80.861  70.969  69.984  1.00 76.28           C  
ATOM   3674  CD2 PHE B  50      79.527  68.960  69.928  1.00 76.04           C  
ATOM   3675  CE1 PHE B  50      80.490  71.271  68.665  1.00 76.69           C  
ATOM   3676  CE2 PHE B  50      79.145  69.242  68.610  1.00 76.54           C  
ATOM   3677  CZ  PHE B  50      79.630  70.404  67.974  1.00 77.31           C  
ATOM   3678  N   ILE B  51      80.011  69.739  75.212  1.00 81.12           N  
ATOM   3679  CA  ILE B  51      80.340  69.395  76.580  1.00 82.21           C  
ATOM   3680  C   ILE B  51      79.593  68.170  77.076  1.00 85.06           C  
ATOM   3681  O   ILE B  51      78.484  67.878  76.631  1.00 85.31           O  
ATOM   3682  CB  ILE B  51      80.029  70.579  77.516  1.00 81.20           C  
ATOM   3683  CG1 ILE B  51      80.686  71.848  76.972  1.00 80.72           C  
ATOM   3684  CG2 ILE B  51      80.533  70.286  78.931  1.00 81.26           C  
ATOM   3685  CD1 ILE B  51      80.374  73.100  77.764  1.00 80.59           C  
ATOM   3686  N   LYS B  52      80.219  67.443  77.992  1.00 88.19           N  
ATOM   3687  CA  LYS B  52      79.601  66.264  78.573  1.00 91.34           C  
ATOM   3688  C   LYS B  52      78.850  66.761  79.796  1.00 91.72           C  
ATOM   3689  O   LYS B  52      79.413  66.858  80.882  1.00 93.20           O  
ATOM   3690  CB  LYS B  52      80.661  65.238  78.990  1.00 93.70           C  
ATOM   3691  CG  LYS B  52      81.565  64.792  77.849  1.00 97.43           C  
ATOM   3692  CD  LYS B  52      82.257  63.449  78.136  1.00 99.98           C  
ATOM   3693  CE  LYS B  52      83.137  63.009  76.950  1.00101.58           C  
ATOM   3694  NZ  LYS B  52      83.774  61.668  77.121  1.00101.21           N  
ATOM   3695  N   ALA B  53      77.585  67.113  79.608  1.00 91.49           N  
ATOM   3696  CA  ALA B  53      76.758  67.602  80.704  1.00 91.10           C  
ATOM   3697  C   ALA B  53      75.293  67.425  80.339  1.00 90.86           C  
ATOM   3698  O   ALA B  53      74.946  67.372  79.162  1.00 91.25           O  
ATOM   3699  CB  ALA B  53      77.061  69.060  80.964  1.00 90.71           C  
ATOM   3700  N   GLY B  54      74.428  67.325  81.337  1.00 90.44           N  
ATOM   3701  CA  GLY B  54      73.025  67.158  81.025  1.00 91.65           C  
ATOM   3702  C   GLY B  54      72.231  66.642  82.195  1.00 92.42           C  
ATOM   3703  O   GLY B  54      72.789  66.342  83.239  1.00 92.52           O  
ATOM   3704  N   SER B  55      70.922  66.539  82.017  1.00 93.97           N  
ATOM   3705  CA  SER B  55      70.038  66.051  83.070  1.00 96.31           C  
ATOM   3706  C   SER B  55      70.511  64.714  83.669  1.00 97.06           C  
ATOM   3707  O   SER B  55      69.944  64.216  84.649  1.00 96.23           O  
ATOM   3708  CB  SER B  55      68.619  65.889  82.512  1.00 96.97           C  
ATOM   3709  OG  SER B  55      68.564  64.823  81.578  1.00 97.88           O  
ATOM   3710  N   ARG B  56      71.552  64.144  83.069  1.00 98.21           N  
ATOM   3711  CA  ARG B  56      72.120  62.869  83.502  1.00 99.07           C  
ATOM   3712  C   ARG B  56      72.901  63.000  84.808  1.00 99.42           C  
ATOM   3713  O   ARG B  56      72.919  62.083  85.629  1.00 99.39           O  
ATOM   3714  CB  ARG B  56      73.038  62.330  82.406  1.00 99.05           C  
ATOM   3715  CG  ARG B  56      73.724  61.037  82.743  1.00100.30           C  
ATOM   3716  CD  ARG B  56      74.704  60.641  81.645  1.00100.76           C  
ATOM   3717  NE  ARG B  56      75.336  59.351  81.913  1.00100.92           N  
ATOM   3718  CZ  ARG B  56      74.665  58.219  82.089  1.00101.25           C  
ATOM   3719  NH1 ARG B  56      73.342  58.215  82.024  1.00102.95           N  
ATOM   3720  NH2 ARG B  56      75.309  57.092  82.331  1.00101.57           N  
ATOM   3721  N   TYR B  57      73.540  64.148  84.992  1.00 99.57           N  
ATOM   3722  CA  TYR B  57      74.328  64.417  86.187  1.00100.42           C  
ATOM   3723  C   TYR B  57      73.497  65.092  87.284  1.00100.94           C  
ATOM   3724  O   TYR B  57      74.019  65.522  88.320  1.00100.38           O  
ATOM   3725  CB  TYR B  57      75.512  65.296  85.813  1.00101.29           C  
ATOM   3726  CG  TYR B  57      76.295  64.741  84.655  1.00103.56           C  
ATOM   3727  CD1 TYR B  57      75.729  64.646  83.393  1.00104.68           C  
ATOM   3728  CD2 TYR B  57      77.605  64.296  84.821  1.00105.39           C  
ATOM   3729  CE1 TYR B  57      76.450  64.123  82.318  1.00105.98           C  
ATOM   3730  CE2 TYR B  57      78.335  63.768  83.753  1.00104.85           C  
ATOM   3731  CZ  TYR B  57      77.751  63.688  82.502  1.00105.00           C  
ATOM   3732  OH  TYR B  57      78.463  63.209  81.424  1.00104.19           O  
ATOM   3733  N   GLU B  58      72.195  65.187  87.043  1.00101.18           N  
ATOM   3734  CA  GLU B  58      71.291  65.803  87.999  1.00100.58           C  
ATOM   3735  C   GLU B  58      70.951  64.804  89.098  1.00 99.05           C  
ATOM   3736  O   GLU B  58      70.879  63.598  88.859  1.00 98.14           O  
ATOM   3737  CB  GLU B  58      70.004  66.263  87.291  1.00101.95           C  
ATOM   3738  CG  GLU B  58      69.932  67.761  86.949  1.00102.78           C  
ATOM   3739  CD  GLU B  58      68.740  68.106  86.052  1.00104.18           C  
ATOM   3740  OE1 GLU B  58      67.670  67.466  86.192  1.00104.15           O  
ATOM   3741  OE2 GLU B  58      68.870  69.027  85.212  1.00105.42           O  
ATOM   3742  N   THR B  59      70.764  65.324  90.305  1.00 97.76           N  
ATOM   3743  CA  THR B  59      70.399  64.513  91.457  1.00 96.27           C  
ATOM   3744  C   THR B  59      69.069  65.041  91.928  1.00 95.56           C  
ATOM   3745  O   THR B  59      68.766  66.223  91.749  1.00 95.49           O  
ATOM   3746  CB  THR B  59      71.361  64.686  92.622  1.00 96.13           C  
ATOM   3747  OG1 THR B  59      72.698  64.433  92.180  1.00 95.94           O  
ATOM   3748  CG2 THR B  59      70.984  63.733  93.752  1.00 94.92           C  
ATOM   3749  N   THR B  60      68.287  64.174  92.555  1.00 94.66           N  
ATOM   3750  CA  THR B  60      66.975  64.561  93.051  1.00 93.62           C  
ATOM   3751  C   THR B  60      67.020  65.947  93.719  1.00 92.65           C  
ATOM   3752  O   THR B  60      65.995  66.632  93.837  1.00 93.64           O  
ATOM   3753  CB  THR B  60      66.453  63.517  94.059  1.00 93.67           C  
ATOM   3754  OG1 THR B  60      65.032  63.624  94.159  1.00 92.92           O  
ATOM   3755  CG2 THR B  60      67.080  63.737  95.442  1.00 94.92           C  
ATOM   3756  N   ALA B  61      68.215  66.363  94.132  1.00 89.95           N  
ATOM   3757  CA  ALA B  61      68.392  67.646  94.794  1.00 86.96           C  
ATOM   3758  C   ALA B  61      68.524  68.862  93.875  1.00 84.81           C  
ATOM   3759  O   ALA B  61      68.187  69.972  94.280  1.00 83.90           O  
ATOM   3760  CB  ALA B  61      69.583  67.576  95.721  1.00 87.01           C  
ATOM   3761  N   ASN B  62      69.004  68.679  92.649  1.00 82.32           N  
ATOM   3762  CA  ASN B  62      69.152  69.832  91.765  1.00 81.01           C  
ATOM   3763  C   ASN B  62      68.500  69.698  90.391  1.00 80.17           C  
ATOM   3764  O   ASN B  62      68.860  70.417  89.447  1.00 79.18           O  
ATOM   3765  CB  ASN B  62      70.636  70.196  91.614  1.00 81.18           C  
ATOM   3766  CG  ASN B  62      71.426  69.143  90.873  1.00 81.52           C  
ATOM   3767  OD1 ASN B  62      71.104  67.954  90.926  1.00 82.68           O  
ATOM   3768  ND2 ASN B  62      72.486  69.572  90.190  1.00 81.68           N  
ATOM   3769  N   LEU B  63      67.526  68.794  90.291  1.00 78.42           N  
ATOM   3770  CA  LEU B  63      66.800  68.574  89.046  1.00 77.17           C  
ATOM   3771  C   LEU B  63      66.497  69.880  88.310  1.00 78.41           C  
ATOM   3772  O   LEU B  63      66.313  70.933  88.924  1.00 79.32           O  
ATOM   3773  CB  LEU B  63      65.498  67.846  89.338  1.00 73.76           C  
ATOM   3774  CG  LEU B  63      65.749  66.415  89.783  1.00 72.52           C  
ATOM   3775  CD1 LEU B  63      64.487  65.756  90.314  1.00 71.73           C  
ATOM   3776  CD2 LEU B  63      66.294  65.666  88.597  1.00 71.89           C  
ATOM   3777  N   GLY B  64      66.459  69.805  86.985  1.00 79.06           N  
ATOM   3778  CA  GLY B  64      66.169  70.978  86.185  1.00 79.00           C  
ATOM   3779  C   GLY B  64      67.294  71.989  86.028  1.00 79.09           C  
ATOM   3780  O   GLY B  64      67.290  72.771  85.068  1.00 80.25           O  
ATOM   3781  N   THR B  65      68.256  71.992  86.945  1.00 78.06           N  
ATOM   3782  CA  THR B  65      69.357  72.947  86.850  1.00 77.87           C  
ATOM   3783  C   THR B  65      70.087  72.885  85.492  1.00 78.15           C  
ATOM   3784  O   THR B  65      70.762  73.845  85.081  1.00 76.83           O  
ATOM   3785  CB  THR B  65      70.345  72.733  87.990  1.00 76.70           C  
ATOM   3786  OG1 THR B  65      71.400  73.697  87.897  1.00 75.94           O  
ATOM   3787  CG2 THR B  65      70.906  71.347  87.919  1.00 78.18           C  
ATOM   3788  N   ALA B  66      69.939  71.760  84.795  1.00 78.70           N  
ATOM   3789  CA  ALA B  66      70.546  71.591  83.479  1.00 80.32           C  
ATOM   3790  C   ALA B  66      69.741  72.426  82.482  1.00 81.58           C  
ATOM   3791  O   ALA B  66      70.306  73.212  81.703  1.00 82.07           O  
ATOM   3792  CB  ALA B  66      70.515  70.128  83.075  1.00 80.80           C  
ATOM   3793  N   HIS B  67      68.417  72.232  82.528  1.00 81.53           N  
ATOM   3794  CA  HIS B  67      67.448  72.932  81.679  1.00 80.10           C  
ATOM   3795  C   HIS B  67      67.585  74.446  81.832  1.00 78.50           C  
ATOM   3796  O   HIS B  67      67.746  75.165  80.841  1.00 77.65           O  
ATOM   3797  CB  HIS B  67      66.029  72.499  82.074  1.00 82.01           C  
ATOM   3798  CG  HIS B  67      64.937  73.153  81.278  1.00 83.38           C  
ATOM   3799  ND1 HIS B  67      63.602  72.928  81.533  1.00 82.98           N  
ATOM   3800  CD2 HIS B  67      64.980  74.007  80.226  1.00 84.14           C  
ATOM   3801  CE1 HIS B  67      62.870  73.614  80.672  1.00 83.12           C  
ATOM   3802  NE2 HIS B  67      63.681  74.277  79.868  1.00 82.34           N  
ATOM   3803  N   LEU B  68      67.517  74.920  83.075  1.00 76.43           N  
ATOM   3804  CA  LEU B  68      67.630  76.345  83.353  1.00 75.94           C  
ATOM   3805  C   LEU B  68      68.963  76.910  82.883  1.00 77.08           C  
ATOM   3806  O   LEU B  68      69.046  78.068  82.455  1.00 77.23           O  
ATOM   3807  CB  LEU B  68      67.472  76.614  84.847  1.00 73.72           C  
ATOM   3808  CG  LEU B  68      67.716  78.069  85.269  1.00 73.37           C  
ATOM   3809  CD1 LEU B  68      66.737  78.992  84.570  1.00 73.63           C  
ATOM   3810  CD2 LEU B  68      67.580  78.198  86.778  1.00 72.77           C  
ATOM   3811  N   LEU B  69      70.009  76.095  82.972  1.00 77.69           N  
ATOM   3812  CA  LEU B  69      71.330  76.536  82.554  1.00 77.92           C  
ATOM   3813  C   LEU B  69      71.322  76.783  81.048  1.00 77.70           C  
ATOM   3814  O   LEU B  69      72.039  77.651  80.530  1.00 77.61           O  
ATOM   3815  CB  LEU B  69      72.381  75.483  82.923  1.00 77.70           C  
ATOM   3816  CG  LEU B  69      73.819  75.843  82.528  1.00 77.40           C  
ATOM   3817  CD1 LEU B  69      74.204  77.178  83.112  1.00 76.77           C  
ATOM   3818  CD2 LEU B  69      74.759  74.776  83.014  1.00 77.59           C  
ATOM   3819  N   ARG B  70      70.486  76.019  80.359  1.00 77.66           N  
ATOM   3820  CA  ARG B  70      70.350  76.120  78.915  1.00 78.81           C  
ATOM   3821  C   ARG B  70      69.721  77.461  78.514  1.00 79.59           C  
ATOM   3822  O   ARG B  70      70.197  78.137  77.595  1.00 80.02           O  
ATOM   3823  CB  ARG B  70      69.497  74.952  78.427  1.00 79.29           C  
ATOM   3824  CG  ARG B  70      69.393  74.810  76.936  1.00 80.88           C  
ATOM   3825  CD  ARG B  70      68.868  73.414  76.579  1.00 83.88           C  
ATOM   3826  NE  ARG B  70      67.433  73.198  76.804  1.00 84.87           N  
ATOM   3827  CZ  ARG B  70      66.920  72.222  77.555  1.00 85.51           C  
ATOM   3828  NH1 ARG B  70      67.714  71.362  78.182  1.00 85.72           N  
ATOM   3829  NH2 ARG B  70      65.605  72.078  77.647  1.00 86.24           N  
ATOM   3830  N   LEU B  71      68.661  77.853  79.218  1.00 79.03           N  
ATOM   3831  CA  LEU B  71      67.972  79.101  78.924  1.00 78.31           C  
ATOM   3832  C   LEU B  71      68.747  80.299  79.424  1.00 78.45           C  
ATOM   3833  O   LEU B  71      68.507  81.426  79.000  1.00 79.33           O  
ATOM   3834  CB  LEU B  71      66.596  79.116  79.581  1.00 78.08           C  
ATOM   3835  CG  LEU B  71      65.644  77.957  79.282  1.00 78.81           C  
ATOM   3836  CD1 LEU B  71      64.286  78.227  79.939  1.00 78.34           C  
ATOM   3837  CD2 LEU B  71      65.489  77.791  77.781  1.00 77.84           C  
ATOM   3838  N   ALA B  72      69.677  80.053  80.333  1.00 78.35           N  
ATOM   3839  CA  ALA B  72      70.464  81.126  80.916  1.00 77.79           C  
ATOM   3840  C   ALA B  72      71.604  81.651  80.041  1.00 77.55           C  
ATOM   3841  O   ALA B  72      72.254  82.630  80.404  1.00 78.24           O  
ATOM   3842  CB  ALA B  72      71.007  80.672  82.268  1.00 77.06           C  
ATOM   3843  N   SER B  73      71.852  81.028  78.894  1.00 76.35           N  
ATOM   3844  CA  SER B  73      72.940  81.483  78.036  1.00 76.64           C  
ATOM   3845  C   SER B  73      73.094  82.999  77.833  1.00 77.22           C  
ATOM   3846  O   SER B  73      74.218  83.512  77.853  1.00 77.53           O  
ATOM   3847  CB  SER B  73      72.845  80.806  76.675  1.00 76.69           C  
ATOM   3848  OG  SER B  73      71.506  80.763  76.234  1.00 80.62           O  
ATOM   3849  N   PRO B  74      71.975  83.740  77.662  1.00 77.74           N  
ATOM   3850  CA  PRO B  74      72.025  85.197  77.448  1.00 77.02           C  
ATOM   3851  C   PRO B  74      72.214  86.117  78.649  1.00 77.03           C  
ATOM   3852  O   PRO B  74      72.266  87.340  78.471  1.00 75.49           O  
ATOM   3853  CB  PRO B  74      70.714  85.475  76.726  1.00 76.73           C  
ATOM   3854  CG  PRO B  74      69.787  84.518  77.393  1.00 76.93           C  
ATOM   3855  CD  PRO B  74      70.596  83.242  77.487  1.00 77.44           C  
ATOM   3856  N   LEU B  75      72.309  85.539  79.852  1.00 78.15           N  
ATOM   3857  CA  LEU B  75      72.506  86.303  81.099  1.00 79.43           C  
ATOM   3858  C   LEU B  75      73.935  86.856  81.185  1.00 81.02           C  
ATOM   3859  O   LEU B  75      74.862  86.297  80.574  1.00 81.81           O  
ATOM   3860  CB  LEU B  75      72.229  85.413  82.314  1.00 77.92           C  
ATOM   3861  CG  LEU B  75      70.809  84.858  82.424  1.00 77.77           C  
ATOM   3862  CD1 LEU B  75      70.708  83.829  83.535  1.00 77.35           C  
ATOM   3863  CD2 LEU B  75      69.863  86.005  82.684  1.00 78.06           C  
ATOM   3864  N   THR B  76      74.119  87.936  81.946  1.00 81.68           N  
ATOM   3865  CA  THR B  76      75.437  88.562  82.064  1.00 83.03           C  
ATOM   3866  C   THR B  76      76.565  87.610  82.444  1.00 84.20           C  
ATOM   3867  O   THR B  76      76.383  86.668  83.229  1.00 83.25           O  
ATOM   3868  CB  THR B  76      75.459  89.732  83.083  1.00 82.99           C  
ATOM   3869  OG1 THR B  76      75.090  89.254  84.383  1.00 82.16           O  
ATOM   3870  CG2 THR B  76      74.520  90.841  82.648  1.00 83.06           C  
ATOM   3871  N   THR B  77      77.733  87.892  81.863  1.00 85.27           N  
ATOM   3872  CA  THR B  77      78.963  87.133  82.070  1.00 84.64           C  
ATOM   3873  C   THR B  77      80.011  88.133  82.532  1.00 86.46           C  
ATOM   3874  O   THR B  77      79.852  89.337  82.327  1.00 86.77           O  
ATOM   3875  CB  THR B  77      79.446  86.501  80.759  1.00 82.17           C  
ATOM   3876  OG1 THR B  77      79.647  87.530  79.781  1.00 77.26           O  
ATOM   3877  CG2 THR B  77      78.418  85.516  80.241  1.00 82.54           C  
ATOM   3878  N   LYS B  78      81.082  87.641  83.146  1.00 87.91           N  
ATOM   3879  CA  LYS B  78      82.143  88.520  83.633  1.00 88.91           C  
ATOM   3880  C   LYS B  78      82.734  89.416  82.537  1.00 88.38           C  
ATOM   3881  O   LYS B  78      83.119  90.558  82.803  1.00 87.58           O  
ATOM   3882  CB  LYS B  78      83.242  87.682  84.303  1.00 90.41           C  
ATOM   3883  CG  LYS B  78      82.762  86.955  85.560  1.00 92.39           C  
ATOM   3884  CD  LYS B  78      83.764  85.930  86.084  1.00 94.27           C  
ATOM   3885  CE  LYS B  78      83.159  85.109  87.226  1.00 95.71           C  
ATOM   3886  NZ  LYS B  78      83.976  83.915  87.601  1.00 96.82           N  
ATOM   3887  N   GLY B  79      82.788  88.909  81.309  1.00 88.20           N  
ATOM   3888  CA  GLY B  79      83.338  89.696  80.217  1.00 89.60           C  
ATOM   3889  C   GLY B  79      82.342  90.580  79.477  1.00 90.74           C  
ATOM   3890  O   GLY B  79      82.661  91.713  79.098  1.00 90.73           O  
ATOM   3891  N   ALA B  80      81.131  90.065  79.268  1.00 91.13           N  
ATOM   3892  CA  ALA B  80      80.091  90.799  78.560  1.00 90.14           C  
ATOM   3893  C   ALA B  80      78.788  90.798  79.345  1.00 90.22           C  
ATOM   3894  O   ALA B  80      78.516  89.887  80.132  1.00 90.27           O  
ATOM   3895  CB  ALA B  80      79.866  90.184  77.182  1.00 89.31           C  
ATOM   3896  N   SER B  81      77.982  91.829  79.110  1.00 90.01           N  
ATOM   3897  CA  SER B  81      76.696  91.990  79.777  1.00 88.52           C  
ATOM   3898  C   SER B  81      75.543  91.407  78.966  1.00 88.85           C  
ATOM   3899  O   SER B  81      75.625  91.253  77.741  1.00 88.74           O  
ATOM   3900  CB  SER B  81      76.431  93.475  80.026  1.00 87.53           C  
ATOM   3901  OG  SER B  81      76.531  94.214  78.815  1.00 85.75           O  
ATOM   3902  N   SER B  82      74.460  91.100  79.671  1.00 89.24           N  
ATOM   3903  CA  SER B  82      73.241  90.550  79.071  1.00 89.08           C  
ATOM   3904  C   SER B  82      72.898  91.360  77.812  1.00 87.25           C  
ATOM   3905  O   SER B  82      72.473  90.823  76.778  1.00 85.21           O  
ATOM   3906  CB  SER B  82      72.102  90.645  80.100  1.00 89.95           C  
ATOM   3907  OG  SER B  82      70.972  89.882  79.720  1.00 91.39           O  
ATOM   3908  N   PHE B  83      73.104  92.664  77.931  1.00 85.59           N  
ATOM   3909  CA  PHE B  83      72.848  93.591  76.854  1.00 84.47           C  
ATOM   3910  C   PHE B  83      73.827  93.384  75.707  1.00 84.39           C  
ATOM   3911  O   PHE B  83      73.417  93.012  74.606  1.00 84.59           O  
ATOM   3912  CB  PHE B  83      72.954  95.022  77.381  1.00 84.18           C  
ATOM   3913  CG  PHE B  83      72.684  96.079  76.347  1.00 84.71           C  
ATOM   3914  CD1 PHE B  83      71.427  96.217  75.777  1.00 85.80           C  
ATOM   3915  CD2 PHE B  83      73.683  96.961  75.965  1.00 85.76           C  
ATOM   3916  CE1 PHE B  83      71.171  97.224  74.842  1.00 86.22           C  
ATOM   3917  CE2 PHE B  83      73.435  97.970  75.030  1.00 86.26           C  
ATOM   3918  CZ  PHE B  83      72.180  98.101  74.472  1.00 85.50           C  
ATOM   3919  N   ARG B  84      75.119  93.600  75.968  1.00 83.68           N  
ATOM   3920  CA  ARG B  84      76.122  93.482  74.915  1.00 81.89           C  
ATOM   3921  C   ARG B  84      76.152  92.135  74.233  1.00 79.55           C  
ATOM   3922  O   ARG B  84      76.428  92.052  73.044  1.00 78.51           O  
ATOM   3923  CB  ARG B  84      77.522  93.835  75.428  1.00 84.31           C  
ATOM   3924  CG  ARG B  84      78.439  94.310  74.284  1.00 87.55           C  
ATOM   3925  CD  ARG B  84      79.821  94.805  74.720  1.00 88.66           C  
ATOM   3926  NE  ARG B  84      80.788  93.715  74.851  1.00 90.16           N  
ATOM   3927  CZ  ARG B  84      81.124  93.139  76.003  1.00 91.32           C  
ATOM   3928  NH1 ARG B  84      80.576  93.542  77.154  1.00 90.87           N  
ATOM   3929  NH2 ARG B  84      82.016  92.158  76.007  1.00 90.65           N  
ATOM   3930  N   ILE B  85      75.858  91.075  74.969  1.00 78.51           N  
ATOM   3931  CA  ILE B  85      75.854  89.760  74.351  1.00 78.96           C  
ATOM   3932  C   ILE B  85      74.868  89.731  73.176  1.00 79.68           C  
ATOM   3933  O   ILE B  85      75.253  89.451  72.030  1.00 80.43           O  
ATOM   3934  CB  ILE B  85      75.444  88.650  75.347  1.00 78.25           C  
ATOM   3935  CG1 ILE B  85      76.449  88.571  76.495  1.00 77.43           C  
ATOM   3936  CG2 ILE B  85      75.354  87.315  74.619  1.00 78.03           C  
ATOM   3937  CD1 ILE B  85      76.134  87.498  77.525  1.00 76.07           C  
ATOM   3938  N   THR B  86      73.601  90.032  73.466  1.00 79.25           N  
ATOM   3939  CA  THR B  86      72.553  90.020  72.445  1.00 77.61           C  
ATOM   3940  C   THR B  86      72.728  91.118  71.398  1.00 76.19           C  
ATOM   3941  O   THR B  86      72.605  90.866  70.202  1.00 74.60           O  
ATOM   3942  CB  THR B  86      71.148  90.148  73.078  1.00 77.60           C  
ATOM   3943  OG1 THR B  86      70.975  89.126  74.072  1.00 77.83           O  
ATOM   3944  CG2 THR B  86      70.072  90.001  72.009  1.00 75.74           C  
ATOM   3945  N   ARG B  87      73.015  92.334  71.838  1.00 75.49           N  
ATOM   3946  CA  ARG B  87      73.202  93.410  70.887  1.00 76.91           C  
ATOM   3947  C   ARG B  87      74.415  93.120  70.036  1.00 78.06           C  
ATOM   3948  O   ARG B  87      74.334  93.128  68.809  1.00 78.53           O  
ATOM   3949  CB  ARG B  87      73.396  94.743  71.600  1.00 77.22           C  
ATOM   3950  CG  ARG B  87      72.121  95.306  72.194  1.00 78.60           C  
ATOM   3951  CD  ARG B  87      71.010  95.424  71.141  1.00 78.21           C  
ATOM   3952  NE  ARG B  87      69.830  96.090  71.684  1.00 76.06           N  
ATOM   3953  CZ  ARG B  87      69.709  97.407  71.829  1.00 74.51           C  
ATOM   3954  NH1 ARG B  87      70.688  98.224  71.466  1.00 71.81           N  
ATOM   3955  NH2 ARG B  87      68.608  97.909  72.358  1.00 74.99           N  
ATOM   3956  N   GLY B  88      75.535  92.858  70.706  1.00 79.00           N  
ATOM   3957  CA  GLY B  88      76.789  92.572  70.028  1.00 79.26           C  
ATOM   3958  C   GLY B  88      76.720  91.490  68.969  1.00 79.50           C  
ATOM   3959  O   GLY B  88      77.268  91.654  67.872  1.00 79.86           O  
ATOM   3960  N   ILE B  89      76.061  90.381  69.287  1.00 78.55           N  
ATOM   3961  CA  ILE B  89      75.940  89.297  68.323  1.00 79.29           C  
ATOM   3962  C   ILE B  89      75.067  89.692  67.131  1.00 81.12           C  
ATOM   3963  O   ILE B  89      75.425  89.434  65.975  1.00 82.05           O  
ATOM   3964  CB  ILE B  89      75.361  88.026  68.981  1.00 78.22           C  
ATOM   3965  CG1 ILE B  89      76.446  87.353  69.831  1.00 77.89           C  
ATOM   3966  CG2 ILE B  89      74.807  87.081  67.909  1.00 77.51           C  
ATOM   3967  CD1 ILE B  89      76.042  86.036  70.471  1.00 75.43           C  
ATOM   3968  N   GLU B  90      73.928  90.323  67.417  1.00 82.23           N  
ATOM   3969  CA  GLU B  90      72.992  90.748  66.378  1.00 81.35           C  
ATOM   3970  C   GLU B  90      73.571  91.829  65.482  1.00 79.87           C  
ATOM   3971  O   GLU B  90      73.137  92.003  64.339  1.00 78.54           O  
ATOM   3972  CB  GLU B  90      71.701  91.264  67.008  1.00 83.25           C  
ATOM   3973  CG  GLU B  90      70.901  90.216  67.746  1.00 86.58           C  
ATOM   3974  CD  GLU B  90      69.503  90.699  68.078  1.00 88.57           C  
ATOM   3975  OE1 GLU B  90      69.378  91.781  68.697  1.00 89.69           O  
ATOM   3976  OE2 GLU B  90      68.532  89.995  67.720  1.00 90.15           O  
ATOM   3977  N   ALA B  91      74.551  92.550  66.017  1.00 78.74           N  
ATOM   3978  CA  ALA B  91      75.205  93.637  65.303  1.00 78.66           C  
ATOM   3979  C   ALA B  91      75.901  93.181  64.024  1.00 78.81           C  
ATOM   3980  O   ALA B  91      76.124  93.975  63.108  1.00 77.64           O  
ATOM   3981  CB  ALA B  91      76.208  94.319  66.221  1.00 78.00           C  
ATOM   3982  N   VAL B  92      76.237  91.898  63.966  1.00 79.89           N  
ATOM   3983  CA  VAL B  92      76.932  91.336  62.814  1.00 80.13           C  
ATOM   3984  C   VAL B  92      76.114  90.247  62.142  1.00 80.45           C  
ATOM   3985  O   VAL B  92      76.630  89.458  61.356  1.00 81.12           O  
ATOM   3986  CB  VAL B  92      78.288  90.737  63.239  1.00 80.00           C  
ATOM   3987  CG1 VAL B  92      79.214  91.847  63.756  1.00 78.06           C  
ATOM   3988  CG2 VAL B  92      78.065  89.671  64.312  1.00 78.60           C  
ATOM   3989  N   GLY B  93      74.830  90.204  62.457  1.00 81.18           N  
ATOM   3990  CA  GLY B  93      73.978  89.194  61.861  1.00 80.38           C  
ATOM   3991  C   GLY B  93      74.376  87.827  62.360  1.00 79.01           C  
ATOM   3992  O   GLY B  93      74.325  86.849  61.623  1.00 78.31           O  
ATOM   3993  N   GLY B  94      74.782  87.767  63.622  1.00 78.86           N  
ATOM   3994  CA  GLY B  94      75.185  86.501  64.196  1.00 79.08           C  
ATOM   3995  C   GLY B  94      74.010  85.748  64.784  1.00 79.30           C  
ATOM   3996  O   GLY B  94      72.862  86.153  64.621  1.00 79.37           O  
ATOM   3997  N   SER B  95      74.304  84.636  65.450  1.00 78.89           N  
ATOM   3998  CA  SER B  95      73.290  83.819  66.095  1.00 78.20           C  
ATOM   3999  C   SER B  95      73.962  83.200  67.311  1.00 78.20           C  
ATOM   4000  O   SER B  95      75.153  83.375  67.508  1.00 78.74           O  
ATOM   4001  CB  SER B  95      72.796  82.722  65.158  1.00 77.66           C  
ATOM   4002  OG  SER B  95      73.693  81.638  65.164  1.00 78.95           O  
ATOM   4003  N   LEU B  96      73.200  82.487  68.128  1.00 78.54           N  
ATOM   4004  CA  LEU B  96      73.743  81.866  69.325  1.00 78.35           C  
ATOM   4005  C   LEU B  96      72.704  80.962  69.939  1.00 79.22           C  
ATOM   4006  O   LEU B  96      71.658  81.423  70.370  1.00 81.70           O  
ATOM   4007  CB  LEU B  96      74.154  82.928  70.339  1.00 77.67           C  
ATOM   4008  CG  LEU B  96      74.383  82.415  71.767  1.00 78.49           C  
ATOM   4009  CD1 LEU B  96      75.186  81.124  71.748  1.00 78.96           C  
ATOM   4010  CD2 LEU B  96      75.104  83.483  72.578  1.00 79.17           C  
ATOM   4011  N   SER B  97      73.004  79.674  69.998  1.00 79.76           N  
ATOM   4012  CA  SER B  97      72.064  78.710  70.540  1.00 80.08           C  
ATOM   4013  C   SER B  97      72.698  77.646  71.439  1.00 80.36           C  
ATOM   4014  O   SER B  97      73.914  77.538  71.540  1.00 80.57           O  
ATOM   4015  CB  SER B  97      71.322  78.060  69.378  1.00 80.87           C  
ATOM   4016  OG  SER B  97      72.052  78.249  68.172  1.00 80.57           O  
ATOM   4017  N   VAL B  98      71.854  76.859  72.092  1.00 79.96           N  
ATOM   4018  CA  VAL B  98      72.315  75.822  72.996  1.00 79.91           C  
ATOM   4019  C   VAL B  98      71.472  74.572  72.807  1.00 82.08           C  
ATOM   4020  O   VAL B  98      70.319  74.530  73.230  1.00 83.05           O  
ATOM   4021  CB  VAL B  98      72.194  76.295  74.465  1.00 78.58           C  
ATOM   4022  CG1 VAL B  98      72.440  75.146  75.425  1.00 78.44           C  
ATOM   4023  CG2 VAL B  98      73.174  77.408  74.719  1.00 77.17           C  
ATOM   4024  N   TYR B  99      72.038  73.557  72.160  1.00 83.62           N  
ATOM   4025  CA  TYR B  99      71.318  72.307  71.949  1.00 85.07           C  
ATOM   4026  C   TYR B  99      71.833  71.323  72.978  1.00 85.19           C  
ATOM   4027  O   TYR B  99      73.021  71.318  73.272  1.00 86.11           O  
ATOM   4028  CB  TYR B  99      71.584  71.754  70.553  1.00 86.37           C  
ATOM   4029  CG  TYR B  99      71.397  72.758  69.447  1.00 88.67           C  
ATOM   4030  CD1 TYR B  99      72.380  73.711  69.179  1.00 89.16           C  
ATOM   4031  CD2 TYR B  99      70.227  72.764  68.668  1.00 89.44           C  
ATOM   4032  CE1 TYR B  99      72.212  74.657  68.154  1.00 91.02           C  
ATOM   4033  CE2 TYR B  99      70.045  73.705  67.636  1.00 91.02           C  
ATOM   4034  CZ  TYR B  99      71.042  74.653  67.383  1.00 91.33           C  
ATOM   4035  OH  TYR B  99      70.874  75.592  66.375  1.00 90.11           O  
ATOM   4036  N   SER B 100      70.961  70.487  73.528  1.00 85.13           N  
ATOM   4037  CA  SER B 100      71.425  69.530  74.516  1.00 85.79           C  
ATOM   4038  C   SER B 100      70.573  68.280  74.692  1.00 86.67           C  
ATOM   4039  O   SER B 100      69.349  68.330  74.636  1.00 86.86           O  
ATOM   4040  CB  SER B 100      71.601  70.224  75.867  1.00 85.24           C  
ATOM   4041  OG  SER B 100      70.367  70.646  76.396  1.00 84.47           O  
ATOM   4042  N   THR B 101      71.253  67.156  74.904  1.00 87.53           N  
ATOM   4043  CA  THR B 101      70.615  65.862  75.112  1.00 88.65           C  
ATOM   4044  C   THR B 101      70.646  65.595  76.611  1.00 88.32           C  
ATOM   4045  O   THR B 101      70.935  66.494  77.396  1.00 88.54           O  
ATOM   4046  CB  THR B 101      71.401  64.751  74.417  1.00 89.72           C  
ATOM   4047  OG1 THR B 101      72.630  64.533  75.125  1.00 90.80           O  
ATOM   4048  CG2 THR B 101      71.718  65.145  72.977  1.00 90.18           C  
ATOM   4049  N   ARG B 102      70.360  64.368  77.023  1.00 88.06           N  
ATOM   4050  CA  ARG B 102      70.397  64.092  78.441  1.00 88.77           C  
ATOM   4051  C   ARG B 102      71.827  64.034  78.918  1.00 89.50           C  
ATOM   4052  O   ARG B 102      72.071  64.079  80.117  1.00 90.16           O  
ATOM   4053  CB  ARG B 102      69.716  62.774  78.759  1.00 89.28           C  
ATOM   4054  CG  ARG B 102      68.391  62.648  78.098  1.00 92.30           C  
ATOM   4055  CD  ARG B 102      67.439  61.829  78.904  1.00 93.93           C  
ATOM   4056  NE  ARG B 102      66.149  61.896  78.247  1.00 98.89           N  
ATOM   4057  CZ  ARG B 102      64.985  61.746  78.864  1.00102.50           C  
ATOM   4058  NH1 ARG B 102      64.946  61.514  80.171  1.00104.29           N  
ATOM   4059  NH2 ARG B 102      63.854  61.851  78.173  1.00104.85           N  
ATOM   4060  N   GLU B 103      72.781  63.956  77.992  1.00 90.34           N  
ATOM   4061  CA  GLU B 103      74.177  63.847  78.397  1.00 90.97           C  
ATOM   4062  C   GLU B 103      75.199  64.685  77.655  1.00 91.79           C  
ATOM   4063  O   GLU B 103      76.400  64.461  77.800  1.00 92.86           O  
ATOM   4064  CB  GLU B 103      74.614  62.376  78.355  1.00 91.41           C  
ATOM   4065  CG  GLU B 103      74.672  61.762  76.964  1.00 91.92           C  
ATOM   4066  CD  GLU B 103      74.744  60.239  76.986  1.00 92.58           C  
ATOM   4067  OE1 GLU B 103      74.908  59.641  75.899  1.00 94.31           O  
ATOM   4068  OE2 GLU B 103      74.627  59.638  78.080  1.00 92.18           O  
ATOM   4069  N   LYS B 104      74.748  65.644  76.860  1.00 92.62           N  
ATOM   4070  CA  LYS B 104      75.691  66.499  76.148  1.00 94.25           C  
ATOM   4071  C   LYS B 104      75.062  67.865  75.912  1.00 93.32           C  
ATOM   4072  O   LYS B 104      73.868  67.966  75.671  1.00 94.56           O  
ATOM   4073  CB  LYS B 104      76.125  65.847  74.815  1.00 96.70           C  
ATOM   4074  CG  LYS B 104      75.092  65.854  73.680  1.00101.21           C  
ATOM   4075  CD  LYS B 104      75.050  67.208  72.927  1.00105.38           C  
ATOM   4076  CE  LYS B 104      74.093  67.193  71.713  1.00107.36           C  
ATOM   4077  NZ  LYS B 104      74.191  68.425  70.852  1.00106.98           N  
ATOM   4078  N   MET B 105      75.860  68.919  76.004  1.00 91.94           N  
ATOM   4079  CA  MET B 105      75.358  70.267  75.790  1.00 90.91           C  
ATOM   4080  C   MET B 105      76.233  70.973  74.783  1.00 90.12           C  
ATOM   4081  O   MET B 105      77.441  71.004  74.932  1.00 91.49           O  
ATOM   4082  CB  MET B 105      75.369  71.061  77.094  1.00 91.99           C  
ATOM   4083  CG  MET B 105      74.191  70.796  78.006  1.00 93.76           C  
ATOM   4084  SD  MET B 105      74.313  71.729  79.557  1.00 97.03           S  
ATOM   4085  CE  MET B 105      74.428  73.409  78.947  1.00 92.70           C  
ATOM   4086  N   THR B 106      75.633  71.555  73.761  1.00 89.03           N  
ATOM   4087  CA  THR B 106      76.421  72.252  72.764  1.00 88.22           C  
ATOM   4088  C   THR B 106      76.089  73.739  72.706  1.00 88.57           C  
ATOM   4089  O   THR B 106      74.926  74.132  72.627  1.00 89.02           O  
ATOM   4090  CB  THR B 106      76.198  71.659  71.370  1.00 88.05           C  
ATOM   4091  OG1 THR B 106      76.216  70.228  71.447  1.00 87.62           O  
ATOM   4092  CG2 THR B 106      77.285  72.144  70.418  1.00 86.52           C  
ATOM   4093  N   TYR B 107      77.122  74.564  72.745  1.00 88.24           N  
ATOM   4094  CA  TYR B 107      76.949  76.002  72.670  1.00 88.71           C  
ATOM   4095  C   TYR B 107      77.567  76.487  71.374  1.00 89.95           C  
ATOM   4096  O   TYR B 107      78.780  76.633  71.298  1.00 90.55           O  
ATOM   4097  CB  TYR B 107      77.672  76.700  73.819  1.00 87.65           C  
ATOM   4098  CG  TYR B 107      76.986  76.634  75.155  1.00 87.26           C  
ATOM   4099  CD1 TYR B 107      76.770  75.415  75.797  1.00 86.96           C  
ATOM   4100  CD2 TYR B 107      76.576  77.802  75.795  1.00 87.20           C  
ATOM   4101  CE1 TYR B 107      76.163  75.364  77.049  1.00 87.49           C  
ATOM   4102  CE2 TYR B 107      75.970  77.766  77.042  1.00 87.78           C  
ATOM   4103  CZ  TYR B 107      75.765  76.549  77.665  1.00 88.41           C  
ATOM   4104  OH  TYR B 107      75.159  76.534  78.904  1.00 90.30           O  
ATOM   4105  N   CYS B 108      76.760  76.747  70.354  1.00 91.50           N  
ATOM   4106  CA  CYS B 108      77.330  77.230  69.102  1.00 94.00           C  
ATOM   4107  C   CYS B 108      76.836  78.598  68.652  1.00 93.27           C  
ATOM   4108  O   CYS B 108      75.844  79.115  69.148  1.00 93.48           O  
ATOM   4109  CB  CYS B 108      77.133  76.201  67.980  1.00 95.98           C  
ATOM   4110  SG  CYS B 108      75.479  75.549  67.823  1.00102.92           S  
ATOM   4111  N   VAL B 109      77.559  79.179  67.704  1.00 92.90           N  
ATOM   4112  CA  VAL B 109      77.240  80.487  67.175  1.00 92.52           C  
ATOM   4113  C   VAL B 109      77.602  80.498  65.700  1.00 94.09           C  
ATOM   4114  O   VAL B 109      78.614  79.917  65.318  1.00 95.36           O  
ATOM   4115  CB  VAL B 109      78.071  81.574  67.896  1.00 91.53           C  
ATOM   4116  CG1 VAL B 109      77.953  81.391  69.393  1.00 90.46           C  
ATOM   4117  CG2 VAL B 109      79.537  81.508  67.472  1.00 89.65           C  
ATOM   4118  N   GLU B 110      76.774  81.131  64.870  1.00 95.06           N  
ATOM   4119  CA  GLU B 110      77.062  81.231  63.438  1.00 95.90           C  
ATOM   4120  C   GLU B 110      77.298  82.690  63.114  1.00 95.98           C  
ATOM   4121  O   GLU B 110      76.979  83.565  63.915  1.00 95.18           O  
ATOM   4122  CB  GLU B 110      75.907  80.711  62.568  1.00 97.94           C  
ATOM   4123  CG  GLU B 110      75.740  79.189  62.555  1.00101.54           C  
ATOM   4124  CD  GLU B 110      75.185  78.641  61.229  1.00104.00           C  
ATOM   4125  OE1 GLU B 110      75.846  78.825  60.178  1.00104.12           O  
ATOM   4126  OE2 GLU B 110      74.095  78.017  61.237  1.00105.61           O  
ATOM   4127  N   CYS B 111      77.868  82.943  61.941  1.00 97.28           N  
ATOM   4128  CA  CYS B 111      78.148  84.304  61.486  1.00 98.65           C  
ATOM   4129  C   CYS B 111      78.975  84.253  60.219  1.00 98.94           C  
ATOM   4130  O   CYS B 111      79.487  83.204  59.847  1.00 98.42           O  
ATOM   4131  CB  CYS B 111      78.914  85.109  62.555  1.00 99.03           C  
ATOM   4132  SG  CYS B 111      80.620  84.579  62.894  1.00 97.63           S  
ATOM   4133  N   LEU B 112      79.097  85.389  59.553  1.00100.37           N  
ATOM   4134  CA  LEU B 112      79.889  85.452  58.338  1.00102.07           C  
ATOM   4135  C   LEU B 112      81.368  85.358  58.726  1.00103.08           C  
ATOM   4136  O   LEU B 112      81.761  85.764  59.825  1.00102.86           O  
ATOM   4137  CB  LEU B 112      79.592  86.757  57.608  1.00102.42           C  
ATOM   4138  CG  LEU B 112      78.084  86.935  57.415  1.00102.07           C  
ATOM   4139  CD1 LEU B 112      77.782  88.319  56.859  1.00102.17           C  
ATOM   4140  CD2 LEU B 112      77.565  85.831  56.494  1.00100.55           C  
ATOM   4141  N   ARG B 113      82.176  84.814  57.820  1.00103.85           N  
ATOM   4142  CA  ARG B 113      83.603  84.625  58.054  1.00104.29           C  
ATOM   4143  C   ARG B 113      84.310  85.783  58.733  1.00104.48           C  
ATOM   4144  O   ARG B 113      85.155  85.574  59.604  1.00104.85           O  
ATOM   4145  CB  ARG B 113      84.324  84.358  56.740  1.00104.58           C  
ATOM   4146  CG  ARG B 113      83.764  83.219  55.938  1.00106.52           C  
ATOM   4147  CD  ARG B 113      84.630  82.974  54.719  1.00107.16           C  
ATOM   4148  NE  ARG B 113      85.936  82.460  55.105  1.00107.80           N  
ATOM   4149  CZ  ARG B 113      86.159  81.208  55.486  1.00108.31           C  
ATOM   4150  NH1 ARG B 113      85.166  80.329  55.523  1.00107.60           N  
ATOM   4151  NH2 ARG B 113      87.373  80.841  55.862  1.00109.46           N  
ATOM   4152  N   ASP B 114      83.971  87.003  58.338  1.00103.75           N  
ATOM   4153  CA  ASP B 114      84.638  88.173  58.884  1.00103.94           C  
ATOM   4154  C   ASP B 114      84.240  88.625  60.273  1.00104.23           C  
ATOM   4155  O   ASP B 114      84.750  89.630  60.768  1.00104.57           O  
ATOM   4156  CB  ASP B 114      84.471  89.342  57.927  1.00104.63           C  
ATOM   4157  CG  ASP B 114      84.869  88.989  56.517  1.00105.95           C  
ATOM   4158  OD1 ASP B 114      85.941  88.370  56.340  1.00107.73           O  
ATOM   4159  OD2 ASP B 114      84.115  89.335  55.586  1.00106.10           O  
ATOM   4160  N   HIS B 115      83.346  87.898  60.921  1.00104.34           N  
ATOM   4161  CA  HIS B 115      82.913  88.325  62.239  1.00103.81           C  
ATOM   4162  C   HIS B 115      83.174  87.273  63.287  1.00103.48           C  
ATOM   4163  O   HIS B 115      82.755  87.421  64.426  1.00103.76           O  
ATOM   4164  CB  HIS B 115      81.420  88.682  62.197  1.00104.11           C  
ATOM   4165  CG  HIS B 115      81.079  89.742  61.188  1.00103.81           C  
ATOM   4166  ND1 HIS B 115      81.627  91.007  61.223  1.00103.33           N  
ATOM   4167  CD2 HIS B 115      80.263  89.716  60.106  1.00103.25           C  
ATOM   4168  CE1 HIS B 115      81.165  91.713  60.205  1.00103.27           C  
ATOM   4169  NE2 HIS B 115      80.336  90.954  59.512  1.00102.95           N  
ATOM   4170  N   VAL B 116      83.879  86.216  62.907  1.00103.62           N  
ATOM   4171  CA  VAL B 116      84.170  85.135  63.840  1.00103.86           C  
ATOM   4172  C   VAL B 116      84.729  85.661  65.156  1.00104.62           C  
ATOM   4173  O   VAL B 116      84.102  85.521  66.206  1.00104.53           O  
ATOM   4174  CB  VAL B 116      85.171  84.123  63.237  1.00103.17           C  
ATOM   4175  CG1 VAL B 116      85.556  83.098  64.275  1.00102.04           C  
ATOM   4176  CG2 VAL B 116      84.550  83.423  62.042  1.00103.58           C  
ATOM   4177  N   ASP B 117      85.903  86.277  65.092  1.00105.67           N  
ATOM   4178  CA  ASP B 117      86.562  86.816  66.280  1.00106.45           C  
ATOM   4179  C   ASP B 117      85.633  87.575  67.228  1.00106.09           C  
ATOM   4180  O   ASP B 117      85.773  87.476  68.452  1.00105.79           O  
ATOM   4181  CB  ASP B 117      87.737  87.716  65.863  1.00107.75           C  
ATOM   4182  CG  ASP B 117      87.367  88.697  64.755  1.00109.38           C  
ATOM   4183  OD1 ASP B 117      86.958  88.238  63.659  1.00109.74           O  
ATOM   4184  OD2 ASP B 117      87.492  89.924  64.982  1.00109.43           O  
ATOM   4185  N   THR B 118      84.685  88.321  66.661  1.00105.90           N  
ATOM   4186  CA  THR B 118      83.734  89.112  67.449  1.00105.04           C  
ATOM   4187  C   THR B 118      82.715  88.236  68.193  1.00104.45           C  
ATOM   4188  O   THR B 118      82.544  88.343  69.411  1.00104.89           O  
ATOM   4189  CB  THR B 118      82.961  90.095  66.548  1.00104.67           C  
ATOM   4190  OG1 THR B 118      83.875  90.778  65.676  1.00103.84           O  
ATOM   4191  CG2 THR B 118      82.226  91.113  67.399  1.00105.33           C  
ATOM   4192  N   VAL B 119      82.041  87.376  67.440  1.00103.40           N  
ATOM   4193  CA  VAL B 119      81.043  86.462  67.981  1.00102.12           C  
ATOM   4194  C   VAL B 119      81.675  85.497  68.978  1.00101.24           C  
ATOM   4195  O   VAL B 119      81.009  84.983  69.881  1.00100.88           O  
ATOM   4196  CB  VAL B 119      80.411  85.631  66.846  1.00102.29           C  
ATOM   4197  CG1 VAL B 119      79.349  84.711  67.395  1.00102.94           C  
ATOM   4198  CG2 VAL B 119      79.826  86.553  65.802  1.00102.82           C  
ATOM   4199  N   MET B 120      82.970  85.256  68.811  1.00100.16           N  
ATOM   4200  CA  MET B 120      83.678  84.327  69.678  1.00 98.56           C  
ATOM   4201  C   MET B 120      83.721  84.773  71.134  1.00 96.12           C  
ATOM   4202  O   MET B 120      83.572  83.956  72.052  1.00 95.15           O  
ATOM   4203  CB  MET B 120      85.102  84.119  69.171  1.00100.32           C  
ATOM   4204  CG  MET B 120      85.744  82.868  69.743  1.00103.26           C  
ATOM   4205  SD  MET B 120      84.924  81.355  69.161  1.00105.18           S  
ATOM   4206  CE  MET B 120      86.223  80.692  68.114  1.00105.01           C  
ATOM   4207  N   GLU B 121      83.930  86.070  71.334  1.00 92.57           N  
ATOM   4208  CA  GLU B 121      84.010  86.631  72.667  1.00 89.79           C  
ATOM   4209  C   GLU B 121      82.877  86.164  73.556  1.00 88.10           C  
ATOM   4210  O   GLU B 121      83.092  85.614  74.643  1.00 87.39           O  
ATOM   4211  CB  GLU B 121      83.993  88.148  72.590  1.00 90.11           C  
ATOM   4212  CG  GLU B 121      83.719  88.818  73.918  1.00 92.80           C  
ATOM   4213  CD  GLU B 121      83.924  90.319  73.860  1.00 96.01           C  
ATOM   4214  OE1 GLU B 121      83.724  90.907  72.765  1.00 95.61           O  
ATOM   4215  OE2 GLU B 121      84.275  90.907  74.914  1.00 98.33           O  
ATOM   4216  N   TYR B 122      81.659  86.388  73.078  1.00 86.26           N  
ATOM   4217  CA  TYR B 122      80.464  86.024  73.827  1.00 82.36           C  
ATOM   4218  C   TYR B 122      80.395  84.509  74.020  1.00 83.07           C  
ATOM   4219  O   TYR B 122      80.034  84.034  75.104  1.00 81.74           O  
ATOM   4220  CB  TYR B 122      79.221  86.586  73.112  1.00 77.09           C  
ATOM   4221  CG  TYR B 122      79.374  88.056  72.728  1.00 71.13           C  
ATOM   4222  CD1 TYR B 122      79.641  88.428  71.403  1.00 68.37           C  
ATOM   4223  CD2 TYR B 122      79.334  89.067  73.700  1.00 67.58           C  
ATOM   4224  CE1 TYR B 122      79.870  89.763  71.053  1.00 65.72           C  
ATOM   4225  CE2 TYR B 122      79.567  90.412  73.361  1.00 65.61           C  
ATOM   4226  CZ  TYR B 122      79.835  90.748  72.030  1.00 65.90           C  
ATOM   4227  OH  TYR B 122      80.081  92.057  71.662  1.00 64.30           O  
ATOM   4228  N   LEU B 123      80.764  83.752  72.984  1.00 83.93           N  
ATOM   4229  CA  LEU B 123      80.760  82.297  73.093  1.00 85.07           C  
ATOM   4230  C   LEU B 123      81.644  81.885  74.270  1.00 87.40           C  
ATOM   4231  O   LEU B 123      81.189  81.197  75.189  1.00 87.82           O  
ATOM   4232  CB  LEU B 123      81.278  81.657  71.806  1.00 82.66           C  
ATOM   4233  CG  LEU B 123      81.409  80.129  71.854  1.00 81.69           C  
ATOM   4234  CD1 LEU B 123      80.188  79.501  72.517  1.00 80.75           C  
ATOM   4235  CD2 LEU B 123      81.591  79.591  70.440  1.00 81.81           C  
ATOM   4236  N   LEU B 124      82.905  82.317  74.232  1.00 89.54           N  
ATOM   4237  CA  LEU B 124      83.878  82.026  75.286  1.00 90.42           C  
ATOM   4238  C   LEU B 124      83.280  82.428  76.629  1.00 89.61           C  
ATOM   4239  O   LEU B 124      83.186  81.610  77.552  1.00 88.72           O  
ATOM   4240  CB  LEU B 124      85.167  82.822  75.024  1.00 93.60           C  
ATOM   4241  CG  LEU B 124      86.349  82.942  76.014  1.00 96.25           C  
ATOM   4242  CD1 LEU B 124      87.389  83.841  75.349  1.00 97.20           C  
ATOM   4243  CD2 LEU B 124      85.952  83.562  77.371  1.00 95.98           C  
ATOM   4244  N   ASN B 125      82.880  83.698  76.712  1.00 88.52           N  
ATOM   4245  CA  ASN B 125      82.286  84.292  77.911  1.00 87.49           C  
ATOM   4246  C   ASN B 125      81.102  83.509  78.488  1.00 87.43           C  
ATOM   4247  O   ASN B 125      81.051  83.223  79.683  1.00 87.47           O  
ATOM   4248  CB  ASN B 125      81.840  85.717  77.596  1.00 85.98           C  
ATOM   4249  CG  ASN B 125      82.792  86.763  78.140  1.00 85.09           C  
ATOM   4250  OD1 ASN B 125      82.936  86.909  79.357  1.00 84.64           O  
ATOM   4251  ND2 ASN B 125      83.445  87.505  77.242  1.00 82.93           N  
ATOM   4252  N   VAL B 126      80.146  83.169  77.636  1.00 86.79           N  
ATOM   4253  CA  VAL B 126      78.982  82.431  78.081  1.00 86.60           C  
ATOM   4254  C   VAL B 126      79.308  81.104  78.759  1.00 87.47           C  
ATOM   4255  O   VAL B 126      78.907  80.868  79.895  1.00 87.01           O  
ATOM   4256  CB  VAL B 126      78.046  82.144  76.905  1.00 85.94           C  
ATOM   4257  CG1 VAL B 126      76.863  81.317  77.377  1.00 85.71           C  
ATOM   4258  CG2 VAL B 126      77.582  83.446  76.295  1.00 85.32           C  
ATOM   4259  N   THR B 127      80.044  80.249  78.050  1.00 89.14           N  
ATOM   4260  CA  THR B 127      80.418  78.908  78.517  1.00 89.84           C  
ATOM   4261  C   THR B 127      81.456  78.792  79.641  1.00 91.09           C  
ATOM   4262  O   THR B 127      81.467  77.802  80.382  1.00 91.07           O  
ATOM   4263  CB  THR B 127      80.936  78.062  77.340  1.00 88.93           C  
ATOM   4264  OG1 THR B 127      82.073  78.711  76.759  1.00 89.21           O  
ATOM   4265  CG2 THR B 127      79.871  77.913  76.278  1.00 88.47           C  
ATOM   4266  N   THR B 128      82.324  79.792  79.774  1.00 92.32           N  
ATOM   4267  CA  THR B 128      83.373  79.740  80.787  1.00 93.18           C  
ATOM   4268  C   THR B 128      83.249  80.724  81.949  1.00 93.73           C  
ATOM   4269  O   THR B 128      83.653  80.409  83.076  1.00 93.92           O  
ATOM   4270  CB  THR B 128      84.762  79.958  80.139  1.00 93.59           C  
ATOM   4271  OG1 THR B 128      84.879  81.316  79.688  1.00 93.07           O  
ATOM   4272  CG2 THR B 128      84.945  79.023  78.949  1.00 93.79           C  
ATOM   4273  N   ALA B 129      82.682  81.901  81.688  1.00 93.48           N  
ATOM   4274  CA  ALA B 129      82.577  82.928  82.721  1.00 93.14           C  
ATOM   4275  C   ALA B 129      81.193  83.450  83.141  1.00 93.44           C  
ATOM   4276  O   ALA B 129      81.031  84.654  83.356  1.00 93.95           O  
ATOM   4277  CB  ALA B 129      83.460  84.109  82.320  1.00 92.41           C  
ATOM   4278  N   PRO B 130      80.180  82.570  83.275  1.00 93.25           N  
ATOM   4279  CA  PRO B 130      78.870  83.097  83.683  1.00 92.78           C  
ATOM   4280  C   PRO B 130      78.901  83.719  85.082  1.00 92.36           C  
ATOM   4281  O   PRO B 130      79.828  83.472  85.848  1.00 92.90           O  
ATOM   4282  CB  PRO B 130      77.968  81.867  83.619  1.00 92.33           C  
ATOM   4283  CG  PRO B 130      78.891  80.757  83.941  1.00 92.50           C  
ATOM   4284  CD  PRO B 130      80.118  81.106  83.120  1.00 93.28           C  
ATOM   4285  N   GLU B 131      77.895  84.534  85.398  1.00 91.75           N  
ATOM   4286  CA  GLU B 131      77.796  85.184  86.704  1.00 90.76           C  
ATOM   4287  C   GLU B 131      76.527  84.773  87.441  1.00 91.00           C  
ATOM   4288  O   GLU B 131      76.465  84.847  88.675  1.00 91.61           O  
ATOM   4289  CB  GLU B 131      77.822  86.703  86.558  1.00 89.48           C  
ATOM   4290  CG  GLU B 131      79.198  87.298  86.708  1.00 90.88           C  
ATOM   4291  CD  GLU B 131      79.193  88.818  86.700  1.00 92.64           C  
ATOM   4292  OE1 GLU B 131      78.394  89.415  87.451  1.00 93.79           O  
ATOM   4293  OE2 GLU B 131      79.996  89.421  85.952  1.00 93.34           O  
ATOM   4294  N   PHE B 132      75.521  84.338  86.682  1.00 90.06           N  
ATOM   4295  CA  PHE B 132      74.250  83.903  87.252  1.00 88.66           C  
ATOM   4296  C   PHE B 132      73.810  84.807  88.391  1.00 87.12           C  
ATOM   4297  O   PHE B 132      73.549  84.329  89.498  1.00 86.83           O  
ATOM   4298  CB  PHE B 132      74.357  82.461  87.762  1.00 89.86           C  
ATOM   4299  CG  PHE B 132      74.688  81.461  86.688  1.00 92.08           C  
ATOM   4300  CD1 PHE B 132      75.279  80.244  87.016  1.00 92.21           C  
ATOM   4301  CD2 PHE B 132      74.426  81.742  85.347  1.00 93.47           C  
ATOM   4302  CE1 PHE B 132      75.611  79.326  86.029  1.00 93.38           C  
ATOM   4303  CE2 PHE B 132      74.753  80.827  84.346  1.00 94.90           C  
ATOM   4304  CZ  PHE B 132      75.348  79.618  84.689  1.00 94.88           C  
ATOM   4305  N   ARG B 133      73.746  86.109  88.116  1.00 85.03           N  
ATOM   4306  CA  ARG B 133      73.323  87.083  89.114  1.00 83.23           C  
ATOM   4307  C   ARG B 133      71.947  86.662  89.623  1.00 83.12           C  
ATOM   4308  O   ARG B 133      71.045  86.355  88.832  1.00 82.61           O  
ATOM   4309  CB  ARG B 133      73.267  88.471  88.495  1.00 81.77           C  
ATOM   4310  CG  ARG B 133      74.549  88.856  87.805  1.00 81.54           C  
ATOM   4311  CD  ARG B 133      74.520  90.303  87.382  1.00 83.17           C  
ATOM   4312  NE  ARG B 133      75.848  90.820  87.072  1.00 84.92           N  
ATOM   4313  CZ  ARG B 133      76.091  92.070  86.686  1.00 87.11           C  
ATOM   4314  NH1 ARG B 133      75.093  92.935  86.557  1.00 88.28           N  
ATOM   4315  NH2 ARG B 133      77.331  92.464  86.430  1.00 88.49           N  
ATOM   4316  N   PRO B 134      71.769  86.639  90.954  1.00 82.59           N  
ATOM   4317  CA  PRO B 134      70.519  86.249  91.610  1.00 82.70           C  
ATOM   4318  C   PRO B 134      69.258  86.775  90.938  1.00 82.69           C  
ATOM   4319  O   PRO B 134      68.379  85.995  90.564  1.00 83.22           O  
ATOM   4320  CB  PRO B 134      70.696  86.784  93.026  1.00 82.02           C  
ATOM   4321  CG  PRO B 134      72.124  86.644  93.233  1.00 81.59           C  
ATOM   4322  CD  PRO B 134      72.702  87.185  91.947  1.00 81.52           C  
ATOM   4323  N   TRP B 135      69.167  88.092  90.784  1.00 82.00           N  
ATOM   4324  CA  TRP B 135      67.997  88.672  90.157  1.00 82.21           C  
ATOM   4325  C   TRP B 135      67.810  88.179  88.712  1.00 83.26           C  
ATOM   4326  O   TRP B 135      66.763  87.613  88.396  1.00 84.41           O  
ATOM   4327  CB  TRP B 135      68.073  90.192  90.227  1.00 81.14           C  
ATOM   4328  CG  TRP B 135      69.314  90.779  89.667  1.00 80.78           C  
ATOM   4329  CD1 TRP B 135      69.509  91.219  88.389  1.00 81.69           C  
ATOM   4330  CD2 TRP B 135      70.521  91.057  90.375  1.00 80.61           C  
ATOM   4331  NE1 TRP B 135      70.766  91.768  88.258  1.00 80.77           N  
ATOM   4332  CE2 TRP B 135      71.407  91.680  89.466  1.00 80.75           C  
ATOM   4333  CE3 TRP B 135      70.943  90.846  91.693  1.00 79.57           C  
ATOM   4334  CZ2 TRP B 135      72.682  92.091  89.832  1.00 79.93           C  
ATOM   4335  CZ3 TRP B 135      72.210  91.258  92.055  1.00 78.01           C  
ATOM   4336  CH2 TRP B 135      73.064  91.875  91.129  1.00 78.54           C  
ATOM   4337  N   GLU B 136      68.810  88.362  87.844  1.00 82.68           N  
ATOM   4338  CA  GLU B 136      68.699  87.904  86.454  1.00 81.03           C  
ATOM   4339  C   GLU B 136      68.153  86.483  86.424  1.00 81.43           C  
ATOM   4340  O   GLU B 136      67.313  86.136  85.593  1.00 81.01           O  
ATOM   4341  CB  GLU B 136      70.059  87.932  85.757  1.00 78.95           C  
ATOM   4342  CG  GLU B 136      70.615  89.321  85.538  1.00 79.16           C  
ATOM   4343  CD  GLU B 136      71.770  89.352  84.541  1.00 81.41           C  
ATOM   4344  OE1 GLU B 136      72.262  90.471  84.240  1.00 79.45           O  
ATOM   4345  OE2 GLU B 136      72.183  88.263  84.059  1.00 82.78           O  
ATOM   4346  N   VAL B 137      68.643  85.674  87.354  1.00 82.43           N  
ATOM   4347  CA  VAL B 137      68.244  84.282  87.482  1.00 83.63           C  
ATOM   4348  C   VAL B 137      66.811  84.144  87.981  1.00 84.88           C  
ATOM   4349  O   VAL B 137      66.083  83.259  87.545  1.00 85.90           O  
ATOM   4350  CB  VAL B 137      69.190  83.526  88.452  1.00 83.15           C  
ATOM   4351  CG1 VAL B 137      68.594  82.177  88.832  1.00 82.55           C  
ATOM   4352  CG2 VAL B 137      70.550  83.343  87.806  1.00 80.94           C  
ATOM   4353  N   THR B 138      66.399  85.006  88.901  1.00 86.11           N  
ATOM   4354  CA  THR B 138      65.036  84.914  89.407  1.00 87.97           C  
ATOM   4355  C   THR B 138      64.048  85.302  88.311  1.00 88.12           C  
ATOM   4356  O   THR B 138      63.043  84.619  88.116  1.00 88.82           O  
ATOM   4357  CB  THR B 138      64.798  85.827  90.627  1.00 88.99           C  
ATOM   4358  OG1 THR B 138      65.753  85.529  91.653  1.00 91.91           O  
ATOM   4359  CG2 THR B 138      63.417  85.586  91.190  1.00 88.82           C  
ATOM   4360  N   ASP B 139      64.345  86.386  87.591  1.00 88.06           N  
ATOM   4361  CA  ASP B 139      63.484  86.869  86.504  1.00 88.13           C  
ATOM   4362  C   ASP B 139      63.355  85.865  85.353  1.00 87.70           C  
ATOM   4363  O   ASP B 139      62.337  85.835  84.668  1.00 88.63           O  
ATOM   4364  CB  ASP B 139      64.014  88.196  85.934  1.00 89.03           C  
ATOM   4365  CG  ASP B 139      64.156  89.289  86.998  1.00 92.16           C  
ATOM   4366  OD1 ASP B 139      63.282  89.377  87.892  1.00 94.94           O  
ATOM   4367  OD2 ASP B 139      65.135  90.078  86.937  1.00 92.30           O  
ATOM   4368  N   LEU B 140      64.387  85.047  85.157  1.00 86.04           N  
ATOM   4369  CA  LEU B 140      64.427  84.059  84.088  1.00 83.14           C  
ATOM   4370  C   LEU B 140      63.634  82.779  84.316  1.00 81.84           C  
ATOM   4371  O   LEU B 140      62.964  82.287  83.419  1.00 80.77           O  
ATOM   4372  CB  LEU B 140      65.880  83.697  83.804  1.00 83.64           C  
ATOM   4373  CG  LEU B 140      66.116  82.568  82.798  1.00 84.89           C  
ATOM   4374  CD1 LEU B 140      65.422  82.902  81.491  1.00 85.28           C  
ATOM   4375  CD2 LEU B 140      67.609  82.372  82.567  1.00 85.33           C  
ATOM   4376  N   GLN B 141      63.706  82.237  85.517  1.00 81.70           N  
ATOM   4377  CA  GLN B 141      63.016  80.991  85.814  1.00 82.62           C  
ATOM   4378  C   GLN B 141      61.574  80.838  85.342  1.00 82.34           C  
ATOM   4379  O   GLN B 141      61.206  79.792  84.816  1.00 83.50           O  
ATOM   4380  CB  GLN B 141      63.109  80.686  87.312  1.00 83.55           C  
ATOM   4381  CG  GLN B 141      64.540  80.418  87.755  1.00 83.95           C  
ATOM   4382  CD  GLN B 141      64.619  79.700  89.070  1.00 84.06           C  
ATOM   4383  OE1 GLN B 141      64.124  78.577  89.207  1.00 83.32           O  
ATOM   4384  NE2 GLN B 141      65.246  80.341  90.054  1.00 85.05           N  
ATOM   4385  N   PRO B 142      60.732  81.861  85.521  1.00 81.72           N  
ATOM   4386  CA  PRO B 142      59.352  81.686  85.059  1.00 80.40           C  
ATOM   4387  C   PRO B 142      59.293  81.270  83.593  1.00 79.37           C  
ATOM   4388  O   PRO B 142      58.272  80.782  83.115  1.00 80.05           O  
ATOM   4389  CB  PRO B 142      58.733  83.052  85.311  1.00 80.94           C  
ATOM   4390  CG  PRO B 142      59.905  83.975  85.152  1.00 81.96           C  
ATOM   4391  CD  PRO B 142      60.976  83.254  85.921  1.00 82.00           C  
ATOM   4392  N   GLN B 143      60.402  81.458  82.889  1.00 77.91           N  
ATOM   4393  CA  GLN B 143      60.490  81.087  81.484  1.00 77.09           C  
ATOM   4394  C   GLN B 143      60.426  79.568  81.292  1.00 75.84           C  
ATOM   4395  O   GLN B 143      59.889  79.078  80.309  1.00 76.15           O  
ATOM   4396  CB  GLN B 143      61.795  81.618  80.890  1.00 78.28           C  
ATOM   4397  CG  GLN B 143      61.983  81.313  79.414  1.00 81.45           C  
ATOM   4398  CD  GLN B 143      61.039  82.100  78.510  1.00 83.36           C  
ATOM   4399  OE1 GLN B 143      59.823  82.097  78.709  1.00 84.95           O  
ATOM   4400  NE2 GLN B 143      61.599  82.768  77.503  1.00 83.55           N  
ATOM   4401  N   LEU B 144      60.988  78.822  82.229  1.00 74.66           N  
ATOM   4402  CA  LEU B 144      60.978  77.372  82.138  1.00 73.53           C  
ATOM   4403  C   LEU B 144      59.561  76.872  81.949  1.00 73.72           C  
ATOM   4404  O   LEU B 144      59.322  75.886  81.259  1.00 74.45           O  
ATOM   4405  CB  LEU B 144      61.559  76.751  83.412  1.00 72.95           C  
ATOM   4406  CG  LEU B 144      63.035  76.982  83.741  1.00 71.59           C  
ATOM   4407  CD1 LEU B 144      63.337  76.443  85.129  1.00 70.45           C  
ATOM   4408  CD2 LEU B 144      63.898  76.305  82.693  1.00 70.08           C  
ATOM   4409  N   LYS B 145      58.613  77.555  82.570  1.00 74.29           N  
ATOM   4410  CA  LYS B 145      57.216  77.152  82.474  1.00 74.02           C  
ATOM   4411  C   LYS B 145      56.747  77.257  81.020  1.00 72.25           C  
ATOM   4412  O   LYS B 145      56.078  76.362  80.510  1.00 71.24           O  
ATOM   4413  CB  LYS B 145      56.373  78.043  83.392  1.00 76.42           C  
ATOM   4414  CG  LYS B 145      55.080  77.417  83.858  1.00 80.21           C  
ATOM   4415  CD  LYS B 145      54.427  78.297  84.914  1.00 84.59           C  
ATOM   4416  CE  LYS B 145      53.073  77.744  85.370  1.00 88.14           C  
ATOM   4417  NZ  LYS B 145      52.450  78.582  86.456  1.00 89.21           N  
ATOM   4418  N   VAL B 146      57.115  78.358  80.369  1.00 70.28           N  
ATOM   4419  CA  VAL B 146      56.773  78.623  78.977  1.00 69.28           C  
ATOM   4420  C   VAL B 146      57.504  77.651  78.069  1.00 69.70           C  
ATOM   4421  O   VAL B 146      56.883  76.825  77.408  1.00 69.39           O  
ATOM   4422  CB  VAL B 146      57.184  80.063  78.574  1.00 69.89           C  
ATOM   4423  CG1 VAL B 146      57.183  80.230  77.057  1.00 68.45           C  
ATOM   4424  CG2 VAL B 146      56.239  81.054  79.200  1.00 70.16           C  
ATOM   4425  N   ASP B 147      58.831  77.779  78.033  1.00 70.40           N  
ATOM   4426  CA  ASP B 147      59.706  76.924  77.221  1.00 70.23           C  
ATOM   4427  C   ASP B 147      59.249  75.466  77.225  1.00 67.93           C  
ATOM   4428  O   ASP B 147      59.158  74.814  76.182  1.00 67.04           O  
ATOM   4429  CB  ASP B 147      61.134  76.989  77.761  1.00 72.53           C  
ATOM   4430  CG  ASP B 147      62.112  76.252  76.886  1.00 75.45           C  
ATOM   4431  OD1 ASP B 147      62.312  76.728  75.742  1.00 77.22           O  
ATOM   4432  OD2 ASP B 147      62.666  75.210  77.335  1.00 76.32           O  
ATOM   4433  N   LYS B 148      58.979  74.969  78.423  1.00 65.51           N  
ATOM   4434  CA  LYS B 148      58.527  73.612  78.609  1.00 65.70           C  
ATOM   4435  C   LYS B 148      57.124  73.411  77.998  1.00 66.66           C  
ATOM   4436  O   LYS B 148      56.814  72.341  77.472  1.00 66.62           O  
ATOM   4437  CB  LYS B 148      58.544  73.283  80.114  1.00 64.31           C  
ATOM   4438  CG  LYS B 148      57.986  71.912  80.459  1.00 66.31           C  
ATOM   4439  CD  LYS B 148      58.246  71.482  81.905  1.00 65.81           C  
ATOM   4440  CE  LYS B 148      57.482  70.186  82.227  1.00 65.61           C  
ATOM   4441  NZ  LYS B 148      57.902  69.551  83.500  1.00 65.90           N  
ATOM   4442  N   ALA B 149      56.288  74.449  78.044  1.00 67.51           N  
ATOM   4443  CA  ALA B 149      54.927  74.377  77.511  1.00 66.84           C  
ATOM   4444  C   ALA B 149      54.850  74.208  75.996  1.00 67.33           C  
ATOM   4445  O   ALA B 149      53.985  73.480  75.509  1.00 68.51           O  
ATOM   4446  CB  ALA B 149      54.139  75.601  77.932  1.00 65.33           C  
ATOM   4447  N   VAL B 150      55.728  74.872  75.246  1.00 67.04           N  
ATOM   4448  CA  VAL B 150      55.688  74.722  73.796  1.00 68.59           C  
ATOM   4449  C   VAL B 150      56.232  73.345  73.410  1.00 70.53           C  
ATOM   4450  O   VAL B 150      55.727  72.693  72.492  1.00 72.21           O  
ATOM   4451  CB  VAL B 150      56.507  75.824  73.040  1.00 67.03           C  
ATOM   4452  CG1 VAL B 150      56.144  77.187  73.560  1.00 65.70           C  
ATOM   4453  CG2 VAL B 150      57.999  75.574  73.159  1.00 67.54           C  
ATOM   4454  N   ALA B 151      57.261  72.890  74.111  1.00 71.83           N  
ATOM   4455  CA  ALA B 151      57.835  71.597  73.795  1.00 72.41           C  
ATOM   4456  C   ALA B 151      56.758  70.533  73.917  1.00 73.37           C  
ATOM   4457  O   ALA B 151      56.501  69.786  72.968  1.00 73.79           O  
ATOM   4458  CB  ALA B 151      58.979  71.298  74.725  1.00 71.88           C  
ATOM   4459  N   PHE B 152      56.107  70.487  75.075  1.00 74.57           N  
ATOM   4460  CA  PHE B 152      55.065  69.497  75.329  1.00 76.31           C  
ATOM   4461  C   PHE B 152      53.823  69.617  74.457  1.00 77.45           C  
ATOM   4462  O   PHE B 152      52.805  68.970  74.728  1.00 78.58           O  
ATOM   4463  CB  PHE B 152      54.651  69.515  76.801  1.00 76.46           C  
ATOM   4464  CG  PHE B 152      55.559  68.711  77.700  1.00 77.84           C  
ATOM   4465  CD1 PHE B 152      56.924  69.018  77.791  1.00 78.14           C  
ATOM   4466  CD2 PHE B 152      55.047  67.653  78.466  1.00 77.06           C  
ATOM   4467  CE1 PHE B 152      57.764  68.288  78.628  1.00 77.92           C  
ATOM   4468  CE2 PHE B 152      55.873  66.915  79.307  1.00 76.84           C  
ATOM   4469  CZ  PHE B 152      57.235  67.231  79.390  1.00 79.29           C  
ATOM   4470  N   GLN B 153      53.901  70.438  73.414  1.00 77.68           N  
ATOM   4471  CA  GLN B 153      52.773  70.603  72.503  1.00 77.01           C  
ATOM   4472  C   GLN B 153      52.700  69.401  71.591  1.00 76.00           C  
ATOM   4473  O   GLN B 153      51.657  69.124  70.988  1.00 75.68           O  
ATOM   4474  CB  GLN B 153      52.941  71.850  71.654  1.00 77.68           C  
ATOM   4475  CG  GLN B 153      52.986  73.109  72.459  1.00 80.38           C  
ATOM   4476  CD  GLN B 153      52.340  74.246  71.734  1.00 82.23           C  
ATOM   4477  OE1 GLN B 153      51.117  74.263  71.564  1.00 85.10           O  
ATOM   4478  NE2 GLN B 153      53.148  75.203  71.281  1.00 81.81           N  
ATOM   4479  N   SER B 154      53.830  68.702  71.494  1.00 75.06           N  
ATOM   4480  CA  SER B 154      53.961  67.505  70.673  1.00 73.89           C  
ATOM   4481  C   SER B 154      53.951  66.335  71.655  1.00 73.95           C  
ATOM   4482  O   SER B 154      54.853  66.213  72.478  1.00 74.90           O  
ATOM   4483  CB  SER B 154      55.286  67.567  69.913  1.00 72.77           C  
ATOM   4484  OG  SER B 154      55.829  68.886  69.957  1.00 71.26           O  
ATOM   4485  N   PRO B 155      52.924  65.467  71.596  1.00 73.21           N  
ATOM   4486  CA  PRO B 155      52.880  64.339  72.530  1.00 74.02           C  
ATOM   4487  C   PRO B 155      54.167  63.529  72.406  1.00 75.38           C  
ATOM   4488  O   PRO B 155      54.640  62.922  73.367  1.00 74.92           O  
ATOM   4489  CB  PRO B 155      51.643  63.562  72.072  1.00 73.14           C  
ATOM   4490  CG  PRO B 155      50.799  64.594  71.429  1.00 72.08           C  
ATOM   4491  CD  PRO B 155      51.817  65.378  70.637  1.00 72.31           C  
ATOM   4492  N   GLN B 156      54.710  63.531  71.191  1.00 77.55           N  
ATOM   4493  CA  GLN B 156      55.958  62.857  70.862  1.00 79.00           C  
ATOM   4494  C   GLN B 156      56.948  63.069  72.041  1.00 79.26           C  
ATOM   4495  O   GLN B 156      57.568  62.121  72.531  1.00 78.21           O  
ATOM   4496  CB  GLN B 156      56.500  63.454  69.530  1.00 79.70           C  
ATOM   4497  CG  GLN B 156      57.928  63.016  69.096  1.00 81.43           C  
ATOM   4498  CD  GLN B 156      58.767  64.118  68.377  1.00 81.15           C  
ATOM   4499  OE1 GLN B 156      58.354  64.679  67.355  1.00 79.91           O  
ATOM   4500  NE2 GLN B 156      59.956  64.402  68.916  1.00 78.69           N  
ATOM   4501  N   VAL B 157      57.054  64.309  72.518  1.00 79.81           N  
ATOM   4502  CA  VAL B 157      57.970  64.646  73.609  1.00 81.52           C  
ATOM   4503  C   VAL B 157      57.527  64.178  75.010  1.00 83.47           C  
ATOM   4504  O   VAL B 157      58.355  64.024  75.916  1.00 83.89           O  
ATOM   4505  CB  VAL B 157      58.222  66.168  73.651  1.00 79.82           C  
ATOM   4506  CG1 VAL B 157      56.969  66.875  74.073  1.00 81.22           C  
ATOM   4507  CG2 VAL B 157      59.349  66.493  74.607  1.00 79.49           C  
ATOM   4508  N   GLY B 158      56.229  63.955  75.188  1.00 84.92           N  
ATOM   4509  CA  GLY B 158      55.734  63.506  76.479  1.00 85.16           C  
ATOM   4510  C   GLY B 158      56.085  62.064  76.803  1.00 84.69           C  
ATOM   4511  O   GLY B 158      56.592  61.771  77.882  1.00 84.79           O  
ATOM   4512  N   VAL B 159      55.824  61.154  75.876  1.00 84.60           N  
ATOM   4513  CA  VAL B 159      56.126  59.759  76.133  1.00 85.04           C  
ATOM   4514  C   VAL B 159      57.624  59.510  76.214  1.00 85.02           C  
ATOM   4515  O   VAL B 159      58.063  58.622  76.942  1.00 84.96           O  
ATOM   4516  CB  VAL B 159      55.522  58.828  75.062  1.00 85.20           C  
ATOM   4517  CG1 VAL B 159      54.010  58.959  75.046  1.00 85.04           C  
ATOM   4518  CG2 VAL B 159      56.101  59.154  73.718  1.00 86.04           C  
ATOM   4519  N   LEU B 160      58.420  60.282  75.481  1.00 85.10           N  
ATOM   4520  CA  LEU B 160      59.861  60.068  75.550  1.00 85.65           C  
ATOM   4521  C   LEU B 160      60.402  60.385  76.942  1.00 86.33           C  
ATOM   4522  O   LEU B 160      61.299  59.706  77.437  1.00 87.07           O  
ATOM   4523  CB  LEU B 160      60.593  60.888  74.491  1.00 84.65           C  
ATOM   4524  CG  LEU B 160      60.406  60.424  73.040  1.00 84.24           C  
ATOM   4525  CD1 LEU B 160      61.601  60.914  72.234  1.00 84.60           C  
ATOM   4526  CD2 LEU B 160      60.321  58.908  72.938  1.00 82.19           C  
ATOM   4527  N   GLU B 161      59.850  61.411  77.578  1.00 87.10           N  
ATOM   4528  CA  GLU B 161      60.259  61.774  78.927  1.00 87.04           C  
ATOM   4529  C   GLU B 161      59.937  60.621  79.856  1.00 86.92           C  
ATOM   4530  O   GLU B 161      60.799  60.145  80.585  1.00 87.03           O  
ATOM   4531  CB  GLU B 161      59.495  62.997  79.399  1.00 88.01           C  
ATOM   4532  CG  GLU B 161      59.970  64.283  78.795  1.00 90.46           C  
ATOM   4533  CD  GLU B 161      61.252  64.758  79.424  1.00 91.50           C  
ATOM   4534  OE1 GLU B 161      62.307  64.144  79.152  1.00 91.78           O  
ATOM   4535  OE2 GLU B 161      61.191  65.743  80.201  1.00 92.73           O  
ATOM   4536  N   ASN B 162      58.684  60.180  79.815  1.00 86.66           N  
ATOM   4537  CA  ASN B 162      58.214  59.090  80.654  1.00 87.57           C  
ATOM   4538  C   ASN B 162      58.836  57.750  80.325  1.00 87.30           C  
ATOM   4539  O   ASN B 162      58.772  56.822  81.134  1.00 87.72           O  
ATOM   4540  CB  ASN B 162      56.700  58.969  80.553  1.00 89.76           C  
ATOM   4541  CG  ASN B 162      55.993  60.159  81.138  1.00 92.71           C  
ATOM   4542  OD1 ASN B 162      56.061  60.408  82.344  1.00 94.28           O  
ATOM   4543  ND2 ASN B 162      55.316  60.919  80.286  1.00 95.63           N  
ATOM   4544  N   LEU B 163      59.423  57.634  79.135  1.00 87.11           N  
ATOM   4545  CA  LEU B 163      60.056  56.378  78.738  1.00 85.43           C  
ATOM   4546  C   LEU B 163      61.329  56.278  79.549  1.00 84.49           C  
ATOM   4547  O   LEU B 163      61.480  55.384  80.384  1.00 83.28           O  
ATOM   4548  CB  LEU B 163      60.390  56.369  77.247  1.00 84.84           C  
ATOM   4549  CG  LEU B 163      60.686  54.968  76.694  1.00 85.05           C  
ATOM   4550  CD1 LEU B 163      59.436  54.098  76.803  1.00 83.44           C  
ATOM   4551  CD2 LEU B 163      61.145  55.060  75.243  1.00 85.13           C  
ATOM   4552  N   HIS B 164      62.238  57.215  79.313  1.00 83.84           N  
ATOM   4553  CA  HIS B 164      63.486  57.236  80.056  1.00 84.46           C  
ATOM   4554  C   HIS B 164      63.238  57.124  81.564  1.00 85.74           C  
ATOM   4555  O   HIS B 164      64.160  56.866  82.333  1.00 86.99           O  
ATOM   4556  CB  HIS B 164      64.251  58.522  79.772  1.00 82.26           C  
ATOM   4557  CG  HIS B 164      64.845  58.584  78.401  1.00 81.73           C  
ATOM   4558  ND1 HIS B 164      64.080  58.557  77.255  1.00 81.28           N  
ATOM   4559  CD2 HIS B 164      66.130  58.716  77.991  1.00 81.35           C  
ATOM   4560  CE1 HIS B 164      64.867  58.675  76.201  1.00 80.75           C  
ATOM   4561  NE2 HIS B 164      66.116  58.772  76.620  1.00 80.50           N  
ATOM   4562  N   ALA B 165      61.996  57.323  81.989  1.00 86.44           N  
ATOM   4563  CA  ALA B 165      61.673  57.241  83.403  1.00 86.23           C  
ATOM   4564  C   ALA B 165      61.306  55.816  83.772  1.00 86.62           C  
ATOM   4565  O   ALA B 165      61.442  55.422  84.926  1.00 87.38           O  
ATOM   4566  CB  ALA B 165      60.525  58.178  83.736  1.00 85.89           C  
ATOM   4567  N   ALA B 166      60.836  55.044  82.798  1.00 86.89           N  
ATOM   4568  CA  ALA B 166      60.454  53.657  83.051  1.00 88.14           C  
ATOM   4569  C   ALA B 166      61.600  52.752  82.626  1.00 88.70           C  
ATOM   4570  O   ALA B 166      61.764  51.633  83.113  1.00 88.54           O  
ATOM   4571  CB  ALA B 166      59.183  53.304  82.272  1.00 87.86           C  
ATOM   4572  N   ALA B 167      62.408  53.254  81.711  1.00 89.08           N  
ATOM   4573  CA  ALA B 167      63.525  52.485  81.226  1.00 89.77           C  
ATOM   4574  C   ALA B 167      64.688  52.565  82.192  1.00 90.89           C  
ATOM   4575  O   ALA B 167      65.635  51.788  82.080  1.00 93.12           O  
ATOM   4576  CB  ALA B 167      63.946  52.993  79.879  1.00 89.20           C  
ATOM   4577  N   TYR B 168      64.643  53.502  83.134  1.00 90.30           N  
ATOM   4578  CA  TYR B 168      65.747  53.620  84.077  1.00 90.17           C  
ATOM   4579  C   TYR B 168      65.365  53.875  85.532  1.00 91.38           C  
ATOM   4580  O   TYR B 168      64.185  54.018  85.873  1.00 91.08           O  
ATOM   4581  CB  TYR B 168      66.724  54.706  83.611  1.00 88.52           C  
ATOM   4582  CG  TYR B 168      67.351  54.419  82.266  1.00 88.25           C  
ATOM   4583  CD1 TYR B 168      66.613  54.530  81.096  1.00 87.78           C  
ATOM   4584  CD2 TYR B 168      68.677  54.013  82.165  1.00 88.32           C  
ATOM   4585  CE1 TYR B 168      67.176  54.244  79.861  1.00 87.91           C  
ATOM   4586  CE2 TYR B 168      69.249  53.723  80.932  1.00 87.82           C  
ATOM   4587  CZ  TYR B 168      68.491  53.842  79.784  1.00 87.69           C  
ATOM   4588  OH  TYR B 168      69.038  53.572  78.551  1.00 87.53           O  
ATOM   4589  N   LYS B 169      66.390  53.897  86.385  1.00 92.92           N  
ATOM   4590  CA  LYS B 169      66.238  54.151  87.818  1.00 93.04           C  
ATOM   4591  C   LYS B 169      67.063  55.377  88.177  1.00 93.55           C  
ATOM   4592  O   LYS B 169      66.975  55.876  89.295  1.00 93.57           O  
ATOM   4593  CB  LYS B 169      66.743  52.976  88.657  1.00 91.98           C  
ATOM   4594  CG  LYS B 169      65.889  51.727  88.616  1.00 92.02           C  
ATOM   4595  CD  LYS B 169      66.437  50.682  89.584  1.00 92.03           C  
ATOM   4596  CE  LYS B 169      65.594  49.407  89.593  1.00 93.34           C  
ATOM   4597  NZ  LYS B 169      66.001  48.429  90.648  1.00 92.86           N  
ATOM   4598  N   THR B 170      67.857  55.861  87.226  1.00 94.19           N  
ATOM   4599  CA  THR B 170      68.706  57.021  87.472  1.00 95.84           C  
ATOM   4600  C   THR B 170      69.289  57.656  86.213  1.00 95.89           C  
ATOM   4601  O   THR B 170      68.949  57.274  85.093  1.00 96.32           O  
ATOM   4602  CB  THR B 170      69.882  56.635  88.383  1.00 97.48           C  
ATOM   4603  OG1 THR B 170      70.195  55.249  88.178  1.00 98.84           O  
ATOM   4604  CG2 THR B 170      69.543  56.887  89.849  1.00 98.29           C  
ATOM   4605  N   ALA B 171      70.171  58.633  86.433  1.00 95.63           N  
ATOM   4606  CA  ALA B 171      70.875  59.372  85.382  1.00 95.17           C  
ATOM   4607  C   ALA B 171      70.068  59.644  84.111  1.00 93.88           C  
ATOM   4608  O   ALA B 171      69.660  60.780  83.847  1.00 93.36           O  
ATOM   4609  CB  ALA B 171      72.178  58.639  85.028  1.00 96.76           C  
ATOM   4610  N   LEU B 172      69.875  58.599  83.314  1.00 91.95           N  
ATOM   4611  CA  LEU B 172      69.122  58.707  82.084  1.00 90.08           C  
ATOM   4612  C   LEU B 172      67.636  58.799  82.409  1.00 89.82           C  
ATOM   4613  O   LEU B 172      66.838  59.262  81.595  1.00 90.02           O  
ATOM   4614  CB  LEU B 172      69.404  57.499  81.188  1.00 87.59           C  
ATOM   4615  CG  LEU B 172      70.832  57.423  80.647  1.00 85.57           C  
ATOM   4616  CD1 LEU B 172      70.929  56.288  79.648  1.00 85.23           C  
ATOM   4617  CD2 LEU B 172      71.213  58.729  79.985  1.00 83.61           C  
ATOM   4618  N   ALA B 173      67.269  58.362  83.606  1.00 89.37           N  
ATOM   4619  CA  ALA B 173      65.878  58.407  84.031  1.00 89.38           C  
ATOM   4620  C   ALA B 173      65.464  59.841  84.322  1.00 89.16           C  
ATOM   4621  O   ALA B 173      64.271  60.134  84.470  1.00 89.19           O  
