PDB Full entry for 5GAG
HEADER    RIBOSOME                                26-NOV-15   5GAG              
TITLE     RNC IN COMPLEX WITH SRP-SR IN THE CLOSED STATE                        
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: SRP 4.5S RNA;                                              
COMPND   3 CHAIN: 1;                                                            
COMPND   4 ENGINEERED: YES;                                                     
COMPND   5 MOL_ID: 2;                                                           
COMPND   6 MOLECULE: TRNA CCAEND;                                               
COMPND   7 CHAIN: 2;                                                            
COMPND   8 MOL_ID: 3;                                                           
COMPND   9 MOLECULE: 23S RRNA;                                                  
COMPND  10 CHAIN: A;                                                            
COMPND  11 MOL_ID: 4;                                                           
COMPND  12 MOLECULE: 5S RRNA;                                                   
COMPND  13 CHAIN: B;                                                            
COMPND  14 MOL_ID: 5;                                                           
COMPND  15 MOLECULE: 50S RIBOSOMAL PROTEIN L2;                                  
COMPND  16 CHAIN: C;                                                            
COMPND  17 SYNONYM: RIBOSOMAL PROTEIN UL2;                                      
COMPND  18 MOL_ID: 6;                                                           
COMPND  19 MOLECULE: 50S RIBOSOMAL PROTEIN L3;                                  
COMPND  20 CHAIN: D;                                                            
COMPND  21 SYNONYM: RIBOSOMAL PROTEIN UL3;                                      
COMPND  22 MOL_ID: 7;                                                           
COMPND  23 MOLECULE: 50S RIBOSOMAL PROTEIN L4;                                  
COMPND  24 CHAIN: E;                                                            
COMPND  25 SYNONYM: RIBOSOMAL PROTEIN UL4;                                      
COMPND  26 MOL_ID: 8;                                                           
COMPND  27 MOLECULE: 50S RIBOSOMAL PROTEIN L5;                                  
COMPND  28 CHAIN: F;                                                            
COMPND  29 SYNONYM: RIBOSOMAL PROTEIN UL5;                                      
COMPND  30 MOL_ID: 9;                                                           
COMPND  31 MOLECULE: 50S RIBOSOMAL PROTEIN L6;                                  
COMPND  32 CHAIN: G;                                                            
COMPND  33 SYNONYM: RIBOSOMAL PROTEIN UL6;                                      
COMPND  34 MOL_ID: 10;                                                          
COMPND  35 MOLECULE: 50S RIBOSOMAL PROTEIN L9;                                  
COMPND  36 CHAIN: H;                                                            
COMPND  37 SYNONYM: RIBOSOMAL PROTEIN BL9;                                      
COMPND  38 MOL_ID: 11;                                                          
COMPND  39 MOLECULE: 50S RIBOSOMAL PROTEIN L10;                                 
COMPND  40 CHAIN: I;                                                            
COMPND  41 SYNONYM: 50S RIBOSOMAL PROTEIN L8, RIBOSOMAL PROTEIN UL10;           
COMPND  42 MOL_ID: 12;                                                          
COMPND  43 MOLECULE: 50S RIBOSOMAL PROTEIN L11;                                 
COMPND  44 CHAIN: J;                                                            
COMPND  45 SYNONYM: RIBOSOMAL PROTEIN UL11;                                     
COMPND  46 MOL_ID: 13;                                                          
COMPND  47 MOLECULE: 50S RIBOSOMAL PROTEIN L13;                                 
COMPND  48 CHAIN: K;                                                            
COMPND  49 SYNONYM: RIBOSOMAL PROTEIN UL13;                                     
COMPND  50 MOL_ID: 14;                                                          
COMPND  51 MOLECULE: 50S RIBOSOMAL PROTEIN L14;                                 
COMPND  52 CHAIN: L;                                                            
COMPND  53 SYNONYM: RIBOSOMAL PROTEIN UL14;                                     
COMPND  54 MOL_ID: 15;                                                          
COMPND  55 MOLECULE: 50S RIBOSOMAL PROTEIN L15;                                 
COMPND  56 CHAIN: M;                                                            
COMPND  57 SYNONYM: RIBOSOMAL PROTEIN UL15;                                     
COMPND  58 MOL_ID: 16;                                                          
COMPND  59 MOLECULE: 50S RIBOSOMAL PROTEIN L16;                                 
COMPND  60 CHAIN: N;                                                            
COMPND  61 SYNONYM: RIBOSOMAL PROTEIN UL16;                                     
COMPND  62 MOL_ID: 17;                                                          
COMPND  63 MOLECULE: 50S RIBOSOMAL PROTEIN L17;                                 
COMPND  64 CHAIN: O;                                                            
COMPND  65 SYNONYM: RIBOSOMAL PROTEIN UL17;                                     
COMPND  66 MOL_ID: 18;                                                          
COMPND  67 MOLECULE: 50S RIBOSOMAL PROTEIN L18;                                 
COMPND  68 CHAIN: P;                                                            
COMPND  69 SYNONYM: RIBOSOMAL PROTEIN UL18;                                     
COMPND  70 MOL_ID: 19;                                                          
COMPND  71 MOLECULE: 50S RIBOSOMAL PROTEIN L19;                                 
COMPND  72 CHAIN: Q;                                                            
COMPND  73 SYNONYM: RIBOSOMAL PROTEIN BL19;                                     
COMPND  74 MOL_ID: 20;                                                          
COMPND  75 MOLECULE: 50S RIBOSOMAL PROTEIN L20;                                 
COMPND  76 CHAIN: R;                                                            
COMPND  77 SYNONYM: RIBOSOMAL PROTEIN BL20;                                     
COMPND  78 MOL_ID: 21;                                                          
COMPND  79 MOLECULE: 50S RIBOSOMAL PROTEIN L21;                                 
COMPND  80 CHAIN: S;                                                            
COMPND  81 SYNONYM: RIBOSOMAL PROTEIN BL21;                                     
COMPND  82 MOL_ID: 22;                                                          
COMPND  83 MOLECULE: 50S RIBOSOMAL PROTEIN L22;                                 
COMPND  84 CHAIN: T;                                                            
COMPND  85 SYNONYM: RIBOSOMAL PROTEIN UL22;                                     
COMPND  86 MOL_ID: 23;                                                          
COMPND  87 MOLECULE: 50S RIBOSOMAL PROTEIN L23;                                 
COMPND  88 CHAIN: U;                                                            
COMPND  89 MOL_ID: 24;                                                          
COMPND  90 MOLECULE: 50S RIBOSOMAL PROTEIN L24;                                 
COMPND  91 CHAIN: V;                                                            
COMPND  92 SYNONYM: RIBOSOMAL PROTEIN UL24;                                     
COMPND  93 MOL_ID: 25;                                                          
COMPND  94 MOLECULE: 50S RIBOSOMAL PROTEIN L25;                                 
COMPND  95 CHAIN: W;                                                            
COMPND  96 SYNONYM: RIBOSOMAL PROTEIN BL25;                                     
COMPND  97 MOL_ID: 26;                                                          
COMPND  98 MOLECULE: 50S RIBOSOMAL PROTEIN L27;                                 
COMPND  99 CHAIN: X;                                                            
COMPND 100 SYNONYM: RIBOSOMAL PROTEIN BL27;                                     
COMPND 101 MOL_ID: 27;                                                          
COMPND 102 MOLECULE: 50S RIBOSOMAL PROTEIN L28;                                 
COMPND 103 CHAIN: Y;                                                            
COMPND 104 SYNONYM: RIBOSOMAL PROTEIN BL28;                                     
COMPND 105 MOL_ID: 28;                                                          
COMPND 106 MOLECULE: 50S RIBOSOMAL PROTEIN L29;                                 
COMPND 107 CHAIN: Z;                                                            
COMPND 108 SYNONYM: RIBOSOMAL PROTEIN UL29;                                     
COMPND 109 MOL_ID: 29;                                                          
COMPND 110 MOLECULE: 50S RIBOSOMAL PROTEIN L30;                                 
COMPND 111 CHAIN: a;                                                            
COMPND 112 SYNONYM: RIBOSOMAL PROTEIN UL30;                                     
COMPND 113 MOL_ID: 30;                                                          
COMPND 114 MOLECULE: 50S RIBOSOMAL PROTEIN L32;                                 
COMPND 115 CHAIN: b;                                                            
COMPND 116 SYNONYM: RIBOSOMAL PROTEIN BL32;                                     
COMPND 117 MOL_ID: 31;                                                          
COMPND 118 MOLECULE: 50S RIBOSOMAL PROTEIN L33;                                 
COMPND 119 CHAIN: c;                                                            
COMPND 120 SYNONYM: RIBOSOMAL PROTEIN BL33;                                     
COMPND 121 MOL_ID: 32;                                                          
COMPND 122 MOLECULE: 50S RIBOSOMAL PROTEIN L34;                                 
COMPND 123 CHAIN: d;                                                            
COMPND 124 SYNONYM: RIBOSOMAL PROTEIN BL34;                                     
COMPND 125 MOL_ID: 33;                                                          
COMPND 126 MOLECULE: 50S RIBOSOMAL PROTEIN L35;                                 
COMPND 127 CHAIN: e;                                                            
COMPND 128 SYNONYM: RIBOSOMAL PROTEIN A,RIBOSOMAL PROTEIN BL35;                 
COMPND 129 MOL_ID: 34;                                                          
COMPND 130 MOLECULE: 50S RIBOSOMAL PROTEIN L36;                                 
COMPND 131 CHAIN: f;                                                            
COMPND 132 SYNONYM: RIBOSOMAL PROTEIN B,RIBOSOMAL PROTEIN BL36;                 
COMPND 133 MOL_ID: 35;                                                          
COMPND 134 MOLECULE: SIGNAL RECOGNITION PARTICLE PROTEIN FFH;                   
COMPND 135 CHAIN: i;                                                            
COMPND 136 ENGINEERED: YES;                                                     
COMPND 137 OTHER_DETAILS: *****NOTES: LESS DEFINED REGIONS WERE REPLACED WITH   
COMPND 138 UNK RESIDUES. FULL SEQUENCE IS BELOW:                                
COMPND 139 MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLT
COMPND 140 PGQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSAD
COMPND 141 VYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQ
COMPND 142 VHASINPVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVG
COMPND 143 EKTEALEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDGFDLNDFLEQLRQMKNMG
COMPND 144 GMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVN
COMPND 145 RLLKQFDDMQRMMKKMKKGGMAKMMRSMKGMMPPGFPGR;                             
COMPND 146 MOL_ID: 36;                                                          