ATOM   4622  CB  ALA B 173      65.681  57.547  85.270  1.00 89.72           C  
ATOM   4623  N   ASN B 174      66.457  60.726  84.411  1.00 88.57           N  
ATOM   4624  CA  ASN B 174      66.212  62.138  84.682  1.00 88.08           C  
ATOM   4625  C   ASN B 174      65.622  62.824  83.457  1.00 88.05           C  
ATOM   4626  O   ASN B 174      66.151  62.684  82.349  1.00 88.73           O  
ATOM   4627  CB  ASN B 174      67.506  62.849  85.087  1.00 86.72           C  
ATOM   4628  CG  ASN B 174      67.890  62.583  86.525  1.00 85.61           C  
ATOM   4629  OD1 ASN B 174      67.110  62.025  87.299  1.00 83.15           O  
ATOM   4630  ND2 ASN B 174      69.095  62.998  86.897  1.00 86.36           N  
ATOM   4631  N   PRO B 175      64.518  63.581  83.648  1.00 87.30           N  
ATOM   4632  CA  PRO B 175      63.801  64.319  82.601  1.00 85.21           C  
ATOM   4633  C   PRO B 175      64.647  65.429  81.982  1.00 83.69           C  
ATOM   4634  O   PRO B 175      65.519  66.006  82.646  1.00 83.96           O  
ATOM   4635  CB  PRO B 175      62.590  64.861  83.344  1.00 85.64           C  
ATOM   4636  CG  PRO B 175      63.152  65.138  84.692  1.00 86.12           C  
ATOM   4637  CD  PRO B 175      63.924  63.872  84.967  1.00 86.90           C  
ATOM   4638  N   LEU B 176      64.368  65.723  80.713  1.00 80.69           N  
ATOM   4639  CA  LEU B 176      65.102  66.726  79.959  1.00 78.38           C  
ATOM   4640  C   LEU B 176      64.581  68.149  80.179  1.00 78.40           C  
ATOM   4641  O   LEU B 176      65.300  69.127  79.950  1.00 79.74           O  
ATOM   4642  CB  LEU B 176      65.058  66.344  78.481  1.00 76.83           C  
ATOM   4643  CG  LEU B 176      65.872  67.153  77.476  1.00 76.74           C  
ATOM   4644  CD1 LEU B 176      67.331  67.240  77.894  1.00 75.72           C  
ATOM   4645  CD2 LEU B 176      65.734  66.493  76.117  1.00 76.51           C  
ATOM   4646  N   TYR B 177      63.332  68.266  80.621  1.00 77.63           N  
ATOM   4647  CA  TYR B 177      62.740  69.570  80.894  1.00 76.46           C  
ATOM   4648  C   TYR B 177      62.424  69.667  82.375  1.00 76.20           C  
ATOM   4649  O   TYR B 177      61.732  68.813  82.932  1.00 74.51           O  
ATOM   4650  CB  TYR B 177      61.460  69.781  80.082  1.00 76.75           C  
ATOM   4651  CG  TYR B 177      61.690  69.887  78.597  1.00 76.70           C  
ATOM   4652  CD1 TYR B 177      61.459  68.799  77.757  1.00 77.07           C  
ATOM   4653  CD2 TYR B 177      62.185  71.061  78.033  1.00 77.63           C  
ATOM   4654  CE1 TYR B 177      61.720  68.874  76.384  1.00 76.84           C  
ATOM   4655  CE2 TYR B 177      62.451  71.151  76.654  1.00 77.66           C  
ATOM   4656  CZ  TYR B 177      62.216  70.049  75.838  1.00 76.72           C  
ATOM   4657  OH  TYR B 177      62.464  70.120  74.484  1.00 76.01           O  
ATOM   4658  N   CYS B 178      62.940  70.719  83.000  1.00 77.03           N  
ATOM   4659  CA  CYS B 178      62.742  70.949  84.423  1.00 78.74           C  
ATOM   4660  C   CYS B 178      61.363  70.552  84.915  1.00 80.91           C  
ATOM   4661  O   CYS B 178      60.347  71.035  84.410  1.00 80.58           O  
ATOM   4662  CB  CYS B 178      62.976  72.419  84.774  1.00 77.65           C  
ATOM   4663  SG  CYS B 178      62.681  72.789  86.534  1.00 74.78           S  
ATOM   4664  N   PRO B 179      61.310  69.661  85.917  1.00 82.95           N  
ATOM   4665  CA  PRO B 179      60.022  69.227  86.459  1.00 83.98           C  
ATOM   4666  C   PRO B 179      59.309  70.433  87.046  1.00 84.72           C  
ATOM   4667  O   PRO B 179      59.941  71.400  87.478  1.00 84.31           O  
ATOM   4668  CB  PRO B 179      60.410  68.184  87.506  1.00 84.01           C  
ATOM   4669  CG  PRO B 179      61.766  68.640  87.947  1.00 85.00           C  
ATOM   4670  CD  PRO B 179      62.428  69.043  86.650  1.00 83.87           C  
ATOM   4671  N   ASP B 180      57.986  70.364  87.041  1.00 86.71           N  
ATOM   4672  CA  ASP B 180      57.143  71.446  87.527  1.00 87.79           C  
ATOM   4673  C   ASP B 180      57.475  71.987  88.919  1.00 86.84           C  
ATOM   4674  O   ASP B 180      57.838  73.156  89.057  1.00 85.95           O  
ATOM   4675  CB  ASP B 180      55.674  71.002  87.448  1.00 89.87           C  
ATOM   4676  CG  ASP B 180      55.128  71.034  86.018  1.00 91.11           C  
ATOM   4677  OD1 ASP B 180      55.928  70.963  85.055  1.00 91.49           O  
ATOM   4678  OD2 ASP B 180      53.892  71.121  85.856  1.00 93.07           O  
ATOM   4679  N   TYR B 181      57.364  71.139  89.939  1.00 86.66           N  
ATOM   4680  CA  TYR B 181      57.632  71.554  91.319  1.00 86.12           C  
ATOM   4681  C   TYR B 181      58.948  72.315  91.536  1.00 83.20           C  
ATOM   4682  O   TYR B 181      59.077  73.081  92.489  1.00 81.04           O  
ATOM   4683  CB  TYR B 181      57.559  70.333  92.259  1.00 89.80           C  
ATOM   4684  CG  TYR B 181      58.825  69.488  92.371  1.00 94.45           C  
ATOM   4685  CD1 TYR B 181      59.932  69.942  93.093  1.00 97.07           C  
ATOM   4686  CD2 TYR B 181      58.902  68.216  91.791  1.00 95.91           C  
ATOM   4687  CE1 TYR B 181      61.084  69.153  93.242  1.00 98.48           C  
ATOM   4688  CE2 TYR B 181      60.057  67.419  91.933  1.00 97.91           C  
ATOM   4689  CZ  TYR B 181      61.142  67.900  92.662  1.00 98.66           C  
ATOM   4690  OH  TYR B 181      62.287  67.145  92.813  1.00 99.09           O  
ATOM   4691  N   ARG B 182      59.917  72.122  90.652  1.00 80.93           N  
ATOM   4692  CA  ARG B 182      61.186  72.802  90.817  1.00 79.79           C  
ATOM   4693  C   ARG B 182      61.345  74.128  90.092  1.00 80.36           C  
ATOM   4694  O   ARG B 182      62.400  74.763  90.191  1.00 81.43           O  
ATOM   4695  CB  ARG B 182      62.340  71.869  90.453  1.00 79.15           C  
ATOM   4696  CG  ARG B 182      62.782  70.993  91.628  1.00 78.16           C  
ATOM   4697  CD  ARG B 182      64.137  70.349  91.416  1.00 77.19           C  
ATOM   4698  NE  ARG B 182      65.213  71.332  91.241  1.00 74.88           N  
ATOM   4699  CZ  ARG B 182      65.695  72.119  92.202  1.00 72.96           C  
ATOM   4700  NH1 ARG B 182      65.211  72.064  93.437  1.00 71.52           N  
ATOM   4701  NH2 ARG B 182      66.673  72.962  91.921  1.00 71.85           N  
ATOM   4702  N   ILE B 183      60.316  74.563  89.369  1.00 79.84           N  
ATOM   4703  CA  ILE B 183      60.405  75.845  88.678  1.00 78.15           C  
ATOM   4704  C   ILE B 183      60.461  76.931  89.738  1.00 78.85           C  
ATOM   4705  O   ILE B 183      59.615  76.988  90.635  1.00 78.36           O  
ATOM   4706  CB  ILE B 183      59.185  76.129  87.797  1.00 77.46           C  
ATOM   4707  CG1 ILE B 183      59.009  75.026  86.757  1.00 76.99           C  
ATOM   4708  CG2 ILE B 183      59.366  77.473  87.104  1.00 75.39           C  
ATOM   4709  CD1 ILE B 183      60.014  75.082  85.654  1.00 77.12           C  
ATOM   4710  N   GLY B 184      61.469  77.785  89.637  1.00 79.88           N  
ATOM   4711  CA  GLY B 184      61.620  78.864  90.592  1.00 80.93           C  
ATOM   4712  C   GLY B 184      62.438  78.508  91.819  1.00 81.54           C  
ATOM   4713  O   GLY B 184      62.835  79.401  92.572  1.00 81.24           O  
ATOM   4714  N   LYS B 185      62.701  77.215  92.014  1.00 82.22           N  
ATOM   4715  CA  LYS B 185      63.468  76.749  93.167  1.00 82.96           C  
ATOM   4716  C   LYS B 185      64.929  76.431  92.885  1.00 83.35           C  
ATOM   4717  O   LYS B 185      65.652  75.943  93.756  1.00 83.41           O  
ATOM   4718  CB  LYS B 185      62.780  75.542  93.790  1.00 82.93           C  
ATOM   4719  CG  LYS B 185      61.529  75.939  94.534  1.00 85.85           C  
ATOM   4720  CD  LYS B 185      60.670  74.747  94.914  1.00 88.76           C  
ATOM   4721  CE  LYS B 185      59.363  75.209  95.578  1.00 90.78           C  
ATOM   4722  NZ  LYS B 185      58.380  74.093  95.773  1.00 92.20           N  
ATOM   4723  N   ILE B 186      65.369  76.707  91.668  1.00 83.79           N  
ATOM   4724  CA  ILE B 186      66.758  76.481  91.310  1.00 84.63           C  
ATOM   4725  C   ILE B 186      67.510  77.709  91.824  1.00 85.57           C  
ATOM   4726  O   ILE B 186      66.896  78.747  92.065  1.00 86.29           O  
ATOM   4727  CB  ILE B 186      66.883  76.318  89.795  1.00 84.39           C  
ATOM   4728  CG1 ILE B 186      66.088  75.076  89.378  1.00 84.00           C  
ATOM   4729  CG2 ILE B 186      68.339  76.227  89.387  1.00 83.67           C  
ATOM   4730  CD1 ILE B 186      65.931  74.907  87.893  1.00 85.93           C  
ATOM   4731  N   THR B 187      68.823  77.608  92.006  1.00 86.47           N  
ATOM   4732  CA  THR B 187      69.574  78.743  92.547  1.00 87.35           C  
ATOM   4733  C   THR B 187      70.869  79.052  91.819  1.00 86.84           C  
ATOM   4734  O   THR B 187      71.407  78.204  91.117  1.00 86.56           O  
ATOM   4735  CB  THR B 187      69.950  78.496  94.007  1.00 88.40           C  
ATOM   4736  OG1 THR B 187      71.100  77.635  94.052  1.00 91.17           O  
ATOM   4737  CG2 THR B 187      68.792  77.828  94.747  1.00 87.92           C  
ATOM   4738  N   SER B 188      71.371  80.269  92.013  1.00 86.95           N  
ATOM   4739  CA  SER B 188      72.620  80.685  91.395  1.00 88.81           C  
ATOM   4740  C   SER B 188      73.726  79.731  91.818  1.00 91.15           C  
ATOM   4741  O   SER B 188      74.699  79.523  91.086  1.00 91.50           O  
ATOM   4742  CB  SER B 188      72.992  82.103  91.820  1.00 87.68           C  
ATOM   4743  OG  SER B 188      72.210  83.054  91.138  1.00 87.48           O  
ATOM   4744  N   GLU B 189      73.584  79.162  93.012  1.00 93.09           N  
ATOM   4745  CA  GLU B 189      74.568  78.213  93.504  1.00 94.91           C  
ATOM   4746  C   GLU B 189      74.509  77.034  92.552  1.00 94.41           C  
ATOM   4747  O   GLU B 189      75.409  76.837  91.729  1.00 94.98           O  
ATOM   4748  CB  GLU B 189      74.229  77.737  94.923  1.00 97.46           C  
ATOM   4749  CG  GLU B 189      74.432  78.790  96.005  1.00103.94           C  
ATOM   4750  CD  GLU B 189      73.333  79.860  96.027  1.00107.56           C  
ATOM   4751  OE1 GLU B 189      73.022  80.429  94.956  1.00109.61           O  
ATOM   4752  OE2 GLU B 189      72.784  80.141  97.122  1.00108.63           O  
ATOM   4753  N   GLN B 190      73.419  76.279  92.650  1.00 92.71           N  
ATOM   4754  CA  GLN B 190      73.220  75.099  91.822  1.00 91.19           C  
ATOM   4755  C   GLN B 190      73.751  75.256  90.409  1.00 89.81           C  
ATOM   4756  O   GLN B 190      74.412  74.361  89.885  1.00 89.63           O  
ATOM   4757  CB  GLN B 190      71.739  74.725  91.817  1.00 91.28           C  
ATOM   4758  CG  GLN B 190      71.266  74.317  93.199  1.00 92.01           C  
ATOM   4759  CD  GLN B 190      69.860  73.798  93.212  1.00 93.10           C  
ATOM   4760  OE1 GLN B 190      68.905  74.549  93.016  1.00 95.82           O  
ATOM   4761  NE2 GLN B 190      69.717  72.498  93.438  1.00 94.07           N  
ATOM   4762  N   LEU B 191      73.476  76.396  89.794  1.00 88.77           N  
ATOM   4763  CA  LEU B 191      73.959  76.644  88.446  1.00 88.02           C  
ATOM   4764  C   LEU B 191      75.481  76.708  88.456  1.00 87.87           C  
ATOM   4765  O   LEU B 191      76.141  76.009  87.685  1.00 87.40           O  
ATOM   4766  CB  LEU B 191      73.374  77.952  87.904  1.00 87.22           C  
ATOM   4767  CG  LEU B 191      71.901  77.915  87.498  1.00 84.29           C  
ATOM   4768  CD1 LEU B 191      71.415  79.304  87.192  1.00 83.34           C  
ATOM   4769  CD2 LEU B 191      71.745  77.016  86.296  1.00 83.92           C  
ATOM   4770  N   HIS B 192      76.032  77.542  89.334  1.00 88.17           N  
ATOM   4771  CA  HIS B 192      77.480  77.674  89.454  1.00 88.27           C  
ATOM   4772  C   HIS B 192      78.133  76.327  89.662  1.00 88.50           C  
ATOM   4773  O   HIS B 192      78.977  75.919  88.869  1.00 89.16           O  
ATOM   4774  CB  HIS B 192      77.841  78.582  90.617  1.00 87.20           C  
ATOM   4775  CG  HIS B 192      77.986  80.015  90.227  1.00 87.51           C  
ATOM   4776  ND1 HIS B 192      77.258  81.028  90.817  1.00 87.38           N  
ATOM   4777  CD2 HIS B 192      78.779  80.609  89.304  1.00 87.40           C  
ATOM   4778  CE1 HIS B 192      77.597  82.184  90.275  1.00 87.24           C  
ATOM   4779  NE2 HIS B 192      78.519  81.957  89.353  1.00 87.40           N  
ATOM   4780  N   HIS B 193      77.741  75.633  90.724  1.00 88.55           N  
ATOM   4781  CA  HIS B 193      78.316  74.328  91.000  1.00 89.33           C  
ATOM   4782  C   HIS B 193      78.176  73.409  89.805  1.00 87.70           C  
ATOM   4783  O   HIS B 193      79.146  72.776  89.416  1.00 87.89           O  
ATOM   4784  CB  HIS B 193      77.679  73.698  92.240  1.00 93.54           C  
ATOM   4785  CG  HIS B 193      77.854  74.522  93.480  1.00 98.57           C  
ATOM   4786  ND1 HIS B 193      78.705  75.609  93.534  1.00100.70           N  
ATOM   4787  CD2 HIS B 193      77.271  74.438  94.701  1.00100.43           C  
ATOM   4788  CE1 HIS B 193      78.634  76.163  94.733  1.00101.69           C  
ATOM   4789  NE2 HIS B 193      77.772  75.472  95.461  1.00102.56           N  
ATOM   4790  N   PHE B 194      76.990  73.345  89.205  1.00 86.41           N  
ATOM   4791  CA  PHE B 194      76.804  72.484  88.038  1.00 84.81           C  
ATOM   4792  C   PHE B 194      77.867  72.801  86.993  1.00 85.48           C  
ATOM   4793  O   PHE B 194      78.520  71.908  86.466  1.00 85.55           O  
ATOM   4794  CB  PHE B 194      75.426  72.676  87.405  1.00 80.39           C  
ATOM   4795  CG  PHE B 194      75.099  71.640  86.356  1.00 76.23           C  
ATOM   4796  CD1 PHE B 194      74.485  70.434  86.710  1.00 73.52           C  
ATOM   4797  CD2 PHE B 194      75.442  71.850  85.018  1.00 74.42           C  
ATOM   4798  CE1 PHE B 194      74.216  69.451  85.741  1.00 71.28           C  
ATOM   4799  CE2 PHE B 194      75.180  70.877  84.040  1.00 72.14           C  
ATOM   4800  CZ  PHE B 194      74.566  69.675  84.401  1.00 71.06           C  
ATOM   4801  N   VAL B 195      78.036  74.081  86.698  1.00 86.86           N  
ATOM   4802  CA  VAL B 195      79.025  74.510  85.722  1.00 88.91           C  
ATOM   4803  C   VAL B 195      80.459  74.187  86.143  1.00 90.20           C  
ATOM   4804  O   VAL B 195      81.233  73.645  85.354  1.00 90.12           O  
ATOM   4805  CB  VAL B 195      78.911  76.024  85.470  1.00 88.92           C  
ATOM   4806  CG1 VAL B 195      80.079  76.515  84.640  1.00 89.63           C  
ATOM   4807  CG2 VAL B 195      77.617  76.311  84.753  1.00 90.16           C  
ATOM   4808  N   GLN B 196      80.807  74.525  87.383  1.00 91.87           N  
ATOM   4809  CA  GLN B 196      82.152  74.289  87.903  1.00 92.80           C  
ATOM   4810  C   GLN B 196      82.494  72.803  87.999  1.00 93.72           C  
ATOM   4811  O   GLN B 196      83.667  72.437  87.951  1.00 94.65           O  
ATOM   4812  CB  GLN B 196      82.305  74.919  89.287  1.00 92.72           C  
ATOM   4813  CG  GLN B 196      81.828  76.361  89.392  1.00 93.99           C  
ATOM   4814  CD  GLN B 196      81.970  76.932  90.806  1.00 95.39           C  
ATOM   4815  OE1 GLN B 196      81.710  76.243  91.806  1.00 96.15           O  
ATOM   4816  NE2 GLN B 196      82.367  78.200  90.894  1.00 94.35           N  
ATOM   4817  N   ASN B 197      81.476  71.954  88.133  1.00 93.84           N  
ATOM   4818  CA  ASN B 197      81.682  70.510  88.249  1.00 94.15           C  
ATOM   4819  C   ASN B 197      81.567  69.724  86.942  1.00 93.59           C  
ATOM   4820  O   ASN B 197      81.794  68.510  86.946  1.00 93.74           O  
ATOM   4821  CB  ASN B 197      80.686  69.890  89.246  1.00 96.96           C  
ATOM   4822  CG  ASN B 197      80.886  70.379  90.672  1.00100.00           C  
ATOM   4823  OD1 ASN B 197      82.012  70.455  91.153  1.00103.38           O  
ATOM   4824  ND2 ASN B 197      79.789  70.694  91.360  1.00100.68           N  
ATOM   4825  N   ASN B 198      81.216  70.383  85.836  1.00 92.22           N  
ATOM   4826  CA  ASN B 198      81.049  69.664  84.568  1.00 91.51           C  
ATOM   4827  C   ASN B 198      81.690  70.336  83.372  1.00 91.86           C  
ATOM   4828  O   ASN B 198      82.203  69.661  82.491  1.00 92.26           O  
ATOM   4829  CB  ASN B 198      79.560  69.450  84.261  1.00 89.65           C  
ATOM   4830  CG  ASN B 198      78.865  68.588  85.294  1.00 89.21           C  
ATOM   4831  OD1 ASN B 198      78.910  67.366  85.224  1.00 90.17           O  
ATOM   4832  ND2 ASN B 198      78.223  69.225  86.271  1.00 88.14           N  
ATOM   4833  N   PHE B 199      81.639  71.660  83.327  1.00 93.17           N  
ATOM   4834  CA  PHE B 199      82.217  72.401  82.206  1.00 95.35           C  
ATOM   4835  C   PHE B 199      83.723  72.493  82.406  1.00 95.91           C  
ATOM   4836  O   PHE B 199      84.291  73.585  82.507  1.00 96.15           O  
ATOM   4837  CB  PHE B 199      81.603  73.811  82.113  1.00 96.37           C  
ATOM   4838  CG  PHE B 199      80.189  73.838  81.558  1.00 97.30           C  
ATOM   4839  CD1 PHE B 199      79.362  72.715  81.632  1.00 97.25           C  
ATOM   4840  CD2 PHE B 199      79.674  75.003  80.997  1.00 96.90           C  
ATOM   4841  CE1 PHE B 199      78.052  72.753  81.162  1.00 96.04           C  
ATOM   4842  CE2 PHE B 199      78.366  75.046  80.527  1.00 96.63           C  
ATOM   4843  CZ  PHE B 199      77.555  73.917  80.611  1.00 96.46           C  
ATOM   4844  N   THR B 200      84.353  71.322  82.457  1.00 96.27           N  
ATOM   4845  CA  THR B 200      85.789  71.185  82.665  1.00 95.42           C  
ATOM   4846  C   THR B 200      86.486  70.740  81.386  1.00 95.78           C  
ATOM   4847  O   THR B 200      86.018  69.828  80.707  1.00 94.42           O  
ATOM   4848  CB  THR B 200      86.053  70.145  83.735  1.00 94.94           C  
ATOM   4849  OG1 THR B 200      85.566  68.875  83.277  1.00 92.64           O  
ATOM   4850  CG2 THR B 200      85.340  70.530  85.028  1.00 93.87           C  
ATOM   4851  N   SER B 201      87.616  71.377  81.090  1.00 96.76           N  
ATOM   4852  CA  SER B 201      88.416  71.111  79.888  1.00 97.72           C  
ATOM   4853  C   SER B 201      88.523  69.660  79.390  1.00 96.60           C  
ATOM   4854  O   SER B 201      88.628  69.423  78.189  1.00 95.09           O  
ATOM   4855  CB  SER B 201      89.829  71.664  80.086  1.00 99.19           C  
ATOM   4856  OG  SER B 201      90.515  70.924  81.080  1.00102.15           O  
ATOM   4857  N   ALA B 202      88.510  68.696  80.302  1.00 96.68           N  
ATOM   4858  CA  ALA B 202      88.618  67.291  79.912  1.00 97.52           C  
ATOM   4859  C   ALA B 202      87.276  66.669  79.489  1.00 98.31           C  
ATOM   4860  O   ALA B 202      87.201  65.477  79.146  1.00 97.97           O  
ATOM   4861  CB  ALA B 202      89.222  66.499  81.054  1.00 97.11           C  
ATOM   4862  N   ARG B 203      86.222  67.486  79.521  1.00 98.56           N  
ATOM   4863  CA  ARG B 203      84.873  67.055  79.152  1.00 96.84           C  
ATOM   4864  C   ARG B 203      84.334  67.932  78.032  1.00 96.31           C  
ATOM   4865  O   ARG B 203      83.249  67.685  77.513  1.00 96.53           O  
ATOM   4866  CB  ARG B 203      83.940  67.165  80.353  1.00 96.23           C  
ATOM   4867  CG  ARG B 203      84.438  66.438  81.574  1.00 96.62           C  
ATOM   4868  CD  ARG B 203      83.535  66.667  82.770  1.00 96.62           C  
ATOM   4869  NE  ARG B 203      82.125  66.478  82.444  1.00 95.78           N  
ATOM   4870  CZ  ARG B 203      81.247  65.890  83.249  1.00 95.21           C  
ATOM   4871  NH1 ARG B 203      81.628  65.425  84.427  1.00 94.94           N  
ATOM   4872  NH2 ARG B 203      79.983  65.775  82.880  1.00 95.88           N  
ATOM   4873  N   MET B 204      85.112  68.945  77.659  1.00 95.79           N  
ATOM   4874  CA  MET B 204      84.728  69.898  76.622  1.00 95.45           C  
ATOM   4875  C   MET B 204      85.558  69.831  75.340  1.00 95.46           C  
ATOM   4876  O   MET B 204      86.753  69.525  75.370  1.00 96.91           O  
ATOM   4877  CB  MET B 204      84.830  71.313  77.180  1.00 95.92           C  
ATOM   4878  CG  MET B 204      83.987  71.572  78.413  1.00 97.09           C  
ATOM   4879  SD  MET B 204      84.434  73.134  79.182  1.00 97.83           S  
ATOM   4880  CE  MET B 204      84.386  74.247  77.727  1.00 98.56           C  
ATOM   4881  N   ALA B 205      84.922  70.152  74.219  1.00 94.26           N  
ATOM   4882  CA  ALA B 205      85.590  70.149  72.923  1.00 93.07           C  
ATOM   4883  C   ALA B 205      85.216  71.416  72.169  1.00 92.38           C  
ATOM   4884  O   ALA B 205      84.048  71.803  72.154  1.00 92.85           O  
ATOM   4885  CB  ALA B 205      85.171  68.922  72.125  1.00 92.36           C  
ATOM   4886  N   LEU B 206      86.203  72.060  71.549  1.00 91.31           N  
ATOM   4887  CA  LEU B 206      85.962  73.282  70.787  1.00 90.41           C  
ATOM   4888  C   LEU B 206      86.043  73.042  69.278  1.00 90.79           C  
ATOM   4889  O   LEU B 206      87.080  73.297  68.669  1.00 91.22           O  
ATOM   4890  CB  LEU B 206      86.973  74.365  71.177  1.00 89.31           C  
ATOM   4891  CG  LEU B 206      86.960  75.637  70.316  1.00 89.75           C  
ATOM   4892  CD1 LEU B 206      85.640  76.370  70.494  1.00 91.76           C  
ATOM   4893  CD2 LEU B 206      88.099  76.548  70.706  1.00 89.25           C  
ATOM   4894  N   VAL B 207      84.945  72.574  68.678  1.00 90.54           N  
ATOM   4895  CA  VAL B 207      84.887  72.298  67.238  1.00 90.50           C  
ATOM   4896  C   VAL B 207      84.745  73.579  66.424  1.00 91.72           C  
ATOM   4897  O   VAL B 207      84.490  74.638  66.989  1.00 91.80           O  
ATOM   4898  CB  VAL B 207      83.703  71.397  66.910  1.00 89.82           C  
ATOM   4899  CG1 VAL B 207      83.917  70.729  65.562  1.00 90.33           C  
ATOM   4900  CG2 VAL B 207      83.532  70.367  68.000  1.00 89.80           C  
ATOM   4901  N   GLY B 208      84.899  73.502  65.103  1.00 93.47           N  
ATOM   4902  CA  GLY B 208      84.774  74.723  64.317  1.00 96.44           C  
ATOM   4903  C   GLY B 208      84.883  74.727  62.796  1.00 98.01           C  
ATOM   4904  O   GLY B 208      85.964  74.931  62.239  1.00 99.14           O  
ATOM   4905  N   ILE B 209      83.754  74.536  62.119  1.00 98.45           N  
ATOM   4906  CA  ILE B 209      83.707  74.549  60.660  1.00 98.56           C  
ATOM   4907  C   ILE B 209      83.895  75.987  60.153  1.00 99.12           C  
ATOM   4908  O   ILE B 209      83.594  76.941  60.860  1.00 98.94           O  
ATOM   4909  CB  ILE B 209      82.351  74.014  60.176  1.00 98.50           C  
ATOM   4910  CG1 ILE B 209      82.217  72.547  60.564  1.00 98.69           C  
ATOM   4911  CG2 ILE B 209      82.205  74.192  58.677  1.00 98.37           C  
ATOM   4912  CD1 ILE B 209      80.830  72.004  60.345  1.00 99.99           C  
ATOM   4913  N   GLY B 210      84.407  76.137  58.938  1.00100.23           N  
ATOM   4914  CA  GLY B 210      84.598  77.461  58.377  1.00102.63           C  
ATOM   4915  C   GLY B 210      85.759  78.280  58.911  1.00104.75           C  
ATOM   4916  O   GLY B 210      85.808  79.486  58.688  1.00103.90           O  
ATOM   4917  N   VAL B 211      86.692  77.644  59.612  1.00107.90           N  
ATOM   4918  CA  VAL B 211      87.857  78.356  60.149  1.00111.22           C  
ATOM   4919  C   VAL B 211      89.156  77.547  60.040  1.00114.13           C  
ATOM   4920  O   VAL B 211      89.123  76.318  59.893  1.00115.16           O  
ATOM   4921  CB  VAL B 211      87.645  78.742  61.624  1.00110.01           C  
ATOM   4922  CG1 VAL B 211      86.623  79.850  61.716  1.00110.65           C  
ATOM   4923  CG2 VAL B 211      87.188  77.533  62.417  1.00108.56           C  
ATOM   4924  N   LYS B 212      90.295  78.239  60.104  1.00116.32           N  
ATOM   4925  CA  LYS B 212      91.613  77.596  60.025  1.00117.74           C  
ATOM   4926  C   LYS B 212      92.031  77.104  61.420  1.00117.85           C  
ATOM   4927  O   LYS B 212      91.896  77.831  62.414  1.00116.80           O  
ATOM   4928  CB  LYS B 212      92.654  78.581  59.478  1.00118.79           C  
ATOM   4929  CG  LYS B 212      94.039  77.974  59.315  1.00120.32           C  
ATOM   4930  CD  LYS B 212      95.088  79.029  58.991  1.00121.35           C  
ATOM   4931  CE  LYS B 212      96.490  78.426  59.010  1.00122.24           C  
ATOM   4932  NZ  LYS B 212      97.562  79.436  58.758  1.00122.49           N  
ATOM   4933  N   HIS B 213      92.552  75.877  61.478  1.00118.03           N  
ATOM   4934  CA  HIS B 213      92.942  75.252  62.744  1.00118.37           C  
ATOM   4935  C   HIS B 213      93.845  76.047  63.695  1.00118.63           C  
ATOM   4936  O   HIS B 213      93.655  76.005  64.912  1.00118.28           O  
ATOM   4937  CB  HIS B 213      93.581  73.883  62.487  1.00117.69           C  
ATOM   4938  CG  HIS B 213      93.592  72.991  63.692  1.00117.18           C  
ATOM   4939  ND1 HIS B 213      92.590  72.085  63.958  1.00117.15           N  
ATOM   4940  CD2 HIS B 213      94.464  72.901  64.725  1.00117.38           C  
ATOM   4941  CE1 HIS B 213      92.843  71.473  65.102  1.00117.11           C  
ATOM   4942  NE2 HIS B 213      93.973  71.950  65.588  1.00117.21           N  
ATOM   4943  N   SER B 214      94.830  76.759  63.160  1.00119.08           N  
ATOM   4944  CA  SER B 214      95.728  77.524  64.019  1.00119.56           C  
ATOM   4945  C   SER B 214      94.974  78.588  64.803  1.00120.48           C  
ATOM   4946  O   SER B 214      95.253  78.816  65.982  1.00119.69           O  
ATOM   4947  CB  SER B 214      96.824  78.192  63.188  1.00119.35           C  
ATOM   4948  OG  SER B 214      96.285  79.167  62.314  1.00118.50           O  
ATOM   4949  N   ASP B 215      94.017  79.230  64.133  1.00122.32           N  
ATOM   4950  CA  ASP B 215      93.199  80.295  64.719  1.00123.45           C  
ATOM   4951  C   ASP B 215      92.271  79.788  65.811  1.00124.58           C  
ATOM   4952  O   ASP B 215      92.215  80.366  66.899  1.00124.39           O  
ATOM   4953  CB  ASP B 215      92.366  80.973  63.634  1.00123.24           C  
ATOM   4954  CG  ASP B 215      93.217  81.548  62.517  1.00123.54           C  
ATOM   4955  OD1 ASP B 215      94.073  82.415  62.806  1.00123.29           O  
ATOM   4956  OD2 ASP B 215      93.025  81.134  61.351  1.00123.26           O  
ATOM   4957  N   LEU B 216      91.532  78.720  65.509  1.00125.76           N  
ATOM   4958  CA  LEU B 216      90.615  78.129  66.475  1.00127.45           C  
ATOM   4959  C   LEU B 216      91.410  77.615  67.668  1.00129.97           C  
ATOM   4960  O   LEU B 216      90.914  77.590  68.795  1.00130.37           O  
ATOM   4961  CB  LEU B 216      89.829  76.978  65.838  1.00125.74           C  
ATOM   4962  CG  LEU B 216      88.899  76.194  66.773  1.00124.70           C  
ATOM   4963  CD1 LEU B 216      87.972  77.141  67.497  1.00123.84           C  
ATOM   4964  CD2 LEU B 216      88.097  75.191  65.981  1.00123.68           C  
ATOM   4965  N   LYS B 217      92.651  77.210  67.410  1.00133.03           N  
ATOM   4966  CA  LYS B 217      93.539  76.702  68.451  1.00135.43           C  
ATOM   4967  C   LYS B 217      93.979  77.830  69.376  1.00136.93           C  
ATOM   4968  O   LYS B 217      93.820  77.743  70.592  1.00137.13           O  
ATOM   4969  CB  LYS B 217      94.776  76.048  67.827  1.00135.65           C  
ATOM   4970  CG  LYS B 217      95.792  75.564  68.854  1.00136.55           C  
ATOM   4971  CD  LYS B 217      96.962  74.817  68.216  1.00136.88           C  
ATOM   4972  CE  LYS B 217      97.887  74.231  69.288  1.00137.10           C  
ATOM   4973  NZ  LYS B 217      98.973  73.376  68.730  1.00136.12           N  
ATOM   4974  N   GLN B 218      94.540  78.885  68.790  1.00138.82           N  
ATOM   4975  CA  GLN B 218      95.006  80.043  69.549  1.00140.71           C  
ATOM   4976  C   GLN B 218      93.931  80.574  70.489  1.00141.35           C  
ATOM   4977  O   GLN B 218      94.221  81.017  71.603  1.00140.88           O  
ATOM   4978  CB  GLN B 218      95.430  81.154  68.597  1.00141.38           C  
ATOM   4979  CG  GLN B 218      95.731  82.457  69.295  1.00142.93           C  
ATOM   4980  CD  GLN B 218      96.262  83.497  68.345  1.00144.08           C  
ATOM   4981  OE1 GLN B 218      95.608  83.849  67.360  1.00144.74           O  
ATOM   4982  NE2 GLN B 218      97.461  83.999  68.628  1.00144.78           N  
ATOM   4983  N   VAL B 219      92.691  80.539  70.014  1.00142.55           N  
ATOM   4984  CA  VAL B 219      91.550  80.992  70.793  1.00143.53           C  
ATOM   4985  C   VAL B 219      91.436  80.119  72.040  1.00144.17           C  
ATOM   4986  O   VAL B 219      91.583  80.600  73.165  1.00144.33           O  
ATOM   4987  CB  VAL B 219      90.240  80.876  69.972  1.00143.53           C  
ATOM   4988  CG1 VAL B 219      89.053  81.340  70.806  1.00143.31           C  
ATOM   4989  CG2 VAL B 219      90.349  81.704  68.698  1.00143.46           C  
ATOM   4990  N   ALA B 220      91.186  78.830  71.821  1.00144.85           N  
ATOM   4991  CA  ALA B 220      91.038  77.853  72.899  1.00145.67           C  
ATOM   4992  C   ALA B 220      92.117  77.968  73.972  1.00146.12           C  
ATOM   4993  O   ALA B 220      91.872  77.683  75.148  1.00146.16           O  
ATOM   4994  CB  ALA B 220      91.041  76.444  72.319  1.00145.82           C  
ATOM   4995  N   GLU B 221      93.305  78.395  73.556  1.00146.60           N  
ATOM   4996  CA  GLU B 221      94.445  78.540  74.454  1.00146.90           C  
ATOM   4997  C   GLU B 221      94.379  79.726  75.412  1.00147.23           C  
ATOM   4998  O   GLU B 221      93.837  79.625  76.516  1.00147.27           O  
ATOM   4999  CB  GLU B 221      95.739  78.631  73.639  1.00146.59           C  
ATOM   5000  CG  GLU B 221      96.294  77.293  73.182  1.00145.89           C  
ATOM   5001  CD  GLU B 221      97.528  77.457  72.325  1.00145.55           C  
ATOM   5002  OE1 GLU B 221      98.398  78.271  72.699  1.00145.21           O  
ATOM   5003  OE2 GLU B 221      97.633  76.774  71.285  1.00145.55           O  
ATOM   5004  N   GLN B 222      94.949  80.845  74.981  1.00147.52           N  
ATOM   5005  CA  GLN B 222      95.000  82.051  75.791  1.00147.93           C  
ATOM   5006  C   GLN B 222      93.722  82.410  76.535  1.00148.28           C  
ATOM   5007  O   GLN B 222      93.766  83.146  77.524  1.00148.00           O  
ATOM   5008  CB  GLN B 222      95.423  83.238  74.926  1.00147.79           C  
ATOM   5009  CG  GLN B 222      95.290  84.572  75.635  1.00148.12           C  
ATOM   5010  CD  GLN B 222      95.879  85.708  74.843  1.00148.72           C  
ATOM   5011  OE1 GLN B 222      95.673  85.808  73.631  1.00149.11           O  
ATOM   5012  NE2 GLN B 222      96.613  86.585  75.523  1.00148.36           N  
ATOM   5013  N   PHE B 223      92.587  81.888  76.082  1.00148.98           N  
ATOM   5014  CA  PHE B 223      91.332  82.237  76.724  1.00149.75           C  
ATOM   5015  C   PHE B 223      90.609  81.216  77.581  1.00149.94           C  
ATOM   5016  O   PHE B 223      90.393  81.476  78.762  1.00149.98           O  
ATOM   5017  CB  PHE B 223      90.378  82.810  75.683  1.00150.61           C  
ATOM   5018  CG  PHE B 223      90.849  84.109  75.105  1.00152.19           C  
ATOM   5019  CD1 PHE B 223      91.667  84.132  73.977  1.00152.52           C  
ATOM   5020  CD2 PHE B 223      90.541  85.315  75.737  1.00152.83           C  
ATOM   5021  CE1 PHE B 223      92.176  85.336  73.486  1.00153.11           C  
ATOM   5022  CE2 PHE B 223      91.044  86.528  75.258  1.00153.14           C  
ATOM   5023  CZ  PHE B 223      91.865  86.538  74.131  1.00153.30           C  
ATOM   5024  N   LEU B 224      90.226  80.072  77.014  1.00150.32           N  
ATOM   5025  CA  LEU B 224      89.504  79.058  77.793  1.00150.82           C  
ATOM   5026  C   LEU B 224      90.165  78.767  79.147  1.00151.48           C  
ATOM   5027  O   LEU B 224      91.055  77.915  79.255  1.00151.40           O  
ATOM   5028  CB  LEU B 224      89.338  77.761  76.987  1.00150.04           C  
ATOM   5029  CG  LEU B 224      88.400  77.814  75.769  1.00149.65           C  
ATOM   5030  CD1 LEU B 224      88.040  76.398  75.365  1.00149.45           C  
ATOM   5031  CD2 LEU B 224      87.123  78.584  76.086  1.00149.13           C  
ATOM   5032  N   ASN B 225      89.698  79.485  80.173  1.00152.16           N  
ATOM   5033  CA  ASN B 225      90.220  79.379  81.538  1.00152.20           C  
ATOM   5034  C   ASN B 225      89.839  78.117  82.308  1.00151.95           C  
ATOM   5035  O   ASN B 225      90.663  77.211  82.402  1.00151.88           O  
ATOM   5036  CB  ASN B 225      89.826  80.623  82.347  1.00152.29           C  
ATOM   5037  CG  ASN B 225      91.041  81.415  82.827  1.00152.39           C  
ATOM   5038  OD1 ASN B 225      91.925  81.761  82.038  1.00151.92           O  
ATOM   5039  ND2 ASN B 225      91.084  81.708  84.125  1.00151.99           N  
ATOM   5040  N   ILE B 226      88.621  78.060  82.863  1.00151.81           N  
ATOM   5041  CA  ILE B 226      88.168  76.880  83.630  1.00151.87           C  
ATOM   5042  C   ILE B 226      88.889  75.642  83.101  1.00151.12           C  
ATOM   5043  O   ILE B 226      88.436  74.985  82.153  1.00151.18           O  
ATOM   5044  CB  ILE B 226      86.629  76.632  83.512  1.00152.58           C  
ATOM   5045  CG1 ILE B 226      85.839  77.858  83.993  1.00152.50           C  
ATOM   5046  CG2 ILE B 226      86.240  75.404  84.349  1.00152.70           C  
ATOM   5047  CD1 ILE B 226      84.322  77.709  83.856  1.00151.61           C  
ATOM   5048  N   ARG B 227      90.012  75.328  83.736  1.00149.69           N  
ATOM   5049  CA  ARG B 227      90.849  74.218  83.309  1.00147.79           C  
ATOM   5050  C   ARG B 227      90.453  72.810  83.725  1.00146.32           C  
ATOM   5051  O   ARG B 227      89.363  72.556  84.259  1.00145.84           O  
ATOM   5052  CB  ARG B 227      92.304  74.473  83.735  1.00147.09           C  
ATOM   5053  CG  ARG B 227      92.494  74.555  85.240  1.00145.62           C  
ATOM   5054  CD  ARG B 227      93.918  74.895  85.617  1.00143.67           C  
ATOM   5055  NE  ARG B 227      94.027  75.125  87.052  1.00142.34           N  
ATOM   5056  CZ  ARG B 227      95.140  75.506  87.668  1.00141.68           C  
ATOM   5057  NH1 ARG B 227      96.249  75.702  86.971  1.00140.94           N  
ATOM   5058  NH2 ARG B 227      95.140  75.697  88.980  1.00141.31           N  
ATOM   5059  N   SER B 228      91.399  71.917  83.443  1.00144.15           N  
ATOM   5060  CA  SER B 228      91.337  70.488  83.694  1.00141.14           C  
ATOM   5061  C   SER B 228      90.425  69.983  84.795  1.00138.76           C  
ATOM   5062  O   SER B 228      90.017  70.715  85.703  1.00138.54           O  
ATOM   5063  CB  SER B 228      92.759  69.965  83.920  1.00141.22           C  
ATOM   5064  OG  SER B 228      93.523  70.902  84.660  1.00141.04           O  
ATOM   5065  N   GLY B 229      90.125  68.698  84.688  1.00135.82           N  
ATOM   5066  CA  GLY B 229      89.267  68.050  85.646  1.00132.67           C  
ATOM   5067  C   GLY B 229      88.322  67.152  84.892  1.00130.85           C  
ATOM   5068  O   GLY B 229      88.307  67.131  83.663  1.00130.32           O  
ATOM   5069  N   ALA B 230      87.542  66.394  85.643  1.00129.53           N  
ATOM   5070  CA  ALA B 230      86.563  65.489  85.081  1.00128.45           C  
ATOM   5071  C   ALA B 230      85.367  65.621  86.007  1.00128.16           C  
ATOM   5072  O   ALA B 230      84.292  65.089  85.736  1.00128.48           O  
ATOM   5073  CB  ALA B 230      87.097  64.066  85.090  1.00128.19           C  
ATOM   5074  N   GLY B 231      85.587  66.347  87.104  1.00127.65           N  
ATOM   5075  CA  GLY B 231      84.563  66.594  88.105  1.00126.75           C  
ATOM   5076  C   GLY B 231      83.518  65.510  88.278  1.00126.60           C  
ATOM   5077  O   GLY B 231      83.758  64.339  87.978  1.00126.84           O  
ATOM   5078  N   THR B 232      82.350  65.907  88.774  1.00126.11           N  
ATOM   5079  CA  THR B 232      81.246  64.981  88.995  1.00125.76           C  
ATOM   5080  C   THR B 232      81.170  63.919  87.903  1.00125.71           C  
ATOM   5081  O   THR B 232      81.224  64.238  86.717  1.00125.78           O  
ATOM   5082  CB  THR B 232      79.896  65.737  89.040  1.00125.89           C  
ATOM   5083  OG1 THR B 232      79.877  66.611  90.177  1.00124.90           O  
ATOM   5084  CG2 THR B 232      78.720  64.754  89.118  1.00125.30           C  
ATOM   5085  N   SER B 233      81.059  62.658  88.307  1.00125.46           N  
ATOM   5086  CA  SER B 233      80.945  61.562  87.352  1.00125.18           C  
ATOM   5087  C   SER B 233      79.545  60.993  87.456  1.00124.39           C  
ATOM   5088  O   SER B 233      79.059  60.714  88.554  1.00124.01           O  
ATOM   5089  CB  SER B 233      81.960  60.464  87.655  1.00126.12           C  
ATOM   5090  OG  SER B 233      83.277  60.936  87.456  1.00128.38           O  
ATOM   5091  N   SER B 234      78.897  60.822  86.311  1.00123.24           N  
ATOM   5092  CA  SER B 234      77.541  60.296  86.282  1.00122.32           C  
ATOM   5093  C   SER B 234      77.443  58.890  86.872  1.00121.32           C  
ATOM   5094  O   SER B 234      78.320  58.053  86.663  1.00121.41           O  
ATOM   5095  CB  SER B 234      77.021  60.286  84.841  1.00122.56           C  
ATOM   5096  OG  SER B 234      75.726  59.710  84.769  1.00122.48           O  
ATOM   5097  N   ALA B 235      76.377  58.634  87.619  1.00120.03           N  
ATOM   5098  CA  ALA B 235      76.174  57.316  88.197  1.00119.91           C  
ATOM   5099  C   ALA B 235      75.828  56.362  87.050  1.00119.81           C  
ATOM   5100  O   ALA B 235      75.180  56.764  86.084  1.00120.54           O  
ATOM   5101  CB  ALA B 235      75.037  57.359  89.209  1.00119.72           C  
ATOM   5102  N   LYS B 236      76.263  55.108  87.147  1.00119.01           N  
ATOM   5103  CA  LYS B 236      75.977  54.125  86.102  1.00117.55           C  
ATOM   5104  C   LYS B 236      74.497  54.071  85.777  1.00116.00           C  
ATOM   5105  O   LYS B 236      73.645  54.272  86.644  1.00115.12           O  
ATOM   5106  CB  LYS B 236      76.441  52.726  86.519  1.00118.28           C  
ATOM   5107  CG  LYS B 236      77.933  52.469  86.336  1.00119.04           C  
ATOM   5108  CD  LYS B 236      78.317  52.413  84.861  1.00119.28           C  
ATOM   5109  CE  LYS B 236      79.774  51.999  84.669  1.00118.31           C  
ATOM   5110  NZ  LYS B 236      80.120  51.861  83.227  1.00117.40           N  
ATOM   5111  N   ALA B 237      74.203  53.787  84.517  1.00114.60           N  
ATOM   5112  CA  ALA B 237      72.831  53.704  84.058  1.00113.27           C  
ATOM   5113  C   ALA B 237      72.209  52.349  84.381  1.00112.18           C  
ATOM   5114  O   ALA B 237      72.352  51.387  83.628  1.00112.36           O  
ATOM   5115  CB  ALA B 237      72.774  53.965  82.558  1.00113.22           C  
ATOM   5116  N   THR B 238      71.524  52.273  85.512  1.00111.04           N  
ATOM   5117  CA  THR B 238      70.860  51.037  85.902  1.00110.83           C  
ATOM   5118  C   THR B 238      69.631  50.931  85.009  1.00110.34           C  
ATOM   5119  O   THR B 238      69.142  51.945  84.522  1.00111.58           O  
ATOM   5120  CB  THR B 238      70.376  51.106  87.366  1.00111.71           C  
ATOM   5121  OG1 THR B 238      71.476  51.445  88.222  1.00111.97           O  
ATOM   5122  CG2 THR B 238      69.760  49.768  87.800  1.00111.15           C  
ATOM   5123  N   TYR B 239      69.129  49.722  84.786  1.00109.03           N  
ATOM   5124  CA  TYR B 239      67.935  49.554  83.963  1.00107.55           C  
ATOM   5125  C   TYR B 239      66.789  49.102  84.867  1.00106.53           C  
ATOM   5126  O   TYR B 239      66.957  48.205  85.692  1.00106.38           O  
ATOM   5127  CB  TYR B 239      68.182  48.518  82.865  1.00107.79           C  
ATOM   5128  CG  TYR B 239      67.032  48.345  81.895  1.00108.87           C  
ATOM   5129  CD1 TYR B 239      67.139  48.760  80.567  1.00108.86           C  
ATOM   5130  CD2 TYR B 239      65.832  47.750  82.300  1.00110.39           C  
ATOM   5131  CE1 TYR B 239      66.075  48.584  79.656  1.00109.18           C  
ATOM   5132  CE2 TYR B 239      64.761  47.571  81.398  1.00110.34           C  
ATOM   5133  CZ  TYR B 239      64.891  47.989  80.082  1.00109.51           C  
ATOM   5134  OH  TYR B 239      63.843  47.809  79.206  1.00107.97           O  
ATOM   5135  N   TRP B 240      65.627  49.728  84.720  1.00105.49           N  
ATOM   5136  CA  TRP B 240      64.477  49.370  85.540  1.00104.56           C  
ATOM   5137  C   TRP B 240      63.481  48.475  84.805  1.00103.85           C  
ATOM   5138  O   TRP B 240      63.170  47.377  85.275  1.00103.81           O  
ATOM   5139  CB  TRP B 240      63.769  50.636  86.070  1.00104.51           C  
ATOM   5140  CG  TRP B 240      62.455  50.366  86.798  1.00104.71           C  
ATOM   5141  CD1 TRP B 240      62.077  49.205  87.430  1.00105.41           C  
ATOM   5142  CD2 TRP B 240      61.352  51.266  86.939  1.00104.53           C  
ATOM   5143  NE1 TRP B 240      60.807  49.329  87.943  1.00104.34           N  
ATOM   5144  CE2 TRP B 240      60.337  50.583  87.657  1.00104.36           C  
ATOM   5145  CE3 TRP B 240      61.118  52.584  86.526  1.00104.85           C  
ATOM   5146  CZ2 TRP B 240      59.110  51.172  87.969  1.00104.03           C  
ATOM   5147  CZ3 TRP B 240      59.895  53.173  86.837  1.00104.96           C  
ATOM   5148  CH2 TRP B 240      58.906  52.462  87.552  1.00104.98           C  
ATOM   5149  N   GLY B 241      62.987  48.929  83.656  1.00102.52           N  
ATOM   5150  CA  GLY B 241      62.019  48.130  82.926  1.00101.08           C  
ATOM   5151  C   GLY B 241      60.635  48.316  83.525  1.00100.11           C  
ATOM   5152  O   GLY B 241      59.942  47.357  83.886  1.00 98.71           O  
ATOM   5153  N   GLY B 242      60.240  49.579  83.635  1.00 99.60           N  
ATOM   5154  CA  GLY B 242      58.944  49.906  84.185  1.00 98.27           C  
ATOM   5155  C   GLY B 242      57.962  50.247  83.092  1.00 97.32           C  
ATOM   5156  O   GLY B 242      58.316  50.365  81.926  1.00 96.63           O  
ATOM   5157  N   GLU B 243      56.711  50.404  83.483  1.00 97.61           N  
ATOM   5158  CA  GLU B 243      55.651  50.732  82.553  1.00 97.95           C  
ATOM   5159  C   GLU B 243      54.870  51.923  83.123  1.00 97.38           C  
ATOM   5160  O   GLU B 243      54.270  51.828  84.194  1.00 98.01           O  
ATOM   5161  CB  GLU B 243      54.765  49.496  82.359  1.00 98.60           C  
ATOM   5162  CG  GLU B 243      53.351  49.786  81.902  1.00101.63           C  
ATOM   5163  CD  GLU B 243      52.547  48.521  81.624  1.00103.81           C  
ATOM   5164  OE1 GLU B 243      52.645  47.554  82.418  1.00104.84           O  
ATOM   5165  OE2 GLU B 243      51.804  48.502  80.613  1.00104.45           O  
ATOM   5166  N   ILE B 244      54.911  53.045  82.406  1.00 96.12           N  
ATOM   5167  CA  ILE B 244      54.241  54.286  82.806  1.00 94.00           C  
ATOM   5168  C   ILE B 244      53.106  54.660  81.845  1.00 93.77           C  
ATOM   5169  O   ILE B 244      53.337  54.916  80.669  1.00 93.79           O  
ATOM   5170  CB  ILE B 244      55.250  55.452  82.830  1.00 92.39           C  
ATOM   5171  CG1 ILE B 244      56.327  55.187  83.884  1.00 89.20           C  
ATOM   5172  CG2 ILE B 244      54.518  56.766  83.059  1.00 92.16           C  
ATOM   5173  CD1 ILE B 244      57.478  56.150  83.820  1.00 86.07           C  
ATOM   5174  N   ARG B 245      51.882  54.714  82.347  1.00 93.84           N  
ATOM   5175  CA  ARG B 245      50.742  55.048  81.496  1.00 94.31           C  
ATOM   5176  C   ARG B 245      50.137  56.423  81.829  1.00 94.70           C  
ATOM   5177  O   ARG B 245      50.044  56.801  83.003  1.00 95.41           O  
ATOM   5178  CB  ARG B 245      49.665  53.968  81.635  1.00 93.58           C  
ATOM   5179  CG  ARG B 245      50.154  52.560  81.350  1.00 92.30           C  
ATOM   5180  CD  ARG B 245      49.145  51.522  81.823  1.00 92.06           C  
ATOM   5181  NE  ARG B 245      47.976  51.397  80.954  1.00 92.47           N  
ATOM   5182  CZ  ARG B 245      47.995  50.880  79.724  1.00 92.94           C  
ATOM   5183  NH1 ARG B 245      49.131  50.433  79.193  1.00 92.56           N  
ATOM   5184  NH2 ARG B 245      46.868  50.796  79.024  1.00 92.68           N  
ATOM   5185  N   GLU B 246      49.718  57.157  80.794  1.00 94.17           N  
ATOM   5186  CA  GLU B 246      49.120  58.488  80.967  1.00 92.72           C  
ATOM   5187  C   GLU B 246      47.779  58.661  80.252  1.00 91.27           C  
ATOM   5188  O   GLU B 246      47.730  58.906  79.045  1.00 91.82           O  
ATOM   5189  CB  GLU B 246      50.089  59.565  80.484  1.00 92.72           C  
ATOM   5190  CG  GLU B 246      49.490  60.949  80.456  1.00 95.07           C  
ATOM   5191  CD  GLU B 246      50.541  62.045  80.521  1.00 97.59           C  
ATOM   5192  OE1 GLU B 246      50.248  63.175  80.059  1.00 98.70           O  
ATOM   5193  OE2 GLU B 246      51.651  61.782  81.047  1.00 97.23           O  
ATOM   5194  N   GLN B 247      46.696  58.538  81.013  1.00 88.96           N  
ATOM   5195  CA  GLN B 247      45.345  58.675  80.483  1.00 86.77           C  
ATOM   5196  C   GLN B 247      45.030  60.162  80.422  1.00 86.38           C  
ATOM   5197  O   GLN B 247      44.930  60.814  81.461  1.00 86.06           O  
ATOM   5198  CB  GLN B 247      44.365  57.965  81.421  1.00 86.88           C  
ATOM   5199  CG  GLN B 247      42.907  58.083  81.048  1.00 86.53           C  
ATOM   5200  CD  GLN B 247      42.604  57.437  79.722  1.00 88.07           C  
ATOM   5201  OE1 GLN B 247      42.863  56.252  79.528  1.00 88.50           O  
ATOM   5202  NE2 GLN B 247      42.048  58.213  78.796  1.00 90.26           N  
ATOM   5203  N   ASN B 248      44.872  60.707  79.218  1.00 85.51           N  
ATOM   5204  CA  ASN B 248      44.590  62.132  79.096  1.00 84.34           C  
ATOM   5205  C   ASN B 248      43.499  62.517  78.103  1.00 85.54           C  
ATOM   5206  O   ASN B 248      43.307  63.696  77.810  1.00 84.96           O  
ATOM   5207  CB  ASN B 248      45.893  62.894  78.792  1.00 81.80           C  
ATOM   5208  CG  ASN B 248      46.476  62.560  77.432  1.00 78.63           C  
ATOM   5209  OD1 ASN B 248      47.641  62.854  77.157  1.00 75.52           O  
ATOM   5210  ND2 ASN B 248      45.667  61.961  76.570  1.00 77.47           N  
ATOM   5211  N   GLY B 249      42.782  61.532  77.580  1.00 87.66           N  
ATOM   5212  CA  GLY B 249      41.708  61.842  76.651  1.00 92.95           C  
ATOM   5213  C   GLY B 249      41.996  61.950  75.155  1.00 96.05           C  
ATOM   5214  O   GLY B 249      41.092  61.691  74.351  1.00 96.50           O  
ATOM   5215  N   HIS B 250      43.218  62.348  74.780  1.00 98.66           N  
ATOM   5216  CA  HIS B 250      43.628  62.471  73.369  1.00100.79           C  
ATOM   5217  C   HIS B 250      43.068  61.350  72.496  1.00101.19           C  
ATOM   5218  O   HIS B 250      43.141  60.172  72.865  1.00102.00           O  
ATOM   5219  CB  HIS B 250      45.137  62.403  73.257  1.00103.62           C  
ATOM   5220  CG  HIS B 250      45.773  63.677  72.823  1.00108.61           C  
ATOM   5221  ND1 HIS B 250      45.835  64.790  73.634  1.00110.48           N  
ATOM   5222  CD2 HIS B 250      46.426  64.002  71.680  1.00110.35           C  
ATOM   5223  CE1 HIS B 250      46.505  65.745  73.012  1.00112.21           C  
ATOM   5224  NE2 HIS B 250      46.876  65.293  71.825  1.00111.96           N  
ATOM   5225  N   SER B 251      42.535  61.699  71.329  1.00100.66           N  
ATOM   5226  CA  SER B 251      41.978  60.681  70.445  1.00 99.49           C  
ATOM   5227  C   SER B 251      43.106  59.788  69.924  1.00 98.56           C  
ATOM   5228  O   SER B 251      42.874  58.650  69.509  1.00 99.52           O  
ATOM   5229  CB  SER B 251      41.261  61.330  69.268  1.00 99.70           C  
ATOM   5230  OG  SER B 251      42.195  61.937  68.394  1.00101.82           O  
ATOM   5231  N   LEU B 252      44.332  60.302  69.955  1.00 96.25           N  
ATOM   5232  CA  LEU B 252      45.471  59.534  69.479  1.00 92.76           C  
ATOM   5233  C   LEU B 252      46.384  59.038  70.584  1.00 91.50           C  
ATOM   5234  O   LEU B 252      46.896  59.823  71.388  1.00 91.20           O  
ATOM   5235  CB  LEU B 252      46.286  60.363  68.497  1.00 91.85           C  
ATOM   5236  CG  LEU B 252      45.543  60.754  67.227  1.00 91.03           C  
ATOM   5237  CD1 LEU B 252      46.534  61.344  66.241  1.00 90.73           C  
ATOM   5238  CD2 LEU B 252      44.860  59.531  66.632  1.00 90.52           C  
ATOM   5239  N   VAL B 253      46.592  57.724  70.600  1.00 89.57           N  
ATOM   5240  CA  VAL B 253      47.456  57.075  71.579  1.00 87.69           C  
ATOM   5241  C   VAL B 253      48.872  56.884  71.055  1.00 86.62           C  
ATOM   5242  O   VAL B 253      49.072  56.337  69.968  1.00 86.71           O  
ATOM   5243  CB  VAL B 253      46.934  55.674  71.951  1.00 87.28           C  
ATOM   5244  CG1 VAL B 253      47.932  54.976  72.854  1.00 87.14           C  
ATOM   5245  CG2 VAL B 253      45.591  55.778  72.635  1.00 88.59           C  
ATOM   5246  N   HIS B 254      49.853  57.345  71.823  1.00 85.66           N  
ATOM   5247  CA  HIS B 254      51.255  57.161  71.458  1.00 84.80           C  
ATOM   5248  C   HIS B 254      51.795  56.070  72.372  1.00 85.26           C  
ATOM   5249  O   HIS B 254      51.508  56.062  73.567  1.00 85.81           O  
ATOM   5250  CB  HIS B 254      52.072  58.436  71.657  1.00 81.83           C  
ATOM   5251  CG  HIS B 254      51.858  59.461  70.591  1.00 80.34           C  
ATOM   5252  ND1 HIS B 254      52.888  60.211  70.064  1.00 80.10           N  
ATOM   5253  CD2 HIS B 254      50.735  59.866  69.954  1.00 79.92           C  
ATOM   5254  CE1 HIS B 254      52.410  61.032  69.147  1.00 79.19           C  
ATOM   5255  NE2 HIS B 254      51.105  60.843  69.061  1.00 79.71           N  
ATOM   5256  N   ALA B 255      52.556  55.140  71.810  1.00 85.47           N  
ATOM   5257  CA  ALA B 255      53.121  54.056  72.600  1.00 85.22           C  
ATOM   5258  C   ALA B 255      54.551  53.787  72.175  1.00 85.59           C  
ATOM   5259  O   ALA B 255      54.907  53.919  70.999  1.00 85.61           O  
ATOM   5260  CB  ALA B 255      52.288  52.799  72.449  1.00 85.00           C  
ATOM   5261  N   ALA B 256      55.371  53.422  73.150  1.00 85.42           N  
ATOM   5262  CA  ALA B 256      56.767  53.128  72.893  1.00 85.34           C  
ATOM   5263  C   ALA B 256      57.202  51.983  73.795  1.00 85.31           C  
ATOM   5264  O   ALA B 256      57.194  52.115  75.014  1.00 85.99           O  
ATOM   5265  CB  ALA B 256      57.620  54.364  73.150  1.00 84.43           C  
ATOM   5266  N   VAL B 257      57.560  50.856  73.187  1.00 85.29           N  
ATOM   5267  CA  VAL B 257      58.013  49.694  73.929  1.00 84.42           C  
ATOM   5268  C   VAL B 257      59.454  49.464  73.544  1.00 85.06           C  
ATOM   5269  O   VAL B 257      59.759  49.356  72.360  1.00 85.25           O  
ATOM   5270  CB  VAL B 257      57.196  48.458  73.568  1.00 83.27           C  
ATOM   5271  CG1 VAL B 257      57.773  47.258  74.254  1.00 83.44           C  
ATOM   5272  CG2 VAL B 257      55.753  48.648  73.990  1.00 83.23           C  
ATOM   5273  N   VAL B 258      60.343  49.412  74.528  1.00 86.31           N  
ATOM   5274  CA  VAL B 258      61.749  49.191  74.227  1.00 89.44           C  
ATOM   5275  C   VAL B 258      62.450  48.230  75.178  1.00 91.87           C  
ATOM   5276  O   VAL B 258      61.872  47.750  76.151  1.00 92.63           O  
ATOM   5277  CB  VAL B 258      62.549  50.513  74.219  1.00 89.29           C  
ATOM   5278  CG1 VAL B 258      61.941  51.482  73.225  1.00 88.11           C  
ATOM   5279  CG2 VAL B 258      62.596  51.103  75.619  1.00 89.04           C  
ATOM   5280  N   THR B 259      63.711  47.952  74.866  1.00 94.25           N  
ATOM   5281  CA  THR B 259      64.551  47.068  75.660  1.00 96.21           C  
ATOM   5282  C   THR B 259      65.934  47.691  75.649  1.00 97.46           C  
ATOM   5283  O   THR B 259      66.226  48.536  74.800  1.00 97.02           O  
ATOM   5284  CB  THR B 259      64.631  45.663  75.036  1.00 96.48           C  
ATOM   5285  OG1 THR B 259      63.348  45.030  75.129  1.00 95.71           O  
ATOM   5286  CG2 THR B 259      65.688  44.810  75.752  1.00 96.83           C  
ATOM   5287  N   GLU B 260      66.785  47.294  76.586  1.00 98.87           N  
ATOM   5288  CA  GLU B 260      68.117  47.855  76.618  1.00100.98           C  
ATOM   5289  C   GLU B 260      68.809  47.425  75.343  1.00101.33           C  
ATOM   5290  O   GLU B 260      68.893  46.236  75.049  1.00102.62           O  
ATOM   5291  CB  GLU B 260      68.877  47.346  77.831  1.00103.27           C  
ATOM   5292  CG  GLU B 260      70.158  48.114  78.110  1.00107.81           C  
ATOM   5293  CD  GLU B 260      70.459  48.210  79.606  1.00110.77           C  
ATOM   5294  OE1 GLU B 260      70.483  47.152  80.281  1.00111.74           O  
ATOM   5295  OE2 GLU B 260      70.670  49.343  80.106  1.00112.09           O  
ATOM   5296  N   GLY B 261      69.281  48.396  74.572  1.00101.38           N  
ATOM   5297  CA  GLY B 261      69.954  48.087  73.325  1.00100.11           C  
ATOM   5298  C   GLY B 261      71.440  48.351  73.433  1.00 99.67           C  
ATOM   5299  O   GLY B 261      72.039  48.144  74.488  1.00 99.79           O  
ATOM   5300  N   ALA B 262      72.034  48.833  72.349  1.00 98.91           N  
ATOM   5301  CA  ALA B 262      73.460  49.112  72.331  1.00 98.47           C  
ATOM   5302  C   ALA B 262      73.776  50.506  72.848  1.00 98.33           C  
ATOM   5303  O   ALA B 262      72.903  51.370  72.919  1.00 97.86           O  
ATOM   5304  CB  ALA B 262      74.000  48.948  70.914  1.00 98.28           C  
ATOM   5305  N   ALA B 263      75.041  50.708  73.212  1.00 98.77           N  
ATOM   5306  CA  ALA B 263      75.524  51.987  73.710  1.00 98.68           C  
ATOM   5307  C   ALA B 263      76.449  52.588  72.660  1.00 99.41           C  
ATOM   5308  O   ALA B 263      76.913  51.890  71.763  1.00 98.02           O  
ATOM   5309  CB  ALA B 263      76.272  51.785  75.005  1.00 97.57           C  
ATOM   5310  N   VAL B 264      76.707  53.887  72.769  1.00101.84           N  
ATOM   5311  CA  VAL B 264      77.583  54.566  71.816  1.00104.39           C  
ATOM   5312  C   VAL B 264      78.855  53.745  71.666  1.00105.74           C  
ATOM   5313  O   VAL B 264      79.313  53.134  72.633  1.00106.30           O  
ATOM   5314  CB  VAL B 264      77.997  55.977  72.305  1.00104.56           C  
ATOM   5315  CG1 VAL B 264      78.757  56.700  71.192  1.00103.79           C  
ATOM   5316  CG2 VAL B 264      76.771  56.774  72.758  1.00104.40           C  
ATOM   5317  N   GLY B 265      79.420  53.734  70.461  1.00106.88           N  
ATOM   5318  CA  GLY B 265      80.641  52.981  70.220  1.00108.24           C  
ATOM   5319  C   GLY B 265      80.580  51.475  70.475  1.00109.31           C  
ATOM   5320  O   GLY B 265      81.618  50.832  70.662  1.00109.33           O  
ATOM   5321  N   SER B 266      79.376  50.904  70.489  1.00109.65           N  
ATOM   5322  CA  SER B 266      79.225  49.469  70.716  1.00108.99           C  
ATOM   5323  C   SER B 266      79.265  48.748  69.371  1.00109.37           C  
ATOM   5324  O   SER B 266      78.867  49.296  68.341  1.00108.58           O  
ATOM   5325  CB  SER B 266      77.903  49.170  71.443  1.00108.21           C  
ATOM   5326  OG  SER B 266      77.778  47.795  71.785  1.00106.89           O  
ATOM   5327  N   ALA B 267      79.763  47.519  69.389  1.00110.64           N  
ATOM   5328  CA  ALA B 267      79.862  46.715  68.179  1.00112.03           C  
ATOM   5329  C   ALA B 267      78.470  46.281  67.763  1.00112.68           C  
ATOM   5330  O   ALA B 267      78.183  46.081  66.580  1.00112.28           O  
ATOM   5331  CB  ALA B 267      80.728  45.494  68.441  1.00112.38           C  
ATOM   5332  N   GLU B 268      77.611  46.145  68.764  1.00113.73           N  
ATOM   5333  CA  GLU B 268      76.230  45.728  68.567  1.00115.32           C  
ATOM   5334  C   GLU B 268      75.350  46.899  68.071  1.00114.74           C  
ATOM   5335  O   GLU B 268      74.222  46.691  67.605  1.00114.71           O  
ATOM   5336  CB  GLU B 268      75.708  45.166  69.898  1.00117.48           C  
ATOM   5337  CG  GLU B 268      74.423  44.349  69.816  1.00120.08           C  
ATOM   5338  CD  GLU B 268      74.073  43.685  71.150  1.00121.37           C  
ATOM   5339  OE1 GLU B 268      74.044  44.400  72.184  1.00120.89           O  
ATOM   5340  OE2 GLU B 268      73.824  42.452  71.156  1.00122.24           O  
ATOM   5341  N   ALA B 269      75.883  48.121  68.166  1.00113.29           N  
ATOM   5342  CA  ALA B 269      75.182  49.340  67.743  1.00110.90           C  
ATOM   5343  C   ALA B 269      74.812  49.311  66.264  1.00109.13           C  
ATOM   5344  O   ALA B 269      73.644  49.456  65.901  1.00109.10           O  
ATOM   5345  CB  ALA B 269      76.055  50.569  68.029  1.00110.90           C  
ATOM   5346  N   ASN B 270      75.826  49.135  65.424  1.00106.40           N  
ATOM   5347  CA  ASN B 270      75.655  49.081  63.982  1.00103.44           C  
ATOM   5348  C   ASN B 270      74.645  48.006  63.617  1.00101.39           C  
ATOM   5349  O   ASN B 270      73.974  48.094  62.597  1.00101.09           O  
ATOM   5350  CB  ASN B 270      76.995  48.765  63.328  1.00104.38           C  
ATOM   5351  CG  ASN B 270      78.105  49.670  63.812  1.00104.65           C  
ATOM   5352  OD1 ASN B 270      78.262  50.786  63.324  1.00105.14           O  
ATOM   5353  ND2 ASN B 270      78.872  49.198  64.791  1.00104.00           N  
ATOM   5354  N   ALA B 271      74.548  46.983  64.453  1.00 99.54           N  
ATOM   5355  CA  ALA B 271      73.620  45.887  64.211  1.00 99.30           C  
ATOM   5356  C   ALA B 271      72.179  46.355  64.348  1.00 98.94           C  
ATOM   5357  O   ALA B 271      71.331  46.067  63.500  1.00 98.58           O  
ATOM   5358  CB  ALA B 271      73.893  44.755  65.191  1.00100.19           C  
ATOM   5359  N   PHE B 272      71.910  47.070  65.436  1.00 98.98           N  
ATOM   5360  CA  PHE B 272      70.578  47.601  65.715  1.00 97.84           C  
ATOM   5361  C   PHE B 272      70.167  48.660  64.698  1.00 97.00           C  
ATOM   5362  O   PHE B 272      69.073  48.610  64.125  1.00 96.31           O  
ATOM   5363  CB  PHE B 272      70.545  48.192  67.120  1.00 96.84           C  
ATOM   5364  CG  PHE B 272      70.305  47.175  68.183  1.00 97.14           C  
ATOM   5365  CD1 PHE B 272      71.290  46.871  69.114  1.00 97.38           C  
ATOM   5366  CD2 PHE B 272      69.080  46.518  68.260  1.00 96.74           C  
ATOM   5367  CE1 PHE B 272      71.054  45.924  70.117  1.00 97.67           C  
ATOM   5368  CE2 PHE B 272      68.834  45.572  69.254  1.00 96.93           C  
ATOM   5369  CZ  PHE B 272      69.822  45.273  70.185  1.00 97.03           C  
ATOM   5370  N   SER B 273      71.056  49.624  64.488  1.00 95.76           N  
ATOM   5371  CA  SER B 273      70.814  50.686  63.535  1.00 94.07           C  
ATOM   5372  C   SER B 273      70.302  50.040  62.256  1.00 93.87           C  
ATOM   5373  O   SER B 273      69.410  50.570  61.600  1.00 95.11           O  
ATOM   5374  CB  SER B 273      72.114  51.447  63.274  1.00 93.33           C  
ATOM   5375  OG  SER B 273      72.711  51.844  64.503  1.00 91.99           O  
ATOM   5376  N   VAL B 274      70.851  48.878  61.918  1.00 93.13           N  
ATOM   5377  CA  VAL B 274      70.431  48.173  60.720  1.00 92.17           C  
ATOM   5378  C   VAL B 274      69.075  47.522  60.914  1.00 91.86           C  
ATOM   5379  O   VAL B 274      68.214  47.625  60.048  1.00 91.26           O  
ATOM   5380  CB  VAL B 274      71.451  47.106  60.303  1.00 91.84           C  
ATOM   5381  CG1 VAL B 274      70.891  46.274  59.172  1.00 91.15           C  
ATOM   5382  CG2 VAL B 274      72.742  47.778  59.860  1.00 91.84           C  
ATOM   5383  N   LEU B 275      68.879  46.845  62.040  1.00 92.85           N  
ATOM   5384  CA  LEU B 275      67.585  46.218  62.294  1.00 94.20           C  
ATOM   5385  C   LEU B 275      66.534  47.317  62.322  1.00 95.69           C  
ATOM   5386  O   LEU B 275      65.337  47.070  62.121  1.00 96.09           O  
ATOM   5387  CB  LEU B 275      67.564  45.481  63.633  1.00 92.95           C  
ATOM   5388  CG  LEU B 275      66.131  45.110  64.045  1.00 92.62           C  
ATOM   5389  CD1 LEU B 275      65.531  44.141  63.045  1.00 91.69           C  
ATOM   5390  CD2 LEU B 275      66.122  44.501  65.420  1.00 93.24           C  
ATOM   5391  N   GLN B 276      66.992  48.536  62.586  1.00 96.53           N  
ATOM   5392  CA  GLN B 276      66.105  49.687  62.624  1.00 96.79           C  
ATOM   5393  C   GLN B 276      65.535  49.857  61.218  1.00 96.55           C  
ATOM   5394  O   GLN B 276      64.354  49.607  60.976  1.00 96.62           O  
ATOM   5395  CB  GLN B 276      66.884  50.939  63.031  1.00 97.08           C  
ATOM   5396  CG  GLN B 276      66.013  52.140  63.340  1.00 97.73           C  
ATOM   5397  CD  GLN B 276      66.815  53.369  63.735  1.00 98.88           C  
ATOM   5398  OE1 GLN B 276      66.248  54.377  64.176  1.00 99.22           O  
ATOM   5399  NE2 GLN B 276      68.138  53.298  63.575  1.00 98.86           N  
ATOM   5400  N   HIS B 277      66.388  50.259  60.286  1.00 96.09           N  
ATOM   5401  CA  HIS B 277      65.963  50.455  58.912  1.00 96.42           C  
ATOM   5402  C   HIS B 277      65.231  49.252  58.328  1.00 94.64           C  
ATOM   5403  O   HIS B 277      64.373  49.392  57.465  1.00 93.52           O  
ATOM   5404  CB  HIS B 277      67.176  50.815  58.061  1.00 99.74           C  
ATOM   5405  CG  HIS B 277      67.691  52.194  58.324  1.00103.68           C  
ATOM   5406  ND1 HIS B 277      67.003  53.329  57.943  1.00106.00           N  
ATOM   5407  CD2 HIS B 277      68.800  52.627  58.970  1.00105.05           C  
ATOM   5408  CE1 HIS B 277      67.666  54.400  58.342  1.00106.36           C  
ATOM   5409  NE2 HIS B 277      68.760  54.002  58.968  1.00106.73           N  
ATOM   5410  N   VAL B 278      65.563  48.064  58.801  1.00 94.03           N  
ATOM   5411  CA  VAL B 278      64.908  46.868  58.304  1.00 93.74           C  
ATOM   5412  C   VAL B 278      63.452  46.878  58.742  1.00 94.14           C  
ATOM   5413  O   VAL B 278      62.549  46.649  57.937  1.00 93.99           O  
ATOM   5414  CB  VAL B 278      65.594  45.597  58.840  1.00 93.39           C  
ATOM   5415  CG1 VAL B 278      64.767  44.365  58.483  1.00 93.17           C  
ATOM   5416  CG2 VAL B 278      66.998  45.487  58.259  1.00 91.59           C  
ATOM   5417  N   LEU B 279      63.230  47.140  60.026  1.00 94.70           N  
ATOM   5418  CA  LEU B 279      61.877  47.185  60.572  1.00 94.99           C  
ATOM   5419  C   LEU B 279      61.170  48.410  60.015  1.00 95.02           C  
ATOM   5420  O   LEU B 279      59.949  48.430  59.845  1.00 93.83           O  
ATOM   5421  CB  LEU B 279      61.934  47.236  62.103  1.00 94.13           C  
ATOM   5422  CG  LEU B 279      62.141  45.871  62.768  1.00 93.70           C  
ATOM   5423  CD1 LEU B 279      62.727  46.041  64.154  1.00 93.57           C  
ATOM   5424  CD2 LEU B 279      60.812  45.124  62.820  1.00 92.77           C  
ATOM   5425  N   GLY B 280      61.970  49.426  59.718  1.00 96.19           N  
ATOM   5426  CA  GLY B 280      61.448  50.660  59.166  1.00 97.97           C  
ATOM   5427  C   GLY B 280      61.490  51.821  60.141  1.00 98.63           C  
ATOM   5428  O   GLY B 280      60.963  51.726  61.249  1.00 99.97           O  
ATOM   5429  N   ALA B 281      62.119  52.920  59.741  1.00 98.60           N  
ATOM   5430  CA  ALA B 281      62.188  54.089  60.602  1.00 98.66           C  
ATOM   5431  C   ALA B 281      62.166  55.376  59.780  1.00 99.25           C  
ATOM   5432  O   ALA B 281      63.215  55.866  59.349  1.00100.12           O  
ATOM   5433  CB  ALA B 281      63.437  54.031  61.455  1.00 97.89           C  
ATOM   5434  N   GLY B 282      60.965  55.913  59.557  1.00 98.73           N  
ATOM   5435  CA  GLY B 282      60.826  57.151  58.804  1.00 97.91           C  
ATOM   5436  C   GLY B 282      60.566  56.961  57.323  1.00 96.83           C  
ATOM   5437  O   GLY B 282      61.278  56.193  56.679  1.00 97.62           O  
ATOM   5438  N   PRO B 283      59.562  57.654  56.747  1.00 95.48           N  
ATOM   5439  CA  PRO B 283      59.224  57.542  55.321  1.00 94.36           C  
ATOM   5440  C   PRO B 283      60.167  58.308  54.386  1.00 93.52           C  
ATOM   5441  O   PRO B 283      60.762  59.320  54.771  1.00 91.70           O  
ATOM   5442  CB  PRO B 283      57.793  58.066  55.277  1.00 94.30           C  
ATOM   5443  CG  PRO B 283      57.830  59.140  56.302  1.00 93.33           C  
ATOM   5444  CD  PRO B 283      58.581  58.503  57.446  1.00 93.76           C  
ATOM   5445  N   LEU B 284      60.298  57.818  53.155  1.00 93.18           N  
ATOM   5446  CA  LEU B 284      61.181  58.452  52.184  1.00 93.20           C  
ATOM   5447  C   LEU B 284      60.382  59.017  51.023  1.00 92.73           C  
ATOM   5448  O   LEU B 284      60.920  59.735  50.169  1.00 92.77           O  
ATOM   5449  CB  LEU B 284      62.205  57.439  51.655  1.00 94.92           C  
ATOM   5450  CG  LEU B 284      62.966  56.552  52.656  1.00 95.96           C  
ATOM   5451  CD1 LEU B 284      64.174  55.938  51.970  1.00 96.20           C  
ATOM   5452  CD2 LEU B 284      63.432  57.364  53.854  1.00 97.51           C  
ATOM   5453  N   ILE B 285      59.093  58.686  51.002  1.00 91.69           N  
ATOM   5454  CA  ILE B 285      58.183  59.149  49.956  1.00 90.64           C  
ATOM   5455  C   ILE B 285      56.999  59.910  50.558  1.00 90.14           C  
ATOM   5456  O   ILE B 285      56.234  59.353  51.345  1.00 90.49           O  
ATOM   5457  CB  ILE B 285      57.657  57.955  49.137  1.00 89.91           C  
ATOM   5458  CG1 ILE B 285      58.828  57.257  48.449  1.00 89.32           C  
ATOM   5459  CG2 ILE B 285      56.654  58.423  48.106  1.00 89.75           C  
ATOM   5460  CD1 ILE B 285      58.440  55.987  47.750  1.00 89.50           C  
ATOM   5461  N   LYS B 286      56.855  61.180  50.178  1.00 89.34           N  
ATOM   5462  CA  LYS B 286      55.776  62.044  50.676  1.00 89.32           C  
ATOM   5463  C   LYS B 286      54.371  61.442  50.533  1.00 89.65           C  
ATOM   5464  O   LYS B 286      53.941  61.089  49.437  1.00 89.50           O  
ATOM   5465  CB  LYS B 286      55.831  63.403  49.963  1.00 88.19           C  
ATOM   5466  CG  LYS B 286      54.776  64.396  50.426  1.00 87.80           C  
ATOM   5467  CD  LYS B 286      54.949  65.774  49.792  1.00 86.63           C  
ATOM   5468  CE  LYS B 286      53.864  66.728  50.274  1.00 85.56           C  
ATOM   5469  NZ  LYS B 286      54.022  68.093  49.728  1.00 84.84           N  
ATOM   5470  N   ARG B 287      53.653  61.337  51.647  1.00 90.21           N  
ATOM   5471  CA  ARG B 287      52.308  60.768  51.630  1.00 91.74           C  
ATOM   5472  C   ARG B 287      52.348  59.349  51.095  1.00 93.03           C  
ATOM   5473  O   ARG B 287      51.319  58.774  50.720  1.00 93.31           O  
ATOM   5474  CB  ARG B 287      51.368  61.584  50.738  1.00 91.22           C  
ATOM   5475  CG  ARG B 287      51.154  63.013  51.172  1.00 89.97           C  
ATOM   5476  CD  ARG B 287      49.799  63.531  50.719  1.00 87.87           C  
ATOM   5477  NE  ARG B 287      49.759  64.983  50.799  1.00 86.37           N  
ATOM   5478  CZ  ARG B 287      50.470  65.783  50.013  1.00 85.89           C  
ATOM   5479  NH1 ARG B 287      51.262  65.270  49.089  1.00 85.74           N  
ATOM   5480  NH2 ARG B 287      50.409  67.094  50.165  1.00 86.79           N  
ATOM   5481  N   GLY B 288      53.537  58.778  51.051  1.00 94.27           N  
ATOM   5482  CA  GLY B 288      53.645  57.438  50.530  1.00 96.03           C  
ATOM   5483  C   GLY B 288      53.605  56.360  51.584  1.00 97.03           C  
ATOM   5484  O   GLY B 288      53.715  56.628  52.785  1.00 97.11           O  
ATOM   5485  N   SER B 289      53.421  55.132  51.104  1.00 98.17           N  
ATOM   5486  CA  SER B 289      53.396  53.929  51.929  1.00 99.09           C  
ATOM   5487  C   SER B 289      54.837  53.450  51.998  1.00 99.98           C  
ATOM   5488  O   SER B 289      55.631  53.729  51.092  1.00101.37           O  
ATOM   5489  CB  SER B 289      52.541  52.838  51.270  1.00 98.65           C  
ATOM   5490  OG  SER B 289      52.723  51.588  51.917  1.00 97.70           O  
ATOM   5491  N   SER B 290      55.192  52.739  53.059  1.00100.02           N  
ATOM   5492  CA  SER B 290      56.555  52.245  53.160  1.00100.44           C  
ATOM   5493  C   SER B 290      56.538  50.728  53.066  1.00100.46           C  
ATOM   5494  O   SER B 290      56.155  50.039  54.011  1.00100.19           O  
ATOM   5495  CB  SER B 290      57.199  52.707  54.473  1.00100.86           C  
ATOM   5496  OG  SER B 290      57.322  54.122  54.506  1.00101.25           O  
ATOM   5497  N   VAL B 291      56.934  50.214  51.905  1.00100.84           N  
ATOM   5498  CA  VAL B 291      56.965  48.772  51.674  1.00101.02           C  
ATOM   5499  C   VAL B 291      58.245  48.185  52.281  1.00101.63           C  
ATOM   5500  O   VAL B 291      58.238  47.088  52.853  1.00 99.89           O  
ATOM   5501  CB  VAL B 291      56.930  48.455  50.165  1.00100.45           C  
ATOM   5502  CG1 VAL B 291      56.454  47.023  49.956  1.00 99.52           C  
ATOM   5503  CG2 VAL B 291      56.037  49.451  49.438  1.00 98.59           C  
ATOM   5504  N   THR B 292      59.334  48.943  52.149  1.00102.78           N  
ATOM   5505  CA  THR B 292      60.647  48.572  52.676  1.00104.36           C  
ATOM   5506  C   THR B 292      60.656  48.594  54.206  1.00105.34           C  
ATOM   5507  O   THR B 292      61.690  48.346  54.837  1.00105.65           O  
ATOM   5508  CB  THR B 292      61.722  49.542  52.165  1.00104.74           C  
ATOM   5509  OG1 THR B 292      61.738  49.496  50.733  1.00105.46           O  
ATOM   5510  CG2 THR B 292      63.106  49.180  52.721  1.00104.79           C  
ATOM   5511  N   SER B 293      59.501  48.910  54.791  1.00106.06           N  
ATOM   5512  CA  SER B 293      59.334  48.949  56.243  1.00104.99           C  
ATOM   5513  C   SER B 293      58.425  47.783  56.634  1.00104.54           C  
ATOM   5514  O   SER B 293      57.207  47.799  56.397  1.00103.16           O  
ATOM   5515  CB  SER B 293      58.715  50.280  56.686  1.00104.62           C  
ATOM   5516  OG  SER B 293      58.618  50.356  58.099  1.00103.60           O  
ATOM   5517  N   LYS B 294      59.042  46.761  57.214  1.00104.14           N  
ATOM   5518  CA  LYS B 294      58.322  45.573  57.629  1.00103.88           C  
ATOM   5519  C   LYS B 294      57.348  45.936  58.731  1.00102.75           C  
ATOM   5520  O   LYS B 294      56.176  45.563  58.695  1.00102.15           O  
ATOM   5521  CB  LYS B 294      59.306  44.516  58.136  1.00104.80           C  
ATOM   5522  CG  LYS B 294      60.359  44.119  57.113  1.00106.09           C  
ATOM   5523  CD  LYS B 294      60.700  42.641  57.227  1.00107.00           C  
ATOM   5524  CE  LYS B 294      61.530  42.180  56.042  1.00107.89           C  
ATOM   5525  NZ  LYS B 294      61.702  40.696  56.021  1.00108.70           N  
ATOM   5526  N   LEU B 295      57.852  46.679  59.707  1.00101.67           N  
ATOM   5527  CA  LEU B 295      57.053  47.099  60.844  1.00100.36           C  
ATOM   5528  C   LEU B 295      55.810  47.829  60.375  1.00 99.63           C  
ATOM   5529  O   LEU B 295      54.696  47.502  60.786  1.00 98.44           O  
ATOM   5530  CB  LEU B 295      57.889  47.996  61.746  1.00100.02           C  
ATOM   5531  CG  LEU B 295      57.271  48.394  63.081  1.00100.34           C  
ATOM   5532  CD1 LEU B 295      56.671  47.180  63.797  1.00 99.23           C  
ATOM   5533  CD2 LEU B 295      58.358  49.064  63.914  1.00100.50           C  
ATOM   5534  N   TYR B 296      56.012  48.814  59.504  1.00 99.91           N  
ATOM   5535  CA  TYR B 296      54.909  49.603  58.951  1.00 99.70           C  
ATOM   5536  C   TYR B 296      53.943  48.651  58.254  1.00 98.56           C  
ATOM   5537  O   TYR B 296      52.795  48.481  58.672  1.00 96.26           O  
ATOM   5538  CB  TYR B 296      55.444  50.627  57.931  1.00101.11           C  
ATOM   5539  CG  TYR B 296      54.483  51.760  57.607  1.00102.43           C  
ATOM   5540  CD1 TYR B 296      53.167  51.502  57.221  1.00103.11           C  
ATOM   5541  CD2 TYR B 296      54.884  53.093  57.727  1.00103.35           C  
ATOM   5542  CE1 TYR B 296      52.270  52.543  56.969  1.00104.89           C  
ATOM   5543  CE2 TYR B 296      53.995  54.144  57.477  1.00104.88           C  
ATOM   5544  CZ  TYR B 296      52.688  53.864  57.102  1.00105.31           C  
ATOM   5545  OH  TYR B 296      51.794  54.900  56.888  1.00105.84           O  
ATOM   5546  N   GLN B 297      54.444  48.037  57.186  1.00 98.39           N  
ATOM   5547  CA  GLN B 297      53.684  47.095  56.382  1.00 98.46           C  
ATOM   5548  C   GLN B 297      52.940  46.070  57.223  1.00 99.14           C  
ATOM   5549  O   GLN B 297      51.833  45.651  56.877  1.00 98.66           O  
ATOM   5550  CB  GLN B 297      54.618  46.372  55.415  1.00 98.19           C  
ATOM   5551  CG  GLN B 297      55.015  47.179  54.195  1.00 97.08           C  
ATOM   5552  CD  GLN B 297      53.816  47.633  53.395  1.00 95.56           C  
ATOM   5553  OE1 GLN B 297      52.762  46.997  53.419  1.00 94.52           O  
ATOM   5554  NE2 GLN B 297      53.973  48.733  52.670  1.00 95.11           N  
ATOM   5555  N   GLY B 298      53.557  45.655  58.322  1.00100.31           N  
ATOM   5556  CA  GLY B 298      52.923  44.677  59.183  1.00101.24           C  
ATOM   5557  C   GLY B 298      51.692  45.260  59.846  1.00101.57           C  
ATOM   5558  O   GLY B 298      50.599  44.686  59.787  1.00101.17           O  
ATOM   5559  N   VAL B 299      51.876  46.416  60.475  1.00101.81           N  
ATOM   5560  CA  VAL B 299      50.790  47.089  61.167  1.00102.22           C  
ATOM   5561  C   VAL B 299      49.703  47.500  60.178  1.00103.16           C  
ATOM   5562  O   VAL B 299      48.513  47.503  60.505  1.00102.63           O  
ATOM   5563  CB  VAL B 299      51.310  48.333  61.903  1.00101.63           C  
ATOM   5564  CG1 VAL B 299      50.195  48.963  62.719  1.00101.70           C  
ATOM   5565  CG2 VAL B 299      52.472  47.949  62.796  1.00101.50           C  
ATOM   5566  N   ALA B 300      50.119  47.844  58.964  1.00104.12           N  
ATOM   5567  CA  ALA B 300      49.176  48.249  57.933  1.00104.83           C  
ATOM   5568  C   ALA B 300      48.154  47.142  57.728  1.00105.48           C  
ATOM   5569  O   ALA B 300      46.949  47.387  57.726  1.00104.76           O  
ATOM   5570  CB  ALA B 300      49.918  48.539  56.627  1.00105.00           C  
ATOM   5571  N   LYS B 301      48.646  45.918  57.566  1.00107.31           N  
ATOM   5572  CA  LYS B 301      47.775  44.770  57.358  1.00110.10           C  
ATOM   5573  C   LYS B 301      46.861  44.560  58.568  1.00111.44           C  
ATOM   5574  O   LYS B 301      45.723  44.095  58.434  1.00111.27           O  
ATOM   5575  CB  LYS B 301      48.615  43.512  57.119  1.00110.62           C  
ATOM   5576  CG  LYS B 301      49.671  43.656  56.025  1.00112.69           C  
ATOM   5577  CD  LYS B 301      50.374  42.326  55.753  1.00114.55           C  
ATOM   5578  CE  LYS B 301      51.571  42.484  54.810  1.00115.65           C  
ATOM   5579  NZ  LYS B 301      51.211  42.945  53.432  1.00115.96           N  
ATOM   5580  N   ALA B 302      47.364  44.927  59.744  1.00112.70           N  
ATOM   5581  CA  ALA B 302      46.630  44.770  60.999  1.00113.45           C  
ATOM   5582  C   ALA B 302      45.405  45.671  61.154  1.00114.15           C  
ATOM   5583  O   ALA B 302      44.293  45.178  61.343  1.00114.08           O  
ATOM   5584  CB  ALA B 302      47.577  44.977  62.171  1.00113.82           C  
ATOM   5585  N   THR B 303      45.611  46.985  61.090  1.00115.23           N  
ATOM   5586  CA  THR B 303      44.512  47.944  61.230  1.00116.01           C  
ATOM   5587  C   THR B 303      44.019  48.474  59.882  1.00116.61           C  
ATOM   5588  O   THR B 303      44.588  48.166  58.829  1.00116.89           O  
ATOM   5589  CB  THR B 303      44.926  49.157  62.102  1.00116.48           C  
ATOM   5590  OG1 THR B 303      43.796  50.023  62.294  1.00116.18           O  
ATOM   5591  CG2 THR B 303      46.066  49.940  61.433  1.00116.50           C  
ATOM   5592  N   THR B 304      42.963  49.283  59.927  1.00117.14           N  
ATOM   5593  CA  THR B 304      42.375  49.862  58.718  1.00117.07           C  
ATOM   5594  C   THR B 304      42.457  51.386  58.727  1.00116.37           C  
ATOM   5595  O   THR B 304      42.567  52.028  57.678  1.00115.87           O  
ATOM   5596  CB  THR B 304      40.898  49.485  58.599  1.00117.26           C  
ATOM   5597  OG1 THR B 304      40.729  48.114  58.980  1.00117.68           O  
ATOM   5598  CG2 THR B 304      40.418  49.683  57.161  1.00117.06           C  
ATOM   5599  N   GLN B 305      42.399  51.953  59.926  1.00115.48           N  
ATOM   5600  CA  GLN B 305      42.445  53.394  60.103  1.00114.33           C  
ATOM   5601  C   GLN B 305      43.873  53.907  60.163  1.00112.59           C  
ATOM   5602  O   GLN B 305      44.812  53.136  60.344  1.00111.54           O  
ATOM   5603  CB  GLN B 305      41.722  53.781  61.394  1.00116.09           C  
ATOM   5604  CG  GLN B 305      40.318  53.198  61.538  1.00116.71           C  
ATOM   5605  CD  GLN B 305      39.403  53.580  60.395  1.00116.79           C  
ATOM   5606  OE1 GLN B 305      39.149  54.765  60.148  1.00115.84           O  
ATOM   5607  NE2 GLN B 305      38.901  52.574  59.685  1.00116.99           N  
ATOM   5608  N   PRO B 306      44.048  55.230  60.009  1.00111.47           N  
ATOM   5609  CA  PRO B 306      45.351  55.897  60.044  1.00109.87           C  
ATOM   5610  C   PRO B 306      46.156  55.596  61.297  1.00107.53           C  
ATOM   5611  O   PRO B 306      45.601  55.371  62.378  1.00106.75           O  
ATOM   5612  CB  PRO B 306      44.981  57.370  59.922  1.00110.70           C  
ATOM   5613  CG  PRO B 306      43.841  57.313  58.969  1.00111.96           C  
ATOM   5614  CD  PRO B 306      43.012  56.170  59.547  1.00112.02           C  
ATOM   5615  N   PHE B 307      47.475  55.611  61.127  1.00104.98           N  
ATOM   5616  CA  PHE B 307      48.408  55.317  62.202  1.00102.56           C  
ATOM   5617  C   PHE B 307      49.824  55.567  61.706  1.00 99.96           C  
ATOM   5618  O   PHE B 307      50.044  56.024  60.586  1.00 99.48           O  
ATOM   5619  CB  PHE B 307      48.302  53.841  62.568  1.00104.59           C  
ATOM   5620  CG  PHE B 307      48.929  52.930  61.545  1.00107.23           C  
ATOM   5621  CD1 PHE B 307      50.256  52.518  61.675  1.00108.18           C  
ATOM   5622  CD2 PHE B 307      48.228  52.559  60.401  1.00108.69           C  
ATOM   5623  CE1 PHE B 307      50.876  51.755  60.680  1.00108.19           C  
ATOM   5624  CE2 PHE B 307      48.841  51.796  59.398  1.00108.87           C  
ATOM   5625  CZ  PHE B 307      50.168  51.396  59.541  1.00108.44           C  
ATOM   5626  N   ASP B 308      50.784  55.251  62.558  1.00 97.33           N  
ATOM   5627  CA  ASP B 308      52.180  55.356  62.196  1.00 96.44           C  
ATOM   5628  C   ASP B 308      52.957  54.498  63.171  1.00 95.88           C  
ATOM   5629  O   ASP B 308      52.621  54.439  64.353  1.00 96.37           O  
ATOM   5630  CB  ASP B 308      52.682  56.799  62.244  1.00 96.47           C  
ATOM   5631  CG  ASP B 308      54.129  56.928  61.747  1.00 97.06           C  
ATOM   5632  OD1 ASP B 308      54.463  56.317  60.709  1.00 97.84           O  
ATOM   5633  OD2 ASP B 308      54.938  57.640  62.381  1.00 97.43           O  
ATOM   5634  N   ALA B 309      53.980  53.815  62.668  1.00 94.69           N  
ATOM   5635  CA  ALA B 309      54.818  52.956  63.494  1.00 93.01           C  
ATOM   5636  C   ALA B 309      56.252  53.027  62.989  1.00 91.68           C  
ATOM   5637  O   ALA B 309      56.487  53.089  61.789  1.00 91.84           O  
ATOM   5638  CB  ALA B 309      54.310  51.528  63.439  1.00 91.84           C  
ATOM   5639  N   SER B 310      57.212  53.026  63.900  1.00 91.07           N  
ATOM   5640  CA  SER B 310      58.602  53.098  63.489  1.00 90.65           C  
ATOM   5641  C   SER B 310      59.539  52.360  64.418  1.00 90.36           C  
ATOM   5642  O   SER B 310      59.169  51.933  65.511  1.00 90.18           O  
ATOM   5643  CB  SER B 310      59.050  54.554  63.396  1.00 90.78           C  
ATOM   5644  OG  SER B 310      58.234  55.280  62.494  1.00 92.51           O  
ATOM   5645  N   ALA B 311      60.772  52.216  63.960  1.00 90.23           N  
ATOM   5646  CA  ALA B 311      61.788  51.555  64.741  1.00 89.45           C  
ATOM   5647  C   ALA B 311      62.426  52.648  65.565  1.00 89.30           C  
ATOM   5648  O   ALA B 311      62.896  53.650  65.021  1.00 89.38           O  
ATOM   5649  CB  ALA B 311      62.812  50.923  63.829  1.00 89.49           C  
ATOM   5650  N   PHE B 312      62.421  52.462  66.877  1.00 88.78           N  
ATOM   5651  CA  PHE B 312      63.009  53.428  67.782  1.00 88.61           C  
ATOM   5652  C   PHE B 312      64.414  52.953  68.202  1.00 88.95           C  
ATOM   5653  O   PHE B 312      64.608  51.779  68.537  1.00 87.57           O  
ATOM   5654  CB  PHE B 312      62.089  53.587  68.993  1.00 88.57           C  
ATOM   5655  CG  PHE B 312      62.600  54.547  70.016  1.00 89.19           C  
ATOM   5656  CD1 PHE B 312      62.827  55.870  69.688  1.00 88.75           C  
ATOM   5657  CD2 PHE B 312      62.874  54.121  71.313  1.00 90.81           C  
ATOM   5658  CE1 PHE B 312      63.318  56.759  70.629  1.00 89.96           C  
ATOM   5659  CE2 PHE B 312      63.367  55.006  72.265  1.00 91.79           C  
ATOM   5660  CZ  PHE B 312      63.589  56.330  71.918  1.00 91.29           C  
ATOM   5661  N   ASN B 313      65.395  53.852  68.170  1.00 89.10           N  
ATOM   5662  CA  ASN B 313      66.750  53.475  68.552  1.00 90.22           C  
ATOM   5663  C   ASN B 313      67.609  54.625  69.052  1.00 90.71           C  
ATOM   5664  O   ASN B 313      67.933  55.545  68.303  1.00 89.72           O  
ATOM   5665  CB  ASN B 313      67.463  52.793  67.377  1.00 92.08           C  
ATOM   5666  CG  ASN B 313      68.921  52.423  67.694  1.00 93.34           C  
ATOM   5667  OD1 ASN B 313      69.199  51.587  68.565  1.00 93.40           O  
ATOM   5668  ND2 ASN B 313      69.854  53.049  66.981  1.00 94.08           N  
ATOM   5669  N   VAL B 314      67.998  54.533  70.323  1.00 92.91           N  
ATOM   5670  CA  VAL B 314      68.836  55.537  70.985  1.00 94.46           C  
ATOM   5671  C   VAL B 314      70.133  54.909  71.486  1.00 95.87           C  
ATOM   5672  O   VAL B 314      70.111  53.820  72.079  1.00 95.90           O  
ATOM   5673  CB  VAL B 314      68.150  56.119  72.226  1.00 94.28           C  
ATOM   5674  CG1 VAL B 314      68.779  57.451  72.583  1.00 93.48           C  
ATOM   5675  CG2 VAL B 314      66.667  56.236  71.997  1.00 94.56           C  
ATOM   5676  N   ASN B 315      71.250  55.601  71.271  1.00 96.90           N  
ATOM   5677  CA  ASN B 315      72.546  55.103  71.727  1.00 98.60           C  
ATOM   5678  C   ASN B 315      73.213  56.088  72.693  1.00 99.71           C  
ATOM   5679  O   ASN B 315      73.628  57.175  72.292  1.00 99.77           O  
ATOM   5680  CB  ASN B 315      73.465  54.826  70.527  1.00 98.43           C  
ATOM   5681  CG  ASN B 315      72.897  53.764  69.582  1.00 98.64           C  
ATOM   5682  OD1 ASN B 315      72.431  52.708  70.018  1.00 97.65           O  
ATOM   5683  ND2 ASN B 315      72.943  54.041  68.281  1.00 97.98           N  
ATOM   5684  N   TYR B 316      73.300  55.696  73.968  1.00101.39           N  
ATOM   5685  CA  TYR B 316      73.905  56.523  75.025  1.00102.39           C  
ATOM   5686  C   TYR B 316      75.235  55.950  75.528  1.00101.73           C  
ATOM   5687  O   TYR B 316      75.436  54.734  75.541  1.00102.14           O  
ATOM   5688  CB  TYR B 316      72.958  56.655  76.234  1.00104.29           C  
ATOM   5689  CG  TYR B 316      71.690  57.457  76.008  1.00105.50           C  
ATOM   5690  CD1 TYR B 316      70.437  56.917  76.321  1.00106.15           C  
ATOM   5691  CD2 TYR B 316      71.742  58.753  75.502  1.00105.77           C  
ATOM   5692  CE1 TYR B 316      69.264  57.650  76.132  1.00107.63           C  
ATOM   5693  CE2 TYR B 316      70.581  59.497  75.311  1.00107.71           C  
ATOM   5694  CZ  TYR B 316      69.342  58.944  75.626  1.00108.79           C  
ATOM   5695  OH  TYR B 316      68.191  59.692  75.428  1.00110.24           O  
ATOM   5696  N   SER B 317      76.120  56.846  75.960  1.00100.63           N  
ATOM   5697  CA  SER B 317      77.442  56.507  76.488  1.00 99.12           C  
ATOM   5698  C   SER B 317      77.537  55.134  77.157  1.00 97.72           C  
ATOM   5699  O   SER B 317      78.313  54.291  76.729  1.00 97.87           O  
ATOM   5700  CB  SER B 317      77.882  57.567  77.498  1.00 99.54           C  
ATOM   5701  OG  SER B 317      77.100  57.488  78.683  1.00100.78           O  
ATOM   5702  N   ASP B 318      76.756  54.915  78.208  1.00 95.91           N  
ATOM   5703  CA  ASP B 318      76.799  53.643  78.912  1.00 95.17           C  
ATOM   5704  C   ASP B 318      75.498  52.849  78.827  1.00 93.18           C  
ATOM   5705  O   ASP B 318      75.129  52.131  79.762  1.00 92.69           O  
ATOM   5706  CB  ASP B 318      77.163  53.865  80.389  1.00 98.68           C  
ATOM   5707  CG  ASP B 318      75.992  54.400  81.220  1.00100.75           C  
ATOM   5708  OD1 ASP B 318      76.044  54.303  82.472  1.00101.19           O  
ATOM   5709  OD2 ASP B 318      75.023  54.919  80.623  1.00102.78           O  
ATOM   5710  N   SER B 319      74.796  52.979  77.713  1.00 90.69           N  
ATOM   5711  CA  SER B 319      73.555  52.246  77.543  1.00 89.02           C  
ATOM   5712  C   SER B 319      72.791  52.717  76.320  1.00 87.27           C  
ATOM   5713  O   SER B 319      73.215  53.631  75.623  1.00 86.30           O  
ATOM   5714  CB  SER B 319      72.675  52.388  78.784  1.00 89.20           C  
ATOM   5715  OG  SER B 319      71.524  51.575  78.667  1.00 90.50           O  
ATOM   5716  N   GLY B 320      71.662  52.077  76.061  1.00 85.52           N  
ATOM   5717  CA  GLY B 320      70.872  52.453  74.914  1.00 84.76           C  
ATOM   5718  C   GLY B 320      69.461  51.929  75.043  1.00 84.83           C  
ATOM   5719  O   GLY B 320      69.142  51.201  75.999  1.00 83.84           O  
ATOM   5720  N   LEU B 321      68.620  52.311  74.081  1.00 83.90           N  
ATOM   5721  CA  LEU B 321      67.230  51.892  74.058  1.00 83.23           C  
ATOM   5722  C   LEU B 321      66.859  51.519  72.646  1.00 82.75           C  
ATOM   5723  O   LEU B 321      67.296  52.175  71.700  1.00 82.40           O  
ATOM   5724  CB  LEU B 321      66.318  53.018  74.543  1.00 83.80           C  
ATOM   5725  CG  LEU B 321      66.266  53.268  76.047  1.00 83.51           C  
ATOM   5726  CD1 LEU B 321      65.287  54.383  76.332  1.00 84.03           C  
ATOM   5727  CD2 LEU B 321      65.839  51.996  76.759  1.00 83.57           C  
ATOM   5728  N   PHE B 322      66.060  50.462  72.514  1.00 81.91           N  
ATOM   5729  CA  PHE B 322      65.615  49.988  71.208  1.00 81.01           C  
ATOM   5730  C   PHE B 322      64.237  49.351  71.266  1.00 81.30           C  
ATOM   5731  O   PHE B 322      63.893  48.642  72.215  1.00 80.91           O  
ATOM   5732  CB  PHE B 322      66.593  48.968  70.635  1.00 79.57           C  
ATOM   5733  CG  PHE B 322      66.244  48.516  69.244  1.00 77.85           C  
ATOM   5734  CD1 PHE B 322      66.838  49.117  68.142  1.00 77.52           C  
ATOM   5735  CD2 PHE B 322      65.303  47.505  69.037  1.00 77.09           C  
ATOM   5736  CE1 PHE B 322      66.504  48.721  66.851  1.00 78.23           C  
ATOM   5737  CE2 PHE B 322      64.959  47.100  67.750  1.00 76.50           C  
ATOM   5738  CZ  PHE B 322      65.562  47.709  66.654  1.00 77.54           C  
ATOM   5739  N   GLY B 323      63.468  49.595  70.213  1.00 81.66           N  
ATOM   5740  CA  GLY B 323      62.125  49.064  70.117  1.00 81.45           C  
ATOM   5741  C   GLY B 323      61.352  49.818  69.055  1.00 81.40           C  
ATOM   5742  O   GLY B 323      61.914  50.340  68.096  1.00 80.60           O  
ATOM   5743  N   PHE B 324      60.049  49.899  69.234  1.00 82.23           N  
ATOM   5744  CA  PHE B 324      59.231  50.581  68.261  1.00 83.88           C  
ATOM   5745  C   PHE B 324      58.351  51.631  68.927  1.00 84.69           C  
ATOM   5746  O   PHE B 324      58.118  51.573  70.136  1.00 84.85           O  
ATOM   5747  CB  PHE B 324      58.374  49.546  67.546  1.00 84.78           C  
ATOM   5748  CG  PHE B 324      57.471  48.760  68.469  1.00 85.66           C  
ATOM   5749  CD1 PHE B 324      56.193  49.222  68.784  1.00 86.11           C  
ATOM   5750  CD2 PHE B 324      57.882  47.547  68.997  1.00 85.17           C  
ATOM   5751  CE1 PHE B 324      55.336  48.479  69.601  1.00 85.82           C  
ATOM   5752  CE2 PHE B 324      57.034  46.803  69.814  1.00 85.56           C  
ATOM   5753  CZ  PHE B 324      55.757  47.273  70.113  1.00 85.62           C  
ATOM   5754  N   TYR B 325      57.866  52.581  68.128  1.00 84.75           N  
ATOM   5755  CA  TYR B 325      56.990  53.650  68.603  1.00 84.11           C  
ATOM   5756  C   TYR B 325      55.753  53.693  67.698  1.00 83.14           C  
ATOM   5757  O   TYR B 325      55.876  53.725  66.474  1.00 82.59           O  
ATOM   5758  CB  TYR B 325      57.743  54.974  68.548  1.00 85.59           C  
ATOM   5759  CG  TYR B 325      57.020  56.143  69.164  1.00 88.28           C  
ATOM   5760  CD1 TYR B 325      57.701  57.038  69.976  1.00 88.66           C  
ATOM   5761  CD2 TYR B 325      55.668  56.388  68.896  1.00 90.45           C  
ATOM   5762  CE1 TYR B 325      57.070  58.155  70.506  1.00 90.26           C  
ATOM   5763  CE2 TYR B 325      55.017  57.502  69.422  1.00 91.15           C  
ATOM   5764  CZ  TYR B 325      55.729  58.387  70.228  1.00 91.51           C  
ATOM   5765  OH  TYR B 325      55.114  59.507  70.745  1.00 92.15           O  
ATOM   5766  N   THR B 326      54.564  53.714  68.291  1.00 81.76           N  
ATOM   5767  CA  THR B 326      53.354  53.715  67.483  1.00 80.83           C  
ATOM   5768  C   THR B 326      52.263  54.727  67.839  1.00 80.43           C  
ATOM   5769  O   THR B 326      51.876  54.856  68.994  1.00 80.25           O  
ATOM   5770  CB  THR B 326      52.711  52.343  67.523  1.00 80.72           C  
ATOM   5771  OG1 THR B 326      52.057  52.167  68.785  1.00 81.02           O  
ATOM   5772  CG2 THR B 326      53.761  51.278  67.374  1.00 80.87           C  
ATOM   5773  N   ILE B 327      51.752  55.414  66.822  1.00 79.57           N  
ATOM   5774  CA  ILE B 327      50.676  56.386  66.984  1.00 77.67           C  
ATOM   5775  C   ILE B 327      49.441  55.780  66.347  1.00 78.24           C  
ATOM   5776  O   ILE B 327      49.527  55.273  65.233  1.00 78.50           O  
ATOM   5777  CB  ILE B 327      50.979  57.663  66.234  1.00 75.67           C  
ATOM   5778  CG1 ILE B 327      52.384  58.140  66.575  1.00 74.43           C  
ATOM   5779  CG2 ILE B 327      49.954  58.705  66.590  1.00 75.02           C  
ATOM   5780  CD1 ILE B 327      52.792  59.361  65.822  1.00 72.56           C  
ATOM   5781  N   SER B 328      48.297  55.839  67.022  1.00 79.15           N  
ATOM   5782  CA  SER B 328      47.075  55.254  66.458  1.00 81.08           C  
ATOM   5783  C   SER B 328      45.775  55.650  67.153  1.00 82.67           C  
ATOM   5784  O   SER B 328      45.771  56.096  68.298  1.00 83.72           O  
ATOM   5785  CB  SER B 328      47.171  53.732  66.484  1.00 80.04           C  
ATOM   5786  OG  SER B 328      47.103  53.264  67.816  1.00 79.21           O  
ATOM   5787  N   GLN B 329      44.659  55.472  66.461  1.00 84.50           N  
ATOM   5788  CA  GLN B 329      43.379  55.796  67.058  1.00 86.43           C  
ATOM   5789  C   GLN B 329      43.242  54.932  68.296  1.00 87.30           C  
ATOM   5790  O   GLN B 329      43.582  53.754  68.276  1.00 86.74           O  
ATOM   5791  CB  GLN B 329      42.245  55.512  66.077  1.00 87.99           C  
ATOM   5792  CG  GLN B 329      42.381  56.295  64.773  1.00 90.86           C  
ATOM   5793  CD  GLN B 329      41.132  56.247  63.904  1.00 92.14           C  
ATOM   5794  OE1 GLN B 329      41.088  56.853  62.826  1.00 91.75           O  
ATOM   5795  NE2 GLN B 329      40.108  55.527  64.370  1.00 93.06           N  
ATOM   5796  N   ALA B 330      42.754  55.533  69.374  1.00 89.72           N  
ATOM   5797  CA  ALA B 330      42.587  54.844  70.648  1.00 91.88           C  
ATOM   5798  C   ALA B 330      42.026  53.433  70.531  1.00 93.58           C  
ATOM   5799  O   ALA B 330      42.656  52.479  70.989  1.00 95.14           O  
ATOM   5800  CB  ALA B 330      41.706  55.672  71.578  1.00 90.69           C  
ATOM   5801  N   ALA B 331      40.852  53.296  69.920  1.00 94.31           N  
ATOM   5802  CA  ALA B 331      40.223  51.988  69.786  1.00 95.47           C  
ATOM   5803  C   ALA B 331      41.036  50.938  69.010  1.00 96.88           C  
ATOM   5804  O   ALA B 331      40.706  49.749  69.048  1.00 97.06           O  
ATOM   5805  CB  ALA B 331      38.857  52.150  69.167  1.00 93.91           C  
ATOM   5806  N   HIS B 332      42.101  51.361  68.327  1.00 97.97           N  
ATOM   5807  CA  HIS B 332      42.917  50.427  67.549  1.00 98.65           C  
ATOM   5808  C   HIS B 332      44.360  50.283  67.996  1.00 99.17           C  
ATOM   5809  O   HIS B 332      45.154  49.643  67.312  1.00 99.57           O  
ATOM   5810  CB  HIS B 332      42.914  50.815  66.070  1.00 98.64           C  
ATOM   5811  CG  HIS B 332      41.554  50.825  65.455  1.00 99.65           C  
ATOM   5812  ND1 HIS B 332      40.655  49.792  65.619  1.00100.06           N  
ATOM   5813  CD2 HIS B 332      40.935  51.743  64.677  1.00100.41           C  
ATOM   5814  CE1 HIS B 332      39.541  50.074  64.970  1.00100.64           C  
ATOM   5815  NE2 HIS B 332      39.684  51.253  64.390  1.00101.51           N  
ATOM   5816  N   ALA B 333      44.716  50.877  69.128  1.00 99.79           N  
ATOM   5817  CA  ALA B 333      46.093  50.771  69.612  1.00100.07           C  
ATOM   5818  C   ALA B 333      46.387  49.325  70.005  1.00 99.98           C  
ATOM   5819  O   ALA B 333      47.544  48.888  70.010  1.00 99.15           O  
ATOM   5820  CB  ALA B 333      46.311  51.700  70.806  1.00100.12           C  
ATOM   5821  N   GLY B 334      45.323  48.590  70.330  1.00100.07           N  
ATOM   5822  CA  GLY B 334      45.475  47.199  70.715  1.00 99.45           C  
ATOM   5823  C   GLY B 334      46.007  46.380  69.558  1.00 98.39           C  
ATOM   5824  O   GLY B 334      47.121  45.853  69.609  1.00 97.72           O  
ATOM   5825  N   GLU B 335      45.207  46.284  68.502  1.00 97.36           N  
ATOM   5826  CA  GLU B 335      45.615  45.532  67.334  1.00 95.94           C  
ATOM   5827  C   GLU B 335      46.894  46.102  66.727  1.00 93.48           C  
ATOM   5828  O   GLU B 335      47.720  45.358  66.212  1.00 93.91           O  
ATOM   5829  CB  GLU B 335      44.485  45.498  66.295  1.00 97.32           C  
ATOM   5830  CG  GLU B 335      43.771  46.821  66.081  1.00100.87           C  
ATOM   5831  CD  GLU B 335      42.854  46.814  64.856  1.00103.37           C  
ATOM   5832  OE1 GLU B 335      43.356  46.600  63.726  1.00105.13           O  
ATOM   5833  OE2 GLU B 335      41.631  47.029  65.020  1.00104.50           O  
ATOM   5834  N   VAL B 336      47.079  47.411  66.809  1.00 90.75           N  
ATOM   5835  CA  VAL B 336      48.267  48.006  66.230  1.00 89.57           C  
ATOM   5836  C   VAL B 336      49.555  47.684  66.954  1.00 89.70           C  
ATOM   5837  O   VAL B 336      50.567  47.415  66.319  1.00 89.65           O  
ATOM   5838  CB  VAL B 336      48.155  49.528  66.137  1.00 89.40           C  
ATOM   5839  CG1 VAL B 336      49.485  50.118  65.681  1.00 88.20           C  
ATOM   5840  CG2 VAL B 336      47.063  49.903  65.162  1.00 89.15           C  
ATOM   5841  N   ILE B 337      49.536  47.716  68.279  1.00 90.55           N  
ATOM   5842  CA  ILE B 337      50.757  47.435  69.027  1.00 91.73           C  
ATOM   5843  C   ILE B 337      51.186  45.964  68.894  1.00 91.72           C  
ATOM   5844  O   ILE B 337      52.376  45.667  68.711  1.00 91.40           O  
ATOM   5845  CB  ILE B 337      50.589  47.833  70.517  1.00 91.96           C  
ATOM   5846  CG1 ILE B 337      50.411  49.348  70.623  1.00 90.91           C  
ATOM   5847  CG2 ILE B 337      51.819  47.440  71.316  1.00 93.46           C  
ATOM   5848  CD1 ILE B 337      50.225  49.835  72.027  1.00 90.15           C  
ATOM   5849  N   ARG B 338      50.213  45.057  68.979  1.00 91.39           N  
ATOM   5850  CA  ARG B 338      50.467  43.623  68.844  1.00 90.95           C  
ATOM   5851  C   ARG B 338      51.219  43.415  67.550  1.00 90.73           C  
ATOM   5852  O   ARG B 338      52.299  42.839  67.528  1.00 90.78           O  
ATOM   5853  CB  ARG B 338      49.157  42.861  68.737  1.00 91.62           C  
ATOM   5854  CG  ARG B 338      48.193  43.135  69.842  1.00 93.52           C  
ATOM   5855  CD  ARG B 338      48.448  42.211  71.006  1.00 96.78           C  
ATOM   5856  NE  ARG B 338      47.446  42.369  72.056  1.00 98.81           N  
ATOM   5857  CZ  ARG B 338      46.137  42.491  71.838  1.00 99.65           C  
ATOM   5858  NH1 ARG B 338      45.645  42.478  70.599  1.00 97.71           N  
ATOM   5859  NH2 ARG B 338      45.316  42.626  72.872  1.00100.31           N  
ATOM   5860  N   ALA B 339      50.607  43.885  66.468  1.00 90.95           N  
ATOM   5861  CA  ALA B 339      51.171  43.772  65.140  1.00 91.08           C  
ATOM   5862  C   ALA B 339      52.633  44.171  65.162  1.00 91.39           C  
ATOM   5863  O   ALA B 339      53.479  43.423  64.686  1.00 91.80           O  
ATOM   5864  CB  ALA B 339      50.400  44.645  64.173  1.00 90.72           C  
ATOM   5865  N   ALA B 340      52.931  45.339  65.720  1.00 92.03           N  
ATOM   5866  CA  ALA B 340      54.312  45.807  65.793  1.00 94.01           C  
ATOM   5867  C   ALA B 340      55.197  44.800  66.539  1.00 95.71           C  
ATOM   5868  O   ALA B 340      56.400  44.694  66.269  1.00 96.23           O  
ATOM   5869  CB  ALA B 340      54.365  47.155  66.477  1.00 93.82           C  
ATOM   5870  N   MET B 341      54.600  44.072  67.484  1.00 96.77           N  
ATOM   5871  CA  MET B 341      55.319  43.054  68.251  1.00 97.02           C  
ATOM   5872  C   MET B 341      55.600  41.835  67.380  1.00 97.33           C  
ATOM   5873  O   MET B 341      56.757  41.502  67.130  1.00 96.74           O  
ATOM   5874  CB  MET B 341      54.503  42.624  69.473  1.00 97.31           C  
ATOM   5875  CG  MET B 341      54.793  43.423  70.731  1.00 98.18           C  
ATOM   5876  SD  MET B 341      56.246  42.827  71.637  1.00 99.36           S  
ATOM   5877  CE  MET B 341      57.552  43.342  70.578  1.00 97.45           C  
ATOM   5878  N   ASN B 342      54.536  41.180  66.918  1.00 97.72           N  
ATOM   5879  CA  ASN B 342      54.672  39.999  66.073  1.00 98.61           C  
ATOM   5880  C   ASN B 342      55.722  40.199  65.004  1.00 98.09           C  
ATOM   5881  O   ASN B 342      56.489  39.292  64.708  1.00 98.21           O  
ATOM   5882  CB  ASN B 342      53.344  39.650  65.400  1.00100.39           C  
ATOM   5883  CG  ASN B 342      52.249  39.380  66.398  1.00103.03           C  
ATOM   5884  OD1 ASN B 342      52.497  38.801  67.456  1.00104.28           O  
ATOM   5885  ND2 ASN B 342      51.024  39.787  66.069  1.00104.43           N  
ATOM   5886  N   GLN B 343      55.751  41.391  64.424  1.00 97.90           N  
ATOM   5887  CA  GLN B 343      56.709  41.699  63.379  1.00 98.23           C  
ATOM   5888  C   GLN B 343      58.133  41.795  63.905  1.00 98.91           C  
ATOM   5889  O   GLN B 343      59.086  41.871  63.128  1.00 98.90           O  
ATOM   5890  CB  GLN B 343      56.312  42.993  62.679  1.00 98.72           C  
ATOM   5891  CG  GLN B 343      55.396  42.789  61.487  1.00 99.02           C  
ATOM   5892  CD  GLN B 343      56.143  42.269  60.277  1.00100.15           C  
ATOM   5893  OE1 GLN B 343      55.573  42.129  59.194  1.00101.42           O  
ATOM   5894  NE2 GLN B 343      57.430  41.981  60.452  1.00100.14           N  
ATOM   5895  N   LEU B 344      58.278  41.802  65.228  1.00 99.77           N  
ATOM   5896  CA  LEU B 344      59.601  41.852  65.851  1.00100.60           C  
ATOM   5897  C   LEU B 344      60.006  40.435  66.221  1.00100.85           C  
ATOM   5898  O   LEU B 344      61.179  40.074  66.150  1.00100.44           O  
ATOM   5899  CB  LEU B 344      59.591  42.737  67.098  1.00100.19           C  
ATOM   5900  CG  LEU B 344      60.067  44.168  66.843  1.00 99.97           C  
ATOM   5901  CD1 LEU B 344      59.728  44.998  68.031  1.00101.43           C  
ATOM   5902  CD2 LEU B 344      61.560  44.208  66.580  1.00 98.56           C  
ATOM   5903  N   LYS B 345      59.024  39.638  66.628  1.00101.71           N  
ATOM   5904  CA  LYS B 345      59.281  38.246  66.957  1.00102.98           C  
ATOM   5905  C   LYS B 345      59.581  37.563  65.621  1.00103.23           C  
ATOM   5906  O   LYS B 345      60.590  36.873  65.473  1.00104.07           O  
ATOM   5907  CB  LYS B 345      58.054  37.607  67.631  1.00103.55           C  
ATOM   5908  CG  LYS B 345      57.810  38.114  69.055  1.00105.94           C  
ATOM   5909  CD  LYS B 345      56.662  37.395  69.778  1.00107.24           C  
ATOM   5910  CE  LYS B 345      55.304  37.676  69.136  1.00108.94           C  
ATOM   5911  NZ  LYS B 345      54.159  37.106  69.920  1.00108.84           N  
ATOM   5912  N   ALA B 346      58.712  37.787  64.639  1.00102.53           N  
ATOM   5913  CA  ALA B 346      58.877  37.204  63.316  1.00101.17           C  
ATOM   5914  C   ALA B 346      60.246  37.524  62.728  1.00100.84           C  
ATOM   5915  O   ALA B 346      60.809  36.734  61.977  1.00100.52           O  
ATOM   5916  CB  ALA B 346      57.790  37.708  62.399  1.00100.41           C  
ATOM   5917  N   ALA B 347      60.783  38.683  63.076  1.00101.58           N  
ATOM   5918  CA  ALA B 347      62.086  39.092  62.569  1.00103.56           C  
ATOM   5919  C   ALA B 347      63.223  38.497  63.386  1.00104.87           C  
ATOM   5920  O   ALA B 347      64.343  38.364  62.899  1.00104.91           O  
ATOM   5921  CB  ALA B 347      62.189  40.606  62.575  1.00103.46           C  
ATOM   5922  N   ALA B 348      62.930  38.153  64.637  1.00106.85           N  
ATOM   5923  CA  ALA B 348      63.925  37.571  65.536  1.00108.18           C  
ATOM   5924  C   ALA B 348      64.077  36.075  65.248  1.00109.32           C  
ATOM   5925  O   ALA B 348      65.025  35.430  65.705  1.00109.32           O  
ATOM   5926  CB  ALA B 348      63.508  37.797  66.994  1.00106.95           C  
ATOM   5927  N   GLN B 349      63.135  35.536  64.479  1.00110.41           N  
ATOM   5928  CA  GLN B 349      63.147  34.123  64.116  1.00111.31           C  
ATOM   5929  C   GLN B 349      63.539  33.961  62.647  1.00112.26           C  
ATOM   5930  O   GLN B 349      62.863  33.266  61.885  1.00112.19           O  
ATOM   5931  CB  GLN B 349      61.765  33.507  64.345  1.00110.73           C  
ATOM   5932  CG  GLN B 349      61.128  33.890  65.664  1.00110.09           C  
ATOM   5933  CD  GLN B 349      59.734  33.329  65.805  1.00110.35           C  
ATOM   5934  OE1 GLN B 349      58.962  33.314  64.844  1.00110.38           O  
ATOM   5935  NE2 GLN B 349      59.394  32.875  67.007  1.00110.65           N  
ATOM   5936  N   GLY B 350      64.625  34.623  62.254  1.00113.26           N  
ATOM   5937  CA  GLY B 350      65.107  34.536  60.884  1.00114.36           C  
ATOM   5938  C   GLY B 350      64.215  35.098  59.784  1.00115.22           C  
ATOM   5939  O   GLY B 350      64.442  34.815  58.603  1.00115.94           O  
ATOM   5940  N   GLY B 351      63.209  35.890  60.151  1.00115.34           N  
ATOM   5941  CA  GLY B 351      62.323  36.467  59.153  1.00114.54           C  
ATOM   5942  C   GLY B 351      62.961  37.654  58.458  1.00114.07           C  
ATOM   5943  O   GLY B 351      62.303  38.650  58.183  1.00113.93           O  
ATOM   5944  N   VAL B 352      64.251  37.537  58.169  1.00114.31           N  
ATOM   5945  CA  VAL B 352      65.003  38.602  57.516  1.00115.30           C  
ATOM   5946  C   VAL B 352      65.766  38.093  56.283  1.00116.31           C  
ATOM   5947  O   VAL B 352      66.689  37.285  56.405  1.00117.17           O  
ATOM   5948  CB  VAL B 352      66.024  39.229  58.507  1.00114.79           C  
ATOM   5949  CG1 VAL B 352      66.784  40.366  57.843  1.00114.47           C  
ATOM   5950  CG2 VAL B 352      65.307  39.719  59.748  1.00114.65           C  
ATOM   5951  N   THR B 353      65.377  38.564  55.099  1.00116.37           N  
ATOM   5952  CA  THR B 353      66.042  38.177  53.855  1.00115.83           C  
ATOM   5953  C   THR B 353      67.466  38.714  53.883  1.00115.92           C  
ATOM   5954  O   THR B 353      67.771  39.641  54.628  1.00115.60           O  
ATOM   5955  CB  THR B 353      65.318  38.777  52.622  1.00116.09           C  
ATOM   5956  OG1 THR B 353      64.028  38.169  52.480  1.00116.65           O  
ATOM   5957  CG2 THR B 353      66.124  38.557  51.350  1.00115.25           C  
ATOM   5958  N   GLU B 354      68.341  38.130  53.077  1.00116.89           N  
ATOM   5959  CA  GLU B 354      69.718  38.596  53.025  1.00118.39           C  
ATOM   5960  C   GLU B 354      69.741  39.920  52.258  1.00118.38           C  
ATOM   5961  O   GLU B 354      70.711  40.678  52.312  1.00118.38           O  
ATOM   5962  CB  GLU B 354      70.605  37.560  52.324  1.00119.47           C  
ATOM   5963  CG  GLU B 354      72.099  37.860  52.420  1.00121.56           C  
ATOM   5964  CD  GLU B 354      72.598  37.905  53.865  1.00122.41           C  
ATOM   5965  OE1 GLU B 354      72.434  36.886  54.573  1.00122.71           O  
ATOM   5966  OE2 GLU B 354      73.151  38.950  54.290  1.00122.16           O  
ATOM   5967  N   GLU B 355      68.651  40.188  51.548  1.00118.65           N  
ATOM   5968  CA  GLU B 355      68.515  41.405  50.762  1.00119.02           C  
ATOM   5969  C   GLU B 355      68.013  42.558  51.622  1.00117.51           C  
ATOM   5970  O   GLU B 355      68.436  43.702  51.447  1.00117.84           O  
ATOM   5971  CB  GLU B 355      67.538  41.173  49.613  1.00121.41           C  
ATOM   5972  CG  GLU B 355      67.196  42.430  48.836  1.00125.05           C  
ATOM   5973  CD  GLU B 355      65.860  42.316  48.121  1.00127.51           C  
ATOM   5974  OE1 GLU B 355      64.842  42.053  48.804  1.00128.28           O  
ATOM   5975  OE2 GLU B 355      65.828  42.489  46.882  1.00128.90           O  
ATOM   5976  N   ASP B 356      67.097  42.257  52.538  1.00115.01           N  
ATOM   5977  CA  ASP B 356      66.559  43.281  53.416  1.00112.19           C  
ATOM   5978  C   ASP B 356      67.728  43.902  54.132  1.00110.62           C  
ATOM   5979  O   ASP B 356      67.729  45.096  54.408  1.00110.72           O  
ATOM   5980  CB  ASP B 356      65.599  42.684  54.441  1.00111.89           C  
ATOM   5981  CG  ASP B 356      64.412  42.005  53.797  1.00111.59           C  
ATOM   5982  OD1 ASP B 356      63.933  42.508  52.760  1.00112.12           O  
ATOM   5983  OD2 ASP B 356      63.949  40.977  54.334  1.00110.90           O  
ATOM   5984  N   VAL B 357      68.725  43.076  54.426  1.00109.36           N  
ATOM   5985  CA  VAL B 357      69.926  43.537  55.109  1.00109.21           C  
ATOM   5986  C   VAL B 357      70.732  44.432  54.180  1.00108.92           C  
ATOM   5987  O   VAL B 357      71.436  45.337  54.623  1.00107.98           O  
ATOM   5988  CB  VAL B 357      70.811  42.350  55.558  1.00109.14           C  
ATOM   5989  CG1 VAL B 357      72.063  42.864  56.255  1.00108.05           C  
ATOM   5990  CG2 VAL B 357      70.023  41.440  56.495  1.00109.32           C  
ATOM   5991  N   THR B 358      70.617  44.172  52.884  1.00109.77           N  
ATOM   5992  CA  THR B 358      71.327  44.950  51.879  1.00110.59           C  
ATOM   5993  C   THR B 358      70.651  46.315  51.715  1.00110.84           C  
ATOM   5994  O   THR B 358      71.314  47.358  51.763  1.00110.29           O  
ATOM   5995  CB  THR B 358      71.343  44.207  50.512  1.00111.07           C  
ATOM   5996  OG1 THR B 358      71.864  42.880  50.687  1.00111.10           O  
ATOM   5997  CG2 THR B 358      72.216  44.951  49.511  1.00111.24           C  
ATOM   5998  N   LYS B 359      69.331  46.300  51.529  1.00111.17           N  
ATOM   5999  CA  LYS B 359      68.556  47.528  51.368  1.00111.28           C  
ATOM   6000  C   LYS B 359      68.826  48.482  52.522  1.00111.44           C  
ATOM   6001  O   LYS B 359      69.339  49.585  52.313  1.00110.99           O  
ATOM   6002  CB  LYS B 359      67.064  47.204  51.291  1.00111.49           C  
ATOM   6003  CG  LYS B 359      66.730  46.319  50.113  1.00113.14           C  
ATOM   6004  CD  LYS B 359      65.243  46.261  49.822  1.00114.51           C  
ATOM   6005  CE  LYS B 359      65.010  45.617  48.454  1.00115.27           C  
ATOM   6006  NZ  LYS B 359      63.590  45.635  48.005  1.00116.74           N  
ATOM   6007  N   ALA B 360      68.484  48.045  53.736  1.00111.60           N  
ATOM   6008  CA  ALA B 360      68.690  48.841  54.945  1.00111.57           C  
ATOM   6009  C   ALA B 360      70.068  49.489  54.922  1.00111.96           C  
ATOM   6010  O   ALA B 360      70.185  50.715  54.979  1.00112.25           O  
ATOM   6011  CB  ALA B 360      68.546  47.963  56.184  1.00110.80           C  
ATOM   6012  N   LYS B 361      71.104  48.658  54.826  1.00112.36           N  
ATOM   6013  CA  LYS B 361      72.485  49.130  54.790  1.00112.51           C  
ATOM   6014  C   LYS B 361      72.674  50.329  53.865  1.00112.21           C  
ATOM   6015  O   LYS B 361      73.534  51.181  54.107  1.00111.66           O  
ATOM   6016  CB  LYS B 361      73.416  48.000  54.349  1.00113.07           C  
ATOM   6017  CG  LYS B 361      73.614  46.899  55.379  1.00113.85           C  
ATOM   6018  CD  LYS B 361      74.529  45.827  54.810  1.00114.67           C  
ATOM   6019  CE  LYS B 361      74.836  44.729  55.807  1.00114.68           C  
ATOM   6020  NZ  LYS B 361      75.693  43.697  55.156  1.00114.39           N  
ATOM   6021  N   ASN B 362      71.873  50.389  52.804  1.00111.98           N  
ATOM   6022  CA  ASN B 362      71.959  51.493  51.855  1.00111.78           C  
ATOM   6023  C   ASN B 362      71.232  52.691  52.440  1.00110.41           C  
ATOM   6024  O   ASN B 362      71.789  53.790  52.524  1.00110.57           O  
ATOM   6025  CB  ASN B 362      71.310  51.119  50.520  1.00113.69           C  
ATOM   6026  CG  ASN B 362      71.780  49.775  49.992  1.00115.40           C  
ATOM   6027  OD1 ASN B 362      72.980  49.473  49.992  1.00116.76           O  
ATOM   6028  ND2 ASN B 362      70.836  48.964  49.523  1.00114.99           N  
ATOM   6029  N   GLN B 363      69.981  52.466  52.842  1.00108.12           N  
ATOM   6030  CA  GLN B 363      69.158  53.512  53.428  1.00105.78           C  
ATOM   6031  C   GLN B 363      69.928  54.186  54.560  1.00104.37           C  
ATOM   6032  O   GLN B 363      69.859  55.405  54.730  1.00104.07           O  
ATOM   6033  CB  GLN B 363      67.847  52.917  53.952  1.00105.25           C  
ATOM   6034  CG  GLN B 363      67.046  52.187  52.880  1.00105.97           C  
ATOM   6035  CD  GLN B 363      65.705  51.653  53.375  1.00106.94           C  
ATOM   6036  OE1 GLN B 363      65.631  50.947  54.382  1.00108.02           O  
ATOM   6037  NE2 GLN B 363      64.639  51.977  52.655  1.00107.00           N  
ATOM   6038  N   LEU B 364      70.681  53.385  55.312  1.00102.76           N  
ATOM   6039  CA  LEU B 364      71.468  53.880  56.437  1.00101.54           C  
ATOM   6040  C   LEU B 364      72.671  54.723  56.000  1.00101.01           C  
ATOM   6041  O   LEU B 364      72.907  55.807  56.538  1.00 99.71           O  
ATOM   6042  CB  LEU B 364      71.916  52.698  57.309  1.00100.81           C  
ATOM   6043  CG  LEU B 364      72.576  52.942  58.676  1.00101.23           C  
ATOM   6044  CD1 LEU B 364      71.882  54.066  59.432  1.00101.18           C  
ATOM   6045  CD2 LEU B 364      72.530  51.649  59.487  1.00100.93           C  
ATOM   6046  N   LYS B 365      73.427  54.231  55.023  1.00101.38           N  
ATOM   6047  CA  LYS B 365      74.587  54.966  54.513  1.00101.82           C  
ATOM   6048  C   LYS B 365      74.153  56.282  53.856  1.00100.59           C  
ATOM   6049  O   LYS B 365      74.840  57.303  53.946  1.00 99.01           O  
ATOM   6050  CB  LYS B 365      75.338  54.138  53.469  1.00104.29           C  
ATOM   6051  CG  LYS B 365      75.905  52.804  53.930  1.00106.93           C  
ATOM   6052  CD  LYS B 365      76.671  52.174  52.762  1.00109.44           C  
ATOM   6053  CE  LYS B 365      77.105  50.742  53.036  1.00111.24           C  
ATOM   6054  NZ  LYS B 365      77.929  50.188  51.914  1.00112.03           N  
ATOM   6055  N   ALA B 366      73.017  56.236  53.169  1.00100.00           N  
ATOM   6056  CA  ALA B 366      72.478  57.412  52.506  1.00 99.60           C  
ATOM   6057  C   ALA B 366      72.092  58.398  53.597  1.00 99.41           C  
ATOM   6058  O   ALA B 366      72.618  59.511  53.668  1.00 98.53           O  
ATOM   6059  CB  ALA B 366      71.253  57.032  51.681  1.00 99.47           C  
ATOM   6060  N   THR B 367      71.168  57.962  54.450  1.00 99.63           N  
ATOM   6061  CA  THR B 367      70.693  58.768  55.564  1.00 99.54           C  
ATOM   6062  C   THR B 367      71.881  59.435  56.263  1.00 99.66           C  
ATOM   6063  O   THR B 367      71.893  60.650  56.445  1.00 99.86           O  
ATOM   6064  CB  THR B 367      69.882  57.887  56.559  1.00 99.16           C  
ATOM   6065  OG1 THR B 367      68.525  57.773  56.096  1.00 97.93           O  
ATOM   6066  CG2 THR B 367      69.921  58.468  57.974  1.00 98.19           C  
ATOM   6067  N   TYR B 368      72.885  58.645  56.632  1.00 99.70           N  
ATOM   6068  CA  TYR B 368      74.073  59.185  57.290  1.00 99.69           C  
ATOM   6069  C   TYR B 368      74.719  60.290  56.438  1.00 98.20           C  
ATOM   6070  O   TYR B 368      74.954  61.402  56.911  1.00 97.01           O  
ATOM   6071  CB  TYR B 368      75.091  58.056  57.556  1.00101.75           C  
ATOM   6072  CG  TYR B 368      76.500  58.549  57.827  1.00104.24           C  
ATOM   6073  CD1 TYR B 368      76.875  59.035  59.085  1.00104.69           C  
ATOM   6074  CD2 TYR B 368      77.437  58.614  56.792  1.00105.88           C  
ATOM   6075  CE1 TYR B 368      78.157  59.588  59.299  1.00106.22           C  
ATOM   6076  CE2 TYR B 368      78.714  59.163  56.988  1.00107.17           C  
ATOM   6077  CZ  TYR B 368      79.071  59.653  58.237  1.00107.34           C  
ATOM   6078  OH  TYR B 368      80.319  60.237  58.388  1.00107.25           O  
ATOM   6079  N   LEU B 369      74.988  59.973  55.177  1.00 97.23           N  
ATOM   6080  CA  LEU B 369      75.620  60.908  54.256  1.00 97.52           C  
ATOM   6081  C   LEU B 369      74.849  62.188  53.948  1.00 97.93           C  
ATOM   6082  O   LEU B 369      75.449  63.238  53.670  1.00 97.45           O  
ATOM   6083  CB  LEU B 369      75.943  60.186  52.954  1.00 98.04           C  
ATOM   6084  CG  LEU B 369      77.252  59.394  52.964  1.00 98.04           C  
ATOM   6085  CD1 LEU B 369      77.320  58.512  51.725  1.00 98.03           C  
ATOM   6086  CD2 LEU B 369      78.444  60.364  53.021  1.00 97.12           C  
ATOM   6087  N   MET B 370      73.522  62.099  53.972  1.00 98.59           N  
ATOM   6088  CA  MET B 370      72.681  63.267  53.714  1.00 98.34           C  
ATOM   6089  C   MET B 370      72.706  64.137  54.969  1.00 98.98           C  
ATOM   6090  O   MET B 370      72.853  65.356  54.895  1.00 99.68           O  
ATOM   6091  CB  MET B 370      71.238  62.839  53.393  1.00 95.86           C  
ATOM   6092  CG  MET B 370      71.120  61.943  52.166  1.00 94.79           C  
ATOM   6093  SD  MET B 370      69.449  61.483  51.624  1.00 92.96           S  
ATOM   6094  CE  MET B 370      69.055  60.136  52.772  1.00 93.51           C  
ATOM   6095  N   SER B 371      72.595  63.482  56.120  1.00 99.39           N  
ATOM   6096  CA  SER B 371      72.590  64.140  57.419  1.00100.05           C  
ATOM   6097  C   SER B 371      73.781  65.032  57.699  1.00100.28           C  
ATOM   6098  O   SER B 371      73.895  65.578  58.795  1.00100.84           O  
ATOM   6099  CB  SER B 371      72.509  63.092  58.525  1.00100.79           C  
ATOM   6100  OG  SER B 371      71.323  62.328  58.404  1.00103.27           O  
ATOM   6101  N   VAL B 372      74.667  65.196  56.726  1.00100.47           N  
ATOM   6102  CA  VAL B 372      75.847  66.014  56.951  1.00100.26           C  
ATOM   6103  C   VAL B 372      76.050  67.125  55.919  1.00101.39           C  
ATOM   6104  O   VAL B 372      77.138  67.698  55.821  1.00102.34           O  
ATOM   6105  CB  VAL B 372      77.097  65.119  57.012  1.00 98.60           C  
ATOM   6106  CG1 VAL B 372      78.268  65.901  57.531  1.00 98.07           C  
ATOM   6107  CG2 VAL B 372      76.829  63.928  57.907  1.00 97.82           C  
ATOM   6108  N   GLU B 373      75.002  67.436  55.156  1.00101.97           N  
ATOM   6109  CA  GLU B 373      75.063  68.495  54.142  1.00102.26           C  
ATOM   6110  C   GLU B 373      74.900  69.846  54.860  1.00102.67           C  
ATOM   6111  O   GLU B 373      75.433  70.879  54.437  1.00102.06           O  
ATOM   6112  CB  GLU B 373      73.933  68.305  53.120  1.00102.10           C  
ATOM   6113  CG  GLU B 373      73.899  66.925  52.446  1.00103.49           C  
ATOM   6114  CD  GLU B 373      72.620  66.687  51.641  1.00104.27           C  
ATOM   6115  OE1 GLU B 373      72.532  65.661  50.923  1.00103.66           O  
ATOM   6116  OE2 GLU B 373      71.697  67.526  51.734  1.00105.91           O  
ATOM   6117  N   THR B 374      74.161  69.795  55.968  1.00103.11           N  
ATOM   6118  CA  THR B 374      73.854  70.937  56.832  1.00102.88           C  
ATOM   6119  C   THR B 374      75.086  71.439  57.573  1.00103.64           C  
ATOM   6120  O   THR B 374      75.872  70.643  58.075  1.00104.15           O  
ATOM   6121  CB  THR B 374      72.841  70.529  57.922  1.00102.05           C  
ATOM   6122  OG1 THR B 374      71.812  69.726  57.340  1.00101.40           O  
ATOM   6123  CG2 THR B 374      72.229  71.751  58.584  1.00101.60           C  
ATOM   6124  N   ALA B 375      75.248  72.752  57.662  1.00104.50           N  
ATOM   6125  CA  ALA B 375      76.373  73.312  58.403  1.00105.66           C  
ATOM   6126  C   ALA B 375      76.229  72.735  59.801  1.00106.68           C  
ATOM   6127  O   ALA B 375      77.204  72.364  60.449  1.00107.57           O  
ATOM   6128  CB  ALA B 375      76.272  74.834  58.460  1.00105.53           C  
ATOM   6129  N   GLN B 376      74.982  72.660  60.246  1.00107.73           N  
ATOM   6130  CA  GLN B 376      74.639  72.136  61.559  1.00108.34           C  
ATOM   6131  C   GLN B 376      74.996  70.665  61.681  1.00106.99           C  
ATOM   6132  O   GLN B 376      75.799  70.290  62.531  1.00106.94           O  
ATOM   6133  CB  GLN B 376      73.145  72.307  61.791  1.00111.11           C  
ATOM   6134  CG  GLN B 376      72.641  71.708  63.078  1.00114.28           C  
ATOM   6135  CD  GLN B 376      71.153  71.455  63.024  1.00116.41           C  
ATOM   6136  OE1 GLN B 376      70.685  70.584  62.272  1.00116.70           O  
ATOM   6137  NE2 GLN B 376      70.392  72.223  63.810  1.00116.90           N  
ATOM   6138  N   GLY B 377      74.381  69.842  60.832  1.00105.75           N  
ATOM   6139  CA  GLY B 377      74.632  68.406  60.843  1.00104.22           C  
ATOM   6140  C   GLY B 377      76.099  68.002  60.769  1.00102.72           C  
ATOM   6141  O   GLY B 377      76.519  67.011  61.376  1.00102.26           O  
ATOM   6142  N   LEU B 378      76.883  68.765  60.017  1.00101.00           N  
ATOM   6143  CA  LEU B 378      78.304  68.491  59.881  1.00 99.10           C  
ATOM   6144  C   LEU B 378      78.999  68.728  61.210  1.00 97.82           C  
ATOM   6145  O   LEU B 378      79.589  67.814  61.768  1.00 98.38           O  
ATOM   6146  CB  LEU B 378      78.924  69.394  58.813  1.00 99.19           C  
ATOM   6147  CG  LEU B 378      80.428  69.243  58.566  1.00 98.81           C  
ATOM   6148  CD1 LEU B 378      80.709  67.875  57.988  1.00 97.47           C  
ATOM   6149  CD2 LEU B 378      80.912  70.331  57.614  1.00 98.51           C  
ATOM   6150  N   LEU B 379      78.925  69.955  61.717  1.00 96.48           N  
ATOM   6151  CA  LEU B 379      79.565  70.294  62.986  1.00 96.16           C  
ATOM   6152  C   LEU B 379      79.155  69.333  64.083  1.00 95.79           C  
ATOM   6153  O   LEU B 379      79.955  68.970  64.935  1.00 95.31           O  
ATOM   6154  CB  LEU B 379      79.199  71.714  63.427  1.00 96.40           C  
ATOM   6155  CG  LEU B 379      79.889  72.205  64.708  1.00 96.35           C  
ATOM   6156  CD1 LEU B 379      81.286  72.701  64.379  1.00 96.95           C  
ATOM   6157  CD2 LEU B 379      79.088  73.325  65.333  1.00 96.79           C  
ATOM   6158  N   ASN B 380      77.895  68.937  64.077  1.00 96.39           N  
ATOM   6159  CA  ASN B 380      77.415  68.014  65.085  1.00 97.86           C  
ATOM   6160  C   ASN B 380      78.207  66.724  64.982  1.00 98.92           C  
ATOM   6161  O   ASN B 380      78.764  66.251  65.971  1.00 99.80           O  
ATOM   6162  CB  ASN B 380      75.930  67.725  64.878  1.00 98.01           C  
ATOM   6163  CG  ASN B 380      75.417  66.636  65.798  1.00 97.85           C  
ATOM   6164  OD1 ASN B 380      75.358  66.813  67.018  1.00 98.40           O  
ATOM   6165  ND2 ASN B 380      75.049  65.495  65.217  1.00 97.02           N  
ATOM   6166  N   GLU B 381      78.252  66.162  63.775  1.00 99.93           N  
ATOM   6167  CA  GLU B 381      78.976  64.916  63.501  1.00100.07           C  
ATOM   6168  C   GLU B 381      80.439  64.990  63.976  1.00 98.58           C  
ATOM   6169  O   GLU B 381      80.870  64.187  64.810  1.00 97.49           O  
ATOM   6170  CB  GLU B 381      78.917  64.613  61.992  1.00101.90           C  
ATOM   6171  CG  GLU B 381      79.512  63.267  61.579  1.00103.88           C  
ATOM   6172  CD  GLU B 381      78.935  62.114  62.380  1.00104.51           C  
ATOM   6173  OE1 GLU B 381      77.726  62.161  62.679  1.00104.77           O  
ATOM   6174  OE2 GLU B 381      79.683  61.164  62.705  1.00104.86           O  
ATOM   6175  N   ILE B 382      81.185  65.953  63.433  1.00 96.60           N  
ATOM   6176  CA  ILE B 382      82.583  66.179  63.783  1.00 95.29           C  
ATOM   6177  C   ILE B 382      82.787  66.290  65.299  1.00 97.15           C  
ATOM   6178  O   ILE B 382      83.583  65.551  65.889  1.00 98.54           O  
ATOM   6179  CB  ILE B 382      83.101  67.479  63.126  1.00 92.44           C  
ATOM   6180  CG1 ILE B 382      83.124  67.308  61.613  1.00 90.71           C  
ATOM   6181  CG2 ILE B 382      84.473  67.848  63.674  1.00 90.67           C  
ATOM   6182  CD1 ILE B 382      83.612  68.525  60.867  1.00 90.12           C  
ATOM   6183  N   GLY B 383      82.069  67.220  65.920  1.00 98.01           N  
ATOM   6184  CA  GLY B 383      82.187  67.435  67.352  1.00 98.19           C  
ATOM   6185  C   GLY B 383      81.868  66.228  68.202  1.00 98.93           C  
ATOM   6186  O   GLY B 383      82.570  65.965  69.173  1.00 98.42           O  
ATOM   6187  N   SER B 384      80.811  65.502  67.846  1.00100.47           N  
ATOM   6188  CA  SER B 384      80.407  64.312  68.594  1.00102.47           C  
ATOM   6189  C   SER B 384      81.584  63.377  68.811  1.00103.96           C  
ATOM   6190  O   SER B 384      81.788  62.864  69.913  1.00104.11           O  
ATOM   6191  CB  SER B 384      79.292  63.564  67.861  1.00102.29           C  
ATOM   6192  OG  SER B 384      78.063  64.250  67.996  1.00101.51           O  
ATOM   6193  N   GLU B 385      82.353  63.150  67.751  1.00105.26           N  
ATOM   6194  CA  GLU B 385      83.521  62.293  67.845  1.00105.74           C  
ATOM   6195  C   GLU B 385      84.581  62.970  68.692  1.00104.84           C  
ATOM   6196  O   GLU B 385      84.954  62.463  69.745  1.00104.84           O  
ATOM   6197  CB  GLU B 385      84.095  62.007  66.466  1.00107.71           C  
ATOM   6198  CG  GLU B 385      83.172  61.197  65.589  1.00112.54           C  
ATOM   6199  CD  GLU B 385      83.892  60.590  64.400  1.00115.18           C  
ATOM   6200  OE1 GLU B 385      84.801  59.755  64.632  1.00116.74           O  
ATOM   6201  OE2 GLU B 385      83.549  60.948  63.243  1.00116.06           O  
ATOM   6202  N   ALA B 386      85.058  64.122  68.234  1.00103.35           N  
ATOM   6203  CA  ALA B 386      86.084  64.858  68.957  1.00102.71           C  
ATOM   6204  C   ALA B 386      85.859  64.963  70.475  1.00102.74           C  
ATOM   6205  O   ALA B 386      86.755  65.393  71.193  1.00103.37           O  
ATOM   6206  CB  ALA B 386      86.239  66.244  68.358  1.00102.06           C  
ATOM   6207  N   LEU B 387      84.684  64.576  70.970  1.00102.41           N  
ATOM   6208  CA  LEU B 387      84.409  64.644  72.409  1.00102.21           C  
ATOM   6209  C   LEU B 387      84.432  63.254  73.058  1.00103.60           C  
ATOM   6210  O   LEU B 387      85.155  63.024  74.024  1.00103.45           O  
ATOM   6211  CB  LEU B 387      83.047  65.307  72.664  1.00100.16           C  
ATOM   6212  CG  LEU B 387      82.726  65.751  74.099  1.00 98.44           C  
ATOM   6213  CD1 LEU B 387      83.483  67.036  74.413  1.00 97.07           C  
ATOM   6214  CD2 LEU B 387      81.231  65.981  74.262  1.00 96.45           C  
ATOM   6215  N   LEU B 388      83.634  62.333  72.523  1.00105.97           N  
ATOM   6216  CA  LEU B 388      83.550  60.960  73.034  1.00107.96           C  
ATOM   6217  C   LEU B 388      84.565  60.037  72.354  1.00109.08           C  
ATOM   6218  O   LEU B 388      84.336  58.831  72.234  1.00109.71           O  
ATOM   6219  CB  LEU B 388      82.135  60.395  72.811  1.00108.22           C  
ATOM   6220  CG  LEU B 388      80.990  60.862  73.716  1.00108.33           C  
ATOM   6221  CD1 LEU B 388      79.655  60.502  73.085  1.00108.69           C  
ATOM   6222  CD2 LEU B 388      81.132  60.223  75.094  1.00108.00           C  
ATOM   6223  N   SER B 389      85.682  60.606  71.909  1.00109.88           N  
ATOM   6224  CA  SER B 389      86.728  59.845  71.226  1.00110.43           C  
ATOM   6225  C   SER B 389      88.014  60.656  71.201  1.00110.84           C  
ATOM   6226  O   SER B 389      88.898  60.459  72.025  1.00110.80           O  
ATOM   6227  CB  SER B 389      86.296  59.517  69.790  1.00110.55           C  
ATOM   6228  OG  SER B 389      87.377  59.043  69.004  1.00110.28           O  
ATOM   6229  N   GLY B 390      88.103  61.578  70.252  1.00111.70           N  
ATOM   6230  CA  GLY B 390      89.278  62.413  70.134  1.00113.50           C  
ATOM   6231  C   GLY B 390      89.792  62.263  68.729  1.00115.55           C  
ATOM   6232  O   GLY B 390      90.875  62.733  68.396  1.00116.27           O  
ATOM   6233  N   THR B 391      88.991  61.611  67.896  1.00117.55           N  
ATOM   6234  CA  THR B 391      89.364  61.363  66.513  1.00120.48           C  
ATOM   6235  C   THR B 391      88.182  61.473  65.558  1.00121.53           C  
ATOM   6236  O   THR B 391      87.053  61.704  65.984  1.00122.32           O  
ATOM   6237  CB  THR B 391      89.957  59.958  66.373  1.00121.47           C  
ATOM   6238  OG1 THR B 391      89.115  59.024  67.066  1.00122.08           O  
ATOM   6239  CG2 THR B 391      91.365  59.908  66.950  1.00122.09           C  
ATOM   6240  N   HIS B 392      88.456  61.291  64.267  1.00122.48           N  
ATOM   6241  CA  HIS B 392      87.427  61.360  63.234  1.00123.39           C  
ATOM   6242  C   HIS B 392      87.427  60.146  62.311  1.00122.98           C  
ATOM   6243  O   HIS B 392      88.273  60.022  61.429  1.00122.81           O  
ATOM   6244  CB  HIS B 392      87.595  62.636  62.403  1.00125.70           C  
ATOM   6245  CG  HIS B 392      86.708  62.695  61.193  1.00128.51           C  
ATOM   6246  ND1 HIS B 392      87.032  62.080  60.001  1.00129.22           N  
ATOM   6247  CD2 HIS B 392      85.514  63.303  60.990  1.00129.17           C  
ATOM   6248  CE1 HIS B 392      86.078  62.310  59.114  1.00129.40           C  
ATOM   6249  NE2 HIS B 392      85.146  63.050  59.689  1.00129.80           N  
ATOM   6250  N   THR B 393      86.461  59.258  62.522  1.00123.00           N  
ATOM   6251  CA  THR B 393      86.306  58.048  61.719  1.00123.21           C  
ATOM   6252  C   THR B 393      85.937  58.435  60.288  1.00124.54           C  
ATOM   6253  O   THR B 393      84.836  58.922  60.047  1.00125.10           O  
ATOM   6254  CB  THR B 393      85.172  57.143  62.285  1.00122.06           C  
ATOM   6255  OG1 THR B 393      85.506  56.708  63.610  1.00120.58           O  
ATOM   6256  CG2 THR B 393      84.955  55.933  61.397  1.00121.28           C  
ATOM   6257  N   ALA B 394      86.849  58.218  59.344  1.00126.11           N  
ATOM   6258  CA  ALA B 394      86.595  58.547  57.939  1.00127.59           C  
ATOM   6259  C   ALA B 394      85.239  58.003  57.478  1.00128.86           C  
ATOM   6260  O   ALA B 394      84.781  56.955  57.949  1.00128.92           O  
ATOM   6261  CB  ALA B 394      87.702  57.985  57.063  1.00127.52           C  
ATOM   6262  N   PRO B 395      84.580  58.707  56.540  1.00129.74           N  
ATOM   6263  CA  PRO B 395      83.272  58.264  56.042  1.00129.92           C  
ATOM   6264  C   PRO B 395      83.296  56.869  55.421  1.00130.05           C  
ATOM   6265  O   PRO B 395      82.296  56.152  55.450  1.00129.92           O  
ATOM   6266  CB  PRO B 395      82.897  59.354  55.035  1.00129.87           C  
ATOM   6267  CG  PRO B 395      84.232  59.816  54.528  1.00130.15           C  
ATOM   6268  CD  PRO B 395      85.055  59.889  55.797  1.00129.87           C  
ATOM   6269  N   SER B 396      84.442  56.492  54.864  1.00130.38           N  
ATOM   6270  CA  SER B 396      84.593  55.183  54.237  1.00130.39           C  
ATOM   6271  C   SER B 396      84.710  54.100  55.301  1.00130.07           C  
ATOM   6272  O   SER B 396      84.321  52.949  55.076  1.00129.25           O  
ATOM   6273  CB  SER B 396      85.835  55.171  53.342  1.00130.48           C  
ATOM   6274  OG  SER B 396      87.002  55.464  54.092  1.00131.44           O  
ATOM   6275  N   VAL B 397      85.248  54.485  56.458  1.00130.02           N  
ATOM   6276  CA  VAL B 397      85.430  53.568  57.579  1.00130.33           C  
ATOM   6277  C   VAL B 397      84.086  53.260  58.219  1.00130.83           C  
ATOM   6278  O   VAL B 397      83.804  52.112  58.570  1.00131.03           O  
ATOM   6279  CB  VAL B 397      86.363  54.166  58.666  1.00129.93           C  
ATOM   6280  CG1 VAL B 397      86.531  53.173  59.812  1.00128.95           C  
ATOM   6281  CG2 VAL B 397      87.715  54.523  58.063  1.00129.40           C  
ATOM   6282  N   VAL B 398      83.262  54.292  58.374  1.00131.04           N  
ATOM   6283  CA  VAL B 398      81.946  54.118  58.970  1.00130.95           C  
ATOM   6284  C   VAL B 398      81.093  53.281  58.021  1.00130.47           C  
ATOM   6285  O   VAL B 398      80.188  52.569  58.450  1.00130.21           O  
ATOM   6286  CB  VAL B 398      81.274  55.484  59.239  1.00131.21           C  
ATOM   6287  CG1 VAL B 398      81.166  56.276  57.953  1.00131.76           C  
ATOM   6288  CG2 VAL B 398      79.906  55.274  59.862  1.00131.36           C  
ATOM   6289  N   ALA B 399      81.401  53.365  56.730  1.00130.29           N  
ATOM   6290  CA  ALA B 399      80.685  52.599  55.719  1.00130.15           C  
ATOM   6291  C   ALA B 399      81.138  51.146  55.818  1.00130.46           C  
ATOM   6292  O   ALA B 399      80.331  50.225  55.743  1.00129.13           O  
ATOM   6293  CB  ALA B 399      80.988  53.151  54.337  1.00130.17           C  
ATOM   6294  N   GLN B 400      82.442  50.950  55.990  1.00131.73           N  
ATOM   6295  CA  GLN B 400      83.016  49.608  56.111  1.00132.58           C  
ATOM   6296  C   GLN B 400      82.477  48.891  57.345  1.00132.16           C  
ATOM   6297  O   GLN B 400      82.348  47.664  57.357  1.00131.84           O  
ATOM   6298  CB  GLN B 400      84.543  49.691  56.208  1.00133.63           C  
ATOM   6299  CG  GLN B 400      85.213  48.382  56.614  1.00135.33           C  
ATOM   6300  CD  GLN B 400      86.693  48.554  56.928  1.00136.59           C  
ATOM   6301  OE1 GLN B 400      87.487  48.924  56.059  1.00137.03           O  
ATOM   6302  NE2 GLN B 400      87.069  48.288  58.178  1.00136.19           N  
ATOM   6303  N   LYS B 401      82.183  49.672  58.381  1.00131.85           N  
ATOM   6304  CA  LYS B 401      81.663  49.145  59.640  1.00131.68           C  
ATOM   6305  C   LYS B 401      80.202  48.763  59.498  1.00131.08           C  
ATOM   6306  O   LYS B 401      79.739  47.790  60.095  1.00130.87           O  
ATOM   6307  CB  LYS B 401      81.776  50.194  60.755  1.00132.46           C  
ATOM   6308  CG  LYS B 401      83.190  50.596  61.134  1.00134.45           C  
ATOM   6309  CD  LYS B 401      83.936  49.458  61.813  1.00135.78           C  
ATOM   6310  CE  LYS B 401      85.325  49.895  62.255  1.00136.46           C  
ATOM   6311  NZ  LYS B 401      86.063  48.794  62.939  1.00137.07           N  
ATOM   6312  N   ILE B 402      79.475  49.535  58.699  1.00130.33           N  
ATOM   6313  CA  ILE B 402      78.052  49.294  58.526  1.00129.23           C  
ATOM   6314  C   ILE B 402      77.719  48.038  57.714  1.00127.67           C  
ATOM   6315  O   ILE B 402      77.011  47.166  58.216  1.00127.70           O  
ATOM   6316  CB  ILE B 402      77.342  50.580  57.948  1.00129.59           C  
ATOM   6317  CG1 ILE B 402      75.818  50.401  57.929  1.00129.29           C  
ATOM   6318  CG2 ILE B 402      77.883  50.918  56.570  1.00130.57           C  
ATOM   6319  CD1 ILE B 402      75.282  49.555  56.786  1.00128.64           C  
ATOM   6320  N   ASP B 403      78.227  47.914  56.488  1.00125.75           N  
ATOM   6321  CA  ASP B 403      77.912  46.727  55.690  1.00123.59           C  
ATOM   6322  C   ASP B 403      78.555  45.460  56.238  1.00121.24           C  
ATOM   6323  O   ASP B 403      78.195  44.358  55.834  1.00120.75           O  
ATOM   6324  CB  ASP B 403      78.293  46.913  54.209  1.00124.77           C  
ATOM   6325  CG  ASP B 403      79.613  47.630  54.027  1.00126.43           C  
ATOM   6326  OD1 ASP B 403      80.540  47.378  54.829  1.00128.34           O  
ATOM   6327  OD2 ASP B 403      79.725  48.438  53.073  1.00125.84           O  
ATOM   6328  N   SER B 404      79.498  45.615  57.163  1.00119.00           N  
ATOM   6329  CA  SER B 404      80.162  44.462  57.768  1.00116.79           C  
ATOM   6330  C   SER B 404      79.270  43.915  58.886  1.00115.50           C  
ATOM   6331  O   SER B 404      79.729  43.643  60.000  1.00114.27           O  
ATOM   6332  CB  SER B 404      81.522  44.872  58.339  1.00116.35           C  
ATOM   6333  OG  SER B 404      81.373  45.617  59.533  1.00115.01           O  
ATOM   6334  N   VAL B 405      77.987  43.764  58.570  1.00114.50           N  
ATOM   6335  CA  VAL B 405      76.995  43.273  59.522  1.00113.50           C  
ATOM   6336  C   VAL B 405      76.217  42.106  58.923  1.00113.19           C  
ATOM   6337  O   VAL B 405      75.421  42.273  58.001  1.00112.52           O  
ATOM   6338  CB  VAL B 405      76.003  44.398  59.916  1.00112.94           C  
ATOM   6339  CG1 VAL B 405      74.941  43.856  60.854  1.00112.46           C  
ATOM   6340  CG2 VAL B 405      76.754  45.546  60.575  1.00112.06           C  
ATOM   6341  N   THR B 406      76.448  40.921  59.473  1.00113.55           N  
ATOM   6342  CA  THR B 406      75.808  39.697  59.004  1.00113.36           C  
ATOM   6343  C   THR B 406      74.302  39.726  59.107  1.00112.12           C  
ATOM   6344  O   THR B 406      73.724  40.540  59.821  1.00112.02           O  
ATOM   6345  CB  THR B 406      76.260  38.461  59.820  1.00114.64           C  
ATOM   6346  OG1 THR B 406      75.594  38.467  61.091  1.00115.13           O  
ATOM   6347  CG2 THR B 406      77.774  38.476  60.048  1.00115.54           C  
ATOM   6348  N   SER B 407      73.679  38.801  58.393  1.00111.36           N  
ATOM   6349  CA  SER B 407      72.239  38.655  58.412  1.00111.22           C  
ATOM   6350  C   SER B 407      71.843  38.113  59.784  1.00111.18           C  
ATOM   6351  O   SER B 407      70.675  38.137  60.168  1.00111.05           O  
ATOM   6352  CB  SER B 407      71.816  37.669  57.329  1.00111.18           C  
ATOM   6353  OG  SER B 407      70.522  37.148  57.585  1.00112.20           O  
ATOM   6354  N   ALA B 408      72.833  37.619  60.518  1.00111.48           N  
ATOM   6355  CA  ALA B 408      72.605  37.055  61.844  1.00111.15           C  
ATOM   6356  C   ALA B 408      72.558  38.142  62.904  1.00110.71           C  
ATOM   6357  O   ALA B 408      71.606  38.208  63.679  1.00110.75           O  
ATOM   6358  CB  ALA B 408      73.698  36.058  62.179  1.00111.95           C  
ATOM   6359  N   ASP B 409      73.592  38.980  62.939  1.00109.95           N  
ATOM   6360  CA  ASP B 409      73.666  40.080  63.901  1.00110.00           C  
ATOM   6361  C   ASP B 409      72.290  40.718  64.039  1.00109.91           C  
ATOM   6362  O   ASP B 409      71.837  41.041  65.144  1.00109.82           O  
ATOM   6363  CB  ASP B 409      74.650  41.149  63.420  1.00109.65           C  
ATOM   6364  CG  ASP B 409      76.080  40.671  63.412  1.00108.88           C  
ATOM   6365  OD1 ASP B 409      76.567  40.229  64.474  1.00108.88           O  
ATOM   6366  OD2 ASP B 409      76.720  40.750  62.345  1.00108.29           O  
ATOM   6367  N   VAL B 410      71.649  40.902  62.886  1.00109.18           N  
ATOM   6368  CA  VAL B 410      70.321  41.484  62.792  1.00107.83           C  
ATOM   6369  C   VAL B 410      69.301  40.624  63.539  1.00107.61           C  
ATOM   6370  O   VAL B 410      68.710  41.074  64.522  1.00107.97           O  
ATOM   6371  CB  VAL B 410      69.916  41.633  61.308  1.00107.32           C  
ATOM   6372  CG1 VAL B 410      68.440  41.970  61.190  1.00106.92           C  
ATOM   6373  CG2 VAL B 410      70.773  42.714  60.654  1.00105.69           C  
ATOM   6374  N   VAL B 411      69.106  39.388  63.090  1.00106.89           N  
ATOM   6375  CA  VAL B 411      68.149  38.503  63.746  1.00107.00           C  
ATOM   6376  C   VAL B 411      68.414  38.394  65.247  1.00107.83           C  
ATOM   6377  O   VAL B 411      67.471  38.294  66.037  1.00107.25           O  
ATOM   6378  CB  VAL B 411      68.179  37.092  63.144  1.00106.24           C  
ATOM   6379  CG1 VAL B 411      67.024  36.273  63.700  1.00105.20           C  
ATOM   6380  CG2 VAL B 411      68.105  37.169  61.631  1.00106.18           C  
ATOM   6381  N   ASN B 412      69.693  38.410  65.636  1.00108.86           N  
ATOM   6382  CA  ASN B 412      70.073  38.328  67.055  1.00109.73           C  
ATOM   6383  C   ASN B 412      69.600  39.585  67.785  1.00108.98           C  
ATOM   6384  O   ASN B 412      69.040  39.504  68.884  1.00109.43           O  
ATOM   6385  CB  ASN B 412      71.601  38.204  67.236  1.00111.68           C  
ATOM   6386  CG  ASN B 412      72.151  36.842  66.807  1.00112.25           C  
ATOM   6387  OD1 ASN B 412      71.570  35.792  67.110  1.00110.94           O  
ATOM   6388  ND2 ASN B 412      73.292  36.860  66.115  1.00112.04           N  
ATOM   6389  N   ALA B 413      69.853  40.745  67.181  1.00107.10           N  
ATOM   6390  CA  ALA B 413      69.427  42.006  67.764  1.00104.49           C  
ATOM   6391  C   ALA B 413      67.953  41.815  68.069  1.00103.51           C  
ATOM   6392  O   ALA B 413      67.517  41.970  69.209  1.00103.12           O  
ATOM   6393  CB  ALA B 413      69.620  43.133  66.769  1.00103.80           C  
ATOM   6394  N   ALA B 414      67.201  41.437  67.040  1.00102.54           N  
ATOM   6395  CA  ALA B 414      65.771  41.202  67.169  1.00102.69           C  
ATOM   6396  C   ALA B 414      65.476  40.320  68.378  1.00103.29           C  
ATOM   6397  O   ALA B 414      64.600  40.629  69.189  1.00102.61           O  
ATOM   6398  CB  ALA B 414      65.244  40.551  65.904  1.00102.12           C  
ATOM   6399  N   LYS B 415      66.212  39.218  68.492  1.00104.75           N  
ATOM   6400  CA  LYS B 415      66.041  38.285  69.608  1.00105.30           C  
ATOM   6401  C   LYS B 415      66.185  39.021  70.935  1.00104.37           C  
ATOM   6402  O   LYS B 415      65.263  39.041  71.758  1.00103.83           O  
ATOM   6403  CB  LYS B 415      67.100  37.174  69.566  1.00107.24           C  
ATOM   6404  CG  LYS B 415      66.945  36.118  68.487  1.00108.97           C  
ATOM   6405  CD  LYS B 415      68.064  35.084  68.632  1.00111.79           C  
ATOM   6406  CE  LYS B 415      68.006  33.999  67.559  1.00114.08           C  
ATOM   6407  NZ  LYS B 415      69.204  33.098  67.596  1.00115.23           N  
ATOM   6408  N   LYS B 416      67.363  39.615  71.125  1.00103.15           N  
ATOM   6409  CA  LYS B 416      67.690  40.348  72.337  1.00101.93           C  
ATOM   6410  C   LYS B 416      66.503  41.180  72.805  1.00101.16           C  
ATOM   6411  O   LYS B 416      66.331  41.410  74.005  1.00100.93           O  
ATOM   6412  CB  LYS B 416      68.909  41.248  72.096  1.00101.68           C  
ATOM   6413  CG  LYS B 416      69.425  41.881  73.372  1.00102.79           C  
ATOM   6414  CD  LYS B 416      70.692  42.694  73.175  1.00103.48           C  
ATOM   6415  CE  LYS B 416      71.166  43.255  74.521  1.00103.80           C  
ATOM   6416  NZ  LYS B 416      72.354  44.146  74.425  1.00103.06           N  
ATOM   6417  N   PHE B 417      65.686  41.615  71.846  1.00 99.97           N  
ATOM   6418  CA  PHE B 417      64.507  42.419  72.129  1.00 98.37           C  
ATOM   6419  C   PHE B 417      63.356  41.561  72.620  1.00 98.27           C  
ATOM   6420  O   PHE B 417      62.738  41.874  73.634  1.00 98.20           O  
ATOM   6421  CB  PHE B 417      64.049  43.173  70.878  1.00 97.21           C  
ATOM   6422  CG  PHE B 417      62.787  43.983  71.085  1.00 96.00           C  
ATOM   6423  CD1 PHE B 417      62.851  45.315  71.501  1.00 95.14           C  
ATOM   6424  CD2 PHE B 417      61.535  43.394  70.915  1.00 94.33           C  
ATOM   6425  CE1 PHE B 417      61.689  46.039  71.744  1.00 93.47           C  
ATOM   6426  CE2 PHE B 417      60.375  44.105  71.158  1.00 92.87           C  
ATOM   6427  CZ  PHE B 417      60.446  45.427  71.573  1.00 93.25           C  
ATOM   6428  N   VAL B 418      63.063  40.486  71.896  1.00 98.74           N  
ATOM   6429  CA  VAL B 418      61.955  39.607  72.264  1.00100.35           C  
ATOM   6430  C   VAL B 418      62.210  38.889  73.575  1.00102.31           C  
ATOM   6431  O   VAL B 418      61.290  38.328  74.179  1.00102.32           O  
ATOM   6432  CB  VAL B 418      61.694  38.531  71.201  1.00 99.38           C  
ATOM   6433  CG1 VAL B 418      60.288  37.969  71.375  1.00 97.48           C  
ATOM   6434  CG2 VAL B 418      61.905  39.106  69.808  1.00 99.28           C  
ATOM   6435  N   SER B 419      63.467  38.911  74.006  1.00104.54           N  
ATOM   6436  CA  SER B 419      63.874  38.257  75.247  1.00106.41           C  
ATOM   6437  C   SER B 419      63.985  39.234  76.430  1.00107.19           C  
ATOM   6438  O   SER B 419      63.321  39.053  77.461  1.00107.83           O  
ATOM   6439  CB  SER B 419      65.213  37.540  75.033  1.00106.38           C  
ATOM   6440  OG  SER B 419      66.210  38.447  74.589  1.00106.67           O  
ATOM   6441  N   GLY B 420      64.822  40.263  76.271  1.00107.33           N  
ATOM   6442  CA  GLY B 420      65.024  41.256  77.316  1.00106.94           C  
ATOM   6443  C   GLY B 420      63.762  41.748  78.017  1.00106.86           C  
ATOM   6444  O   GLY B 420      62.634  41.523  77.550  1.00106.86           O  
ATOM   6445  N   LYS B 421      63.956  42.421  79.151  1.00105.84           N  
ATOM   6446  CA  LYS B 421      62.844  42.957  79.933  1.00103.85           C  
ATOM   6447  C   LYS B 421      62.438  44.275  79.287  1.00102.82           C  
ATOM   6448  O   LYS B 421      63.265  45.185  79.136  1.00102.85           O  
ATOM   6449  CB  LYS B 421      63.284  43.187  81.384  1.00104.03           C  
ATOM   6450  CG  LYS B 421      62.160  43.490  82.363  1.00104.00           C  
ATOM   6451  CD  LYS B 421      62.717  43.830  83.748  1.00105.00           C  
ATOM   6452  CE  LYS B 421      61.615  44.270  84.724  1.00106.09           C  
ATOM   6453  NZ  LYS B 421      62.110  44.695  86.080  1.00105.58           N  
ATOM   6454  N   LYS B 422      61.169  44.367  78.894  1.00100.81           N  
ATOM   6455  CA  LYS B 422      60.662  45.569  78.241  1.00 98.43           C  
ATOM   6456  C   LYS B 422      60.098  46.617  79.192  1.00 97.30           C  
ATOM   6457  O   LYS B 422      59.602  46.295  80.271  1.00 96.84           O  
ATOM   6458  CB  LYS B 422      59.581  45.205  77.220  1.00 97.35           C  
ATOM   6459  CG  LYS B 422      60.071  44.428  76.015  1.00 95.63           C  
ATOM   6460  CD  LYS B 422      59.768  42.960  76.148  1.00 95.55           C  
ATOM   6461  CE  LYS B 422      60.013  42.240  74.836  1.00 95.40           C  
ATOM   6462  NZ  LYS B 422      59.588  40.810  74.900  1.00 95.27           N  
ATOM   6463  N   SER B 423      60.206  47.877  78.773  1.00 96.61           N  
ATOM   6464  CA  SER B 423      59.686  49.029  79.512  1.00 95.49           C  
ATOM   6465  C   SER B 423      58.827  49.798  78.505  1.00 94.04           C  
ATOM   6466  O   SER B 423      59.280  50.109  77.401  1.00 94.12           O  
ATOM   6467  CB  SER B 423      60.826  49.914  80.064  1.00 95.57           C  
ATOM   6468  OG  SER B 423      61.719  50.340  79.056  1.00 95.60           O  
ATOM   6469  N   MET B 424      57.586  50.090  78.890  1.00 92.42           N  
ATOM   6470  CA  MET B 424      56.636  50.770  78.009  1.00 90.80           C  
ATOM   6471  C   MET B 424      56.086  52.115  78.513  1.00 90.36           C  
ATOM   6472  O   MET B 424      55.806  52.291  79.698  1.00 89.89           O  
ATOM   6473  CB  MET B 424      55.480  49.807  77.713  1.00 88.99           C  
ATOM   6474  CG  MET B 424      54.349  50.370  76.894  1.00 87.25           C  
ATOM   6475  SD  MET B 424      52.832  49.461  77.270  1.00 89.69           S  
ATOM   6476  CE  MET B 424      52.516  48.611  75.756  1.00 87.96           C  
ATOM   6477  N   ALA B 425      55.936  53.059  77.590  1.00 90.15           N  
ATOM   6478  CA  ALA B 425      55.408  54.386  77.890  1.00 90.00           C  
ATOM   6479  C   ALA B 425      54.280  54.666  76.898  1.00 90.43           C  
ATOM   6480  O   ALA B 425      54.474  54.548  75.693  1.00 91.27           O  
ATOM   6481  CB  ALA B 425      56.504  55.427  77.747  1.00 88.52           C  
ATOM   6482  N   ALA B 426      53.103  55.025  77.397  1.00 91.06           N  
ATOM   6483  CA  ALA B 426      51.969  55.301  76.515  1.00 92.22           C  
ATOM   6484  C   ALA B 426      51.070  56.415  77.055  1.00 93.07           C  
ATOM   6485  O   ALA B 426      50.841  56.498  78.262  1.00 94.55           O  
ATOM   6486  CB  ALA B 426      51.157  54.031  76.311  1.00 91.85           C  
ATOM   6487  N   SER B 427      50.553  57.260  76.161  1.00 92.50           N  
ATOM   6488  CA  SER B 427      49.687  58.365  76.571  1.00 91.06           C  
ATOM   6489  C   SER B 427      48.575  58.729  75.584  1.00 89.57           C  
ATOM   6490  O   SER B 427      48.823  59.042  74.419  1.00 88.20           O  
ATOM   6491  CB  SER B 427      50.539  59.599  76.864  1.00 92.09           C  
ATOM   6492  OG  SER B 427      51.312  59.967  75.736  1.00 94.60           O  
ATOM   6493  N   GLY B 428      47.344  58.697  76.081  1.00 89.06           N  
ATOM   6494  CA  GLY B 428      46.181  59.014  75.269  1.00 89.07           C  
ATOM   6495  C   GLY B 428      44.975  58.360  75.905  1.00 88.82           C  
ATOM   6496  O   GLY B 428      44.973  58.158  77.121  1.00 88.32           O  
ATOM   6497  N   ASP B 429      43.944  58.058  75.116  1.00 88.83           N  
ATOM   6498  CA  ASP B 429      42.779  57.376  75.663  1.00 90.17           C  
ATOM   6499  C   ASP B 429      43.192  55.904  75.619  1.00 91.01           C  
ATOM   6500  O   ASP B 429      42.887  55.174  74.669  1.00 91.91           O  
ATOM   6501  CB  ASP B 429      41.540  57.613  74.805  1.00 91.08           C  
ATOM   6502  CG  ASP B 429      40.270  57.070  75.455  1.00 92.99           C  
ATOM   6503  OD1 ASP B 429      40.213  55.856  75.762  1.00 93.84           O  
ATOM   6504  OD2 ASP B 429      39.322  57.857  75.663  1.00 94.39           O  
ATOM   6505  N   LEU B 430      43.907  55.488  76.661  1.00 90.67           N  
ATOM   6506  CA  LEU B 430      44.442  54.141  76.786  1.00 89.67           C  
ATOM   6507  C   LEU B 430      43.424  53.040  77.093  1.00 90.47           C  
ATOM   6508  O   LEU B 430      43.803  51.894  77.342  1.00 90.96           O  
ATOM   6509  CB  LEU B 430      45.539  54.153  77.854  1.00 87.41           C  
ATOM   6510  CG  LEU B 430      46.541  55.312  77.731  1.00 86.00           C  
ATOM   6511  CD1 LEU B 430      47.557  55.244  78.851  1.00 84.02           C  
ATOM   6512  CD2 LEU B 430      47.237  55.265  76.384  1.00 84.94           C  
ATOM   6513  N   GLY B 431      42.140  53.381  77.056  1.00 90.95           N  
ATOM   6514  CA  GLY B 431      41.096  52.407  77.342  1.00 90.83           C  
ATOM   6515  C   GLY B 431      41.203  51.050  76.663  1.00 90.94           C  
ATOM   6516  O   GLY B 431      40.778  50.042  77.227  1.00 89.59           O  
ATOM   6517  N   SER B 432      41.763  51.021  75.454  1.00 92.04           N  