COMPND 147 MOLECULE: 1A9L SS;                                                   
COMPND 148 CHAIN: k;                                                            
COMPND 149 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE   3 ORGANISM_TAXID: 562;                                                 
SOURCE   4 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE   5 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE   6 MOL_ID: 2;                                                           
SOURCE   7 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE   8 ORGANISM_TAXID: 562;                                                 
SOURCE   9 MOL_ID: 3;                                                           
SOURCE  10 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  11 ORGANISM_TAXID: 562;                                                 
SOURCE  12 MOL_ID: 4;                                                           
SOURCE  13 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  14 ORGANISM_TAXID: 562;                                                 
SOURCE  15 MOL_ID: 5;                                                           
SOURCE  16 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  17 ORGANISM_TAXID: 562;                                                 
SOURCE  18 MOL_ID: 6;                                                           
SOURCE  19 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  20 ORGANISM_TAXID: 562;                                                 
SOURCE  21 MOL_ID: 7;                                                           
SOURCE  22 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  23 ORGANISM_TAXID: 562;                                                 
SOURCE  24 MOL_ID: 8;                                                           
SOURCE  25 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  26 ORGANISM_TAXID: 562;                                                 
SOURCE  27 MOL_ID: 9;                                                           
SOURCE  28 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  29 ORGANISM_TAXID: 562;                                                 
SOURCE  30 MOL_ID: 10;                                                          
SOURCE  31 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  32 ORGANISM_TAXID: 562;                                                 
SOURCE  33 MOL_ID: 11;                                                          
SOURCE  34 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  35 ORGANISM_TAXID: 562;                                                 
SOURCE  36 MOL_ID: 12;                                                          
SOURCE  37 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  38 ORGANISM_TAXID: 562;                                                 
SOURCE  39 MOL_ID: 13;                                                          
SOURCE  40 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  41 ORGANISM_TAXID: 562;                                                 
SOURCE  42 MOL_ID: 14;                                                          
SOURCE  43 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  44 ORGANISM_TAXID: 562;                                                 
SOURCE  45 MOL_ID: 15;                                                          
SOURCE  46 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  47 ORGANISM_TAXID: 562;                                                 
SOURCE  48 MOL_ID: 16;                                                          
SOURCE  49 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  50 ORGANISM_TAXID: 562;                                                 
SOURCE  51 MOL_ID: 17;                                                          
SOURCE  52 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  53 ORGANISM_TAXID: 562;                                                 
SOURCE  54 MOL_ID: 18;                                                          
SOURCE  55 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  56 ORGANISM_TAXID: 562;                                                 
SOURCE  57 MOL_ID: 19;                                                          
SOURCE  58 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  59 ORGANISM_TAXID: 562;                                                 
SOURCE  60 MOL_ID: 20;                                                          
SOURCE  61 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  62 ORGANISM_TAXID: 562;                                                 
SOURCE  63 MOL_ID: 21;                                                          
SOURCE  64 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  65 ORGANISM_TAXID: 562;                                                 
SOURCE  66 MOL_ID: 22;                                                          
SOURCE  67 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  68 ORGANISM_TAXID: 562;                                                 
SOURCE  69 MOL_ID: 23;                                                          
SOURCE  70 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI (STRAIN K12);                  
SOURCE  71 ORGANISM_TAXID: 83333;                                               
SOURCE  72 STRAIN: K12;                                                         
SOURCE  73 MOL_ID: 24;                                                          
SOURCE  74 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  75 ORGANISM_TAXID: 562;                                                 
SOURCE  76 MOL_ID: 25;                                                          
SOURCE  77 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  78 ORGANISM_TAXID: 562;                                                 
SOURCE  79 MOL_ID: 26;                                                          
SOURCE  80 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  81 ORGANISM_TAXID: 562;                                                 
SOURCE  82 MOL_ID: 27;                                                          
SOURCE  83 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  84 ORGANISM_TAXID: 562;                                                 
SOURCE  85 MOL_ID: 28;                                                          
SOURCE  86 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  87 ORGANISM_TAXID: 562;                                                 
SOURCE  88 MOL_ID: 29;                                                          
SOURCE  89 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  90 ORGANISM_TAXID: 562;                                                 
SOURCE  91 MOL_ID: 30;                                                          
SOURCE  92 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  93 ORGANISM_TAXID: 562;                                                 
SOURCE  94 MOL_ID: 31;                                                          
SOURCE  95 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  96 ORGANISM_TAXID: 562;                                                 
SOURCE  97 MOL_ID: 32;                                                          
SOURCE  98 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  99 ORGANISM_TAXID: 562;                                                 
SOURCE 100 MOL_ID: 33;                                                          
SOURCE 101 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE 102 ORGANISM_TAXID: 562;                                                 
SOURCE 103 MOL_ID: 34;                                                          
SOURCE 104 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE 105 ORGANISM_TAXID: 562;                                                 
SOURCE 106 MOL_ID: 35;                                                          
SOURCE 107 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE 108 ORGANISM_TAXID: 562;                                                 
SOURCE 109 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE 110 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE 111 MOL_ID: 36;                                                          
SOURCE 112 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE 113 ORGANISM_TAXID: 562;                                                 
SOURCE 114 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE 115 EXPRESSION_SYSTEM_TAXID: 562                                         
KEYWDS    RIBOSOME NASCENT CHAIN, SRP, SR, RIBOSOME                             
EXPDTA    ELECTRON MICROSCOPY                                                   
AUTHOR    A.JOMAA,D.BOEHRINGER,M.LEIBUNDGUT,N.BAN                               
REVDAT   4   02-AUG-17 5GAG    1                                                
REVDAT   3   12-OCT-16 5GAG    1                                                
REVDAT   2   03-FEB-16 5GAG    1       JRNL                                     
REVDAT   1   27-JAN-16 5GAG    0                                                
JRNL        AUTH   A.JOMAA,D.BOEHRINGER,M.LEIBUNDGUT,N.BAN                      
JRNL        TITL   STRUCTURES OF THE E. COLI TRANSLATING RIBOSOME WITH SRP AND  
JRNL        TITL 2 ITS RECEPTOR AND WITH THE TRANSLOCON.                        
JRNL        REF    NAT COMMUN                    V.   7 10471 2016              
JRNL        REFN                   ESSN 2041-1723                               
JRNL        PMID   26804923                                                     
JRNL        DOI    10.1038/NCOMMS10471                                          
REMARK   2                                                                      
REMARK   2 RESOLUTION.    3.80 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   SOFTWARE PACKAGES      : NULL                                      
REMARK   3   RECONSTRUCTION SCHEMA  : NULL                                      
REMARK   3                                                                      
REMARK   3 EM MAP-MODEL FITTING AND REFINEMENT                                  
REMARK   3   PDB ENTRY                    : NULL                                
REMARK   3   REFINEMENT SPACE             : RECIPROCAL                          
REMARK   3   REFINEMENT PROTOCOL          : RIGID BODY FIT                      
REMARK   3   REFINEMENT TARGET            : NULL                                
REMARK   3   OVERALL ANISOTROPIC B VALUE  : NULL                                
REMARK   3                                                                      
REMARK   3 FITTING PROCEDURE : NULL                                             
REMARK   3                                                                      
REMARK   3 EM IMAGE RECONSTRUCTION STATISTICS                                   
REMARK   3   NOMINAL PIXEL SIZE (ANGSTROMS)    : NULL                           
REMARK   3   ACTUAL PIXEL SIZE  (ANGSTROMS)    : NULL                           
REMARK   3   EFFECTIVE RESOLUTION (ANGSTROMS)  : 3.800                          
REMARK   3   NUMBER OF PARTICLES               : 75942                          
REMARK   3   CTF CORRECTION METHOD             : PHASE FLIPPING AND AMPLITUDE   
REMARK   3                                       CORRECTION                     
REMARK   3                                                                      
REMARK   3 EM RECONSTRUCTION MAGNIFICATION CALIBRATION: NULL                    
REMARK   3                                                                      
REMARK   3 OTHER DETAILS: NULL                                                  
REMARK   4                                                                      
REMARK   4 5GAG COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY PDBE ON 14-DEC-15.                  
REMARK 100 THE DEPOSITION ID IS D_1001300013.                                   