ATOM   6518  CA  SER B 432      41.912  49.780  74.685  1.00 91.95           C  
ATOM   6519  C   SER B 432      43.375  49.483  74.381  1.00 92.22           C  
ATOM   6520  O   SER B 432      43.687  48.720  73.460  1.00 91.25           O  
ATOM   6521  CB  SER B 432      41.144  49.873  73.362  1.00 91.91           C  
ATOM   6522  OG  SER B 432      39.751  50.028  73.567  1.00 91.92           O  
ATOM   6523  N   THR B 433      44.265  50.101  75.151  1.00 92.57           N  
ATOM   6524  CA  THR B 433      45.698  49.908  74.987  1.00 92.44           C  
ATOM   6525  C   THR B 433      46.159  48.812  75.934  1.00 92.70           C  
ATOM   6526  O   THR B 433      45.764  48.775  77.100  1.00 93.18           O  
ATOM   6527  CB  THR B 433      46.458  51.199  75.296  1.00 92.55           C  
ATOM   6528  OG1 THR B 433      45.990  52.239  74.424  1.00 93.37           O  
ATOM   6529  CG2 THR B 433      47.959  50.997  75.107  1.00 92.32           C  
ATOM   6530  N   PRO B 434      46.999  47.895  75.443  1.00 92.76           N  
ATOM   6531  CA  PRO B 434      47.497  46.795  76.270  1.00 92.59           C  
ATOM   6532  C   PRO B 434      48.619  47.143  77.245  1.00 92.07           C  
ATOM   6533  O   PRO B 434      49.381  48.096  77.038  1.00 90.93           O  
ATOM   6534  CB  PRO B 434      47.935  45.769  75.229  1.00 92.60           C  
ATOM   6535  CG  PRO B 434      48.487  46.646  74.150  1.00 92.97           C  
ATOM   6536  CD  PRO B 434      47.422  47.725  74.042  1.00 92.86           C  
ATOM   6537  N   PHE B 435      48.699  46.351  78.311  1.00 92.58           N  
ATOM   6538  CA  PHE B 435      49.730  46.505  79.333  1.00 93.97           C  
ATOM   6539  C   PHE B 435      50.958  45.680  78.918  1.00 94.84           C  
ATOM   6540  O   PHE B 435      50.827  44.612  78.312  1.00 96.05           O  
ATOM   6541  CB  PHE B 435      49.243  45.996  80.698  1.00 93.08           C  
ATOM   6542  CG  PHE B 435      48.228  46.879  81.364  1.00 92.15           C  
ATOM   6543  CD1 PHE B 435      46.936  46.990  80.859  1.00 92.32           C  
ATOM   6544  CD2 PHE B 435      48.551  47.564  82.528  1.00 91.23           C  
ATOM   6545  CE1 PHE B 435      45.977  47.769  81.511  1.00 91.75           C  
ATOM   6546  CE2 PHE B 435      47.600  48.342  83.183  1.00 91.23           C  
ATOM   6547  CZ  PHE B 435      46.311  48.444  82.675  1.00 90.93           C  
ATOM   6548  N   LEU B 436      52.143  46.175  79.263  1.00 93.90           N  
ATOM   6549  CA  LEU B 436      53.395  45.510  78.944  1.00 92.59           C  
ATOM   6550  C   LEU B 436      53.348  43.987  79.118  1.00 93.47           C  
ATOM   6551  O   LEU B 436      53.967  43.259  78.352  1.00 93.01           O  
ATOM   6552  CB  LEU B 436      54.488  46.103  79.816  1.00 91.00           C  
ATOM   6553  CG  LEU B 436      55.930  45.779  79.482  1.00 90.04           C  
ATOM   6554  CD1 LEU B 436      56.227  46.118  78.042  1.00 90.14           C  
ATOM   6555  CD2 LEU B 436      56.804  46.580  80.406  1.00 90.22           C  
ATOM   6556  N   ASP B 437      52.610  43.502  80.112  1.00 95.11           N  
ATOM   6557  CA  ASP B 437      52.524  42.065  80.340  1.00 97.77           C  
ATOM   6558  C   ASP B 437      51.470  41.338  79.498  1.00 99.60           C  
ATOM   6559  O   ASP B 437      51.198  40.167  79.731  1.00100.72           O  
ATOM   6560  CB  ASP B 437      52.277  41.761  81.826  1.00 98.61           C  
ATOM   6561  CG  ASP B 437      50.835  42.019  82.260  1.00100.35           C  
ATOM   6562  OD1 ASP B 437      49.890  41.486  81.629  1.00 98.36           O  
ATOM   6563  OD2 ASP B 437      50.651  42.750  83.260  1.00103.21           O  
ATOM   6564  N   GLU B 438      50.861  42.015  78.533  1.00101.13           N  
ATOM   6565  CA  GLU B 438      49.864  41.355  77.694  1.00102.24           C  
ATOM   6566  C   GLU B 438      50.411  41.241  76.283  1.00103.72           C  
ATOM   6567  O   GLU B 438      49.683  40.909  75.357  1.00102.99           O  
ATOM   6568  CB  GLU B 438      48.563  42.149  77.648  1.00102.21           C  
ATOM   6569  CG  GLU B 438      48.000  42.544  78.992  1.00103.44           C  
ATOM   6570  CD  GLU B 438      46.662  43.249  78.852  1.00104.45           C  
ATOM   6571  OE1 GLU B 438      46.538  44.095  77.946  1.00105.19           O  
ATOM   6572  OE2 GLU B 438      45.736  42.968  79.643  1.00105.23           O  
ATOM   6573  N   LEU B 439      51.696  41.535  76.121  1.00106.59           N  
ATOM   6574  CA  LEU B 439      52.335  41.461  74.808  1.00109.66           C  
ATOM   6575  C   LEU B 439      53.208  40.204  74.678  1.00111.90           C  
ATOM   6576  O   LEU B 439      54.420  40.351  74.372  1.00113.66           O  
ATOM   6577  CB  LEU B 439      53.200  42.704  74.566  1.00108.93           C  
ATOM   6578  CG  LEU B 439      52.571  44.080  74.765  1.00108.65           C  
ATOM   6579  CD1 LEU B 439      53.565  45.147  74.312  1.00108.89           C  
ATOM   6580  CD2 LEU B 439      51.270  44.176  73.980  1.00108.43           C  
ATOM   6581  OXT LEU B 439      52.673  39.085  74.878  1.00112.92           O  
TER    6582      LEU B 439                                                      
ATOM   6583  N   MET C   1      55.218 103.614  80.693  1.00136.56           N  
ATOM   6584  CA  MET C   1      53.968 103.024  81.260  1.00136.85           C  
ATOM   6585  C   MET C   1      53.235 102.171  80.215  1.00136.77           C  
ATOM   6586  O   MET C   1      53.376 100.942  80.191  1.00136.93           O  
ATOM   6587  CB  MET C   1      53.047 104.143  81.767  1.00136.95           C  
ATOM   6588  N   ALA C   2      52.448 102.829  79.363  1.00136.17           N  
ATOM   6589  CA  ALA C   2      51.696 102.157  78.303  1.00134.68           C  
ATOM   6590  C   ALA C   2      52.287 102.588  76.960  1.00133.45           C  
ATOM   6591  O   ALA C   2      52.849 103.682  76.848  1.00133.53           O  
ATOM   6592  CB  ALA C   2      50.211 102.543  78.380  1.00134.61           C  
ATOM   6593  N   PRO C   3      52.176 101.736  75.925  1.00131.84           N  
ATOM   6594  CA  PRO C   3      52.732 102.116  74.622  1.00130.76           C  
ATOM   6595  C   PRO C   3      52.385 103.540  74.149  1.00129.90           C  
ATOM   6596  O   PRO C   3      53.259 104.409  74.137  1.00129.66           O  
ATOM   6597  CB  PRO C   3      52.218 101.013  73.686  1.00130.82           C  
ATOM   6598  CG  PRO C   3      51.039 100.416  74.420  1.00130.97           C  
ATOM   6599  CD  PRO C   3      51.493 100.435  75.847  1.00131.21           C  
ATOM   6600  N   ASN C   4      51.130 103.788  73.764  1.00129.10           N  
ATOM   6601  CA  ASN C   4      50.745 105.131  73.317  1.00127.88           C  
ATOM   6602  C   ASN C   4      50.251 106.039  74.439  1.00127.27           C  
ATOM   6603  O   ASN C   4      49.452 105.643  75.291  1.00127.63           O  
ATOM   6604  CB  ASN C   4      49.717 105.094  72.160  1.00127.68           C  
ATOM   6605  CG  ASN C   4      48.439 104.328  72.487  1.00126.79           C  
ATOM   6606  OD1 ASN C   4      48.461 103.131  72.777  1.00126.62           O  
ATOM   6607  ND2 ASN C   4      47.312 105.020  72.404  1.00126.21           N  
ATOM   6608  N   ILE C   5      50.757 107.268  74.416  1.00126.14           N  
ATOM   6609  CA  ILE C   5      50.459 108.298  75.409  1.00124.20           C  
ATOM   6610  C   ILE C   5      49.002 108.743  75.437  1.00122.71           C  
ATOM   6611  O   ILE C   5      48.634 109.623  76.207  1.00122.84           O  
ATOM   6612  CB  ILE C   5      51.356 109.541  75.167  1.00124.08           C  
ATOM   6613  CG1 ILE C   5      52.788 109.090  74.843  1.00124.74           C  
ATOM   6614  CG2 ILE C   5      51.353 110.450  76.382  1.00123.89           C  
ATOM   6615  CD1 ILE C   5      53.383 108.062  75.815  1.00125.03           C  
ATOM   6616  N   ARG C   6      48.170 108.140  74.600  1.00121.23           N  
ATOM   6617  CA  ARG C   6      46.760 108.504  74.561  1.00119.51           C  
ATOM   6618  C   ARG C   6      46.004 107.710  75.621  1.00118.27           C  
ATOM   6619  O   ARG C   6      44.896 108.074  76.009  1.00118.09           O  
ATOM   6620  CB  ARG C   6      46.181 108.209  73.176  1.00119.78           C  
ATOM   6621  CG  ARG C   6      44.770 108.726  72.943  1.00119.25           C  
ATOM   6622  CD  ARG C   6      44.070 107.892  71.874  1.00119.36           C  
ATOM   6623  NE  ARG C   6      44.783 107.896  70.602  1.00119.47           N  
ATOM   6624  CZ  ARG C   6      44.866 106.847  69.791  1.00120.04           C  
ATOM   6625  NH1 ARG C   6      44.279 105.701  70.122  1.00119.33           N  
ATOM   6626  NH2 ARG C   6      45.543 106.943  68.650  1.00120.44           N  
ATOM   6627  N   LYS C   7      46.617 106.629  76.095  1.00117.15           N  
ATOM   6628  CA  LYS C   7      46.002 105.768  77.103  1.00116.18           C  
ATOM   6629  C   LYS C   7      46.609 105.896  78.502  1.00115.60           C  
ATOM   6630  O   LYS C   7      45.916 105.703  79.508  1.00115.91           O  
ATOM   6631  CB  LYS C   7      46.088 104.308  76.665  1.00116.07           C  
ATOM   6632  CG  LYS C   7      45.300 103.971  75.413  1.00115.70           C  
ATOM   6633  CD  LYS C   7      45.387 102.479  75.146  1.00116.04           C  
ATOM   6634  CE  LYS C   7      44.666 102.079  73.878  1.00116.44           C  
ATOM   6635  NZ  LYS C   7      44.794 100.611  73.665  1.00115.73           N  
ATOM   6636  N   SER C   8      47.903 106.207  78.564  1.00114.32           N  
ATOM   6637  CA  SER C   8      48.603 106.352  79.838  1.00112.37           C  
ATOM   6638  C   SER C   8      48.356 107.696  80.541  1.00111.46           C  
ATOM   6639  O   SER C   8      47.952 107.712  81.707  1.00111.27           O  
ATOM   6640  CB  SER C   8      50.107 106.134  79.629  1.00112.28           C  
ATOM   6641  OG  SER C   8      50.603 106.927  78.564  1.00110.64           O  
ATOM   6642  N   HIS C   9      48.593 108.806  79.831  1.00109.93           N  
ATOM   6643  CA  HIS C   9      48.415 110.178  80.355  1.00108.14           C  
ATOM   6644  C   HIS C   9      47.114 110.358  81.133  1.00107.38           C  
ATOM   6645  O   HIS C   9      46.038 110.058  80.620  1.00108.85           O  
ATOM   6646  CB  HIS C   9      48.439 111.194  79.206  1.00106.59           C  
ATOM   6647  CG  HIS C   9      48.499 112.619  79.655  1.00104.98           C  
ATOM   6648  ND1 HIS C   9      49.628 113.178  80.210  1.00104.79           N  
ATOM   6649  CD2 HIS C   9      47.574 113.604  79.621  1.00105.60           C  
ATOM   6650  CE1 HIS C   9      49.398 114.447  80.495  1.00104.23           C  
ATOM   6651  NE2 HIS C   9      48.158 114.730  80.146  1.00105.19           N  
ATOM   6652  N   PRO C  10      47.192 110.882  82.370  1.00105.82           N  
ATOM   6653  CA  PRO C  10      45.989 111.081  83.188  1.00104.29           C  
ATOM   6654  C   PRO C  10      44.888 111.927  82.560  1.00102.40           C  
ATOM   6655  O   PRO C  10      43.723 111.761  82.911  1.00101.94           O  
ATOM   6656  CB  PRO C  10      46.539 111.694  84.473  1.00104.48           C  
ATOM   6657  CG  PRO C  10      47.761 112.415  84.003  1.00105.03           C  
ATOM   6658  CD  PRO C  10      48.376 111.439  83.043  1.00105.27           C  
ATOM   6659  N   LEU C  11      45.250 112.820  81.637  1.00100.20           N  
ATOM   6660  CA  LEU C  11      44.268 113.678  80.976  1.00 97.95           C  
ATOM   6661  C   LEU C  11      43.834 113.187  79.594  1.00 97.79           C  
ATOM   6662  O   LEU C  11      42.637 113.024  79.334  1.00 97.72           O  
ATOM   6663  CB  LEU C  11      44.794 115.113  80.860  1.00 95.74           C  
ATOM   6664  CG  LEU C  11      44.770 115.992  82.115  1.00 94.21           C  
ATOM   6665  CD1 LEU C  11      45.115 117.416  81.736  1.00 92.54           C  
ATOM   6666  CD2 LEU C  11      43.397 115.959  82.755  1.00 94.03           C  
ATOM   6667  N   LEU C  12      44.798 112.963  78.704  1.00 97.20           N  
ATOM   6668  CA  LEU C  12      44.474 112.500  77.362  1.00 96.39           C  
ATOM   6669  C   LEU C  12      43.624 111.263  77.477  1.00 96.02           C  
ATOM   6670  O   LEU C  12      42.661 111.097  76.741  1.00 96.06           O  
ATOM   6671  CB  LEU C  12      45.740 112.185  76.575  1.00 96.16           C  
ATOM   6672  CG  LEU C  12      46.655 113.380  76.324  1.00 95.76           C  
ATOM   6673  CD1 LEU C  12      47.814 112.925  75.476  1.00 95.41           C  
ATOM   6674  CD2 LEU C  12      45.894 114.500  75.636  1.00 94.88           C  
ATOM   6675  N   LYS C  13      43.993 110.400  78.415  1.00 96.26           N  
ATOM   6676  CA  LYS C  13      43.261 109.166  78.671  1.00 96.97           C  
ATOM   6677  C   LYS C  13      41.772 109.464  78.830  1.00 97.57           C  
ATOM   6678  O   LYS C  13      40.929 108.702  78.367  1.00 98.02           O  
ATOM   6679  CB  LYS C  13      43.779 108.505  79.948  1.00 96.76           C  
ATOM   6680  CG  LYS C  13      42.893 107.392  80.467  1.00 98.41           C  
ATOM   6681  CD  LYS C  13      43.110 107.112  81.949  1.00 99.14           C  
ATOM   6682  CE  LYS C  13      44.430 106.416  82.213  1.00100.31           C  
ATOM   6683  NZ  LYS C  13      44.553 106.055  83.650  1.00101.02           N  
ATOM   6684  N   MET C  14      41.454 110.574  79.490  1.00 98.41           N  
ATOM   6685  CA  MET C  14      40.065 110.961  79.710  1.00 98.70           C  
ATOM   6686  C   MET C  14      39.445 111.430  78.402  1.00 97.53           C  
ATOM   6687  O   MET C  14      38.288 111.119  78.108  1.00 97.80           O  
ATOM   6688  CB  MET C  14      39.976 112.075  80.760  1.00100.99           C  
ATOM   6689  CG  MET C  14      40.541 111.685  82.121  1.00103.51           C  
ATOM   6690  SD  MET C  14      40.287 112.924  83.424  1.00106.92           S  
ATOM   6691  CE  MET C  14      39.737 111.848  84.836  1.00105.71           C  
ATOM   6692  N   ILE C  15      40.217 112.183  77.624  1.00 95.33           N  
ATOM   6693  CA  ILE C  15      39.744 112.673  76.338  1.00 93.06           C  
ATOM   6694  C   ILE C  15      39.516 111.478  75.413  1.00 92.32           C  
ATOM   6695  O   ILE C  15      38.541 111.420  74.671  1.00 92.39           O  
ATOM   6696  CB  ILE C  15      40.773 113.610  75.701  1.00 91.52           C  
ATOM   6697  CG1 ILE C  15      40.989 114.813  76.605  1.00 91.23           C  
ATOM   6698  CG2 ILE C  15      40.299 114.062  74.334  1.00 90.41           C  
ATOM   6699  CD1 ILE C  15      41.999 115.786  76.059  1.00 91.97           C  
ATOM   6700  N   ASN C  16      40.425 110.517  75.480  1.00 91.24           N  
ATOM   6701  CA  ASN C  16      40.343 109.333  74.657  1.00 90.06           C  
ATOM   6702  C   ASN C  16      39.142 108.463  75.002  1.00 89.27           C  
ATOM   6703  O   ASN C  16      38.379 108.077  74.125  1.00 90.26           O  
ATOM   6704  CB  ASN C  16      41.633 108.518  74.801  1.00 91.00           C  
ATOM   6705  CG  ASN C  16      41.586 107.191  74.044  1.00 92.71           C  
ATOM   6706  OD1 ASN C  16      41.482 107.167  72.812  1.00 92.93           O  
ATOM   6707  ND2 ASN C  16      41.664 106.079  74.783  1.00 92.04           N  
ATOM   6708  N   ASN C  17      38.955 108.159  76.276  1.00 88.40           N  
ATOM   6709  CA  ASN C  17      37.853 107.285  76.655  1.00 88.17           C  
ATOM   6710  C   ASN C  17      36.457 107.909  76.552  1.00 87.67           C  
ATOM   6711  O   ASN C  17      35.478 107.326  77.038  1.00 87.56           O  
ATOM   6712  CB  ASN C  17      38.064 106.735  78.078  1.00 88.66           C  
ATOM   6713  CG  ASN C  17      39.425 106.057  78.268  1.00 88.93           C  
ATOM   6714  OD1 ASN C  17      39.976 105.424  77.356  1.00 88.67           O  
ATOM   6715  ND2 ASN C  17      39.960 106.175  79.474  1.00 88.39           N  
ATOM   6716  N   SER C  18      36.355 109.076  75.916  1.00 86.20           N  
ATOM   6717  CA  SER C  18      35.056 109.740  75.778  1.00 84.35           C  
ATOM   6718  C   SER C  18      34.861 110.484  74.457  1.00 82.59           C  
ATOM   6719  O   SER C  18      33.814 111.094  74.227  1.00 82.75           O  
ATOM   6720  CB  SER C  18      34.840 110.710  76.941  1.00 84.74           C  
ATOM   6721  OG  SER C  18      35.812 111.737  76.937  1.00 85.94           O  
ATOM   6722  N   LEU C  19      35.861 110.424  73.585  1.00 80.08           N  
ATOM   6723  CA  LEU C  19      35.776 111.099  72.299  1.00 77.33           C  
ATOM   6724  C   LEU C  19      36.616 110.483  71.201  1.00 75.95           C  
ATOM   6725  O   LEU C  19      36.694 111.041  70.118  1.00 77.06           O  
ATOM   6726  CB  LEU C  19      36.202 112.553  72.437  1.00 76.06           C  
ATOM   6727  CG  LEU C  19      35.202 113.524  73.027  1.00 75.62           C  
ATOM   6728  CD1 LEU C  19      35.836 114.894  73.043  1.00 74.17           C  
ATOM   6729  CD2 LEU C  19      33.918 113.520  72.198  1.00 75.44           C  
ATOM   6730  N   ILE C  20      37.244 109.343  71.453  1.00 73.74           N  
ATOM   6731  CA  ILE C  20      38.094 108.759  70.431  1.00 71.50           C  
ATOM   6732  C   ILE C  20      38.051 107.242  70.386  1.00 71.01           C  
ATOM   6733  O   ILE C  20      37.784 106.660  69.333  1.00 71.95           O  
ATOM   6734  CB  ILE C  20      39.553 109.239  70.621  1.00 69.86           C  
ATOM   6735  CG1 ILE C  20      39.606 110.760  70.438  1.00 69.10           C  
ATOM   6736  CG2 ILE C  20      40.474 108.534  69.641  1.00 68.68           C  
ATOM   6737  CD1 ILE C  20      40.921 111.403  70.781  1.00 69.92           C  
ATOM   6738  N   ASP C  21      38.316 106.601  71.517  1.00 69.14           N  
ATOM   6739  CA  ASP C  21      38.303 105.144  71.575  1.00 68.39           C  
ATOM   6740  C   ASP C  21      37.042 104.626  72.233  1.00 65.65           C  
ATOM   6741  O   ASP C  21      36.920 103.432  72.516  1.00 64.44           O  
ATOM   6742  CB  ASP C  21      39.527 104.629  72.333  1.00 72.74           C  
ATOM   6743  CG  ASP C  21      40.755 104.509  71.448  1.00 74.58           C  
ATOM   6744  OD1 ASP C  21      40.979 105.442  70.637  1.00 75.19           O  
ATOM   6745  OD2 ASP C  21      41.487 103.491  71.577  1.00 73.58           O  
ATOM   6746  N   LEU C  22      36.113 105.547  72.466  1.00 62.86           N  
ATOM   6747  CA  LEU C  22      34.825 105.254  73.073  1.00 59.91           C  
ATOM   6748  C   LEU C  22      33.904 104.435  72.169  1.00 57.39           C  
ATOM   6749  O   LEU C  22      33.674 104.781  71.021  1.00 56.00           O  
ATOM   6750  CB  LEU C  22      34.144 106.559  73.413  1.00 62.07           C  
ATOM   6751  CG  LEU C  22      32.636 106.484  73.570  1.00 64.87           C  
ATOM   6752  CD1 LEU C  22      32.249 106.022  74.977  1.00 66.63           C  
ATOM   6753  CD2 LEU C  22      32.096 107.865  73.286  1.00 66.90           C  
ATOM   6754  N   PRO C  23      33.369 103.330  72.686  1.00 55.87           N  
ATOM   6755  CA  PRO C  23      32.467 102.448  71.941  1.00 56.76           C  
ATOM   6756  C   PRO C  23      31.055 103.008  71.694  1.00 58.08           C  
ATOM   6757  O   PRO C  23      30.307 103.328  72.633  1.00 60.17           O  
ATOM   6758  CB  PRO C  23      32.444 101.186  72.804  1.00 56.07           C  
ATOM   6759  CG  PRO C  23      33.802 101.191  73.412  1.00 55.05           C  
ATOM   6760  CD  PRO C  23      33.936 102.621  73.840  1.00 54.97           C  
ATOM   6761  N   ALA C  24      30.686 103.115  70.423  1.00 57.06           N  
ATOM   6762  CA  ALA C  24      29.373 103.633  70.053  1.00 56.25           C  
ATOM   6763  C   ALA C  24      28.630 102.684  69.131  1.00 56.01           C  
ATOM   6764  O   ALA C  24      29.221 102.074  68.242  1.00 55.95           O  
ATOM   6765  CB  ALA C  24      29.526 104.971  69.371  1.00 55.32           C  
ATOM   6766  N   PRO C  25      27.316 102.548  69.323  1.00 56.02           N  
ATOM   6767  CA  PRO C  25      26.548 101.652  68.461  1.00 57.34           C  
ATOM   6768  C   PRO C  25      26.776 102.051  67.003  1.00 58.20           C  
ATOM   6769  O   PRO C  25      26.894 103.235  66.681  1.00 60.86           O  
ATOM   6770  CB  PRO C  25      25.115 101.896  68.910  1.00 58.22           C  
ATOM   6771  CG  PRO C  25      25.271 102.257  70.346  1.00 56.81           C  
ATOM   6772  CD  PRO C  25      26.441 103.202  70.305  1.00 56.18           C  
ATOM   6773  N   SER C  26      26.837 101.073  66.119  1.00 56.18           N  
ATOM   6774  CA  SER C  26      27.076 101.372  64.725  1.00 54.85           C  
ATOM   6775  C   SER C  26      25.859 101.971  64.042  1.00 54.85           C  
ATOM   6776  O   SER C  26      25.962 102.545  62.959  1.00 55.33           O  
ATOM   6777  CB  SER C  26      27.473 100.089  64.007  1.00 54.79           C  
ATOM   6778  OG  SER C  26      26.529  99.061  64.267  1.00 53.71           O  
ATOM   6779  N   ASN C  27      24.705 101.867  64.683  1.00 54.58           N  
ATOM   6780  CA  ASN C  27      23.487 102.332  64.047  1.00 54.65           C  
ATOM   6781  C   ASN C  27      22.761 103.523  64.631  1.00 55.88           C  
ATOM   6782  O   ASN C  27      21.559 103.677  64.388  1.00 57.98           O  
ATOM   6783  CB  ASN C  27      22.503 101.185  63.993  1.00 52.29           C  
ATOM   6784  CG  ASN C  27      22.046 100.789  65.356  1.00 52.64           C  
ATOM   6785  OD1 ASN C  27      22.867 100.513  66.245  1.00 51.51           O  
ATOM   6786  ND2 ASN C  27      20.732 100.761  65.550  1.00 53.61           N  
ATOM   6787  N   ILE C  28      23.433 104.372  65.394  1.00 56.17           N  
ATOM   6788  CA  ILE C  28      22.694 105.501  65.928  1.00 56.55           C  
ATOM   6789  C   ILE C  28      22.468 106.489  64.803  1.00 56.69           C  
ATOM   6790  O   ILE C  28      23.363 106.730  63.973  1.00 56.39           O  
ATOM   6791  CB  ILE C  28      23.407 106.153  67.108  1.00 57.28           C  
ATOM   6792  CG1 ILE C  28      24.870 106.392  66.761  1.00 58.05           C  
ATOM   6793  CG2 ILE C  28      23.265 105.263  68.338  1.00 57.08           C  
ATOM   6794  CD1 ILE C  28      25.644 107.023  67.880  1.00 60.21           C  
ATOM   6795  N   SER C  29      21.245 107.027  64.774  1.00 56.59           N  
ATOM   6796  CA  SER C  29      20.802 107.962  63.744  1.00 55.21           C  
ATOM   6797  C   SER C  29      21.088 109.409  64.056  1.00 54.75           C  
ATOM   6798  O   SER C  29      21.883 109.731  64.946  1.00 56.20           O  
ATOM   6799  CB  SER C  29      19.308 107.802  63.498  1.00 54.72           C  
ATOM   6800  OG  SER C  29      18.579 108.099  64.670  1.00 54.43           O  
ATOM   6801  N   ALA C  30      20.445 110.284  63.294  1.00 53.04           N  
ATOM   6802  CA  ALA C  30      20.630 111.706  63.471  1.00 51.71           C  
ATOM   6803  C   ALA C  30      20.064 112.152  64.813  1.00 52.20           C  
ATOM   6804  O   ALA C  30      20.549 113.112  65.409  1.00 52.29           O  
ATOM   6805  CB  ALA C  30      19.969 112.450  62.340  1.00 49.59           C  
ATOM   6806  N   TRP C  31      19.052 111.454  65.314  1.00 52.48           N  
ATOM   6807  CA  TRP C  31      18.485 111.856  66.589  1.00 52.83           C  
ATOM   6808  C   TRP C  31      19.509 111.843  67.715  1.00 51.97           C  
ATOM   6809  O   TRP C  31      19.286 112.410  68.775  1.00 53.39           O  
ATOM   6810  CB  TRP C  31      17.281 110.985  66.940  1.00 53.36           C  
ATOM   6811  CG  TRP C  31      16.197 111.116  65.937  1.00 53.77           C  
ATOM   6812  CD1 TRP C  31      15.849 110.196  65.015  1.00 54.71           C  
ATOM   6813  CD2 TRP C  31      15.401 112.279  65.669  1.00 54.95           C  
ATOM   6814  NE1 TRP C  31      14.895 110.703  64.173  1.00 57.38           N  
ATOM   6815  CE2 TRP C  31      14.599 111.983  64.550  1.00 56.25           C  
ATOM   6816  CE3 TRP C  31      15.292 113.543  66.261  1.00 54.82           C  
ATOM   6817  CZ2 TRP C  31      13.697 112.900  63.999  1.00 55.73           C  
ATOM   6818  CZ3 TRP C  31      14.398 114.461  65.716  1.00 55.63           C  
ATOM   6819  CH2 TRP C  31      13.610 114.130  64.592  1.00 55.54           C  
ATOM   6820  N   TRP C  32      20.646 111.220  67.478  1.00 51.49           N  
ATOM   6821  CA  TRP C  32      21.692 111.157  68.483  1.00 51.47           C  
ATOM   6822  C   TRP C  32      22.714 112.291  68.289  1.00 51.48           C  
ATOM   6823  O   TRP C  32      23.772 112.307  68.919  1.00 53.42           O  
ATOM   6824  CB  TRP C  32      22.379 109.786  68.407  1.00 51.07           C  
ATOM   6825  CG  TRP C  32      21.809 108.752  69.344  1.00 50.09           C  
ATOM   6826  CD1 TRP C  32      22.336 108.367  70.537  1.00 50.74           C  
ATOM   6827  CD2 TRP C  32      20.590 108.010  69.189  1.00 49.93           C  
ATOM   6828  NE1 TRP C  32      21.527 107.438  71.137  1.00 50.59           N  
ATOM   6829  CE2 TRP C  32      20.446 107.201  70.332  1.00 49.87           C  
ATOM   6830  CE3 TRP C  32      19.601 107.951  68.198  1.00 51.04           C  
ATOM   6831  CZ2 TRP C  32      19.348 106.341  70.515  1.00 49.46           C  
ATOM   6832  CZ3 TRP C  32      18.501 107.086  68.384  1.00 48.49           C  
ATOM   6833  CH2 TRP C  32      18.391 106.301  69.530  1.00 47.04           C  
ATOM   6834  N   ASN C  33      22.394 113.253  67.435  1.00 49.93           N  
ATOM   6835  CA  ASN C  33      23.318 114.349  67.171  1.00 49.89           C  
ATOM   6836  C   ASN C  33      23.066 115.524  68.086  1.00 49.94           C  
ATOM   6837  O   ASN C  33      23.921 116.385  68.263  1.00 52.42           O  
ATOM   6838  CB  ASN C  33      23.184 114.834  65.716  1.00 50.81           C  
ATOM   6839  CG  ASN C  33      24.021 114.022  64.728  1.00 52.55           C  
ATOM   6840  OD1 ASN C  33      23.832 112.804  64.551  1.00 52.80           O  
ATOM   6841  ND2 ASN C  33      24.954 114.703  64.072  1.00 51.97           N  
ATOM   6842  N   PHE C  34      21.892 115.563  68.684  1.00 48.28           N  
ATOM   6843  CA  PHE C  34      21.545 116.686  69.530  1.00 46.52           C  
ATOM   6844  C   PHE C  34      22.356 116.846  70.812  1.00 47.62           C  
ATOM   6845  O   PHE C  34      22.455 117.962  71.344  1.00 48.62           O  
ATOM   6846  CB  PHE C  34      20.029 116.647  69.777  1.00 42.08           C  
ATOM   6847  CG  PHE C  34      19.249 116.780  68.509  1.00 36.33           C  
ATOM   6848  CD1 PHE C  34      19.237 117.983  67.815  1.00 33.68           C  
ATOM   6849  CD2 PHE C  34      18.683 115.676  67.911  1.00 35.43           C  
ATOM   6850  CE1 PHE C  34      18.691 118.083  66.545  1.00 30.13           C  
ATOM   6851  CE2 PHE C  34      18.133 115.776  66.628  1.00 33.94           C  
ATOM   6852  CZ  PHE C  34      18.145 116.985  65.953  1.00 30.49           C  
ATOM   6853  N   GLY C  35      22.952 115.753  71.293  1.00 47.68           N  
ATOM   6854  CA  GLY C  35      23.772 115.828  72.496  1.00 47.23           C  
ATOM   6855  C   GLY C  35      24.940 116.785  72.270  1.00 47.67           C  
ATOM   6856  O   GLY C  35      25.108 117.782  72.978  1.00 46.20           O  
ATOM   6857  N   SER C  36      25.752 116.494  71.262  1.00 47.56           N  
ATOM   6858  CA  SER C  36      26.882 117.350  70.955  1.00 48.60           C  
ATOM   6859  C   SER C  36      26.425 118.762  70.651  1.00 49.13           C  
ATOM   6860  O   SER C  36      27.053 119.722  71.100  1.00 49.11           O  
ATOM   6861  CB  SER C  36      27.668 116.795  69.774  1.00 48.38           C  
ATOM   6862  OG  SER C  36      26.795 116.312  68.784  1.00 50.15           O  
ATOM   6863  N   LEU C  37      25.339 118.903  69.887  1.00 49.62           N  
ATOM   6864  CA  LEU C  37      24.828 120.244  69.570  1.00 47.99           C  
ATOM   6865  C   LEU C  37      24.532 120.979  70.869  1.00 45.80           C  
ATOM   6866  O   LEU C  37      24.975 122.114  71.063  1.00 45.99           O  
ATOM   6867  CB  LEU C  37      23.560 120.178  68.715  1.00 48.74           C  
ATOM   6868  CG  LEU C  37      23.759 119.707  67.271  1.00 50.95           C  
ATOM   6869  CD1 LEU C  37      22.424 119.725  66.561  1.00 51.37           C  
ATOM   6870  CD2 LEU C  37      24.755 120.596  66.543  1.00 50.13           C  
ATOM   6871  N   LEU C  38      23.795 120.328  71.763  1.00 42.35           N  
ATOM   6872  CA  LEU C  38      23.483 120.941  73.037  1.00 38.83           C  
ATOM   6873  C   LEU C  38      24.760 121.427  73.662  1.00 37.24           C  
ATOM   6874  O   LEU C  38      24.848 122.568  74.075  1.00 35.47           O  
ATOM   6875  CB  LEU C  38      22.779 119.951  73.949  1.00 36.69           C  
ATOM   6876  CG  LEU C  38      21.342 119.816  73.467  1.00 35.36           C  
ATOM   6877  CD1 LEU C  38      20.627 118.759  74.232  1.00 36.05           C  
ATOM   6878  CD2 LEU C  38      20.649 121.138  73.640  1.00 35.70           C  
ATOM   6879  N   ALA C  39      25.763 120.561  73.702  1.00 39.07           N  
ATOM   6880  CA  ALA C  39      27.063 120.922  74.272  1.00 38.89           C  
ATOM   6881  C   ALA C  39      27.657 122.118  73.532  1.00 39.27           C  
ATOM   6882  O   ALA C  39      27.935 123.139  74.146  1.00 40.55           O  
ATOM   6883  CB  ALA C  39      28.013 119.746  74.196  1.00 36.67           C  
ATOM   6884  N   VAL C  40      27.841 122.001  72.220  1.00 39.69           N  
ATOM   6885  CA  VAL C  40      28.406 123.099  71.432  1.00 42.69           C  
ATOM   6886  C   VAL C  40      27.626 124.388  71.645  1.00 45.22           C  
ATOM   6887  O   VAL C  40      28.178 125.467  71.839  1.00 44.99           O  
ATOM   6888  CB  VAL C  40      28.364 122.778  69.960  1.00 41.36           C  
ATOM   6889  CG1 VAL C  40      28.873 123.952  69.159  1.00 38.93           C  
ATOM   6890  CG2 VAL C  40      29.190 121.562  69.706  1.00 42.52           C  
ATOM   6891  N   CYS C  41      26.318 124.242  71.587  1.00 47.68           N  
ATOM   6892  CA  CYS C  41      25.394 125.332  71.798  1.00 49.25           C  
ATOM   6893  C   CYS C  41      25.762 126.067  73.116  1.00 47.37           C  
ATOM   6894  O   CYS C  41      25.871 127.289  73.169  1.00 46.01           O  
ATOM   6895  CB  CYS C  41      23.999 124.706  71.868  1.00 52.15           C  
ATOM   6896  SG  CYS C  41      22.657 125.796  71.587  1.00 60.09           S  
ATOM   6897  N   LEU C  42      25.965 125.291  74.172  1.00 45.98           N  
ATOM   6898  CA  LEU C  42      26.316 125.809  75.481  1.00 45.46           C  
ATOM   6899  C   LEU C  42      27.612 126.591  75.483  1.00 48.36           C  
ATOM   6900  O   LEU C  42      27.713 127.614  76.153  1.00 49.98           O  
ATOM   6901  CB  LEU C  42      26.450 124.666  76.478  1.00 42.87           C  
ATOM   6902  CG  LEU C  42      26.889 125.112  77.864  1.00 41.86           C  
ATOM   6903  CD1 LEU C  42      25.792 125.929  78.448  1.00 43.21           C  
ATOM   6904  CD2 LEU C  42      27.167 123.937  78.768  1.00 42.65           C  
ATOM   6905  N   MET C  43      28.625 126.105  74.771  1.00 49.81           N  
ATOM   6906  CA  MET C  43      29.890 126.815  74.739  1.00 50.18           C  
ATOM   6907  C   MET C  43      29.684 128.147  74.051  1.00 48.52           C  
ATOM   6908  O   MET C  43      30.165 129.173  74.499  1.00 49.33           O  
ATOM   6909  CB  MET C  43      30.931 125.991  74.014  1.00 55.84           C  
ATOM   6910  CG  MET C  43      31.321 124.734  74.775  1.00 66.52           C  
ATOM   6911  SD  MET C  43      32.542 123.675  73.878  1.00 80.19           S  
ATOM   6912  CE  MET C  43      34.167 124.232  74.691  1.00 77.94           C  
ATOM   6913  N   THR C  44      28.924 128.133  72.972  1.00 47.77           N  
ATOM   6914  CA  THR C  44      28.630 129.337  72.208  1.00 46.72           C  
ATOM   6915  C   THR C  44      27.922 130.399  73.047  1.00 47.02           C  
ATOM   6916  O   THR C  44      28.246 131.584  72.969  1.00 46.09           O  
ATOM   6917  CB  THR C  44      27.733 128.985  71.042  1.00 47.11           C  
ATOM   6918  OG1 THR C  44      28.238 127.801  70.435  1.00 48.40           O  
ATOM   6919  CG2 THR C  44      27.696 130.095  70.013  1.00 47.04           C  
ATOM   6920  N   GLN C  45      26.936 129.979  73.836  1.00 47.12           N  
ATOM   6921  CA  GLN C  45      26.202 130.925  74.671  1.00 46.90           C  
ATOM   6922  C   GLN C  45      27.138 131.626  75.637  1.00 46.28           C  
ATOM   6923  O   GLN C  45      27.138 132.861  75.739  1.00 47.08           O  
ATOM   6924  CB  GLN C  45      25.086 130.228  75.461  1.00 45.73           C  
ATOM   6925  CG  GLN C  45      23.834 129.939  74.657  1.00 47.50           C  
ATOM   6926  CD  GLN C  45      23.381 131.124  73.806  1.00 48.29           C  
ATOM   6927  OE1 GLN C  45      23.960 131.405  72.743  1.00 50.32           O  
ATOM   6928  NE2 GLN C  45      22.355 131.827  74.271  1.00 45.24           N  
ATOM   6929  N   ILE C  46      27.927 130.821  76.346  1.00 45.02           N  
ATOM   6930  CA  ILE C  46      28.895 131.313  77.316  1.00 42.84           C  
ATOM   6931  C   ILE C  46      29.872 132.264  76.649  1.00 42.31           C  
ATOM   6932  O   ILE C  46      30.140 133.345  77.154  1.00 43.85           O  
ATOM   6933  CB  ILE C  46      29.658 130.154  77.934  1.00 41.90           C  
ATOM   6934  CG1 ILE C  46      28.742 129.422  78.912  1.00 42.38           C  
ATOM   6935  CG2 ILE C  46      30.903 130.649  78.599  1.00 39.23           C  
ATOM   6936  CD1 ILE C  46      29.232 128.048  79.297  1.00 43.77           C  
ATOM   6937  N   LEU C  47      30.390 131.876  75.498  1.00 40.19           N  
ATOM   6938  CA  LEU C  47      31.317 132.732  74.808  1.00 39.37           C  
ATOM   6939  C   LEU C  47      30.685 134.069  74.413  1.00 38.91           C  
ATOM   6940  O   LEU C  47      31.192 135.120  74.795  1.00 38.47           O  
ATOM   6941  CB  LEU C  47      31.862 132.010  73.592  1.00 41.64           C  
ATOM   6942  CG  LEU C  47      32.962 132.800  72.886  1.00 44.28           C  
ATOM   6943  CD1 LEU C  47      34.079 133.157  73.865  1.00 43.76           C  
ATOM   6944  CD2 LEU C  47      33.501 131.961  71.748  1.00 45.25           C  
ATOM   6945  N   THR C  48      29.585 134.043  73.658  1.00 39.15           N  
ATOM   6946  CA  THR C  48      28.899 135.289  73.259  1.00 38.39           C  
ATOM   6947  C   THR C  48      28.420 136.058  74.500  1.00 38.87           C  
ATOM   6948  O   THR C  48      28.542 137.283  74.586  1.00 36.82           O  
ATOM   6949  CB  THR C  48      27.663 135.011  72.352  1.00 37.87           C  
ATOM   6950  OG1 THR C  48      26.701 134.202  73.048  1.00 38.61           O  
ATOM   6951  CG2 THR C  48      28.090 134.301  71.093  1.00 34.99           C  
ATOM   6952  N   GLY C  49      27.881 135.316  75.462  1.00 39.14           N  
ATOM   6953  CA  GLY C  49      27.406 135.917  76.687  1.00 39.61           C  
ATOM   6954  C   GLY C  49      28.460 136.736  77.406  1.00 41.22           C  
ATOM   6955  O   GLY C  49      28.164 137.825  77.884  1.00 41.15           O  
ATOM   6956  N   LEU C  50      29.680 136.212  77.521  1.00 42.52           N  
ATOM   6957  CA  LEU C  50      30.753 136.944  78.196  1.00 43.18           C  
ATOM   6958  C   LEU C  50      31.057 138.216  77.412  1.00 44.10           C  
ATOM   6959  O   LEU C  50      31.152 139.317  77.977  1.00 43.43           O  
ATOM   6960  CB  LEU C  50      32.022 136.099  78.292  1.00 42.70           C  
ATOM   6961  CG  LEU C  50      32.078 134.999  79.360  1.00 43.50           C  
ATOM   6962  CD1 LEU C  50      33.304 134.136  79.079  1.00 42.18           C  
ATOM   6963  CD2 LEU C  50      32.136 135.576  80.772  1.00 38.96           C  
ATOM   6964  N   LEU C  51      31.215 138.059  76.105  1.00 43.69           N  
ATOM   6965  CA  LEU C  51      31.483 139.202  75.263  1.00 43.86           C  
ATOM   6966  C   LEU C  51      30.417 140.280  75.477  1.00 43.21           C  
ATOM   6967  O   LEU C  51      30.732 141.466  75.433  1.00 43.84           O  
ATOM   6968  CB  LEU C  51      31.547 138.768  73.791  1.00 46.37           C  
ATOM   6969  CG  LEU C  51      32.933 138.296  73.308  1.00 46.33           C  
ATOM   6970  CD1 LEU C  51      32.856 137.633  71.934  1.00 44.94           C  
ATOM   6971  CD2 LEU C  51      33.855 139.512  73.248  1.00 45.93           C  
ATOM   6972  N   LEU C  52      29.166 139.880  75.723  1.00 42.30           N  
ATOM   6973  CA  LEU C  52      28.091 140.856  75.947  1.00 40.83           C  
ATOM   6974  C   LEU C  52      28.115 141.453  77.327  1.00 42.39           C  
ATOM   6975  O   LEU C  52      27.763 142.617  77.509  1.00 43.18           O  
ATOM   6976  CB  LEU C  52      26.720 140.244  75.792  1.00 37.23           C  
ATOM   6977  CG  LEU C  52      26.184 139.874  74.433  1.00 35.16           C  
ATOM   6978  CD1 LEU C  52      24.728 139.667  74.645  1.00 33.57           C  
ATOM   6979  CD2 LEU C  52      26.423 140.938  73.395  1.00 34.61           C  
ATOM   6980  N   ALA C  53      28.492 140.636  78.303  1.00 44.85           N  
ATOM   6981  CA  ALA C  53      28.553 141.069  79.692  1.00 46.98           C  
ATOM   6982  C   ALA C  53      29.662 142.084  79.909  1.00 48.90           C  
ATOM   6983  O   ALA C  53      29.679 142.787  80.910  1.00 50.15           O  
ATOM   6984  CB  ALA C  53      28.756 139.870  80.599  1.00 45.81           C  
ATOM   6985  N   MET C  54      30.597 142.164  78.976  1.00 50.84           N  
ATOM   6986  CA  MET C  54      31.670 143.122  79.132  1.00 53.30           C  
ATOM   6987  C   MET C  54      31.254 144.502  78.682  1.00 53.04           C  
ATOM   6988  O   MET C  54      32.088 145.420  78.633  1.00 56.99           O  
ATOM   6989  CB  MET C  54      32.888 142.692  78.343  1.00 54.97           C  
ATOM   6990  CG  MET C  54      33.351 141.368  78.767  1.00 58.35           C  
ATOM   6991  SD  MET C  54      34.796 140.963  77.871  1.00 65.34           S  
ATOM   6992  CE  MET C  54      35.447 139.564  79.008  1.00 60.03           C  
ATOM   6993  N   HIS C  55      29.980 144.663  78.353  1.00 48.92           N  
ATOM   6994  CA  HIS C  55      29.512 145.957  77.913  1.00 46.95           C  
ATOM   6995  C   HIS C  55      28.158 146.291  78.513  1.00 47.74           C  
ATOM   6996  O   HIS C  55      27.595 147.365  78.269  1.00 48.88           O  
ATOM   6997  CB  HIS C  55      29.438 145.992  76.389  1.00 44.47           C  
ATOM   6998  CG  HIS C  55      30.772 145.934  75.714  1.00 44.81           C  
ATOM   6999  ND1 HIS C  55      31.261 144.787  75.126  1.00 44.88           N  
ATOM   7000  CD2 HIS C  55      31.706 146.894  75.497  1.00 45.70           C  
ATOM   7001  CE1 HIS C  55      32.433 145.045  74.567  1.00 46.48           C  
ATOM   7002  NE2 HIS C  55      32.728 146.316  74.778  1.00 44.60           N  
ATOM   7003  N   TYR C  56      27.642 145.374  79.316  1.00 47.44           N  
ATOM   7004  CA  TYR C  56      26.335 145.551  79.929  1.00 47.47           C  
ATOM   7005  C   TYR C  56      26.447 146.257  81.254  1.00 47.81           C  
ATOM   7006  O   TYR C  56      27.491 146.230  81.887  1.00 48.45           O  
ATOM   7007  CB  TYR C  56      25.689 144.182  80.146  1.00 47.38           C  
ATOM   7008  CG  TYR C  56      24.357 144.197  80.862  1.00 46.48           C  
ATOM   7009  CD1 TYR C  56      23.199 144.617  80.212  1.00 47.34           C  
ATOM   7010  CD2 TYR C  56      24.249 143.759  82.180  1.00 45.78           C  
ATOM   7011  CE1 TYR C  56      21.958 144.597  80.853  1.00 46.78           C  
ATOM   7012  CE2 TYR C  56      23.027 143.737  82.829  1.00 46.45           C  
ATOM   7013  CZ  TYR C  56      21.879 144.159  82.160  1.00 47.05           C  
ATOM   7014  OH  TYR C  56      20.661 144.149  82.804  1.00 45.85           O  
ATOM   7015  N   THR C  57      25.373 146.908  81.674  1.00 49.05           N  
ATOM   7016  CA  THR C  57      25.378 147.557  82.974  1.00 50.88           C  
ATOM   7017  C   THR C  57      24.090 147.137  83.638  1.00 50.37           C  
ATOM   7018  O   THR C  57      23.024 147.384  83.116  1.00 51.80           O  
ATOM   7019  CB  THR C  57      25.425 149.090  82.891  1.00 51.01           C  
ATOM   7020  OG1 THR C  57      26.683 149.513  82.346  1.00 54.82           O  
ATOM   7021  CG2 THR C  57      25.288 149.675  84.286  1.00 49.96           C  
ATOM   7022  N   ALA C  58      24.196 146.479  84.782  1.00 50.57           N  
ATOM   7023  CA  ALA C  58      23.026 146.005  85.494  1.00 50.99           C  
ATOM   7024  C   ALA C  58      22.454 147.055  86.416  1.00 52.35           C  
ATOM   7025  O   ALA C  58      22.658 147.031  87.637  1.00 53.52           O  
ATOM   7026  CB  ALA C  58      23.366 144.754  86.279  1.00 50.10           C  
ATOM   7027  N   ASP C  59      21.738 147.995  85.829  1.00 53.21           N  
ATOM   7028  CA  ASP C  59      21.114 149.022  86.619  1.00 54.65           C  
ATOM   7029  C   ASP C  59      19.936 149.470  85.820  1.00 53.53           C  
ATOM   7030  O   ASP C  59      20.080 149.751  84.640  1.00 53.22           O  
ATOM   7031  CB  ASP C  59      22.059 150.184  86.839  1.00 58.70           C  
ATOM   7032  CG  ASP C  59      21.482 151.207  87.786  1.00 63.13           C  
ATOM   7033  OD1 ASP C  59      21.564 150.997  89.031  1.00 64.52           O  
ATOM   7034  OD2 ASP C  59      20.928 152.207  87.274  1.00 64.01           O  
ATOM   7035  N   THR C  60      18.772 149.531  86.452  1.00 53.69           N  
ATOM   7036  CA  THR C  60      17.556 149.935  85.753  1.00 56.02           C  
ATOM   7037  C   THR C  60      17.748 151.163  84.859  1.00 55.76           C  
ATOM   7038  O   THR C  60      17.309 151.177  83.707  1.00 56.64           O  
ATOM   7039  CB  THR C  60      16.393 150.200  86.742  1.00 57.55           C  
ATOM   7040  OG1 THR C  60      16.727 151.280  87.625  1.00 60.09           O  
ATOM   7041  CG2 THR C  60      16.113 148.963  87.562  1.00 57.28           C  
ATOM   7042  N   SER C  61      18.433 152.175  85.372  1.00 55.13           N  
ATOM   7043  CA  SER C  61      18.665 153.392  84.607  1.00 55.16           C  
ATOM   7044  C   SER C  61      19.671 153.264  83.466  1.00 53.28           C  
ATOM   7045  O   SER C  61      19.841 154.210  82.710  1.00 53.34           O  
ATOM   7046  CB  SER C  61      19.157 154.505  85.526  1.00 58.45           C  
ATOM   7047  OG  SER C  61      20.532 154.317  85.848  1.00 63.12           O  
ATOM   7048  N   LEU C  62      20.344 152.125  83.337  1.00 51.11           N  
ATOM   7049  CA  LEU C  62      21.327 151.977  82.273  1.00 49.07           C  
ATOM   7050  C   LEU C  62      21.264 150.672  81.473  1.00 49.92           C  
ATOM   7051  O   LEU C  62      21.915 150.537  80.426  1.00 51.16           O  
ATOM   7052  CB  LEU C  62      22.715 152.129  82.866  1.00 48.47           C  
ATOM   7053  CG  LEU C  62      22.949 153.414  83.642  1.00 47.98           C  
ATOM   7054  CD1 LEU C  62      24.277 153.354  84.340  1.00 48.04           C  
ATOM   7055  CD2 LEU C  62      22.901 154.590  82.686  1.00 47.88           C  
ATOM   7056  N   ALA C  63      20.484 149.712  81.956  1.00 48.58           N  
ATOM   7057  CA  ALA C  63      20.360 148.425  81.284  1.00 46.11           C  
ATOM   7058  C   ALA C  63      19.978 148.541  79.823  1.00 45.16           C  
ATOM   7059  O   ALA C  63      20.734 148.179  78.927  1.00 46.01           O  
ATOM   7060  CB  ALA C  63      19.337 147.588  81.990  1.00 47.13           C  
ATOM   7061  N   PHE C  64      18.783 149.050  79.591  1.00 43.93           N  
ATOM   7062  CA  PHE C  64      18.269 149.177  78.245  1.00 41.82           C  
ATOM   7063  C   PHE C  64      19.253 149.843  77.306  1.00 41.32           C  
ATOM   7064  O   PHE C  64      19.491 149.365  76.193  1.00 40.94           O  
ATOM   7065  CB  PHE C  64      16.957 149.969  78.275  1.00 42.08           C  
ATOM   7066  CG  PHE C  64      16.264 150.053  76.946  1.00 38.02           C  
ATOM   7067  CD1 PHE C  64      15.338 149.108  76.583  1.00 37.83           C  
ATOM   7068  CD2 PHE C  64      16.577 151.058  76.043  1.00 36.56           C  
ATOM   7069  CE1 PHE C  64      14.720 149.148  75.325  1.00 37.91           C  
ATOM   7070  CE2 PHE C  64      15.972 151.101  74.804  1.00 36.94           C  
ATOM   7071  CZ  PHE C  64      15.036 150.135  74.442  1.00 36.06           C  
ATOM   7072  N   SER C  65      19.827 150.948  77.751  1.00 41.06           N  
ATOM   7073  CA  SER C  65      20.753 151.684  76.904  1.00 44.30           C  
ATOM   7074  C   SER C  65      22.149 151.059  76.762  1.00 44.69           C  
ATOM   7075  O   SER C  65      22.865 151.319  75.770  1.00 45.45           O  
ATOM   7076  CB  SER C  65      20.887 153.114  77.412  1.00 45.07           C  
ATOM   7077  OG  SER C  65      21.366 153.111  78.745  1.00 51.40           O  
ATOM   7078  N   SER C  66      22.549 150.260  77.751  1.00 42.55           N  
ATOM   7079  CA  SER C  66      23.847 149.610  77.694  1.00 41.40           C  
ATOM   7080  C   SER C  66      23.810 148.616  76.536  1.00 41.48           C  
ATOM   7081  O   SER C  66      24.764 148.499  75.742  1.00 42.02           O  
ATOM   7082  CB  SER C  66      24.138 148.893  79.011  1.00 41.28           C  
ATOM   7083  OG  SER C  66      23.308 147.777  79.182  1.00 40.28           O  
ATOM   7084  N   VAL C  67      22.684 147.924  76.447  1.00 39.28           N  
ATOM   7085  CA  VAL C  67      22.449 146.955  75.407  1.00 38.18           C  
ATOM   7086  C   VAL C  67      22.419 147.690  74.076  1.00 39.31           C  
ATOM   7087  O   VAL C  67      22.969 147.225  73.079  1.00 40.27           O  
ATOM   7088  CB  VAL C  67      21.091 146.272  75.621  1.00 38.63           C  
ATOM   7089  CG1 VAL C  67      20.754 145.408  74.428  1.00 38.68           C  
ATOM   7090  CG2 VAL C  67      21.104 145.443  76.903  1.00 35.84           C  
ATOM   7091  N   ALA C  68      21.773 148.848  74.052  1.00 39.73           N  
ATOM   7092  CA  ALA C  68      21.671 149.595  72.804  1.00 41.00           C  
ATOM   7093  C   ALA C  68      23.021 150.128  72.411  1.00 41.84           C  
ATOM   7094  O   ALA C  68      23.346 150.186  71.224  1.00 41.59           O  
ATOM   7095  CB  ALA C  68      20.674 150.739  72.942  1.00 40.36           C  
ATOM   7096  N   HIS C  69      23.803 150.528  73.412  1.00 42.54           N  
ATOM   7097  CA  HIS C  69      25.121 151.061  73.150  1.00 43.72           C  
ATOM   7098  C   HIS C  69      25.952 149.918  72.582  1.00 42.07           C  
ATOM   7099  O   HIS C  69      26.746 150.100  71.647  1.00 41.14           O  
ATOM   7100  CB  HIS C  69      25.711 151.647  74.446  1.00 51.58           C  
ATOM   7101  CG  HIS C  69      27.221 151.600  74.530  1.00 60.64           C  
ATOM   7102  ND1 HIS C  69      27.909 150.564  75.142  1.00 62.46           N  
ATOM   7103  CD2 HIS C  69      28.169 152.461  74.075  1.00 60.52           C  
ATOM   7104  CE1 HIS C  69      29.210 150.791  75.055  1.00 62.94           C  
ATOM   7105  NE2 HIS C  69      29.393 151.934  74.413  1.00 62.87           N  
ATOM   7106  N   THR C  70      25.743 148.726  73.119  1.00 38.94           N  
ATOM   7107  CA  THR C  70      26.483 147.586  72.632  1.00 38.55           C  
ATOM   7108  C   THR C  70      26.194 147.333  71.168  1.00 41.22           C  
ATOM   7109  O   THR C  70      27.100 147.045  70.409  1.00 44.39           O  
ATOM   7110  CB  THR C  70      26.130 146.323  73.381  1.00 36.25           C  
ATOM   7111  OG1 THR C  70      26.311 146.537  74.774  1.00 37.67           O  
ATOM   7112  CG2 THR C  70      27.009 145.199  72.953  1.00 33.41           C  
ATOM   7113  N   CYS C  71      24.938 147.434  70.757  1.00 42.63           N  
ATOM   7114  CA  CYS C  71      24.602 147.169  69.366  1.00 44.07           C  
ATOM   7115  C   CYS C  71      25.036 148.277  68.433  1.00 45.86           C  
ATOM   7116  O   CYS C  71      25.526 148.022  67.324  1.00 46.95           O  
ATOM   7117  CB  CYS C  71      23.110 146.953  69.238  1.00 45.18           C  
ATOM   7118  SG  CYS C  71      22.548 145.584  70.243  1.00 49.12           S  
ATOM   7119  N   ARG C  72      24.876 149.509  68.899  1.00 47.20           N  
ATOM   7120  CA  ARG C  72      25.219 150.687  68.112  1.00 48.95           C  
ATOM   7121  C   ARG C  72      26.686 151.156  68.066  1.00 51.62           C  
ATOM   7122  O   ARG C  72      27.101 151.778  67.071  1.00 52.75           O  
ATOM   7123  CB  ARG C  72      24.359 151.854  68.571  1.00 46.44           C  
ATOM   7124  CG  ARG C  72      22.922 151.724  68.217  1.00 44.36           C  
ATOM   7125  CD  ARG C  72      22.162 152.904  68.746  1.00 44.44           C  
ATOM   7126  NE  ARG C  72      20.724 152.749  68.569  1.00 44.20           N  
ATOM   7127  CZ  ARG C  72      20.105 152.954  67.420  1.00 44.62           C  
ATOM   7128  NH1 ARG C  72      20.821 153.328  66.365  1.00 46.18           N  
ATOM   7129  NH2 ARG C  72      18.793 152.771  67.323  1.00 42.72           N  
ATOM   7130  N   ASN C  73      27.466 150.888  69.117  1.00 52.31           N  
ATOM   7131  CA  ASN C  73      28.853 151.346  69.134  1.00 51.86           C  
ATOM   7132  C   ASN C  73      29.911 150.274  69.159  1.00 51.92           C  
ATOM   7133  O   ASN C  73      30.943 150.434  68.536  1.00 51.61           O  
ATOM   7134  CB  ASN C  73      29.087 152.260  70.322  1.00 52.50           C  
ATOM   7135  CG  ASN C  73      28.130 153.409  70.350  1.00 55.38           C  
ATOM   7136  OD1 ASN C  73      27.855 154.033  69.319  1.00 56.90           O  
ATOM   7137  ND2 ASN C  73      27.615 153.714  71.531  1.00 55.08           N  
ATOM   7138  N   VAL C  74      29.671 149.195  69.895  1.00 51.65           N  
ATOM   7139  CA  VAL C  74      30.651 148.120  69.996  1.00 51.34           C  
ATOM   7140  C   VAL C  74      30.850 147.382  68.673  1.00 52.72           C  
ATOM   7141  O   VAL C  74      29.884 146.996  68.012  1.00 53.95           O  
ATOM   7142  CB  VAL C  74      30.239 147.090  71.082  1.00 50.22           C  
ATOM   7143  CG1 VAL C  74      31.246 145.955  71.121  1.00 48.67           C  
ATOM   7144  CG2 VAL C  74      30.118 147.770  72.441  1.00 45.18           C  
ATOM   7145  N   GLN C  75      32.112 147.187  68.301  1.00 53.38           N  
ATOM   7146  CA  GLN C  75      32.470 146.494  67.064  1.00 53.48           C  
ATOM   7147  C   GLN C  75      31.824 145.114  67.005  1.00 52.54           C  
ATOM   7148  O   GLN C  75      32.236 144.203  67.715  1.00 52.43           O  
ATOM   7149  CB  GLN C  75      33.984 146.349  66.996  1.00 56.01           C  
ATOM   7150  CG  GLN C  75      34.695 147.646  67.201  1.00 58.83           C  
ATOM   7151  CD  GLN C  75      34.158 148.689  66.259  1.00 63.02           C  
ATOM   7152  OE1 GLN C  75      33.599 148.343  65.213  1.00 65.00           O  
ATOM   7153  NE2 GLN C  75      34.325 149.975  66.604  1.00 64.48           N  
ATOM   7154  N   TYR C  76      30.823 144.968  66.146  1.00 51.31           N  
ATOM   7155  CA  TYR C  76      30.081 143.718  65.998  1.00 49.92           C  
ATOM   7156  C   TYR C  76      29.200 143.394  67.202  1.00 47.86           C  
ATOM   7157  O   TYR C  76      28.713 142.271  67.363  1.00 45.83           O  
ATOM   7158  CB  TYR C  76      31.030 142.558  65.711  1.00 50.93           C  
ATOM   7159  CG  TYR C  76      31.756 142.742  64.420  1.00 51.77           C  
ATOM   7160  CD1 TYR C  76      33.029 143.279  64.395  1.00 52.35           C  
ATOM   7161  CD2 TYR C  76      31.133 142.461  63.212  1.00 52.48           C  
ATOM   7162  CE1 TYR C  76      33.662 143.537  63.205  1.00 52.91           C  
ATOM   7163  CE2 TYR C  76      31.751 142.722  62.013  1.00 52.47           C  
ATOM   7164  CZ  TYR C  76      33.019 143.265  62.014  1.00 53.44           C  
ATOM   7165  OH  TYR C  76      33.639 143.576  60.821  1.00 56.79           O  
ATOM   7166  N   GLY C  77      28.995 144.387  68.049  1.00 47.03           N  
ATOM   7167  CA  GLY C  77      28.150 144.163  69.196  1.00 49.59           C  
ATOM   7168  C   GLY C  77      26.803 143.675  68.704  1.00 50.69           C  
ATOM   7169  O   GLY C  77      26.212 142.756  69.272  1.00 52.25           O  
ATOM   7170  N   TRP C  78      26.316 144.280  67.628  1.00 49.69           N  
ATOM   7171  CA  TRP C  78      25.027 143.891  67.083  1.00 48.66           C  
ATOM   7172  C   TRP C  78      24.962 142.418  66.677  1.00 48.38           C  
ATOM   7173  O   TRP C  78      23.926 141.763  66.842  1.00 47.76           O  
ATOM   7174  CB  TRP C  78      24.688 144.769  65.888  1.00 48.25           C  
ATOM   7175  CG  TRP C  78      25.571 144.574  64.717  1.00 45.77           C  
ATOM   7176  CD1 TRP C  78      26.670 145.304  64.381  1.00 47.15           C  
ATOM   7177  CD2 TRP C  78      25.429 143.580  63.716  1.00 44.48           C  
ATOM   7178  NE1 TRP C  78      27.226 144.821  63.216  1.00 43.66           N  
ATOM   7179  CE2 TRP C  78      26.480 143.760  62.791  1.00 43.45           C  
ATOM   7180  CE3 TRP C  78      24.516 142.548  63.509  1.00 44.50           C  
ATOM   7181  CZ2 TRP C  78      26.638 142.954  61.686  1.00 44.54           C  
ATOM   7182  CZ3 TRP C  78      24.671 141.744  62.409  1.00 45.52           C  
ATOM   7183  CH2 TRP C  78      25.724 141.948  61.507  1.00 46.15           C  
ATOM   7184  N   LEU C  79      26.079 141.913  66.151  1.00 48.49           N  
ATOM   7185  CA  LEU C  79      26.200 140.522  65.710  1.00 45.96           C  
ATOM   7186  C   LEU C  79      26.231 139.612  66.921  1.00 45.61           C  
ATOM   7187  O   LEU C  79      25.493 138.632  67.005  1.00 46.25           O  
ATOM   7188  CB  LEU C  79      27.482 140.329  64.907  1.00 42.80           C  
ATOM   7189  CG  LEU C  79      27.798 138.872  64.595  1.00 42.72           C  
ATOM   7190  CD1 LEU C  79      26.583 138.193  64.032  1.00 41.28           C  
ATOM   7191  CD2 LEU C  79      28.946 138.799  63.620  1.00 40.93           C  
ATOM   7192  N   ILE C  80      27.107 139.939  67.858  1.00 44.85           N  
ATOM   7193  CA  ILE C  80      27.233 139.159  69.073  1.00 44.40           C  
ATOM   7194  C   ILE C  80      25.884 139.106  69.790  1.00 44.79           C  
ATOM   7195  O   ILE C  80      25.446 138.036  70.234  1.00 43.23           O  
ATOM   7196  CB  ILE C  80      28.299 139.774  69.969  1.00 43.29           C  
ATOM   7197  CG1 ILE C  80      29.652 139.646  69.285  1.00 44.40           C  
ATOM   7198  CG2 ILE C  80      28.336 139.080  71.308  1.00 42.54           C  
ATOM   7199  CD1 ILE C  80      30.734 140.509  69.918  1.00 46.42           C  
ATOM   7200  N   ARG C  81      25.215 140.256  69.866  1.00 45.32           N  
ATOM   7201  CA  ARG C  81      23.912 140.335  70.517  1.00 45.73           C  
ATOM   7202  C   ARG C  81      22.942 139.406  69.801  1.00 46.18           C  
ATOM   7203  O   ARG C  81      22.279 138.615  70.455  1.00 45.96           O  
ATOM   7204  CB  ARG C  81      23.390 141.771  70.494  1.00 46.39           C  
ATOM   7205  CG  ARG C  81      22.386 142.112  71.591  1.00 45.90           C  
ATOM   7206  CD  ARG C  81      21.106 141.343  71.395  1.00 48.77           C  
ATOM   7207  NE  ARG C  81      20.047 141.704  72.346  1.00 49.28           N  
ATOM   7208  CZ  ARG C  81      19.365 142.845  72.332  1.00 45.17           C  
ATOM   7209  NH1 ARG C  81      19.625 143.759  71.423  1.00 43.12           N  
ATOM   7210  NH2 ARG C  81      18.405 143.052  73.217  1.00 43.05           N  
ATOM   7211  N   ASN C  82      22.871 139.487  68.469  1.00 46.75           N  
ATOM   7212  CA  ASN C  82      21.974 138.610  67.705  1.00 49.05           C  
ATOM   7213  C   ASN C  82      22.290 137.150  68.020  1.00 48.29           C  
ATOM   7214  O   ASN C  82      21.441 136.405  68.519  1.00 48.70           O  
ATOM   7215  CB  ASN C  82      22.086 138.860  66.179  1.00 52.04           C  
ATOM   7216  CG  ASN C  82      21.391 140.183  65.733  1.00 58.71           C  
ATOM   7217  OD1 ASN C  82      21.401 140.553  64.545  1.00 58.96           O  
ATOM   7218  ND2 ASN C  82      20.785 140.892  66.696  1.00 59.22           N  
ATOM   7219  N   LEU C  83      23.522 136.742  67.764  1.00 47.02           N  
ATOM   7220  CA  LEU C  83      23.910 135.369  68.029  1.00 45.54           C  
ATOM   7221  C   LEU C  83      23.476 134.861  69.422  1.00 45.68           C  
ATOM   7222  O   LEU C  83      22.880 133.784  69.546  1.00 42.86           O  
ATOM   7223  CB  LEU C  83      25.422 135.237  67.852  1.00 44.64           C  
ATOM   7224  CG  LEU C  83      25.936 135.364  66.411  1.00 45.30           C  
ATOM   7225  CD1 LEU C  83      27.464 135.278  66.365  1.00 43.36           C  
ATOM   7226  CD2 LEU C  83      25.316 134.262  65.565  1.00 42.43           C  
ATOM   7227  N   HIS C  84      23.752 135.645  70.465  1.00 45.21           N  
ATOM   7228  CA  HIS C  84      23.404 135.235  71.825  1.00 43.65           C  
ATOM   7229  C   HIS C  84      21.886 135.070  71.959  1.00 43.58           C  
ATOM   7230  O   HIS C  84      21.402 134.028  72.407  1.00 44.78           O  
ATOM   7231  CB  HIS C  84      23.923 136.263  72.861  1.00 40.90           C  
ATOM   7232  CG  HIS C  84      23.883 135.778  74.285  1.00 39.94           C  
ATOM   7233  ND1 HIS C  84      24.690 134.763  74.743  1.00 41.05           N  
ATOM   7234  CD2 HIS C  84      23.144 136.177  75.354  1.00 39.51           C  
ATOM   7235  CE1 HIS C  84      24.455 134.558  76.029  1.00 40.56           C  
ATOM   7236  NE2 HIS C  84      23.520 135.403  76.428  1.00 39.00           N  
ATOM   7237  N   ALA C  85      21.133 136.083  71.548  1.00 42.27           N  
ATOM   7238  CA  ALA C  85      19.684 136.028  71.674  1.00 40.30           C  
ATOM   7239  C   ALA C  85      19.086 134.893  70.879  1.00 40.34           C  
ATOM   7240  O   ALA C  85      18.249 134.148  71.394  1.00 40.34           O  
ATOM   7241  CB  ALA C  85      19.079 137.331  71.260  1.00 38.77           C  
ATOM   7242  N   ASN C  86      19.505 134.742  69.629  1.00 40.67           N  
ATOM   7243  CA  ASN C  86      18.971 133.645  68.830  1.00 43.81           C  
ATOM   7244  C   ASN C  86      19.538 132.296  69.278  1.00 44.93           C  
ATOM   7245  O   ASN C  86      18.857 131.256  69.182  1.00 44.37           O  
ATOM   7246  CB  ASN C  86      19.239 133.867  67.340  1.00 46.72           C  
ATOM   7247  CG  ASN C  86      18.271 134.865  66.717  1.00 50.75           C  
ATOM   7248  OD1 ASN C  86      18.590 136.050  66.555  1.00 51.67           O  
ATOM   7249  ND2 ASN C  86      17.069 134.390  66.382  1.00 53.36           N  
ATOM   7250  N   GLY C  87      20.778 132.325  69.777  1.00 44.76           N  
ATOM   7251  CA  GLY C  87      21.417 131.115  70.269  1.00 43.93           C  
ATOM   7252  C   GLY C  87      20.549 130.431  71.313  1.00 43.95           C  
ATOM   7253  O   GLY C  87      20.514 129.203  71.403  1.00 43.80           O  
ATOM   7254  N   ALA C  88      19.837 131.234  72.097  1.00 43.73           N  
ATOM   7255  CA  ALA C  88      18.938 130.706  73.107  1.00 43.97           C  
ATOM   7256  C   ALA C  88      17.909 129.772  72.465  1.00 45.20           C  
ATOM   7257  O   ALA C  88      17.703 128.649  72.944  1.00 47.29           O  
ATOM   7258  CB  ALA C  88      18.232 131.831  73.809  1.00 43.45           C  
ATOM   7259  N   SER C  89      17.267 130.216  71.383  1.00 43.28           N  
ATOM   7260  CA  SER C  89      16.273 129.371  70.739  1.00 43.53           C  
ATOM   7261  C   SER C  89      16.844 128.082  70.181  1.00 44.99           C  
ATOM   7262  O   SER C  89      16.244 127.010  70.331  1.00 45.69           O  
ATOM   7263  CB  SER C  89      15.569 130.129  69.642  1.00 42.32           C  
ATOM   7264  OG  SER C  89      14.670 131.045  70.224  1.00 45.84           O  
ATOM   7265  N   PHE C  90      17.999 128.185  69.532  1.00 45.10           N  
ATOM   7266  CA  PHE C  90      18.655 127.018  68.967  1.00 43.45           C  
ATOM   7267  C   PHE C  90      18.804 126.053  70.135  1.00 41.14           C  
ATOM   7268  O   PHE C  90      18.510 124.857  70.016  1.00 41.42           O  
ATOM   7269  CB  PHE C  90      20.032 127.417  68.406  1.00 48.12           C  
ATOM   7270  CG  PHE C  90      20.797 126.283  67.723  1.00 54.68           C  
ATOM   7271  CD1 PHE C  90      20.686 126.066  66.336  1.00 56.93           C  
ATOM   7272  CD2 PHE C  90      21.642 125.427  68.463  1.00 55.37           C  
ATOM   7273  CE1 PHE C  90      21.415 125.001  65.690  1.00 57.37           C  
ATOM   7274  CE2 PHE C  90      22.360 124.376  67.828  1.00 57.03           C  
ATOM   7275  CZ  PHE C  90      22.244 124.165  66.436  1.00 55.77           C  
ATOM   7276  N   PHE C  91      19.216 126.586  71.281  1.00 36.96           N  
ATOM   7277  CA  PHE C  91      19.432 125.759  72.460  1.00 36.15           C  
ATOM   7278  C   PHE C  91      18.196 124.980  72.841  1.00 36.55           C  
ATOM   7279  O   PHE C  91      18.280 123.766  73.047  1.00 36.39           O  
ATOM   7280  CB  PHE C  91      19.897 126.607  73.635  1.00 36.85           C  
ATOM   7281  CG  PHE C  91      20.857 125.896  74.584  1.00 38.15           C  
ATOM   7282  CD1 PHE C  91      20.506 124.702  75.204  1.00 39.33           C  
ATOM   7283  CD2 PHE C  91      22.031 126.509  74.987  1.00 37.46           C  
ATOM   7284  CE1 PHE C  91      21.298 124.151  76.217  1.00 35.27           C  
ATOM   7285  CE2 PHE C  91      22.809 125.958  75.994  1.00 36.40           C  
ATOM   7286  CZ  PHE C  91      22.432 124.782  76.605  1.00 35.18           C  
ATOM   7287  N   PHE C  92      17.049 125.659  72.938  1.00 37.38           N  
ATOM   7288  CA  PHE C  92      15.774 124.978  73.266  1.00 36.10           C  
ATOM   7289  C   PHE C  92      15.271 124.029  72.158  1.00 36.12           C  
ATOM   7290  O   PHE C  92      14.788 122.923  72.449  1.00 34.09           O  
ATOM   7291  CB  PHE C  92      14.693 125.992  73.599  1.00 34.36           C  
ATOM   7292  CG  PHE C  92      14.770 126.492  74.999  1.00 32.93           C  
ATOM   7293  CD1 PHE C  92      15.393 127.700  75.291  1.00 32.94           C  
ATOM   7294  CD2 PHE C  92      14.244 125.738  76.035  1.00 30.86           C  
ATOM   7295  CE1 PHE C  92      15.488 128.151  76.601  1.00 31.47           C  
ATOM   7296  CE2 PHE C  92      14.333 126.176  77.343  1.00 28.98           C  
ATOM   7297  CZ  PHE C  92      14.954 127.379  77.631  1.00 31.12           C  
ATOM   7298  N   ILE C  93      15.373 124.461  70.900  1.00 34.66           N  
ATOM   7299  CA  ILE C  93      14.985 123.597  69.811  1.00 36.43           C  
ATOM   7300  C   ILE C  93      15.771 122.312  70.020  1.00 37.97           C  
ATOM   7301  O   ILE C  93      15.215 121.217  70.057  1.00 40.12           O  
ATOM   7302  CB  ILE C  93      15.399 124.155  68.454  1.00 37.76           C  
ATOM   7303  CG1 ILE C  93      14.510 125.345  68.092  1.00 41.38           C  
ATOM   7304  CG2 ILE C  93      15.308 123.061  67.399  1.00 35.48           C  
ATOM   7305  CD1 ILE C  93      14.817 126.016  66.727  1.00 40.10           C  
ATOM   7306  N   CYS C  94      17.081 122.443  70.163  1.00 37.45           N  
ATOM   7307  CA  CYS C  94      17.886 121.261  70.369  1.00 36.90           C  
ATOM   7308  C   CYS C  94      17.474 120.457  71.589  1.00 36.18           C  
ATOM   7309  O   CYS C  94      17.352 119.244  71.527  1.00 36.72           O  
ATOM   7310  CB  CYS C  94      19.349 121.640  70.452  1.00 36.41           C  
ATOM   7311  SG  CYS C  94      19.991 121.968  68.813  1.00 43.07           S  
ATOM   7312  N   ILE C  95      17.226 121.113  72.700  1.00 35.33           N  
ATOM   7313  CA  ILE C  95      16.858 120.352  73.863  1.00 36.46           C  
ATOM   7314  C   ILE C  95      15.534 119.617  73.708  1.00 38.16           C  
ATOM   7315  O   ILE C  95      15.357 118.537  74.281  1.00 38.96           O  
ATOM   7316  CB  ILE C  95      16.784 121.231  75.085  1.00 37.71           C  
ATOM   7317  CG1 ILE C  95      17.055 120.375  76.314  1.00 37.47           C  
ATOM   7318  CG2 ILE C  95      15.397 121.915  75.168  1.00 36.38           C  
ATOM   7319  CD1 ILE C  95      17.430 121.181  77.530  1.00 40.05           C  
ATOM   7320  N   PHE C  96      14.589 120.178  72.954  1.00 37.79           N  
ATOM   7321  CA  PHE C  96      13.312 119.477  72.788  1.00 38.05           C  
ATOM   7322  C   PHE C  96      13.470 118.237  71.899  1.00 38.92           C  
ATOM   7323  O   PHE C  96      12.869 117.191  72.174  1.00 39.28           O  
ATOM   7324  CB  PHE C  96      12.229 120.402  72.230  1.00 37.70           C  
ATOM   7325  CG  PHE C  96      11.866 121.540  73.151  1.00 37.02           C  
ATOM   7326  CD1 PHE C  96      11.785 121.345  74.527  1.00 36.08           C  
ATOM   7327  CD2 PHE C  96      11.623 122.814  72.642  1.00 35.89           C  
ATOM   7328  CE1 PHE C  96      11.472 122.412  75.390  1.00 36.78           C  
ATOM   7329  CE2 PHE C  96      11.310 123.874  73.488  1.00 37.00           C  
ATOM   7330  CZ  PHE C  96      11.236 123.673  74.873  1.00 36.26           C  
ATOM   7331  N   LEU C  97      14.268 118.339  70.838  1.00 37.22           N  
ATOM   7332  CA  LEU C  97      14.508 117.163  70.018  1.00 37.42           C  
ATOM   7333  C   LEU C  97      15.304 116.138  70.856  1.00 38.24           C  
ATOM   7334  O   LEU C  97      15.054 114.943  70.767  1.00 39.14           O  
ATOM   7335  CB  LEU C  97      15.284 117.532  68.759  1.00 37.77           C  
ATOM   7336  CG  LEU C  97      14.567 118.602  67.929  1.00 42.29           C  
ATOM   7337  CD1 LEU C  97      15.325 118.887  66.653  1.00 39.63           C  
ATOM   7338  CD2 LEU C  97      13.146 118.131  67.606  1.00 43.00           C  
ATOM   7339  N   HIS C  98      16.242 116.601  71.689  1.00 37.89           N  
ATOM   7340  CA  HIS C  98      17.048 115.702  72.522  1.00 36.40           C  
ATOM   7341  C   HIS C  98      16.086 114.935  73.428  1.00 35.95           C  
ATOM   7342  O   HIS C  98      16.129 113.697  73.500  1.00 35.72           O  
ATOM   7343  CB  HIS C  98      18.074 116.518  73.336  1.00 35.47           C  
ATOM   7344  CG  HIS C  98      19.092 115.695  74.083  1.00 36.71           C  
ATOM   7345  ND1 HIS C  98      20.089 114.979  73.456  1.00 37.70           N  
ATOM   7346  CD2 HIS C  98      19.338 115.577  75.414  1.00 36.66           C  
ATOM   7347  CE1 HIS C  98      20.908 114.469  74.365  1.00 37.24           C  
ATOM   7348  NE2 HIS C  98      20.478 114.818  75.566  1.00 36.58           N  
ATOM   7349  N   ILE C  99      15.193 115.663  74.091  1.00 35.55           N  
ATOM   7350  CA  ILE C  99      14.218 115.024  74.974  1.00 35.86           C  
ATOM   7351  C   ILE C  99      13.317 114.072  74.189  1.00 37.18           C  
ATOM   7352  O   ILE C  99      13.135 112.918  74.572  1.00 38.61           O  
ATOM   7353  CB  ILE C  99      13.354 116.073  75.706  1.00 34.37           C  
ATOM   7354  CG1 ILE C  99      14.231 116.796  76.735  1.00 34.56           C  
ATOM   7355  CG2 ILE C  99      12.143 115.402  76.387  1.00 30.10           C  
ATOM   7356  CD1 ILE C  99      13.627 118.035  77.369  1.00 34.81           C  
ATOM   7357  N   GLY C 100      12.773 114.541  73.075  1.00 36.09           N  
ATOM   7358  CA  GLY C 100      11.903 113.687  72.293  1.00 36.80           C  
ATOM   7359  C   GLY C 100      12.548 112.358  72.004  1.00 36.07           C  
ATOM   7360  O   GLY C 100      12.010 111.315  72.364  1.00 37.59           O  
ATOM   7361  N   ARG C 101      13.698 112.419  71.346  1.00 36.05           N  
ATOM   7362  CA  ARG C 101      14.483 111.254  70.983  1.00 35.71           C  
ATOM   7363  C   ARG C 101      14.541 110.286  72.149  1.00 36.29           C  
ATOM   7364  O   ARG C 101      14.376 109.077  71.987  1.00 34.92           O  
ATOM   7365  CB  ARG C 101      15.901 111.686  70.619  1.00 35.80           C  
ATOM   7366  CG  ARG C 101      16.891 110.558  70.331  1.00 37.90           C  
ATOM   7367  CD  ARG C 101      17.337 109.796  71.603  1.00 41.93           C  
ATOM   7368  NE  ARG C 101      17.989 110.639  72.603  1.00 44.08           N  
ATOM   7369  CZ  ARG C 101      19.284 110.926  72.607  1.00 46.22           C  
ATOM   7370  NH1 ARG C 101      20.086 110.431  71.671  1.00 48.01           N  
ATOM   7371  NH2 ARG C 101      19.773 111.732  73.530  1.00 47.35           N  
ATOM   7372  N   GLY C 102      14.784 110.810  73.337  1.00 36.54           N  
ATOM   7373  CA  GLY C 102      14.878 109.917  74.477  1.00 39.56           C  
ATOM   7374  C   GLY C 102      13.587 109.219  74.872  1.00 40.62           C  
ATOM   7375  O   GLY C 102      13.579 108.074  75.342  1.00 40.50           O  
ATOM   7376  N   LEU C 103      12.481 109.921  74.694  1.00 41.23           N  
ATOM   7377  CA  LEU C 103      11.199 109.371  75.043  1.00 42.61           C  
ATOM   7378  C   LEU C 103      10.806 108.294  74.045  1.00 42.38           C  
ATOM   7379  O   LEU C 103      10.377 107.203  74.420  1.00 42.14           O  
ATOM   7380  CB  LEU C 103      10.185 110.494  75.063  1.00 46.81           C  
ATOM   7381  CG  LEU C 103       8.748 110.092  75.357  1.00 51.36           C  
ATOM   7382  CD1 LEU C 103       8.699 109.127  76.535  1.00 52.04           C  
ATOM   7383  CD2 LEU C 103       7.954 111.361  75.633  1.00 51.80           C  
ATOM   7384  N   TYR C 104      10.986 108.598  72.766  1.00 41.67           N  
ATOM   7385  CA  TYR C 104      10.665 107.661  71.696  1.00 40.82           C  
ATOM   7386  C   TYR C 104      11.537 106.419  71.645  1.00 40.07           C  
ATOM   7387  O   TYR C 104      11.112 105.416  71.098  1.00 41.50           O  
ATOM   7388  CB  TYR C 104      10.769 108.352  70.348  1.00 41.55           C  
ATOM   7389  CG  TYR C 104      10.284 107.518  69.171  1.00 44.35           C  
ATOM   7390  CD1 TYR C 104       8.937 107.547  68.776  1.00 44.41           C  
ATOM   7391  CD2 TYR C 104      11.177 106.747  68.417  1.00 44.08           C  
ATOM   7392  CE1 TYR C 104       8.488 106.843  67.661  1.00 44.96           C  
ATOM   7393  CE2 TYR C 104      10.743 106.040  67.298  1.00 46.21           C  
ATOM   7394  CZ  TYR C 104       9.389 106.091  66.917  1.00 47.14           C  
ATOM   7395  OH  TYR C 104       8.942 105.405  65.794  1.00 45.02           O  
ATOM   7396  N   TYR C 105      12.761 106.481  72.172  1.00 40.56           N  
ATOM   7397  CA  TYR C 105      13.659 105.320  72.141  1.00 39.94           C  
ATOM   7398  C   TYR C 105      14.008 104.764  73.515  1.00 41.52           C  
ATOM   7399  O   TYR C 105      14.968 103.998  73.686  1.00 39.93           O  
ATOM   7400  CB  TYR C 105      14.933 105.639  71.389  1.00 37.96           C  
ATOM   7401  CG  TYR C 105      14.727 105.902  69.918  1.00 37.90           C  
ATOM   7402  CD1 TYR C 105      14.632 107.195  69.434  1.00 38.06           C  
ATOM   7403  CD2 TYR C 105      14.675 104.860  69.005  1.00 37.79           C  
ATOM   7404  CE1 TYR C 105      14.502 107.447  68.080  1.00 39.49           C  
ATOM   7405  CE2 TYR C 105      14.541 105.099  67.648  1.00 38.27           C  
ATOM   7406  CZ  TYR C 105      14.462 106.394  67.185  1.00 39.94           C  
ATOM   7407  OH  TYR C 105      14.416 106.642  65.822  1.00 42.10           O  
ATOM   7408  N   GLY C 106      13.197 105.161  74.490  1.00 42.91           N  
ATOM   7409  CA  GLY C 106      13.347 104.687  75.852  1.00 43.75           C  
ATOM   7410  C   GLY C 106      14.708 104.850  76.454  1.00 43.79           C  
ATOM   7411  O   GLY C 106      15.152 103.993  77.205  1.00 44.44           O  
ATOM   7412  N   SER C 107      15.361 105.955  76.125  1.00 43.96           N  
ATOM   7413  CA  SER C 107      16.684 106.244  76.640  1.00 43.39           C  
ATOM   7414  C   SER C 107      16.598 106.440  78.134  1.00 43.14           C  
ATOM   7415  O   SER C 107      17.530 106.134  78.869  1.00 43.14           O  
ATOM   7416  CB  SER C 107      17.208 107.503  75.981  1.00 42.53           C  
ATOM   7417  OG  SER C 107      17.075 107.377  74.578  1.00 46.22           O  
ATOM   7418  N   TYR C 108      15.449 106.944  78.569  1.00 44.70           N  
ATOM   7419  CA  TYR C 108      15.175 107.221  79.974  1.00 44.41           C  
ATOM   7420  C   TYR C 108      15.333 105.987  80.813  1.00 43.56           C  
ATOM   7421  O   TYR C 108      15.303 106.072  82.024  1.00 44.80           O  
ATOM   7422  CB  TYR C 108      13.753 107.778  80.153  1.00 45.59           C  
ATOM   7423  CG  TYR C 108      12.697 106.908  79.526  1.00 45.01           C  
ATOM   7424  CD1 TYR C 108      12.300 105.728  80.132  1.00 45.54           C  
ATOM   7425  CD2 TYR C 108      12.157 107.233  78.277  1.00 44.56           C  
ATOM   7426  CE1 TYR C 108      11.399 104.880  79.515  1.00 47.31           C  
ATOM   7427  CE2 TYR C 108      11.258 106.409  77.656  1.00 45.73           C  
ATOM   7428  CZ  TYR C 108      10.880 105.225  78.278  1.00 47.36           C  
ATOM   7429  OH  TYR C 108       9.986 104.375  77.663  1.00 50.35           O  
ATOM   7430  N   LEU C 109      15.480 104.826  80.196  1.00 44.59           N  
ATOM   7431  CA  LEU C 109      15.663 103.639  81.016  1.00 44.80           C  
ATOM   7432  C   LEU C 109      17.046 103.726  81.622  1.00 44.96           C  
ATOM   7433  O   LEU C 109      17.421 102.898  82.429  1.00 48.84           O  
ATOM   7434  CB  LEU C 109      15.469 102.344  80.215  1.00 43.55           C  
ATOM   7435  CG  LEU C 109      13.982 102.053  79.924  1.00 41.17           C  
ATOM   7436  CD1 LEU C 109      13.778 100.622  79.464  1.00 39.84           C  
ATOM   7437  CD2 LEU C 109      13.189 102.271  81.183  1.00 39.19           C  
ATOM   7438  N   TYR C 110      17.791 104.753  81.225  1.00 43.74           N  
ATOM   7439  CA  TYR C 110      19.107 105.034  81.768  1.00 43.37           C  
ATOM   7440  C   TYR C 110      18.840 106.090  82.842  1.00 47.39           C  
ATOM   7441  O   TYR C 110      19.350 107.211  82.768  1.00 49.50           O  
ATOM   7442  CB  TYR C 110      19.990 105.659  80.718  1.00 39.24           C  
ATOM   7443  CG  TYR C 110      20.527 104.708  79.704  1.00 39.70           C  
ATOM   7444  CD1 TYR C 110      20.677 103.349  79.992  1.00 38.44           C  
ATOM   7445  CD2 TYR C 110      20.962 105.177  78.469  1.00 39.81           C  
ATOM   7446  CE1 TYR C 110      21.249 102.485  79.067  1.00 41.21           C  
ATOM   7447  CE2 TYR C 110      21.542 104.330  77.540  1.00 43.01           C  
ATOM   7448  CZ  TYR C 110      21.683 102.985  77.838  1.00 44.36           C  
ATOM   7449  OH  TYR C 110      22.248 102.152  76.893  1.00 48.18           O  
ATOM   7450  N   LYS C 111      18.044 105.722  83.841  1.00 50.12           N  
ATOM   7451  CA  LYS C 111      17.634 106.622  84.903  1.00 50.94           C  
ATOM   7452  C   LYS C 111      18.500 107.787  85.343  1.00 50.67           C  
ATOM   7453  O   LYS C 111      18.019 108.910  85.323  1.00 50.08           O  
ATOM   7454  CB  LYS C 111      17.212 105.804  86.109  1.00 55.03           C  
ATOM   7455  CG  LYS C 111      15.872 105.117  85.895  1.00 59.11           C  
ATOM   7456  CD  LYS C 111      15.465 104.275  87.104  1.00 65.67           C  
ATOM   7457  CE  LYS C 111      14.196 103.435  86.820  1.00 69.72           C  
ATOM   7458  NZ  LYS C 111      14.331 102.484  85.649  1.00 72.09           N  
ATOM   7459  N   GLU C 112      19.751 107.571  85.742  1.00 52.47           N  
ATOM   7460  CA  GLU C 112      20.553 108.725  86.179  1.00 53.99           C  
ATOM   7461  C   GLU C 112      20.878 109.654  85.033  1.00 52.54           C  
ATOM   7462  O   GLU C 112      20.874 110.880  85.202  1.00 52.27           O  
ATOM   7463  CB  GLU C 112      21.857 108.317  86.846  1.00 57.67           C  
ATOM   7464  CG  GLU C 112      21.694 107.314  87.948  1.00 68.28           C  
ATOM   7465  CD  GLU C 112      22.059 105.912  87.476  1.00 75.34           C  
ATOM   7466  OE1 GLU C 112      21.530 105.480  86.411  1.00 78.43           O  
ATOM   7467  OE2 GLU C 112      22.879 105.251  88.169  1.00 78.61           O  
ATOM   7468  N   THR C 113      21.185 109.096  83.868  1.00 50.02           N  
ATOM   7469  CA  THR C 113      21.462 109.974  82.751  1.00 48.25           C  
ATOM   7470  C   THR C 113      20.190 110.784  82.513  1.00 47.86           C  
ATOM   7471  O   THR C 113      20.256 111.990  82.286  1.00 50.40           O  
ATOM   7472  CB  THR C 113      21.806 109.210  81.487  1.00 47.23           C  
ATOM   7473  OG1 THR C 113      22.920 108.358  81.742  1.00 48.76           O  
ATOM   7474  CG2 THR C 113      22.182 110.164  80.391  1.00 46.39           C  
ATOM   7475  N   TRP C 114      19.035 110.127  82.588  1.00 44.04           N  
ATOM   7476  CA  TRP C 114      17.764 110.797  82.381  1.00 40.39           C  
ATOM   7477  C   TRP C 114      17.556 111.884  83.408  1.00 39.52           C  
ATOM   7478  O   TRP C 114      17.388 113.039  83.051  1.00 39.72           O  
ATOM   7479  CB  TRP C 114      16.619 109.788  82.449  1.00 42.01           C  
ATOM   7480  CG  TRP C 114      15.272 110.372  82.191  1.00 43.36           C  
ATOM   7481  CD1 TRP C 114      14.322 110.682  83.115  1.00 43.80           C  
ATOM   7482  CD2 TRP C 114      14.733 110.756  80.919  1.00 44.77           C  
ATOM   7483  NE1 TRP C 114      13.221 111.239  82.503  1.00 45.24           N  
ATOM   7484  CE2 TRP C 114      13.446 111.295  81.154  1.00 44.61           C  
ATOM   7485  CE3 TRP C 114      15.209 110.698  79.605  1.00 44.09           C  
ATOM   7486  CZ2 TRP C 114      12.634 111.772  80.125  1.00 41.99           C  
ATOM   7487  CZ3 TRP C 114      14.400 111.173  78.588  1.00 43.15           C  
ATOM   7488  CH2 TRP C 114      13.126 111.703  78.856  1.00 41.35           C  
ATOM   7489  N   ASN C 115      17.593 111.532  84.689  1.00 39.82           N  
ATOM   7490  CA  ASN C 115      17.374 112.532  85.731  1.00 39.89           C  
ATOM   7491  C   ASN C 115      18.346 113.711  85.665  1.00 39.62           C  
ATOM   7492  O   ASN C 115      17.921 114.862  85.796  1.00 40.79           O  
ATOM   7493  CB  ASN C 115      17.410 111.902  87.121  1.00 41.09           C  
ATOM   7494  CG  ASN C 115      16.336 110.832  87.325  1.00 44.29           C  
ATOM   7495  OD1 ASN C 115      15.149 111.039  87.047  1.00 48.33           O  
ATOM   7496  ND2 ASN C 115      16.752 109.683  87.837  1.00 43.64           N  
ATOM   7497  N   THR C 116      19.639 113.469  85.472  1.00 38.56           N  
ATOM   7498  CA  THR C 116      20.521 114.627  85.378  1.00 39.36           C  
ATOM   7499  C   THR C 116      19.973 115.483  84.220  1.00 40.22           C  
ATOM   7500  O   THR C 116      19.950 116.720  84.279  1.00 40.52           O  
ATOM   7501  CB  THR C 116      22.017 114.247  85.118  1.00 37.78           C  
ATOM   7502  OG1 THR C 116      22.126 113.401  83.970  1.00 40.38           O  
ATOM   7503  CG2 THR C 116      22.596 113.551  86.318  1.00 34.12           C  
ATOM   7504  N   GLY C 117      19.480 114.812  83.188  1.00 40.12           N  
ATOM   7505  CA  GLY C 117      18.932 115.527  82.051  1.00 40.62           C  
ATOM   7506  C   GLY C 117      17.794 116.462  82.432  1.00 40.73           C  
ATOM   7507  O   GLY C 117      17.740 117.623  82.002  1.00 41.27           O  
ATOM   7508  N   VAL C 118      16.866 115.978  83.240  1.00 38.32           N  
ATOM   7509  CA  VAL C 118      15.779 116.848  83.633  1.00 37.88           C  
ATOM   7510  C   VAL C 118      16.355 118.058  84.381  1.00 39.33           C  
ATOM   7511  O   VAL C 118      15.880 119.188  84.224  1.00 40.90           O  
ATOM   7512  CB  VAL C 118      14.778 116.114  84.517  1.00 35.84           C  
ATOM   7513  CG1 VAL C 118      13.568 116.972  84.753  1.00 32.28           C  
ATOM   7514  CG2 VAL C 118      14.380 114.823  83.851  1.00 37.35           C  
ATOM   7515  N   ILE C 119      17.393 117.842  85.179  1.00 38.31           N  
ATOM   7516  CA  ILE C 119      17.974 118.965  85.910  1.00 37.56           C  
ATOM   7517  C   ILE C 119      18.602 119.971  84.935  1.00 36.40           C  
ATOM   7518  O   ILE C 119      18.589 121.189  85.160  1.00 33.95           O  
ATOM   7519  CB  ILE C 119      19.039 118.476  86.925  1.00 37.63           C  
ATOM   7520  CG1 ILE C 119      18.361 117.796  88.105  1.00 37.35           C  
ATOM   7521  CG2 ILE C 119      19.855 119.642  87.450  1.00 35.19           C  
ATOM   7522  CD1 ILE C 119      19.339 117.429  89.175  1.00 36.71           C  
ATOM   7523  N   LEU C 120      19.150 119.454  83.845  1.00 34.95           N  
ATOM   7524  CA  LEU C 120      19.769 120.315  82.865  1.00 35.28           C  
ATOM   7525  C   LEU C 120      18.730 121.218  82.259  1.00 35.09           C  
ATOM   7526  O   LEU C 120      18.960 122.412  82.099  1.00 34.41           O  
ATOM   7527  CB  LEU C 120      20.453 119.474  81.796  1.00 36.45           C  
ATOM   7528  CG  LEU C 120      21.840 119.103  82.296  1.00 37.66           C  
ATOM   7529  CD1 LEU C 120      22.497 118.158  81.352  1.00 42.17           C  
ATOM   7530  CD2 LEU C 120      22.663 120.365  82.413  1.00 38.23           C  
ATOM   7531  N   LEU C 121      17.574 120.635  81.944  1.00 36.63           N  
ATOM   7532  CA  LEU C 121      16.438 121.361  81.367  1.00 34.83           C  
ATOM   7533  C   LEU C 121      15.986 122.449  82.321  1.00 33.89           C  
ATOM   7534  O   LEU C 121      15.872 123.613  81.945  1.00 32.88           O  
ATOM   7535  CB  LEU C 121      15.264 120.412  81.123  1.00 34.60           C  
ATOM   7536  CG  LEU C 121      13.961 121.106  80.698  1.00 34.19           C  
ATOM   7537  CD1 LEU C 121      14.175 121.899  79.399  1.00 31.82           C  
ATOM   7538  CD2 LEU C 121      12.886 120.061  80.497  1.00 29.89           C  
ATOM   7539  N   LEU C 122      15.718 122.062  83.559  1.00 32.83           N  
ATOM   7540  CA  LEU C 122      15.316 123.044  84.543  1.00 35.76           C  
ATOM   7541  C   LEU C 122      16.351 124.174  84.669  1.00 36.26           C  
ATOM   7542  O   LEU C 122      16.005 125.353  84.577  1.00 36.62           O  
ATOM   7543  CB  LEU C 122      15.089 122.380  85.900  1.00 36.56           C  
ATOM   7544  CG  LEU C 122      13.935 121.363  85.951  1.00 38.32           C  
ATOM   7545  CD1 LEU C 122      13.785 120.832  87.363  1.00 38.00           C  
ATOM   7546  CD2 LEU C 122      12.642 122.011  85.496  1.00 33.71           C  
ATOM   7547  N   THR C 123      17.623 123.840  84.848  1.00 36.14           N  
ATOM   7548  CA  THR C 123      18.599 124.908  84.983  1.00 36.09           C  
ATOM   7549  C   THR C 123      18.563 125.819  83.766  1.00 35.67           C  
ATOM   7550  O   THR C 123      18.560 127.051  83.899  1.00 34.22           O  
ATOM   7551  CB  THR C 123      20.021 124.360  85.174  1.00 38.29           C  
ATOM   7552  OG1 THR C 123      20.050 123.497  86.319  1.00 38.11           O  
ATOM   7553  CG2 THR C 123      21.011 125.512  85.402  1.00 37.75           C  
ATOM   7554  N   LEU C 124      18.516 125.214  82.580  1.00 35.16           N  
ATOM   7555  CA  LEU C 124      18.483 125.988  81.335  1.00 35.18           C  
ATOM   7556  C   LEU C 124      17.323 126.977  81.324  1.00 37.14           C  
ATOM   7557  O   LEU C 124      17.516 128.169  81.007  1.00 36.32           O  
ATOM   7558  CB  LEU C 124      18.370 125.063  80.133  1.00 31.55           C  
ATOM   7559  CG  LEU C 124      18.007 125.752  78.818  1.00 29.69           C  
ATOM   7560  CD1 LEU C 124      18.975 126.864  78.514  1.00 31.04           C  
ATOM   7561  CD2 LEU C 124      18.013 124.734  77.695  1.00 30.31           C  
ATOM   7562  N   MET C 125      16.128 126.476  81.672  1.00 37.39           N  
ATOM   7563  CA  MET C 125      14.931 127.304  81.724  1.00 37.62           C  
ATOM   7564  C   MET C 125      15.167 128.511  82.607  1.00 37.83           C  
ATOM   7565  O   MET C 125      14.970 129.643  82.164  1.00 39.30           O  
ATOM   7566  CB  MET C 125      13.757 126.502  82.238  1.00 39.18           C  
ATOM   7567  CG  MET C 125      13.302 125.435  81.243  1.00 44.48           C  
ATOM   7568  SD  MET C 125      11.945 124.377  81.836  1.00 48.22           S  
ATOM   7569  CE  MET C 125      10.522 125.458  81.516  1.00 47.40           C  
ATOM   7570  N   ALA C 126      15.617 128.287  83.841  1.00 36.61           N  
ATOM   7571  CA  ALA C 126      15.907 129.404  84.749  1.00 36.25           C  
ATOM   7572  C   ALA C 126      16.916 130.350  84.109  1.00 37.69           C  
ATOM   7573  O   ALA C 126      16.734 131.571  84.117  1.00 37.48           O  
ATOM   7574  CB  ALA C 126      16.460 128.903  86.046  1.00 32.89           C  
ATOM   7575  N   THR C 127      17.977 129.788  83.539  1.00 38.70           N  
ATOM   7576  CA  THR C 127      18.993 130.621  82.913  1.00 39.46           C  
ATOM   7577  C   THR C 127      18.372 131.608  81.906  1.00 38.87           C  
ATOM   7578  O   THR C 127      18.584 132.827  81.997  1.00 37.84           O  
ATOM   7579  CB  THR C 127      20.090 129.751  82.209  1.00 40.10           C  
ATOM   7580  OG1 THR C 127      20.739 128.921  83.182  1.00 39.60           O  
ATOM   7581  CG2 THR C 127      21.136 130.635  81.535  1.00 35.38           C  
ATOM   7582  N   ALA C 128      17.586 131.101  80.964  1.00 37.78           N  
ATOM   7583  CA  ALA C 128      17.005 131.995  79.972  1.00 39.08           C  
ATOM   7584  C   ALA C 128      16.065 132.996  80.618  1.00 41.26           C  
ATOM   7585  O   ALA C 128      16.077 134.176  80.279  1.00 41.07           O  
ATOM   7586  CB  ALA C 128      16.271 131.202  78.909  1.00 38.71           C  
ATOM   7587  N   PHE C 129      15.259 132.532  81.568  1.00 42.79           N  
ATOM   7588  CA  PHE C 129      14.309 133.416  82.217  1.00 43.17           C  
ATOM   7589  C   PHE C 129      14.962 134.636  82.838  1.00 43.32           C  
ATOM   7590  O   PHE C 129      14.412 135.723  82.774  1.00 43.52           O  
ATOM   7591  CB  PHE C 129      13.541 132.690  83.297  1.00 44.88           C  
ATOM   7592  CG  PHE C 129      12.459 133.526  83.907  1.00 47.23           C  
ATOM   7593  CD1 PHE C 129      11.196 133.588  83.316  1.00 46.61           C  
ATOM   7594  CD2 PHE C 129      12.707 134.275  85.055  1.00 46.76           C  
ATOM   7595  CE1 PHE C 129      10.209 134.368  83.853  1.00 45.95           C  
ATOM   7596  CE2 PHE C 129      11.722 135.065  85.603  1.00 45.57           C  
ATOM   7597  CZ  PHE C 129      10.472 135.112  85.003  1.00 47.57           C  
ATOM   7598  N   VAL C 130      16.118 134.457  83.468  1.00 43.85           N  
ATOM   7599  CA  VAL C 130      16.818 135.592  84.071  1.00 44.05           C  
ATOM   7600  C   VAL C 130      17.566 136.395  82.999  1.00 44.56           C  
ATOM   7601  O   VAL C 130      17.669 137.628  83.078  1.00 44.02           O  
ATOM   7602  CB  VAL C 130      17.824 135.137  85.136  1.00 43.71           C  
ATOM   7603  CG1 VAL C 130      17.110 134.315  86.159  1.00 42.17           C  
ATOM   7604  CG2 VAL C 130      18.974 134.355  84.494  1.00 41.31           C  
ATOM   7605  N   GLY C 131      18.077 135.699  81.992  1.00 43.81           N  
ATOM   7606  CA  GLY C 131      18.781 136.397  80.939  1.00 45.87           C  
ATOM   7607  C   GLY C 131      17.872 137.366  80.221  1.00 46.60           C  
ATOM   7608  O   GLY C 131      18.248 138.499  79.925  1.00 47.36           O  
ATOM   7609  N   TYR C 132      16.653 136.912  79.963  1.00 47.11           N  
ATOM   7610  CA  TYR C 132      15.665 137.708  79.264  1.00 45.87           C  
ATOM   7611  C   TYR C 132      15.376 139.006  79.994  1.00 45.14           C  
ATOM   7612  O   TYR C 132      15.143 140.034  79.367  1.00 46.44           O  
ATOM   7613  CB  TYR C 132      14.373 136.914  79.111  1.00 46.70           C  
ATOM   7614  CG  TYR C 132      13.398 137.530  78.143  1.00 49.21           C  
ATOM   7615  CD1 TYR C 132      13.740 137.724  76.806  1.00 50.98           C  
ATOM   7616  CD2 TYR C 132      12.134 137.924  78.559  1.00 49.82           C  
ATOM   7617  CE1 TYR C 132      12.839 138.295  75.910  1.00 52.19           C  
ATOM   7618  CE2 TYR C 132      11.229 138.494  77.671  1.00 50.95           C  
ATOM   7619  CZ  TYR C 132      11.584 138.674  76.354  1.00 51.44           C  
ATOM   7620  OH  TYR C 132      10.673 139.211  75.477  1.00 54.62           O  
ATOM   7621  N   VAL C 133      15.392 138.981  81.317  1.00 42.40           N  
ATOM   7622  CA  VAL C 133      15.091 140.204  82.041  1.00 41.76           C  
ATOM   7623  C   VAL C 133      16.155 141.289  81.862  1.00 41.32           C  
ATOM   7624  O   VAL C 133      15.847 142.474  81.904  1.00 42.16           O  
ATOM   7625  CB  VAL C 133      14.875 139.918  83.565  1.00 41.29           C  
ATOM   7626  CG1 VAL C 133      14.554 141.181  84.309  1.00 40.28           C  
ATOM   7627  CG2 VAL C 133      13.724 138.973  83.754  1.00 41.27           C  
ATOM   7628  N   LEU C 134      17.395 140.899  81.620  1.00 40.20           N  
ATOM   7629  CA  LEU C 134      18.473 141.885  81.514  1.00 40.85           C  
ATOM   7630  C   LEU C 134      18.346 143.125  80.632  1.00 40.87           C  
ATOM   7631  O   LEU C 134      18.712 144.197  81.058  1.00 41.48           O  
ATOM   7632  CB  LEU C 134      19.796 141.184  81.191  1.00 40.16           C  
ATOM   7633  CG  LEU C 134      20.140 140.114  82.225  1.00 38.98           C  
ATOM   7634  CD1 LEU C 134      21.377 139.388  81.809  1.00 38.86           C  
ATOM   7635  CD2 LEU C 134      20.322 140.750  83.583  1.00 37.45           C  
ATOM   7636  N   PRO C 135      17.856 143.004  79.390  1.00 42.10           N  
ATOM   7637  CA  PRO C 135      17.742 144.207  78.555  1.00 42.55           C  
ATOM   7638  C   PRO C 135      16.742 145.206  79.102  1.00 43.03           C  
ATOM   7639  O   PRO C 135      16.701 146.350  78.682  1.00 43.42           O  
ATOM   7640  CB  PRO C 135      17.341 143.658  77.197  1.00 42.40           C  
ATOM   7641  CG  PRO C 135      16.575 142.458  77.556  1.00 44.59           C  
ATOM   7642  CD  PRO C 135      17.409 141.823  78.646  1.00 43.77           C  
ATOM   7643  N   TRP C 136      15.916 144.759  80.031  1.00 44.74           N  
ATOM   7644  CA  TRP C 136      14.970 145.645  80.690  1.00 44.76           C  
ATOM   7645  C   TRP C 136      13.998 146.381  79.773  1.00 44.93           C  
ATOM   7646  O   TRP C 136      13.811 147.603  79.884  1.00 43.74           O  
ATOM   7647  CB  TRP C 136      15.756 146.644  81.535  1.00 43.86           C  
ATOM   7648  CG  TRP C 136      15.036 147.151  82.722  1.00 44.37           C  
ATOM   7649  CD1 TRP C 136      14.721 148.438  82.984  1.00 46.21           C  
ATOM   7650  CD2 TRP C 136      14.565 146.388  83.838  1.00 46.27           C  
ATOM   7651  NE1 TRP C 136      14.081 148.540  84.199  1.00 46.29           N  
ATOM   7652  CE2 TRP C 136      13.968 147.294  84.743  1.00 45.81           C  
ATOM   7653  CE3 TRP C 136      14.592 145.028  84.167  1.00 48.16           C  
ATOM   7654  CZ2 TRP C 136      13.400 146.890  85.949  1.00 46.34           C  
ATOM   7655  CZ3 TRP C 136      14.026 144.626  85.381  1.00 48.47           C  
ATOM   7656  CH2 TRP C 136      13.436 145.559  86.252  1.00 47.22           C  
ATOM   7657  N   GLY C 137      13.394 145.625  78.863  1.00 45.24           N  
ATOM   7658  CA  GLY C 137      12.386 146.183  77.981  1.00 46.48           C  
ATOM   7659  C   GLY C 137      11.013 145.910  78.612  1.00 46.96           C  
ATOM   7660  O   GLY C 137      10.922 145.320  79.696  1.00 45.95           O  
ATOM   7661  N   GLN C 138       9.939 146.320  77.945  1.00 47.26           N  
ATOM   7662  CA  GLN C 138       8.599 146.118  78.483  1.00 47.62           C  
ATOM   7663  C   GLN C 138       8.290 144.668  78.802  1.00 47.24           C  
ATOM   7664  O   GLN C 138       7.743 144.371  79.864  1.00 46.27           O  
ATOM   7665  CB  GLN C 138       7.540 146.657  77.518  1.00 48.71           C  
ATOM   7666  CG  GLN C 138       7.141 148.082  77.796  1.00 50.19           C  
ATOM   7667  CD  GLN C 138       6.472 148.230  79.145  1.00 53.99           C  
ATOM   7668  OE1 GLN C 138       7.081 147.970  80.192  1.00 53.39           O  
ATOM   7669  NE2 GLN C 138       5.205 148.645  79.130  1.00 54.56           N  
ATOM   7670  N   MET C 139       8.636 143.762  77.893  1.00 46.47           N  
ATOM   7671  CA  MET C 139       8.349 142.363  78.136  1.00 46.46           C  
ATOM   7672  C   MET C 139       9.313 141.806  79.146  1.00 47.41           C  
ATOM   7673  O   MET C 139       8.980 140.891  79.876  1.00 48.75           O  
ATOM   7674  CB  MET C 139       8.408 141.546  76.852  1.00 45.98           C  
ATOM   7675  CG  MET C 139       7.462 140.346  76.875  1.00 50.26           C  
ATOM   7676  SD  MET C 139       5.684 140.730  77.367  1.00 53.45           S  
ATOM   7677  CE  MET C 139       4.968 141.179  75.771  1.00 47.11           C  
ATOM   7678  N   SER C 140      10.512 142.360  79.210  1.00 48.75           N  
ATOM   7679  CA  SER C 140      11.481 141.867  80.178  1.00 49.42           C  
ATOM   7680  C   SER C 140      10.875 142.074  81.553  1.00 49.72           C  
ATOM   7681  O   SER C 140      10.785 141.166  82.366  1.00 50.27           O  
ATOM   7682  CB  SER C 140      12.797 142.655  80.101  1.00 50.83           C  
ATOM   7683  OG  SER C 140      13.469 142.479  78.863  1.00 52.67           O  
ATOM   7684  N   PHE C 141      10.440 143.293  81.802  1.00 50.48           N  
ATOM   7685  CA  PHE C 141       9.876 143.630  83.090  1.00 50.22           C  
ATOM   7686  C   PHE C 141       8.611 142.866  83.412  1.00 49.62           C  
ATOM   7687  O   PHE C 141       8.533 142.193  84.428  1.00 50.63           O  
ATOM   7688  CB  PHE C 141       9.589 145.126  83.156  1.00 51.62           C  
ATOM   7689  CG  PHE C 141       8.956 145.555  84.439  1.00 53.11           C  
ATOM   7690  CD1 PHE C 141       9.729 145.729  85.586  1.00 53.71           C  
ATOM   7691  CD2 PHE C 141       7.577 145.729  84.520  1.00 53.12           C  
ATOM   7692  CE1 PHE C 141       9.138 146.064  86.799  1.00 52.88           C  
ATOM   7693  CE2 PHE C 141       6.978 146.063  85.725  1.00 53.42           C  
ATOM   7694  CZ  PHE C 141       7.762 146.229  86.869  1.00 53.85           C  
ATOM   7695  N   TRP C 142       7.614 142.964  82.549  1.00 49.27           N  
ATOM   7696  CA  TRP C 142       6.350 142.288  82.812  1.00 49.05           C  
ATOM   7697  C   TRP C 142       6.393 140.761  82.896  1.00 47.58           C  
ATOM   7698  O   TRP C 142       5.627 140.171  83.642  1.00 48.00           O  
ATOM   7699  CB  TRP C 142       5.295 142.779  81.817  1.00 49.70           C  
ATOM   7700  CG  TRP C 142       4.959 144.238  82.086  1.00 50.39           C  
ATOM   7701  CD1 TRP C 142       5.488 145.346  81.468  1.00 51.17           C  
ATOM   7702  CD2 TRP C 142       4.128 144.731  83.132  1.00 49.51           C  
ATOM   7703  NE1 TRP C 142       5.038 146.492  82.075  1.00 49.52           N  
ATOM   7704  CE2 TRP C 142       4.202 146.141  83.100  1.00 49.89           C  
ATOM   7705  CE3 TRP C 142       3.331 144.116  84.102  1.00 48.39           C  
ATOM   7706  CZ2 TRP C 142       3.510 146.942  84.002  1.00 51.19           C  
ATOM   7707  CZ3 TRP C 142       2.650 144.908  84.997  1.00 49.02           C  
ATOM   7708  CH2 TRP C 142       2.741 146.308  84.944  1.00 50.42           C  
ATOM   7709  N   GLY C 143       7.280 140.115  82.153  1.00 46.05           N  
ATOM   7710  CA  GLY C 143       7.376 138.675  82.271  1.00 43.95           C  
ATOM   7711  C   GLY C 143       7.905 138.411  83.677  1.00 44.54           C  
ATOM   7712  O   GLY C 143       7.374 137.585  84.447  1.00 42.58           O  
ATOM   7713  N   ALA C 144       8.971 139.130  84.016  1.00 43.96           N  
ATOM   7714  CA  ALA C 144       9.581 139.014  85.323  1.00 44.30           C  
ATOM   7715  C   ALA C 144       8.497 139.172  86.388  1.00 46.05           C  
ATOM   7716  O   ALA C 144       8.391 138.360  87.307  1.00 46.69           O  
ATOM   7717  CB  ALA C 144      10.638 140.075  85.487  1.00 42.56           C  
ATOM   7718  N   THR C 145       7.677 140.212  86.244  1.00 48.39           N  
ATOM   7719  CA  THR C 145       6.584 140.505  87.190  1.00 50.29           C  
ATOM   7720  C   THR C 145       5.511 139.421  87.279  1.00 48.94           C  
ATOM   7721  O   THR C 145       5.226 138.885  88.344  1.00 48.30           O  
ATOM   7722  CB  THR C 145       5.869 141.817  86.832  1.00 51.02           C  
ATOM   7723  OG1 THR C 145       6.811 142.895  86.842  1.00 53.36           O  
ATOM   7724  CG2 THR C 145       4.797 142.112  87.849  1.00 51.29           C  
ATOM   7725  N   VAL C 146       4.899 139.134  86.149  1.00 48.65           N  
ATOM   7726  CA  VAL C 146       3.879 138.114  86.073  1.00 50.18           C  
ATOM   7727  C   VAL C 146       4.282 136.785  86.710  1.00 51.48           C  
ATOM   7728  O   VAL C 146       3.563 136.252  87.552  1.00 50.52           O  
ATOM   7729  CB  VAL C 146       3.525 137.849  84.600  1.00 49.84           C  
ATOM   7730  CG1 VAL C 146       3.049 136.414  84.408  1.00 50.00           C  
ATOM   7731  CG2 VAL C 146       2.473 138.822  84.158  1.00 49.13           C  
ATOM   7732  N   ILE C 147       5.432 136.255  86.303  1.00 53.21           N  
ATOM   7733  CA  ILE C 147       5.870 134.958  86.787  1.00 54.70           C  
ATOM   7734  C   ILE C 147       6.391 134.875  88.201  1.00 55.90           C  
ATOM   7735  O   ILE C 147       6.160 133.878  88.873  1.00 56.44           O  
ATOM   7736  CB  ILE C 147       6.910 134.363  85.853  1.00 55.33           C  
ATOM   7737  CG1 ILE C 147       6.330 134.257  84.443  1.00 55.72           C  
ATOM   7738  CG2 ILE C 147       7.291 132.984  86.322  1.00 55.77           C  
ATOM   7739  CD1 ILE C 147       5.139 133.323  84.343  1.00 56.38           C  
ATOM   7740  N   THR C 148       7.103 135.894  88.664  1.00 57.90           N  
ATOM   7741  CA  THR C 148       7.609 135.856  90.035  1.00 60.07           C  
ATOM   7742  C   THR C 148       6.480 136.142  91.032  1.00 61.50           C  
ATOM   7743  O   THR C 148       6.581 135.800  92.196  1.00 62.34           O  
ATOM   7744  CB  THR C 148       8.754 136.871  90.265  1.00 59.29           C  
ATOM   7745  OG1 THR C 148       8.298 138.188  89.936  1.00 60.60           O  
ATOM   7746  CG2 THR C 148       9.959 136.522  89.417  1.00 56.58           C  
ATOM   7747  N   ASN C 149       5.403 136.766  90.576  1.00 63.30           N  
ATOM   7748  CA  ASN C 149       4.293 137.051  91.464  1.00 66.42           C  
ATOM   7749  C   ASN C 149       3.545 135.776  91.798  1.00 68.22           C  
ATOM   7750  O   ASN C 149       2.792 135.717  92.760  1.00 69.32           O  
ATOM   7751  CB  ASN C 149       3.314 138.015  90.809  1.00 70.04           C  
ATOM   7752  CG  ASN C 149       3.031 139.240  91.671  1.00 74.51           C  
ATOM   7753  OD1 ASN C 149       2.834 139.129  92.896  1.00 74.47           O  
ATOM   7754  ND2 ASN C 149       3.001 140.425  91.033  1.00 75.09           N  
ATOM   7755  N   LEU C 150       3.742 134.742  90.999  1.00 70.12           N  
ATOM   7756  CA  LEU C 150       3.034 133.505  91.246  1.00 72.08           C  
ATOM   7757  C   LEU C 150       3.352 132.908  92.598  1.00 74.37           C  
ATOM   7758  O   LEU C 150       2.473 132.381  93.261  1.00 75.47           O  
ATOM   7759  CB  LEU C 150       3.338 132.491  90.146  1.00 70.86           C  
ATOM   7760  CG  LEU C 150       2.872 132.925  88.757  1.00 70.20           C  
ATOM   7761  CD1 LEU C 150       3.035 131.778  87.770  1.00 70.58           C  
ATOM   7762  CD2 LEU C 150       1.412 133.357  88.831  1.00 70.64           C  
ATOM   7763  N   PHE C 151       4.604 133.006  93.020  1.00 76.86           N  
ATOM   7764  CA  PHE C 151       5.009 132.423  94.290  1.00 79.85           C  
ATOM   7765  C   PHE C 151       4.240 132.970  95.472  1.00 80.15           C  
ATOM   7766  O   PHE C 151       4.190 132.340  96.518  1.00 80.55           O  
ATOM   7767  CB  PHE C 151       6.522 132.602  94.485  1.00 83.46           C  
ATOM   7768  CG  PHE C 151       7.340 132.016  93.362  1.00 89.55           C  
ATOM   7769  CD1 PHE C 151       8.595 132.549  93.028  1.00 89.95           C  
ATOM   7770  CD2 PHE C 151       6.816 130.957  92.586  1.00 91.96           C  
ATOM   7771  CE1 PHE C 151       9.320 132.041  91.928  1.00 92.09           C  
ATOM   7772  CE2 PHE C 151       7.524 130.435  91.484  1.00 93.28           C  
ATOM   7773  CZ  PHE C 151       8.781 130.980  91.149  1.00 93.35           C  
ATOM   7774  N   SER C 152       3.620 134.130  95.312  1.00 81.31           N  
ATOM   7775  CA  SER C 152       2.855 134.712  96.409  1.00 83.19           C  
ATOM   7776  C   SER C 152       1.598 133.884  96.638  1.00 85.13           C  
ATOM   7777  O   SER C 152       0.852 134.117  97.590  1.00 84.66           O  
ATOM   7778  CB  SER C 152       2.467 136.151  96.082  1.00 83.12           C  
ATOM   7779  OG  SER C 152       1.584 136.184  94.980  1.00 83.34           O  
ATOM   7780  N   ALA C 153       1.378 132.915  95.751  1.00 88.34           N  
ATOM   7781  CA  ALA C 153       0.225 132.006  95.806  1.00 90.78           C  
ATOM   7782  C   ALA C 153       0.477 130.779  96.688  1.00 92.54           C  
ATOM   7783  O   ALA C 153      -0.431 129.989  96.941  1.00 92.13           O  
ATOM   7784  CB  ALA C 153      -0.146 131.552  94.401  1.00 90.38           C  
ATOM   7785  N   ILE C 154       1.718 130.606  97.126  1.00 95.22           N  
ATOM   7786  CA  ILE C 154       2.055 129.499  98.000  1.00 97.91           C  
ATOM   7787  C   ILE C 154       1.528 129.937  99.357  1.00101.72           C  
ATOM   7788  O   ILE C 154       1.619 131.109  99.715  1.00102.06           O  
ATOM   7789  CB  ILE C 154       3.573 129.283  98.051  1.00 96.60           C  
ATOM   7790  CG1 ILE C 154       4.060 128.780  96.692  1.00 95.73           C  
ATOM   7791  CG2 ILE C 154       3.924 128.285  99.136  1.00 96.49           C  
ATOM   7792  CD1 ILE C 154       5.522 129.051  96.433  1.00 96.42           C  
ATOM   7793  N   PRO C 155       0.949 129.005 100.126  1.00105.96           N  
ATOM   7794  CA  PRO C 155       0.382 129.279 101.460  1.00108.93           C  
ATOM   7795  C   PRO C 155       1.335 129.728 102.587  1.00111.05           C  
ATOM   7796  O   PRO C 155       2.390 129.114 102.814  1.00111.17           O  
ATOM   7797  CB  PRO C 155      -0.318 127.960 101.818  1.00109.02           C  
ATOM   7798  CG  PRO C 155      -0.585 127.310 100.472  1.00108.69           C  
ATOM   7799  CD  PRO C 155       0.672 127.618  99.710  1.00106.94           C  
ATOM   7800  N   TYR C 156       0.941 130.797 103.288  1.00112.82           N  
ATOM   7801  CA  TYR C 156       1.697 131.332 104.433  1.00114.64           C  
ATOM   7802  C   TYR C 156       3.095 131.905 104.112  1.00114.07           C  
ATOM   7803  O   TYR C 156       3.385 133.068 104.398  1.00113.84           O  
ATOM   7804  CB  TYR C 156       1.849 130.234 105.505  1.00117.81           C  
ATOM   7805  CG  TYR C 156       0.610 129.377 105.769  1.00120.47           C  
ATOM   7806  CD1 TYR C 156       0.744 128.049 106.204  1.00121.67           C  
ATOM   7807  CD2 TYR C 156      -0.686 129.877 105.571  1.00121.12           C  
ATOM   7808  CE1 TYR C 156      -0.376 127.237 106.428  1.00122.21           C  
ATOM   7809  CE2 TYR C 156      -1.815 129.070 105.794  1.00121.38           C  
ATOM   7810  CZ  TYR C 156      -1.648 127.753 106.219  1.00121.95           C  
ATOM   7811  OH  TYR C 156      -2.742 126.940 106.413  1.00121.33           O  
ATOM   7812  N   ILE C 157       3.952 131.065 103.539  1.00113.09           N  
ATOM   7813  CA  ILE C 157       5.318 131.427 103.169  1.00112.18           C  
ATOM   7814  C   ILE C 157       5.388 132.102 101.797  1.00112.34           C  
ATOM   7815  O   ILE C 157       6.475 132.328 101.248  1.00112.71           O  
ATOM   7816  CB  ILE C 157       6.184 130.168 103.119  1.00111.64           C  
ATOM   7817  CG1 ILE C 157       5.483 129.099 102.265  1.00111.49           C  
ATOM   7818  CG2 ILE C 157       6.426 129.664 104.522  1.00111.55           C  
ATOM   7819  CD1 ILE C 157       6.252 127.792 102.106  1.00111.37           C  
ATOM   7820  N   GLY C 158       4.220 132.431 101.256  1.00112.09           N  
ATOM   7821  CA  GLY C 158       4.144 133.034  99.939  1.00111.00           C  
ATOM   7822  C   GLY C 158       4.671 134.439  99.781  1.00109.99           C  
ATOM   7823  O   GLY C 158       5.769 134.646  99.267  1.00109.19           O  
ATOM   7824  N   HIS C 159       3.879 135.407 100.219  1.00109.61           N  
ATOM   7825  CA  HIS C 159       4.259 136.803 100.099  1.00109.62           C  
ATOM   7826  C   HIS C 159       5.674 137.111 100.549  1.00108.04           C  
ATOM   7827  O   HIS C 159       6.220 138.163 100.217  1.00107.74           O  
ATOM   7828  CB  HIS C 159       3.250 137.673 100.844  1.00112.33           C  
ATOM   7829  CG  HIS C 159       1.987 137.902 100.072  1.00115.15           C  
ATOM   7830  ND1 HIS C 159       1.803 138.997  99.251  1.00115.68           N  
ATOM   7831  CD2 HIS C 159       0.879 137.133  99.929  1.00115.85           C  
ATOM   7832  CE1 HIS C 159       0.638 138.893  98.636  1.00116.11           C  
ATOM   7833  NE2 HIS C 159       0.058 137.771  99.029  1.00116.76           N  
ATOM   7834  N   THR C 160       6.277 136.190 101.289  1.00106.51           N  
ATOM   7835  CA  THR C 160       7.643 136.389 101.748  1.00104.64           C  
ATOM   7836  C   THR C 160       8.640 135.889 100.712  1.00101.97           C  
ATOM   7837  O   THR C 160       9.430 136.677 100.196  1.00101.04           O  
ATOM   7838  CB  THR C 160       7.893 135.694 103.118  1.00106.26           C  
ATOM   7839  OG1 THR C 160       7.321 136.492 104.169  1.00105.98           O  
ATOM   7840  CG2 THR C 160       9.397 135.516 103.380  1.00107.16           C  
ATOM   7841  N   LEU C 161       8.605 134.595 100.396  1.00 99.58           N  
ATOM   7842  CA  LEU C 161       9.535 134.060  99.409  1.00 98.12           C  
ATOM   7843  C   LEU C 161       9.624 135.005  98.206  1.00 95.54           C  
ATOM   7844  O   LEU C 161      10.670 135.111  97.569  1.00 95.63           O  
ATOM   7845  CB  LEU C 161       9.108 132.654  98.949  1.00100.34           C  
ATOM   7846  CG  LEU C 161       9.679 132.145  97.598  1.00102.86           C  
ATOM   7847  CD1 LEU C 161      11.202 131.967  97.653  1.00101.07           C  
ATOM   7848  CD2 LEU C 161       8.997 130.827  97.230  1.00103.17           C  
ATOM   7849  N   VAL C 162       8.530 135.704  97.918  1.00 92.22           N  
ATOM   7850  CA  VAL C 162       8.479 136.631  96.794  1.00 88.82           C  
ATOM   7851  C   VAL C 162       9.263 137.903  97.044  1.00 87.94           C  
ATOM   7852  O   VAL C 162      10.120 138.272  96.241  1.00 87.69           O  
ATOM   7853  CB  VAL C 162       7.025 137.009  96.453  1.00 87.91           C  
ATOM   7854  CG1 VAL C 162       6.994 138.157  95.485  1.00 86.97           C  
ATOM   7855  CG2 VAL C 162       6.324 135.825  95.837  1.00 88.77           C  
ATOM   7856  N   GLU C 163       8.965 138.576  98.155  1.00 87.50           N  
ATOM   7857  CA  GLU C 163       9.646 139.828  98.506  1.00 87.03           C  
ATOM   7858  C   GLU C 163      11.107 139.607  98.832  1.00 84.43           C  
ATOM   7859  O   GLU C 163      11.869 140.553  98.999  1.00 83.76           O  
ATOM   7860  CB  GLU C 163       8.974 140.508  99.696  1.00 90.21           C  
ATOM   7861  CG  GLU C 163       7.575 141.032  99.402  1.00 95.64           C  
ATOM   7862  CD  GLU C 163       7.079 142.037 100.444  1.00 98.70           C  
ATOM   7863  OE1 GLU C 163       5.912 142.478 100.320  1.00 99.74           O  
ATOM   7864  OE2 GLU C 163       7.850 142.389 101.374  1.00 99.26           O  
ATOM   7865  N   TRP C 164      11.481 138.345  98.937  1.00 81.89           N  
ATOM   7866  CA  TRP C 164      12.846 137.994  99.223  1.00 79.25           C  
ATOM   7867  C   TRP C 164      13.551 137.917  97.876  1.00 77.19           C  
ATOM   7868  O   TRP C 164      14.647 138.440  97.707  1.00 77.92           O  
ATOM   7869  CB  TRP C 164      12.893 136.650  99.949  1.00 80.55           C  
ATOM   7870  CG  TRP C 164      14.253 136.271 100.373  1.00 81.21           C  
ATOM   7871  CD1 TRP C 164      15.036 136.908 101.292  1.00 81.61           C  
ATOM   7872  CD2 TRP C 164      15.047 135.230  99.819  1.00 81.67           C  
ATOM   7873  NE1 TRP C 164      16.278 136.332 101.334  1.00 82.56           N  
ATOM   7874  CE2 TRP C 164      16.312 135.297 100.436  1.00 82.52           C  
ATOM   7875  CE3 TRP C 164      14.814 134.247  98.855  1.00 82.37           C  
ATOM   7876  CZ2 TRP C 164      17.345 134.418 100.119  1.00 82.90           C  
ATOM   7877  CZ3 TRP C 164      15.840 133.372  98.538  1.00 83.42           C  
ATOM   7878  CH2 TRP C 164      17.090 133.463  99.168  1.00 83.93           C  
ATOM   7879  N   ALA C 165      12.895 137.291  96.910  1.00 74.41           N  
ATOM   7880  CA  ALA C 165      13.445 137.139  95.570  1.00 72.05           C  
ATOM   7881  C   ALA C 165      13.630 138.466  94.848  1.00 70.92           C  
ATOM   7882  O   ALA C 165      14.614 138.661  94.139  1.00 69.74           O  
ATOM   7883  CB  ALA C 165      12.543 136.254  94.753  1.00 73.86           C  
ATOM   7884  N   TRP C 166      12.666 139.368  95.008  1.00 69.64           N  
ATOM   7885  CA  TRP C 166      12.734 140.682  94.369  1.00 67.61           C  
ATOM   7886  C   TRP C 166      13.739 141.611  95.044  1.00 66.38           C  
ATOM   7887  O   TRP C 166      14.305 142.503  94.404  1.00 65.27           O  
ATOM   7888  CB  TRP C 166      11.384 141.382  94.432  1.00 66.30           C  
ATOM   7889  CG  TRP C 166      10.350 140.834  93.570  1.00 64.85           C  
ATOM   7890  CD1 TRP C 166      10.527 140.171  92.400  1.00 65.58           C  
ATOM   7891  CD2 TRP C 166       8.941 140.986  93.743  1.00 65.40           C  
ATOM   7892  NE1 TRP C 166       9.311 139.897  91.824  1.00 66.77           N  
ATOM   7893  CE2 TRP C 166       8.317 140.388  92.632  1.00 66.49           C  
ATOM   7894  CE3 TRP C 166       8.142 141.573  94.733  1.00 64.73           C  
ATOM   7895  CZ2 TRP C 166       6.922 140.359  92.479  1.00 65.74           C  
ATOM   7896  CZ3 TRP C 166       6.761 141.544  94.583  1.00 63.76           C  
ATOM   7897  CH2 TRP C 166       6.166 140.940  93.463  1.00 64.11           C  
ATOM   7898  N   GLY C 167      13.919 141.407  96.349  1.00 64.62           N  
ATOM   7899  CA  GLY C 167      14.806 142.249  97.126  1.00 62.37           C  
ATOM   7900  C   GLY C 167      14.071 143.537  97.484  1.00 60.53           C  
ATOM   7901  O   GLY C 167      14.675 144.590  97.693  1.00 60.56           O  
ATOM   7902  N   GLY C 168      12.753 143.450  97.561  1.00 58.99           N  
ATOM   7903  CA  GLY C 168      11.957 144.618  97.862  1.00 57.15           C  
ATOM   7904  C   GLY C 168      10.494 144.338  97.619  1.00 57.22           C  
ATOM   7905  O   GLY C 168      10.021 143.237  97.868  1.00 57.20           O  
ATOM   7906  N   PHE C 169       9.772 145.313  97.094  1.00 58.47           N  
ATOM   7907  CA  PHE C 169       8.345 145.123  96.893  1.00 62.27           C  
ATOM   7908  C   PHE C 169       7.846 144.933  95.467  1.00 62.56           C  
ATOM   7909  O   PHE C 169       6.671 144.644  95.239  1.00 62.47           O  
ATOM   7910  CB  PHE C 169       7.616 146.286  97.541  1.00 66.08           C  
ATOM   7911  CG  PHE C 169       7.997 146.492  98.972  1.00 70.51           C  
ATOM   7912  CD1 PHE C 169       8.703 147.629  99.361  1.00 71.14           C  
ATOM   7913  CD2 PHE C 169       7.685 145.518  99.931  1.00 72.79           C  
ATOM   7914  CE1 PHE C 169       9.101 147.799 100.684  1.00 72.76           C  
ATOM   7915  CE2 PHE C 169       8.076 145.672 101.260  1.00 74.58           C  
ATOM   7916  CZ  PHE C 169       8.788 146.818 101.637  1.00 75.45           C  
ATOM   7917  N   SER C 170       8.739 145.094  94.506  1.00 62.41           N  
ATOM   7918  CA  SER C 170       8.386 144.940  93.106  1.00 61.70           C  
ATOM   7919  C   SER C 170       9.669 144.671  92.344  1.00 61.00           C  
ATOM   7920  O   SER C 170      10.774 144.876  92.863  1.00 61.39           O  
ATOM   7921  CB  SER C 170       7.746 146.218  92.573  1.00 61.59           C  
ATOM   7922  OG  SER C 170       8.634 147.312  92.729  1.00 62.22           O  
ATOM   7923  N   VAL C 171       9.532 144.200  91.114  1.00 58.62           N  
ATOM   7924  CA  VAL C 171      10.708 143.939  90.331  1.00 55.83           C  
ATOM   7925  C   VAL C 171      11.363 145.284  90.146  1.00 54.92           C  
ATOM   7926  O   VAL C 171      10.840 146.139  89.446  1.00 56.09           O  
ATOM   7927  CB  VAL C 171      10.328 143.378  88.991  1.00 56.78           C  
ATOM   7928  CG1 VAL C 171      11.564 143.217  88.125  1.00 54.29           C  
ATOM   7929  CG2 VAL C 171       9.609 142.050  89.196  1.00 58.40           C  
ATOM   7930  N   ASP C 172      12.494 145.498  90.794  1.00 53.23           N  
ATOM   7931  CA  ASP C 172      13.163 146.775  90.644  1.00 51.26           C  
ATOM   7932  C   ASP C 172      14.652 146.537  90.559  1.00 48.81           C  
ATOM   7933  O   ASP C 172      15.079 145.401  90.403  1.00 48.00           O  
ATOM   7934  CB  ASP C 172      12.848 147.694  91.814  1.00 54.74           C  
ATOM   7935  CG  ASP C 172      12.975 149.171  91.455  1.00 58.62           C  
ATOM   7936  OD1 ASP C 172      13.746 149.534  90.531  1.00 61.27           O  
ATOM   7937  OD2 ASP C 172      12.295 149.983  92.116  1.00 62.34           O  
ATOM   7938  N   ASN C 173      15.438 147.599  90.691  1.00 47.07           N  
ATOM   7939  CA  ASN C 173      16.871 147.481  90.569  1.00 48.35           C  
ATOM   7940  C   ASN C 173      17.494 146.344  91.356  1.00 49.57           C  
ATOM   7941  O   ASN C 173      18.369 145.633  90.845  1.00 50.49           O  
ATOM   7942  CB  ASN C 173      17.565 148.779  90.933  1.00 50.34           C  
ATOM   7943  CG  ASN C 173      18.956 148.864  90.323  1.00 53.72           C  
ATOM   7944  OD1 ASN C 173      19.109 149.214  89.152  1.00 56.08           O  
ATOM   7945  ND2 ASN C 173      19.973 148.510  91.100  1.00 55.48           N  
ATOM   7946  N   PRO C 174      17.069 146.149  92.610  1.00 48.74           N  
ATOM   7947  CA  PRO C 174      17.646 145.062  93.393  1.00 48.71           C  
ATOM   7948  C   PRO C 174      17.418 143.675  92.795  1.00 48.70           C  
ATOM   7949  O   PRO C 174      18.132 142.720  93.120  1.00 49.48           O  
ATOM   7950  CB  PRO C 174      16.981 145.242  94.758  1.00 49.57           C  
ATOM   7951  CG  PRO C 174      15.701 145.923  94.439  1.00 49.61           C  
ATOM   7952  CD  PRO C 174      16.158 146.942  93.445  1.00 49.27           C  
ATOM   7953  N   THR C 175      16.422 143.574  91.925  1.00 48.24           N  
ATOM   7954  CA  THR C 175      16.077 142.316  91.281  1.00 48.50           C  
ATOM   7955  C   THR C 175      16.955 142.160  90.047  1.00 48.84           C  
ATOM   7956  O   THR C 175      17.493 141.080  89.753  1.00 49.81           O  
ATOM   7957  CB  THR C 175      14.592 142.327  90.846  1.00 48.30           C  
ATOM   7958  OG1 THR C 175      13.806 142.923  91.879  1.00 49.86           O  
ATOM   7959  CG2 THR C 175      14.083 140.922  90.603  1.00 46.84           C  
ATOM   7960  N   LEU C 176      17.100 143.255  89.321  1.00 47.98           N  
ATOM   7961  CA  LEU C 176      17.894 143.242  88.116  1.00 47.76           C  
ATOM   7962  C   LEU C 176      19.300 142.822  88.459  1.00 48.46           C  
ATOM   7963  O   LEU C 176      19.838 141.918  87.839  1.00 50.52           O  
ATOM   7964  CB  LEU C 176      17.914 144.626  87.475  1.00 46.89           C  
ATOM   7965  CG  LEU C 176      18.641 144.802  86.151  1.00 45.32           C  
ATOM   7966  CD1 LEU C 176      17.959 143.968  85.094  1.00 46.45           C  
ATOM   7967  CD2 LEU C 176      18.618 146.264  85.753  1.00 44.73           C  
ATOM   7968  N   THR C 177      19.892 143.449  89.463  1.00 47.76           N  
ATOM   7969  CA  THR C 177      21.257 143.111  89.800  1.00 49.46           C  
ATOM   7970  C   THR C 177      21.481 141.669  90.197  1.00 50.08           C  
ATOM   7971  O   THR C 177      22.511 141.078  89.842  1.00 51.28           O  
ATOM   7972  CB  THR C 177      21.819 144.018  90.901  1.00 50.80           C  
ATOM   7973  OG1 THR C 177      20.867 144.145  91.959  1.00 53.36           O  
ATOM   7974  CG2 THR C 177      22.141 145.388  90.335  1.00 52.05           C  
ATOM   7975  N   ARG C 178      20.539 141.084  90.923  1.00 49.93           N  
ATOM   7976  CA  ARG C 178      20.727 139.699  91.321  1.00 50.30           C  
ATOM   7977  C   ARG C 178      20.441 138.774  90.152  1.00 49.90           C  
ATOM   7978  O   ARG C 178      20.977 137.666  90.093  1.00 51.42           O  
ATOM   7979  CB  ARG C 178      19.858 139.338  92.530  1.00 50.63           C  
ATOM   7980  CG  ARG C 178      18.366 139.460  92.310  1.00 53.10           C  
ATOM   7981  CD  ARG C 178      17.631 139.270  93.627  1.00 56.08           C  
ATOM   7982  NE  ARG C 178      18.056 140.244  94.633  1.00 56.80           N  
ATOM   7983  CZ  ARG C 178      17.556 140.318  95.864  1.00 56.79           C  
ATOM   7984  NH1 ARG C 178      16.603 139.472  96.251  1.00 52.44           N  
ATOM   7985  NH2 ARG C 178      18.014 141.245  96.702  1.00 57.91           N  
ATOM   7986  N   PHE C 179      19.608 139.212  89.209  1.00 48.64           N  
ATOM   7987  CA  PHE C 179      19.332 138.366  88.054  1.00 47.65           C  
ATOM   7988  C   PHE C 179      20.564 138.269  87.154  1.00 47.13           C  
ATOM   7989  O   PHE C 179      20.884 137.194  86.638  1.00 46.41           O  
ATOM   7990  CB  PHE C 179      18.129 138.889  87.290  1.00 46.67           C  
ATOM   7991  CG  PHE C 179      16.816 138.352  87.796  1.00 47.77           C  
ATOM   7992  CD1 PHE C 179      16.710 137.813  89.076  1.00 48.65           C  
ATOM   7993  CD2 PHE C 179      15.676 138.394  87.001  1.00 47.14           C  
ATOM   7994  CE1 PHE C 179      15.484 137.318  89.552  1.00 48.19           C  
ATOM   7995  CE2 PHE C 179      14.462 137.909  87.469  1.00 46.51           C  
ATOM   7996  CZ  PHE C 179      14.367 137.369  88.746  1.00 46.12           C  
ATOM   7997  N   PHE C 180      21.265 139.388  86.977  1.00 46.79           N  
ATOM   7998  CA  PHE C 180      22.483 139.393  86.176  1.00 46.15           C  
ATOM   7999  C   PHE C 180      23.457 138.380  86.794  1.00 45.61           C  
ATOM   8000  O   PHE C 180      24.007 137.538  86.094  1.00 45.07           O  
ATOM   8001  CB  PHE C 180      23.116 140.789  86.173  1.00 47.18           C  
ATOM   8002  CG  PHE C 180      24.390 140.891  85.351  1.00 49.62           C  
ATOM   8003  CD1 PHE C 180      25.513 141.530  85.858  1.00 50.32           C  
ATOM   8004  CD2 PHE C 180      24.467 140.354  84.082  1.00 49.62           C  
ATOM   8005  CE1 PHE C 180      26.677 141.623  85.116  1.00 48.09           C  
ATOM   8006  CE2 PHE C 180      25.642 140.449  83.337  1.00 48.70           C  
ATOM   8007  CZ  PHE C 180      26.735 141.080  83.856  1.00 48.04           C  
ATOM   8008  N   ALA C 181      23.662 138.453  88.108  1.00 44.76           N  
ATOM   8009  CA  ALA C 181      24.570 137.525  88.785  1.00 44.69           C  
ATOM   8010  C   ALA C 181      24.156 136.087  88.493  1.00 45.73           C  
ATOM   8011  O   ALA C 181      24.970 135.241  88.107  1.00 47.81           O  
ATOM   8012  CB  ALA C 181      24.550 137.761  90.276  1.00 41.80           C  
ATOM   8013  N   LEU C 182      22.882 135.804  88.701  1.00 44.24           N  
ATOM   8014  CA  LEU C 182      22.373 134.479  88.455  1.00 41.91           C  
ATOM   8015  C   LEU C 182      22.562 134.045  87.011  1.00 40.63           C  
ATOM   8016  O   LEU C 182      22.926 132.898  86.744  1.00 37.79           O  
ATOM   8017  CB  LEU C 182      20.901 134.452  88.789  1.00 44.17           C  
ATOM   8018  CG  LEU C 182      20.606 134.000  90.193  1.00 44.95           C  
ATOM   8019  CD1 LEU C 182      19.091 133.988  90.380  1.00 44.27           C  
ATOM   8020  CD2 LEU C 182      21.221 132.620  90.395  1.00 43.66           C  
ATOM   8021  N   HIS C 183      22.295 134.959  86.081  1.00 39.66           N  
ATOM   8022  CA  HIS C 183      22.415 134.630  84.673  1.00 39.49           C  
ATOM   8023  C   HIS C 183      23.870 134.319  84.330  1.00 40.60           C  
ATOM   8024  O   HIS C 183      24.149 133.475  83.496  1.00 42.05           O  
ATOM   8025  CB  HIS C 183      21.882 135.764  83.801  1.00 36.85           C  
ATOM   8026  CG  HIS C 183      21.841 135.423  82.349  1.00 37.71           C  
ATOM   8027  ND1 HIS C 183      21.082 134.382  81.864  1.00 38.51           N  
ATOM   8028  CD2 HIS C 183      22.492 135.945  81.276  1.00 38.48           C  
ATOM   8029  CE1 HIS C 183      21.271 134.277  80.557  1.00 40.13           C  
ATOM   8030  NE2 HIS C 183      22.123 135.213  80.172  1.00 38.74           N  
ATOM   8031  N   PHE C 184      24.802 134.988  84.988  1.00 41.76           N  
ATOM   8032  CA  PHE C 184      26.227 134.755  84.750  1.00 42.22           C  
ATOM   8033  C   PHE C 184      26.623 133.382  85.346  1.00 42.62           C  
ATOM   8034  O   PHE C 184      27.399 132.633  84.762  1.00 43.43           O  
ATOM   8035  CB  PHE C 184      27.019 135.877  85.433  1.00 41.91           C  
ATOM   8036  CG  PHE C 184      28.417 136.070  84.910  1.00 41.87           C  
ATOM   8037  CD1 PHE C 184      28.837 137.329  84.492  1.00 41.98           C  
ATOM   8038  CD2 PHE C 184      29.324 135.033  84.885  1.00 40.98           C  
ATOM   8039  CE1 PHE C 184      30.125 137.548  84.064  1.00 38.41           C  
ATOM   8040  CE2 PHE C 184      30.619 135.250  84.456  1.00 41.20           C  
ATOM   8041  CZ  PHE C 184      31.014 136.508  84.046  1.00 40.73           C  
ATOM   8042  N   LEU C 185      26.060 133.053  86.501  1.00 41.91           N  
ATOM   8043  CA  LEU C 185      26.381 131.816  87.199  1.00 41.15           C  
ATOM   8044  C   LEU C 185      25.805 130.497  86.666  1.00 41.74           C  
ATOM   8045  O   LEU C 185      26.548 129.553  86.445  1.00 43.96           O  
ATOM   8046  CB  LEU C 185      25.998 131.975  88.671  1.00 40.15           C  
ATOM   8047  CG  LEU C 185      26.110 130.749  89.572  1.00 39.51           C  
ATOM   8048  CD1 LEU C 185      27.541 130.231  89.559  1.00 39.88           C  
ATOM   8049  CD2 LEU C 185      25.707 131.131  90.982  1.00 38.62           C  
ATOM   8050  N   LEU C 186      24.498 130.418  86.455  1.00 39.97           N  
ATOM   8051  CA  LEU C 186      23.894 129.176  86.001  1.00 39.09           C  
ATOM   8052  C   LEU C 186      24.497 128.430  84.811  1.00 39.38           C  
ATOM   8053  O   LEU C 186      24.543 127.200  84.798  1.00 39.29           O  
ATOM   8054  CB  LEU C 186      22.418 129.407  85.754  1.00 41.00           C  
ATOM   8055  CG  LEU C 186      21.751 129.851  87.045  1.00 42.53           C  
ATOM   8056  CD1 LEU C 186      20.255 130.075  86.817  1.00 43.49           C  
ATOM   8057  CD2 LEU C 186      21.978 128.783  88.087  1.00 43.81           C  
ATOM   8058  N   PRO C 187      24.932 129.149  83.777  1.00 39.44           N  
ATOM   8059  CA  PRO C 187      25.509 128.408  82.651  1.00 39.34           C  
ATOM   8060  C   PRO C 187      26.671 127.517  83.100  1.00 39.66           C  
ATOM   8061  O   PRO C 187      26.862 126.402  82.596  1.00 40.15           O  
ATOM   8062  CB  PRO C 187      25.949 129.514  81.707  1.00 40.53           C  
ATOM   8063  CG  PRO C 187      24.876 130.544  81.919  1.00 41.24           C  
ATOM   8064  CD  PRO C 187      24.714 130.563  83.434  1.00 39.00           C  
ATOM   8065  N   PHE C 188      27.455 128.001  84.049  1.00 38.49           N  
ATOM   8066  CA  PHE C 188      28.546 127.184  84.526  1.00 39.73           C  
ATOM   8067  C   PHE C 188      28.009 125.951  85.243  1.00 38.77           C  
ATOM   8068  O   PHE C 188      28.501 124.842  85.041  1.00 38.52           O  
ATOM   8069  CB  PHE C 188      29.447 128.021  85.396  1.00 43.41           C  
ATOM   8070  CG  PHE C 188      30.029 129.177  84.659  1.00 49.10           C  
ATOM   8071  CD1 PHE C 188      29.668 130.487  84.969  1.00 52.48           C  
ATOM   8072  CD2 PHE C 188      30.889 128.956  83.585  1.00 50.89           C  
ATOM   8073  CE1 PHE C 188      30.158 131.565  84.202  1.00 53.58           C  
ATOM   8074  CE2 PHE C 188      31.386 130.027  82.810  1.00 51.97           C  
ATOM   8075  CZ  PHE C 188      31.021 131.328  83.117  1.00 51.47           C  
ATOM   8076  N   ALA C 189      26.974 126.124  86.052  1.00 37.43           N  
ATOM   8077  CA  ALA C 189      26.374 124.971  86.723  1.00 35.97           C  
ATOM   8078  C   ALA C 189      25.935 124.013  85.633  1.00 35.81           C  
ATOM   8079  O   ALA C 189      26.043 122.797  85.777  1.00 36.71           O  
ATOM   8080  CB  ALA C 189      25.152 125.381  87.545  1.00 33.77           C  
ATOM   8081  N   ILE C 190      25.426 124.563  84.536  1.00 34.76           N  
ATOM   8082  CA  ILE C 190      24.969 123.709  83.467  1.00 34.08           C  
ATOM   8083  C   ILE C 190      26.121 122.890  82.940  1.00 33.70           C  
ATOM   8084  O   ILE C 190      26.015 121.651  82.869  1.00 33.70           O  
ATOM   8085  CB  ILE C 190      24.329 124.505  82.340  1.00 34.42           C  
ATOM   8086  CG1 ILE C 190      23.053 125.189  82.860  1.00 33.41           C  
ATOM   8087  CG2 ILE C 190      24.029 123.575  81.177  1.00 31.87           C  
ATOM   8088  CD1 ILE C 190      22.273 125.979  81.789  1.00 33.50           C  
ATOM   8089  N   ALA C 191      27.221 123.564  82.594  1.00 31.86           N  
ATOM   8090  CA  ALA C 191      28.413 122.866  82.100  1.00 30.01           C  
ATOM   8091  C   ALA C 191      28.832 121.790  83.108  1.00 29.63           C  
ATOM   8092  O   ALA C 191      29.066 120.635  82.756  1.00 27.94           O  
ATOM   8093  CB  ALA C 191      29.522 123.825  81.922  1.00 30.16           C  
ATOM   8094  N   GLY C 192      28.931 122.172  84.371  1.00 28.84           N  
ATOM   8095  CA  GLY C 192      29.280 121.190  85.374  1.00 30.53           C  
ATOM   8096  C   GLY C 192      28.354 119.982  85.323  1.00 33.84           C  
ATOM   8097  O   GLY C 192      28.799 118.856  85.076  1.00 34.10           O  
ATOM   8098  N   ILE C 193      27.060 120.208  85.552  1.00 36.37           N  
ATOM   8099  CA  ILE C 193      26.080 119.131  85.524  1.00 38.68           C  
ATOM   8100  C   ILE C 193      26.124 118.323  84.221  1.00 40.37           C  
ATOM   8101  O   ILE C 193      25.805 117.124  84.222  1.00 39.99           O  
ATOM   8102  CB  ILE C 193      24.668 119.674  85.739  1.00 40.61           C  
ATOM   8103  CG1 ILE C 193      24.609 120.373  87.079  1.00 39.55           C  
ATOM   8104  CG2 ILE C 193      23.629 118.544  85.746  1.00 38.74           C  
ATOM   8105  CD1 ILE C 193      23.223 120.807  87.396  1.00 43.31           C  
ATOM   8106  N   THR C 194      26.496 118.959  83.110  1.00 39.85           N  
ATOM   8107  CA  THR C 194      26.621 118.208  81.864  1.00 41.53           C  
ATOM   8108  C   THR C 194      27.741 117.152  82.013  1.00 43.98           C  
ATOM   8109  O   THR C 194      27.621 116.034  81.510  1.00 45.02           O  
ATOM   8110  CB  THR C 194      26.974 119.120  80.708  1.00 40.29           C  
ATOM   8111  OG1 THR C 194      25.948 120.096  80.585  1.00 43.62           O  
ATOM   8112  CG2 THR C 194      27.095 118.347  79.405  1.00 35.74           C  
ATOM   8113  N   ILE C 195      28.826 117.493  82.704  1.00 44.60           N  
ATOM   8114  CA  ILE C 195      29.891 116.520  82.870  1.00 44.92           C  
ATOM   8115  C   ILE C 195      29.311 115.317  83.593  1.00 44.85           C  
ATOM   8116  O   ILE C 195      29.611 114.178  83.236  1.00 44.62           O  
ATOM   8117  CB  ILE C 195      31.070 117.048  83.697  1.00 46.42           C  
ATOM   8118  CG1 ILE C 195      31.519 118.434  83.217  1.00 46.71           C  
ATOM   8119  CG2 ILE C 195      32.228 116.109  83.520  1.00 44.54           C  
ATOM   8120  CD1 ILE C 195      32.102 118.432  81.834  1.00 46.39           C  
ATOM   8121  N   ILE C 196      28.488 115.564  84.613  1.00 44.31           N  
ATOM   8122  CA  ILE C 196      27.840 114.458  85.351  1.00 44.40           C  
ATOM   8123  C   ILE C 196      26.924 113.655  84.389  1.00 44.03           C  
ATOM   8124  O   ILE C 196      26.932 112.422  84.388  1.00 42.63           O  
ATOM   8125  CB  ILE C 196      26.943 114.981  86.527  1.00 44.01           C  
ATOM   8126  CG1 ILE C 196      27.755 115.864  87.476  1.00 43.76           C  
ATOM   8127  CG2 ILE C 196      26.322 113.814  87.277  1.00 40.69           C  
ATOM   8128  CD1 ILE C 196      28.958 115.178  88.074  1.00 43.72           C  
ATOM   8129  N   HIS C 197      26.137 114.373  83.584  1.00 42.62           N  
ATOM   8130  CA  HIS C 197      25.221 113.755  82.627  1.00 42.30           C  
ATOM   8131  C   HIS C 197      26.012 112.732  81.803  1.00 41.94           C  
ATOM   8132  O   HIS C 197      25.680 111.546  81.800  1.00 42.76           O  
ATOM   8133  CB  HIS C 197      24.591 114.852  81.741  1.00 40.78           C  
ATOM   8134  CG  HIS C 197      23.476 114.394  80.839  1.00 39.69           C  
ATOM   8135  ND1 HIS C 197      22.292 113.863  81.307  1.00 37.43           N  
ATOM   8136  CD2 HIS C 197      23.324 114.507  79.492  1.00 40.55           C  
ATOM   8137  CE1 HIS C 197      21.460 113.681  80.291  1.00 37.76           C  
ATOM   8138  NE2 HIS C 197      22.057 114.066  79.174  1.00 38.16           N  
ATOM   8139  N   LEU C 198      27.075 113.170  81.137  1.00 41.64           N  
ATOM   8140  CA  LEU C 198      27.875 112.246  80.323  1.00 42.07           C  
ATOM   8141  C   LEU C 198      28.589 111.153  81.118  1.00 43.51           C  
ATOM   8142  O   LEU C 198      28.898 110.091  80.579  1.00 42.73           O  
ATOM   8143  CB  LEU C 198      28.913 113.001  79.515  1.00 39.39           C  
ATOM   8144  CG  LEU C 198      28.350 113.931  78.466  1.00 39.29           C  
ATOM   8145  CD1 LEU C 198      29.448 114.689  77.751  1.00 36.93           C  
ATOM   8146  CD2 LEU C 198      27.592 113.088  77.501  1.00 42.18           C  
ATOM   8147  N   THR C 199      28.866 111.407  82.390  1.00 43.78           N  
ATOM   8148  CA  THR C 199      29.541 110.398  83.183  1.00 45.76           C  
ATOM   8149  C   THR C 199      28.627 109.216  83.413  1.00 45.60           C  
ATOM   8150  O   THR C 199      29.018 108.077  83.197  1.00 46.98           O  
ATOM   8151  CB  THR C 199      30.014 110.962  84.526  1.00 48.02           C  
ATOM   8152  OG1 THR C 199      31.228 111.692  84.312  1.00 50.89           O  
ATOM   8153  CG2 THR C 199      30.259 109.841  85.531  1.00 48.23           C  
ATOM   8154  N   PHE C 200      27.414 109.477  83.874  1.00 45.16           N  
ATOM   8155  CA  PHE C 200      26.472 108.394  84.071  1.00 43.53           C  
ATOM   8156  C   PHE C 200      26.276 107.727  82.712  1.00 45.01           C  
ATOM   8157  O   PHE C 200      26.298 106.508  82.592  1.00 45.34           O  
ATOM   8158  CB  PHE C 200      25.139 108.938  84.550  1.00 40.67           C  
ATOM   8159  CG  PHE C 200      25.079 109.189  86.010  1.00 37.69           C  
ATOM   8160  CD1 PHE C 200      25.081 108.136  86.905  1.00 38.84           C  
ATOM   8161  CD2 PHE C 200      24.976 110.477  86.496  1.00 38.14           C  
ATOM   8162  CE1 PHE C 200      24.976 108.359  88.265  1.00 37.71           C  
ATOM   8163  CE2 PHE C 200      24.873 110.716  87.858  1.00 36.75           C  
ATOM   8164  CZ  PHE C 200      24.872 109.655  88.740  1.00 37.60           C  
ATOM   8165  N   LEU C 201      26.081 108.528  81.676  1.00 46.09           N  
ATOM   8166  CA  LEU C 201      25.877 107.941  80.376  1.00 48.31           C  
ATOM   8167  C   LEU C 201      26.949 106.920  80.045  1.00 49.78           C  
ATOM   8168  O   LEU C 201      26.631 105.815  79.656  1.00 52.22           O  
ATOM   8169  CB  LEU C 201      25.864 108.998  79.281  1.00 48.84           C  
ATOM   8170  CG  LEU C 201      25.764 108.306  77.916  1.00 49.35           C  
ATOM   8171  CD1 LEU C 201      24.373 107.675  77.821  1.00 48.59           C  
ATOM   8172  CD2 LEU C 201      26.012 109.273  76.764  1.00 47.64           C  
ATOM   8173  N   HIS C 202      28.217 107.273  80.204  1.00 50.61           N  
ATOM   8174  CA  HIS C 202      29.281 106.338  79.859  1.00 52.62           C  
ATOM   8175  C   HIS C 202      29.325 105.023  80.616  1.00 53.59           C  
ATOM   8176  O   HIS C 202      30.083 104.135  80.249  1.00 53.86           O  
ATOM   8177  CB  HIS C 202      30.636 107.027  79.957  1.00 54.26           C  
ATOM   8178  CG  HIS C 202      30.838 108.090  78.918  1.00 58.23           C  
ATOM   8179  ND1 HIS C 202      31.912 108.954  78.929  1.00 58.86           N  
ATOM   8180  CD2 HIS C 202      30.091 108.434  77.841  1.00 59.05           C  
ATOM   8181  CE1 HIS C 202      31.817 109.786  77.906  1.00 59.06           C  
ATOM   8182  NE2 HIS C 202      30.722 109.491  77.231  1.00 59.00           N  
ATOM   8183  N   GLU C 203      28.524 104.889  81.666  1.00 55.23           N  
ATOM   8184  CA  GLU C 203      28.481 103.649  82.441  1.00 57.20           C  
ATOM   8185  C   GLU C 203      27.863 102.567  81.588  1.00 57.26           C  
ATOM   8186  O   GLU C 203      28.310 101.429  81.577  1.00 57.90           O  
ATOM   8187  CB  GLU C 203      27.624 103.818  83.693  1.00 60.37           C  
ATOM   8188  CG  GLU C 203      28.226 104.732  84.739  1.00 67.69           C  
ATOM   8189  CD  GLU C 203      29.472 104.138  85.371  1.00 71.29           C  
ATOM   8190  OE1 GLU C 203      29.335 103.141  86.125  1.00 74.43           O  
ATOM   8191  OE2 GLU C 203      30.581 104.664  85.107  1.00 71.56           O  
ATOM   8192  N   SER C 204      26.818 102.945  80.867  1.00 59.09           N  
ATOM   8193  CA  SER C 204      26.081 102.030  79.990  1.00 59.65           C  
ATOM   8194  C   SER C 204      26.486 102.125  78.522  1.00 58.96           C  
ATOM   8195  O   SER C 204      26.512 101.120  77.810  1.00 60.28           O  
ATOM   8196  CB  SER C 204      24.575 102.310  80.095  1.00 59.30           C  
ATOM   8197  OG  SER C 204      24.260 103.623  79.662  1.00 57.70           O  
ATOM   8198  N   GLY C 205      26.807 103.335  78.080  1.00 57.50           N  
ATOM   8199  CA  GLY C 205      27.167 103.531  76.698  1.00 57.37           C  
ATOM   8200  C   GLY C 205      25.855 103.929  76.065  1.00 58.56           C  
ATOM   8201  O   GLY C 205      24.810 103.868  76.737  1.00 58.21           O  
ATOM   8202  N   SER C 206      25.884 104.325  74.792  1.00 58.12           N  
ATOM   8203  CA  SER C 206      24.658 104.755  74.127  1.00 56.97           C  
ATOM   8204  C   SER C 206      23.663 103.671  73.804  1.00 55.46           C  
ATOM   8205  O   SER C 206      23.996 102.512  73.610  1.00 57.73           O  
ATOM   8206  CB  SER C 206      24.976 105.489  72.839  1.00 56.66           C  
ATOM   8207  OG  SER C 206      25.710 106.658  73.109  1.00 61.01           O  
ATOM   8208  N   ASN C 207      22.414 104.076  73.754  1.00 53.82           N  
ATOM   8209  CA  ASN C 207      21.333 103.189  73.397  1.00 52.06           C  
ATOM   8210  C   ASN C 207      21.319 103.326  71.867  1.00 50.71           C  
ATOM   8211  O   ASN C 207      22.058 104.151  71.320  1.00 50.19           O  
ATOM   8212  CB  ASN C 207      20.048 103.740  73.995  1.00 53.46           C  
ATOM   8213  CG  ASN C 207      18.866 102.892  73.702  1.00 52.85           C  
ATOM   8214  OD1 ASN C 207      17.724 103.351  73.795  1.00 54.24           O  
ATOM   8215  ND2 ASN C 207      19.114 101.639  73.358  1.00 51.43           N  
ATOM   8216  N   ASN C 208      20.513 102.536  71.165  1.00 48.05           N  
ATOM   8217  CA  ASN C 208      20.460 102.664  69.707  1.00 45.75           C  
ATOM   8218  C   ASN C 208      19.011 102.512  69.254  1.00 44.63           C  
ATOM   8219  O   ASN C 208      18.209 101.951  69.965  1.00 45.39           O  
ATOM   8220  CB  ASN C 208      21.354 101.628  69.042  1.00 44.50           C  
ATOM   8221  CG  ASN C 208      20.766 100.252  69.078  1.00 45.05           C  
ATOM   8222  OD1 ASN C 208      19.976  99.884  68.212  1.00 46.43           O  
ATOM   8223  ND2 ASN C 208      21.137  99.477  70.088  1.00 44.35           N  
ATOM   8224  N   PRO C 209      18.666 103.002  68.057  1.00 43.86           N  
ATOM   8225  CA  PRO C 209      17.299 102.918  67.553  1.00 43.26           C  
ATOM   8226  C   PRO C 209      16.541 101.593  67.503  1.00 43.90           C  
ATOM   8227  O   PRO C 209      15.330 101.601  67.372  1.00 46.16           O  
ATOM   8228  CB  PRO C 209      17.394 103.608  66.193  1.00 43.82           C  
ATOM   8229  CG  PRO C 209      18.831 103.425  65.791  1.00 42.52           C  
ATOM   8230  CD  PRO C 209      19.546 103.656  67.069  1.00 44.75           C  
ATOM   8231  N   LEU C 210      17.204 100.453  67.595  1.00 43.46           N  
ATOM   8232  CA  LEU C 210      16.445  99.207  67.572  1.00 43.18           C  
ATOM   8233  C   LEU C 210      16.244  98.732  69.003  1.00 42.97           C  
ATOM   8234  O   LEU C 210      15.519  97.775  69.246  1.00 44.06           O  
ATOM   8235  CB  LEU C 210      17.166  98.113  66.778  1.00 45.06           C  
ATOM   8236  CG  LEU C 210      17.424  98.273  65.281  1.00 46.15           C  
ATOM   8237  CD1 LEU C 210      18.142  97.034  64.736  1.00 46.95           C  
ATOM   8238  CD2 LEU C 210      16.117  98.456  64.577  1.00 47.60           C  
ATOM   8239  N   GLY C 211      16.908  99.391  69.944  1.00 42.47           N  
ATOM   8240  CA  GLY C 211      16.778  99.037  71.350  1.00 45.69           C  
ATOM   8241  C   GLY C 211      17.158  97.618  71.764  1.00 49.00           C  
ATOM   8242  O   GLY C 211      16.532  97.026  72.664  1.00 50.77           O  
ATOM   8243  N   ILE C 212      18.165  97.054  71.103  1.00 49.05           N  
ATOM   8244  CA  ILE C 212      18.639  95.721  71.424  1.00 48.34           C  
ATOM   8245  C   ILE C 212      20.128  95.889  71.582  1.00 50.39           C  
ATOM   8246  O   ILE C 212      20.724  96.743  70.942  1.00 50.64           O  
ATOM   8247  CB  ILE C 212      18.363  94.718  70.290  1.00 48.74           C  
ATOM   8248  CG1 ILE C 212      18.954  95.238  68.984  1.00 47.28           C  
ATOM   8249  CG2 ILE C 212      16.844  94.467  70.136  1.00 48.94           C  
ATOM   8250  CD1 ILE C 212      18.859  94.241  67.867  1.00 45.76           C  
ATOM   8251  N   SER C 213      20.733  95.080  72.434  1.00 53.36           N  
ATOM   8252  CA  SER C 213      22.173  95.167  72.692  1.00 56.90           C  
ATOM   8253  C   SER C 213      23.049  95.357  71.448  1.00 56.67           C  
ATOM   8254  O   SER C 213      22.993  94.567  70.514  1.00 56.98           O  
ATOM   8255  CB  SER C 213      22.612  93.912  73.456  1.00 59.90           C  
ATOM   8256  OG  SER C 213      24.015  93.872  73.636  1.00 65.96           O  
ATOM   8257  N   SER C 214      23.876  96.395  71.445  1.00 56.90           N  
ATOM   8258  CA  SER C 214      24.740  96.645  70.294  1.00 59.49           C  
ATOM   8259  C   SER C 214      26.217  96.303  70.518  1.00 60.46           C  
ATOM   8260  O   SER C 214      27.091  96.842  69.851  1.00 58.89           O  
ATOM   8261  CB  SER C 214      24.599  98.109  69.822  1.00 60.15           C  
ATOM   8262  OG  SER C 214      24.606  99.050  70.892  1.00 61.65           O  
ATOM   8263  N   ASP C 215      26.486  95.389  71.444  1.00 63.27           N  
ATOM   8264  CA  ASP C 215      27.860  94.987  71.763  1.00 65.70           C  
ATOM   8265  C   ASP C 215      28.456  94.186  70.613  1.00 65.95           C  
ATOM   8266  O   ASP C 215      29.688  94.130  70.408  1.00 66.02           O  
ATOM   8267  CB  ASP C 215      27.872  94.127  73.035  1.00 67.31           C  
ATOM   8268  CG  ASP C 215      27.599  94.933  74.302  1.00 70.05           C  
ATOM   8269  OD1 ASP C 215      27.442  94.300  75.375  1.00 70.92           O  
ATOM   8270  OD2 ASP C 215      27.555  96.187  74.227  1.00 70.48           O  
ATOM   8271  N   SER C 216      27.552  93.557  69.871  1.00 64.58           N  
ATOM   8272  CA  SER C 216      27.910  92.720  68.736  1.00 62.60           C  
ATOM   8273  C   SER C 216      28.419  93.528  67.569  1.00 61.66           C  
ATOM   8274  O   SER C 216      28.960  92.963  66.621  1.00 60.91           O  
ATOM   8275  CB  SER C 216      26.687  91.929  68.300  1.00 61.47           C  
ATOM   8276  OG  SER C 216      25.511  92.625  68.684  1.00 63.16           O  
ATOM   8277  N   ASP C 217      28.250  94.847  67.648  1.00 61.37           N  
ATOM   8278  CA  ASP C 217      28.647  95.738  66.562  1.00 61.44           C  
ATOM   8279  C   ASP C 217      28.949  97.151  67.045  1.00 59.98           C  
ATOM   8280  O   ASP C 217      28.102  98.034  66.915  1.00 59.76           O  
ATOM   8281  CB  ASP C 217      27.514  95.799  65.523  1.00 64.24           C  
ATOM   8282  CG  ASP C 217      27.990  96.272  64.163  1.00 67.82           C  
ATOM   8283  OD1 ASP C 217      27.140  96.381  63.244  1.00 67.74           O  
ATOM   8284  OD2 ASP C 217      29.218  96.524  64.023  1.00 69.75           O  
ATOM   8285  N   LYS C 218      30.143  97.379  67.589  1.00 58.05           N  
ATOM   8286  CA  LYS C 218      30.483  98.712  68.068  1.00 56.79           C  
ATOM   8287  C   LYS C 218      31.627  99.328  67.292  1.00 56.08           C  
ATOM   8288  O   LYS C 218      32.522  98.623  66.858  1.00 59.26           O  
ATOM   8289  CB  LYS C 218      30.797  98.677  69.557  1.00 57.03           C  
ATOM   8290  CG  LYS C 218      29.538  98.528  70.431  1.00 59.34           C  
ATOM   8291  CD  LYS C 218      29.666  99.240  71.794  1.00 58.83           C  
ATOM   8292  CE  LYS C 218      28.493  98.925  72.726  1.00 57.43           C  
ATOM   8293  NZ  LYS C 218      27.238  99.532  72.268  1.00 55.22           N  
ATOM   8294  N   ILE C 219      31.577 100.642  67.095  1.00 53.00           N  
ATOM   8295  CA  ILE C 219      32.597 101.353  66.330  1.00 50.98           C  
ATOM   8296  C   ILE C 219      33.171 102.504  67.154  1.00 49.97           C  
ATOM   8297  O   ILE C 219      32.481 103.078  67.996  1.00 49.91           O  
ATOM   8298  CB  ILE C 219      32.008 101.918  64.984  1.00 50.43           C  
ATOM   8299  CG1 ILE C 219      30.801 102.818  65.259  1.00 50.11           C  
ATOM   8300  CG2 ILE C 219      31.543 100.783  64.094  1.00 47.04           C  
ATOM   8301  CD1 ILE C 219      30.188 103.404  64.020  1.00 49.67           C  
ATOM   8302  N   PRO C 220      34.445 102.859  66.924  1.00 48.39           N  
ATOM   8303  CA  PRO C 220      35.029 103.953  67.698  1.00 47.63           C  
ATOM   8304  C   PRO C 220      34.387 105.306  67.365  1.00 46.61           C  
ATOM   8305  O   PRO C 220      34.116 105.594  66.205  1.00 46.51           O  
ATOM   8306  CB  PRO C 220      36.512 103.878  67.325  1.00 46.80           C  
ATOM   8307  CG  PRO C 220      36.462 103.435  65.904  1.00 46.99           C  
ATOM   8308  CD  PRO C 220      35.417 102.326  65.955  1.00 48.67           C  
ATOM   8309  N   PHE C 221      34.145 106.118  68.395  1.00 45.58           N  
ATOM   8310  CA  PHE C 221      33.548 107.433  68.244  1.00 45.91           C  
ATOM   8311  C   PHE C 221      34.193 108.182  67.096  1.00 47.30           C  
ATOM   8312  O   PHE C 221      33.505 108.745  66.252  1.00 46.58           O  
ATOM   8313  CB  PHE C 221      33.715 108.231  69.530  1.00 47.50           C  
ATOM   8314  CG  PHE C 221      33.063 109.577  69.487  1.00 49.47           C  
ATOM   8315  CD1 PHE C 221      31.688 109.707  69.679  1.00 50.06           C  
ATOM   8316  CD2 PHE C 221      33.813 110.716  69.195  1.00 50.21           C  
ATOM   8317  CE1 PHE C 221      31.068 110.961  69.576  1.00 50.96           C  
ATOM   8318  CE2 PHE C 221      33.209 111.976  69.090  1.00 50.11           C  
ATOM   8319  CZ  PHE C 221      31.834 112.100  69.279  1.00 50.67           C  
ATOM   8320  N   HIS C 222      35.524 108.216  67.089  1.00 50.75           N  
ATOM   8321  CA  HIS C 222      36.282 108.864  66.015  1.00 51.78           C  
ATOM   8322  C   HIS C 222      36.768 107.758  65.076  1.00 51.56           C  
ATOM   8323  O   HIS C 222      37.313 106.745  65.540  1.00 52.66           O  
ATOM   8324  CB  HIS C 222      37.500 109.595  66.566  1.00 53.67           C  
ATOM   8325  CG  HIS C 222      38.384 110.153  65.495  1.00 56.62           C  
ATOM   8326  ND1 HIS C 222      38.066 111.294  64.788  1.00 57.22           N  
ATOM   8327  CD2 HIS C 222      39.534 109.684  64.953  1.00 57.56           C  
ATOM   8328  CE1 HIS C 222      38.980 111.501  63.855  1.00 57.09           C  
ATOM   8329  NE2 HIS C 222      39.881 110.538  63.933  1.00 57.88           N  
ATOM   8330  N   PRO C 223      36.651 107.960  63.750  1.00 50.39           N  
ATOM   8331  CA  PRO C 223      36.117 109.129  63.054  1.00 50.32           C  
ATOM   8332  C   PRO C 223      34.631 109.108  62.768  1.00 50.88           C  
ATOM   8333  O   PRO C 223      34.062 110.132  62.388  1.00 51.53           O  
ATOM   8334  CB  PRO C 223      36.913 109.130  61.759  1.00 49.72           C  
ATOM   8335  CG  PRO C 223      36.935 107.679  61.420  1.00 48.73           C  
ATOM   8336  CD  PRO C 223      37.149 106.973  62.770  1.00 49.61           C  
ATOM   8337  N   TYR C 224      34.004 107.950  62.935  1.00 50.86           N  
ATOM   8338  CA  TYR C 224      32.583 107.809  62.652  1.00 50.88           C  
ATOM   8339  C   TYR C 224      31.687 108.916  63.179  1.00 51.35           C  
ATOM   8340  O   TYR C 224      31.076 109.656  62.392  1.00 49.61           O  
ATOM   8341  CB  TYR C 224      32.113 106.451  63.140  1.00 51.57           C  
ATOM   8342  CG  TYR C 224      32.769 105.359  62.334  1.00 53.26           C  
ATOM   8343  CD1 TYR C 224      33.443 104.300  62.956  1.00 52.94           C  
ATOM   8344  CD2 TYR C 224      32.779 105.421  60.938  1.00 51.51           C  
ATOM   8345  CE1 TYR C 224      34.112 103.338  62.198  1.00 52.39           C  
ATOM   8346  CE2 TYR C 224      33.447 104.466  60.180  1.00 51.70           C  
ATOM   8347  CZ  TYR C 224      34.109 103.433  60.809  1.00 51.68           C  
ATOM   8348  OH  TYR C 224      34.758 102.496  60.041  1.00 53.93           O  
ATOM   8349  N   TYR C 225      31.620 109.050  64.499  1.00 50.96           N  
ATOM   8350  CA  TYR C 225      30.783 110.085  65.079  1.00 51.74           C  
ATOM   8351  C   TYR C 225      31.390 111.481  65.183  1.00 52.84           C  
ATOM   8352  O   TYR C 225      30.663 112.483  65.232  1.00 54.41           O  
ATOM   8353  CB  TYR C 225      30.254 109.599  66.415  1.00 49.99           C  
ATOM   8354  CG  TYR C 225      29.354 108.446  66.170  1.00 49.04           C  
ATOM   8355  CD1 TYR C 225      29.721 107.160  66.539  1.00 50.32           C  
ATOM   8356  CD2 TYR C 225      28.170 108.624  65.455  1.00 47.90           C  
ATOM   8357  CE1 TYR C 225      28.919 106.066  66.192  1.00 52.10           C  
ATOM   8358  CE2 TYR C 225      27.370 107.554  65.101  1.00 47.25           C  
ATOM   8359  CZ  TYR C 225      27.739 106.280  65.468  1.00 49.61           C  
ATOM   8360  OH  TYR C 225      26.926 105.226  65.130  1.00 48.95           O  
ATOM   8361  N   SER C 226      32.710 111.578  65.211  1.00 52.25           N  
ATOM   8362  CA  SER C 226      33.278 112.899  65.258  1.00 51.51           C  
ATOM   8363  C   SER C 226      32.834 113.570  63.949  1.00 51.42           C  
ATOM   8364  O   SER C 226      32.397 114.720  63.943  1.00 50.87           O  
ATOM   8365  CB  SER C 226      34.801 112.821  65.379  1.00 52.09           C  
ATOM   8366  OG  SER C 226      35.360 111.958  64.417  1.00 53.99           O  
ATOM   8367  N   PHE C 227      32.899 112.837  62.843  1.00 51.92           N  
ATOM   8368  CA  PHE C 227      32.485 113.398  61.561  1.00 53.06           C  
ATOM   8369  C   PHE C 227      30.987 113.594  61.462  1.00 53.19           C  
ATOM   8370  O   PHE C 227      30.523 114.636  60.999  1.00 53.00           O  
ATOM   8371  CB  PHE C 227      32.941 112.513  60.418  1.00 54.51           C  
ATOM   8372  CG  PHE C 227      34.379 112.675  60.083  1.00 59.02           C  
ATOM   8373  CD1 PHE C 227      34.766 113.339  58.924  1.00 60.27           C  
ATOM   8374  CD2 PHE C 227      35.364 112.193  60.941  1.00 61.01           C  
ATOM   8375  CE1 PHE C 227      36.124 113.526  58.620  1.00 60.74           C  
ATOM   8376  CE2 PHE C 227      36.720 112.373  60.646  1.00 62.43           C  
ATOM   8377  CZ  PHE C 227      37.101 113.045  59.477  1.00 60.68           C  
ATOM   8378  N   LYS C 228      30.225 112.596  61.895  1.00 53.53           N  
ATOM   8379  CA  LYS C 228      28.771 112.695  61.834  1.00 54.29           C  
ATOM   8380  C   LYS C 228      28.263 113.906  62.616  1.00 55.00           C  
ATOM   8381  O   LYS C 228      27.370 114.610  62.157  1.00 55.76           O  
ATOM   8382  CB  LYS C 228      28.117 111.426  62.372  1.00 54.13           C  
ATOM   8383  CG  LYS C 228      26.651 111.288  62.005  1.00 55.16           C  
ATOM   8384  CD  LYS C 228      26.019 110.167  62.819  1.00 60.32           C  
ATOM   8385  CE  LYS C 228      24.531 109.972  62.550  1.00 61.21           C  
ATOM   8386  NZ  LYS C 228      24.275 109.258  61.263  1.00 63.80           N  
ATOM   8387  N   ASP C 229      28.833 114.162  63.788  1.00 54.91           N  
ATOM   8388  CA  ASP C 229      28.414 115.312  64.579  1.00 56.31           C  
ATOM   8389  C   ASP C 229      28.796 116.663  63.953  1.00 56.65           C  
ATOM   8390  O   ASP C 229      28.007 117.611  63.980  1.00 56.54           O  
ATOM   8391  CB  ASP C 229      28.997 115.219  65.981  1.00 57.81           C  
ATOM   8392  CG  ASP C 229      28.419 114.072  66.757  1.00 61.17           C  
ATOM   8393  OD1 ASP C 229      28.734 113.936  67.970  1.00 62.14           O  
ATOM   8394  OD2 ASP C 229      27.643 113.303  66.135  1.00 61.92           O  
ATOM   8395  N   ILE C 230      30.002 116.755  63.396  1.00 55.78           N  
ATOM   8396  CA  ILE C 230      30.446 117.997  62.778  1.00 53.43           C  
ATOM   8397  C   ILE C 230      29.540 118.322  61.624  1.00 51.60           C  
ATOM   8398  O   ILE C 230      29.247 119.485  61.365  1.00 50.51           O  
ATOM   8399  CB  ILE C 230      31.889 117.883  62.284  1.00 54.49           C  
ATOM   8400  CG1 ILE C 230      32.824 118.131  63.458  1.00 53.48           C  
ATOM   8401  CG2 ILE C 230      32.151 118.867  61.144  1.00 53.30           C  
ATOM   8402  CD1 ILE C 230      34.248 117.915  63.117  1.00 59.84           C  
ATOM   8403  N   LEU C 231      29.108 117.283  60.926  1.00 50.71           N  
ATOM   8404  CA  LEU C 231      28.199 117.464  59.808  1.00 51.69           C  
ATOM   8405  C   LEU C 231      26.857 117.954  60.371  1.00 51.53           C  
ATOM   8406  O   LEU C 231      26.209 118.846  59.811  1.00 49.83           O  
ATOM   8407  CB  LEU C 231      27.992 116.140  59.074  1.00 50.98           C  
ATOM   8408  CG  LEU C 231      26.961 116.280  57.949  1.00 51.64           C  
ATOM   8409  CD1 LEU C 231      27.478 117.253  56.927  1.00 50.52           C  
ATOM   8410  CD2 LEU C 231      26.690 114.950  57.303  1.00 51.91           C  
ATOM   8411  N   GLY C 232      26.457 117.349  61.485  1.00 51.14           N  
ATOM   8412  CA  GLY C 232      25.221 117.721  62.133  1.00 51.99           C  
ATOM   8413  C   GLY C 232      25.290 119.164  62.573  1.00 53.98           C  
ATOM   8414  O   GLY C 232      24.308 119.891  62.468  1.00 55.41           O  