REMARK 245                                                                      
REMARK 245 EXPERIMENTAL DETAILS                                                 
REMARK 245   RECONSTRUCTION METHOD          : SINGLE PARTICLE                   
REMARK 245   SPECIMEN TYPE                  : NULL                              
REMARK 245                                                                      
REMARK 245 ELECTRON MICROSCOPE SAMPLE                                           
REMARK 245   SAMPLE TYPE                    : PARTICLE                          
REMARK 245   PARTICLE TYPE                  : POINT                             
REMARK 245   NAME OF SAMPLE                 : RIBOSOME NASCENT CHAIN COMPLEX    
REMARK 245                                    WITH SRP-SR IN THE CLOSED STATE   
REMARK 245   SAMPLE CONCENTRATION (MG ML-1) : 0.05                              
REMARK 245   SAMPLE SUPPORT DETAILS         : NULL                              
REMARK 245   SAMPLE VITRIFICATION DETAILS   : NULL                              
REMARK 245   SAMPLE BUFFER                  : NULL                              
REMARK 245   PH                             : 7.50                              
REMARK 245   SAMPLE DETAILS                 : NULL                              
REMARK 245                                                                      
REMARK 245 DATA ACQUISITION                                                     
REMARK 245   DATE OF EXPERIMENT                : NULL                           
REMARK 245   NUMBER OF MICROGRAPHS-IMAGES      : NULL                           
REMARK 245   TEMPERATURE (KELVIN)              : NULL                           
REMARK 245   MICROSCOPE MODEL                  : FEI TITAN KRIOS                
REMARK 245   DETECTOR TYPE                     : FEI FALCON II (4K X 4K)        
REMARK 245   MINIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MAXIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MINIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   MAXIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   NOMINAL CS                        : 2.70                           
REMARK 245   IMAGING MODE                      : BRIGHT FIELD                   
REMARK 245   ELECTRON DOSE (ELECTRONS NM**-2)  : 20.00                          
REMARK 245   ILLUMINATION MODE                 : FLOOD BEAM                     
REMARK 245   NOMINAL MAGNIFICATION             : NULL                           
REMARK 245   CALIBRATED MAGNIFICATION          : NULL                           
REMARK 245   SOURCE                            : FIELD EMISSION GUN             
REMARK 245   ACCELERATION VOLTAGE (KV)         : 300                            
REMARK 245   IMAGING DETAILS                   : NULL                           
REMARK 247                                                                      
REMARK 247 ELECTRON MICROSCOPY                                                  
REMARK 247  THE COORDINATES IN THIS ENTRY WERE GENERATED FROM ELECTRON          
REMARK 247  MICROSCOPY DATA. PROTEIN DATA BANK CONVENTIONS REQUIRE              
REMARK 247  THAT CRYST1 AND SCALE RECORDS BE INCLUDED, BUT THE VALUES           
REMARK 247  ON THESE RECORDS ARE MEANINGLESS EXCEPT FOR THE CALCULATION         
REMARK 247  OF THE STRUCTURE FACTORS.                                           
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: 36-MERIC                   
REMARK 350 SOFTWARE USED: PISA                                                  
REMARK 350 TOTAL BURIED SURFACE AREA: 209960 ANGSTROM**2                        
REMARK 350 SURFACE AREA OF THE COMPLEX: 495670 ANGSTROM**2                      
REMARK 350 CHANGE IN SOLVENT FREE ENERGY: -5025.0 KCAL/MOL                      
REMARK 350 APPLY THE FOLLOWING TO CHAINS: 1, 2, A, B, C, D, E, F, G, H,         
REMARK 350                    AND CHAINS: I, J, K, L, M, N, O, P, Q,            
REMARK 350                    AND CHAINS: R, S, T, U, V, W, X, Y, Z, a,         
REMARK 350                    AND CHAINS: b, c, d, e, f, i, k                   
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465       G 1     1                                                      
REMARK 465       G 1     2                                                      
REMARK 465       G 1     3                                                      
REMARK 465       G 1     4                                                      
REMARK 465       G 1     5                                                      
REMARK 465       C 1     6                                                      
REMARK 465       U 1     7                                                      
REMARK 465       C 1     8                                                      
REMARK 465       U 1     9                                                      
REMARK 465       G 1    10                                                      
REMARK 465       U 1    11                                                      
REMARK 465       U 1    12                                                      
REMARK 465       G 1    13                                                      
REMARK 465       G 1    14                                                      
REMARK 465       U 1    15                                                      
REMARK 465       U 1    16                                                      
REMARK 465       C 1    17                                                      
REMARK 465       U 1    18                                                      
REMARK 465       C 1    19                                                      
REMARK 465       C 1    20                                                      
REMARK 465       C 1    21                                                      
REMARK 465       G 1    22                                                      
REMARK 465       C 1    23                                                      
REMARK 465       A 1    24                                                      
REMARK 465       A 1    25                                                      
REMARK 465       C 1    26                                                      
REMARK 465       G 1    27                                                      
REMARK 465       C 1    28                                                      
REMARK 465       U 1    29                                                      
REMARK 465       A 1    30                                                      
REMARK 465       C 1    31                                                      
REMARK 465       U 1    75                                                      
REMARK 465       G 1    76                                                      
REMARK 465       A 1    77                                                      
REMARK 465       C 1    78                                                      
REMARK 465       G 1    79                                                      
REMARK 465       C 1    80                                                      
REMARK 465       G 1    81                                                      
REMARK 465       U 1    82                                                      
REMARK 465       G 1    83                                                      
REMARK 465       U 1    84                                                      
REMARK 465       G 1    85                                                      
REMARK 465       C 1    86                                                      
REMARK 465       C 1    87                                                      
REMARK 465       G 1    88                                                      
REMARK 465       G 1    89                                                      
REMARK 465       G 1    90                                                      
REMARK 465       A 1    91                                                      
REMARK 465       U 1    92                                                      
REMARK 465       G 1    93                                                      
REMARK 465       U 1    94                                                      
REMARK 465       A 1    95                                                      
REMARK 465       G 1    96                                                      
REMARK 465       C 1    97                                                      
REMARK 465       U 1    98                                                      
REMARK 465       G 1    99                                                      
REMARK 465       G 1   100                                                      
REMARK 465       C 1   101                                                      
REMARK 465       A 1   102                                                      
REMARK 465       G 1   103                                                      
REMARK 465       G 1   104                                                      
REMARK 465       G 1   105                                                      
REMARK 465       C 1   106                                                      
REMARK 465       C 1   107                                                      
REMARK 465       C 1   108                                                      
REMARK 465       C 1   109                                                      
REMARK 465       C 1   110                                                      
REMARK 465       A 1   111                                                      
REMARK 465       C 1   112                                                      
REMARK 465       C 1   113                                                      
REMARK 465       U A   546                                                      
REMARK 465       A A   547                                                      
REMARK 465       G A   883                                                      
REMARK 465       U A   884                                                      
REMARK 465       C A   885                                                      
REMARK 465       A A   886                                                      
REMARK 465       U A   887                                                      
REMARK 465       C A   888                                                      
REMARK 465       C A   889                                                      
REMARK 465       C A   890                                                      
REMARK 465       G A   891                                                      
REMARK 465       A A   892                                                      
REMARK 465       C A   893                                                      
REMARK 465       U A  1174                                                      
REMARK 465       A A  1175                                                      
REMARK 465       U A  1176                                                      
REMARK 465       A A  1913                                                      
REMARK 465       C A  1914                                                      
REMARK 465       U A  1915                                                      
REMARK 465       A A  1916                                                      
REMARK 465     MET C     1                                                      
REMARK 465     MET F     1                                                      
REMARK 465     MET G     1                                                      
REMARK 465     MET I     1                                                      
REMARK 465     ALA I   127                                                      
REMARK 465     THR I   128                                                      
REMARK 465     LEU I   129                                                      
REMARK 465     PRO I   130                                                      
REMARK 465     THR I   131                                                      
REMARK 465     TYR I   132                                                      
REMARK 465     GLU I   133                                                      
REMARK 465     GLU I   134                                                      
REMARK 465     ALA I   135                                                      
REMARK 465     ILE I   136                                                      
REMARK 465     ALA I   137                                                      
REMARK 465     ARG I   138                                                      
REMARK 465     LEU I   139                                                      
REMARK 465     MET I   140                                                      
REMARK 465     ALA I   141                                                      
REMARK 465     THR I   142                                                      
REMARK 465     MET I   143                                                      
REMARK 465     LYS I   144                                                      
REMARK 465     GLU I   145                                                      
REMARK 465     ALA I   146                                                      
REMARK 465     SER I   147                                                      
REMARK 465     ALA I   148                                                      
REMARK 465     GLY I   149                                                      
REMARK 465     LYS I   150                                                      
REMARK 465     LEU I   151                                                      
REMARK 465     VAL I   152                                                      