ATOM   8415  N   LEU C 233      26.451 119.584  63.071  1.00 55.70           N  
ATOM   8416  CA  LEU C 233      26.654 120.959  63.518  1.00 55.62           C  
ATOM   8417  C   LEU C 233      26.443 121.928  62.364  1.00 56.13           C  
ATOM   8418  O   LEU C 233      25.688 122.877  62.497  1.00 57.85           O  
ATOM   8419  CB  LEU C 233      28.066 121.142  64.072  1.00 56.41           C  
ATOM   8420  CG  LEU C 233      28.468 122.542  64.546  1.00 56.33           C  
ATOM   8421  CD1 LEU C 233      27.710 122.858  65.804  1.00 55.84           C  
ATOM   8422  CD2 LEU C 233      29.968 122.616  64.816  1.00 54.18           C  
ATOM   8423  N   THR C 234      27.099 121.702  61.230  1.00 56.80           N  
ATOM   8424  CA  THR C 234      26.928 122.604  60.076  1.00 58.05           C  
ATOM   8425  C   THR C 234      25.506 122.596  59.523  1.00 56.68           C  
ATOM   8426  O   THR C 234      25.014 123.614  59.039  1.00 56.19           O  
ATOM   8427  CB  THR C 234      27.861 122.254  58.895  1.00 58.20           C  
ATOM   8428  OG1 THR C 234      27.437 121.019  58.309  1.00 62.16           O  
ATOM   8429  CG2 THR C 234      29.296 122.145  59.363  1.00 57.68           C  
ATOM   8430  N   LEU C 235      24.855 121.443  59.572  1.00 55.67           N  
ATOM   8431  CA  LEU C 235      23.505 121.372  59.084  1.00 56.25           C  
ATOM   8432  C   LEU C 235      22.540 122.196  59.936  1.00 58.20           C  
ATOM   8433  O   LEU C 235      21.624 122.815  59.405  1.00 59.27           O  
ATOM   8434  CB  LEU C 235      23.058 119.926  58.999  1.00 54.61           C  
ATOM   8435  CG  LEU C 235      23.713 119.223  57.813  1.00 54.62           C  
ATOM   8436  CD1 LEU C 235      23.221 117.791  57.733  1.00 54.06           C  
ATOM   8437  CD2 LEU C 235      23.380 119.964  56.529  1.00 51.92           C  
ATOM   8438  N   MET C 236      22.727 122.230  61.247  1.00 59.87           N  
ATOM   8439  CA  MET C 236      21.828 123.040  62.059  1.00 63.18           C  
ATOM   8440  C   MET C 236      22.256 124.495  62.026  1.00 64.45           C  
ATOM   8441  O   MET C 236      21.433 125.406  61.957  1.00 65.83           O  
ATOM   8442  CB  MET C 236      21.795 122.543  63.494  1.00 65.23           C  
ATOM   8443  CG  MET C 236      21.002 121.235  63.651  1.00 71.07           C  
ATOM   8444  SD  MET C 236      19.258 121.330  63.112  1.00 74.15           S  
ATOM   8445  CE  MET C 236      18.523 122.345  64.422  1.00 68.04           C  
ATOM   8446  N   LEU C 237      23.560 124.706  62.049  1.00 64.65           N  
ATOM   8447  CA  LEU C 237      24.124 126.039  62.023  1.00 63.59           C  
ATOM   8448  C   LEU C 237      23.590 126.891  60.870  1.00 62.62           C  
ATOM   8449  O   LEU C 237      23.443 128.102  61.010  1.00 62.31           O  
ATOM   8450  CB  LEU C 237      25.641 125.927  61.924  1.00 65.08           C  
ATOM   8451  CG  LEU C 237      26.482 126.979  62.633  1.00 65.72           C  
ATOM   8452  CD1 LEU C 237      26.065 127.080  64.101  1.00 65.91           C  
ATOM   8453  CD2 LEU C 237      27.945 126.589  62.502  1.00 65.06           C  
ATOM   8454  N   THR C 238      23.295 126.275  59.732  1.00 61.93           N  
ATOM   8455  CA  THR C 238      22.794 127.052  58.600  1.00 63.26           C  
ATOM   8456  C   THR C 238      21.458 127.779  58.866  1.00 63.86           C  
ATOM   8457  O   THR C 238      21.365 128.992  58.674  1.00 65.74           O  
ATOM   8458  CB  THR C 238      22.660 126.195  57.328  1.00 63.53           C  
ATOM   8459  OG1 THR C 238      23.935 125.625  56.981  1.00 61.44           O  
ATOM   8460  CG2 THR C 238      22.175 127.065  56.182  1.00 63.75           C  
ATOM   8461  N   PRO C 239      20.405 127.057  59.283  1.00 62.61           N  
ATOM   8462  CA  PRO C 239      19.139 127.749  59.550  1.00 61.42           C  
ATOM   8463  C   PRO C 239      19.335 128.817  60.626  1.00 61.63           C  
ATOM   8464  O   PRO C 239      18.790 129.912  60.538  1.00 61.47           O  
ATOM   8465  CB  PRO C 239      18.239 126.629  60.016  1.00 60.62           C  
ATOM   8466  CG  PRO C 239      18.711 125.504  59.179  1.00 61.99           C  
ATOM   8467  CD  PRO C 239      20.205 125.602  59.279  1.00 61.43           C  
ATOM   8468  N   PHE C 240      20.120 128.484  61.644  1.00 62.26           N  
ATOM   8469  CA  PHE C 240      20.429 129.407  62.742  1.00 63.33           C  
ATOM   8470  C   PHE C 240      20.896 130.748  62.188  1.00 62.48           C  
ATOM   8471  O   PHE C 240      20.209 131.758  62.324  1.00 63.38           O  
ATOM   8472  CB  PHE C 240      21.546 128.804  63.616  1.00 66.49           C  
ATOM   8473  CG  PHE C 240      22.006 129.681  64.775  1.00 67.54           C  
ATOM   8474  CD1 PHE C 240      23.326 129.606  65.229  1.00 67.90           C  
ATOM   8475  CD2 PHE C 240      21.136 130.533  65.434  1.00 69.40           C  
ATOM   8476  CE1 PHE C 240      23.771 130.362  66.314  1.00 66.62           C  
ATOM   8477  CE2 PHE C 240      21.581 131.295  66.529  1.00 70.22           C  
ATOM   8478  CZ  PHE C 240      22.902 131.204  66.960  1.00 67.87           C  
ATOM   8479  N   LEU C 241      22.067 130.741  61.558  1.00 60.05           N  
ATOM   8480  CA  LEU C 241      22.647 131.947  61.001  1.00 58.44           C  
ATOM   8481  C   LEU C 241      21.753 132.658  60.013  1.00 58.51           C  
ATOM   8482  O   LEU C 241      21.744 133.891  59.969  1.00 57.72           O  
ATOM   8483  CB  LEU C 241      23.966 131.622  60.327  1.00 57.62           C  
ATOM   8484  CG  LEU C 241      24.988 131.026  61.276  1.00 55.05           C  
ATOM   8485  CD1 LEU C 241      26.348 131.042  60.615  1.00 55.61           C  
ATOM   8486  CD2 LEU C 241      25.012 131.833  62.549  1.00 52.86           C  
ATOM   8487  N   THR C 242      21.023 131.879  59.212  1.00 58.61           N  
ATOM   8488  CA  THR C 242      20.092 132.420  58.216  1.00 58.86           C  
ATOM   8489  C   THR C 242      19.022 133.236  58.908  1.00 59.83           C  
ATOM   8490  O   THR C 242      18.623 134.292  58.434  1.00 59.36           O  
ATOM   8491  CB  THR C 242      19.404 131.317  57.441  1.00 58.35           C  
ATOM   8492  OG1 THR C 242      20.336 130.729  56.529  1.00 61.50           O  
ATOM   8493  CG2 THR C 242      18.235 131.858  56.683  1.00 56.77           C  
ATOM   8494  N   LEU C 243      18.564 132.729  60.042  1.00 61.57           N  
ATOM   8495  CA  LEU C 243      17.568 133.413  60.840  1.00 62.83           C  
ATOM   8496  C   LEU C 243      18.185 134.640  61.525  1.00 62.81           C  
ATOM   8497  O   LEU C 243      17.700 135.753  61.385  1.00 63.84           O  
ATOM   8498  CB  LEU C 243      17.025 132.465  61.900  1.00 64.57           C  
ATOM   8499  CG  LEU C 243      16.008 133.137  62.814  1.00 66.84           C  
ATOM   8500  CD1 LEU C 243      14.790 133.476  61.960  1.00 66.78           C  
ATOM   8501  CD2 LEU C 243      15.647 132.239  64.004  1.00 66.09           C  
ATOM   8502  N   ALA C 244      19.265 134.432  62.263  1.00 63.21           N  
ATOM   8503  CA  ALA C 244      19.926 135.522  62.978  1.00 63.77           C  
ATOM   8504  C   ALA C 244      20.556 136.580  62.078  1.00 63.49           C  
ATOM   8505  O   ALA C 244      21.001 137.626  62.557  1.00 64.58           O  
ATOM   8506  CB  ALA C 244      20.997 134.955  63.927  1.00 64.50           C  
ATOM   8507  N   LEU C 245      20.626 136.316  60.784  1.00 61.52           N  
ATOM   8508  CA  LEU C 245      21.219 137.299  59.908  1.00 60.30           C  
ATOM   8509  C   LEU C 245      20.214 137.909  58.958  1.00 61.46           C  
ATOM   8510  O   LEU C 245      20.343 139.070  58.581  1.00 61.62           O  
ATOM   8511  CB  LEU C 245      22.366 136.694  59.111  1.00 59.07           C  
ATOM   8512  CG  LEU C 245      23.696 136.577  59.836  1.00 58.57           C  
ATOM   8513  CD1 LEU C 245      24.779 136.423  58.798  1.00 59.08           C  
ATOM   8514  CD2 LEU C 245      23.968 137.816  60.666  1.00 57.36           C  
ATOM   8515  N   PHE C 246      19.205 137.143  58.562  1.00 61.56           N  
ATOM   8516  CA  PHE C 246      18.236 137.693  57.641  1.00 61.16           C  
ATOM   8517  C   PHE C 246      16.955 138.160  58.291  1.00 63.13           C  
ATOM   8518  O   PHE C 246      16.397 139.162  57.872  1.00 66.35           O  
ATOM   8519  CB  PHE C 246      17.958 136.702  56.525  1.00 58.47           C  
ATOM   8520  CG  PHE C 246      19.098 136.565  55.555  1.00 57.03           C  
ATOM   8521  CD1 PHE C 246      19.720 135.338  55.348  1.00 54.46           C  
ATOM   8522  CD2 PHE C 246      19.539 137.664  54.828  1.00 55.90           C  
ATOM   8523  CE1 PHE C 246      20.759 135.210  54.433  1.00 53.79           C  
ATOM   8524  CE2 PHE C 246      20.584 137.538  53.907  1.00 55.30           C  
ATOM   8525  CZ  PHE C 246      21.191 136.308  53.711  1.00 52.68           C  
ATOM   8526  N   SER C 247      16.497 137.469  59.324  1.00 63.61           N  
ATOM   8527  CA  SER C 247      15.270 137.862  60.009  1.00 64.61           C  
ATOM   8528  C   SER C 247      15.553 137.852  61.509  1.00 64.95           C  
ATOM   8529  O   SER C 247      14.978 137.073  62.267  1.00 66.70           O  
ATOM   8530  CB  SER C 247      14.160 136.876  59.668  1.00 64.63           C  
ATOM   8531  OG  SER C 247      12.963 137.256  60.315  1.00 68.72           O  
ATOM   8532  N   PRO C 248      16.436 138.743  61.954  1.00 64.23           N  
ATOM   8533  CA  PRO C 248      16.906 138.942  63.330  1.00 64.21           C  
ATOM   8534  C   PRO C 248      15.872 139.003  64.443  1.00 64.92           C  
ATOM   8535  O   PRO C 248      16.138 138.560  65.569  1.00 64.45           O  
ATOM   8536  CB  PRO C 248      17.691 140.247  63.254  1.00 63.63           C  
ATOM   8537  CG  PRO C 248      18.063 140.359  61.813  1.00 66.04           C  
ATOM   8538  CD  PRO C 248      16.847 139.862  61.098  1.00 64.72           C  
ATOM   8539  N   ASN C 249      14.698 139.553  64.147  1.00 65.79           N  
ATOM   8540  CA  ASN C 249      13.693 139.701  65.189  1.00 64.91           C  
ATOM   8541  C   ASN C 249      12.460 138.871  64.985  1.00 63.75           C  
ATOM   8542  O   ASN C 249      11.472 139.077  65.677  1.00 66.01           O  
ATOM   8543  CB  ASN C 249      13.288 141.165  65.308  1.00 66.13           C  
ATOM   8544  CG  ASN C 249      14.490 142.095  65.458  1.00 68.67           C  
ATOM   8545  OD1 ASN C 249      15.257 142.004  66.433  1.00 67.08           O  
ATOM   8546  ND2 ASN C 249      14.662 143.002  64.483  1.00 69.35           N  
ATOM   8547  N   LEU C 250      12.505 137.933  64.050  1.00 60.62           N  
ATOM   8548  CA  LEU C 250      11.345 137.098  63.786  1.00 58.44           C  
ATOM   8549  C   LEU C 250      10.691 136.567  65.059  1.00 57.80           C  
ATOM   8550  O   LEU C 250       9.524 136.820  65.336  1.00 57.73           O  
ATOM   8551  CB  LEU C 250      11.735 135.917  62.913  1.00 57.60           C  
ATOM   8552  CG  LEU C 250      10.593 135.211  62.193  1.00 56.18           C  
ATOM   8553  CD1 LEU C 250      10.191 136.023  60.971  1.00 54.74           C  
ATOM   8554  CD2 LEU C 250      11.035 133.840  61.764  1.00 55.85           C  
ATOM   8555  N   LEU C 251      11.464 135.842  65.845  1.00 58.05           N  
ATOM   8556  CA  LEU C 251      10.954 135.233  67.060  1.00 58.13           C  
ATOM   8557  C   LEU C 251      10.771 136.134  68.273  1.00 57.67           C  
ATOM   8558  O   LEU C 251      10.314 135.665  69.317  1.00 59.19           O  
ATOM   8559  CB  LEU C 251      11.868 134.079  67.452  1.00 59.46           C  
ATOM   8560  CG  LEU C 251      12.034 132.997  66.384  1.00 61.80           C  
ATOM   8561  CD1 LEU C 251      13.218 132.074  66.737  1.00 61.97           C  
ATOM   8562  CD2 LEU C 251      10.725 132.224  66.263  1.00 60.34           C  
ATOM   8563  N   GLY C 252      11.102 137.413  68.159  1.00 56.19           N  
ATOM   8564  CA  GLY C 252      10.991 138.267  69.328  1.00 56.01           C  
ATOM   8565  C   GLY C 252       9.921 139.328  69.382  1.00 55.99           C  
ATOM   8566  O   GLY C 252       9.548 139.921  68.364  1.00 57.62           O  
ATOM   8567  N   ASP C 253       9.454 139.591  70.598  1.00 55.75           N  
ATOM   8568  CA  ASP C 253       8.409 140.584  70.826  1.00 55.82           C  
ATOM   8569  C   ASP C 253       8.900 142.006  70.599  1.00 54.93           C  
ATOM   8570  O   ASP C 253       9.957 142.403  71.103  1.00 55.99           O  
ATOM   8571  CB  ASP C 253       7.874 140.477  72.252  1.00 58.47           C  
ATOM   8572  CG  ASP C 253       6.469 141.034  72.386  1.00 61.79           C  
ATOM   8573  OD1 ASP C 253       6.217 142.145  71.863  1.00 63.63           O  
ATOM   8574  OD2 ASP C 253       5.616 140.362  73.018  1.00 64.20           O  
ATOM   8575  N   PRO C 254       8.143 142.797  69.823  1.00 53.06           N  
ATOM   8576  CA  PRO C 254       8.531 144.182  69.553  1.00 51.41           C  
ATOM   8577  C   PRO C 254       8.392 145.034  70.797  1.00 50.32           C  
ATOM   8578  O   PRO C 254       9.040 146.062  70.940  1.00 52.03           O  
ATOM   8579  CB  PRO C 254       7.572 144.594  68.450  1.00 50.34           C  
ATOM   8580  CG  PRO C 254       6.399 143.732  68.686  1.00 50.26           C  
ATOM   8581  CD  PRO C 254       7.001 142.412  68.984  1.00 51.03           C  
ATOM   8582  N   GLU C 255       7.543 144.578  71.703  1.00 49.45           N  
ATOM   8583  CA  GLU C 255       7.289 145.270  72.951  1.00 48.21           C  
ATOM   8584  C   GLU C 255       8.595 145.417  73.736  1.00 46.22           C  
ATOM   8585  O   GLU C 255       8.716 146.260  74.629  1.00 45.43           O  
ATOM   8586  CB  GLU C 255       6.252 144.475  73.758  1.00 49.67           C  
ATOM   8587  CG  GLU C 255       5.569 145.255  74.880  1.00 56.36           C  
ATOM   8588  CD  GLU C 255       4.492 146.224  74.386  1.00 59.72           C  
ATOM   8589  OE1 GLU C 255       3.402 145.740  73.994  1.00 61.57           O  
ATOM   8590  OE2 GLU C 255       4.733 147.464  74.390  1.00 62.61           O  
ATOM   8591  N   ASN C 256       9.592 144.617  73.385  1.00 45.55           N  
ATOM   8592  CA  ASN C 256      10.845 144.692  74.106  1.00 45.44           C  
ATOM   8593  C   ASN C 256      11.827 145.701  73.561  1.00 46.20           C  
ATOM   8594  O   ASN C 256      13.010 145.674  73.907  1.00 46.32           O  
ATOM   8595  CB  ASN C 256      11.490 143.329  74.200  1.00 45.99           C  
ATOM   8596  CG  ASN C 256      11.856 142.975  75.625  1.00 48.83           C  
ATOM   8597  OD1 ASN C 256      11.276 143.513  76.580  1.00 48.84           O  
ATOM   8598  ND2 ASN C 256      12.811 142.054  75.785  1.00 51.12           N  
ATOM   8599  N   PHE C 257      11.321 146.592  72.710  1.00 46.01           N  
ATOM   8600  CA  PHE C 257      12.103 147.680  72.145  1.00 45.21           C  
ATOM   8601  C   PHE C 257      11.615 148.966  72.778  1.00 46.20           C  
ATOM   8602  O   PHE C 257      11.817 150.062  72.255  1.00 45.73           O  
ATOM   8603  CB  PHE C 257      11.901 147.766  70.662  1.00 45.02           C  
ATOM   8604  CG  PHE C 257      12.797 146.876  69.900  1.00 46.85           C  
ATOM   8605  CD1 PHE C 257      12.517 145.535  69.777  1.00 46.59           C  
ATOM   8606  CD2 PHE C 257      13.933 147.387  69.281  1.00 48.17           C  
ATOM   8607  CE1 PHE C 257      13.351 144.718  69.046  1.00 47.46           C  
ATOM   8608  CE2 PHE C 257      14.772 146.571  68.546  1.00 46.94           C  
ATOM   8609  CZ  PHE C 257      14.482 145.240  68.429  1.00 45.92           C  
ATOM   8610  N   THR C 258      10.949 148.800  73.913  1.00 47.13           N  
ATOM   8611  CA  THR C 258      10.402 149.901  74.665  1.00 47.84           C  
ATOM   8612  C   THR C 258      10.873 149.730  76.081  1.00 49.33           C  
ATOM   8613  O   THR C 258      10.640 148.689  76.687  1.00 52.50           O  
ATOM   8614  CB  THR C 258       8.895 149.843  74.670  1.00 46.40           C  
ATOM   8615  OG1 THR C 258       8.410 150.019  73.340  1.00 51.41           O  
ATOM   8616  CG2 THR C 258       8.347 150.927  75.525  1.00 47.21           C  
ATOM   8617  N   PRO C 259      11.555 150.737  76.632  1.00 48.77           N  
ATOM   8618  CA  PRO C 259      12.032 150.622  78.009  1.00 49.60           C  
ATOM   8619  C   PRO C 259      10.906 150.304  79.005  1.00 51.29           C  
ATOM   8620  O   PRO C 259       9.817 150.884  78.963  1.00 50.99           O  
ATOM   8621  CB  PRO C 259      12.676 151.976  78.249  1.00 49.58           C  
ATOM   8622  CG  PRO C 259      13.222 152.314  76.903  1.00 48.29           C  
ATOM   8623  CD  PRO C 259      12.091 151.943  75.987  1.00 48.29           C  
ATOM   8624  N   ALA C 260      11.184 149.365  79.901  1.00 53.72           N  
ATOM   8625  CA  ALA C 260      10.213 148.947  80.897  1.00 53.99           C  
ATOM   8626  C   ALA C 260       9.530 150.149  81.529  1.00 54.00           C  
ATOM   8627  O   ALA C 260      10.148 151.177  81.757  1.00 53.50           O  
ATOM   8628  CB  ALA C 260      10.902 148.099  81.972  1.00 51.72           C  
ATOM   8629  N   ASN C 261       8.238 150.003  81.785  1.00 55.27           N  
ATOM   8630  CA  ASN C 261       7.433 151.037  82.410  1.00 55.06           C  
ATOM   8631  C   ASN C 261       6.412 150.344  83.307  1.00 53.74           C  
ATOM   8632  O   ASN C 261       5.459 149.730  82.826  1.00 51.99           O  
ATOM   8633  CB  ASN C 261       6.714 151.860  81.350  1.00 57.52           C  
ATOM   8634  CG  ASN C 261       5.736 152.831  81.956  1.00 59.51           C  
ATOM   8635  OD1 ASN C 261       5.575 152.887  83.185  1.00 58.68           O  
ATOM   8636  ND2 ASN C 261       5.075 153.607  81.107  1.00 58.83           N  
ATOM   8637  N   PRO C 262       6.609 150.437  84.624  1.00 52.78           N  
ATOM   8638  CA  PRO C 262       5.760 149.843  85.655  1.00 54.09           C  
ATOM   8639  C   PRO C 262       4.329 150.341  85.617  1.00 56.22           C  
ATOM   8640  O   PRO C 262       3.448 149.720  86.200  1.00 57.59           O  
ATOM   8641  CB  PRO C 262       6.443 150.264  86.953  1.00 52.79           C  
ATOM   8642  CG  PRO C 262       7.830 150.461  86.562  1.00 52.45           C  
ATOM   8643  CD  PRO C 262       7.712 151.171  85.247  1.00 52.20           C  
ATOM   8644  N   LEU C 263       4.103 151.467  84.941  1.00 57.52           N  
ATOM   8645  CA  LEU C 263       2.778 152.080  84.869  1.00 57.00           C  
ATOM   8646  C   LEU C 263       2.105 151.899  83.535  1.00 56.47           C  
ATOM   8647  O   LEU C 263       1.346 152.754  83.108  1.00 57.01           O  
ATOM   8648  CB  LEU C 263       2.879 153.578  85.149  1.00 58.83           C  
ATOM   8649  CG  LEU C 263       3.588 153.972  86.442  1.00 59.67           C  
ATOM   8650  CD1 LEU C 263       3.782 155.477  86.512  1.00 59.55           C  
ATOM   8651  CD2 LEU C 263       2.767 153.469  87.607  1.00 61.88           C  
ATOM   8652  N   VAL C 264       2.393 150.801  82.864  1.00 55.96           N  
ATOM   8653  CA  VAL C 264       1.772 150.535  81.581  1.00 55.73           C  
ATOM   8654  C   VAL C 264       1.861 149.058  81.292  1.00 56.19           C  
ATOM   8655  O   VAL C 264       2.922 148.539  80.942  1.00 57.63           O  
ATOM   8656  CB  VAL C 264       2.460 151.286  80.453  1.00 54.49           C  
ATOM   8657  CG1 VAL C 264       1.930 150.813  79.126  1.00 55.34           C  
ATOM   8658  CG2 VAL C 264       2.207 152.744  80.591  1.00 55.22           C  
ATOM   8659  N   THR C 265       0.746 148.371  81.447  1.00 55.78           N  
ATOM   8660  CA  THR C 265       0.755 146.960  81.182  1.00 56.52           C  
ATOM   8661  C   THR C 265       0.579 146.669  79.696  1.00 57.43           C  
ATOM   8662  O   THR C 265      -0.310 147.221  79.029  1.00 57.52           O  
ATOM   8663  CB  THR C 265      -0.328 146.285  81.951  1.00 55.97           C  
ATOM   8664  OG1 THR C 265      -0.216 146.675  83.324  1.00 57.28           O  
ATOM   8665  CG2 THR C 265      -0.195 144.780  81.822  1.00 56.96           C  
ATOM   8666  N   PRO C 266       1.467 145.834  79.136  1.00 57.63           N  
ATOM   8667  CA  PRO C 266       1.287 145.552  77.717  1.00 58.09           C  
ATOM   8668  C   PRO C 266      -0.032 144.807  77.528  1.00 59.91           C  
ATOM   8669  O   PRO C 266      -0.513 144.122  78.436  1.00 59.91           O  
ATOM   8670  CB  PRO C 266       2.512 144.713  77.392  1.00 57.38           C  
ATOM   8671  CG  PRO C 266       3.561 145.341  78.283  1.00 56.08           C  
ATOM   8672  CD  PRO C 266       2.813 145.434  79.585  1.00 55.57           C  
ATOM   8673  N   PRO C 267      -0.643 144.939  76.347  1.00 61.90           N  
ATOM   8674  CA  PRO C 267      -1.915 144.275  76.050  1.00 63.27           C  
ATOM   8675  C   PRO C 267      -1.802 142.751  76.103  1.00 65.19           C  
ATOM   8676  O   PRO C 267      -2.627 142.069  76.714  1.00 65.82           O  
ATOM   8677  CB  PRO C 267      -2.240 144.768  74.644  1.00 62.86           C  
ATOM   8678  CG  PRO C 267      -1.500 146.067  74.538  1.00 62.39           C  
ATOM   8679  CD  PRO C 267      -0.191 145.731  75.192  1.00 63.57           C  
ATOM   8680  N   HIS C 268      -0.770 142.216  75.458  1.00 67.11           N  
ATOM   8681  CA  HIS C 268      -0.579 140.776  75.442  1.00 67.45           C  
ATOM   8682  C   HIS C 268       0.763 140.382  76.000  1.00 65.32           C  
ATOM   8683  O   HIS C 268       1.787 140.512  75.313  1.00 67.05           O  
ATOM   8684  CB  HIS C 268      -0.735 140.257  74.020  1.00 71.03           C  
ATOM   8685  CG  HIS C 268      -2.017 140.687  73.381  1.00 76.60           C  
ATOM   8686  ND1 HIS C 268      -2.071 141.320  72.153  1.00 77.30           N  
ATOM   8687  CD2 HIS C 268      -3.294 140.623  73.829  1.00 78.20           C  
ATOM   8688  CE1 HIS C 268      -3.324 141.629  71.875  1.00 77.12           C  
ATOM   8689  NE2 HIS C 268      -4.086 141.217  72.876  1.00 79.38           N  
ATOM   8690  N   ILE C 269       0.734 139.920  77.255  1.00 61.01           N  
ATOM   8691  CA  ILE C 269       1.914 139.457  77.980  1.00 57.31           C  
ATOM   8692  C   ILE C 269       2.134 137.963  77.713  1.00 56.23           C  
ATOM   8693  O   ILE C 269       1.656 137.110  78.459  1.00 57.19           O  
ATOM   8694  CB  ILE C 269       1.754 139.698  79.502  1.00 54.71           C  
ATOM   8695  CG1 ILE C 269       1.898 141.181  79.793  1.00 54.01           C  
ATOM   8696  CG2 ILE C 269       2.799 138.942  80.292  1.00 54.32           C  
ATOM   8697  CD1 ILE C 269       2.011 141.505  81.262  1.00 53.59           C  
ATOM   8698  N   LYS C 270       2.844 137.651  76.637  1.00 53.28           N  
ATOM   8699  CA  LYS C 270       3.107 136.269  76.303  1.00 53.26           C  
ATOM   8700  C   LYS C 270       4.618 136.036  76.304  1.00 53.36           C  
ATOM   8701  O   LYS C 270       5.393 136.950  76.043  1.00 55.17           O  
ATOM   8702  CB  LYS C 270       2.514 135.942  74.933  1.00 53.79           C  
ATOM   8703  CG  LYS C 270       3.175 136.662  73.780  1.00 53.41           C  
ATOM   8704  CD  LYS C 270       2.553 136.240  72.467  1.00 57.60           C  
ATOM   8705  CE  LYS C 270       3.500 136.448  71.287  1.00 62.78           C  
ATOM   8706  NZ  LYS C 270       4.742 135.594  71.448  1.00 68.28           N  
ATOM   8707  N   PRO C 271       5.055 134.807  76.603  1.00 51.58           N  
ATOM   8708  CA  PRO C 271       6.469 134.443  76.645  1.00 49.97           C  
ATOM   8709  C   PRO C 271       7.093 134.170  75.288  1.00 49.52           C  
ATOM   8710  O   PRO C 271       6.451 134.308  74.243  1.00 50.38           O  
ATOM   8711  CB  PRO C 271       6.458 133.196  77.502  1.00 50.32           C  
ATOM   8712  CG  PRO C 271       5.217 132.544  77.057  1.00 52.08           C  
ATOM   8713  CD  PRO C 271       4.228 133.682  77.060  1.00 51.62           C  
ATOM   8714  N   GLU C 272       8.368 133.798  75.320  1.00 48.45           N  
ATOM   8715  CA  GLU C 272       9.106 133.442  74.118  1.00 47.47           C  
ATOM   8716  C   GLU C 272       8.537 132.091  73.702  1.00 46.68           C  
ATOM   8717  O   GLU C 272       8.072 131.321  74.545  1.00 47.23           O  
ATOM   8718  CB  GLU C 272      10.571 133.304  74.452  1.00 49.10           C  
ATOM   8719  CG  GLU C 272      11.225 134.604  74.759  1.00 53.41           C  
ATOM   8720  CD  GLU C 272      11.264 135.482  73.540  1.00 58.34           C  
ATOM   8721  OE1 GLU C 272      11.905 135.071  72.542  1.00 57.89           O  
ATOM   8722  OE2 GLU C 272      10.642 136.575  73.581  1.00 61.71           O  
ATOM   8723  N   TRP C 273       8.580 131.770  72.421  1.00 44.84           N  
ATOM   8724  CA  TRP C 273       7.982 130.516  72.000  1.00 43.31           C  
ATOM   8725  C   TRP C 273       8.243 129.344  72.929  1.00 44.12           C  
ATOM   8726  O   TRP C 273       7.294 128.683  73.372  1.00 45.14           O  
ATOM   8727  CB  TRP C 273       8.410 130.159  70.583  1.00 41.75           C  
ATOM   8728  CG  TRP C 273       9.835 129.818  70.426  1.00 43.31           C  
ATOM   8729  CD1 TRP C 273      10.862 130.669  70.132  1.00 43.92           C  
ATOM   8730  CD2 TRP C 273      10.401 128.516  70.496  1.00 42.89           C  
ATOM   8731  NE1 TRP C 273      12.035 129.968  70.005  1.00 43.03           N  
ATOM   8732  CE2 TRP C 273      11.776 128.641  70.223  1.00 44.23           C  
ATOM   8733  CE3 TRP C 273       9.876 127.249  70.759  1.00 43.60           C  
ATOM   8734  CZ2 TRP C 273      12.636 127.541  70.204  1.00 46.72           C  
ATOM   8735  CZ3 TRP C 273      10.727 126.152  70.740  1.00 44.87           C  
ATOM   8736  CH2 TRP C 273      12.091 126.303  70.463  1.00 45.33           C  
ATOM   8737  N   TYR C 274       9.516 129.106  73.253  1.00 43.90           N  
ATOM   8738  CA  TYR C 274       9.889 127.981  74.108  1.00 43.35           C  
ATOM   8739  C   TYR C 274       9.265 127.871  75.504  1.00 43.26           C  
ATOM   8740  O   TYR C 274       9.534 126.906  76.220  1.00 44.31           O  
ATOM   8741  CB  TYR C 274      11.411 127.867  74.211  1.00 41.31           C  
ATOM   8742  CG  TYR C 274      12.137 129.123  74.608  1.00 41.35           C  
ATOM   8743  CD1 TYR C 274      12.167 129.565  75.942  1.00 40.67           C  
ATOM   8744  CD2 TYR C 274      12.884 129.830  73.658  1.00 41.72           C  
ATOM   8745  CE1 TYR C 274      12.948 130.687  76.326  1.00 39.86           C  
ATOM   8746  CE2 TYR C 274      13.658 130.942  74.019  1.00 40.72           C  
ATOM   8747  CZ  TYR C 274      13.689 131.363  75.349  1.00 40.41           C  
ATOM   8748  OH  TYR C 274      14.463 132.448  75.667  1.00 38.72           O  
ATOM   8749  N   PHE C 275       8.431 128.829  75.895  1.00 41.51           N  
ATOM   8750  CA  PHE C 275       7.779 128.749  77.193  1.00 40.84           C  
ATOM   8751  C   PHE C 275       6.283 128.747  77.020  1.00 41.74           C  
ATOM   8752  O   PHE C 275       5.544 128.485  77.982  1.00 41.08           O  
ATOM   8753  CB  PHE C 275       8.137 129.932  78.066  1.00 41.10           C  
ATOM   8754  CG  PHE C 275       9.471 129.828  78.706  1.00 42.59           C  
ATOM   8755  CD1 PHE C 275       9.989 130.898  79.419  1.00 43.18           C  
ATOM   8756  CD2 PHE C 275      10.223 128.672  78.596  1.00 44.30           C  
ATOM   8757  CE1 PHE C 275      11.235 130.817  80.011  1.00 43.77           C  
ATOM   8758  CE2 PHE C 275      11.475 128.585  79.187  1.00 44.89           C  
ATOM   8759  CZ  PHE C 275      11.978 129.664  79.894  1.00 44.49           C  
ATOM   8760  N   LEU C 276       5.846 129.061  75.796  1.00 41.69           N  
ATOM   8761  CA  LEU C 276       4.427 129.125  75.464  1.00 40.71           C  
ATOM   8762  C   LEU C 276       3.652 127.956  76.029  1.00 42.27           C  
ATOM   8763  O   LEU C 276       2.808 128.141  76.897  1.00 43.67           O  
ATOM   8764  CB  LEU C 276       4.244 129.205  73.955  1.00 38.06           C  
ATOM   8765  CG  LEU C 276       4.642 130.561  73.345  1.00 34.88           C  
ATOM   8766  CD1 LEU C 276       4.440 130.555  71.851  1.00 29.95           C  
ATOM   8767  CD2 LEU C 276       3.810 131.660  73.967  1.00 33.90           C  
ATOM   8768  N   PHE C 277       3.963 126.750  75.572  1.00 44.11           N  
ATOM   8769  CA  PHE C 277       3.277 125.553  76.060  1.00 45.07           C  
ATOM   8770  C   PHE C 277       3.063 125.549  77.566  1.00 44.73           C  
ATOM   8771  O   PHE C 277       2.000 125.179  78.037  1.00 46.69           O  
ATOM   8772  CB  PHE C 277       4.054 124.294  75.665  1.00 47.83           C  
ATOM   8773  CG  PHE C 277       5.108 123.883  76.661  1.00 52.33           C  
ATOM   8774  CD1 PHE C 277       4.800 123.015  77.699  1.00 53.47           C  
ATOM   8775  CD2 PHE C 277       6.408 124.379  76.575  1.00 54.68           C  
ATOM   8776  CE1 PHE C 277       5.773 122.651  78.639  1.00 54.21           C  
ATOM   8777  CE2 PHE C 277       7.381 124.018  77.512  1.00 53.88           C  
ATOM   8778  CZ  PHE C 277       7.060 123.154  78.541  1.00 53.86           C  
ATOM   8779  N   ALA C 278       4.065 125.953  78.333  1.00 44.24           N  
ATOM   8780  CA  ALA C 278       3.919 125.944  79.786  1.00 45.24           C  
ATOM   8781  C   ALA C 278       2.992 127.055  80.260  1.00 44.66           C  
ATOM   8782  O   ALA C 278       2.257 126.913  81.243  1.00 43.89           O  
ATOM   8783  CB  ALA C 278       5.290 126.091  80.453  1.00 45.41           C  
ATOM   8784  N   TYR C 279       3.052 128.176  79.563  1.00 43.23           N  
ATOM   8785  CA  TYR C 279       2.230 129.299  79.922  1.00 43.50           C  
ATOM   8786  C   TYR C 279       0.781 128.908  79.676  1.00 45.07           C  
ATOM   8787  O   TYR C 279      -0.130 129.360  80.372  1.00 45.96           O  
ATOM   8788  CB  TYR C 279       2.610 130.497  79.071  1.00 42.65           C  
ATOM   8789  CG  TYR C 279       1.996 131.790  79.541  1.00 43.05           C  
ATOM   8790  CD1 TYR C 279       2.051 132.170  80.884  1.00 42.48           C  
ATOM   8791  CD2 TYR C 279       1.401 132.659  78.635  1.00 43.09           C  
ATOM   8792  CE1 TYR C 279       1.534 133.382  81.297  1.00 42.63           C  
ATOM   8793  CE2 TYR C 279       0.886 133.865  79.031  1.00 42.34           C  
ATOM   8794  CZ  TYR C 279       0.955 134.223  80.354  1.00 44.01           C  
ATOM   8795  OH  TYR C 279       0.453 135.452  80.705  1.00 49.90           O  
ATOM   8796  N   ALA C 280       0.574 128.050  78.682  1.00 44.68           N  
ATOM   8797  CA  ALA C 280      -0.758 127.591  78.346  1.00 43.83           C  
ATOM   8798  C   ALA C 280      -1.277 126.745  79.495  1.00 45.83           C  
ATOM   8799  O   ALA C 280      -2.348 127.009  80.043  1.00 48.24           O  
ATOM   8800  CB  ALA C 280      -0.717 126.792  77.081  1.00 39.33           C  
ATOM   8801  N   ILE C 281      -0.513 125.732  79.872  1.00 47.27           N  
ATOM   8802  CA  ILE C 281      -0.927 124.870  80.961  1.00 49.42           C  
ATOM   8803  C   ILE C 281      -1.185 125.704  82.191  1.00 50.77           C  
ATOM   8804  O   ILE C 281      -2.116 125.436  82.928  1.00 51.60           O  
ATOM   8805  CB  ILE C 281       0.144 123.795  81.251  1.00 50.64           C  
ATOM   8806  CG1 ILE C 281       0.129 122.776  80.111  1.00 52.37           C  
ATOM   8807  CG2 ILE C 281      -0.115 123.096  82.588  1.00 49.77           C  
ATOM   8808  CD1 ILE C 281       1.230 121.766  80.172  1.00 54.35           C  
ATOM   8809  N   LEU C 282      -0.377 126.734  82.404  1.00 52.90           N  
ATOM   8810  CA  LEU C 282      -0.554 127.576  83.579  1.00 54.92           C  
ATOM   8811  C   LEU C 282      -1.945 128.164  83.663  1.00 56.77           C  
ATOM   8812  O   LEU C 282      -2.624 128.051  84.686  1.00 56.15           O  
ATOM   8813  CB  LEU C 282       0.443 128.729  83.585  1.00 53.88           C  
ATOM   8814  CG  LEU C 282       0.204 129.730  84.731  1.00 52.86           C  
ATOM   8815  CD1 LEU C 282       0.491 129.077  86.071  1.00 52.78           C  
ATOM   8816  CD2 LEU C 282       1.095 130.927  84.571  1.00 53.21           C  
ATOM   8817  N   ARG C 283      -2.352 128.805  82.577  1.00 59.45           N  
ATOM   8818  CA  ARG C 283      -3.646 129.456  82.511  1.00 63.78           C  
ATOM   8819  C   ARG C 283      -4.817 128.491  82.359  1.00 66.20           C  
ATOM   8820  O   ARG C 283      -5.984 128.893  82.428  1.00 67.71           O  
ATOM   8821  CB  ARG C 283      -3.647 130.457  81.362  1.00 64.74           C  
ATOM   8822  CG  ARG C 283      -2.463 131.393  81.410  1.00 68.37           C  
ATOM   8823  CD  ARG C 283      -2.624 132.618  80.511  1.00 70.77           C  
ATOM   8824  NE  ARG C 283      -2.679 132.285  79.087  1.00 72.90           N  
ATOM   8825  CZ  ARG C 283      -2.649 133.194  78.115  1.00 73.39           C  
ATOM   8826  NH1 ARG C 283      -2.560 134.488  78.422  1.00 74.53           N  
ATOM   8827  NH2 ARG C 283      -2.713 132.814  76.845  1.00 71.37           N  
ATOM   8828  N   SER C 284      -4.513 127.217  82.153  1.00 67.60           N  
ATOM   8829  CA  SER C 284      -5.568 126.231  81.988  1.00 68.67           C  
ATOM   8830  C   SER C 284      -6.338 126.017  83.278  1.00 68.58           C  
ATOM   8831  O   SER C 284      -7.515 125.711  83.248  1.00 69.55           O  
ATOM   8832  CB  SER C 284      -4.986 124.898  81.519  1.00 69.45           C  
ATOM   8833  OG  SER C 284      -4.221 124.283  82.541  1.00 68.25           O  
ATOM   8834  N   ILE C 285      -5.674 126.171  84.412  1.00 68.77           N  
ATOM   8835  CA  ILE C 285      -6.336 125.982  85.688  1.00 70.64           C  
ATOM   8836  C   ILE C 285      -6.583 127.324  86.333  1.00 73.74           C  
ATOM   8837  O   ILE C 285      -5.681 127.884  86.960  1.00 73.74           O  
ATOM   8838  CB  ILE C 285      -5.472 125.185  86.675  1.00 70.52           C  
ATOM   8839  CG1 ILE C 285      -5.054 123.855  86.063  1.00 72.54           C  
ATOM   8840  CG2 ILE C 285      -6.224 124.957  87.960  1.00 69.18           C  
ATOM   8841  CD1 ILE C 285      -6.197 122.918  85.756  1.00 75.61           C  
ATOM   8842  N   PRO C 286      -7.803 127.875  86.187  1.00 76.74           N  
ATOM   8843  CA  PRO C 286      -8.081 129.175  86.813  1.00 77.91           C  
ATOM   8844  C   PRO C 286      -8.062 128.941  88.334  1.00 79.18           C  
ATOM   8845  O   PRO C 286      -8.887 128.180  88.862  1.00 79.40           O  
ATOM   8846  CB  PRO C 286      -9.470 129.510  86.288  1.00 77.17           C  
ATOM   8847  CG  PRO C 286     -10.121 128.143  86.242  1.00 77.20           C  
ATOM   8848  CD  PRO C 286      -9.032 127.292  85.615  1.00 77.11           C  
ATOM   8849  N   ASN C 287      -7.116 129.586  89.016  1.00 78.63           N  
ATOM   8850  CA  ASN C 287      -6.928 129.447  90.457  1.00 79.44           C  
ATOM   8851  C   ASN C 287      -5.440 129.560  90.615  1.00 80.15           C  
ATOM   8852  O   ASN C 287      -4.725 128.587  90.395  1.00 81.93           O  
ATOM   8853  CB  ASN C 287      -7.357 128.064  90.957  1.00 80.34           C  
ATOM   8854  CG  ASN C 287      -6.872 127.776  92.368  1.00 82.31           C  
ATOM   8855  OD1 ASN C 287      -5.673 127.821  92.650  1.00 84.48           O  
ATOM   8856  ND2 ASN C 287      -7.803 127.474  93.263  1.00 83.60           N  
ATOM   8857  N   LYS C 288      -4.969 130.733  91.008  1.00 80.61           N  
ATOM   8858  CA  LYS C 288      -3.538 130.952  91.139  1.00 80.24           C  
ATOM   8859  C   LYS C 288      -2.744 129.720  91.605  1.00 77.81           C  
ATOM   8860  O   LYS C 288      -1.775 129.342  90.953  1.00 77.20           O  
ATOM   8861  CB  LYS C 288      -3.274 132.165  92.050  1.00 83.57           C  
ATOM   8862  CG  LYS C 288      -1.969 132.922  91.709  1.00 88.22           C  
ATOM   8863  CD  LYS C 288      -1.852 134.312  92.382  1.00 90.39           C  
ATOM   8864  CE  LYS C 288      -0.596 135.071  91.899  1.00 91.16           C  
ATOM   8865  NZ  LYS C 288      -0.616 136.539  92.212  1.00 91.97           N  
ATOM   8866  N   LEU C 289      -3.164 129.065  92.686  1.00 75.40           N  
ATOM   8867  CA  LEU C 289      -2.412 127.909  93.179  1.00 73.56           C  
ATOM   8868  C   LEU C 289      -2.445 126.646  92.337  1.00 71.71           C  
ATOM   8869  O   LEU C 289      -1.416 125.985  92.163  1.00 72.70           O  
ATOM   8870  CB  LEU C 289      -2.829 127.546  94.603  1.00 74.08           C  
ATOM   8871  CG  LEU C 289      -1.912 126.474  95.219  1.00 75.45           C  
ATOM   8872  CD1 LEU C 289      -0.443 126.809  94.948  1.00 76.09           C  
ATOM   8873  CD2 LEU C 289      -2.153 126.385  96.716  1.00 75.53           C  
ATOM   8874  N   GLY C 290      -3.617 126.289  91.833  1.00 68.99           N  
ATOM   8875  CA  GLY C 290      -3.708 125.098  91.013  1.00 65.26           C  
ATOM   8876  C   GLY C 290      -2.871 125.260  89.762  1.00 63.39           C  
ATOM   8877  O   GLY C 290      -2.099 124.383  89.395  1.00 62.46           O  
ATOM   8878  N   GLY C 291      -3.026 126.400  89.104  1.00 62.16           N  
ATOM   8879  CA  GLY C 291      -2.266 126.656  87.897  1.00 61.94           C  
ATOM   8880  C   GLY C 291      -0.772 126.497  88.120  1.00 61.46           C  
ATOM   8881  O   GLY C 291      -0.056 125.967  87.266  1.00 62.67           O  
ATOM   8882  N   VAL C 292      -0.288 126.964  89.264  1.00 59.47           N  
ATOM   8883  CA  VAL C 292       1.118 126.840  89.557  1.00 57.13           C  
ATOM   8884  C   VAL C 292       1.446 125.363  89.582  1.00 57.60           C  
ATOM   8885  O   VAL C 292       2.244 124.893  88.779  1.00 59.60           O  
ATOM   8886  CB  VAL C 292       1.462 127.465  90.885  1.00 56.24           C  
ATOM   8887  CG1 VAL C 292       2.824 126.999  91.331  1.00 56.15           C  
ATOM   8888  CG2 VAL C 292       1.453 128.976  90.745  1.00 55.62           C  
ATOM   8889  N   LEU C 293       0.824 124.615  90.480  1.00 56.07           N  
ATOM   8890  CA  LEU C 293       1.094 123.183  90.523  1.00 56.52           C  
ATOM   8891  C   LEU C 293       1.056 122.567  89.113  1.00 56.28           C  
ATOM   8892  O   LEU C 293       1.958 121.830  88.724  1.00 57.97           O  
ATOM   8893  CB  LEU C 293       0.074 122.480  91.416  1.00 56.35           C  
ATOM   8894  CG  LEU C 293       0.054 122.981  92.858  1.00 58.03           C  
ATOM   8895  CD1 LEU C 293      -1.193 122.484  93.540  1.00 57.95           C  
ATOM   8896  CD2 LEU C 293       1.298 122.515  93.595  1.00 56.30           C  
ATOM   8897  N   ALA C 294       0.020 122.870  88.341  1.00 54.69           N  
ATOM   8898  CA  ALA C 294      -0.089 122.319  86.999  1.00 53.51           C  
ATOM   8899  C   ALA C 294       1.176 122.624  86.187  1.00 52.07           C  
ATOM   8900  O   ALA C 294       1.662 121.779  85.432  1.00 49.83           O  
ATOM   8901  CB  ALA C 294      -1.344 122.886  86.299  1.00 53.40           C  
ATOM   8902  N   LEU C 295       1.696 123.838  86.354  1.00 50.48           N  
ATOM   8903  CA  LEU C 295       2.896 124.250  85.652  1.00 51.29           C  
ATOM   8904  C   LEU C 295       4.060 123.402  86.130  1.00 52.40           C  
ATOM   8905  O   LEU C 295       4.775 122.812  85.328  1.00 53.65           O  
ATOM   8906  CB  LEU C 295       3.199 125.721  85.916  1.00 50.55           C  
ATOM   8907  CG  LEU C 295       4.526 126.281  85.379  1.00 49.15           C  
ATOM   8908  CD1 LEU C 295       4.733 125.946  83.898  1.00 48.85           C  
ATOM   8909  CD2 LEU C 295       4.502 127.774  85.572  1.00 47.86           C  
ATOM   8910  N   ALA C 296       4.259 123.362  87.441  1.00 52.21           N  
ATOM   8911  CA  ALA C 296       5.319 122.568  88.015  1.00 51.92           C  
ATOM   8912  C   ALA C 296       5.210 121.177  87.399  1.00 53.70           C  
ATOM   8913  O   ALA C 296       6.078 120.739  86.658  1.00 54.75           O  
ATOM   8914  CB  ALA C 296       5.132 122.490  89.493  1.00 52.89           C  
ATOM   8915  N   ALA C 297       4.118 120.493  87.692  1.00 55.18           N  
ATOM   8916  CA  ALA C 297       3.884 119.159  87.167  1.00 56.98           C  
ATOM   8917  C   ALA C 297       4.188 118.986  85.668  1.00 58.26           C  
ATOM   8918  O   ALA C 297       4.700 117.943  85.245  1.00 58.31           O  
ATOM   8919  CB  ALA C 297       2.446 118.769  87.434  1.00 57.03           C  
ATOM   8920  N   SER C 298       3.869 119.991  84.861  1.00 58.47           N  
ATOM   8921  CA  SER C 298       4.102 119.876  83.422  1.00 58.75           C  
ATOM   8922  C   SER C 298       5.522 119.486  83.067  1.00 58.64           C  
ATOM   8923  O   SER C 298       5.730 118.664  82.186  1.00 60.70           O  
ATOM   8924  CB  SER C 298       3.771 121.179  82.703  1.00 59.33           C  
ATOM   8925  OG  SER C 298       4.755 122.155  82.971  1.00 61.38           O  
ATOM   8926  N   VAL C 299       6.503 120.082  83.734  1.00 56.49           N  
ATOM   8927  CA  VAL C 299       7.887 119.764  83.449  1.00 54.29           C  
ATOM   8928  C   VAL C 299       8.382 118.669  84.388  1.00 53.58           C  
ATOM   8929  O   VAL C 299       9.122 117.772  83.982  1.00 53.58           O  
ATOM   8930  CB  VAL C 299       8.757 121.005  83.588  1.00 54.84           C  
ATOM   8931  CG1 VAL C 299      10.217 120.638  83.406  1.00 56.62           C  
ATOM   8932  CG2 VAL C 299       8.343 122.030  82.551  1.00 55.10           C  
ATOM   8933  N   LEU C 300       7.971 118.725  85.646  1.00 52.16           N  
ATOM   8934  CA  LEU C 300       8.391 117.699  86.586  1.00 51.91           C  
ATOM   8935  C   LEU C 300       7.886 116.315  86.175  1.00 51.98           C  
ATOM   8936  O   LEU C 300       8.477 115.310  86.537  1.00 52.94           O  
ATOM   8937  CB  LEU C 300       7.905 118.034  87.999  1.00 51.00           C  
ATOM   8938  CG  LEU C 300       8.487 119.338  88.569  1.00 52.66           C  
ATOM   8939  CD1 LEU C 300       8.221 119.431  90.071  1.00 48.60           C  
ATOM   8940  CD2 LEU C 300       9.987 119.390  88.284  1.00 51.25           C  
ATOM   8941  N   ILE C 301       6.804 116.264  85.402  1.00 51.93           N  
ATOM   8942  CA  ILE C 301       6.218 114.994  84.960  1.00 50.15           C  
ATOM   8943  C   ILE C 301       7.287 114.074  84.384  1.00 48.45           C  
ATOM   8944  O   ILE C 301       7.179 112.849  84.473  1.00 45.79           O  
ATOM   8945  CB  ILE C 301       5.129 115.246  83.892  1.00 51.18           C  
ATOM   8946  CG1 ILE C 301       4.319 113.978  83.645  1.00 51.96           C  
ATOM   8947  CG2 ILE C 301       5.769 115.684  82.597  1.00 51.58           C  
ATOM   8948  CD1 ILE C 301       3.568 113.518  84.851  1.00 54.54           C  
ATOM   8949  N   LEU C 302       8.312 114.698  83.800  1.00 47.80           N  
ATOM   8950  CA  LEU C 302       9.463 114.027  83.190  1.00 47.70           C  
ATOM   8951  C   LEU C 302      10.215 113.051  84.102  1.00 47.11           C  
ATOM   8952  O   LEU C 302      10.812 112.092  83.624  1.00 46.03           O  
ATOM   8953  CB  LEU C 302      10.445 115.071  82.696  1.00 48.26           C  
ATOM   8954  CG  LEU C 302      10.084 115.815  81.418  1.00 49.20           C  
ATOM   8955  CD1 LEU C 302      10.830 117.116  81.410  1.00 52.50           C  
ATOM   8956  CD2 LEU C 302      10.464 115.024  80.201  1.00 48.32           C  
ATOM   8957  N   PHE C 303      10.205 113.316  85.404  1.00 46.76           N  
ATOM   8958  CA  PHE C 303      10.861 112.449  86.368  1.00 47.57           C  
ATOM   8959  C   PHE C 303      10.128 111.111  86.518  1.00 50.27           C  
ATOM   8960  O   PHE C 303      10.721 110.135  86.978  1.00 52.91           O  
ATOM   8961  CB  PHE C 303      10.943 113.125  87.744  1.00 44.33           C  
ATOM   8962  CG  PHE C 303      12.083 114.093  87.894  1.00 43.18           C  
ATOM   8963  CD1 PHE C 303      11.860 115.370  88.394  1.00 42.72           C  
ATOM   8964  CD2 PHE C 303      13.384 113.723  87.564  1.00 44.35           C  
ATOM   8965  CE1 PHE C 303      12.918 116.268  88.564  1.00 44.58           C  
ATOM   8966  CE2 PHE C 303      14.455 114.609  87.728  1.00 43.94           C  
ATOM   8967  CZ  PHE C 303      14.226 115.888  88.230  1.00 43.94           C  
ATOM   8968  N   LEU C 304       8.855 111.053  86.132  1.00 51.33           N  
ATOM   8969  CA  LEU C 304       8.093 109.813  86.262  1.00 53.42           C  
ATOM   8970  C   LEU C 304       8.132 108.883  85.055  1.00 55.03           C  
ATOM   8971  O   LEU C 304       7.797 107.700  85.173  1.00 56.34           O  
ATOM   8972  CB  LEU C 304       6.623 110.102  86.555  1.00 55.28           C  
ATOM   8973  CG  LEU C 304       6.192 110.847  87.817  1.00 58.72           C  
ATOM   8974  CD1 LEU C 304       4.666 110.758  87.904  1.00 57.59           C  
ATOM   8975  CD2 LEU C 304       6.851 110.247  89.069  1.00 58.25           C  
ATOM   8976  N   ILE C 305       8.533 109.393  83.897  1.00 54.77           N  
ATOM   8977  CA  ILE C 305       8.540 108.561  82.706  1.00 54.44           C  
ATOM   8978  C   ILE C 305       9.171 107.195  82.911  1.00 55.56           C  
ATOM   8979  O   ILE C 305       8.552 106.186  82.595  1.00 56.40           O  
ATOM   8980  CB  ILE C 305       9.237 109.244  81.533  1.00 54.51           C  
ATOM   8981  CG1 ILE C 305       8.508 110.536  81.159  1.00 56.33           C  
ATOM   8982  CG2 ILE C 305       9.231 108.328  80.345  1.00 55.01           C  
ATOM   8983  CD1 ILE C 305       7.047 110.346  80.762  1.00 55.68           C  
ATOM   8984  N   PRO C 306      10.408 107.136  83.444  1.00 56.61           N  
ATOM   8985  CA  PRO C 306      11.099 105.856  83.678  1.00 56.28           C  
ATOM   8986  C   PRO C 306      10.248 104.817  84.410  1.00 57.10           C  
ATOM   8987  O   PRO C 306      10.364 103.614  84.183  1.00 57.07           O  
ATOM   8988  CB  PRO C 306      12.311 106.262  84.507  1.00 55.87           C  
ATOM   8989  CG  PRO C 306      12.601 107.642  84.013  1.00 56.99           C  
ATOM   8990  CD  PRO C 306      11.231 108.268  83.913  1.00 55.89           C  
ATOM   8991  N   PHE C 307       9.380 105.280  85.291  1.00 57.67           N  
ATOM   8992  CA  PHE C 307       8.559 104.355  86.032  1.00 59.08           C  
ATOM   8993  C   PHE C 307       7.238 104.049  85.362  1.00 58.27           C  
ATOM   8994  O   PHE C 307       6.470 103.256  85.869  1.00 59.81           O  
ATOM   8995  CB  PHE C 307       8.326 104.905  87.428  1.00 62.31           C  
ATOM   8996  CG  PHE C 307       9.601 105.253  88.151  1.00 68.01           C  
ATOM   8997  CD1 PHE C 307      10.562 104.269  88.421  1.00 70.92           C  
ATOM   8998  CD2 PHE C 307       9.858 106.562  88.551  1.00 68.95           C  
ATOM   8999  CE1 PHE C 307      11.766 104.587  89.080  1.00 70.52           C  
ATOM   9000  CE2 PHE C 307      11.051 106.886  89.207  1.00 70.37           C  
ATOM   9001  CZ  PHE C 307      12.006 105.896  89.470  1.00 70.69           C  
ATOM   9002  N   LEU C 308       6.965 104.665  84.222  1.00 56.87           N  
ATOM   9003  CA  LEU C 308       5.706 104.416  83.526  1.00 55.58           C  
ATOM   9004  C   LEU C 308       5.914 103.599  82.268  1.00 55.92           C  
ATOM   9005  O   LEU C 308       5.072 103.620  81.360  1.00 57.53           O  
ATOM   9006  CB  LEU C 308       5.024 105.729  83.149  1.00 53.62           C  
ATOM   9007  CG  LEU C 308       4.681 106.640  84.315  1.00 51.25           C  
ATOM   9008  CD1 LEU C 308       3.973 107.879  83.806  1.00 48.45           C  
ATOM   9009  CD2 LEU C 308       3.828 105.857  85.288  1.00 48.28           C  
ATOM   9010  N   HIS C 309       7.035 102.890  82.208  1.00 54.37           N  
ATOM   9011  CA  HIS C 309       7.340 102.066  81.045  1.00 52.86           C  
ATOM   9012  C   HIS C 309       6.814 100.659  81.297  1.00 52.79           C  
ATOM   9013  O   HIS C 309       7.228  99.993  82.234  1.00 53.53           O  
ATOM   9014  CB  HIS C 309       8.839 102.040  80.809  1.00 51.50           C  
ATOM   9015  CG  HIS C 309       9.253 101.175  79.666  1.00 51.20           C  
ATOM   9016  ND1 HIS C 309       9.542 101.682  78.421  1.00 49.65           N  
ATOM   9017  CD2 HIS C 309       9.415  99.832  79.576  1.00 52.23           C  
ATOM   9018  CE1 HIS C 309       9.864 100.688  77.609  1.00 50.65           C  
ATOM   9019  NE2 HIS C 309       9.795  99.555  78.283  1.00 50.91           N  
ATOM   9020  N   LYS C 310       5.891 100.210  80.461  1.00 53.07           N  
ATOM   9021  CA  LYS C 310       5.315  98.897  80.646  1.00 53.03           C  
ATOM   9022  C   LYS C 310       5.732  97.937  79.574  1.00 53.81           C  
ATOM   9023  O   LYS C 310       5.727  96.735  79.808  1.00 54.99           O  
ATOM   9024  CB  LYS C 310       3.790  98.984  80.684  1.00 53.71           C  
ATOM   9025  CG  LYS C 310       3.270  99.822  81.824  1.00 54.97           C  
ATOM   9026  CD  LYS C 310       3.708  99.221  83.143  1.00 58.50           C  
ATOM   9027  CE  LYS C 310       3.423 100.151  84.322  1.00 62.61           C  
ATOM   9028  NZ  LYS C 310       3.902  99.616  85.639  1.00 62.86           N  
ATOM   9029  N   SER C 311       6.103  98.449  78.403  1.00 54.18           N  
ATOM   9030  CA  SER C 311       6.507  97.569  77.304  1.00 53.72           C  
ATOM   9031  C   SER C 311       7.623  96.573  77.615  1.00 52.75           C  
ATOM   9032  O   SER C 311       8.440  96.780  78.503  1.00 52.50           O  
ATOM   9033  CB  SER C 311       6.921  98.373  76.086  1.00 53.09           C  
ATOM   9034  OG  SER C 311       7.191  97.463  75.027  1.00 56.17           O  
ATOM   9035  N   LYS C 312       7.656  95.489  76.857  1.00 52.50           N  
ATOM   9036  CA  LYS C 312       8.666  94.471  77.051  1.00 53.32           C  
ATOM   9037  C   LYS C 312       9.858  94.773  76.139  1.00 52.98           C  
ATOM   9038  O   LYS C 312      10.921  94.140  76.214  1.00 52.36           O  
ATOM   9039  CB  LYS C 312       8.059  93.109  76.740  1.00 55.21           C  
ATOM   9040  CG  LYS C 312       7.114  92.625  77.811  1.00 57.52           C  
ATOM   9041  CD  LYS C 312       7.647  91.343  78.456  1.00 63.26           C  
ATOM   9042  CE  LYS C 312       6.848  90.953  79.704  1.00 67.64           C  
ATOM   9043  NZ  LYS C 312       6.896  92.029  80.765  1.00 69.26           N  
ATOM   9044  N   GLN C 313       9.653  95.765  75.285  1.00 51.87           N  
ATOM   9045  CA  GLN C 313      10.650  96.223  74.339  1.00 50.01           C  
ATOM   9046  C   GLN C 313      11.023  97.645  74.764  1.00 50.65           C  
ATOM   9047  O   GLN C 313      10.229  98.348  75.389  1.00 50.95           O  
ATOM   9048  CB  GLN C 313      10.054  96.188  72.940  1.00 47.38           C  
ATOM   9049  CG  GLN C 313       9.633  94.803  72.551  1.00 48.74           C  
ATOM   9050  CD  GLN C 313       8.917  94.745  71.222  1.00 52.79           C  
ATOM   9051  OE1 GLN C 313       7.871  95.382  71.027  1.00 57.98           O  
ATOM   9052  NE2 GLN C 313       9.468  93.971  70.294  1.00 52.79           N  
ATOM   9053  N   ARG C 314      12.233  98.071  74.430  1.00 51.27           N  
ATOM   9054  CA  ARG C 314      12.705  99.384  74.843  1.00 49.61           C  
ATOM   9055  C   ARG C 314      12.189 100.562  74.058  1.00 50.01           C  
ATOM   9056  O   ARG C 314      11.614 101.485  74.627  1.00 50.00           O  
ATOM   9057  CB  ARG C 314      14.220  99.406  74.814  1.00 48.60           C  
ATOM   9058  CG  ARG C 314      14.779 100.674  75.346  1.00 49.87           C  
ATOM   9059  CD  ARG C 314      16.244 100.531  75.647  1.00 51.73           C  
ATOM   9060  NE  ARG C 314      16.718 101.668  76.427  1.00 52.97           N  
ATOM   9061  CZ  ARG C 314      17.963 101.818  76.862  1.00 52.88           C  
ATOM   9062  NH1 ARG C 314      18.879 100.896  76.594  1.00 53.36           N  
ATOM   9063  NH2 ARG C 314      18.285 102.888  77.575  1.00 51.69           N  
ATOM   9064  N   THR C 315      12.416 100.528  72.751  1.00 50.14           N  
ATOM   9065  CA  THR C 315      12.007 101.597  71.845  1.00 50.33           C  
ATOM   9066  C   THR C 315      10.582 101.476  71.320  1.00 50.20           C  
ATOM   9067  O   THR C 315       9.881 100.497  71.576  1.00 51.70           O  
ATOM   9068  CB  THR C 315      12.919 101.615  70.629  1.00 50.74           C  
ATOM   9069  OG1 THR C 315      12.896 100.322  70.016  1.00 48.81           O  
ATOM   9070  CG2 THR C 315      14.336 101.944  71.044  1.00 51.34           C  
ATOM   9071  N   MET C 316      10.157 102.476  70.565  1.00 48.51           N  
ATOM   9072  CA  MET C 316       8.825 102.434  69.969  1.00 48.07           C  
ATOM   9073  C   MET C 316       8.954 101.994  68.498  1.00 49.35           C  
ATOM   9074  O   MET C 316       7.986 102.043  67.737  1.00 49.81           O  
ATOM   9075  CB  MET C 316       8.153 103.819  70.038  1.00 43.30           C  
ATOM   9076  CG  MET C 316       7.480 104.141  71.347  1.00 37.94           C  
ATOM   9077  SD  MET C 316       7.192 105.921  71.499  1.00 42.45           S  
ATOM   9078  CE  MET C 316       6.752 106.088  73.237  1.00 37.02           C  
ATOM   9079  N   THR C 317      10.144 101.559  68.097  1.00 49.26           N  
ATOM   9080  CA  THR C 317      10.327 101.188  66.710  1.00 49.50           C  
ATOM   9081  C   THR C 317       9.347 100.156  66.245  1.00 50.61           C  
ATOM   9082  O   THR C 317       8.785 100.281  65.162  1.00 53.88           O  
ATOM   9083  CB  THR C 317      11.705 100.640  66.436  1.00 48.37           C  
ATOM   9084  OG1 THR C 317      12.680 101.589  66.851  1.00 50.10           O  
ATOM   9085  CG2 THR C 317      11.878 100.396  64.967  1.00 48.40           C  
ATOM   9086  N   PHE C 318       9.138  99.134  67.057  1.00 50.55           N  
ATOM   9087  CA  PHE C 318       8.238  98.056  66.677  1.00 51.24           C  
ATOM   9088  C   PHE C 318       6.943  98.105  67.489  1.00 53.41           C  
ATOM   9089  O   PHE C 318       6.376  97.056  67.836  1.00 53.80           O  
ATOM   9090  CB  PHE C 318       8.941  96.709  66.900  1.00 48.55           C  
ATOM   9091  CG  PHE C 318      10.329  96.635  66.324  1.00 44.21           C  
ATOM   9092  CD1 PHE C 318      11.392  96.155  67.093  1.00 43.82           C  
ATOM   9093  CD2 PHE C 318      10.586  97.050  65.033  1.00 42.85           C  
ATOM   9094  CE1 PHE C 318      12.701  96.092  66.581  1.00 40.90           C  
ATOM   9095  CE2 PHE C 318      11.896  96.991  64.513  1.00 43.49           C  
ATOM   9096  CZ  PHE C 318      12.950  96.510  65.294  1.00 41.41           C  
ATOM   9097  N   ARG C 319       6.488  99.319  67.800  1.00 55.23           N  
ATOM   9098  CA  ARG C 319       5.264  99.518  68.591  1.00 58.14           C  
ATOM   9099  C   ARG C 319       4.400 100.605  67.957  1.00 60.34           C  
ATOM   9100  O   ARG C 319       4.305 101.730  68.475  1.00 61.02           O  
ATOM   9101  CB  ARG C 319       5.606  99.931  70.029  1.00 57.47           C  
ATOM   9102  CG  ARG C 319       6.305  98.870  70.835  1.00 59.10           C  
ATOM   9103  CD  ARG C 319       6.144  99.162  72.302  1.00 61.47           C  
ATOM   9104  NE  ARG C 319       7.017 100.232  72.767  1.00 64.32           N  
ATOM   9105  CZ  ARG C 319       6.665 101.133  73.680  1.00 66.03           C  
ATOM   9106  NH1 ARG C 319       5.452 101.102  74.215  1.00 67.50           N  
ATOM   9107  NH2 ARG C 319       7.534 102.049  74.085  1.00 68.02           N  
ATOM   9108  N   PRO C 320       3.727 100.269  66.845  1.00 60.98           N  
ATOM   9109  CA  PRO C 320       2.859 101.165  66.079  1.00 60.37           C  
ATOM   9110  C   PRO C 320       1.782 101.916  66.864  1.00 60.45           C  
ATOM   9111  O   PRO C 320       1.497 103.085  66.547  1.00 61.98           O  
ATOM   9112  CB  PRO C 320       2.294 100.249  65.011  1.00 61.04           C  
ATOM   9113  CG  PRO C 320       2.192  98.945  65.736  1.00 61.43           C  
ATOM   9114  CD  PRO C 320       3.509  98.870  66.442  1.00 60.92           C  
ATOM   9115  N   LEU C 321       1.172 101.281  67.869  1.00 58.50           N  
ATOM   9116  CA  LEU C 321       0.167 102.007  68.651  1.00 56.68           C  
ATOM   9117  C   LEU C 321       0.865 103.113  69.435  1.00 55.85           C  
ATOM   9118  O   LEU C 321       0.406 104.253  69.453  1.00 55.37           O  
ATOM   9119  CB  LEU C 321      -0.584 101.090  69.614  1.00 56.07           C  
ATOM   9120  CG  LEU C 321      -1.375  99.952  68.963  1.00 56.06           C  
ATOM   9121  CD1 LEU C 321      -2.284  99.322  70.017  1.00 53.62           C  
ATOM   9122  CD2 LEU C 321      -2.187 100.475  67.787  1.00 52.31           C  
ATOM   9123  N   SER C 322       1.992 102.781  70.058  1.00 54.61           N  
ATOM   9124  CA  SER C 322       2.752 103.768  70.818  1.00 54.18           C  
ATOM   9125  C   SER C 322       3.214 104.915  69.914  1.00 52.55           C  
ATOM   9126  O   SER C 322       3.270 106.073  70.318  1.00 50.72           O  
ATOM   9127  CB  SER C 322       3.969 103.105  71.475  1.00 55.96           C  
ATOM   9128  OG  SER C 322       3.582 102.158  72.464  1.00 57.61           O  
ATOM   9129  N   GLN C 323       3.541 104.581  68.678  1.00 52.11           N  
ATOM   9130  CA  GLN C 323       4.002 105.579  67.733  1.00 52.31           C  
ATOM   9131  C   GLN C 323       2.988 106.655  67.425  1.00 52.44           C  
ATOM   9132  O   GLN C 323       3.344 107.823  67.327  1.00 53.79           O  
ATOM   9133  CB  GLN C 323       4.427 104.919  66.433  1.00 52.13           C  
ATOM   9134  CG  GLN C 323       5.687 104.133  66.547  1.00 53.37           C  
ATOM   9135  CD  GLN C 323       6.018 103.483  65.250  1.00 55.62           C  
ATOM   9136  OE1 GLN C 323       5.982 104.131  64.204  1.00 59.43           O  
ATOM   9137  NE2 GLN C 323       6.341 102.196  65.290  1.00 55.97           N  
ATOM   9138  N   THR C 324       1.726 106.294  67.239  1.00 51.97           N  
ATOM   9139  CA  THR C 324       0.766 107.349  66.954  1.00 50.56           C  
ATOM   9140  C   THR C 324       0.543 108.096  68.258  1.00 47.34           C  
ATOM   9141  O   THR C 324       0.505 109.321  68.289  1.00 45.87           O  
ATOM   9142  CB  THR C 324      -0.577 106.792  66.399  1.00 52.82           C  
ATOM   9143  OG1 THR C 324      -1.101 105.823  67.310  1.00 54.32           O  
ATOM   9144  CG2 THR C 324      -0.365 106.142  65.014  1.00 53.35           C  
ATOM   9145  N   LEU C 325       0.430 107.358  69.351  1.00 45.06           N  
ATOM   9146  CA  LEU C 325       0.229 108.022  70.620  1.00 45.30           C  
ATOM   9147  C   LEU C 325       1.358 109.037  70.806  1.00 45.94           C  
ATOM   9148  O   LEU C 325       1.120 110.177  71.195  1.00 47.93           O  
ATOM   9149  CB  LEU C 325       0.206 107.001  71.752  1.00 43.53           C  
ATOM   9150  CG  LEU C 325      -0.444 107.488  73.041  1.00 43.07           C  
ATOM   9151  CD1 LEU C 325      -1.746 108.173  72.695  1.00 43.07           C  
ATOM   9152  CD2 LEU C 325      -0.682 106.315  73.998  1.00 43.67           C  
ATOM   9153  N   PHE C 326       2.584 108.630  70.494  1.00 45.73           N  
ATOM   9154  CA  PHE C 326       3.737 109.516  70.596  1.00 43.89           C  
ATOM   9155  C   PHE C 326       3.568 110.785  69.750  1.00 44.55           C  
ATOM   9156  O   PHE C 326       3.801 111.883  70.245  1.00 44.76           O  
ATOM   9157  CB  PHE C 326       5.006 108.788  70.154  1.00 42.13           C  
ATOM   9158  CG  PHE C 326       6.234 109.666  70.140  1.00 39.49           C  
ATOM   9159  CD1 PHE C 326       6.952 109.890  71.305  1.00 37.27           C  
ATOM   9160  CD2 PHE C 326       6.639 110.309  68.968  1.00 37.63           C  
ATOM   9161  CE1 PHE C 326       8.047 110.738  71.310  1.00 35.78           C  
ATOM   9162  CE2 PHE C 326       7.728 111.154  68.967  1.00 36.15           C  
ATOM   9163  CZ  PHE C 326       8.434 111.369  70.149  1.00 35.51           C  
ATOM   9164  N   TRP C 327       3.193 110.641  68.476  1.00 46.08           N  
ATOM   9165  CA  TRP C 327       2.989 111.808  67.599  1.00 48.32           C  
ATOM   9166  C   TRP C 327       1.733 112.604  67.974  1.00 50.82           C  
ATOM   9167  O   TRP C 327       1.611 113.790  67.639  1.00 51.34           O  
ATOM   9168  CB  TRP C 327       2.891 111.394  66.140  1.00 46.82           C  
ATOM   9169  CG  TRP C 327       4.158 110.884  65.636  1.00 49.68           C  
ATOM   9170  CD1 TRP C 327       4.439 109.604  65.253  1.00 50.50           C  
ATOM   9171  CD2 TRP C 327       5.375 111.616  65.515  1.00 50.81           C  
ATOM   9172  NE1 TRP C 327       5.765 109.494  64.903  1.00 50.98           N  
ATOM   9173  CE2 TRP C 327       6.363 110.717  65.057  1.00 50.08           C  
ATOM   9174  CE3 TRP C 327       5.730 112.946  65.752  1.00 51.66           C  
ATOM   9175  CZ2 TRP C 327       7.681 111.105  64.834  1.00 48.55           C  
ATOM   9176  CZ3 TRP C 327       7.043 113.329  65.527  1.00 52.04           C  
ATOM   9177  CH2 TRP C 327       8.002 112.407  65.072  1.00 49.71           C  
ATOM   9178  N   LEU C 328       0.792 111.953  68.651  1.00 51.03           N  
ATOM   9179  CA  LEU C 328      -0.399 112.648  69.086  1.00 50.80           C  
ATOM   9180  C   LEU C 328       0.100 113.637  70.113  1.00 50.63           C  
ATOM   9181  O   LEU C 328      -0.202 114.816  70.051  1.00 52.97           O  
ATOM   9182  CB  LEU C 328      -1.352 111.697  69.762  1.00 53.85           C  
ATOM   9183  CG  LEU C 328      -2.768 111.861  69.255  1.00 55.57           C  
ATOM   9184  CD1 LEU C 328      -2.861 111.245  67.854  1.00 55.11           C  
ATOM   9185  CD2 LEU C 328      -3.706 111.169  70.213  1.00 57.47           C  
ATOM   9186  N   LEU C 329       0.874 113.138  71.065  1.00 49.28           N  
ATOM   9187  CA  LEU C 329       1.464 113.965  72.114  1.00 46.89           C  
ATOM   9188  C   LEU C 329       2.258 115.142  71.540  1.00 45.74           C  
ATOM   9189  O   LEU C 329       2.142 116.269  72.013  1.00 46.32           O  
ATOM   9190  CB  LEU C 329       2.410 113.119  72.954  1.00 47.54           C  
ATOM   9191  CG  LEU C 329       3.146 113.920  74.011  1.00 46.81           C  
ATOM   9192  CD1 LEU C 329       2.107 114.417  74.999  1.00 47.33           C  
ATOM   9193  CD2 LEU C 329       4.205 113.077  74.692  1.00 44.88           C  
ATOM   9194  N   VAL C 330       3.092 114.875  70.542  1.00 43.49           N  
ATOM   9195  CA  VAL C 330       3.868 115.942  69.935  1.00 43.74           C  
ATOM   9196  C   VAL C 330       2.898 117.008  69.446  1.00 44.67           C  
ATOM   9197  O   VAL C 330       3.065 118.190  69.744  1.00 45.59           O  
ATOM   9198  CB  VAL C 330       4.675 115.437  68.743  1.00 42.95           C  
ATOM   9199  CG1 VAL C 330       5.590 116.533  68.236  1.00 38.91           C  
ATOM   9200  CG2 VAL C 330       5.445 114.205  69.143  1.00 41.58           C  
ATOM   9201  N   ALA C 331       1.880 116.580  68.698  1.00 44.04           N  
ATOM   9202  CA  ALA C 331       0.870 117.495  68.186  1.00 41.61           C  
ATOM   9203  C   ALA C 331       0.208 118.205  69.363  1.00 41.77           C  
ATOM   9204  O   ALA C 331      -0.052 119.410  69.306  1.00 43.40           O  
ATOM   9205  CB  ALA C 331      -0.149 116.740  67.402  1.00 39.88           C  
ATOM   9206  N   ASN C 332      -0.053 117.458  70.432  1.00 41.11           N  
ATOM   9207  CA  ASN C 332      -0.672 118.007  71.636  1.00 40.37           C  
ATOM   9208  C   ASN C 332       0.123 119.240  72.055  1.00 39.59           C  
ATOM   9209  O   ASN C 332      -0.448 120.301  72.310  1.00 38.99           O  
ATOM   9210  CB  ASN C 332      -0.650 116.961  72.750  1.00 42.33           C  
ATOM   9211  CG  ASN C 332      -1.650 117.253  73.855  1.00 46.04           C  
ATOM   9212  OD1 ASN C 332      -1.865 118.404  74.229  1.00 46.55           O  
ATOM   9213  ND2 ASN C 332      -2.253 116.197  74.404  1.00 49.30           N  
ATOM   9214  N   LEU C 333       1.446 119.096  72.090  1.00 39.71           N  
ATOM   9215  CA  LEU C 333       2.348 120.185  72.474  1.00 41.42           C  
ATOM   9216  C   LEU C 333       2.320 121.390  71.524  1.00 41.25           C  
ATOM   9217  O   LEU C 333       2.414 122.534  71.967  1.00 40.01           O  
ATOM   9218  CB  LEU C 333       3.777 119.652  72.602  1.00 43.66           C  
ATOM   9219  CG  LEU C 333       3.993 118.687  73.779  1.00 45.85           C  
ATOM   9220  CD1 LEU C 333       5.345 118.024  73.708  1.00 42.21           C  
ATOM   9221  CD2 LEU C 333       3.849 119.454  75.084  1.00 46.61           C  
ATOM   9222  N   LEU C 334       2.214 121.148  70.223  1.00 41.26           N  
ATOM   9223  CA  LEU C 334       2.119 122.262  69.286  1.00 43.05           C  
ATOM   9224  C   LEU C 334       0.886 123.065  69.631  1.00 42.72           C  
ATOM   9225  O   LEU C 334       0.917 124.286  69.661  1.00 43.25           O  
ATOM   9226  CB  LEU C 334       1.974 121.785  67.849  1.00 44.73           C  
ATOM   9227  CG  LEU C 334       3.294 121.542  67.134  1.00 48.13           C  
ATOM   9228  CD1 LEU C 334       3.015 121.031  65.716  1.00 46.75           C  
ATOM   9229  CD2 LEU C 334       4.087 122.850  67.107  1.00 49.72           C  
ATOM   9230  N   ILE C 335      -0.210 122.377  69.900  1.00 42.10           N  
ATOM   9231  CA  ILE C 335      -1.422 123.083  70.233  1.00 42.65           C  
ATOM   9232  C   ILE C 335      -1.280 123.903  71.509  1.00 41.57           C  
ATOM   9233  O   ILE C 335      -1.699 125.068  71.562  1.00 40.35           O  
ATOM   9234  CB  ILE C 335      -2.586 122.115  70.354  1.00 44.74           C  
ATOM   9235  CG1 ILE C 335      -2.862 121.499  68.978  1.00 44.78           C  
ATOM   9236  CG2 ILE C 335      -3.816 122.849  70.892  1.00 44.57           C  
ATOM   9237  CD1 ILE C 335      -3.815 120.324  69.025  1.00 46.48           C  
ATOM   9238  N   LEU C 336      -0.702 123.307  72.542  1.00 40.69           N  
ATOM   9239  CA  LEU C 336      -0.523 124.052  73.773  1.00 40.13           C  
ATOM   9240  C   LEU C 336       0.335 125.284  73.455  1.00 41.21           C  
ATOM   9241  O   LEU C 336       0.077 126.391  73.950  1.00 42.75           O  
ATOM   9242  CB  LEU C 336       0.128 123.171  74.833  1.00 38.49           C  
ATOM   9243  CG  LEU C 336      -0.838 122.227  75.557  1.00 38.54           C  
ATOM   9244  CD1 LEU C 336      -0.104 121.310  76.502  1.00 39.57           C  
ATOM   9245  CD2 LEU C 336      -1.816 123.053  76.360  1.00 38.55           C  
ATOM   9246  N   THR C 337       1.337 125.103  72.599  1.00 40.03           N  
ATOM   9247  CA  THR C 337       2.212 126.209  72.216  1.00 39.28           C  
ATOM   9248  C   THR C 337       1.401 127.324  71.585  1.00 39.40           C  
ATOM   9249  O   THR C 337       1.573 128.492  71.912  1.00 38.29           O  
ATOM   9250  CB  THR C 337       3.258 125.733  71.222  1.00 38.85           C  
ATOM   9251  OG1 THR C 337       4.044 124.725  71.851  1.00 40.94           O  
ATOM   9252  CG2 THR C 337       4.159 126.863  70.783  1.00 36.48           C  
ATOM   9253  N   TRP C 338       0.522 126.939  70.664  1.00 40.95           N  
ATOM   9254  CA  TRP C 338      -0.360 127.869  69.975  1.00 41.93           C  
ATOM   9255  C   TRP C 338      -1.280 128.545  70.993  1.00 42.97           C  
ATOM   9256  O   TRP C 338      -1.384 129.774  71.016  1.00 43.03           O  
ATOM   9257  CB  TRP C 338      -1.180 127.120  68.940  1.00 42.82           C  
ATOM   9258  CG  TRP C 338      -2.285 127.903  68.362  1.00 47.08           C  
ATOM   9259  CD1 TRP C 338      -2.204 129.128  67.776  1.00 48.80           C  
ATOM   9260  CD2 TRP C 338      -3.657 127.525  68.314  1.00 50.48           C  
ATOM   9261  NE1 TRP C 338      -3.447 129.546  67.366  1.00 50.45           N  
ATOM   9262  CE2 TRP C 338      -4.360 128.580  67.686  1.00 52.21           C  
ATOM   9263  CE3 TRP C 338      -4.367 126.398  68.742  1.00 52.81           C  
ATOM   9264  CZ2 TRP C 338      -5.741 128.541  67.478  1.00 53.66           C  
ATOM   9265  CZ3 TRP C 338      -5.747 126.357  68.533  1.00 54.43           C  
ATOM   9266  CH2 TRP C 338      -6.416 127.425  67.906  1.00 54.83           C  
ATOM   9267  N   ILE C 339      -1.939 127.755  71.840  1.00 41.52           N  
ATOM   9268  CA  ILE C 339      -2.792 128.344  72.848  1.00 42.27           C  
ATOM   9269  C   ILE C 339      -2.018 129.332  73.709  1.00 43.53           C  
ATOM   9270  O   ILE C 339      -2.541 130.389  74.051  1.00 46.43           O  
ATOM   9271  CB  ILE C 339      -3.403 127.291  73.766  1.00 43.32           C  
ATOM   9272  CG1 ILE C 339      -4.421 126.489  72.973  1.00 45.52           C  
ATOM   9273  CG2 ILE C 339      -4.051 127.952  75.008  1.00 40.94           C  
ATOM   9274  CD1 ILE C 339      -5.524 127.339  72.365  1.00 45.71           C  
ATOM   9275  N   GLY C 340      -0.784 129.001  74.069  1.00 42.62           N  
ATOM   9276  CA  GLY C 340      -0.004 129.913  74.888  1.00 43.01           C  
ATOM   9277  C   GLY C 340       0.202 131.297  74.287  1.00 43.76           C  
ATOM   9278  O   GLY C 340       0.442 132.270  75.011  1.00 43.81           O  
ATOM   9279  N   SER C 341       0.099 131.396  72.965  1.00 44.70           N  
ATOM   9280  CA  SER C 341       0.278 132.674  72.270  1.00 47.47           C  
ATOM   9281  C   SER C 341      -1.009 133.489  72.044  1.00 49.33           C  
ATOM   9282  O   SER C 341      -0.962 134.595  71.501  1.00 48.72           O  
ATOM   9283  CB  SER C 341       0.924 132.436  70.906  1.00 46.57           C  
ATOM   9284  OG  SER C 341      -0.003 131.859  70.004  1.00 44.05           O  
ATOM   9285  N   GLN C 342      -2.152 132.935  72.431  1.00 51.14           N  
ATOM   9286  CA  GLN C 342      -3.421 133.614  72.246  1.00 52.86           C  
ATOM   9287  C   GLN C 342      -3.966 134.206  73.528  1.00 56.14           C  
ATOM   9288  O   GLN C 342      -3.536 133.853  74.630  1.00 58.31           O  
ATOM   9289  CB  GLN C 342      -4.432 132.645  71.670  1.00 50.13           C  
ATOM   9290  CG  GLN C 342      -4.021 132.140  70.331  1.00 51.18           C  
ATOM   9291  CD  GLN C 342      -3.809 133.261  69.356  1.00 53.42           C  
ATOM   9292  OE1 GLN C 342      -2.853 133.255  68.584  1.00 55.43           O  
ATOM   9293  NE2 GLN C 342      -4.708 134.241  69.377  1.00 56.23           N  
ATOM   9294  N   PRO C 343      -4.918 135.139  73.406  1.00 57.59           N  
ATOM   9295  CA  PRO C 343      -5.505 135.759  74.598  1.00 57.81           C  
ATOM   9296  C   PRO C 343      -6.317 134.739  75.383  1.00 58.36           C  
ATOM   9297  O   PRO C 343      -6.499 133.606  74.932  1.00 58.41           O  
ATOM   9298  CB  PRO C 343      -6.363 136.878  74.014  1.00 57.50           C  
ATOM   9299  CG  PRO C 343      -6.756 136.337  72.661  1.00 58.24           C  
ATOM   9300  CD  PRO C 343      -5.473 135.718  72.171  1.00 57.65           C  
ATOM   9301  N   VAL C 344      -6.790 135.127  76.559  1.00 59.58           N  
ATOM   9302  CA  VAL C 344      -7.583 134.207  77.355  1.00 62.53           C  
ATOM   9303  C   VAL C 344      -9.056 134.471  77.079  1.00 63.14           C  
ATOM   9304  O   VAL C 344      -9.735 135.172  77.820  1.00 63.03           O  
ATOM   9305  CB  VAL C 344      -7.307 134.361  78.862  1.00 64.22           C  
ATOM   9306  CG1 VAL C 344      -7.742 133.103  79.594  1.00 65.17           C  
ATOM   9307  CG2 VAL C 344      -5.836 134.609  79.101  1.00 66.25           C  
ATOM   9308  N   GLU C 345      -9.537 133.894  75.990  1.00 64.50           N  
ATOM   9309  CA  GLU C 345     -10.910 134.054  75.576  1.00 66.22           C  
ATOM   9310  C   GLU C 345     -11.374 132.833  74.827  1.00 66.39           C  
ATOM   9311  O   GLU C 345     -10.565 132.030  74.363  1.00 67.62           O  
ATOM   9312  CB  GLU C 345     -11.025 135.235  74.642  1.00 68.78           C  
ATOM   9313  CG  GLU C 345     -10.678 136.546  75.276  1.00 74.10           C  
ATOM   9314  CD  GLU C 345     -10.658 137.662  74.254  1.00 77.91           C  
ATOM   9315  OE1 GLU C 345     -11.269 137.468  73.170  1.00 79.08           O  
ATOM   9316  OE2 GLU C 345     -10.042 138.724  74.537  1.00 78.95           O  
ATOM   9317  N   HIS C 346     -12.685 132.694  74.700  1.00 65.52           N  
ATOM   9318  CA  HIS C 346     -13.229 131.571  73.960  1.00 63.81           C  
ATOM   9319  C   HIS C 346     -12.769 131.828  72.520  1.00 60.43           C  
ATOM   9320  O   HIS C 346     -12.618 132.983  72.127  1.00 61.25           O  
ATOM   9321  CB  HIS C 346     -14.760 131.575  74.054  1.00 65.10           C  
ATOM   9322  CG  HIS C 346     -15.406 130.475  73.272  1.00 67.97           C  
ATOM   9323  ND1 HIS C 346     -15.426 129.167  73.709  1.00 68.49           N  
ATOM   9324  CD2 HIS C 346     -15.973 130.471  72.039  1.00 67.82           C  
ATOM   9325  CE1 HIS C 346     -15.975 128.405  72.778  1.00 68.54           C  
ATOM   9326  NE2 HIS C 346     -16.314 129.170  71.754  1.00 68.65           N  
ATOM   9327  N   PRO C 347     -12.505 130.771  71.730  1.00 57.31           N  
ATOM   9328  CA  PRO C 347     -12.584 129.340  72.032  1.00 56.57           C  
ATOM   9329  C   PRO C 347     -11.303 128.826  72.692  1.00 56.31           C  
ATOM   9330  O   PRO C 347     -11.283 127.731  73.270  1.00 57.42           O  
ATOM   9331  CB  PRO C 347     -12.813 128.724  70.659  1.00 54.90           C  
ATOM   9332  CG  PRO C 347     -11.958 129.583  69.808  1.00 55.64           C  
ATOM   9333  CD  PRO C 347     -12.285 130.972  70.287  1.00 55.74           C  
ATOM   9334  N   PHE C 348     -10.247 129.636  72.599  1.00 54.19           N  
ATOM   9335  CA  PHE C 348      -8.931 129.328  73.152  1.00 51.27           C  
ATOM   9336  C   PHE C 348      -8.958 128.794  74.587  1.00 52.90           C  
ATOM   9337  O   PHE C 348      -8.182 127.887  74.930  1.00 54.91           O  
ATOM   9338  CB  PHE C 348      -8.063 130.570  73.114  1.00 46.52           C  
ATOM   9339  CG  PHE C 348      -7.945 131.172  71.765  1.00 43.72           C  
ATOM   9340  CD1 PHE C 348      -7.779 132.539  71.618  1.00 44.18           C  
ATOM   9341  CD2 PHE C 348      -7.974 130.381  70.635  1.00 43.88           C  
ATOM   9342  CE1 PHE C 348      -7.642 133.111  70.352  1.00 43.56           C  
ATOM   9343  CE2 PHE C 348      -7.837 130.944  69.366  1.00 44.20           C  
ATOM   9344  CZ  PHE C 348      -7.670 132.314  69.227  1.00 42.67           C  
ATOM   9345  N   ILE C 349      -9.837 129.343  75.426  1.00 50.28           N  
ATOM   9346  CA  ILE C 349      -9.909 128.899  76.809  1.00 48.77           C  
ATOM   9347  C   ILE C 349     -10.255 127.429  76.951  1.00 48.66           C  
ATOM   9348  O   ILE C 349      -9.611 126.698  77.689  1.00 48.63           O  
ATOM   9349  CB  ILE C 349     -10.936 129.716  77.611  1.00 48.65           C  
ATOM   9350  CG1 ILE C 349     -10.583 131.209  77.524  1.00 49.27           C  
ATOM   9351  CG2 ILE C 349     -10.963 129.242  79.065  1.00 46.31           C  
ATOM   9352  CD1 ILE C 349     -11.238 132.091  78.574  1.00 46.98           C  
ATOM   9353  N   ILE C 350     -11.271 126.986  76.237  1.00 49.26           N  
ATOM   9354  CA  ILE C 350     -11.673 125.595  76.350  1.00 49.85           C  
ATOM   9355  C   ILE C 350     -10.634 124.683  75.694  1.00 48.98           C  
ATOM   9356  O   ILE C 350     -10.210 123.675  76.286  1.00 47.57           O  
ATOM   9357  CB  ILE C 350     -13.107 125.375  75.729  1.00 50.56           C  
ATOM   9358  CG1 ILE C 350     -13.639 123.994  76.099  1.00 49.90           C  
ATOM   9359  CG2 ILE C 350     -13.062 125.511  74.218  1.00 50.13           C  
ATOM   9360  CD1 ILE C 350     -13.698 123.759  77.596  1.00 52.90           C  
ATOM   9361  N   ILE C 351     -10.222 125.041  74.479  1.00 48.11           N  
ATOM   9362  CA  ILE C 351      -9.225 124.250  73.770  1.00 48.27           C  
ATOM   9363  C   ILE C 351      -8.005 124.087  74.673  1.00 50.23           C  
ATOM   9364  O   ILE C 351      -7.370 123.033  74.681  1.00 50.84           O  
ATOM   9365  CB  ILE C 351      -8.782 124.927  72.480  1.00 45.62           C  
ATOM   9366  CG1 ILE C 351      -9.961 125.038  71.534  1.00 44.06           C  
ATOM   9367  CG2 ILE C 351      -7.683 124.132  71.830  1.00 44.01           C  
ATOM   9368  CD1 ILE C 351      -9.630 125.798  70.291  1.00 45.88           C  
ATOM   9369  N   GLY C 352      -7.694 125.138  75.436  1.00 50.30           N  
ATOM   9370  CA  GLY C 352      -6.562 125.109  76.340  1.00 49.31           C  
ATOM   9371  C   GLY C 352      -6.665 124.015  77.377  1.00 50.30           C  
ATOM   9372  O   GLY C 352      -5.742 123.225  77.557  1.00 51.12           O  
ATOM   9373  N   GLN C 353      -7.793 123.948  78.059  1.00 51.97           N  
ATOM   9374  CA  GLN C 353      -7.962 122.939  79.081  1.00 54.64           C  
ATOM   9375  C   GLN C 353      -8.013 121.546  78.490  1.00 55.31           C  
ATOM   9376  O   GLN C 353      -7.690 120.563  79.153  1.00 56.52           O  
ATOM   9377  CB  GLN C 353      -9.228 123.220  79.849  1.00 57.62           C  
ATOM   9378  CG  GLN C 353      -9.195 124.566  80.508  1.00 62.55           C  
ATOM   9379  CD  GLN C 353     -10.574 125.122  80.702  1.00 63.99           C  
ATOM   9380  OE1 GLN C 353     -11.365 125.176  79.755  1.00 66.83           O  
ATOM   9381  NE2 GLN C 353     -10.876 125.550  81.921  1.00 63.78           N  
ATOM   9382  N   MET C 354      -8.431 121.444  77.244  1.00 54.97           N  
ATOM   9383  CA  MET C 354      -8.477 120.135  76.641  1.00 56.55           C  
ATOM   9384  C   MET C 354      -7.061 119.652  76.423  1.00 55.56           C  
ATOM   9385  O   MET C 354      -6.682 118.584  76.907  1.00 56.52           O  
ATOM   9386  CB  MET C 354      -9.241 120.191  75.325  1.00 62.55           C  
ATOM   9387  CG  MET C 354     -10.704 120.550  75.525  1.00 67.59           C  
ATOM   9388  SD  MET C 354     -11.489 119.356  76.661  1.00 76.20           S  
ATOM   9389  CE  MET C 354     -11.535 120.256  78.304  1.00 71.16           C  
ATOM   9390  N   ALA C 355      -6.273 120.450  75.713  1.00 53.86           N  
ATOM   9391  CA  ALA C 355      -4.886 120.110  75.438  1.00 52.66           C  
ATOM   9392  C   ALA C 355      -4.129 119.840  76.727  1.00 52.69           C  
ATOM   9393  O   ALA C 355      -3.299 118.936  76.778  1.00 52.89           O  
ATOM   9394  CB  ALA C 355      -4.226 121.224  74.690  1.00 53.36           C  
ATOM   9395  N   SER C 356      -4.403 120.628  77.762  1.00 51.52           N  
ATOM   9396  CA  SER C 356      -3.743 120.425  79.042  1.00 52.92           C  
ATOM   9397  C   SER C 356      -4.154 119.104  79.648  1.00 53.64           C  
ATOM   9398  O   SER C 356      -3.347 118.388  80.234  1.00 55.28           O  
ATOM   9399  CB  SER C 356      -4.106 121.521  80.028  1.00 53.36           C  
ATOM   9400  OG  SER C 356      -3.322 122.672  79.817  1.00 57.42           O  
ATOM   9401  N   LEU C 357      -5.430 118.785  79.520  1.00 53.85           N  
ATOM   9402  CA  LEU C 357      -5.949 117.552  80.075  1.00 53.16           C  
ATOM   9403  C   LEU C 357      -5.386 116.349  79.335  1.00 52.74           C  
ATOM   9404  O   LEU C 357      -4.913 115.387  79.943  1.00 50.53           O  
ATOM   9405  CB  LEU C 357      -7.466 117.561  79.979  1.00 53.73           C  
ATOM   9406  CG  LEU C 357      -8.165 116.553  80.877  1.00 54.35           C  
ATOM   9407  CD1 LEU C 357      -7.622 116.619  82.304  1.00 53.59           C  
ATOM   9408  CD2 LEU C 357      -9.626 116.882  80.860  1.00 54.65           C  
ATOM   9409  N   SER C 358      -5.439 116.414  78.011  1.00 52.49           N  
ATOM   9410  CA  SER C 358      -4.937 115.328  77.189  1.00 53.41           C  
ATOM   9411  C   SER C 358      -3.464 115.130  77.435  1.00 53.77           C  
ATOM   9412  O   SER C 358      -2.988 114.006  77.424  1.00 57.11           O  
ATOM   9413  CB  SER C 358      -5.143 115.630  75.717  1.00 52.42           C  
ATOM   9414  OG  SER C 358      -4.554 116.872  75.410  1.00 56.74           O  
ATOM   9415  N   TYR C 359      -2.736 116.223  77.634  1.00 52.29           N  
ATOM   9416  CA  TYR C 359      -1.305 116.137  77.883  1.00 51.21           C  
ATOM   9417  C   TYR C 359      -0.999 115.138  79.008  1.00 51.85           C  
ATOM   9418  O   TYR C 359      -0.308 114.131  78.791  1.00 51.78           O  
ATOM   9419  CB  TYR C 359      -0.750 117.517  78.252  1.00 50.80           C  
ATOM   9420  CG  TYR C 359       0.721 117.523  78.593  1.00 49.65           C  
ATOM   9421  CD1 TYR C 359       1.682 117.360  77.598  1.00 48.99           C  
ATOM   9422  CD2 TYR C 359       1.148 117.630  79.928  1.00 50.49           C  
ATOM   9423  CE1 TYR C 359       3.031 117.296  77.912  1.00 50.73           C  
ATOM   9424  CE2 TYR C 359       2.499 117.568  80.261  1.00 51.17           C  
ATOM   9425  CZ  TYR C 359       3.434 117.397  79.244  1.00 52.03           C  
ATOM   9426  OH  TYR C 359       4.770 117.308  79.548  1.00 52.59           O  
ATOM   9427  N   PHE C 360      -1.528 115.397  80.202  1.00 50.97           N  
ATOM   9428  CA  PHE C 360      -1.264 114.515  81.329  1.00 51.00           C  
ATOM   9429  C   PHE C 360      -1.827 113.115  81.179  1.00 51.51           C  
ATOM   9430  O   PHE C 360      -1.276 112.142  81.698  1.00 52.09           O  
ATOM   9431  CB  PHE C 360      -1.763 115.148  82.622  1.00 49.66           C  
ATOM   9432  CG  PHE C 360      -0.964 116.335  83.041  1.00 49.95           C  
ATOM   9433  CD1 PHE C 360      -1.440 117.617  82.839  1.00 50.97           C  
ATOM   9434  CD2 PHE C 360       0.301 116.174  83.574  1.00 49.72           C  
ATOM   9435  CE1 PHE C 360      -0.657 118.727  83.162  1.00 51.08           C  
ATOM   9436  CE2 PHE C 360       1.081 117.276  83.894  1.00 50.78           C  
ATOM   9437  CZ  PHE C 360       0.602 118.551  83.688  1.00 49.74           C  
ATOM   9438  N   THR C 361      -2.922 113.002  80.456  1.00 52.09           N  
ATOM   9439  CA  THR C 361      -3.531 111.707  80.270  1.00 52.37           C  
ATOM   9440  C   THR C 361      -2.626 110.832  79.436  1.00 52.78           C  
ATOM   9441  O   THR C 361      -2.280 109.714  79.826  1.00 53.58           O  
ATOM   9442  CB  THR C 361      -4.837 111.859  79.570  1.00 51.67           C  
ATOM   9443  OG1 THR C 361      -5.500 113.008  80.096  1.00 51.22           O  
ATOM   9444  CG2 THR C 361      -5.677 110.633  79.793  1.00 51.66           C  
ATOM   9445  N   ILE C 362      -2.236 111.357  78.285  1.00 52.31           N  
ATOM   9446  CA  ILE C 362      -1.370 110.632  77.384  1.00 52.54           C  
ATOM   9447  C   ILE C 362      -0.145 110.046  78.068  1.00 52.65           C  
ATOM   9448  O   ILE C 362       0.231 108.915  77.782  1.00 54.39           O  
ATOM   9449  CB  ILE C 362      -0.893 111.514  76.242  1.00 52.46           C  
ATOM   9450  CG1 ILE C 362      -2.077 111.859  75.350  1.00 50.83           C  
ATOM   9451  CG2 ILE C 362       0.214 110.798  75.464  1.00 53.59           C  
ATOM   9452  CD1 ILE C 362      -1.688 112.275  73.974  1.00 54.45           C  
ATOM   9453  N   LEU C 363       0.479 110.803  78.966  1.00 51.01           N  
ATOM   9454  CA  LEU C 363       1.669 110.308  79.651  1.00 49.17           C  
ATOM   9455  C   LEU C 363       1.391 109.500  80.905  1.00 49.28           C  
ATOM   9456  O   LEU C 363       2.099 108.537  81.180  1.00 49.83           O  
ATOM   9457  CB  LEU C 363       2.592 111.453  80.042  1.00 47.24           C  
ATOM   9458  CG  LEU C 363       3.276 112.292  78.968  1.00 47.12           C  
ATOM   9459  CD1 LEU C 363       3.834 113.512  79.698  1.00 48.21           C  
ATOM   9460  CD2 LEU C 363       4.371 111.544  78.202  1.00 42.50           C  
ATOM   9461  N   LEU C 364       0.390 109.894  81.685  1.00 49.13           N  
ATOM   9462  CA  LEU C 364       0.096 109.173  82.924  1.00 48.57           C  
ATOM   9463  C   LEU C 364      -0.747 107.919  82.738  1.00 48.91           C  
ATOM   9464  O   LEU C 364      -0.513 106.895  83.386  1.00 48.30           O  
ATOM   9465  CB  LEU C 364      -0.605 110.088  83.934  1.00 45.48           C  
ATOM   9466  CG  LEU C 364       0.216 111.219  84.555  1.00 44.34           C  
ATOM   9467  CD1 LEU C 364      -0.676 112.008  85.495  1.00 43.35           C  
ATOM   9468  CD2 LEU C 364       1.409 110.669  85.312  1.00 41.93           C  
ATOM   9469  N   ILE C 365      -1.709 107.983  81.828  1.00 48.53           N  
ATOM   9470  CA  ILE C 365      -2.600 106.859  81.635  1.00 46.61           C  
ATOM   9471  C   ILE C 365      -2.493 106.079  80.347  1.00 48.12           C  
ATOM   9472  O   ILE C 365      -2.429 104.856  80.379  1.00 48.78           O  
ATOM   9473  CB  ILE C 365      -4.036 107.323  81.776  1.00 45.02           C  
ATOM   9474  CG1 ILE C 365      -4.290 107.678  83.237  1.00 43.58           C  
ATOM   9475  CG2 ILE C 365      -4.982 106.265  81.207  1.00 43.48           C  
ATOM   9476  CD1 ILE C 365      -5.410 108.649  83.435  1.00 45.19           C  
ATOM   9477  N   LEU C 366      -2.494 106.761  79.210  1.00 48.50           N  
ATOM   9478  CA  LEU C 366      -2.443 106.029  77.960  1.00 49.17           C  
ATOM   9479  C   LEU C 366      -1.151 105.299  77.702  1.00 49.44           C  
ATOM   9480  O   LEU C 366      -1.150 104.074  77.584  1.00 50.28           O  
ATOM   9481  CB  LEU C 366      -2.778 106.937  76.778  1.00 49.17           C  
ATOM   9482  CG  LEU C 366      -4.210 107.482  76.783  1.00 48.06           C  
ATOM   9483  CD1 LEU C 366      -4.602 107.836  75.356  1.00 45.44           C  
ATOM   9484  CD2 LEU C 366      -5.168 106.439  77.352  1.00 44.95           C  
ATOM   9485  N   PHE C 367      -0.046 106.022  77.630  1.00 49.51           N  
ATOM   9486  CA  PHE C 367       1.206 105.350  77.361  1.00 50.45           C  
ATOM   9487  C   PHE C 367       1.402 104.063  78.143  1.00 50.94           C  
ATOM   9488  O   PHE C 367       1.670 103.008  77.557  1.00 52.74           O  
ATOM   9489  CB  PHE C 367       2.386 106.298  77.561  1.00 49.94           C  
ATOM   9490  CG  PHE C 367       2.831 106.936  76.282  1.00 51.27           C  
ATOM   9491  CD1 PHE C 367       2.983 108.309  76.179  1.00 51.24           C  
ATOM   9492  CD2 PHE C 367       3.005 106.153  75.142  1.00 51.33           C  
ATOM   9493  CE1 PHE C 367       3.285 108.892  74.959  1.00 52.72           C  
ATOM   9494  CE2 PHE C 367       3.311 106.726  73.912  1.00 52.13           C  
ATOM   9495  CZ  PHE C 367       3.448 108.098  73.817  1.00 53.22           C  
ATOM   9496  N   PRO C 368       1.244 104.107  79.467  1.00 49.35           N  
ATOM   9497  CA  PRO C 368       1.444 102.843  80.181  1.00 49.12           C  
ATOM   9498  C   PRO C 368       0.397 101.780  79.818  1.00 48.90           C  
ATOM   9499  O   PRO C 368       0.681 100.582  79.754  1.00 47.90           O  
ATOM   9500  CB  PRO C 368       1.409 103.270  81.657  1.00 47.52           C  
ATOM   9501  CG  PRO C 368       0.566 104.492  81.648  1.00 47.26           C  
ATOM   9502  CD  PRO C 368       0.952 105.216  80.387  1.00 48.05           C  
ATOM   9503  N   THR C 369      -0.811 102.233  79.547  1.00 49.50           N  
ATOM   9504  CA  THR C 369      -1.880 101.322  79.217  1.00 51.35           C  
ATOM   9505  C   THR C 369      -1.709 100.690  77.850  1.00 53.06           C  
ATOM   9506  O   THR C 369      -1.758  99.470  77.722  1.00 54.67           O  
ATOM   9507  CB  THR C 369      -3.217 102.044  79.304  1.00 50.98           C  
ATOM   9508  OG1 THR C 369      -3.484 102.334  80.681  1.00 51.30           O  
ATOM   9509  CG2 THR C 369      -4.333 101.212  78.710  1.00 47.28           C  
ATOM   9510  N   ILE C 370      -1.519 101.504  76.823  1.00 53.12           N  
ATOM   9511  CA  ILE C 370      -1.342 100.949  75.497  1.00 55.04           C  
ATOM   9512  C   ILE C 370      -0.154  99.993  75.538  1.00 55.36           C  
ATOM   9513  O   ILE C 370      -0.179  98.923  74.918  1.00 55.80           O  
ATOM   9514  CB  ILE C 370      -1.065 102.055  74.466  1.00 57.35           C  
ATOM   9515  CG1 ILE C 370      -2.260 103.006  74.417  1.00 60.11           C  
ATOM   9516  CG2 ILE C 370      -0.798 101.453  73.072  1.00 57.44           C  
ATOM   9517  CD1 ILE C 370      -3.521 102.382  73.875  1.00 60.70           C  
ATOM   9518  N   GLY C 371       0.877 100.371  76.290  1.00 54.78           N  
ATOM   9519  CA  GLY C 371       2.070  99.545  76.381  1.00 54.97           C  
ATOM   9520  C   GLY C 371       1.804  98.122  76.832  1.00 55.56           C  
ATOM   9521  O   GLY C 371       2.352  97.159  76.282  1.00 55.63           O  
ATOM   9522  N   THR C 372       0.971  97.996  77.858  1.00 55.32           N  
ATOM   9523  CA  THR C 372       0.592  96.696  78.394  1.00 54.14           C  
ATOM   9524  C   THR C 372      -0.185  95.922  77.332  1.00 53.65           C  
ATOM   9525  O   THR C 372       0.118  94.765  77.024  1.00 52.59           O  
ATOM   9526  CB  THR C 372      -0.298  96.863  79.631  1.00 54.27           C  
ATOM   9527  OG1 THR C 372       0.509  97.177  80.775  1.00 54.81           O  
ATOM   9528  CG2 THR C 372      -1.085  95.603  79.884  1.00 55.89           C  
ATOM   9529  N   LEU C 373      -1.202  96.578  76.787  1.00 53.69           N  
ATOM   9530  CA  LEU C 373      -2.038  95.989  75.755  1.00 53.19           C  
ATOM   9531  C   LEU C 373      -1.152  95.497  74.616  1.00 53.18           C  
ATOM   9532  O   LEU C 373      -1.319  94.388  74.119  1.00 53.99           O  
ATOM   9533  CB  LEU C 373      -3.029  97.030  75.244  1.00 52.46           C  
ATOM   9534  CG  LEU C 373      -3.682  96.691  73.914  1.00 52.40           C  
ATOM   9535  CD1 LEU C 373      -4.670  95.581  74.130  1.00 52.87           C  
ATOM   9536  CD2 LEU C 373      -4.357  97.917  73.336  1.00 52.65           C  
ATOM   9537  N   GLU C 374      -0.208  96.321  74.196  1.00 52.34           N  
ATOM   9538  CA  GLU C 374       0.683  95.905  73.134  1.00 54.03           C  
ATOM   9539  C   GLU C 374       1.429  94.626  73.536  1.00 55.28           C  
ATOM   9540  O   GLU C 374       1.615  93.722  72.722  1.00 55.82           O  
ATOM   9541  CB  GLU C 374       1.675  97.021  72.827  1.00 54.84           C  
ATOM   9542  CG  GLU C 374       1.311  97.839  71.610  1.00 57.72           C  
ATOM   9543  CD  GLU C 374       2.136  99.104  71.494  1.00 60.41           C  
ATOM   9544  OE1 GLU C 374       2.223  99.640  70.349  1.00 59.46           O  
ATOM   9545  OE2 GLU C 374       2.681  99.548  72.549  1.00 60.78           O  
ATOM   9546  N   ASN C 375       1.853  94.541  74.794  1.00 55.93           N  
ATOM   9547  CA  ASN C 375       2.576  93.362  75.239  1.00 56.28           C  
ATOM   9548  C   ASN C 375       1.747  92.127  75.022  1.00 59.22           C  
ATOM   9549  O   ASN C 375       2.287  91.082  74.663  1.00 61.67           O  
ATOM   9550  CB  ASN C 375       2.934  93.440  76.718  1.00 54.52           C  
ATOM   9551  CG  ASN C 375       4.176  94.242  76.978  1.00 51.42           C  
ATOM   9552  OD1 ASN C 375       5.048  94.350  76.124  1.00 54.09           O  
ATOM   9553  ND2 ASN C 375       4.276  94.792  78.170  1.00 48.57           N  
ATOM   9554  N   LYS C 376       0.439  92.237  75.249  1.00 60.78           N  
ATOM   9555  CA  LYS C 376      -0.429  91.087  75.073  1.00 61.52           C  
ATOM   9556  C   LYS C 376      -0.539  90.710  73.621  1.00 61.20           C  
ATOM   9557  O   LYS C 376      -0.597  89.533  73.303  1.00 63.42           O  
ATOM   9558  CB  LYS C 376      -1.809  91.346  75.657  1.00 63.67           C  
ATOM   9559  CG  LYS C 376      -1.792  91.526  77.169  1.00 68.52           C  
ATOM   9560  CD  LYS C 376      -3.173  91.932  77.689  1.00 74.50           C  
ATOM   9561  CE  LYS C 376      -3.132  92.448  79.144  1.00 77.71           C  
ATOM   9562  NZ  LYS C 376      -2.709  91.418  80.154  1.00 79.68           N  
ATOM   9563  N   MET C 377      -0.531  91.681  72.724  1.00 60.56           N  
ATOM   9564  CA  MET C 377      -0.633  91.338  71.317  1.00 63.17           C  
ATOM   9565  C   MET C 377       0.584  90.641  70.710  1.00 65.35           C  
ATOM   9566  O   MET C 377       0.559  90.205  69.554  1.00 65.67           O  
ATOM   9567  CB  MET C 377      -1.004  92.565  70.518  1.00 62.94           C  
ATOM   9568  CG  MET C 377      -2.463  92.849  70.618  1.00 64.12           C  
ATOM   9569  SD  MET C 377      -2.743  94.575  70.419  1.00 72.10           S  
ATOM   9570  CE  MET C 377      -2.201  94.827  68.737  1.00 69.31           C  
ATOM   9571  N   LEU C 378       1.651  90.523  71.487  1.00 67.75           N  
ATOM   9572  CA  LEU C 378       2.846  89.829  71.018  1.00 70.46           C  
ATOM   9573  C   LEU C 378       2.805  88.468  71.675  1.00 72.71           C  
ATOM   9574  O   LEU C 378       3.698  87.650  71.485  1.00 72.56           O  
ATOM   9575  CB  LEU C 378       4.106  90.562  71.456  1.00 69.26           C  
ATOM   9576  CG  LEU C 378       4.480  91.794  70.652  1.00 68.83           C  
ATOM   9577  CD1 LEU C 378       5.457  92.656  71.445  1.00 69.81           C  
ATOM   9578  CD2 LEU C 378       5.076  91.353  69.332  1.00 68.41           C  
ATOM   9579  N   ASN C 379       1.749  88.256  72.454  1.00 75.69           N  
ATOM   9580  CA  ASN C 379       1.522  87.023  73.183  1.00 81.15           C  
ATOM   9581  C   ASN C 379       2.537  86.916  74.324  1.00 83.96           C  
ATOM   9582  O   ASN C 379       3.184  85.882  74.529  1.00 85.18           O  
ATOM   9583  CB  ASN C 379       1.609  85.827  72.230  1.00 83.45           C  
ATOM   9584  CG  ASN C 379       1.084  84.542  72.848  1.00 87.02           C  
ATOM   9585  OD1 ASN C 379      -0.059  84.476  73.327  1.00 87.56           O  
ATOM   9586  ND2 ASN C 379       1.921  83.505  72.839  1.00 89.83           N  
ATOM   9587  N   TYR C 380       2.654  88.015  75.067  1.00 86.30           N  
ATOM   9588  CA  TYR C 380       3.561  88.136  76.211  1.00 88.51           C  
ATOM   9589  C   TYR C 380       2.773  88.545  77.453  1.00 90.66           C  
ATOM   9590  O   TYR C 380       1.535  88.724  77.339  1.00 91.07           O  
ATOM   9591  CB  TYR C 380       4.622  89.209  75.942  1.00 86.84           C  
ATOM   9592  CG  TYR C 380       5.867  88.722  75.265  1.00 84.46           C  
ATOM   9593  CD1 TYR C 380       6.477  89.483  74.268  1.00 83.56           C  
ATOM   9594  CD2 TYR C 380       6.462  87.522  75.646  1.00 84.33           C  
ATOM   9595  CE1 TYR C 380       7.646  89.064  73.665  1.00 83.92           C  
ATOM   9596  CE2 TYR C 380       7.637  87.089  75.050  1.00 85.30           C  
ATOM   9597  CZ  TYR C 380       8.225  87.868  74.057  1.00 85.36           C  
ATOM   9598  OH  TYR C 380       9.396  87.460  73.459  1.00 86.96           O  
ATOM   9599  OXT TYR C 380       3.419  88.703  78.520  1.00 93.85           O  
TER    9600      TYR C 380                                                      
ATOM   9601  N   GLY D   1     -14.826 145.936  69.313  1.00104.91           N  
ATOM   9602  CA  GLY D   1     -13.940 146.482  70.386  1.00105.71           C  
ATOM   9603  C   GLY D   1     -12.504 146.015  70.222  1.00105.46           C  
ATOM   9604  O   GLY D   1     -11.554 146.778  70.454  1.00105.83           O  
ATOM   9605  N   GLU D   2     -12.363 144.747  69.832  1.00104.68           N  
ATOM   9606  CA  GLU D   2     -11.067 144.098  69.597  1.00102.49           C  
ATOM   9607  C   GLU D   2     -10.777 144.158  68.100  1.00100.20           C  
ATOM   9608  O   GLU D   2      -9.925 143.418  67.601  1.00 99.88           O  
ATOM   9609  CB  GLU D   2     -11.114 142.622  69.999  1.00103.67           C  
ATOM   9610  CG  GLU D   2     -11.543 142.332  71.421  1.00105.49           C  
ATOM   9611  CD  GLU D   2     -12.070 140.915  71.557  1.00106.93           C  
ATOM   9612  OE1 GLU D   2     -11.425 139.987  71.017  1.00107.10           O  
ATOM   9613  OE2 GLU D   2     -13.128 140.729  72.201  1.00107.73           O  
ATOM   9614  N   LEU D   3     -11.510 145.018  67.393  1.00 96.79           N  
ATOM   9615  CA  LEU D   3     -11.348 145.180  65.953  1.00 92.97           C  
ATOM   9616  C   LEU D   3     -10.159 146.064  65.610  1.00 90.32           C  
ATOM   9617  O   LEU D   3      -9.959 147.116  66.223  1.00 90.11           O  
ATOM   9618  CB  LEU D   3     -12.612 145.791  65.348  1.00 93.18           C  
ATOM   9619  CG  LEU D   3     -13.812 144.875  65.125  1.00 93.06           C  
ATOM   9620  CD1 LEU D   3     -14.940 145.659  64.485  1.00 93.11           C  
ATOM   9621  CD2 LEU D   3     -13.407 143.727  64.215  1.00 94.28           C  
ATOM   9622  N   GLU D   4      -9.364 145.636  64.637  1.00 86.72           N  
ATOM   9623  CA  GLU D   4      -8.222 146.429  64.224  1.00 84.79           C  
ATOM   9624  C   GLU D   4      -7.854 146.154  62.779  1.00 81.00           C  
ATOM   9625  O   GLU D   4      -7.944 145.033  62.305  1.00 80.77           O  
ATOM   9626  CB  GLU D   4      -7.021 146.184  65.151  1.00 87.76           C  
ATOM   9627  CG  GLU D   4      -6.653 144.718  65.364  1.00 93.00           C  
ATOM   9628  CD  GLU D   4      -5.550 144.519  66.420  1.00 96.74           C  
ATOM   9629  OE1 GLU D   4      -5.358 143.351  66.851  1.00 97.93           O  
ATOM   9630  OE2 GLU D   4      -4.882 145.516  66.812  1.00 97.25           O  
ATOM   9631  N   LEU D   5      -7.463 147.206  62.076  1.00 76.85           N  
ATOM   9632  CA  LEU D   5      -7.075 147.104  60.681  1.00 71.88           C  
ATOM   9633  C   LEU D   5      -5.551 146.906  60.586  1.00 70.07           C  
ATOM   9634  O   LEU D   5      -4.762 147.659  61.177  1.00 69.60           O  
ATOM   9635  CB  LEU D   5      -7.504 148.378  59.945  1.00 68.44           C  
ATOM   9636  CG  LEU D   5      -7.306 148.383  58.439  1.00 65.44           C  
ATOM   9637  CD1 LEU D   5      -8.295 147.443  57.827  1.00 64.81           C  
ATOM   9638  CD2 LEU D   5      -7.478 149.777  57.887  1.00 65.91           C  
ATOM   9639  N   HIS D   6      -5.139 145.887  59.844  1.00 67.98           N  
ATOM   9640  CA  HIS D   6      -3.718 145.598  59.690  1.00 66.11           C  
ATOM   9641  C   HIS D   6      -3.154 146.193  58.410  1.00 62.50           C  
ATOM   9642  O   HIS D   6      -3.734 146.069  57.336  1.00 63.30           O  
ATOM   9643  CB  HIS D   6      -3.495 144.080  59.741  1.00 69.26           C  
ATOM   9644  CG  HIS D   6      -3.913 143.455  61.042  1.00 70.87           C  
ATOM   9645  ND1 HIS D   6      -4.440 142.184  61.124  1.00 72.24           N  
ATOM   9646  CD2 HIS D   6      -3.915 143.946  62.306  1.00 71.13           C  
ATOM   9647  CE1 HIS D   6      -4.757 141.921  62.380  1.00 72.51           C  
ATOM   9648  NE2 HIS D   6      -4.449 142.974  63.117  1.00 72.37           N  
ATOM   9649  N   PRO D   7      -1.998 146.846  58.506  1.00 60.17           N  
ATOM   9650  CA  PRO D   7      -1.425 147.446  57.303  1.00 59.16           C  
ATOM   9651  C   PRO D   7      -1.105 146.447  56.223  1.00 58.22           C  
ATOM   9652  O   PRO D   7      -1.039 145.257  56.465  1.00 58.24           O  
ATOM   9653  CB  PRO D   7      -0.174 148.150  57.825  1.00 58.42           C  
ATOM   9654  CG  PRO D   7       0.241 147.284  58.964  1.00 58.35           C  
ATOM   9655  CD  PRO D   7      -1.067 146.943  59.644  1.00 59.41           C  
ATOM   9656  N   PRO D   8      -0.939 146.929  54.995  1.00 58.39           N  
ATOM   9657  CA  PRO D   8      -0.615 146.106  53.835  1.00 58.02           C  
ATOM   9658  C   PRO D   8       0.897 146.036  53.774  1.00 57.25           C  
ATOM   9659  O   PRO D   8       1.572 146.670  54.571  1.00 58.86           O  
ATOM   9660  CB  PRO D   8      -1.192 146.910  52.690  1.00 58.98           C  
ATOM   9661  CG  PRO D   8      -0.885 148.298  53.119  1.00 58.93           C  
ATOM   9662  CD  PRO D   8      -1.314 148.287  54.569  1.00 59.41           C  
ATOM   9663  N   ALA D   9       1.442 145.296  52.826  1.00 55.35           N  
ATOM   9664  CA  ALA D   9       2.881 145.181  52.756  1.00 53.53           C  
ATOM   9665  C   ALA D   9       3.446 145.912  51.573  1.00 53.52           C  
ATOM   9666  O   ALA D   9       3.365 145.438  50.442  1.00 55.38           O  
ATOM   9667  CB  ALA D   9       3.271 143.735  52.690  1.00 51.91           C  
ATOM   9668  N   PHE D  10       4.031 147.074  51.810  1.00 52.69           N  
ATOM   9669  CA  PHE D  10       4.609 147.800  50.691  1.00 51.45           C  
ATOM   9670  C   PHE D  10       5.935 147.162  50.341  1.00 50.28           C  
ATOM   9671  O   PHE D  10       6.615 146.625  51.198  1.00 51.32           O  
ATOM   9672  CB  PHE D  10       4.772 149.266  51.041  1.00 49.90           C  
ATOM   9673  CG  PHE D  10       3.496 149.912  51.437  1.00 49.74           C  
ATOM   9674  CD1 PHE D  10       2.900 149.601  52.658  1.00 51.71           C  
ATOM   9675  CD2 PHE D  10       2.871 150.818  50.593  1.00 49.34           C  
ATOM   9676  CE1 PHE D  10       1.691 150.191  53.042  1.00 52.33           C  
ATOM   9677  CE2 PHE D  10       1.665 151.412  50.963  1.00 51.00           C  
ATOM   9678  CZ  PHE D  10       1.073 151.100  52.191  1.00 51.52           C  
ATOM   9679  N   PRO D  11       6.302 147.189  49.067  1.00 49.61           N  
ATOM   9680  CA  PRO D  11       7.549 146.607  48.587  1.00 49.99           C  
ATOM   9681  C   PRO D  11       8.726 147.540  48.723  1.00 49.63           C  
ATOM   9682  O   PRO D  11       9.149 148.118  47.736  1.00 51.02           O  
ATOM   9683  CB  PRO D  11       7.238 146.333  47.128  1.00 50.35           C  
ATOM   9684  CG  PRO D  11       6.447 147.549  46.776  1.00 50.48           C  
ATOM   9685  CD  PRO D  11       5.480 147.651  47.939  1.00 50.68           C  
ATOM   9686  N   TRP D  12       9.268 147.685  49.925  1.00 49.63           N  
ATOM   9687  CA  TRP D  12      10.408 148.579  50.128  1.00 49.89           C  
ATOM   9688  C   TRP D  12      11.639 148.118  49.358  1.00 51.58           C  
ATOM   9689  O   TRP D  12      11.825 146.928  49.106  1.00 52.16           O  
ATOM   9690  CB  TRP D  12      10.750 148.699  51.617  1.00 46.24           C  
ATOM   9691  CG  TRP D  12       9.564 148.962  52.468  1.00 44.18           C  
ATOM   9692  CD1 TRP D  12       8.685 148.046  52.920  1.00 43.86           C  
ATOM   9693  CD2 TRP D  12       9.085 150.234  52.915  1.00 44.73           C  
ATOM   9694  NE1 TRP D  12       7.681 148.650  53.622  1.00 45.16           N  
ATOM   9695  CE2 TRP D  12       7.896 149.998  53.636  1.00 45.79           C  
ATOM   9696  CE3 TRP D  12       9.540 151.549  52.773  1.00 44.81           C  
ATOM   9697  CZ2 TRP D  12       7.145 151.026  54.219  1.00 48.19           C  
ATOM   9698  CZ3 TRP D  12       8.799 152.578  53.347  1.00 48.43           C  
ATOM   9699  CH2 TRP D  12       7.607 152.309  54.064  1.00 50.39           C  
ATOM   9700  N   SER D  13      12.476 149.075  48.977  1.00 53.84           N  
ATOM   9701  CA  SER D  13      13.701 148.768  48.242  1.00 56.54           C  
ATOM   9702  C   SER D  13      14.694 148.009  49.119  1.00 57.80           C  
ATOM   9703  O   SER D  13      15.705 147.517  48.617  1.00 60.18           O  
ATOM   9704  CB  SER D  13      14.385 150.050  47.756  1.00 57.62           C  
ATOM   9705  OG  SER D  13      14.854 150.841  48.850  1.00 62.28           O  
ATOM   9706  N   HIS D  14      14.419 147.930  50.423  1.00 56.74           N  
ATOM   9707  CA  HIS D  14      15.306 147.249  51.351  1.00 55.20           C  
ATOM   9708  C   HIS D  14      14.642 146.037  51.969  1.00 57.02           C  
ATOM   9709  O   HIS D  14      15.050 145.576  53.030  1.00 59.00           O  
ATOM   9710  CB  HIS D  14      15.731 148.197  52.453  1.00 52.81           C  
ATOM   9711  CG  HIS D  14      14.583 148.777  53.213  1.00 52.62           C  
ATOM   9712  ND1 HIS D  14      14.034 150.002  52.908  1.00 52.41           N  
ATOM   9713  CD2 HIS D  14      13.853 148.285  54.243  1.00 52.50           C  
ATOM   9714  CE1 HIS D  14      13.015 150.239  53.716  1.00 51.42           C  
ATOM   9715  NE2 HIS D  14      12.884 149.213  54.536  1.00 50.68           N  
ATOM   9716  N   GLY D  15      13.620 145.515  51.299  1.00 58.49           N  
ATOM   9717  CA  GLY D  15      12.928 144.345  51.808  1.00 59.16           C  
ATOM   9718  C   GLY D  15      13.619 143.029  51.492  1.00 59.10           C  
ATOM   9719  O   GLY D  15      13.648 142.116  52.316  1.00 59.30           O  
ATOM   9720  N   GLY D  16      14.174 142.916  50.293  1.00 59.33           N  
ATOM   9721  CA  GLY D  16      14.849 141.683  49.926  1.00 60.48           C  
ATOM   9722  C   GLY D  16      15.939 141.312  50.908  1.00 61.10           C  
ATOM   9723  O   GLY D  16      16.576 142.195  51.485  1.00 63.10           O  
ATOM   9724  N   PRO D  17      16.189 140.017  51.121  1.00 60.93           N  
ATOM   9725  CA  PRO D  17      17.232 139.613  52.061  1.00 61.64           C  
ATOM   9726  C   PRO D  17      18.601 140.110  51.603  1.00 61.53           C  
ATOM   9727  O   PRO D  17      19.496 140.353  52.418  1.00 61.16           O  
ATOM   9728  CB  PRO D  17      17.123 138.090  52.054  1.00 60.82           C  
ATOM   9729  CG  PRO D  17      16.802 137.817  50.648  1.00 61.62           C  
ATOM   9730  CD  PRO D  17      15.723 138.856  50.350  1.00 62.26           C  
ATOM   9731  N   LEU D  18      18.767 140.269  50.299  1.00 60.54           N  
ATOM   9732  CA  LEU D  18      20.037 140.751  49.808  1.00 61.48           C  
ATOM   9733  C   LEU D  18      20.015 142.228  49.424  1.00 62.01           C  
ATOM   9734  O   LEU D  18      21.045 142.788  49.037  1.00 62.53           O  
ATOM   9735  CB  LEU D  18      20.477 139.916  48.616  1.00 61.83           C  
ATOM   9736  CG  LEU D  18      20.871 138.486  48.974  1.00 63.00           C  
ATOM   9737  CD1 LEU D  18      21.415 137.795  47.726  1.00 61.95           C  
ATOM   9738  CD2 LEU D  18      21.926 138.498  50.082  1.00 62.00           C  
ATOM   9739  N   SER D  19      18.853 142.862  49.555  1.00 61.32           N  
ATOM   9740  CA  SER D  19      18.705 144.263  49.174  1.00 60.57           C  
ATOM   9741  C   SER D  19      18.938 145.252  50.294  1.00 59.66           C  
ATOM   9742  O   SER D  19      18.246 145.225  51.319  1.00 59.78           O  
ATOM   9743  CB  SER D  19      17.317 144.504  48.600  1.00 61.25           C  
ATOM   9744  OG  SER D  19      16.354 144.333  49.619  1.00 63.49           O  
ATOM   9745  N   ALA D  20      19.892 146.151  50.055  1.00 58.32           N  
ATOM   9746  CA  ALA D  20      20.273 147.186  51.007  1.00 57.62           C  
ATOM   9747  C   ALA D  20      19.262 148.329  51.053  1.00 57.26           C  
ATOM   9748  O   ALA D  20      18.217 148.282  50.412  1.00 58.27           O  
ATOM   9749  CB  ALA D  20      21.645 147.730  50.641  1.00 56.16           C  
ATOM   9750  N   LEU D  21      19.585 149.355  51.828  1.00 55.49           N  
ATOM   9751  CA  LEU D  21      18.738 150.522  51.953  1.00 54.01           C  
ATOM   9752  C   LEU D  21      19.075 151.498  50.814  1.00 56.60           C  
ATOM   9753  O   LEU D  21      20.213 151.533  50.338  1.00 58.12           O  
ATOM   9754  CB  LEU D  21      19.006 151.211  53.295  1.00 50.30           C  
ATOM   9755  CG  LEU D  21      18.433 150.732  54.634  1.00 48.28           C  
ATOM   9756  CD1 LEU D  21      19.002 151.593  55.735  1.00 48.76           C  
ATOM   9757  CD2 LEU D  21      16.926 150.854  54.673  1.00 46.93           C  
ATOM   9758  N   ASP D  22      18.095 152.281  50.360  1.00 57.82           N  
ATOM   9759  CA  ASP D  22      18.357 153.282  49.327  1.00 57.28           C  
ATOM   9760  C   ASP D  22      18.817 154.509  50.111  1.00 56.27           C  
ATOM   9761  O   ASP D  22      18.009 155.232  50.697  1.00 55.64           O  
ATOM   9762  CB  ASP D  22      17.084 153.567  48.532  1.00 60.67           C  
ATOM   9763  CG  ASP D  22      17.196 154.804  47.641  1.00 64.46           C  
ATOM   9764  OD1 ASP D  22      18.302 155.148  47.143  1.00 64.51           O  
ATOM   9765  OD2 ASP D  22      16.137 155.431  47.425  1.00 69.81           O  
ATOM   9766  N   HIS D  23      20.127 154.729  50.130  1.00 55.25           N  
ATOM   9767  CA  HIS D  23      20.693 155.824  50.897  1.00 54.56           C  
ATOM   9768  C   HIS D  23      20.257 157.219  50.534  1.00 53.50           C  
ATOM   9769  O   HIS D  23      20.351 158.136  51.349  1.00 51.38           O  
ATOM   9770  CB  HIS D  23      22.208 155.694  50.917  1.00 56.28           C  
ATOM   9771  CG  HIS D  23      22.680 154.546  51.757  1.00 59.16           C  
ATOM   9772  ND1 HIS D  23      23.918 154.516  52.363  1.00 61.77           N  
ATOM   9773  CD2 HIS D  23      22.067 153.388  52.104  1.00 58.93           C  
ATOM   9774  CE1 HIS D  23      24.047 153.392  53.046  1.00 61.07           C  
ATOM   9775  NE2 HIS D  23      22.936 152.690  52.905  1.00 58.55           N  
ATOM   9776  N   SER D  24      19.758 157.380  49.321  1.00 54.64           N  
ATOM   9777  CA  SER D  24      19.258 158.677  48.893  1.00 57.52           C  
ATOM   9778  C   SER D  24      17.910 158.910  49.586  1.00 58.97           C  
ATOM   9779  O   SER D  24      17.615 160.026  50.057  1.00 59.65           O  
ATOM   9780  CB  SER D  24      19.076 158.704  47.377  1.00 57.91           C  
ATOM   9781  OG  SER D  24      20.332 158.618  46.731  1.00 60.57           O  
ATOM   9782  N   SER D  25      17.100 157.850  49.656  1.00 57.72           N  
ATOM   9783  CA  SER D  25      15.806 157.943  50.293  1.00 56.86           C  
ATOM   9784  C   SER D  25      15.967 158.122  51.784  1.00 57.04           C  
ATOM   9785  O   SER D  25      15.087 158.686  52.436  1.00 60.07           O  
ATOM   9786  CB  SER D  25      14.971 156.701  50.034  1.00 57.36           C  
ATOM   9787  OG  SER D  25      13.734 156.780  50.739  1.00 60.07           O  
ATOM   9788  N   VAL D  26      17.071 157.635  52.339  1.00 55.08           N  
ATOM   9789  CA  VAL D  26      17.293 157.790  53.772  1.00 53.84           C  
ATOM   9790  C   VAL D  26      17.672 159.227  54.070  1.00 54.04           C  
ATOM   9791  O   VAL D  26      17.244 159.795  55.078  1.00 53.52           O  
ATOM   9792  CB  VAL D  26      18.413 156.869  54.293  1.00 53.85           C  
ATOM   9793  CG1 VAL D  26      18.800 157.269  55.721  1.00 50.44           C  
ATOM   9794  CG2 VAL D  26      17.945 155.407  54.262  1.00 52.07           C  
ATOM   9795  N   ARG D  27      18.473 159.809  53.182  1.00 53.82           N  
ATOM   9796  CA  ARG D  27      18.906 161.187  53.343  1.00 54.27           C  
ATOM   9797  C   ARG D  27      17.699 162.112  53.393  1.00 52.45           C  
ATOM   9798  O   ARG D  27      17.632 163.015  54.246  1.00 53.22           O  
ATOM   9799  CB  ARG D  27      19.817 161.590  52.192  1.00 56.93           C  
ATOM   9800  CG  ARG D  27      20.403 162.998  52.283  1.00 59.92           C  
ATOM   9801  CD  ARG D  27      21.148 163.281  50.987  1.00 64.61           C  
ATOM   9802  NE  ARG D  27      21.678 164.637  50.864  1.00 69.08           N  
ATOM   9803  CZ  ARG D  27      22.750 165.081  51.506  1.00 70.78           C  
ATOM   9804  NH1 ARG D  27      23.415 164.277  52.328  1.00 73.35           N  
ATOM   9805  NH2 ARG D  27      23.169 166.322  51.310  1.00 71.15           N  
ATOM   9806  N   ARG D  28      16.749 161.901  52.482  1.00 48.67           N  
ATOM   9807  CA  ARG D  28      15.556 162.734  52.485  1.00 46.42           C  
ATOM   9808  C   ARG D  28      14.846 162.502  53.801  1.00 46.14           C  
ATOM   9809  O   ARG D  28      14.516 163.450  54.511  1.00 46.48           O  
ATOM   9810  CB  ARG D  28      14.632 162.396  51.320  1.00 45.49           C  
ATOM   9811  CG  ARG D  28      15.151 162.872  49.965  1.00 46.17           C  
ATOM   9812  CD  ARG D  28      14.079 162.816  48.897  1.00 45.39           C  
ATOM   9813  NE  ARG D  28      13.684 161.447  48.621  1.00 46.54           N  
ATOM   9814  CZ  ARG D  28      14.339 160.648  47.796  1.00 47.77           C  
ATOM   9815  NH1 ARG D  28      15.411 161.101  47.161  1.00 49.02           N  
ATOM   9816  NH2 ARG D  28      13.941 159.393  47.629  1.00 48.89           N  
ATOM   9817  N   GLY D  29      14.636 161.232  54.139  1.00 46.24           N  
ATOM   9818  CA  GLY D  29      13.979 160.895  55.393  1.00 46.32           C  
ATOM   9819  C   GLY D  29      14.534 161.670  56.583  1.00 45.91           C  
ATOM   9820  O   GLY D  29      13.801 162.075  57.492  1.00 44.43           O  
ATOM   9821  N   PHE D  30      15.842 161.880  56.567  1.00 45.64           N  
ATOM   9822  CA  PHE D  30      16.502 162.593  57.640  1.00 46.04           C  
ATOM   9823  C   PHE D  30      15.961 164.006  57.704  1.00 47.13           C  
ATOM   9824  O   PHE D  30      15.670 164.543  58.784  1.00 45.49           O  
ATOM   9825  CB  PHE D  30      18.026 162.640  57.411  1.00 44.08           C  
ATOM   9826  CG  PHE D  30      18.742 163.616  58.318  1.00 40.30           C  
ATOM   9827  CD1 PHE D  30      18.812 163.402  59.689  1.00 39.54           C  
ATOM   9828  CD2 PHE D  30      19.225 164.813  57.814  1.00 40.07           C  
ATOM   9829  CE1 PHE D  30      19.344 164.377  60.538  1.00 39.34           C  
ATOM   9830  CE2 PHE D  30      19.755 165.790  58.655  1.00 39.32           C  
ATOM   9831  CZ  PHE D  30      19.810 165.572  60.017  1.00 38.66           C  
ATOM   9832  N   GLN D  31      15.842 164.616  56.533  1.00 49.61           N  
ATOM   9833  CA  GLN D  31      15.356 165.982  56.461  1.00 53.44           C  
ATOM   9834  C   GLN D  31      13.963 166.032  57.026  1.00 54.18           C  
ATOM   9835  O   GLN D  31      13.676 166.842  57.916  1.00 56.01           O  
ATOM   9836  CB  GLN D  31      15.394 166.484  55.025  1.00 55.88           C  
ATOM   9837  CG  GLN D  31      16.828 166.570  54.523  1.00 64.38           C  
ATOM   9838  CD  GLN D  31      16.942 167.038  53.091  1.00 68.26           C  
ATOM   9839  OE1 GLN D  31      16.183 167.934  52.653  1.00 68.86           O  
ATOM   9840  NE2 GLN D  31      17.909 166.453  52.347  1.00 67.40           N  
ATOM   9841  N   VAL D  32      13.097 165.158  56.532  1.00 53.08           N  
ATOM   9842  CA  VAL D  32      11.756 165.123  57.055  1.00 52.25           C  
ATOM   9843  C   VAL D  32      11.846 165.111  58.580  1.00 53.75           C  
ATOM   9844  O   VAL D  32      11.310 165.995  59.238  1.00 54.95           O  
ATOM   9845  CB  VAL D  32      11.012 163.874  56.629  1.00 51.57           C  
ATOM   9846  CG1 VAL D  32       9.627 163.876  57.279  1.00 51.31           C  
ATOM   9847  CG2 VAL D  32      10.921 163.810  55.126  1.00 48.66           C  
ATOM   9848  N   TYR D  33      12.538 164.123  59.144  1.00 54.41           N  
ATOM   9849  CA  TYR D  33      12.651 164.048  60.598  1.00 54.63           C  
ATOM   9850  C   TYR D  33      13.119 165.353  61.190  1.00 55.37           C  
ATOM   9851  O   TYR D  33      12.452 165.923  62.056  1.00 55.74           O  
ATOM   9852  CB  TYR D  33      13.633 162.965  61.058  1.00 54.53           C  
ATOM   9853  CG  TYR D  33      13.903 163.051  62.556  1.00 54.46           C  
ATOM   9854  CD1 TYR D  33      12.866 162.877  63.478  1.00 54.99           C  
ATOM   9855  CD2 TYR D  33      15.165 163.389  63.046  1.00 53.41           C  
ATOM   9856  CE1 TYR D  33      13.070 163.044  64.844  1.00 54.97           C  
ATOM   9857  CE2 TYR D  33      15.381 163.558  64.419  1.00 54.26           C  
ATOM   9858  CZ  TYR D  33      14.324 163.387  65.306  1.00 56.24           C  
ATOM   9859  OH  TYR D  33      14.508 163.577  66.658  1.00 59.40           O  
ATOM   9860  N   LYS D  34      14.285 165.801  60.730  1.00 55.87           N  
ATOM   9861  CA  LYS D  34      14.890 167.028  61.218  1.00 55.59           C  
ATOM   9862  C   LYS D  34      13.992 168.250  61.094  1.00 55.95           C  
ATOM   9863  O   LYS D  34      13.913 169.063  62.013  1.00 56.54           O  
ATOM   9864  CB  LYS D  34      16.181 167.307  60.472  1.00 56.43           C  
ATOM   9865  CG  LYS D  34      16.773 168.640  60.845  1.00 58.26           C  
ATOM   9866  CD  LYS D  34      17.599 169.212  59.714  1.00 62.53           C  
ATOM   9867  CE  LYS D  34      18.184 170.555  60.114  1.00 64.91           C  
ATOM   9868  NZ  LYS D  34      18.892 170.404  61.424  1.00 67.43           N  
ATOM   9869  N   GLN D  35      13.320 168.396  59.958  1.00 54.51           N  
ATOM   9870  CA  GLN D  35      12.472 169.552  59.759  1.00 53.63           C  
ATOM   9871  C   GLN D  35      11.032 169.431  60.235  1.00 53.39           C  
ATOM   9872  O   GLN D  35      10.358 170.449  60.401  1.00 55.71           O  
ATOM   9873  CB  GLN D  35      12.499 169.949  58.294  1.00 52.21           C  
ATOM   9874  CG  GLN D  35      13.711 170.743  57.912  1.00 53.56           C  
ATOM   9875  CD  GLN D  35      13.861 170.858  56.409  1.00 58.56           C  
ATOM   9876  OE1 GLN D  35      14.624 171.685  55.909  1.00 62.24           O  
ATOM   9877  NE2 GLN D  35      13.137 170.017  55.673  1.00 59.13           N  
ATOM   9878  N   VAL D  36      10.559 168.212  60.482  1.00 51.78           N  
ATOM   9879  CA  VAL D  36       9.174 168.022  60.913  1.00 50.57           C  
ATOM   9880  C   VAL D  36       8.936 167.250  62.217  1.00 51.16           C  
ATOM   9881  O   VAL D  36       8.345 167.778  63.158  1.00 51.61           O  
ATOM   9882  CB  VAL D  36       8.355 167.321  59.813  1.00 48.39           C  
ATOM   9883  CG1 VAL D  36       6.875 167.389  60.122  1.00 47.46           C  
ATOM   9884  CG2 VAL D  36       8.641 167.955  58.510  1.00 47.39           C  
ATOM   9885  N   CYS D  37       9.383 166.002  62.268  1.00 50.50           N  
ATOM   9886  CA  CYS D  37       9.143 165.179  63.438  1.00 51.62           C  
ATOM   9887  C   CYS D  37       9.982 165.607  64.622  1.00 52.98           C  
ATOM   9888  O   CYS D  37       9.525 165.611  65.775  1.00 54.41           O  
ATOM   9889  CB  CYS D  37       9.438 163.712  63.119  1.00 49.47           C  
ATOM   9890  SG  CYS D  37       9.031 163.264  61.405  1.00 53.99           S  
ATOM   9891  N   SER D  38      11.221 165.973  64.341  1.00 52.78           N  
ATOM   9892  CA  SER D  38      12.139 166.349  65.401  1.00 51.94           C  
ATOM   9893  C   SER D  38      11.633 167.520  66.235  1.00 52.58           C  
ATOM   9894  O   SER D  38      12.371 168.086  67.042  1.00 53.58           O  
ATOM   9895  CB  SER D  38      13.493 166.688  64.795  1.00 50.95           C  
ATOM   9896  OG  SER D  38      13.422 167.880  64.051  1.00 51.10           O  
ATOM   9897  N   ALA D  39      10.371 167.886  66.049  1.00 52.10           N  
ATOM   9898  CA  ALA D  39       9.818 169.005  66.787  1.00 50.27           C  
ATOM   9899  C   ALA D  39       9.064 168.513  67.982  1.00 50.02           C  
ATOM   9900  O   ALA D  39       8.826 169.271  68.909  1.00 48.92           O  
ATOM   9901  CB  ALA D  39       8.909 169.801  65.909  1.00 50.00           C  
ATOM   9902  N   CYS D  40       8.677 167.244  67.956  1.00 51.00           N  
ATOM   9903  CA  CYS D  40       7.940 166.652  69.071  1.00 52.61           C  
ATOM   9904  C   CYS D  40       8.557 165.306  69.385  1.00 53.29           C  
ATOM   9905  O   CYS D  40       8.396 164.769  70.486  1.00 53.33           O  
ATOM   9906  CB  CYS D  40       6.470 166.425  68.709  1.00 52.58           C  
ATOM   9907  SG  CYS D  40       5.572 167.846  68.017  1.00 52.72           S  
ATOM   9908  N   HIS D  41       9.269 164.769  68.400  1.00 53.28           N  
ATOM   9909  CA  HIS D  41       9.899 163.470  68.545  1.00 53.06           C  
ATOM   9910  C   HIS D  41      11.406 163.493  68.753  1.00 53.51           C  
ATOM   9911  O   HIS D  41      12.145 164.099  67.961  1.00 53.18           O  
ATOM   9912  CB  HIS D  41       9.584 162.609  67.323  1.00 51.76           C  
ATOM   9913  CG  HIS D  41       8.175 162.115  67.284  1.00 50.95           C  
ATOM   9914  ND1 HIS D  41       7.679 161.220  68.203  1.00 52.52           N  
ATOM   9915  CD2 HIS D  41       7.148 162.416  66.458  1.00 49.98           C  
ATOM   9916  CE1 HIS D  41       6.402 160.993  67.947  1.00 51.77           C  
ATOM   9917  NE2 HIS D  41       6.056 161.707  66.892  1.00 47.96           N  
ATOM   9918  N   SER D  42      11.841 162.806  69.810  1.00 52.56           N  
ATOM   9919  CA  SER D  42      13.253 162.662  70.137  1.00 51.87           C  
ATOM   9920  C   SER D  42      13.855 161.457  69.412  1.00 51.27           C  
ATOM   9921  O   SER D  42      13.151 160.537  69.008  1.00 51.38           O  
ATOM   9922  CB  SER D  42      13.423 162.440  71.637  1.00 53.73           C  
ATOM   9923  OG  SER D  42      12.913 161.178  72.033  1.00 51.91           O  
ATOM   9924  N   MET D  43      15.169 161.461  69.261  1.00 50.87           N  
ATOM   9925  CA  MET D  43      15.865 160.349  68.618  1.00 49.71           C  
ATOM   9926  C   MET D  43      17.158 160.162  69.401  1.00 49.15           C  
ATOM   9927  O   MET D  43      18.262 160.305  68.878  1.00 47.23           O  
ATOM   9928  CB  MET D  43      16.160 160.679  67.161  1.00 47.77           C  
ATOM   9929  CG  MET D  43      16.916 159.599  66.481  1.00 46.88           C  
ATOM   9930  SD  MET D  43      16.054 159.052  65.042  1.00 48.50           S  
ATOM   9931  CE  MET D  43      17.053 159.724  63.875  1.00 46.95           C  
ATOM   9932  N   ASP D  44      16.982 159.830  70.671  1.00 49.90           N  
ATOM   9933  CA  ASP D  44      18.079 159.679  71.605  1.00 52.05           C  
ATOM   9934  C   ASP D  44      19.286 158.836  71.257  1.00 51.49           C  
ATOM   9935  O   ASP D  44      20.375 159.145  71.727  1.00 53.59           O  
ATOM   9936  CB  ASP D  44      17.541 159.235  72.965  1.00 54.75           C  
ATOM   9937  CG  ASP D  44      16.568 160.260  73.583  1.00 59.02           C  
ATOM   9938  OD1 ASP D  44      16.689 161.480  73.299  1.00 58.56           O  
ATOM   9939  OD2 ASP D  44      15.681 159.841  74.366  1.00 60.90           O  
ATOM   9940  N   TYR D  45      19.132 157.801  70.440  1.00 49.75           N  
ATOM   9941  CA  TYR D  45      20.274 156.954  70.114  1.00 48.09           C  
ATOM   9942  C   TYR D  45      21.093 157.284  68.865  1.00 49.73           C  
ATOM   9943  O   TYR D  45      22.082 156.600  68.555  1.00 52.72           O  
ATOM   9944  CB  TYR D  45      19.821 155.503  70.060  1.00 45.62           C  
ATOM   9945  CG  TYR D  45      19.298 155.042  71.382  1.00 44.02           C  
ATOM   9946  CD1 TYR D  45      18.000 155.317  71.768  1.00 44.38           C  
ATOM   9947  CD2 TYR D  45      20.134 154.430  72.299  1.00 43.39           C  
ATOM   9948  CE1 TYR D  45      17.548 155.000  73.050  1.00 44.03           C  
ATOM   9949  CE2 TYR D  45      19.689 154.116  73.580  1.00 43.02           C  
ATOM   9950  CZ  TYR D  45      18.403 154.407  73.948  1.00 42.20           C  
ATOM   9951  OH  TYR D  45      17.983 154.135  75.223  1.00 43.75           O  
ATOM   9952  N   VAL D  46      20.708 158.311  68.125  1.00 48.77           N  
ATOM   9953  CA  VAL D  46      21.493 158.642  66.955  1.00 48.24           C  
ATOM   9954  C   VAL D  46      22.216 159.964  67.179  1.00 50.27           C  
ATOM   9955  O   VAL D  46      21.692 160.893  67.810  1.00 50.99           O  
ATOM   9956  CB  VAL D  46      20.633 158.746  65.710  1.00 46.99           C  
ATOM   9957  CG1 VAL D  46      21.499 158.582  64.474  1.00 47.27           C  
ATOM   9958  CG2 VAL D  46      19.575 157.694  65.741  1.00 47.05           C  
ATOM   9959  N   ALA D  47      23.443 160.032  66.678  1.00 50.94           N  
ATOM   9960  CA  ALA D  47      24.273 161.222  66.806  1.00 49.52           C  
ATOM   9961  C   ALA D  47      24.596 161.693  65.399  1.00 49.73           C  
ATOM   9962  O   ALA D  47      24.479 160.924  64.434  1.00 50.99           O  
ATOM   9963  CB  ALA D  47      25.527 160.881  67.533  1.00 48.20           C  
ATOM   9964  N   PHE D  48      25.005 162.946  65.270  1.00 47.89           N  
ATOM   9965  CA  PHE D  48      25.312 163.468  63.957  1.00 47.62           C  
ATOM   9966  C   PHE D  48      26.421 162.702  63.251  1.00 48.67           C  
ATOM   9967  O   PHE D  48      26.376 162.516  62.028  1.00 49.41           O  
ATOM   9968  CB  PHE D  48      25.664 164.930  64.062  1.00 46.69           C  
ATOM   9969  CG  PHE D  48      24.525 165.784  64.543  1.00 45.52           C  
ATOM   9970  CD1 PHE D  48      24.336 166.027  65.897  1.00 44.96           C  
ATOM   9971  CD2 PHE D  48      23.636 166.340  63.636  1.00 43.60           C  
ATOM   9972  CE1 PHE D  48      23.270 166.817  66.330  1.00 44.09           C  
ATOM   9973  CE2 PHE D  48      22.577 167.124  64.060  1.00 41.95           C  
ATOM   9974  CZ  PHE D  48      22.391 167.363  65.404  1.00 43.19           C  
ATOM   9975  N   ARG D  49      27.400 162.228  64.014  1.00 48.20           N  
ATOM   9976  CA  ARG D  49      28.497 161.477  63.419  1.00 48.19           C  
ATOM   9977  C   ARG D  49      28.009 160.255  62.668  1.00 47.52           C  
ATOM   9978  O   ARG D  49      28.581 159.884  61.642  1.00 47.04           O  
ATOM   9979  CB  ARG D  49      29.498 161.044  64.484  1.00 49.47           C  
ATOM   9980  CG  ARG D  49      28.979 160.043  65.481  1.00 49.31           C  
ATOM   9981  CD  ARG D  49      30.014 159.836  66.562  1.00 49.25           C  
ATOM   9982  NE  ARG D  49      29.454 159.156  67.717  1.00 47.69           N  
ATOM   9983  CZ  ARG D  49      29.141 157.868  67.741  1.00 48.01           C  
ATOM   9984  NH1 ARG D  49      29.333 157.102  66.666  1.00 45.45           N  
ATOM   9985  NH2 ARG D  49      28.648 157.348  68.856  1.00 49.32           N  
ATOM   9986  N   ASN D  50      26.949 159.642  63.184  1.00 47.95           N  
ATOM   9987  CA  ASN D  50      26.367 158.448  62.574  1.00 48.78           C  
ATOM   9988  C   ASN D  50      25.970 158.678  61.111  1.00 49.62           C  
ATOM   9989  O   ASN D  50      25.947 157.737  60.320  1.00 49.51           O  
ATOM   9990  CB  ASN D  50      25.134 157.984  63.370  1.00 48.85           C  
ATOM   9991  CG  ASN D  50      25.492 157.375  64.732  1.00 48.60           C  
ATOM   9992  OD1 ASN D  50      26.293 156.444  64.813  1.00 48.80           O  
ATOM   9993  ND2 ASN D  50      24.880 157.884  65.800  1.00 45.97           N  
ATOM   9994  N   LEU D  51      25.670 159.927  60.751  1.00 49.41           N  
ATOM   9995  CA  LEU D  51      25.258 160.245  59.380  1.00 48.76           C  
ATOM   9996  C   LEU D  51      26.404 160.157  58.381  1.00 48.10           C  
ATOM   9997  O   LEU D  51      26.211 159.774  57.222  1.00 45.66           O  
ATOM   9998  CB  LEU D  51      24.613 161.643  59.340  1.00 47.98           C  
ATOM   9999  CG  LEU D  51      23.290 161.744  60.134  1.00 46.16           C  
ATOM  10000  CD1 LEU D  51      22.777 163.167  60.200  1.00 43.18           C  
ATOM  10001  CD2 LEU D  51      22.260 160.841  59.474  1.00 44.32           C  
ATOM  10002  N   ILE D  52      27.602 160.493  58.857  1.00 49.10           N  
ATOM  10003  CA  ILE D  52      28.822 160.477  58.042  1.00 47.99           C  
ATOM  10004  C   ILE D  52      29.127 159.163  57.352  1.00 49.03           C  
ATOM  10005  O   ILE D  52      29.351 158.139  58.004  1.00 49.33           O  
ATOM  10006  CB  ILE D  52      30.046 160.800  58.873  1.00 45.68           C  
ATOM  10007  CG1 ILE D  52      29.869 162.142  59.583  1.00 44.25           C  
ATOM  10008  CG2 ILE D  52      31.249 160.819  57.972  1.00 44.80           C  
ATOM  10009  CD1 ILE D  52      30.988 162.471  60.530  1.00 42.69           C  
ATOM  10010  N   GLY D  53      29.160 159.195  56.027  1.00 50.25           N  
ATOM  10011  CA  GLY D  53      29.465 157.991  55.276  1.00 52.45           C  
ATOM  10012  C   GLY D  53      28.255 157.134  55.006  1.00 54.30           C  
ATOM  10013  O   GLY D  53      28.372 156.047  54.429  1.00 55.20           O  
ATOM  10014  N   VAL D  54      27.089 157.624  55.427  1.00 55.53           N  
ATOM  10015  CA  VAL D  54      25.827 156.913  55.230  1.00 54.80           C  
ATOM  10016  C   VAL D  54      24.894 157.749  54.369  1.00 54.64           C  
ATOM  10017  O   VAL D  54      24.440 157.299  53.326  1.00 54.92           O  
ATOM  10018  CB  VAL D  54      25.130 156.654  56.549  1.00 54.13           C  
ATOM  10019  CG1 VAL D  54      24.215 155.463  56.412  1.00 56.01           C  
ATOM  10020  CG2 VAL D  54      26.144 156.444  57.630  1.00 53.23           C  
ATOM  10021  N   THR D  55      24.611 158.968  54.815  1.00 55.16           N  
ATOM  10022  CA  THR D  55      23.745 159.876  54.069  1.00 56.36           C  
ATOM  10023  C   THR D  55      24.379 161.248  53.822  1.00 57.25           C  
ATOM  10024  O   THR D  55      24.046 161.918  52.851  1.00 57.03           O  
ATOM  10025  CB  THR D  55      22.394 160.091  54.779  1.00 56.47           C  
ATOM  10026  OG1 THR D  55      22.614 160.631  56.090  1.00 56.00           O  
ATOM  10027  CG2 THR D  55      21.634 158.771  54.871  1.00 56.28           C  
ATOM  10028  N   HIS D  56      25.295 161.664  54.691  1.00 58.31           N  
ATOM  10029  CA  HIS D  56      25.945 162.950  54.518  1.00 58.70           C  
ATOM  10030  C   HIS D  56      27.457 162.881  54.493  1.00 60.95           C  
ATOM  10031  O   HIS D  56      28.067 161.862  54.795  1.00 62.39           O  
ATOM  10032  CB  HIS D  56      25.565 163.892  55.642  1.00 58.05           C  
ATOM  10033  CG  HIS D  56      24.122 164.264  55.663  1.00 58.45           C  
ATOM  10034  ND1 HIS D  56      23.120 163.346  55.882  1.00 58.14           N  
ATOM  10035  CD2 HIS D  56      23.512 165.465  55.531  1.00 57.32           C  
ATOM  10036  CE1 HIS D  56      21.956 163.967  55.887  1.00 58.14           C  
ATOM  10037  NE2 HIS D  56      22.165 165.253  55.676  1.00 57.04           N  
ATOM  10038  N   THR D  57      28.044 164.018  54.158  1.00 63.02           N  
ATOM  10039  CA  THR D  57      29.480 164.212  54.106  1.00 64.24           C  
ATOM  10040  C   THR D  57      29.897 164.526  55.523  1.00 64.40           C  
ATOM  10041  O   THR D  57      29.070 164.876  56.345  1.00 64.34           O  
ATOM  10042  CB  THR D  57      29.804 165.437  53.266  1.00 65.41           C  
ATOM  10043  OG1 THR D  57      29.540 165.154  51.892  1.00 68.87           O  
ATOM  10044  CG2 THR D  57      31.244 165.836  53.430  1.00 69.73           C  
ATOM  10045  N   GLU D  58      31.179 164.418  55.819  1.00 66.49           N  
ATOM  10046  CA  GLU D  58      31.636 164.752  57.156  1.00 68.94           C  
ATOM  10047  C   GLU D  58      31.482 166.264  57.384  1.00 68.23           C  
ATOM  10048  O   GLU D  58      31.169 166.719  58.486  1.00 67.28           O  
ATOM  10049  CB  GLU D  58      33.091 164.344  57.326  1.00 73.46           C  
ATOM  10050  CG  GLU D  58      33.691 164.862  58.605  1.00 81.36           C  
ATOM  10051  CD  GLU D  58      34.914 164.081  59.011  1.00 86.68           C  
ATOM  10052  OE1 GLU D  58      35.815 163.935  58.144  1.00 89.82           O  
ATOM  10053  OE2 GLU D  58      34.965 163.621  60.186  1.00 87.71           O  
ATOM  10054  N   ALA D  59      31.718 167.043  56.334  1.00 67.55           N  
ATOM  10055  CA  ALA D  59      31.582 168.491  56.410  1.00 66.60           C  
ATOM  10056  C   ALA D  59      30.111 168.843  56.660  1.00 66.76           C  
ATOM  10057  O   ALA D  59      29.802 169.683  57.510  1.00 67.75           O  
ATOM  10058  CB  ALA D  59      32.054 169.118  55.119  1.00 65.63           C  
ATOM  10059  N   GLU D  60      29.215 168.197  55.909  1.00 65.06           N  
ATOM  10060  CA  GLU D  60      27.776 168.413  56.043  1.00 62.03           C  
ATOM  10061  C   GLU D  60      27.318 168.056  57.451  1.00 60.76           C  
ATOM  10062  O   GLU D  60      26.496 168.744  58.038  1.00 60.68           O  
ATOM  10063  CB  GLU D  60      27.006 167.540  55.054  1.00 61.45           C  
ATOM  10064  CG  GLU D  60      27.326 167.771  53.595  1.00 60.99           C  
ATOM  10065  CD  GLU D  60      26.339 167.068  52.664  1.00 61.37           C  
ATOM  10066  OE1 GLU D  60      25.747 167.750  51.800  1.00 61.20           O  
ATOM  10067  OE2 GLU D  60      26.154 165.836  52.794  1.00 60.57           O  
ATOM  10068  N   ALA D  61      27.850 166.963  57.976  1.00 59.10           N  
ATOM  10069  CA  ALA D  61      27.501 166.502  59.305  1.00 59.32           C  
ATOM  10070  C   ALA D  61      27.936 167.493  60.369  1.00 60.53           C  
ATOM  10071  O   ALA D  61      27.183 167.839  61.279  1.00 59.07           O  
ATOM  10072  CB  ALA D  61      28.145 165.167  59.560  1.00 58.61           C  
ATOM  10073  N   LYS D  62      29.171 167.948  60.262  1.00 63.61           N  
ATOM  10074  CA  LYS D  62      29.668 168.891  61.236  1.00 66.42           C  
ATOM  10075  C   LYS D  62      28.785 170.139  61.212  1.00 66.83           C  
ATOM  10076  O   LYS D  62      28.467 170.689  62.264  1.00 66.18           O  
ATOM  10077  CB  LYS D  62      31.120 169.248  60.929  1.00 68.65           C  
ATOM  10078  CG  LYS D  62      31.812 169.995  62.057  1.00 72.74           C  
ATOM  10079  CD  LYS D  62      33.141 170.578  61.598  1.00 75.63           C  
ATOM  10080  CE  LYS D  62      33.668 171.569  62.623  1.00 77.79           C  
ATOM  10081  NZ  LYS D  62      34.750 172.418  62.052  1.00 80.26           N  
ATOM  10082  N   ALA D  63      28.377 170.570  60.015  1.00 67.34           N  
ATOM  10083  CA  ALA D  63      27.514 171.756  59.863  1.00 67.76           C  
ATOM  10084  C   ALA D  63      26.182 171.558  60.569  1.00 68.09           C  
ATOM  10085  O   ALA D  63      25.746 172.397  61.357  1.00 69.71           O  
ATOM  10086  CB  ALA D  63      27.265 172.046  58.403  1.00 67.72           C  
ATOM  10087  N   LEU D  64      25.538 170.439  60.264  1.00 66.96           N  
ATOM  10088  CA  LEU D  64      24.273 170.069  60.865  1.00 64.31           C  
ATOM  10089  C   LEU D  64      24.312 170.108  62.391  1.00 65.52           C  
ATOM  10090  O   LEU D  64      23.373 170.587  63.027  1.00 66.56           O  
ATOM  10091  CB  LEU D  64      23.909 168.664  60.422  1.00 60.35           C  
ATOM  10092  CG  LEU D  64      23.173 168.559  59.111  1.00 56.61           C  
ATOM  10093  CD1 LEU D  64      23.167 167.124  58.677  1.00 56.48           C  
ATOM  10094  CD2 LEU D  64      21.763 169.079  59.300  1.00 56.03           C  
ATOM  10095  N   ALA D  65      25.388 169.591  62.976  1.00 66.14           N  
ATOM  10096  CA  ALA D  65      25.517 169.552  64.427  1.00 68.43           C  
ATOM  10097  C   ALA D  65      25.646 170.925  65.048  1.00 70.56           C  
ATOM  10098  O   ALA D  65      25.246 171.141  66.189  1.00 69.47           O  
ATOM  10099  CB  ALA D  65      26.708 168.713  64.814  1.00 66.49           C  
ATOM  10100  N   GLU D  66      26.208 171.853  64.286  1.00 75.21           N  
ATOM  10101  CA  GLU D  66      26.429 173.211  64.762  1.00 80.05           C  
ATOM  10102  C   GLU D  66      25.185 174.093  64.763  1.00 82.25           C  
ATOM  10103  O   GLU D  66      25.128 175.070  65.508  1.00 83.61           O  
ATOM  10104  CB  GLU D  66      27.562 173.836  63.955  1.00 81.35           C  
ATOM  10105  CG  GLU D  66      28.777 172.922  63.980  1.00 86.56           C  
ATOM  10106  CD  GLU D  66      29.987 173.474  63.259  1.00 90.51           C  
ATOM  10107  OE1 GLU D  66      29.834 173.980  62.125  1.00 93.03           O  
ATOM  10108  OE2 GLU D  66      31.103 173.382  63.823  1.00 92.86           O  
ATOM  10109  N   GLU D  67      24.190 173.739  63.948  1.00 84.08           N  
ATOM  10110  CA  GLU D  67      22.925 174.473  63.889  1.00 84.57           C  
ATOM  10111  C   GLU D  67      22.245 174.401  65.249  1.00 86.76           C  
ATOM  10112  O   GLU D  67      21.270 175.100  65.509  1.00 86.64           O  
ATOM  10113  CB  GLU D  67      21.996 173.836  62.863  1.00 82.45           C  
ATOM  10114  CG  GLU D  67      22.462 173.988  61.452  1.00 83.71           C  
ATOM  10115  CD  GLU D  67      21.526 173.340  60.466  1.00 84.93           C  
ATOM  10116  OE1 GLU D  67      20.300 173.409  60.687  1.00 84.56           O  
ATOM  10117  OE2 GLU D  67      22.017 172.774  59.461  1.00 88.12           O  
ATOM  10118  N   VAL D  68      22.775 173.543  66.113  1.00 89.84           N  
ATOM  10119  CA  VAL D  68      22.219 173.328  67.440  1.00 92.70           C  
ATOM  10120  C   VAL D  68      23.127 173.753  68.579  1.00 95.50           C  
ATOM  10121  O   VAL D  68      24.337 173.526  68.542  1.00 96.90           O  
ATOM  10122  CB  VAL D  68      21.920 171.849  67.658  1.00 92.13           C  
ATOM  10123  CG1 VAL D  68      21.177 171.660  68.982  1.00 91.90           C  
ATOM  10124  CG2 VAL D  68      21.153 171.305  66.471  1.00 91.64           C  
ATOM  10125  N   GLU D  69      22.531 174.355  69.602  1.00 97.92           N  
ATOM  10126  CA  GLU D  69      23.278 174.776  70.783  1.00 99.98           C  
ATOM  10127  C   GLU D  69      23.009 173.721  71.839  1.00 99.06           C  
ATOM  10128  O   GLU D  69      21.856 173.374  72.095  1.00 98.53           O  
ATOM  10129  CB  GLU D  69      22.800 176.152  71.291  1.00103.57           C  
ATOM  10130  CG  GLU D  69      23.228 177.363  70.425  1.00108.16           C  
ATOM  10131  CD  GLU D  69      24.680 177.833  70.663  1.00110.07           C  
ATOM  10132  OE1 GLU D  69      24.954 178.448  71.726  1.00110.24           O  
ATOM  10133  OE2 GLU D  69      25.544 177.587  69.783  1.00110.43           O  
ATOM  10134  N   VAL D  70      24.066 173.192  72.439  1.00 98.35           N  
ATOM  10135  CA  VAL D  70      23.878 172.184  73.464  1.00 98.47           C  
ATOM  10136  C   VAL D  70      24.265 172.762  74.816  1.00 98.81           C  
ATOM  10137  O   VAL D  70      24.967 173.769  74.898  1.00 97.97           O  
ATOM  10138  CB  VAL D  70      24.713 170.897  73.168  1.00 98.12           C  
ATOM  10139  CG1 VAL D  70      25.056 170.821  71.689  1.00 97.47           C  
ATOM  10140  CG2 VAL D  70      25.960 170.857  74.024  1.00 98.81           C  
ATOM  10141  N   GLN D  71      23.792 172.125  75.877  1.00 99.96           N  
ATOM  10142  CA  GLN D  71      24.098 172.578  77.218  1.00101.19           C  
ATOM  10143  C   GLN D  71      25.234 171.765  77.807  1.00101.18           C  
ATOM  10144  O   GLN D  71      25.059 170.602  78.149  1.00100.71           O  
ATOM  10145  CB  GLN D  71      22.863 172.458  78.110  1.00102.71           C  
ATOM  10146  CG  GLN D  71      23.086 172.953  79.529  1.00105.62           C  
ATOM  10147  CD  GLN D  71      21.803 173.007  80.341  1.00107.48           C  
ATOM  10148  OE1 GLN D  71      21.182 171.975  80.615  1.00108.83           O  
ATOM  10149  NE2 GLN D  71      21.397 174.217  80.732  1.00107.14           N  
ATOM  10150  N   ASP D  72      26.403 172.383  77.914  1.00102.13           N  
ATOM  10151  CA  ASP D  72      27.567 171.719  78.487  1.00103.43           C  
ATOM  10152  C   ASP D  72      27.748 172.268  79.898  1.00104.62           C  
ATOM  10153  O   ASP D  72      26.980 173.125  80.334  1.00105.17           O  
ATOM  10154  CB  ASP D  72      28.820 172.009  77.656  1.00102.40           C  
ATOM  10155  CG  ASP D  72      29.722 170.790  77.508  1.00101.77           C  
ATOM  10156  OD1 ASP D  72      30.848 170.936  76.984  1.00101.04           O  
ATOM  10157  OD2 ASP D  72      29.301 169.682  77.906  1.00101.22           O  
ATOM  10158  N   GLY D  73      28.758 171.776  80.608  1.00106.16           N  
ATOM  10159  CA  GLY D  73      29.004 172.242  81.962  1.00107.42           C  
ATOM  10160  C   GLY D  73      29.337 171.118  82.926  1.00108.44           C  
ATOM  10161  O   GLY D  73      29.294 169.948  82.557  1.00108.62           O  
ATOM  10162  N   PRO D  74      29.660 171.442  84.181  1.00109.59           N  
ATOM  10163  CA  PRO D  74      29.714 172.807  84.695  1.00111.21           C  
ATOM  10164  C   PRO D  74      31.008 173.502  84.280  1.00112.97           C  
ATOM  10165  O   PRO D  74      31.936 172.859  83.785  1.00112.64           O  
ATOM  10166  CB  PRO D  74      29.631 172.592  86.194  1.00110.72           C  
ATOM  10167  CG  PRO D  74      30.479 171.365  86.365  1.00110.19           C  
ATOM  10168  CD  PRO D  74      30.010 170.473  85.235  1.00109.64           C  
ATOM  10169  N   ASP D  75      31.055 174.817  84.473  1.00115.29           N  
ATOM  10170  CA  ASP D  75      32.242 175.600  84.138  1.00117.76           C  
ATOM  10171  C   ASP D  75      32.999 175.918  85.415  1.00118.74           C  
ATOM  10172  O   ASP D  75      32.786 175.281  86.447  1.00118.87           O  
ATOM  10173  CB  ASP D  75      31.866 176.915  83.448  1.00118.17           C  
ATOM  10174  CG  ASP D  75      30.955 177.779  84.296  1.00118.96           C  
ATOM  10175  OD1 ASP D  75      31.159 177.835  85.528  1.00119.55           O  
ATOM  10176  OD2 ASP D  75      30.038 178.412  83.729  1.00119.93           O  
ATOM  10177  N   GLU D  76      33.867 176.920  85.340  1.00119.78           N  
ATOM  10178  CA  GLU D  76      34.656 177.331  86.491  1.00120.75           C  
ATOM  10179  C   GLU D  76      33.855 177.536  87.774  1.00119.78           C  
ATOM  10180  O   GLU D  76      34.261 177.079  88.838  1.00120.42           O  
ATOM  10181  CB  GLU D  76      35.411 178.617  86.180  1.00123.07           C  
ATOM  10182  CG  GLU D  76      36.599 178.434  85.270  1.00126.42           C  
ATOM  10183  CD  GLU D  76      37.635 179.516  85.492  1.00128.54           C  
ATOM  10184  OE1 GLU D  76      37.300 180.713  85.310  1.00129.46           O  
ATOM  10185  OE2 GLU D  76      38.780 179.165  85.858  1.00129.01           O  
ATOM  10186  N   ASN D  77      32.726 178.227  87.686  1.00118.21           N  
ATOM  10187  CA  ASN D  77      31.917 178.476  88.870  1.00117.08           C  
ATOM  10188  C   ASN D  77      30.785 177.479  88.967  1.00116.08           C  
ATOM  10189  O   ASN D  77      29.762 177.743  89.597  1.00116.07           O  
ATOM  10190  CB  ASN D  77      31.353 179.888  88.827  1.00118.29           C  
ATOM  10191  CG  ASN D  77      32.417 180.925  88.553  1.00119.65           C  
ATOM  10192  OD1 ASN D  77      33.315 181.142  89.370  1.00120.77           O  
ATOM  10193  ND2 ASN D  77      32.331 181.568  87.390  1.00120.26           N  
ATOM  10194  N   GLY D  78      30.973 176.329  88.335  1.00114.92           N  
ATOM  10195  CA  GLY D  78      29.950 175.305  88.372  1.00114.23           C  
ATOM  10196  C   GLY D  78      28.655 175.806  87.776  1.00113.56           C  
ATOM  10197  O   GLY D  78      27.600 175.753  88.412  1.00113.56           O  
ATOM  10198  N   GLU D  79      28.744 176.308  86.549  1.00112.57           N  
ATOM  10199  CA  GLU D  79      27.578 176.819  85.845  1.00110.99           C  
ATOM  10200  C   GLU D  79      27.370 176.124  84.509  1.00108.83           C  
ATOM  10201  O   GLU D  79      28.327 175.855  83.777  1.00108.54           O  
ATOM  10202  CB  GLU D  79      27.719 178.322  85.608  1.00112.95           C  
ATOM  10203  CG  GLU D  79      27.528 179.171  86.849  1.00116.44           C  
ATOM  10204  CD  GLU D  79      26.163 178.966  87.502  1.00119.03           C  
ATOM  10205  OE1 GLU D  79      25.804 179.773  88.391  1.00119.65           O  
ATOM  10206  OE2 GLU D  79      25.451 177.997  87.136  1.00119.70           O  
ATOM  10207  N   LEU D  80      26.114 175.819  84.203  1.00105.71           N  
ATOM  10208  CA  LEU D  80      25.783 175.184  82.937  1.00102.41           C  
ATOM  10209  C   LEU D  80      25.921 176.295  81.895  1.00 99.78           C  
ATOM  10210  O   LEU D  80      25.898 177.473  82.246  1.00100.57           O  
ATOM  10211  CB  LEU D  80      24.348 174.648  82.983  1.00102.48           C  
ATOM  10212  CG  LEU D  80      24.063 173.585  84.056  1.00101.82           C  
ATOM  10213  CD1 LEU D  80      22.567 173.377  84.204  1.00102.22           C  
ATOM  10214  CD2 LEU D  80      24.746 172.279  83.685  1.00101.10           C  
ATOM  10215  N   PHE D  81      26.078 175.944  80.626  1.00 95.70           N  
ATOM  10216  CA  PHE D  81      26.225 176.975  79.607  1.00 91.55           C  
ATOM  10217  C   PHE D  81      26.020 176.407  78.225  1.00 89.18           C  
ATOM  10218  O   PHE D  81      25.986 175.193  78.053  1.00 88.92           O  
ATOM  10219  CB  PHE D  81      27.609 177.598  79.699  1.00 91.12           C  
ATOM  10220  CG  PHE D  81      28.722 176.638  79.405  1.00 89.95           C  
ATOM  10221  CD1 PHE D  81      29.147 176.423  78.097  1.00 88.97           C  
ATOM  10222  CD2 PHE D  81      29.350 175.955  80.435  1.00 88.82           C  
ATOM  10223  CE1 PHE D  81      30.180 175.546  77.822  1.00 88.26           C  
ATOM  10224  CE2 PHE D  81      30.381 175.075  80.168  1.00 89.18           C  
ATOM  10225  CZ  PHE D  81      30.799 174.871  78.857  1.00 88.90           C  
ATOM  10226  N   MET D  82      25.891 177.281  77.236  1.00 86.32           N  
ATOM  10227  CA  MET D  82      25.666 176.813  75.881  1.00 84.46           C  
ATOM  10228  C   MET D  82      26.949 176.724  75.089  1.00 83.01           C  
ATOM  10229  O   MET D  82      27.971 177.295  75.467  1.00 82.23           O  
ATOM  10230  CB  MET D  82      24.681 177.726  75.144  1.00 84.63           C  
ATOM  10231  CG  MET D  82      23.308 177.824  75.784  1.00 84.67           C  
ATOM  10232  SD  MET D  82      22.564 176.214  76.133  1.00 84.77           S  
ATOM  10233  CE  MET D  82      22.577 176.204  77.957  1.00 83.62           C  
ATOM  10234  N   ARG D  83      26.880 175.981  73.990  1.00 81.51           N  
ATOM  10235  CA  ARG D  83      28.006 175.799  73.085  1.00 79.62           C  
ATOM  10236  C   ARG D  83      27.455 175.214  71.793  1.00 78.62           C  
ATOM  10237  O   ARG D  83      26.406 174.561  71.781  1.00 78.49           O  
ATOM  10238  CB  ARG D  83      29.037 174.832  73.669  1.00 79.45           C  
ATOM  10239  CG  ARG D  83      28.557 173.386  73.742  1.00 79.99           C  
ATOM  10240  CD  ARG D  83      29.675 172.424  74.127  1.00 81.06           C  
ATOM  10241  NE  ARG D  83      29.231 171.030  74.216  1.00 81.21           N  
ATOM  10242  CZ  ARG D  83      28.916 170.263  73.173  1.00 80.26           C  
ATOM  10243  NH1 ARG D  83      28.994 170.738  71.938  1.00 78.96           N  
ATOM  10244  NH2 ARG D  83      28.514 169.015  73.370  1.00 80.74           N  
ATOM  10245  N   PRO D  84      28.146 175.454  70.680  1.00 77.61           N  
ATOM  10246  CA  PRO D  84      27.684 174.920  69.396  1.00 76.96           C  
ATOM  10247  C   PRO D  84      27.910 173.403  69.359  1.00 76.04           C  
ATOM  10248  O   PRO D  84      28.904 172.905  69.884  1.00 76.48           O  
ATOM  10249  CB  PRO D  84      28.532 175.690  68.389  1.00 76.71           C  
ATOM  10250  CG  PRO D  84      29.814 175.906  69.134  1.00 76.70           C  
ATOM  10251  CD  PRO D  84      29.345 176.291  70.516  1.00 76.92           C  
ATOM  10252  N   GLY D  85      26.981 172.676  68.751  1.00 75.18           N  
ATOM  10253  CA  GLY D  85      27.090 171.230  68.696  1.00 74.01           C  
ATOM  10254  C   GLY D  85      28.232 170.653  67.879  1.00 73.14           C  
ATOM  10255  O   GLY D  85      28.686 171.263  66.912  1.00 73.21           O  
ATOM  10256  N   LYS D  86      28.690 169.469  68.288  1.00 71.82           N  
ATOM  10257  CA  LYS D  86      29.773 168.743  67.623  1.00 70.56           C  
ATOM  10258  C   LYS D  86      29.150 167.448  67.093  1.00 69.23           C  
ATOM  10259  O   LYS D  86      28.054 167.061  67.521  1.00 69.01           O  
ATOM  10260  CB  LYS D  86      30.874 168.370  68.618  1.00 71.92           C  
ATOM  10261  CG  LYS D  86      31.191 169.402  69.674  1.00 73.47           C  
ATOM  10262  CD  LYS D  86      31.797 168.709  70.880  1.00 77.05           C  
ATOM  10263  CE  LYS D  86      32.142 169.699  71.991  1.00 81.51           C  
ATOM  10264  NZ  LYS D  86      32.583 168.992  73.248  1.00 84.08           N  
ATOM  10265  N   ILE D  87      29.855 166.760  66.200  1.00 66.00           N  
ATOM  10266  CA  ILE D  87      29.315 165.541  65.636  1.00 63.65           C  
ATOM  10267  C   ILE D  87      29.184 164.434  66.659  1.00 62.90           C  
ATOM  10268  O   ILE D  87      28.538 163.422  66.406  1.00 62.75           O  
ATOM  10269  CB  ILE D  87      30.170 165.032  64.481  1.00 63.53           C  
ATOM  10270  CG1 ILE D  87      31.572 164.736  64.972  1.00 63.37           C  
ATOM  10271  CG2 ILE D  87      30.229 166.059  63.369  1.00 63.64           C  
ATOM  10272  CD1 ILE D  87      32.435 164.167  63.879  1.00 64.63           C  
ATOM  10273  N   SER D  88      29.796 164.620  67.817  1.00 62.05           N  
ATOM  10274  CA  SER D  88      29.728 163.604  68.853  1.00 62.79           C  
ATOM  10275  C   SER D  88      28.452 163.754  69.677  1.00 62.67           C  
ATOM  10276  O   SER D  88      28.207 162.993  70.613  1.00 63.03           O  
ATOM  10277  CB  SER D  88      30.962 163.695  69.752  1.00 62.84           C  
ATOM  10278  OG  SER D  88      31.048 164.974  70.356  1.00 64.82           O  
ATOM  10279  N   ASP D  89      27.635 164.738  69.326  1.00 62.86           N  
ATOM  10280  CA  ASP D  89      26.383 164.961  70.037  1.00 63.16           C  
ATOM  10281  C   ASP D  89      25.231 164.191  69.427  1.00 62.49           C  
ATOM  10282  O   ASP D  89      25.227 163.874  68.232  1.00 62.06           O  
ATOM  10283  CB  ASP D  89      26.021 166.442  70.041  1.00 65.00           C  
ATOM  10284  CG  ASP D  89      26.944 167.258  70.900  1.00 66.59           C  
ATOM  10285  OD1 ASP D  89      27.305 166.772  72.001  1.00 68.19           O  
ATOM  10286  OD2 ASP D  89      27.297 168.382  70.482  1.00 66.11           O  
ATOM  10287  N   TYR D  90      24.233 163.902  70.246  1.00 61.76           N  
ATOM  10288  CA  TYR D  90      23.085 163.175  69.744  1.00 61.52           C  
ATOM  10289  C   TYR D  90      22.005 164.169  69.365  1.00 59.28           C  
ATOM  10290  O   TYR D  90      22.020 165.308  69.822  1.00 58.29           O  
ATOM  10291  CB  TYR D  90      22.587 162.182  70.806  1.00 63.81           C  
ATOM  10292  CG  TYR D  90      23.573 161.060  71.041  1.00 66.26           C  
ATOM  10293  CD1 TYR D  90      24.815 161.306  71.635  1.00 66.61           C  
ATOM  10294  CD2 TYR D  90      23.314 159.769  70.569  1.00 67.95           C  
ATOM  10295  CE1 TYR D  90      25.783 160.294  71.743  1.00 68.36           C  
ATOM  10296  CE2 TYR D  90      24.276 158.744  70.673  1.00 69.01           C  
ATOM  10297  CZ  TYR D  90      25.507 159.014  71.256  1.00 69.00           C  
ATOM  10298  OH  TYR D  90      26.451 158.012  71.340  1.00 69.13           O  
ATOM  10299  N   PHE D  91      21.090 163.749  68.501  1.00 57.48           N  
ATOM  10300  CA  PHE D  91      19.995 164.612  68.104  1.00 55.98           C  
ATOM  10301  C   PHE D  91      19.306 165.174  69.363  1.00 56.69           C  
ATOM  10302  O   PHE D  91      19.039 164.464  70.346  1.00 56.03           O  
ATOM  10303  CB  PHE D  91      19.001 163.839  67.233  1.00 54.72           C  
ATOM  10304  CG  PHE D  91      19.596 163.306  65.969  1.00 52.58           C  
ATOM  10305  CD1 PHE D  91      20.763 163.853  65.455  1.00 52.01           C  
ATOM  10306  CD2 PHE D  91      18.978 162.280  65.272  1.00 53.45           C  
ATOM  10307  CE1 PHE D  91      21.309 163.387  64.270  1.00 52.03           C  
ATOM  10308  CE2 PHE D  91      19.520 161.804  64.078  1.00 52.94           C  
ATOM  10309  CZ  PHE D  91      20.682 162.360  63.580  1.00 52.93           C  
ATOM  10310  N   PRO D  92      18.996 166.470  69.334  1.00 57.76           N  