REMARK 465     ARG I   153                                                      
REMARK 465     THR I   154                                                      
REMARK 465     LEU I   155                                                      
REMARK 465     ALA I   156                                                      
REMARK 465     ALA I   157                                                      
REMARK 465     VAL I   158                                                      
REMARK 465     ARG I   159                                                      
REMARK 465     ASP I   160                                                      
REMARK 465     ALA I   161                                                      
REMARK 465     LYS I   162                                                      
REMARK 465     GLU I   163                                                      
REMARK 465     ALA I   164                                                      
REMARK 465     ALA I   165                                                      
REMARK 465     MET J     1                                                      
REMARK 465     ALA J     2                                                      
REMARK 465     LYS J     3                                                      
REMARK 465     LYS J     4                                                      
REMARK 465     VAL J     5                                                      
REMARK 465     GLN J     6                                                      
REMARK 465     ALA J     7                                                      
REMARK 465     ASP J   142                                                      
REMARK 465     ALA O   126                                                      
REMARK 465     GLU O   127                                                      
REMARK 465     MET Q     1                                                      
REMARK 465     MET R     1                                                      
REMARK 465     MET U     1                                                      
REMARK 465     GLY U    97                                                      
REMARK 465     GLY U    98                                                      
REMARK 465     ALA U    99                                                      
REMARK 465     GLU U   100                                                      
REMARK 465     MET V     1                                                      
REMARK 465     MET X     1                                                      
REMARK 465     ALA X     2                                                      
REMARK 465     HIS X     3                                                      
REMARK 465     LYS X     4                                                      
REMARK 465     LYS X     5                                                      
REMARK 465     ALA X     6                                                      
REMARK 465     GLY X     7                                                      
REMARK 465     GLY X     8                                                      
REMARK 465     SER X     9                                                      
REMARK 465     MET Y     1                                                      
REMARK 465     MET Z     1                                                      
REMARK 465     MET a     1                                                      
REMARK 465     MET b     1                                                      
REMARK 465     MET c     1                                                      
REMARK 465     ALA c     2                                                      
REMARK 465     LYS c     3                                                      
REMARK 465     LYS c    55                                                      
REMARK 465     MET e     1                                                      
REMARK 465     ASN i     4                                                      
REMARK 465     LEU i     5                                                      
REMARK 465     THR i     6                                                      
REMARK 465     ASP i     7                                                      
REMARK 465     ARG i     8                                                      
REMARK 465     LEU i     9                                                      
REMARK 465     SER i    10                                                      
REMARK 465     ARG i    11                                                      
REMARK 465     THR i    12                                                      
REMARK 465     LEU i    13                                                      
REMARK 465     ARG i    14                                                      
REMARK 465     ASN i    15                                                      
REMARK 465     ILE i    16                                                      
REMARK 465     SER i    17                                                      
REMARK 465     GLY i    18                                                      
REMARK 465     ARG i    19                                                      
REMARK 465     GLY i    20                                                      
REMARK 465     ARG i    21                                                      
REMARK 465     LEU i    22                                                      
REMARK 465     THR i    23                                                      
REMARK 465     GLU i    24                                                      
REMARK 465     ASP i    25                                                      
REMARK 465     ASN i    26                                                      
REMARK 465     VAL i    27                                                      
REMARK 465     LYS i    28                                                      
REMARK 465     ASP i    29                                                      
REMARK 465     THR i    30                                                      
REMARK 465     LEU i    31                                                      
REMARK 465     ARG i    32                                                      
REMARK 465     GLU i    33                                                      
REMARK 465     VAL i    34                                                      
REMARK 465     ARG i    35                                                      
REMARK 465     MET i    36                                                      
REMARK 465     ALA i    37                                                      
REMARK 465     LEU i    38                                                      
REMARK 465     LEU i    39                                                      
REMARK 465     GLU i    40                                                      
REMARK 465     ALA i    41                                                      
REMARK 465     ASP i    42                                                      
REMARK 465     VAL i    43                                                      
REMARK 465     ALA i    44                                                      
REMARK 465     LEU i    45                                                      
REMARK 465     PRO i    46                                                      
REMARK 465     VAL i    47                                                      
REMARK 465     VAL i    48                                                      
REMARK 465     ARG i    49                                                      
REMARK 465     GLU i    50                                                      
REMARK 465     PHE i    51                                                      
REMARK 465     ILE i    52                                                      
REMARK 465     ASN i    53                                                      
REMARK 465     ARG i    54                                                      
REMARK 465     VAL i    55                                                      
REMARK 465     LYS i    56                                                      
REMARK 465     GLU i    57                                                      
REMARK 465     LYS i    58                                                      
REMARK 465     ALA i    59                                                      
REMARK 465     VAL i    60                                                      
REMARK 465     GLY i    61                                                      
REMARK 465     HIS i    62                                                      
REMARK 465     GLU i    63                                                      
REMARK 465     VAL i    64                                                      
REMARK 465     ASN i    65                                                      
REMARK 465     LYS i    66                                                      
REMARK 465     SER i    67                                                      
REMARK 465     LEU i    68                                                      
REMARK 465     THR i    69                                                      
REMARK 465     PRO i    70                                                      
REMARK 465     GLY i    71                                                      
REMARK 465     GLN i    72                                                      
REMARK 465     GLU i    73                                                      
REMARK 465     PHE i    74                                                      
REMARK 465     VAL i    75                                                      
REMARK 465     LYS i    76                                                      
REMARK 465     ILE i    77                                                      
REMARK 465     VAL i    78                                                      
REMARK 465     ARG i    79                                                      
REMARK 465     ASN i    80                                                      
REMARK 465     GLU i    81                                                      
REMARK 465     LEU i    82                                                      
REMARK 465     VAL i    83                                                      
REMARK 465     ALA i    84                                                      
REMARK 465     ALA i    85                                                      
REMARK 465     MET i    86                                                      
REMARK 465     GLY i    87                                                      
REMARK 465     GLU i    88                                                      
REMARK 465     GLU i    89                                                      
REMARK 465     ASN i    90                                                      
REMARK 465     GLN i    91                                                      
REMARK 465     THR i    92                                                      
REMARK 465     LEU i    93                                                      
REMARK 465     ASN i    94                                                      
REMARK 465     LEU i    95                                                      
REMARK 465     ALA i    96                                                      
REMARK 465     ALA i    97                                                      
REMARK 465     GLN i    98                                                      
REMARK 465     PRO i    99                                                      
REMARK 465     PRO i   100                                                      
REMARK 465     ALA i   101                                                      
REMARK 465     VAL i   102                                                      
REMARK 465     VAL i   103                                                      
REMARK 465     LEU i   104                                                      
REMARK 465     MET i   105                                                      
REMARK 465     ALA i   106                                                      
REMARK 465     GLY i   107                                                      
REMARK 465     LEU i   108                                                      
REMARK 465     GLN i   109                                                      
REMARK 465     GLY i   110                                                      
REMARK 465     ALA i   111                                                      
REMARK 465     GLY i   112                                                      
REMARK 465     LYS i   113                                                      
REMARK 465     THR i   114                                                      
REMARK 465     THR i   115                                                      
REMARK 465     SER i   116                                                      
REMARK 465     VAL i   117                                                      
REMARK 465     GLY i   118                                                      
REMARK 465     LYS i   119                                                      
REMARK 465     LEU i   120                                                      
REMARK 465     GLY i   121                                                      
REMARK 465     LYS i   122                                                      
REMARK 465     PHE i   123                                                      
REMARK 465     LEU i   124                                                      
REMARK 465     ARG i   125                                                      
REMARK 465     GLU i   126                                                      
REMARK 465     LYS i   127                                                      
REMARK 465     HIS i   128                                                      
REMARK 465     LYS i   129                                                      
REMARK 465     LYS i   130                                                      
REMARK 465     LYS i   131                                                      
REMARK 465     VAL i   132                                                      
REMARK 465     LEU i   133                                                      
REMARK 465     VAL i   134                                                      
REMARK 465     VAL i   135                                                      
REMARK 465     SER i   136                                                      
REMARK 465     ALA i   137                                                      
REMARK 465     ASP i   138                                                      
REMARK 465     VAL i   139                                                      
REMARK 465     TYR i   140                                                      
REMARK 465     ARG i   141                                                      
REMARK 465     PRO i   142                                                      
REMARK 465     ALA i   143                                                      
REMARK 465     ALA i   144                                                      
REMARK 465     ILE i   145                                                      
REMARK 465     LYS i   146                                                      
REMARK 465     GLN i   147                                                      
REMARK 465     LEU i   148                                                      
REMARK 465     GLU i   149                                                      
REMARK 465     THR i   150                                                      
REMARK 465     LEU i   151                                                      
REMARK 465     ALA i   152                                                      
REMARK 465     GLU i   153                                                      
REMARK 465     GLN i   154                                                      
REMARK 465     VAL i   155                                                      
REMARK 465     GLY i   156                                                      
REMARK 465     VAL i   157                                                      
REMARK 465     ASP i   158                                                      
REMARK 465     PHE i   159                                                      
REMARK 465     PHE i   160                                                      
REMARK 465     PRO i   161                                                      
REMARK 465     SER i   162                                                      
REMARK 465     ASP i   163                                                      
REMARK 465     VAL i   164                                                      
REMARK 465     GLY i   165                                                      
REMARK 465     GLN i   166                                                      
REMARK 465     LYS i   167                                                      
REMARK 465     PRO i   168                                                      
REMARK 465     VAL i   169                                                      
REMARK 465     ASP i   170                                                      
REMARK 465     ILE i   171                                                      
REMARK 465     VAL i   172                                                      
REMARK 465     ASN i   173                                                      
REMARK 465     ALA i   174                                                      
REMARK 465     ALA i   175                                                      
REMARK 465     LEU i   176                                                      
REMARK 465     LYS i   177                                                      
REMARK 465     GLU i   178                                                      
REMARK 465     ALA i   179                                                      
REMARK 465     LYS i   180                                                      
REMARK 465     LEU i   181                                                      
REMARK 465     LYS i   182                                                      
REMARK 465     PHE i   183                                                      
REMARK 465     TYR i   184                                                      
REMARK 465     ASP i   185                                                      
REMARK 465     VAL i   186                                                      
REMARK 465     LEU i   187                                                      
REMARK 465     LEU i   188                                                      
REMARK 465     VAL i   189                                                      
REMARK 465     ASP i   190                                                      
REMARK 465     THR i   191                                                      
REMARK 465     ALA i   192                                                      
REMARK 465     GLY i   193                                                      
REMARK 465     ARG i   194                                                      
REMARK 465     LEU i   195                                                      
REMARK 465     HIS i   196                                                      
REMARK 465     VAL i   197                                                      
REMARK 465     ASP i   198                                                      
REMARK 465     GLU i   199                                                      
REMARK 465     ALA i   200                                                      
REMARK 465     MET i   201                                                      
REMARK 465     MET i   202                                                      
REMARK 465     ASP i   203                                                      
REMARK 465     GLU i   204                                                      
REMARK 465     ILE i   205                                                      
REMARK 465     LYS i   206                                                      
REMARK 465     GLN i   207                                                      
REMARK 465     VAL i   208                                                      
REMARK 465     HIS i   209                                                      
REMARK 465     ALA i   210                                                      
REMARK 465     SER i   211                                                      
REMARK 465     ILE i   212                                                      
REMARK 465     ASN i   213                                                      
REMARK 465     PRO i   214                                                      
REMARK 465     VAL i   215                                                      
REMARK 465     GLU i   216                                                      
REMARK 465     THR i   217                                                      
REMARK 465     LEU i   218                                                      
REMARK 465     PHE i   219                                                      
REMARK 465     VAL i   220                                                      
REMARK 465     VAL i   221                                                      
REMARK 465     ASP i   222                                                      
REMARK 465     ALA i   223                                                      
REMARK 465     MET i   224                                                      
REMARK 465     THR i   225                                                      
REMARK 465     GLY i   226                                                      
REMARK 465     GLN i   227                                                      
REMARK 465     ASP i   228                                                      
REMARK 465     ALA i   229                                                      
REMARK 465     ALA i   230                                                      
REMARK 465     ASN i   231                                                      
REMARK 465     THR i   232                                                      
REMARK 465     ALA i   233                                                      
REMARK 465     LYS i   234                                                      
REMARK 465     ALA i   235                                                      
REMARK 465     PHE i   236                                                      
REMARK 465     ASN i   237                                                      
REMARK 465     GLU i   238                                                      
REMARK 465     ALA i   239                                                      
REMARK 465     LEU i   240                                                      
REMARK 465     PRO i   241                                                      
REMARK 465     LEU i   242                                                      
REMARK 465     THR i   243                                                      
REMARK 465     GLY i   244                                                      
REMARK 465     VAL i   245                                                      
REMARK 465     VAL i   246                                                      
REMARK 465     LEU i   247                                                      
REMARK 465     THR i   248                                                      
REMARK 465     LYS i   249                                                      
REMARK 465     VAL i   250                                                      
REMARK 465     ASP i   251                                                      
REMARK 465     GLY i   252                                                      
REMARK 465     ASP i   253                                                      
REMARK 465     ALA i   254                                                      
REMARK 465     ARG i   255                                                      
REMARK 465     GLY i   256                                                      
REMARK 465     GLY i   257                                                      
REMARK 465     ALA i   258                                                      
REMARK 465     ALA i   259                                                      
REMARK 465     LEU i   260                                                      
REMARK 465     SER i   261                                                      
REMARK 465     ILE i   262                                                      
REMARK 465     ARG i   263                                                      
REMARK 465     HIS i   264                                                      
REMARK 465     ILE i   265                                                      
REMARK 465     THR i   266                                                      
REMARK 465     GLY i   267                                                      
REMARK 465     LYS i   268                                                      
REMARK 465     PRO i   269                                                      
REMARK 465     ILE i   270                                                      
REMARK 465     LYS i   271                                                      
REMARK 465     PHE i   272                                                      
REMARK 465     LEU i   273                                                      
REMARK 465     GLY i   274                                                      
REMARK 465     VAL i   275                                                      
REMARK 465     GLY i   276                                                      
REMARK 465     GLU i   277                                                      
REMARK 465     LYS i   278                                                      
REMARK 465     THR i   279                                                      
REMARK 465     GLU i   280                                                      
REMARK 465     ALA i   281                                                      
REMARK 465     LEU i   282                                                      
REMARK 465     GLU i   283                                                      
REMARK 465     PRO i   284                                                      
REMARK 465     PHE i   285                                                      
REMARK 465     HIS i   286                                                      
REMARK 465     PRO i   287                                                      
REMARK 465     ASP i   288                                                      
REMARK 465     ARG i   289                                                      
REMARK 465     ILE i   290                                                      
REMARK 465     ALA i   291                                                      
REMARK 465     SER i   292                                                      
REMARK 465     ARG i   293                                                      
REMARK 465     ILE i   294                                                      
REMARK 465     LEU i   295                                                      