ATOM  10311  CA  PRO D  92      18.353 167.221  70.420  1.00 58.35           C  
ATOM  10312  C   PRO D  92      16.928 166.835  70.812  1.00 58.35           C  
ATOM  10313  O   PRO D  92      16.043 166.683  69.971  1.00 58.12           O  
ATOM  10314  CB  PRO D  92      18.427 168.663  69.929  1.00 59.69           C  
ATOM  10315  CG  PRO D  92      19.482 168.626  68.824  1.00 59.77           C  
ATOM  10316  CD  PRO D  92      19.217 167.331  68.163  1.00 57.90           C  
ATOM  10317  N   LYS D  93      16.717 166.706  72.109  1.00 57.59           N  
ATOM  10318  CA  LYS D  93      15.422 166.357  72.624  1.00 58.81           C  
ATOM  10319  C   LYS D  93      14.577 167.613  72.543  1.00 60.75           C  
ATOM  10320  O   LYS D  93      15.078 168.709  72.793  1.00 61.54           O  
ATOM  10321  CB  LYS D  93      15.539 165.930  74.083  1.00 60.55           C  
ATOM  10322  CG  LYS D  93      16.304 164.636  74.349  1.00 63.97           C  
ATOM  10323  CD  LYS D  93      16.388 164.369  75.851  1.00 66.60           C  
ATOM  10324  CE  LYS D  93      16.591 162.887  76.183  1.00 71.45           C  
ATOM  10325  NZ  LYS D  93      17.946 162.349  75.840  1.00 73.32           N  
ATOM  10326  N   PRO D  94      13.287 167.477  72.177  1.00 61.91           N  
ATOM  10327  CA  PRO D  94      12.362 168.607  72.066  1.00 61.50           C  
ATOM  10328  C   PRO D  94      11.856 169.057  73.430  1.00 62.13           C  
ATOM  10329  O   PRO D  94      11.398 170.177  73.586  1.00 61.73           O  
ATOM  10330  CB  PRO D  94      11.236 168.044  71.215  1.00 60.58           C  
ATOM  10331  CG  PRO D  94      11.896 166.982  70.426  1.00 61.34           C  
ATOM  10332  CD  PRO D  94      12.723 166.314  71.474  1.00 61.95           C  
ATOM  10333  N   TYR D  95      11.931 168.168  74.412  1.00 64.27           N  
ATOM  10334  CA  TYR D  95      11.483 168.481  75.763  1.00 66.40           C  
ATOM  10335  C   TYR D  95      12.459 167.887  76.776  1.00 69.06           C  
ATOM  10336  O   TYR D  95      13.204 166.964  76.472  1.00 69.90           O  
ATOM  10337  CB  TYR D  95      10.076 167.910  76.030  1.00 64.97           C  
ATOM  10338  CG  TYR D  95       9.081 168.126  74.915  1.00 62.25           C  
ATOM  10339  CD1 TYR D  95       8.956 167.208  73.881  1.00 62.71           C  
ATOM  10340  CD2 TYR D  95       8.290 169.259  74.875  1.00 61.60           C  
ATOM  10341  CE1 TYR D  95       8.068 167.418  72.829  1.00 61.76           C  
ATOM  10342  CE2 TYR D  95       7.396 169.479  73.827  1.00 61.30           C  
ATOM  10343  CZ  TYR D  95       7.295 168.555  72.808  1.00 61.36           C  
ATOM  10344  OH  TYR D  95       6.446 168.777  71.751  1.00 62.01           O  
ATOM  10345  N   PRO D  96      12.457 168.412  78.001  1.00 71.31           N  
ATOM  10346  CA  PRO D  96      13.325 167.969  79.100  1.00 72.92           C  
ATOM  10347  C   PRO D  96      12.938 166.624  79.721  1.00 74.63           C  
ATOM  10348  O   PRO D  96      13.804 165.836  80.124  1.00 75.07           O  
ATOM  10349  CB  PRO D  96      13.196 169.099  80.107  1.00 73.41           C  
ATOM  10350  CG  PRO D  96      12.831 170.303  79.233  1.00 73.81           C  
ATOM  10351  CD  PRO D  96      11.830 169.706  78.314  1.00 71.85           C  
ATOM  10352  N   ASN D  97      11.634 166.378  79.804  1.00 76.16           N  
ATOM  10353  CA  ASN D  97      11.092 165.152  80.396  1.00 76.75           C  
ATOM  10354  C   ASN D  97       9.673 164.935  79.906  1.00 76.57           C  
ATOM  10355  O   ASN D  97       8.985 165.888  79.548  1.00 77.34           O  
ATOM  10356  CB  ASN D  97      11.053 165.289  81.906  1.00 77.97           C  
ATOM  10357  CG  ASN D  97      10.472 166.615  82.337  1.00 78.34           C  
ATOM  10358  OD1 ASN D  97       9.470 167.071  81.789  1.00 78.12           O  
ATOM  10359  ND2 ASN D  97      11.099 167.244  83.319  1.00 79.66           N  
ATOM  10360  N   PRO D  98       9.198 163.683  79.925  1.00 76.10           N  
ATOM  10361  CA  PRO D  98       7.838 163.386  79.461  1.00 75.65           C  
ATOM  10362  C   PRO D  98       6.774 164.347  79.963  1.00 74.56           C  
ATOM  10363  O   PRO D  98       5.931 164.797  79.191  1.00 73.05           O  
ATOM  10364  CB  PRO D  98       7.609 161.952  79.940  1.00 76.28           C  
ATOM  10365  CG  PRO D  98       8.551 161.828  81.112  1.00 76.51           C  
ATOM  10366  CD  PRO D  98       9.778 162.521  80.611  1.00 76.52           C  
ATOM  10367  N   GLU D  99       6.829 164.665  81.253  1.00 74.27           N  
ATOM  10368  CA  GLU D  99       5.859 165.570  81.859  1.00 74.46           C  
ATOM  10369  C   GLU D  99       5.715 166.843  81.020  1.00 73.14           C  
ATOM  10370  O   GLU D  99       4.604 167.322  80.773  1.00 72.02           O  
ATOM  10371  CB  GLU D  99       6.287 165.927  83.288  1.00 75.97           C  
ATOM  10372  CG  GLU D  99       6.317 164.761  84.285  1.00 78.26           C  
ATOM  10373  CD  GLU D  99       7.410 163.733  83.984  1.00 81.28           C  
ATOM  10374  OE1 GLU D  99       8.329 164.037  83.185  1.00 83.71           O  
ATOM  10375  OE2 GLU D  99       7.360 162.621  84.561  1.00 81.08           O  
ATOM  10376  N   ALA D 100       6.848 167.382  80.582  1.00 71.94           N  
ATOM  10377  CA  ALA D 100       6.858 168.590  79.758  1.00 71.17           C  
ATOM  10378  C   ALA D 100       6.280 168.282  78.379  1.00 70.13           C  
ATOM  10379  O   ALA D 100       5.415 168.998  77.872  1.00 69.68           O  
ATOM  10380  CB  ALA D 100       8.287 169.113  79.618  1.00 71.01           C  
ATOM  10381  N   ALA D 101       6.774 167.209  77.775  1.00 68.72           N  
ATOM  10382  CA  ALA D 101       6.315 166.801  76.467  1.00 67.43           C  
ATOM  10383  C   ALA D 101       4.802 166.636  76.469  1.00 66.56           C  
ATOM  10384  O   ALA D 101       4.121 167.190  75.606  1.00 67.08           O  
ATOM  10385  CB  ALA D 101       6.983 165.509  76.071  1.00 66.75           C  
ATOM  10386  N   ARG D 102       4.283 165.875  77.435  1.00 65.56           N  
ATOM  10387  CA  ARG D 102       2.840 165.642  77.547  1.00 63.81           C  
ATOM  10388  C   ARG D 102       2.117 166.969  77.655  1.00 64.35           C  
ATOM  10389  O   ARG D 102       1.113 167.188  76.983  1.00 64.04           O  
ATOM  10390  CB  ARG D 102       2.505 164.807  78.780  1.00 62.37           C  
ATOM  10391  CG  ARG D 102       2.751 163.330  78.648  1.00 60.72           C  
ATOM  10392  CD  ARG D 102       2.264 162.618  79.911  1.00 61.97           C  
ATOM  10393  NE  ARG D 102       2.516 161.177  79.903  1.00 61.06           N  
ATOM  10394  CZ  ARG D 102       2.087 160.346  78.955  1.00 60.72           C  
ATOM  10395  NH1 ARG D 102       1.380 160.814  77.932  1.00 60.50           N  
ATOM  10396  NH2 ARG D 102       2.377 159.046  79.017  1.00 60.12           N  
ATOM  10397  N   ALA D 103       2.643 167.849  78.508  1.00 65.13           N  
ATOM  10398  CA  ALA D 103       2.070 169.174  78.713  1.00 65.53           C  
ATOM  10399  C   ALA D 103       1.903 169.901  77.387  1.00 66.07           C  
ATOM  10400  O   ALA D 103       0.909 170.585  77.157  1.00 68.01           O  
ATOM  10401  CB  ALA D 103       2.958 169.988  79.623  1.00 65.06           C  
ATOM  10402  N   ALA D 104       2.876 169.738  76.505  1.00 65.74           N  
ATOM  10403  CA  ALA D 104       2.831 170.407  75.221  1.00 64.90           C  
ATOM  10404  C   ALA D 104       2.095 169.656  74.123  1.00 64.46           C  
ATOM  10405  O   ALA D 104       2.101 170.110  72.973  1.00 65.03           O  
ATOM  10406  CB  ALA D 104       4.245 170.714  74.764  1.00 66.31           C  
ATOM  10407  N   ASN D 105       1.467 168.527  74.450  1.00 62.22           N  
ATOM  10408  CA  ASN D 105       0.761 167.750  73.436  1.00 60.93           C  
ATOM  10409  C   ASN D 105      -0.543 167.184  73.950  1.00 61.96           C  
ATOM  10410  O   ASN D 105      -0.960 166.105  73.533  1.00 61.65           O  
ATOM  10411  CB  ASN D 105       1.625 166.589  72.943  1.00 59.23           C  
ATOM  10412  CG  ASN D 105       2.738 167.022  72.002  1.00 57.65           C  
ATOM  10413  OD1 ASN D 105       2.519 167.237  70.803  1.00 56.21           O  
ATOM  10414  ND2 ASN D 105       3.950 167.137  72.543  1.00 56.10           N  
ATOM  10415  N   ASN D 106      -1.188 167.900  74.859  1.00 63.52           N  
ATOM  10416  CA  ASN D 106      -2.461 167.438  75.402  1.00 65.75           C  
ATOM  10417  C   ASN D 106      -2.297 166.202  76.244  1.00 64.63           C  
ATOM  10418  O   ASN D 106      -3.075 165.270  76.129  1.00 65.31           O  
ATOM  10419  CB  ASN D 106      -3.448 167.106  74.282  1.00 71.42           C  
ATOM  10420  CG  ASN D 106      -3.879 168.330  73.503  1.00 78.09           C  
ATOM  10421  OD1 ASN D 106      -4.449 169.272  74.075  1.00 81.89           O  
ATOM  10422  ND2 ASN D 106      -3.613 168.331  72.187  1.00 80.24           N  
ATOM  10423  N   GLY D 107      -1.279 166.180  77.087  1.00 64.52           N  
ATOM  10424  CA  GLY D 107      -1.075 165.023  77.940  1.00 62.81           C  
ATOM  10425  C   GLY D 107      -0.681 163.758  77.202  1.00 60.31           C  
ATOM  10426  O   GLY D 107      -0.581 162.707  77.824  1.00 59.46           O  
ATOM  10427  N   ALA D 108      -0.468 163.862  75.887  1.00 58.72           N  
ATOM  10428  CA  ALA D 108      -0.055 162.732  75.049  1.00 56.58           C  
ATOM  10429  C   ALA D 108       1.465 162.718  75.019  1.00 56.79           C  
ATOM  10430  O   ALA D 108       2.109 163.735  75.254  1.00 59.05           O  
ATOM  10431  CB  ALA D 108      -0.584 162.896  73.651  1.00 54.59           C  
ATOM  10432  N   LEU D 109       2.059 161.576  74.724  1.00 55.59           N  
ATOM  10433  CA  LEU D 109       3.509 161.519  74.712  1.00 51.54           C  
ATOM  10434  C   LEU D 109       4.089 160.985  73.427  1.00 49.81           C  
ATOM  10435  O   LEU D 109       3.963 159.803  73.104  1.00 48.72           O  
ATOM  10436  CB  LEU D 109       4.009 160.679  75.887  1.00 50.65           C  
ATOM  10437  CG  LEU D 109       5.526 160.571  76.063  1.00 49.29           C  
ATOM  10438  CD1 LEU D 109       6.164 161.928  75.918  1.00 49.71           C  
ATOM  10439  CD2 LEU D 109       5.839 160.006  77.420  1.00 46.86           C  
ATOM  10440  N   PRO D 110       4.715 161.864  72.656  1.00 48.10           N  
ATOM  10441  CA  PRO D 110       5.315 161.423  71.396  1.00 47.26           C  
ATOM  10442  C   PRO D 110       6.589 160.662  71.738  1.00 47.21           C  
ATOM  10443  O   PRO D 110       7.578 161.244  72.206  1.00 47.82           O  
ATOM  10444  CB  PRO D 110       5.575 162.730  70.655  1.00 45.69           C  
ATOM  10445  CG  PRO D 110       5.790 163.706  71.761  1.00 47.78           C  
ATOM  10446  CD  PRO D 110       4.753 163.324  72.797  1.00 46.79           C  
ATOM  10447  N   PRO D 111       6.572 159.338  71.519  1.00 46.33           N  
ATOM  10448  CA  PRO D 111       7.670 158.401  71.772  1.00 45.50           C  
ATOM  10449  C   PRO D 111       8.999 158.679  71.027  1.00 46.60           C  
ATOM  10450  O   PRO D 111       9.051 159.316  69.951  1.00 46.04           O  
ATOM  10451  CB  PRO D 111       7.063 157.070  71.360  1.00 43.14           C  
ATOM  10452  CG  PRO D 111       6.208 157.440  70.231  1.00 42.36           C  
ATOM  10453  CD  PRO D 111       5.499 158.662  70.767  1.00 45.67           C  
ATOM  10454  N   ASP D 112      10.086 158.193  71.607  1.00 44.69           N  
ATOM  10455  CA  ASP D 112      11.364 158.394  70.972  1.00 44.50           C  
ATOM  10456  C   ASP D 112      11.298 157.529  69.729  1.00 43.53           C  
ATOM  10457  O   ASP D 112      10.819 156.406  69.787  1.00 43.04           O  
ATOM  10458  CB  ASP D 112      12.494 157.966  71.920  1.00 44.98           C  
ATOM  10459  CG  ASP D 112      13.855 158.043  71.271  1.00 45.94           C  
ATOM  10460  OD1 ASP D 112      14.273 157.020  70.682  1.00 47.45           O  
ATOM  10461  OD2 ASP D 112      14.492 159.121  71.331  1.00 43.87           O  
ATOM  10462  N   LEU D 113      11.754 158.056  68.602  1.00 43.12           N  
ATOM  10463  CA  LEU D 113      11.712 157.304  67.366  1.00 43.43           C  
ATOM  10464  C   LEU D 113      12.932 156.453  67.061  1.00 43.93           C  
ATOM  10465  O   LEU D 113      13.018 155.875  65.987  1.00 46.59           O  
ATOM  10466  CB  LEU D 113      11.472 158.254  66.205  1.00 43.02           C  
ATOM  10467  CG  LEU D 113      10.129 158.976  66.287  1.00 45.24           C  
ATOM  10468  CD1 LEU D 113       9.967 159.844  65.075  1.00 46.12           C  
ATOM  10469  CD2 LEU D 113       8.989 157.976  66.357  1.00 46.17           C  
ATOM  10470  N   SER D 114      13.860 156.335  67.997  1.00 43.75           N  
ATOM  10471  CA  SER D 114      15.071 155.573  67.724  1.00 44.62           C  
ATOM  10472  C   SER D 114      14.826 154.133  67.278  1.00 46.14           C  
ATOM  10473  O   SER D 114      15.428 153.656  66.307  1.00 46.00           O  
ATOM  10474  CB  SER D 114      15.997 155.597  68.948  1.00 45.01           C  
ATOM  10475  OG  SER D 114      16.465 156.908  69.246  1.00 46.41           O  
ATOM  10476  N   TYR D 115      13.945 153.436  67.985  1.00 47.93           N  
ATOM  10477  CA  TYR D 115      13.644 152.047  67.651  1.00 49.97           C  
ATOM  10478  C   TYR D 115      12.157 151.850  67.282  1.00 52.16           C  
ATOM  10479  O   TYR D 115      11.604 150.750  67.411  1.00 52.96           O  
ATOM  10480  CB  TYR D 115      13.986 151.150  68.842  1.00 49.28           C  
ATOM  10481  CG  TYR D 115      15.454 151.010  69.136  1.00 49.39           C  
ATOM  10482  CD1 TYR D 115      16.108 151.856  70.043  1.00 49.15           C  
ATOM  10483  CD2 TYR D 115      16.195 150.045  68.498  1.00 50.29           C  
ATOM  10484  CE1 TYR D 115      17.473 151.732  70.296  1.00 48.67           C  
ATOM  10485  CE2 TYR D 115      17.555 149.909  68.743  1.00 53.56           C  
ATOM  10486  CZ  TYR D 115      18.191 150.751  69.640  1.00 51.15           C  
ATOM  10487  OH  TYR D 115      19.537 150.560  69.866  1.00 53.18           O  
ATOM  10488  N   ILE D 116      11.508 152.893  66.789  1.00 52.07           N  
ATOM  10489  CA  ILE D 116      10.098 152.759  66.508  1.00 51.23           C  
ATOM  10490  C   ILE D 116       9.670 151.644  65.556  1.00 50.53           C  
ATOM  10491  O   ILE D 116       8.757 150.882  65.876  1.00 52.04           O  
ATOM  10492  CB  ILE D 116       9.521 154.077  66.008  1.00 51.63           C  
ATOM  10493  CG1 ILE D 116       8.000 154.023  66.077  1.00 50.40           C  
ATOM  10494  CG2 ILE D 116      10.001 154.349  64.602  1.00 53.52           C  
ATOM  10495  CD1 ILE D 116       7.496 153.838  67.480  1.00 47.95           C  
ATOM  10496  N   VAL D 117      10.310 151.519  64.402  1.00 48.05           N  
ATOM  10497  CA  VAL D 117       9.871 150.492  63.459  1.00 46.63           C  
ATOM  10498  C   VAL D 117      10.025 149.056  63.978  1.00 47.19           C  
ATOM  10499  O   VAL D 117       9.610 148.094  63.309  1.00 48.28           O  
ATOM  10500  CB  VAL D 117      10.577 150.618  62.060  1.00 45.37           C  
ATOM  10501  CG1 VAL D 117      10.283 151.977  61.433  1.00 42.35           C  
ATOM  10502  CG2 VAL D 117      12.067 150.394  62.202  1.00 45.30           C  
ATOM  10503  N   ASN D 118      10.613 148.900  65.161  1.00 45.82           N  
ATOM  10504  CA  ASN D 118      10.786 147.565  65.726  1.00 45.14           C  
ATOM  10505  C   ASN D 118      10.015 147.504  67.016  1.00 45.62           C  
ATOM  10506  O   ASN D 118       9.935 146.463  67.658  1.00 46.86           O  
ATOM  10507  CB  ASN D 118      12.262 147.233  66.004  1.00 43.81           C  
ATOM  10508  CG  ASN D 118      13.058 146.971  64.736  1.00 45.45           C  
ATOM  10509  OD1 ASN D 118      12.526 146.491  63.736  1.00 48.77           O  
ATOM  10510  ND2 ASN D 118      14.348 147.266  64.780  1.00 46.95           N  
ATOM  10511  N   ALA D 119       9.447 148.632  67.406  1.00 45.26           N  
ATOM  10512  CA  ALA D 119       8.670 148.681  68.630  1.00 45.41           C  
ATOM  10513  C   ALA D 119       7.196 148.552  68.299  1.00 45.25           C  
ATOM  10514  O   ALA D 119       6.341 148.545  69.183  1.00 45.41           O  
ATOM  10515  CB  ALA D 119       8.911 149.982  69.332  1.00 47.92           C  
ATOM  10516  N   ARG D 120       6.909 148.449  67.012  1.00 44.19           N  
ATOM  10517  CA  ARG D 120       5.550 148.354  66.548  1.00 43.16           C  
ATOM  10518  C   ARG D 120       5.410 147.226  65.533  1.00 44.71           C  
ATOM  10519  O   ARG D 120       6.257 147.082  64.642  1.00 46.10           O  
ATOM  10520  CB  ARG D 120       5.174 149.683  65.903  1.00 41.20           C  
ATOM  10521  CG  ARG D 120       5.151 150.849  66.859  1.00 39.14           C  
ATOM  10522  CD  ARG D 120       3.943 150.791  67.777  1.00 40.43           C  
ATOM  10523  NE  ARG D 120       3.813 151.987  68.603  1.00 41.18           N  
ATOM  10524  CZ  ARG D 120       4.641 152.296  69.598  1.00 43.98           C  
ATOM  10525  NH1 ARG D 120       5.659 151.503  69.901  1.00 45.96           N  
ATOM  10526  NH2 ARG D 120       4.477 153.414  70.281  1.00 46.21           N  
ATOM  10527  N   HIS D 121       4.360 146.414  65.662  1.00 45.08           N  
ATOM  10528  CA  HIS D 121       4.145 145.349  64.683  1.00 44.61           C  
ATOM  10529  C   HIS D 121       3.881 146.026  63.345  1.00 44.28           C  
ATOM  10530  O   HIS D 121       3.129 147.001  63.271  1.00 44.20           O  
ATOM  10531  CB  HIS D 121       2.915 144.522  65.014  1.00 47.66           C  
ATOM  10532  CG  HIS D 121       3.089 143.582  66.162  1.00 50.49           C  
ATOM  10533  ND1 HIS D 121       2.664 143.876  67.441  1.00 53.92           N  
ATOM  10534  CD2 HIS D 121       3.594 142.328  66.212  1.00 49.88           C  
ATOM  10535  CE1 HIS D 121       2.898 142.840  68.230  1.00 53.60           C  
ATOM  10536  NE2 HIS D 121       3.460 141.888  67.506  1.00 52.07           N  
ATOM  10537  N   GLY D 122       4.475 145.511  62.281  1.00 44.02           N  
ATOM  10538  CA  GLY D 122       4.247 146.111  60.982  1.00 44.84           C  
ATOM  10539  C   GLY D 122       5.451 146.917  60.570  1.00 46.85           C  
ATOM  10540  O   GLY D 122       5.829 146.916  59.401  1.00 48.92           O  
ATOM  10541  N   GLY D 123       6.058 147.614  61.524  1.00 46.48           N  
ATOM  10542  CA  GLY D 123       7.243 148.381  61.203  1.00 47.80           C  
ATOM  10543  C   GLY D 123       6.983 149.508  60.236  1.00 49.02           C  
ATOM  10544  O   GLY D 123       6.008 150.223  60.402  1.00 50.18           O  
ATOM  10545  N   GLU D 124       7.846 149.687  59.240  1.00 49.98           N  
ATOM  10546  CA  GLU D 124       7.640 150.770  58.292  1.00 51.23           C  
ATOM  10547  C   GLU D 124       6.279 150.645  57.659  1.00 52.29           C  
ATOM  10548  O   GLU D 124       5.572 151.638  57.499  1.00 54.73           O  
ATOM  10549  CB  GLU D 124       8.705 150.787  57.201  1.00 50.65           C  
ATOM  10550  CG  GLU D 124       9.162 149.436  56.740  1.00 51.65           C  
ATOM  10551  CD  GLU D 124      10.326 148.925  57.571  1.00 50.67           C  
ATOM  10552  OE1 GLU D 124      10.127 148.657  58.775  1.00 48.63           O  
ATOM  10553  OE2 GLU D 124      11.440 148.809  57.016  1.00 48.68           O  
ATOM  10554  N   ASP D 125       5.894 149.431  57.304  1.00 52.39           N  
ATOM  10555  CA  ASP D 125       4.586 149.246  56.711  1.00 54.03           C  
ATOM  10556  C   ASP D 125       3.499 149.850  57.603  1.00 53.44           C  
ATOM  10557  O   ASP D 125       2.532 150.418  57.114  1.00 55.63           O  
ATOM  10558  CB  ASP D 125       4.328 147.759  56.454  1.00 57.33           C  
ATOM  10559  CG  ASP D 125       4.900 147.292  55.118  1.00 60.29           C  
ATOM  10560  OD1 ASP D 125       4.961 146.066  54.860  1.00 61.46           O  
ATOM  10561  OD2 ASP D 125       5.282 148.168  54.314  1.00 63.65           O  
ATOM  10562  N   TYR D 126       3.651 149.741  58.912  1.00 51.53           N  
ATOM  10563  CA  TYR D 126       2.665 150.323  59.813  1.00 50.38           C  
ATOM  10564  C   TYR D 126       2.819 151.841  59.801  1.00 50.20           C  
ATOM  10565  O   TYR D 126       1.927 152.550  59.394  1.00 51.96           O  
ATOM  10566  CB  TYR D 126       2.873 149.796  61.230  1.00 49.10           C  
ATOM  10567  CG  TYR D 126       2.112 150.549  62.297  1.00 48.46           C  
ATOM  10568  CD1 TYR D 126       0.736 150.400  62.437  1.00 48.46           C  
ATOM  10569  CD2 TYR D 126       2.774 151.404  63.178  1.00 47.94           C  
ATOM  10570  CE1 TYR D 126       0.037 151.078  63.432  1.00 48.29           C  
ATOM  10571  CE2 TYR D 126       2.087 152.087  64.174  1.00 47.93           C  
ATOM  10572  CZ  TYR D 126       0.717 151.921  64.295  1.00 48.70           C  
ATOM  10573  OH  TYR D 126       0.021 152.615  65.260  1.00 49.29           O  
ATOM  10574  N   VAL D 127       3.962 152.331  60.252  1.00 50.68           N  
ATOM  10575  CA  VAL D 127       4.227 153.762  60.297  1.00 49.68           C  
ATOM  10576  C   VAL D 127       3.732 154.464  59.041  1.00 49.19           C  
ATOM  10577  O   VAL D 127       3.072 155.509  59.122  1.00 49.61           O  
ATOM  10578  CB  VAL D 127       5.753 154.029  60.484  1.00 48.77           C  
ATOM  10579  CG1 VAL D 127       6.070 155.503  60.329  1.00 46.01           C  
ATOM  10580  CG2 VAL D 127       6.184 153.553  61.853  1.00 47.61           C  
ATOM  10581  N   PHE D 128       4.037 153.892  57.884  1.00 47.65           N  
ATOM  10582  CA  PHE D 128       3.615 154.496  56.623  1.00 48.93           C  
ATOM  10583  C   PHE D 128       2.094 154.563  56.526  1.00 49.20           C  
ATOM  10584  O   PHE D 128       1.512 155.633  56.348  1.00 50.52           O  
ATOM  10585  CB  PHE D 128       4.157 153.701  55.450  1.00 48.90           C  
ATOM  10586  CG  PHE D 128       3.899 154.339  54.122  1.00 50.03           C  
ATOM  10587  CD1 PHE D 128       4.790 155.262  53.590  1.00 50.21           C  
ATOM  10588  CD2 PHE D 128       2.785 153.982  53.371  1.00 49.33           C  
ATOM  10589  CE1 PHE D 128       4.572 155.803  52.324  1.00 48.34           C  
ATOM  10590  CE2 PHE D 128       2.571 154.527  52.107  1.00 46.17           C  
ATOM  10591  CZ  PHE D 128       3.458 155.425  51.591  1.00 45.58           C  
ATOM  10592  N   SER D 129       1.446 153.414  56.645  1.00 49.25           N  
ATOM  10593  CA  SER D 129      -0.013 153.357  56.603  1.00 49.88           C  
ATOM  10594  C   SER D 129      -0.673 154.360  57.541  1.00 48.54           C  
ATOM  10595  O   SER D 129      -1.659 154.995  57.183  1.00 51.81           O  
ATOM  10596  CB  SER D 129      -0.495 151.953  56.955  1.00 50.00           C  
ATOM  10597  OG  SER D 129      -0.077 151.038  55.956  1.00 54.40           O  
ATOM  10598  N   LEU D 130      -0.122 154.504  58.736  1.00 46.69           N  
ATOM  10599  CA  LEU D 130      -0.656 155.422  59.729  1.00 45.28           C  
ATOM  10600  C   LEU D 130      -0.514 156.872  59.344  1.00 46.89           C  
ATOM  10601  O   LEU D 130      -1.439 157.652  59.548  1.00 47.27           O  
ATOM  10602  CB  LEU D 130       0.041 155.227  61.060  1.00 42.12           C  
ATOM  10603  CG  LEU D 130      -0.399 156.188  62.146  1.00 37.87           C  
ATOM  10604  CD1 LEU D 130      -1.196 155.493  63.206  1.00 37.41           C  
ATOM  10605  CD2 LEU D 130       0.835 156.740  62.760  1.00 42.32           C  
ATOM  10606  N   LEU D 131       0.650 157.237  58.812  1.00 47.91           N  
ATOM  10607  CA  LEU D 131       0.902 158.617  58.418  1.00 48.98           C  
ATOM  10608  C   LEU D 131      -0.027 159.053  57.311  1.00 51.74           C  
ATOM  10609  O   LEU D 131      -0.628 160.135  57.355  1.00 53.29           O  
ATOM  10610  CB  LEU D 131       2.340 158.781  57.949  1.00 46.14           C  
ATOM  10611  CG  LEU D 131       3.375 158.687  59.058  1.00 44.18           C  
ATOM  10612  CD1 LEU D 131       4.738 158.911  58.466  1.00 45.13           C  
ATOM  10613  CD2 LEU D 131       3.090 159.714  60.118  1.00 41.62           C  
ATOM  10614  N   THR D 132      -0.141 158.196  56.310  1.00 52.87           N  
ATOM  10615  CA  THR D 132      -0.989 158.464  55.165  1.00 53.70           C  
ATOM  10616  C   THR D 132      -2.414 157.942  55.377  1.00 54.64           C  
ATOM  10617  O   THR D 132      -3.195 157.914  54.444  1.00 57.03           O  
ATOM  10618  CB  THR D 132      -0.420 157.756  53.932  1.00 53.62           C  
ATOM  10619  OG1 THR D 132      -0.608 156.339  54.076  1.00 54.37           O  
ATOM  10620  CG2 THR D 132       1.060 158.035  53.794  1.00 51.69           C  
ATOM  10621  N   GLY D 133      -2.770 157.540  56.589  1.00 55.16           N  
ATOM  10622  CA  GLY D 133      -4.093 156.971  56.783  1.00 54.68           C  
ATOM  10623  C   GLY D 133      -5.189 157.700  57.535  1.00 54.94           C  
ATOM  10624  O   GLY D 133      -6.233 157.091  57.815  1.00 53.66           O  
ATOM  10625  N   TYR D 134      -4.993 158.979  57.855  1.00 54.62           N  
ATOM  10626  CA  TYR D 134      -6.026 159.712  58.589  1.00 54.55           C  
ATOM  10627  C   TYR D 134      -7.293 159.929  57.750  1.00 55.62           C  
ATOM  10628  O   TYR D 134      -7.245 160.021  56.516  1.00 54.26           O  
ATOM  10629  CB  TYR D 134      -5.508 161.071  59.063  1.00 53.12           C  
ATOM  10630  CG  TYR D 134      -4.483 161.026  60.172  1.00 51.33           C  
ATOM  10631  CD1 TYR D 134      -3.121 160.929  59.895  1.00 51.33           C  
ATOM  10632  CD2 TYR D 134      -4.871 161.129  61.500  1.00 50.73           C  
ATOM  10633  CE1 TYR D 134      -2.175 160.946  60.918  1.00 48.52           C  
ATOM  10634  CE2 TYR D 134      -3.935 161.145  62.522  1.00 48.95           C  
ATOM  10635  CZ  TYR D 134      -2.597 161.057  62.219  1.00 48.46           C  
ATOM  10636  OH  TYR D 134      -1.687 161.104  63.231  1.00 49.80           O  
ATOM  10637  N   CYS D 135      -8.429 160.013  58.431  1.00 56.92           N  
ATOM  10638  CA  CYS D 135      -9.706 160.217  57.761  1.00 57.79           C  
ATOM  10639  C   CYS D 135     -10.775 160.399  58.812  1.00 59.27           C  
ATOM  10640  O   CYS D 135     -10.498 160.296  60.009  1.00 59.38           O  
ATOM  10641  CB  CYS D 135     -10.058 159.026  56.873  1.00 57.24           C  
ATOM  10642  SG  CYS D 135     -10.287 157.478  57.759  1.00 58.86           S  
ATOM  10643  N   ASP D 136     -11.998 160.658  58.358  1.00 61.23           N  
ATOM  10644  CA  ASP D 136     -13.127 160.891  59.255  1.00 61.75           C  
ATOM  10645  C   ASP D 136     -13.698 159.604  59.849  1.00 60.11           C  
ATOM  10646  O   ASP D 136     -13.789 158.569  59.180  1.00 59.14           O  
ATOM  10647  CB  ASP D 136     -14.225 161.659  58.510  1.00 66.58           C  
ATOM  10648  CG  ASP D 136     -13.742 163.015  57.969  1.00 71.11           C  
ATOM  10649  OD1 ASP D 136     -13.390 163.903  58.788  1.00 73.55           O  
ATOM  10650  OD2 ASP D 136     -13.715 163.191  56.723  1.00 72.39           O  
ATOM  10651  N   PRO D 137     -14.114 159.662  61.116  1.00 58.08           N  
ATOM  10652  CA  PRO D 137     -14.673 158.487  61.782  1.00 58.54           C  
ATOM  10653  C   PRO D 137     -15.935 157.989  61.119  1.00 59.50           C  
ATOM  10654  O   PRO D 137     -16.722 158.765  60.576  1.00 60.14           O  
ATOM  10655  CB  PRO D 137     -14.926 158.979  63.199  1.00 57.32           C  
ATOM  10656  CG  PRO D 137     -15.285 160.391  62.978  1.00 58.74           C  
ATOM  10657  CD  PRO D 137     -14.298 160.868  61.933  1.00 57.88           C  
ATOM  10658  N   PRO D 138     -16.140 156.673  61.133  1.00 60.40           N  
ATOM  10659  CA  PRO D 138     -17.336 156.098  60.523  1.00 61.09           C  
ATOM  10660  C   PRO D 138     -18.529 156.362  61.432  1.00 62.14           C  
ATOM  10661  O   PRO D 138     -18.364 156.813  62.579  1.00 62.24           O  
ATOM  10662  CB  PRO D 138     -16.986 154.632  60.443  1.00 59.85           C  
ATOM  10663  CG  PRO D 138     -16.191 154.439  61.683  1.00 59.35           C  
ATOM  10664  CD  PRO D 138     -15.270 155.618  61.667  1.00 59.33           C  
ATOM  10665  N   ALA D 139     -19.721 156.083  60.917  1.00 62.55           N  
ATOM  10666  CA  ALA D 139     -20.950 156.288  61.674  1.00 63.62           C  
ATOM  10667  C   ALA D 139     -20.928 155.587  63.041  1.00 64.10           C  
ATOM  10668  O   ALA D 139     -20.423 154.471  63.165  1.00 64.01           O  
ATOM  10669  CB  ALA D 139     -22.131 155.798  60.862  1.00 63.51           C  
ATOM  10670  N   GLY D 140     -21.483 156.253  64.056  1.00 64.52           N  
ATOM  10671  CA  GLY D 140     -21.534 155.693  65.400  1.00 64.61           C  
ATOM  10672  C   GLY D 140     -20.314 155.967  66.267  1.00 64.92           C  
ATOM  10673  O   GLY D 140     -20.347 155.815  67.493  1.00 64.72           O  
ATOM  10674  N   VAL D 141     -19.235 156.396  65.631  1.00 64.99           N  
ATOM  10675  CA  VAL D 141     -18.001 156.661  66.337  1.00 65.43           C  
ATOM  10676  C   VAL D 141     -17.758 158.133  66.620  1.00 66.46           C  
ATOM  10677  O   VAL D 141     -17.965 158.974  65.745  1.00 67.85           O  
ATOM  10678  CB  VAL D 141     -16.835 156.149  65.515  1.00 65.08           C  
ATOM  10679  CG1 VAL D 141     -15.569 156.167  66.338  1.00 66.01           C  
ATOM  10680  CG2 VAL D 141     -17.144 154.770  65.017  1.00 64.82           C  
ATOM  10681  N   VAL D 142     -17.313 158.446  67.835  1.00 66.91           N  
ATOM  10682  CA  VAL D 142     -16.991 159.831  68.188  1.00 69.11           C  
ATOM  10683  C   VAL D 142     -15.577 159.917  68.762  1.00 70.01           C  
ATOM  10684  O   VAL D 142     -15.219 159.217  69.713  1.00 70.99           O  
ATOM  10685  CB  VAL D 142     -17.981 160.434  69.219  1.00 69.20           C  
ATOM  10686  CG1 VAL D 142     -19.379 160.417  68.649  1.00 69.34           C  
ATOM  10687  CG2 VAL D 142     -17.925 159.658  70.541  1.00 71.34           C  
ATOM  10688  N   VAL D 143     -14.766 160.774  68.165  1.00 70.59           N  
ATOM  10689  CA  VAL D 143     -13.397 160.965  68.618  1.00 72.29           C  
ATOM  10690  C   VAL D 143     -13.394 162.078  69.671  1.00 73.46           C  
ATOM  10691  O   VAL D 143     -13.673 163.238  69.338  1.00 73.41           O  
ATOM  10692  CB  VAL D 143     -12.506 161.387  67.431  1.00 72.92           C  
ATOM  10693  CG1 VAL D 143     -11.158 161.870  67.932  1.00 73.87           C  
ATOM  10694  CG2 VAL D 143     -12.347 160.224  66.458  1.00 72.43           C  
ATOM  10695  N   ARG D 144     -13.077 161.752  70.925  1.00 74.16           N  
ATOM  10696  CA  ARG D 144     -13.100 162.795  71.942  1.00 76.43           C  
ATOM  10697  C   ARG D 144     -12.156 163.929  71.565  1.00 77.52           C  
ATOM  10698  O   ARG D 144     -11.154 163.723  70.876  1.00 77.07           O  
ATOM  10699  CB  ARG D 144     -12.795 162.245  73.344  1.00 76.79           C  
ATOM  10700  CG  ARG D 144     -11.353 162.206  73.748  1.00 81.34           C  
ATOM  10701  CD  ARG D 144     -11.234 161.980  75.257  1.00 85.11           C  
ATOM  10702  NE  ARG D 144      -9.863 161.678  75.683  1.00 89.06           N  
ATOM  10703  CZ  ARG D 144      -8.826 162.508  75.556  1.00 90.52           C  
ATOM  10704  NH1 ARG D 144      -8.989 163.711  75.011  1.00 91.31           N  
ATOM  10705  NH2 ARG D 144      -7.620 162.130  75.970  1.00 91.11           N  
ATOM  10706  N   GLU D 145     -12.513 165.135  71.995  1.00 79.63           N  
ATOM  10707  CA  GLU D 145     -11.747 166.332  71.688  1.00 80.96           C  
ATOM  10708  C   GLU D 145     -10.264 166.167  71.948  1.00 79.19           C  
ATOM  10709  O   GLU D 145      -9.862 165.561  72.938  1.00 79.70           O  
ATOM  10710  CB  GLU D 145     -12.263 167.517  72.503  1.00 85.27           C  
ATOM  10711  CG  GLU D 145     -11.417 168.772  72.319  1.00 93.79           C  
ATOM  10712  CD  GLU D 145     -11.677 169.848  73.371  1.00 98.38           C  
ATOM  10713  OE1 GLU D 145     -11.704 169.509  74.586  1.00 99.59           O  
ATOM  10714  OE2 GLU D 145     -11.834 171.034  72.974  1.00101.00           O  
ATOM  10715  N   GLY D 146      -9.454 166.724  71.055  1.00 76.67           N  
ATOM  10716  CA  GLY D 146      -8.018 166.642  71.221  1.00 73.56           C  
ATOM  10717  C   GLY D 146      -7.431 165.443  70.515  1.00 71.09           C  
ATOM  10718  O   GLY D 146      -6.213 165.361  70.331  1.00 71.35           O  
ATOM  10719  N   LEU D 147      -8.295 164.511  70.123  1.00 68.49           N  
ATOM  10720  CA  LEU D 147      -7.850 163.309  69.425  1.00 65.67           C  
ATOM  10721  C   LEU D 147      -8.258 163.347  67.960  1.00 63.94           C  
ATOM  10722  O   LEU D 147      -9.207 164.044  67.598  1.00 64.24           O  
ATOM  10723  CB  LEU D 147      -8.430 162.068  70.090  1.00 64.85           C  
ATOM  10724  CG  LEU D 147      -8.018 161.839  71.541  1.00 63.54           C  
ATOM  10725  CD1 LEU D 147      -8.585 160.525  72.009  1.00 63.04           C  
ATOM  10726  CD2 LEU D 147      -6.514 161.824  71.651  1.00 63.20           C  
ATOM  10727  N   HIS D 148      -7.527 162.612  67.122  1.00 61.18           N  
ATOM  10728  CA  HIS D 148      -7.807 162.562  65.689  1.00 59.49           C  
ATOM  10729  C   HIS D 148      -8.068 161.143  65.230  1.00 58.10           C  
ATOM  10730  O   HIS D 148      -7.475 160.195  65.736  1.00 60.15           O  
ATOM  10731  CB  HIS D 148      -6.646 163.136  64.899  1.00 60.78           C  
ATOM  10732  CG  HIS D 148      -6.205 164.477  65.383  1.00 63.22           C  
ATOM  10733  ND1 HIS D 148      -5.831 165.487  64.527  1.00 64.32           N  
ATOM  10734  CD2 HIS D 148      -6.073 164.974  66.636  1.00 64.59           C  
ATOM  10735  CE1 HIS D 148      -5.490 166.552  65.233  1.00 66.05           C  
ATOM  10736  NE2 HIS D 148      -5.628 166.267  66.516  1.00 65.42           N  
ATOM  10737  N   TYR D 149      -8.953 160.982  64.264  1.00 56.04           N  
ATOM  10738  CA  TYR D 149      -9.253 159.643  63.827  1.00 54.03           C  
ATOM  10739  C   TYR D 149      -8.250 159.095  62.827  1.00 54.00           C  
ATOM  10740  O   TYR D 149      -7.893 159.741  61.828  1.00 54.81           O  
ATOM  10741  CB  TYR D 149     -10.656 159.564  63.227  1.00 52.77           C  
ATOM  10742  CG  TYR D 149     -11.145 158.141  63.047  1.00 52.88           C  
ATOM  10743  CD1 TYR D 149     -11.728 157.447  64.112  1.00 52.79           C  
ATOM  10744  CD2 TYR D 149     -10.972 157.459  61.826  1.00 53.17           C  
ATOM  10745  CE1 TYR D 149     -12.124 156.111  63.972  1.00 53.30           C  
ATOM  10746  CE2 TYR D 149     -11.360 156.114  61.674  1.00 51.81           C  
ATOM  10747  CZ  TYR D 149     -11.934 155.451  62.751  1.00 53.76           C  
ATOM  10748  OH  TYR D 149     -12.313 154.130  62.618  1.00 55.89           O  
ATOM  10749  N   ASN D 150      -7.791 157.889  63.126  1.00 51.43           N  
ATOM  10750  CA  ASN D 150      -6.882 157.173  62.271  1.00 50.42           C  
ATOM  10751  C   ASN D 150      -7.335 155.727  62.438  1.00 50.50           C  
ATOM  10752  O   ASN D 150      -7.451 155.213  63.550  1.00 49.85           O  
ATOM  10753  CB  ASN D 150      -5.433 157.363  62.725  1.00 50.42           C  
ATOM  10754  CG  ASN D 150      -4.425 156.934  61.660  1.00 50.81           C  
ATOM  10755  OD1 ASN D 150      -4.405 155.774  61.232  1.00 50.11           O  
ATOM  10756  ND2 ASN D 150      -3.584 157.871  61.228  1.00 49.89           N  
ATOM  10757  N   PRO D 151      -7.654 155.063  61.329  1.00 50.73           N  
ATOM  10758  CA  PRO D 151      -8.097 153.678  61.445  1.00 51.64           C  
ATOM  10759  C   PRO D 151      -6.965 152.707  61.742  1.00 52.81           C  
ATOM  10760  O   PRO D 151      -7.192 151.649  62.323  1.00 55.01           O  
ATOM  10761  CB  PRO D 151      -8.759 153.428  60.101  1.00 51.63           C  
ATOM  10762  CG  PRO D 151      -7.980 154.309  59.173  1.00 49.39           C  
ATOM  10763  CD  PRO D 151      -7.811 155.565  59.955  1.00 49.98           C  
ATOM  10764  N   TYR D 152      -5.745 153.068  61.361  1.00 52.96           N  
ATOM  10765  CA  TYR D 152      -4.596 152.200  61.603  1.00 52.61           C  
ATOM  10766  C   TYR D 152      -4.056 152.220  63.036  1.00 52.30           C  
ATOM  10767  O   TYR D 152      -3.250 151.369  63.413  1.00 52.67           O  
ATOM  10768  CB  TYR D 152      -3.486 152.551  60.636  1.00 52.31           C  
ATOM  10769  CG  TYR D 152      -3.745 152.028  59.255  1.00 54.50           C  
ATOM  10770  CD1 TYR D 152      -3.763 150.664  59.004  1.00 55.12           C  
ATOM  10771  CD2 TYR D 152      -3.952 152.894  58.190  1.00 55.82           C  
ATOM  10772  CE1 TYR D 152      -3.975 150.169  57.723  1.00 55.20           C  
ATOM  10773  CE2 TYR D 152      -4.167 152.411  56.904  1.00 56.71           C  
ATOM  10774  CZ  TYR D 152      -4.174 151.048  56.682  1.00 56.82           C  
ATOM  10775  OH  TYR D 152      -4.362 150.570  55.411  1.00 59.06           O  
ATOM  10776  N   PHE D 153      -4.504 153.180  63.836  1.00 50.01           N  
ATOM  10777  CA  PHE D 153      -4.052 153.268  65.208  1.00 48.90           C  
ATOM  10778  C   PHE D 153      -4.959 152.434  66.078  1.00 49.50           C  
ATOM  10779  O   PHE D 153      -6.154 152.382  65.865  1.00 50.40           O  
ATOM  10780  CB  PHE D 153      -4.106 154.712  65.684  1.00 47.39           C  
ATOM  10781  CG  PHE D 153      -3.493 154.930  67.037  1.00 47.95           C  
ATOM  10782  CD1 PHE D 153      -2.106 154.865  67.215  1.00 46.88           C  
ATOM  10783  CD2 PHE D 153      -4.296 155.210  68.136  1.00 49.34           C  
ATOM  10784  CE1 PHE D 153      -1.528 155.077  68.461  1.00 44.90           C  
ATOM  10785  CE2 PHE D 153      -3.720 155.425  69.404  1.00 50.22           C  
ATOM  10786  CZ  PHE D 153      -2.329 155.358  69.560  1.00 46.88           C  
ATOM  10787  N   PRO D 154      -4.402 151.744  67.065  1.00 51.13           N  
ATOM  10788  CA  PRO D 154      -5.290 150.947  67.908  1.00 52.27           C  
ATOM  10789  C   PRO D 154      -6.208 151.821  68.753  1.00 53.16           C  
ATOM  10790  O   PRO D 154      -5.745 152.641  69.560  1.00 53.76           O  
ATOM  10791  CB  PRO D 154      -4.317 150.118  68.746  1.00 51.27           C  
ATOM  10792  CG  PRO D 154      -3.102 150.941  68.784  1.00 51.38           C  
ATOM  10793  CD  PRO D 154      -2.999 151.425  67.356  1.00 51.46           C  
ATOM  10794  N   GLY D 155      -7.512 151.627  68.562  1.00 53.81           N  
ATOM  10795  CA  GLY D 155      -8.505 152.399  69.287  1.00 53.99           C  
ATOM  10796  C   GLY D 155      -9.001 153.456  68.340  1.00 54.70           C  
ATOM  10797  O   GLY D 155     -10.045 154.063  68.563  1.00 57.31           O  
ATOM  10798  N   GLN D 156      -8.218 153.658  67.280  1.00 53.69           N  
ATOM  10799  CA  GLN D 156      -8.477 154.613  66.211  1.00 51.37           C  
ATOM  10800  C   GLN D 156      -8.429 156.089  66.573  1.00 50.29           C  
ATOM  10801  O   GLN D 156      -8.500 156.943  65.693  1.00 48.87           O  
ATOM  10802  CB  GLN D 156      -9.799 154.282  65.536  1.00 54.01           C  
ATOM  10803  CG  GLN D 156      -9.801 152.933  64.819  1.00 57.22           C  
ATOM  10804  CD  GLN D 156      -9.971 151.758  65.763  1.00 59.00           C  
ATOM  10805  OE1 GLN D 156     -10.960 151.678  66.489  1.00 60.07           O  
ATOM  10806  NE2 GLN D 156      -9.010 150.834  65.750  1.00 60.84           N  
ATOM  10807  N   ALA D 157      -8.293 156.399  67.856  1.00 50.79           N  
ATOM  10808  CA  ALA D 157      -8.221 157.798  68.272  1.00 51.94           C  
ATOM  10809  C   ALA D 157      -6.802 158.084  68.707  1.00 52.47           C  
ATOM  10810  O   ALA D 157      -6.402 157.726  69.825  1.00 52.94           O  
ATOM  10811  CB  ALA D 157      -9.173 158.064  69.418  1.00 54.08           C  
ATOM  10812  N   ILE D 158      -6.050 158.725  67.814  1.00 50.33           N  
ATOM  10813  CA  ILE D 158      -4.657 159.043  68.061  1.00 49.02           C  
ATOM  10814  C   ILE D 158      -4.482 160.473  68.536  1.00 49.05           C  
ATOM  10815  O   ILE D 158      -5.266 161.353  68.178  1.00 49.76           O  
ATOM  10816  CB  ILE D 158      -3.831 158.820  66.791  1.00 48.54           C  
ATOM  10817  CG1 ILE D 158      -2.334 158.876  67.121  1.00 49.70           C  
ATOM  10818  CG2 ILE D 158      -4.205 159.852  65.754  1.00 47.37           C  
ATOM  10819  CD1 ILE D 158      -1.423 158.357  66.003  1.00 47.94           C  
ATOM  10820  N   GLY D 159      -3.458 160.702  69.355  1.00 48.48           N  
ATOM  10821  CA  GLY D 159      -3.216 162.042  69.865  1.00 47.61           C  
ATOM  10822  C   GLY D 159      -2.312 162.866  68.967  1.00 46.93           C  
ATOM  10823  O   GLY D 159      -1.868 163.937  69.345  1.00 46.83           O  
ATOM  10824  N   MET D 160      -2.033 162.370  67.773  1.00 47.03           N  
ATOM  10825  CA  MET D 160      -1.161 163.089  66.865  1.00 47.95           C  
ATOM  10826  C   MET D 160      -1.926 163.616  65.643  1.00 49.71           C  
ATOM  10827  O   MET D 160      -2.600 162.877  64.928  1.00 49.30           O  
ATOM  10828  CB  MET D 160       0.017 162.186  66.423  1.00 45.49           C  
ATOM  10829  CG  MET D 160       0.993 162.855  65.461  1.00 43.59           C  
ATOM  10830  SD  MET D 160       2.409 161.874  64.915  1.00 45.84           S  
ATOM  10831  CE  MET D 160       1.581 160.494  64.170  1.00 41.20           C  
ATOM  10832  N   ALA D 161      -1.812 164.914  65.407  1.00 51.11           N  
ATOM  10833  CA  ALA D 161      -2.464 165.517  64.268  1.00 51.73           C  
ATOM  10834  C   ALA D 161      -1.666 165.108  63.051  1.00 52.75           C  
ATOM  10835  O   ALA D 161      -0.448 165.006  63.120  1.00 53.60           O  
ATOM  10836  CB  ALA D 161      -2.445 167.008  64.403  1.00 53.64           C  
ATOM  10837  N   PRO D 162      -2.339 164.893  61.912  1.00 53.48           N  
ATOM  10838  CA  PRO D 162      -1.645 164.494  60.678  1.00 52.67           C  
ATOM  10839  C   PRO D 162      -0.415 165.370  60.531  1.00 52.40           C  
ATOM  10840  O   PRO D 162      -0.515 166.550  60.221  1.00 52.45           O  
ATOM  10841  CB  PRO D 162      -2.678 164.768  59.604  1.00 52.65           C  
ATOM  10842  CG  PRO D 162      -3.989 164.542  60.345  1.00 51.94           C  
ATOM  10843  CD  PRO D 162      -3.743 165.248  61.639  1.00 52.56           C  
ATOM  10844  N   PRO D 163       0.762 164.794  60.773  1.00 52.03           N  
ATOM  10845  CA  PRO D 163       2.073 165.435  60.709  1.00 51.59           C  
ATOM  10846  C   PRO D 163       2.557 165.927  59.369  1.00 51.47           C  
ATOM  10847  O   PRO D 163       3.323 166.885  59.307  1.00 50.91           O  
ATOM  10848  CB  PRO D 163       2.991 164.372  61.284  1.00 51.87           C  
ATOM  10849  CG  PRO D 163       2.360 163.135  60.836  1.00 52.26           C  
ATOM  10850  CD  PRO D 163       0.907 163.373  61.114  1.00 52.30           C  
ATOM  10851  N   ILE D 164       2.133 165.285  58.296  1.00 51.97           N  
ATOM  10852  CA  ILE D 164       2.602 165.734  57.001  1.00 55.53           C  
ATOM  10853  C   ILE D 164       1.527 165.976  55.944  1.00 56.76           C  
ATOM  10854  O   ILE D 164       0.442 165.388  55.984  1.00 60.26           O  
ATOM  10855  CB  ILE D 164       3.655 164.757  56.415  1.00 56.25           C  
ATOM  10856  CG1 ILE D 164       3.096 163.341  56.375  1.00 57.36           C  
ATOM  10857  CG2 ILE D 164       4.908 164.788  57.245  1.00 55.45           C  
ATOM  10858  CD1 ILE D 164       4.020 162.363  55.705  1.00 58.14           C  
ATOM  10859  N   TYR D 165       1.850 166.855  55.002  1.00 54.88           N  
ATOM  10860  CA  TYR D 165       0.962 167.201  53.913  1.00 53.66           C  
ATOM  10861  C   TYR D 165       1.812 167.708  52.758  1.00 55.13           C  
ATOM  10862  O   TYR D 165       2.902 168.222  52.966  1.00 55.87           O  
ATOM  10863  CB  TYR D 165      -0.011 168.274  54.361  1.00 50.59           C  
ATOM  10864  CG  TYR D 165       0.638 169.469  55.021  1.00 47.78           C  
ATOM  10865  CD1 TYR D 165       0.511 169.680  56.392  1.00 48.73           C  
ATOM  10866  CD2 TYR D 165       1.314 170.421  54.276  1.00 45.77           C  
ATOM  10867  CE1 TYR D 165       1.027 170.813  57.008  1.00 46.51           C  
ATOM  10868  CE2 TYR D 165       1.839 171.553  54.875  1.00 46.12           C  
ATOM  10869  CZ  TYR D 165       1.690 171.747  56.242  1.00 47.47           C  
ATOM  10870  OH  TYR D 165       2.192 172.887  56.843  1.00 49.74           O  
ATOM  10871  N   ASN D 166       1.315 167.562  51.540  1.00 56.67           N  
ATOM  10872  CA  ASN D 166       2.059 167.984  50.366  1.00 58.50           C  
ATOM  10873  C   ASN D 166       2.812 169.287  50.526  1.00 59.03           C  
ATOM  10874  O   ASN D 166       2.366 170.199  51.228  1.00 58.17           O  
ATOM  10875  CB  ASN D 166       1.110 168.074  49.192  1.00 61.33           C  
ATOM  10876  CG  ASN D 166       0.509 166.751  48.869  1.00 65.67           C  
ATOM  10877  OD1 ASN D 166       1.064 165.994  48.071  1.00 69.53           O  
ATOM  10878  ND2 ASN D 166      -0.614 166.427  49.518  1.00 67.79           N  
ATOM  10879  N   GLU D 167       3.962 169.359  49.861  1.00 58.90           N  
ATOM  10880  CA  GLU D 167       4.826 170.534  49.894  1.00 58.18           C  
ATOM  10881  C   GLU D 167       5.084 171.085  51.304  1.00 56.08           C  
ATOM  10882  O   GLU D 167       5.552 172.214  51.433  1.00 57.62           O  
ATOM  10883  CB  GLU D 167       4.250 171.655  49.017  1.00 60.38           C  
ATOM  10884  CG  GLU D 167       4.078 171.317  47.536  1.00 66.64           C  
ATOM  10885  CD  GLU D 167       3.504 172.487  46.683  1.00 71.57           C  
ATOM  10886  OE1 GLU D 167       2.476 173.102  47.070  1.00 73.41           O  
ATOM  10887  OE2 GLU D 167       4.074 172.786  45.602  1.00 74.30           O  
ATOM  10888  N   ILE D 168       4.805 170.308  52.354  1.00 52.53           N  
ATOM  10889  CA  ILE D 168       5.021 170.785  53.722  1.00 49.38           C  
ATOM  10890  C   ILE D 168       6.464 171.182  53.923  1.00 50.58           C  
ATOM  10891  O   ILE D 168       6.803 171.869  54.887  1.00 50.15           O  
ATOM  10892  CB  ILE D 168       4.675 169.726  54.776  1.00 47.44           C  
ATOM  10893  CG1 ILE D 168       4.884 170.303  56.170  1.00 43.10           C  
ATOM  10894  CG2 ILE D 168       5.538 168.489  54.591  1.00 47.68           C  
ATOM  10895  CD1 ILE D 168       4.621 169.317  57.253  1.00 41.10           C  
ATOM  10896  N   LEU D 169       7.312 170.728  53.007  1.00 51.79           N  
ATOM  10897  CA  LEU D 169       8.729 171.041  53.035  1.00 54.15           C  
ATOM  10898  C   LEU D 169       9.236 170.836  51.616  1.00 56.44           C  
ATOM  10899  O   LEU D 169       8.496 170.344  50.767  1.00 55.01           O  
ATOM  10900  CB  LEU D 169       9.461 170.119  54.016  1.00 54.44           C  
ATOM  10901  CG  LEU D 169      10.014 168.778  53.524  1.00 54.63           C  
ATOM  10902  CD1 LEU D 169      10.474 167.964  54.700  1.00 52.99           C  
ATOM  10903  CD2 LEU D 169       8.958 168.018  52.781  1.00 57.61           C  
ATOM  10904  N   GLU D 170      10.483 171.220  51.354  1.00 60.89           N  
ATOM  10905  CA  GLU D 170      11.063 171.065  50.018  1.00 65.86           C  
ATOM  10906  C   GLU D 170      12.355 170.263  50.051  1.00 65.97           C  
ATOM  10907  O   GLU D 170      13.283 170.599  50.781  1.00 67.43           O  
ATOM  10908  CB  GLU D 170      11.326 172.439  49.381  1.00 70.23           C  
ATOM  10909  CG  GLU D 170      10.056 173.290  49.150  1.00 77.88           C  
ATOM  10910  CD  GLU D 170      10.304 174.573  48.330  1.00 81.83           C  
ATOM  10911  OE1 GLU D 170      11.092 175.450  48.779  1.00 82.41           O  
ATOM  10912  OE2 GLU D 170       9.695 174.701  47.235  1.00 83.97           O  
ATOM  10913  N   TYR D 171      12.414 169.199  49.259  1.00 66.60           N  
ATOM  10914  CA  TYR D 171      13.610 168.363  49.217  1.00 67.52           C  
ATOM  10915  C   TYR D 171      14.669 169.080  48.397  1.00 68.57           C  
ATOM  10916  O   TYR D 171      14.493 169.320  47.196  1.00 68.82           O  
ATOM  10917  CB  TYR D 171      13.297 167.010  48.575  1.00 66.29           C  
ATOM  10918  CG  TYR D 171      12.510 166.040  49.439  1.00 64.02           C  
ATOM  10919  CD1 TYR D 171      11.530 165.235  48.873  1.00 63.44           C  
ATOM  10920  CD2 TYR D 171      12.789 165.875  50.791  1.00 62.41           C  
ATOM  10921  CE1 TYR D 171      10.855 164.295  49.616  1.00 62.42           C  
ATOM  10922  CE2 TYR D 171      12.110 164.927  51.543  1.00 62.13           C  
ATOM  10923  CZ  TYR D 171      11.142 164.140  50.941  1.00 61.45           C  
ATOM  10924  OH  TYR D 171      10.446 163.187  51.645  1.00 61.29           O  
ATOM  10925  N   ASP D 172      15.779 169.414  49.029  1.00 69.37           N  
ATOM  10926  CA  ASP D 172      16.782 170.120  48.283  1.00 73.14           C  
ATOM  10927  C   ASP D 172      17.501 169.284  47.228  1.00 73.06           C  
ATOM  10928  O   ASP D 172      18.498 169.724  46.664  1.00 75.41           O  
ATOM  10929  CB  ASP D 172      17.771 170.785  49.236  1.00 76.18           C  
ATOM  10930  CG  ASP D 172      18.303 169.837  50.263  1.00 79.32           C  
ATOM  10931  OD1 ASP D 172      18.648 168.695  49.867  1.00 81.19           O  
ATOM  10932  OD2 ASP D 172      18.386 170.244  51.453  1.00 80.31           O  
ATOM  10933  N   ASP D 173      16.998 168.090  46.940  1.00 72.22           N  
ATOM  10934  CA  ASP D 173      17.621 167.262  45.908  1.00 71.48           C  
ATOM  10935  C   ASP D 173      16.697 167.290  44.705  1.00 70.17           C  
ATOM  10936  O   ASP D 173      16.917 166.596  43.707  1.00 68.19           O  
ATOM  10937  CB  ASP D 173      17.838 165.824  46.407  1.00 73.62           C  
ATOM  10938  CG  ASP D 173      16.602 164.950  46.274  1.00 74.98           C  
ATOM  10939  OD1 ASP D 173      15.482 165.442  46.532  1.00 75.93           O  
ATOM  10940  OD2 ASP D 173      16.758 163.754  45.930  1.00 75.39           O  
ATOM  10941  N   GLY D 174      15.655 168.114  44.831  1.00 69.53           N  
ATOM  10942  CA  GLY D 174      14.677 168.288  43.773  1.00 69.35           C  
ATOM  10943  C   GLY D 174      13.668 167.168  43.598  1.00 69.67           C  
ATOM  10944  O   GLY D 174      13.310 166.815  42.465  1.00 71.68           O  
ATOM  10945  N   THR D 175      13.207 166.592  44.703  1.00 67.58           N  
ATOM  10946  CA  THR D 175      12.235 165.517  44.614  1.00 65.08           C  
ATOM  10947  C   THR D 175      10.892 166.153  44.891  1.00 63.73           C  
ATOM  10948  O   THR D 175      10.801 167.076  45.694  1.00 65.50           O  
ATOM  10949  CB  THR D 175      12.506 164.395  45.665  1.00 64.38           C  
ATOM  10950  OG1 THR D 175      13.795 163.816  45.444  1.00 63.44           O  
ATOM  10951  CG2 THR D 175      11.482 163.293  45.548  1.00 64.48           C  
ATOM  10952  N   PRO D 176       9.844 165.715  44.183  1.00 62.62           N  
ATOM  10953  CA  PRO D 176       8.475 166.224  44.344  1.00 61.23           C  
ATOM  10954  C   PRO D 176       7.897 165.808  45.703  1.00 59.91           C  
ATOM  10955  O   PRO D 176       7.442 164.678  45.879  1.00 59.93           O  
ATOM  10956  CB  PRO D 176       7.734 165.579  43.182  1.00 60.94           C  
ATOM  10957  CG  PRO D 176       8.783 165.511  42.126  1.00 62.65           C  
ATOM  10958  CD  PRO D 176       9.988 165.016  42.895  1.00 63.36           C  
ATOM  10959  N   ALA D 177       7.918 166.739  46.649  1.00 58.22           N  
ATOM  10960  CA  ALA D 177       7.444 166.516  48.009  1.00 57.09           C  
ATOM  10961  C   ALA D 177       5.930 166.279  48.231  1.00 57.38           C  
ATOM  10962  O   ALA D 177       5.226 167.058  48.905  1.00 54.67           O  
ATOM  10963  CB  ALA D 177       7.929 167.657  48.891  1.00 57.77           C  
ATOM  10964  N   THR D 178       5.434 165.186  47.665  1.00 57.37           N  
ATOM  10965  CA  THR D 178       4.041 164.818  47.847  1.00 57.75           C  
ATOM  10966  C   THR D 178       3.987 164.173  49.239  1.00 57.33           C  
ATOM  10967  O   THR D 178       5.017 163.746  49.779  1.00 57.53           O  
ATOM  10968  CB  THR D 178       3.598 163.794  46.785  1.00 59.06           C  
ATOM  10969  OG1 THR D 178       4.389 162.609  46.910  1.00 62.21           O  
ATOM  10970  CG2 THR D 178       3.796 164.346  45.382  1.00 61.20           C  
ATOM  10971  N   MET D 179       2.803 164.093  49.829  1.00 55.93           N  
ATOM  10972  CA  MET D 179       2.694 163.506  51.154  1.00 54.05           C  
ATOM  10973  C   MET D 179       3.173 162.074  51.202  1.00 53.73           C  
ATOM  10974  O   MET D 179       3.892 161.696  52.115  1.00 54.66           O  
ATOM  10975  CB  MET D 179       1.260 163.530  51.649  1.00 54.76           C  
ATOM  10976  CG  MET D 179       1.131 162.944  53.033  1.00 54.02           C  
ATOM  10977  SD  MET D 179      -0.544 162.463  53.462  1.00 54.68           S  
ATOM  10978  CE  MET D 179      -1.147 163.937  54.305  1.00 53.49           C  
ATOM  10979  N   SER D 180       2.769 161.264  50.233  1.00 52.52           N  
ATOM  10980  CA  SER D 180       3.180 159.872  50.246  1.00 52.15           C  
ATOM  10981  C   SER D 180       4.670 159.725  49.998  1.00 50.91           C  
ATOM  10982  O   SER D 180       5.291 158.787  50.490  1.00 50.15           O  
ATOM  10983  CB  SER D 180       2.389 159.057  49.222  1.00 52.80           C  
ATOM  10984  OG  SER D 180       2.745 159.424  47.909  1.00 57.42           O  
ATOM  10985  N   GLN D 181       5.249 160.637  49.229  1.00 50.77           N  
ATOM  10986  CA  GLN D 181       6.686 160.577  48.977  1.00 52.19           C  
ATOM  10987  C   GLN D 181       7.389 160.778  50.306  1.00 53.71           C  
ATOM  10988  O   GLN D 181       8.321 160.041  50.659  1.00 54.53           O  
ATOM  10989  CB  GLN D 181       7.131 161.681  48.030  1.00 52.41           C  
ATOM  10990  CG  GLN D 181       8.637 161.839  47.908  1.00 49.62           C  
ATOM  10991  CD  GLN D 181       9.304 160.630  47.299  1.00 51.38           C  
ATOM  10992  OE1 GLN D 181       8.934 160.177  46.206  1.00 53.11           O  
ATOM  10993  NE2 GLN D 181      10.302 160.098  47.996  1.00 50.43           N  
ATOM  10994  N   ILE D 182       6.943 161.791  51.038  1.00 53.03           N  
ATOM  10995  CA  ILE D 182       7.515 162.078  52.338  1.00 53.34           C  
ATOM  10996  C   ILE D 182       7.441 160.861  53.278  1.00 54.73           C  
ATOM  10997  O   ILE D 182       8.478 160.346  53.711  1.00 55.47           O  
ATOM  10998  CB  ILE D 182       6.812 163.294  52.964  1.00 53.28           C  
ATOM  10999  CG1 ILE D 182       7.287 164.555  52.263  1.00 53.45           C  
ATOM  11000  CG2 ILE D 182       7.092 163.399  54.450  1.00 51.23           C  
ATOM  11001  CD1 ILE D 182       6.671 165.786  52.849  1.00 56.14           C  
ATOM  11002  N   ALA D 183       6.233 160.384  53.586  1.00 55.36           N  
ATOM  11003  CA  ALA D 183       6.086 159.233  54.490  1.00 54.92           C  
ATOM  11004  C   ALA D 183       7.028 158.104  54.074  1.00 54.24           C  
ATOM  11005  O   ALA D 183       7.724 157.517  54.906  1.00 53.59           O  
ATOM  11006  CB  ALA D 183       4.641 158.739  54.495  1.00 54.36           C  
ATOM  11007  N   LYS D 184       7.054 157.814  52.778  1.00 52.84           N  
ATOM  11008  CA  LYS D 184       7.915 156.771  52.269  1.00 52.16           C  
ATOM  11009  C   LYS D 184       9.339 157.078  52.720  1.00 53.56           C  
ATOM  11010  O   LYS D 184       9.933 156.272  53.435  1.00 54.72           O  
ATOM  11011  CB  LYS D 184       7.805 156.714  50.745  1.00 52.01           C  
ATOM  11012  CG  LYS D 184       8.545 155.574  50.044  1.00 49.51           C  
ATOM  11013  CD  LYS D 184       9.831 156.061  49.401  1.00 48.47           C  
ATOM  11014  CE  LYS D 184      10.458 154.988  48.543  1.00 49.07           C  
ATOM  11015  NZ  LYS D 184      11.844 155.373  48.116  1.00 50.34           N  
ATOM  11016  N   ASP D 185       9.878 158.244  52.346  1.00 53.26           N  
ATOM  11017  CA  ASP D 185      11.253 158.602  52.736  1.00 52.39           C  
ATOM  11018  C   ASP D 185      11.563 158.519  54.236  1.00 51.68           C  
ATOM  11019  O   ASP D 185      12.556 157.908  54.628  1.00 53.23           O  
ATOM  11020  CB  ASP D 185      11.615 160.010  52.265  1.00 52.10           C  
ATOM  11021  CG  ASP D 185      11.783 160.104  50.778  1.00 53.77           C  
ATOM  11022  OD1 ASP D 185      12.216 159.104  50.159  1.00 55.14           O  
ATOM  11023  OD2 ASP D 185      11.499 161.195  50.236  1.00 53.76           O  
ATOM  11024  N   VAL D 186      10.729 159.134  55.073  1.00 49.24           N  
ATOM  11025  CA  VAL D 186      10.966 159.127  56.519  1.00 47.23           C  
ATOM  11026  C   VAL D 186      10.934 157.702  57.092  1.00 47.75           C  
ATOM  11027  O   VAL D 186      11.712 157.342  57.985  1.00 45.25           O  
ATOM  11028  CB  VAL D 186       9.922 160.030  57.268  1.00 45.89           C  
ATOM  11029  CG1 VAL D 186       8.570 159.325  57.384  1.00 43.40           C  
ATOM  11030  CG2 VAL D 186      10.456 160.425  58.633  1.00 42.55           C  
ATOM  11031  N   CYS D 187      10.026 156.885  56.574  1.00 48.74           N  
ATOM  11032  CA  CYS D 187       9.930 155.519  57.045  1.00 47.91           C  
ATOM  11033  C   CYS D 187      11.227 154.817  56.724  1.00 47.66           C  
ATOM  11034  O   CYS D 187      11.736 154.089  57.563  1.00 46.88           O  
ATOM  11035  CB  CYS D 187       8.743 154.816  56.400  1.00 47.26           C  
ATOM  11036  SG  CYS D 187       7.232 155.157  57.289  1.00 48.19           S  
ATOM  11037  N   THR D 188      11.763 155.048  55.519  1.00 47.16           N  
ATOM  11038  CA  THR D 188      13.038 154.456  55.124  1.00 46.00           C  
ATOM  11039  C   THR D 188      14.100 154.919  56.110  1.00 45.73           C  
ATOM  11040  O   THR D 188      14.956 154.147  56.516  1.00 46.89           O  
ATOM  11041  CB  THR D 188      13.495 154.892  53.729  1.00 45.82           C  
ATOM  11042  OG1 THR D 188      12.702 154.247  52.725  1.00 48.72           O  
ATOM  11043  CG2 THR D 188      14.925 154.489  53.518  1.00 46.60           C  
ATOM  11044  N   PHE D 189      14.044 156.184  56.494  1.00 44.64           N  
ATOM  11045  CA  PHE D 189      15.002 156.716  57.450  1.00 46.61           C  
ATOM  11046  C   PHE D 189      14.870 156.004  58.804  1.00 48.25           C  
ATOM  11047  O   PHE D 189      15.859 155.542  59.381  1.00 49.22           O  
ATOM  11048  CB  PHE D 189      14.774 158.223  57.624  1.00 47.75           C  
ATOM  11049  CG  PHE D 189      15.555 158.844  58.759  1.00 47.23           C  
ATOM  11050  CD1 PHE D 189      16.927 158.979  58.682  1.00 47.89           C  
ATOM  11051  CD2 PHE D 189      14.902 159.317  59.895  1.00 47.08           C  
ATOM  11052  CE1 PHE D 189      17.635 159.576  59.709  1.00 48.47           C  
ATOM  11053  CE2 PHE D 189      15.602 159.916  60.927  1.00 45.37           C  
ATOM  11054  CZ  PHE D 189      16.967 160.046  60.830  1.00 47.75           C  
ATOM  11055  N   LEU D 190      13.644 155.930  59.316  1.00 48.86           N  
ATOM  11056  CA  LEU D 190      13.391 155.277  60.595  1.00 47.06           C  
ATOM  11057  C   LEU D 190      13.959 153.863  60.639  1.00 45.50           C  
ATOM  11058  O   LEU D 190      14.433 153.420  61.682  1.00 45.33           O  
ATOM  11059  CB  LEU D 190      11.885 155.233  60.873  1.00 48.12           C  
ATOM  11060  CG  LEU D 190      11.184 156.568  61.114  1.00 47.09           C  
ATOM  11061  CD1 LEU D 190       9.819 156.265  61.669  1.00 47.99           C  
ATOM  11062  CD2 LEU D 190      11.946 157.427  62.108  1.00 45.56           C  
ATOM  11063  N   ARG D 191      13.895 153.155  59.514  1.00 43.80           N  
ATOM  11064  CA  ARG D 191      14.417 151.799  59.446  1.00 43.14           C  
ATOM  11065  C   ARG D 191      15.890 151.832  59.781  1.00 43.56           C  
ATOM  11066  O   ARG D 191      16.357 151.078  60.628  1.00 42.79           O  
ATOM  11067  CB  ARG D 191      14.220 151.219  58.056  1.00 42.13           C  
ATOM  11068  CG  ARG D 191      15.026 149.972  57.774  1.00 44.73           C  
ATOM  11069  CD  ARG D 191      14.931 148.922  58.882  1.00 45.65           C  
ATOM  11070  NE  ARG D 191      13.563 148.506  59.158  1.00 48.89           N  
ATOM  11071  CZ  ARG D 191      13.202 147.810  60.233  1.00 51.99           C  
ATOM  11072  NH1 ARG D 191      14.122 147.449  61.123  1.00 52.96           N  
ATOM  11073  NH2 ARG D 191      11.919 147.507  60.450  1.00 52.94           N  
ATOM  11074  N   TRP D 192      16.620 152.712  59.106  1.00 43.95           N  
ATOM  11075  CA  TRP D 192      18.038 152.868  59.349  1.00 44.43           C  
ATOM  11076  C   TRP D 192      18.299 153.272  60.811  1.00 45.60           C  
ATOM  11077  O   TRP D 192      19.097 152.653  61.505  1.00 48.18           O  
ATOM  11078  CB  TRP D 192      18.600 153.926  58.422  1.00 45.20           C  
ATOM  11079  CG  TRP D 192      20.036 154.248  58.681  1.00 49.80           C  
ATOM  11080  CD1 TRP D 192      21.119 153.568  58.220  1.00 50.76           C  
ATOM  11081  CD2 TRP D 192      20.552 155.348  59.457  1.00 51.05           C  
ATOM  11082  NE1 TRP D 192      22.282 154.174  58.653  1.00 52.57           N  
ATOM  11083  CE2 TRP D 192      21.961 155.265  59.414  1.00 50.72           C  
ATOM  11084  CE3 TRP D 192      19.960 156.391  60.179  1.00 51.37           C  
ATOM  11085  CZ2 TRP D 192      22.789 156.180  60.063  1.00 50.94           C  
ATOM  11086  CZ3 TRP D 192      20.790 157.306  60.827  1.00 53.20           C  
ATOM  11087  CH2 TRP D 192      22.192 157.190  60.763  1.00 52.08           C  
ATOM  11088  N   ALA D 193      17.631 154.303  61.297  1.00 45.21           N  
ATOM  11089  CA  ALA D 193      17.858 154.730  62.669  1.00 44.92           C  
ATOM  11090  C   ALA D 193      17.650 153.587  63.641  1.00 46.60           C  
ATOM  11091  O   ALA D 193      18.223 153.556  64.724  1.00 46.79           O  
ATOM  11092  CB  ALA D 193      16.928 155.853  63.008  1.00 44.32           C  
ATOM  11093  N   ALA D 194      16.808 152.644  63.255  1.00 48.69           N  
ATOM  11094  CA  ALA D 194      16.515 151.512  64.111  1.00 49.97           C  
ATOM  11095  C   ALA D 194      17.647 150.485  64.095  1.00 51.37           C  
ATOM  11096  O   ALA D 194      17.966 149.876  65.116  1.00 53.12           O  
ATOM  11097  CB  ALA D 194      15.205 150.862  63.665  1.00 48.85           C  
ATOM  11098  N   GLU D 195      18.262 150.291  62.939  1.00 52.05           N  
ATOM  11099  CA  GLU D 195      19.315 149.307  62.843  1.00 52.56           C  
ATOM  11100  C   GLU D 195      20.279 149.588  61.734  1.00 51.35           C  
ATOM  11101  O   GLU D 195      20.213 148.982  60.665  1.00 50.86           O  
ATOM  11102  CB  GLU D 195      18.718 147.942  62.627  1.00 56.06           C  
ATOM  11103  CG  GLU D 195      17.603 147.953  61.647  1.00 62.77           C  
ATOM  11104  CD  GLU D 195      17.323 146.571  61.138  1.00 68.73           C  
ATOM  11105  OE1 GLU D 195      18.050 146.151  60.208  1.00 71.12           O  
ATOM  11106  OE2 GLU D 195      16.400 145.905  61.680  1.00 72.02           O  
ATOM  11107  N   PRO D 196      21.207 150.505  61.992  1.00 50.04           N  
ATOM  11108  CA  PRO D 196      22.259 150.966  61.100  1.00 49.86           C  
ATOM  11109  C   PRO D 196      23.010 149.803  60.468  1.00 50.83           C  
ATOM  11110  O   PRO D 196      23.396 149.854  59.299  1.00 53.10           O  
ATOM  11111  CB  PRO D 196      23.134 151.781  62.025  1.00 50.10           C  
ATOM  11112  CG  PRO D 196      22.153 152.352  62.989  1.00 49.61           C  
ATOM  11113  CD  PRO D 196      21.299 151.174  63.299  1.00 49.40           C  
ATOM  11114  N   GLU D 197      23.216 148.747  61.237  1.00 49.63           N  
ATOM  11115  CA  GLU D 197      23.927 147.602  60.709  1.00 50.54           C  
ATOM  11116  C   GLU D 197      23.202 147.004  59.496  1.00 50.94           C  
ATOM  11117  O   GLU D 197      23.788 146.230  58.735  1.00 51.65           O  
ATOM  11118  CB  GLU D 197      24.077 146.520  61.787  1.00 50.61           C  
ATOM  11119  CG  GLU D 197      22.786 145.782  62.112  1.00 54.95           C  
ATOM  11120  CD  GLU D 197      21.978 146.429  63.231  1.00 58.63           C  
ATOM  11121  OE1 GLU D 197      22.264 147.602  63.602  1.00 61.50           O  
ATOM  11122  OE2 GLU D 197      21.051 145.751  63.739  1.00 58.68           O  
ATOM  11123  N   HIS D 198      21.940 147.377  59.302  1.00 50.09           N  
ATOM  11124  CA  HIS D 198      21.137 146.806  58.222  1.00 49.88           C  
ATOM  11125  C   HIS D 198      21.870 146.293  56.978  1.00 51.52           C  
ATOM  11126  O   HIS D 198      21.724 145.128  56.599  1.00 50.91           O  
ATOM  11127  CB  HIS D 198      20.029 147.777  57.807  1.00 46.82           C  
ATOM  11128  CG  HIS D 198      19.125 147.230  56.746  1.00 44.74           C  
ATOM  11129  ND1 HIS D 198      19.466 147.218  55.409  1.00 45.10           N  
ATOM  11130  CD2 HIS D 198      17.925 146.606  56.832  1.00 44.34           C  
ATOM  11131  CE1 HIS D 198      18.517 146.609  54.719  1.00 45.36           C  
ATOM  11132  NE2 HIS D 198      17.570 146.226  55.560  1.00 44.62           N  
ATOM  11133  N   ASP D 199      22.656 147.154  56.345  1.00 54.24           N  
ATOM  11134  CA  ASP D 199      23.390 146.770  55.143  1.00 55.85           C  
ATOM  11135  C   ASP D 199      24.541 145.787  55.342  1.00 56.57           C  
ATOM  11136  O   ASP D 199      24.670 144.818  54.591  1.00 57.88           O  
ATOM  11137  CB  ASP D 199      23.910 148.018  54.453  1.00 59.00           C  
ATOM  11138  CG  ASP D 199      22.818 148.773  53.743  1.00 60.86           C  
ATOM  11139  OD1 ASP D 199      21.642 148.592  54.123  1.00 62.10           O  
ATOM  11140  OD2 ASP D 199      23.136 149.548  52.815  1.00 61.96           O  
ATOM  11141  N   GLN D 200      25.388 146.035  56.333  1.00 56.05           N  
ATOM  11142  CA  GLN D 200      26.498 145.138  56.589  1.00 55.83           C  
ATOM  11143  C   GLN D 200      25.970 143.769  56.963  1.00 55.13           C  
ATOM  11144  O   GLN D 200      26.526 142.741  56.569  1.00 55.22           O  
ATOM  11145  CB  GLN D 200      27.356 145.667  57.715  1.00 57.36           C  
ATOM  11146  CG  GLN D 200      28.376 144.672  58.155  1.00 64.68           C  
ATOM  11147  CD  GLN D 200      29.170 145.147  59.352  1.00 69.16           C  
ATOM  11148  OE1 GLN D 200      28.601 145.647  60.336  1.00 70.08           O  
ATOM  11149  NE2 GLN D 200      30.498 144.983  59.286  1.00 70.54           N  
ATOM  11150  N   ARG D 201      24.890 143.761  57.732  1.00 55.03           N  
ATOM  11151  CA  ARG D 201      24.261 142.517  58.157  1.00 54.73           C  
ATOM  11152  C   ARG D 201      23.854 141.676  56.952  1.00 54.62           C  
ATOM  11153  O   ARG D 201      24.113 140.483  56.905  1.00 55.60           O  
ATOM  11154  CB  ARG D 201      23.017 142.807  58.980  1.00 54.42           C  
ATOM  11155  CG  ARG D 201      22.559 141.627  59.783  1.00 55.13           C  
ATOM  11156  CD  ARG D 201      21.093 141.381  59.604  1.00 55.14           C  
ATOM  11157  NE  ARG D 201      20.294 142.561  59.869  1.00 54.96           N  
ATOM  11158  CZ  ARG D 201      19.140 142.799  59.261  1.00 56.99           C  
ATOM  11159  NH1 ARG D 201      18.660 141.935  58.363  1.00 54.65           N  
ATOM  11160  NH2 ARG D 201      18.471 143.907  59.531  1.00 56.84           N  
ATOM  11161  N   LYS D 202      23.210 142.302  55.976  1.00 53.74           N  
ATOM  11162  CA  LYS D 202      22.778 141.581  54.803  1.00 53.26           C  
ATOM  11163  C   LYS D 202      23.946 141.144  53.957  1.00 53.63           C  
ATOM  11164  O   LYS D 202      23.982 140.013  53.498  1.00 53.93           O  
ATOM  11165  CB  LYS D 202      21.804 142.435  53.998  1.00 53.91           C  
ATOM  11166  CG  LYS D 202      20.473 142.607  54.709  1.00 54.06           C  
ATOM  11167  CD  LYS D 202      19.352 143.061  53.786  1.00 55.13           C  
ATOM  11168  CE  LYS D 202      17.996 143.030  54.514  1.00 57.17           C  
ATOM  11169  NZ  LYS D 202      16.890 143.753  53.808  1.00 56.67           N  
ATOM  11170  N   ARG D 203      24.914 142.029  53.751  1.00 55.44           N  
ATOM  11171  CA  ARG D 203      26.095 141.671  52.962  1.00 56.40           C  
ATOM  11172  C   ARG D 203      26.748 140.441  53.589  1.00 55.39           C  
ATOM  11173  O   ARG D 203      27.245 139.567  52.880  1.00 53.50           O  
ATOM  11174  CB  ARG D 203      27.098 142.820  52.935  1.00 58.98           C  
ATOM  11175  CG  ARG D 203      28.373 142.487  52.201  1.00 63.73           C  
ATOM  11176  CD  ARG D 203      29.458 143.551  52.422  1.00 70.36           C  
ATOM  11177  NE  ARG D 203      29.754 144.344  51.224  1.00 75.15           N  
ATOM  11178  CZ  ARG D 203      29.075 145.422  50.825  1.00 76.97           C  
ATOM  11179  NH1 ARG D 203      28.031 145.873  51.528  1.00 77.24           N  
ATOM  11180  NH2 ARG D 203      29.449 146.053  49.712  1.00 76.97           N  
ATOM  11181  N   MET D 204      26.741 140.395  54.925  1.00 55.06           N  
ATOM  11182  CA  MET D 204      27.290 139.271  55.675  1.00 54.85           C  
ATOM  11183  C   MET D 204      26.479 138.000  55.427  1.00 54.78           C  
ATOM  11184  O   MET D 204      27.051 136.925  55.290  1.00 56.34           O  
ATOM  11185  CB  MET D 204      27.288 139.555  57.177  1.00 55.92           C  
ATOM  11186  CG  MET D 204      28.502 140.293  57.700  1.00 59.34           C  
ATOM  11187  SD  MET D 204      28.676 140.243  59.533  1.00 64.63           S  
ATOM  11188  CE  MET D 204      29.253 138.429  59.842  1.00 60.57           C  
ATOM  11189  N   GLY D 205      25.153 138.122  55.380  1.00 53.16           N  
ATOM  11190  CA  GLY D 205      24.305 136.967  55.145  1.00 50.86           C  
ATOM  11191  C   GLY D 205      24.646 136.299  53.828  1.00 51.03           C  
ATOM  11192  O   GLY D 205      24.556 135.076  53.695  1.00 50.77           O  
ATOM  11193  N   LEU D 206      25.038 137.101  52.847  1.00 51.03           N  
ATOM  11194  CA  LEU D 206      25.416 136.571  51.544  1.00 53.00           C  
ATOM  11195  C   LEU D 206      26.648 135.707  51.734  1.00 54.19           C  
ATOM  11196  O   LEU D 206      26.650 134.526  51.393  1.00 55.48           O  
ATOM  11197  CB  LEU D 206      25.752 137.706  50.571  1.00 54.58           C  
ATOM  11198  CG  LEU D 206      26.247 137.345  49.159  1.00 54.09           C  
ATOM  11199  CD1 LEU D 206      25.148 136.647  48.386  1.00 54.01           C  
ATOM  11200  CD2 LEU D 206      26.666 138.601  48.421  1.00 53.04           C  
ATOM  11201  N   LYS D 207      27.703 136.298  52.279  1.00 53.87           N  
ATOM  11202  CA  LYS D 207      28.919 135.550  52.508  1.00 54.34           C  
ATOM  11203  C   LYS D 207      28.666 134.263  53.293  1.00 55.37           C  
ATOM  11204  O   LYS D 207      29.222 133.214  52.973  1.00 56.45           O  
ATOM  11205  CB  LYS D 207      29.914 136.417  53.243  1.00 55.05           C  
ATOM  11206  CG  LYS D 207      30.410 137.577  52.426  1.00 56.39           C  
ATOM  11207  CD  LYS D 207      31.552 138.235  53.157  1.00 59.33           C  
ATOM  11208  CE  LYS D 207      32.180 139.332  52.346  1.00 61.28           C  
ATOM  11209  NZ  LYS D 207      33.208 139.999  53.184  1.00 65.20           N  
ATOM  11210  N   MET D 208      27.820 134.342  54.314  1.00 55.69           N  
ATOM  11211  CA  MET D 208      27.487 133.184  55.133  1.00 55.21           C  
ATOM  11212  C   MET D 208      26.827 132.081  54.299  1.00 54.94           C  
ATOM  11213  O   MET D 208      27.186 130.910  54.435  1.00 56.35           O  
ATOM  11214  CB  MET D 208      26.578 133.616  56.290  1.00 56.75           C  
ATOM  11215  CG  MET D 208      26.064 132.517  57.227  1.00 58.50           C  
ATOM  11216  SD  MET D 208      24.699 131.500  56.549  1.00 65.06           S  
ATOM  11217  CE  MET D 208      23.290 132.618  56.535  1.00 59.69           C  
ATOM  11218  N   LEU D 209      25.877 132.426  53.432  1.00 53.16           N  
ATOM  11219  CA  LEU D 209      25.230 131.389  52.622  1.00 52.25           C  
ATOM  11220  C   LEU D 209      26.197 130.656  51.717  1.00 51.73           C  
ATOM  11221  O   LEU D 209      26.291 129.434  51.778  1.00 51.98           O  
ATOM  11222  CB  LEU D 209      24.099 131.969  51.789  1.00 50.92           C  
ATOM  11223  CG  LEU D 209      22.875 132.260  52.649  1.00 49.93           C  
ATOM  11224  CD1 LEU D 209      21.858 132.987  51.822  1.00 49.87           C  
ATOM  11225  CD2 LEU D 209      22.312 130.970  53.187  1.00 48.87           C  
ATOM  11226  N   LEU D 210      26.914 131.400  50.880  1.00 51.96           N  
ATOM  11227  CA  LEU D 210      27.903 130.810  49.980  1.00 51.38           C  
ATOM  11228  C   LEU D 210      28.829 129.852  50.730  1.00 52.73           C  
ATOM  11229  O   LEU D 210      28.890 128.666  50.398  1.00 52.66           O  
ATOM  11230  CB  LEU D 210      28.720 131.913  49.322  1.00 49.09           C  
ATOM  11231  CG  LEU D 210      27.811 132.706  48.387  1.00 50.18           C  
ATOM  11232  CD1 LEU D 210      28.508 133.929  47.824  1.00 49.96           C  
ATOM  11233  CD2 LEU D 210      27.355 131.788  47.272  1.00 49.00           C  
ATOM  11234  N   ILE D 211      29.544 130.360  51.735  1.00 52.59           N  
ATOM  11235  CA  ILE D 211      30.437 129.525  52.519  1.00 53.61           C  
ATOM  11236  C   ILE D 211      29.698 128.344  53.116  1.00 55.46           C  
ATOM  11237  O   ILE D 211      30.207 127.229  53.116  1.00 56.95           O  
ATOM  11238  CB  ILE D 211      31.064 130.299  53.666  1.00 54.45           C  
ATOM  11239  CG1 ILE D 211      32.160 131.219  53.134  1.00 57.09           C  
ATOM  11240  CG2 ILE D 211      31.625 129.339  54.697  1.00 53.33           C  
ATOM  11241  CD1 ILE D 211      33.362 130.497  52.553  1.00 59.21           C  
ATOM  11242  N   SER D 212      28.500 128.590  53.632  1.00 56.66           N  
ATOM  11243  CA  SER D 212      27.694 127.530  54.240  1.00 57.92           C  
ATOM  11244  C   SER D 212      27.406 126.423  53.221  1.00 55.51           C  
ATOM  11245  O   SER D 212      27.521 125.234  53.524  1.00 53.27           O  
ATOM  11246  CB  SER D 212      26.379 128.126  54.782  1.00 61.16           C  
ATOM  11247  OG  SER D 212      25.586 127.161  55.465  1.00 65.50           O  
ATOM  11248  N   ALA D 213      27.043 126.830  52.011  1.00 54.90           N  
ATOM  11249  CA  ALA D 213      26.749 125.894  50.929  1.00 55.64           C  
ATOM  11250  C   ALA D 213      27.966 125.040  50.634  1.00 55.63           C  
ATOM  11251  O   ALA D 213      27.885 123.815  50.595  1.00 54.47           O  
ATOM  11252  CB  ALA D 213      26.356 126.651  49.676  1.00 55.45           C  
ATOM  11253  N   LEU D 214      29.089 125.716  50.411  1.00 56.67           N  
ATOM  11254  CA  LEU D 214      30.380 125.084  50.122  1.00 57.28           C  
ATOM  11255  C   LEU D 214      30.858 124.107  51.226  1.00 57.90           C  
ATOM  11256  O   LEU D 214      31.191 122.941  50.955  1.00 57.82           O  
ATOM  11257  CB  LEU D 214      31.424 126.183  49.915  1.00 56.02           C  
ATOM  11258  CG  LEU D 214      32.869 125.732  49.793  1.00 55.51           C  
ATOM  11259  CD1 LEU D 214      33.049 124.936  48.532  1.0