REMARK 465     GLY i   296                                                      
REMARK 465     MET i   297                                                      
REMARK 465     UNK i   298                                                      
REMARK 465     UNK i   299                                                      
REMARK 465     UNK i   300                                                      
REMARK 465     UNK i   301                                                      
REMARK 465     UNK i   302                                                      
REMARK 465     UNK i   303                                                      
REMARK 465     UNK i   304                                                      
REMARK 465     UNK i   305                                                      
REMARK 465     UNK i   306                                                      
REMARK 465     UNK i   307                                                      
REMARK 465     UNK i   308                                                      
REMARK 465     UNK i   309                                                      
REMARK 465     UNK i   310                                                      
REMARK 465     UNK i   311                                                      
REMARK 465     UNK i   312                                                      
REMARK 465     UNK i   313                                                      
REMARK 465     UNK i   314                                                      
REMARK 465     UNK i   315                                                      
REMARK 465     UNK i   316                                                      
REMARK 465     UNK i   317                                                      
REMARK 465     UNK i   318                                                      
REMARK 465     UNK i   319                                                      
REMARK 465     UNK i   320                                                      
REMARK 465     UNK i   321                                                      
REMARK 465     UNK i   322                                                      
REMARK 465     UNK i   323                                                      
REMARK 465     UNK i   324                                                      
REMARK 465     UNK i   325                                                      
REMARK 465     UNK i   326                                                      
REMARK 465     UNK i   327                                                      
REMARK 470                                                                      
REMARK 470 MISSING ATOM                                                         
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 470 I=INSERTION CODE):                                                   
REMARK 470   M RES CSSEQI  ATOMS                                                
REMARK 470     LYS C 273    CA   C    O    CB   CG   CD   CE                    
REMARK 470     LYS C 273    NZ                                                  
REMARK 470     LYS F 179    CA   C    O    CB   CG   CD   CE                    
REMARK 470     LYS F 179    NZ                                                  
REMARK 470     LYS V 104    CA   C    O    CB   CG   CD   CE                    
REMARK 470     LYS V 104    NZ                                                  
REMARK 470     THR X  10    OG1  CG2                                            
REMARK 470     ILE c  54    CG1  CG2  CD1                                       
REMARK 470     LYS i 371    CG   CD   CE   NZ                                   
REMARK 470     LYS i 431    CG   CD   CE   NZ                                   
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   O2     U A   276     N6     A A   278              2.03            
REMARK 500   O2'    A A  1342     OP2    U A  1344              2.05            
REMARK 500   NZ   LYS c    25     O    GLU c    32              2.07            
REMARK 500   O2'    C 1    62     O    SER i   382              2.09            
REMARK 500   O2     C B    43     NH2  ARG F    92              2.09            
REMARK 500   O2'    U A  1534     O6     G A  1537              2.10            
REMARK 500   O2'    U A  2130     O2'    G A  2133              2.11            
REMARK 500   OP1    G A  1753     NH1  ARG Q    93              2.12            
REMARK 500   N3     U A   545     O6     G A   548              2.13            
REMARK 500   O    ALA D   196     OG   SER D   199              2.13            
REMARK 500   O2'    G A   370     OP1    G A   424              2.14            
REMARK 500   O2'    G A  1266     O6     G A  2012              2.15            
REMARK 500   OP1    G A   617     NH2  ARG E   102              2.15            
REMARK 500   OP1    C A  2420     OG1  THR e    34              2.17            
REMARK 500   OP1    U A  2122     N2     G A  2168              2.17            
REMARK 500   OE1  GLN W    51     OH   TYR W    57              2.17            
REMARK 500   N2     G A  1869     O2'    A A  1871              2.17            
REMARK 500   O    HIS N    13     NZ   LYS N    71              2.18            
REMARK 500   O2'    C A  2636     OH   TYR D    45              2.18            
REMARK 500   O2     C A  2793     N2     G A  2803              2.19            
REMARK 500   O2     U A   545     N1     G A   548              2.19            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND LENGTHS                                      
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,2(A3,1X,A1,I4,A1,1X,A4,3X),1X,F6.3)               
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   RES CSSEQI ATM2   DEVIATION                     
REMARK 500      A A1490   N9      A A1490   C4      0.038                       
REMARK 500      A A2117   N9      A A2117   C4      0.036                       
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500      A 1  42   O4' -  C1' -  N9  ANGL. DEV. =   4.9 DEGREES          
REMARK 500      A 1  42   C4  -  N9  -  C1' ANGL. DEV. =  12.1 DEGREES          
REMARK 500      C 1  62   C6  -  N1  -  C2  ANGL. DEV. =  -2.9 DEGREES          
REMARK 500      G A 141   N7  -  C8  -  N9  ANGL. DEV. =   3.2 DEGREES          
REMARK 500      C A 281   O3' -  P   -  OP2 ANGL. DEV. =   9.1 DEGREES          
REMARK 500      A A 479   O4' -  C1' -  N9  ANGL. DEV. =   4.4 DEGREES          
REMARK 500      C A 645   C2  -  N1  -  C1' ANGL. DEV. =   7.1 DEGREES          
REMARK 500      G A 748   O4' -  C1' -  N9  ANGL. DEV. =   4.3 DEGREES          
REMARK 500      C A 995   C6  -  N1  -  C2  ANGL. DEV. =   2.9 DEGREES          
REMARK 500      C A1052   C5  -  C6  -  N1  ANGL. DEV. =   3.6 DEGREES          
REMARK 500      U A1065   C6  -  N1  -  C2  ANGL. DEV. =  -3.7 DEGREES          
REMARK 500      U A1065   C5  -  C6  -  N1  ANGL. DEV. =   3.0 DEGREES          
REMARK 500      C A1072   C6  -  N1  -  C2  ANGL. DEV. =  -3.3 DEGREES          
REMARK 500      C A1072   C5  -  C6  -  N1  ANGL. DEV. =   3.1 DEGREES          
REMARK 500      C A1164   C6  -  N1  -  C2  ANGL. DEV. =  -2.5 DEGREES          
REMARK 500      A A1308   N1  -  C6  -  N6  ANGL. DEV. =  -3.6 DEGREES          
REMARK 500      A A1434   O4' -  C1' -  N9  ANGL. DEV. =   4.5 DEGREES          
REMARK 500      A A1490   N7  -  C8  -  N9  ANGL. DEV. =   3.9 DEGREES          
REMARK 500      A A1490   C8  -  N9  -  C4  ANGL. DEV. =  -4.2 DEGREES          
REMARK 500      C A1533   C6  -  N1  -  C2  ANGL. DEV. =  -2.6 DEGREES          
REMARK 500      C A1533   C5  -  C6  -  N1  ANGL. DEV. =   3.6 DEGREES          
REMARK 500      U A1584   N1  -  C2  -  O2  ANGL. DEV. =   4.5 DEGREES          
REMARK 500      U A1584   C2  -  N1  -  C1' ANGL. DEV. =   9.3 DEGREES          
REMARK 500      U A1917   C2  -  N1  -  C1' ANGL. DEV. =   8.4 DEGREES          
REMARK 500      A A1970   C8  -  N9  -  C4  ANGL. DEV. =  -2.9 DEGREES          
REMARK 500      C A2153   C6  -  N1  -  C2  ANGL. DEV. =  -2.8 DEGREES          
REMARK 500      C A2160   C6  -  N1  -  C2  ANGL. DEV. =  -3.4 DEGREES          
REMARK 500      C A2160   C5  -  C6  -  N1  ANGL. DEV. =   3.3 DEGREES          
REMARK 500      C A2177   C6  -  N1  -  C2  ANGL. DEV. =  -2.4 DEGREES          
REMARK 500      C A2422   O4' -  C1' -  N1  ANGL. DEV. =   6.6 DEGREES          
REMARK 500      C A2422   C6  -  N1  -  C2  ANGL. DEV. =  -2.9 DEGREES          
REMARK 500      U A2423   C6  -  N1  -  C2  ANGL. DEV. =  -4.9 DEGREES          
REMARK 500      C A2427   C6  -  N1  -  C2  ANGL. DEV. =  -3.4 DEGREES          
REMARK 500      U A2431   C5  -  C4  -  O4  ANGL. DEV. =   3.9 DEGREES          
REMARK 500      U A2796   C5  -  C6  -  N1  ANGL. DEV. =   3.1 DEGREES          
REMARK 500    PRO D 143   C   -  N   -  CA  ANGL. DEV. =  10.6 DEGREES          
REMARK 500    PRO K   8   C   -  N   -  CA  ANGL. DEV. =   9.1 DEGREES          
REMARK 500    PRO i 391   C   -  N   -  CA  ANGL. DEV. =  10.6 DEGREES          
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    SER C  10      139.20   -176.04                                   
REMARK 500    GLN C 153      -61.03   -128.10                                   
REMARK 500    PHE C 240      -78.36   -124.83                                   
REMARK 500    LYS C 253       71.64     53.05                                   
REMARK 500    GLN D 130     -168.33    -75.28                                   
REMARK 500    HIS D 140      -62.96   -133.11                                   
REMARK 500    GLN D 148      -79.40   -102.37                                   
REMARK 500    ASN D 149     -166.22   -172.98                                   
REMARK 500    LYS E   6      -75.34    -57.78                                   
REMARK 500    THR E  18      -63.10   -104.20                                   
REMARK 500    SER E  80       -1.14     67.12                                   
REMARK 500    GLU E 144      -75.69   -121.43                                   
REMARK 500    GLU F  11      -64.80   -104.08                                   
REMARK 500    GLU F  32      -70.59    -81.26                                   
REMARK 500    VAL F  40      -74.58    -94.51                                   
REMARK 500    LYS F  78       60.49     60.70                                   
REMARK 500    ASP G  47     -126.26     54.22                                   
REMARK 500    THR G  80      -69.80   -107.62                                   
REMARK 500    TYR G 157      -71.59    -99.32                                   
REMARK 500    ASN H  11       -1.83     69.23                                   
REMARK 500    PHE H  29      -66.75   -132.36                                   
REMARK 500    LYS H  42      -70.11    -45.86                                   
REMARK 500    LEU H  75        0.12    -63.55                                   
REMARK 500    GLU H  87       -3.18     73.72                                   
REMARK 500    PRO H 118     -170.79    -66.06                                   
REMARK 500    LEU H 122       65.82     61.38                                   
REMARK 500    THR I  67      150.98     69.83                                   
REMARK 500    PRO I  68       46.46    -91.28                                   
REMARK 500    GLU I  70       -7.98    -59.66                                   
REMARK 500    HIS I  88      148.34     78.94                                   
REMARK 500    ALA I  91      -14.79     67.29                                   
REMARK 500    PHE I 106     -144.37     41.55                                   
REMARK 500    GLU I 107      -68.71   -135.33                                   
REMARK 500    VAL I 108       72.85     62.93                                   
REMARK 500    LYS I 109      -71.20    -73.72                                   
REMARK 500    GLU I 114       -3.84     72.11                                   
REMARK 500    ARG J  65      -13.90     76.85                                   
REMARK 500    ASN J  94      -12.59     64.07                                   
REMARK 500    ARG K  95      -74.41    -76.13                                   
REMARK 500    GLN L   5       -2.38     83.77                                   
REMARK 500    ARG L  17      -73.52   -123.23                                   
REMARK 500    ASN L  90      -65.70   -102.67                                   
REMARK 500    LYS M  29     -113.09     52.61                                   
REMARK 500    LYS M  36     -143.91     50.96                                   
REMARK 500    GLN N   3      134.78    179.29                                   
REMARK 500    PHE N  28      -72.25   -131.02                                   
REMARK 500    PRO N  77     -174.31    -66.26                                   
REMARK 500    GLU O  32      -15.19     69.30                                   
REMARK 500    VAL O  47      -60.91   -101.06                                   
REMARK 500    GLU O  82      -61.56   -127.12                                   
REMARK 500                                                                      
REMARK 500 THIS ENTRY HAS      74 RAMACHANDRAN OUTLIERS.                        
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: NON-CIS, NON-TRANS                                         
REMARK 500                                                                      
REMARK 500 THE FOLLOWING PEPTIDE BONDS DEVIATE SIGNIFICANTLY FROM BOTH          
REMARK 500 CIS AND TRANS CONFORMATION.  CIS BONDS, IF ANY, ARE LISTED           
REMARK 500 ON CISPEP RECORDS.  TRANS IS DEFINED AS 180 +/- 30 AND               
REMARK 500 CIS IS DEFINED AS 0 +/- 30 DEGREES.                                  
REMARK 500                                 MODEL     OMEGA                      
REMARK 500 HIS C  232     GLY C  233                  145.75                    
REMARK 500 UNK i  367     UNK i  368                  148.45                    
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 620                                                                      
REMARK 620 METAL COORDINATION                                                   
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):                             
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3134  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 163   OP2                                                    
REMARK 620 2   C A 164   OP2 107.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3095  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 192   OP1                                                    
REMARK 620 2   U A2243   OP1  78.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3098  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 197   OP1                                                    
REMARK 620 2   C A 198   OP2  91.4                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3377  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 284   O4                                                     
REMARK 620 2   G A 285   O6   78.3                                              
REMARK 620 3   U A 355   O4  174.0 107.5                                        
REMARK 620 4   G A 356   O6   69.0  82.1 109.9                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3066  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 370   OP2                                                    
REMARK 620 2   A A 422   OP2 160.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3133  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 375   OP1                                                    
REMARK 620 2   C A 393   OP1  92.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3067  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 411   OP1                                                    
REMARK 620 2   A A2407   OP1  86.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3007  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 450   O6                                                     
REMARK 620 2   A A 453   OP1  82.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3302  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 452   O4'                                                    
REMARK 620 2   A A 470   OP2  92.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3225  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 452   O3'                                                    
REMARK 620 2   A A 453   OP1  61.0                                              
REMARK 620 3   A A 471   OP1 140.9 148.9                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3147  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 505   OP2                                                    
REMARK 620 2   G A1235   OP1  64.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3101  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 510   OP1                                                    
REMARK 620 2   U A 511   OP2  74.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3008  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 526   OP1                                                    
REMARK 620 2   C A 527   OP1  77.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3085  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 570   O6                                                     
REMARK 620 2   A A2448   OP1 153.8                                              
REMARK 620 3   C A2499   OP1  75.0  79.0                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3012  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 574   OP1                                                    
REMARK 620 2   A A 574   OP2  56.4                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3082  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 576   OP1                                                    
REMARK 620 2   A A2503   OP1  78.5                                              
REMARK 620 3   A A2503   OP2 137.3  58.8                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3177  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 586   OP2                                                    
REMARK 620 2   U A1249   OP1 146.1                                              
REMARK 620 3   G A1250   OP1 131.7  72.7                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3257  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 594   O4                                                     
REMARK 620 2   G A 662   O6   89.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3142  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 597   O6                                                     
REMARK 620 2   U A 598   O4   78.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3016  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 622   OP1                                                    
REMARK 620 2 ASN M  99   OD1 130.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3331  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 638   O6                                                     
REMARK 620 2   G A 649   O6   64.4                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3341  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 695   O6                                                     
REMARK 620 2   U A 767   O4   97.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3334  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 711   O6                                                     
REMARK 620 2   G A 712   O6   86.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3087  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 740   OP2                                                    
REMARK 620 2   A A1783   OP1 161.8                                              
REMARK 620 3   A A1784   OP2 101.4  72.2                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3020  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 751   OP1                                                    
REMARK 620 2   A A1614   OP1 170.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3021  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 783   OP2                                                    
REMARK 620 2   G A 784   OP2  75.4                                              
REMARK 620 3   A A2589   OP1  73.8  83.2                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3022  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 784   OP1                                                    
REMARK 620 2   G A2588   OP1  71.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3174  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 787   OP1                                                    
REMARK 620 2   U A 790   OP2 150.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3070  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 818   OP2                                                    
REMARK 620 2   G A1187   O6   95.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3027  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 827   OP1                                                    
REMARK 620 2   G A2429   OP2 106.1                                              
REMARK 620 3   A A2430   OP2 155.1  80.9                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3213  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 827   OP2                                                    
REMARK 620 2   C A2427   OP1 131.3                                              
REMARK 620 3   G A2429   OP1 118.8  63.2                                        
REMARK 620 4   G A2429   OP2  85.6 116.6  53.4                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3236  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 869   O6                                                     
REMARK 620 2   U A 870   O4   93.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3028  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 945   OP2                                                    
REMARK 620 2   C A 946   OP2  80.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3030  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 948   OP1                                                    
REMARK 620 2   G A 962   OP1  73.9                                              
REMARK 620 3   U A 963   OP2 147.8  75.3                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3211  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 949   O6                                                     
REMARK 620 2   G A 950   O6   68.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3228  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 953   OP1                                                    
REMARK 620 2   G A 953   O5'  55.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3072  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 990   OP2                                                    
REMARK 620 2   C A 991   OP2  93.0                                              
REMARK 620 3   G A1186   OP2 158.6  68.0                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3169  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 999   OP2                                                    
REMARK 620 2   C A1153   OP2 132.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3103  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1009   OP2                                                    
REMARK 620 2   A A1010   OP2  76.4                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3224  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A1013   OP2                                                    
REMARK 620 2   A A1014   OP2  85.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3212  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A1023   OP2                                                    
REMARK 620 2   G A1025   O2'  81.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3097  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1265   OP2                                                    
REMARK 620 2   U A2615   OP1  67.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3033  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1268   OP1                                                    
REMARK 620 2   C A2006   OP1  80.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3034  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1269   OP2                                                    
REMARK 620 2   A A2005   OP1 104.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3035  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A1271   OP2                                                    
REMARK 620 2   A A1272   OP1  74.2                                              
REMARK 620 3   U A1647   OP1 168.1  94.1                                        
REMARK 620 4   U A1648   OP1  85.7 153.8 106.2                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3171  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A1298   OP2                                                    
REMARK 620 2   C A1639   OP2 151.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3140  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A1303   OP2                                                    
REMARK 620 2   C A1607   OP1 150.9                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3099  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A1314   OP1                                                    
REMARK 620 2   C A1315   OP2  77.7                                              
REMARK 620 3   G A1332   OP1  88.7 150.1                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3343  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A1318   O4                                                     
REMARK 620 2   G A1331   OP2 108.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3319  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A1326   O2                                                     
REMARK 620 2 GLY O 105   O   141.9                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3090  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1342   OP2                                                    
REMARK 620 2   U A1602   O4   90.9                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3074  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1359   OP1                                                    
REMARK 620 2   G A1360   OP2  77.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3138  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A1379   OP2                                                    
REMARK 620 2   G A1380   OP2  80.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3040  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A1394   OP1                                                    
REMARK 620 2   C A1604   OP1  79.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3041  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1395   OP1                                                    
REMARK 620 2   A A1603   OP1  80.7                                              
REMARK 620 3   C A1604   OP2 110.8  81.1                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3193  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1395   O5'                                                    
REMARK 620 2   A A1603   OP1 109.4                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3076  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1439   OP2                                                    
REMARK 620 2   U A1440   O4   73.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3336  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A1622   OP1                                                    
REMARK 620 2   G A1622   OP2  51.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3110  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1664   OP1                                                    
REMARK 620 2   A A1665   OP2  71.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3092  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1669   OP2                                                    
REMARK 620 2   C A1670   OP2  84.3                                              
REMARK 620 3   U A1671   O4   89.5 106.2                                        
REMARK 620 4   G A2550   OP1  87.6  84.3 168.8                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3045  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A1670   OP1                                                    
REMARK 620 2   U A1671   OP2  70.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3281  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A1673   OP1                                                    
REMARK 620 2   U A2552   OP2 118.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3086  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1780   OP1                                                    
REMARK 620 2   U A1782   OP1  85.1                                              
REMARK 620 3   A A1783   OP2 112.1  80.4                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3190  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A1968   OP1                                                    
REMARK 620 2   G A2592   OP1  78.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3245  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1970   OP1                                                    
REMARK 620 2   U A1971   OP1  97.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3052  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A2056   OP2                                                    
REMARK 620 2   G A2057   OP2  68.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3053  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A2061   OP2                                                    
REMARK 620 2   G A2502   OP2  72.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3320  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2071   OP1                                                    
REMARK 620 2   U A2243   OP2 160.9                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3405  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A2202   O4                                                     
REMARK 620 2   G A2221   O6  100.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3056  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A2248   OP2                                                    
REMARK 620 2   U A2249   O4   74.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3214  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A2250   O2'                                                    
REMARK 620 2   G A2251   OP2  84.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3057  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2268   OP1                                                    
REMARK 620 2   G A2269   OP1  92.9                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3084  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2448   OP2                                                    
REMARK 620 2   A A2497   O3' 120.7                                              
REMARK 620 3   C A2498   OP2  70.4  52.8                                        
REMARK 620 4   C A2499   OP2  70.0  94.1  61.5                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3089  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A2507   OP1                                                    
REMARK 620 2   C A2573   OP1 109.5                                              
REMARK 620 3   G A2574   OP1 111.1  58.7                                        
REMARK 620 4   C A2575   OP2 173.4  64.7  63.5                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3129  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A2576   OP1                                                    
REMARK 620 2   A A2577   OP1  88.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3307  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A2579   OP1                                                    
REMARK 620 2   C A2611   OP2 165.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3296  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A2582   OP2                                                    
REMARK 620 2   G A2583   OP2  92.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3242  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A2646   OP1                                                    
REMARK 620 2   U A2647   OP2  72.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3064  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2711   OP2                                                    
REMARK 620 2   G A2714   OP2  74.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3206  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2748   OP2                                                    
REMARK 620 2   U A2754   O4   70.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3231  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2766   OP1                                                    
REMARK 620 2   C A2767   OP2  81.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3273  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2776   O2'                                                    
REMARK 620 2   A A2781   O2'  90.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3116  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2821   OP2                                                    
REMARK 620 2   G A2822   OP2  72.1                                              
REMARK 620 3 GLY D 115   O    73.4  76.5                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG B 208  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A B  57   OP2                                                    
REMARK 620 2   A B  58   OP2  71.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG b 101  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 ASP b  20   OD1                                                    
REMARK 620 2 ASP b  20   OD2  44.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              ZN f 101  ZN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 CYS f  11   SG                                                     
REMARK 620 2 CYS f  14   SG  103.2                                              
REMARK 620 3 CYS f  27   SG  109.6 110.0                                        
REMARK 620 4 HIS f  33   ND1 116.4 108.7 108.7                                  
REMARK 620 N                    1     2     3                                   
REMARK 800                                                                      
REMARK 800 SITE                                                                 
REMARK 800 SITE_IDENTIFIER: AC1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG 2 101                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3002                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3003                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3004                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3005                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3006                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3007                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3008                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3010                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3011                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3012                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3014                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3016                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3017                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3019                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3020                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3021                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3022                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3023                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3024                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3025                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3026                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3027                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3028                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3029                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3030                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3031                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3033                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3034                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3035                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3036                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3037                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3038                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3039                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3040                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3041                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3042                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3043                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3045                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3046                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3047                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3048                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3050                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3051                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3052                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3053                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3054                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3056                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3057                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3058                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3059                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3060                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3061                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3062                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3063                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3064                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3065                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3066                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3067                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3068                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3070                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3071                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3072                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3073                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3074                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3075                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3076                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3079                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3080                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3081                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3082                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3083                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3084                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3085                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3086                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3087                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3088                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3089                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3090                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3091                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3092                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3093                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3094                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3095                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3096                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3097                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3098                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3099                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3100                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3101                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3102                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3103                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3104                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3105                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3106                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3107                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3108                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3110                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3111                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3112                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3114                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3115                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3116                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3118                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3119                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3120                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3122                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3124                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3128                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3129                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3130                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3131                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3132                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3133                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3134                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3137                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3138                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3139                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3140                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3141                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3142                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3143                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3144                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3146                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3147                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3148                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3149                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3150                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3151                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3152                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3153                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3154                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3155                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3156                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3158                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3159                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3161                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3162                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3163                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3164                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3165                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3166                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3167                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3168                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3169                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3170                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3171                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3172                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3173                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3174                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3175                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3176                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3177                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3178                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3179                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3180                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3182                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3183                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3185                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3186                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3187                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3188                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3190                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3191                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3192                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3193                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3194                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3195                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3196                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3198                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3199                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3200                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3201                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3202                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3203                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3204                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3205                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3206                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3208                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3209                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3210                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3211                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3212                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3213                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3214                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3215                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3216                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3217                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3219                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3220                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3221                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3222                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3223                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3224                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3225                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3227                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3228                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3229                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3230                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3231                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3232                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3233                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3234                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3235                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3236                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3237                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3238                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3239                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3240                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3242                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3243                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3244                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3245                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3247                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3248                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3250                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3251                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3253                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3254                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3255                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3256                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3257                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3258                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3262                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3263                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3264                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3265                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3266                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3268                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3269                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3271                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3273                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3274                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3275                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3276                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3277                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3278                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3279                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3280                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3281                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3282                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3283                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3284                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3285                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3286                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3288                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3289                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3290                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3291                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3292                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3293                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3294                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3295                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3296                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3297                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3298                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3299                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3300                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3301                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3302                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3304                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3305                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3306                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3307                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3308                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3309                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3310                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3311                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3312                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3313                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3314                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3315                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3316                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3317                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3318                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3319                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3320                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3321                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3322                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3323                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3324                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3326                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3327                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3328                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3329                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3330                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3331                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3332                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3333                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3334                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3335                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3336                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3337                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3338                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3339                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3340                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3341                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3343                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3344                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3345                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3346                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3347                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3348                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3349                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3350                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3351                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3352                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3353                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3354                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3355                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3356                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3357                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3358                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3360                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3361                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3362                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3363                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3364                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3365                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3366                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3367                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3369                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3370                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3371                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3372                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3374                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3375                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3376                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3377                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3378                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3379                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3380                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3381                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3382                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3383                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3384                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3385                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3386                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3387                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3389                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3391                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3392                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3394                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3395                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3396                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3397                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3398                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3399                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3400                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3401                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3402                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3403                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3404                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3405                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3407                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3408                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3409                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3410                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3411                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 202                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 203                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 205                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 206                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 207                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 208                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 209                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 211                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 212                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG C 301                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG C 302                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG O 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG R 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG b 101                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue ZN f 101                  
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: EMD-8003   RELATED DB: EMDB                              
DBREF1 5GAG 1    1   113  GB                   CP011938.1                       
DBREF2 5GAG 1     850013407                      444142      444254             
DBREF  5GAG 2   74    76  PDB    5GAG     5GAG            74     76             
DBREF1 5GAG A    1  2903  GB                   J01695.2                         
DBREF2 5GAG A     170787319                        3250        6152             
DBREF1 5GAG B    1   120  GB                   CP007594.1                       
DBREF2 5GAG B     817146391                     3810264     3810145             
DBREF  5GAG C    1   273  UNP    P60422   RL2_ECOLI        1    273             
DBREF  5GAG D    1   209  UNP    P60438   RL3_ECOLI        1    209             
DBREF  5GAG E    1   201  UNP    P60723   RL4_ECOLI        1    201             
DBREF  5GAG F    1   179  UNP    P62399   RL5_ECOLI        1    179             
DBREF  5GAG G    1   177  UNP    P0AG55   RL6_ECOLI        1    177             
DBREF  5GAG H    1   149  UNP    P0A7R1   RL9_ECOLI        1    149             
DBREF  5GAG I    1   165  UNP    P0A7J3   RL10_ECOLI       1    165             
DBREF  5GAG J    1   142  UNP    P0A7J7   RL11_ECOLI       1    142             
DBREF  5GAG K    1   142  UNP    P0AA10   RL13_ECOLI       1    142             
DBREF  5GAG L    1   123  UNP    P0ADY3   RL14_ECOLI       1    123             
DBREF  5GAG M    1   144  UNP    P02413   RL15_ECOLI       1    144             
DBREF  5GAG N    1   136  UNP    P0ADY7   RL16_ECOLI       1    136             
DBREF  5GAG O    1   127  UNP    P0AG44   RL17_ECOLI       1    127             
DBREF  5GAG P    1   117  UNP    P0C018   RL18_ECOLI       1    117             
DBREF  5GAG Q    1   115  UNP    P0A7K6   RL19_ECOLI       1    115             
DBREF  5GAG R    1   118  UNP    P0A7L3   RL20_ECOLI       1    118             
DBREF  5GAG S    1   103  UNP    P0AG48   RL21_ECOLI       1    103             
DBREF  5GAG T    1   110  UNP    P61175   RL22_ECOLI       1    110             
DBREF  5GAG U    1   100  UNP    P0ADZ0   RL23_ECOLI       1    100             
DBREF  5GAG V    1   104  UNP    P60624   RL24_ECOLI       1    104             
DBREF  5GAG W    1    94  UNP    P68919   RL25_ECOLI       1     94             
DBREF  5GAG X    1    85  UNP    P0A7L8   RL27_ECOLI       1     85             
DBREF  5GAG Y    1    78  UNP    P0A7M2   RL28_ECOLI       1     78             
DBREF  5GAG Z    1    63  UNP    P0A7M6   RL29_ECOLI       1     63             
DBREF  5GAG a    1    59  UNP    P0AG51   RL30_ECOLI       1     59             
DBREF  5GAG b    1    57  UNP    P0A7N4   RL32_ECOLI       1     57             
DBREF  5GAG c    1    55  UNP    P0A7N9   RL33_ECOLI       1     55             
DBREF  5GAG d    1    46  UNP    P0A7P5   RL34_ECOLI       1     46             
DBREF  5GAG e    1    65  UNP    P0A7Q1   RL35_ECOLI       1     65             
DBREF  5GAG f    1    38  UNP    P0A7Q6   RL36_ECOLI       1     38             
DBREF  5GAG i    4   453  PDB    5GAG     5GAG             4    453             
DBREF  5GAG k   27    44  PDB    5GAG     5GAG            27     44             
SEQADV 5GAG VAL I   85  UNP  P0A7J3    SER    85 CONFLICT                       
SEQADV 5GAG THR I   86  UNP  P0A7J3    MET    86 CONFLICT                       
SEQRES   1 1  113    G   G   G   G   G   C   U   C   U   G   U   U   G          
SEQRES   2 1  113    G   U   U   C   U   C   C   C   G   C   A   A   C          
SEQRES   3 1  113    G   C   U   A   C   U   C   U   G   U   U   U   A          
SEQRES   4 1  113    C   C   A   G   G   U   C   A   G   G   U   C   C          
SEQRES   5 1  113    G   G   A   A   G   G   A   A   G   C   A   G   C          
SEQRES   6 1  113    C   A   A   G   G   C   A   G   A   U   G   A   C          
SEQRES   7 1  113    G   C   G   U   G   U   G   C   C   G   G   G   A          
SEQRES   8 1  113    U   G   U   A   G   C   U   G   G   C   A   G   G          
SEQRES   9 1  113    G   C   C   C   C   C   A   C   C                          
SEQRES   1 2    3    C   C   A                                                  
SEQRES   1 A 2903    G   G   U   U   A   A   G   C   G   A   C   U   A          
SEQRES   2 A 2903    A   G   C   G   U   A   C   A   C   G   G   U   G          
SEQRES   3 A 2903    G   A   U   G   C   C   C   U   G   G   C   A   G          
SEQRES   4 A 2903    U   C   A   G   A   G   G   C   G   A   U   G   A          
SEQRES   5 A 2903    A   G   G   A   C   G   U   G   C   U   A   A   U          
SEQRES   6 A 2903    C   U   G   C   G   A   U   A   A   G   C   G   U          
SEQRES   7 A 2903    C   G   G   U   A   A   G   G   U   G   A   U   A          
SEQRES   8 A 2903    U   G   A   A   C   C   G   U   U   A   U   A   A          
SEQRES   9 A 2903    C   C   G   G   C   G   A   U   U   U   C   C   G          
SEQRES  10 A 2903    A   A   U   G   G   G   G   A   A   A   C   C   C          
SEQRES  11 A 2903    A   G   U   G   U   G   U   U   U   C   G   A   C          
SEQRES  12 A 2903    A   C   A   C   U   A   U   C   A   U   U   A   A          
SEQRES  13 A 2903    C   U   G   A   A   U   C   C   A   U   A   G   G          
SEQRES  14 A 2903    U   U   A   A   U   G   A   G   G   C   G   A   A          
SEQRES  15 A 2903    C   C   G   G   G   G   G   A   A   C   U   G   A          
SEQRES  16 A 2903    A   A   C   A   U   C   U   A   A   G   U   A   C          
SEQRES  17 A 2903    C   C   C   G   A   G   G   A   A   A   A   G   A          
SEQRES  18 A 2903    A   A   U   C   A   A   C   C   G   A   G   A   U          
SEQRES  19 A 2903    U   C   C   C   C   C   A   G   U   A   G   C   G          
SEQRES  20 A 2903    G   C   G   A   G   C   G   A   A   C   G   G   G          
SEQRES  21 A 2903    G   A   G   C   A   G   C   C   C   A   G   A   G          
SEQRES  22 A 2903    C   C   U   G   A   A   U   C   A   G   U   G   U          
SEQRES  23 A 2903    G   U   G   U   G   U   U   A   G   U   G   G   A          
SEQRES  24 A 2903    A   G   C   G   U   C   U   G   G   A   A   A   G          
SEQRES  25 A 2903    G   C   G   C   G   C   G   A   U   A   C   A   G          
SEQRES  26 A 2903    G   G   U   G   A   C   A   G   C   C   C   C   G          
SEQRES  27 A 2903    U   A   C   A   C   A   A   A   A   A   U   G   C          
SEQRES  28 A 2903    A   C   A   U   G   C   U   G   U   G   A   G   C          
SEQRES  29 A 2903    U   C   G   A   U   G   A   G   U   A   G   G   G          
SEQRES  30 A 2903    C   G   G   G   A   C   A   C   G   U   G   G   U          
SEQRES  31 A 2903    A   U   C   C   U   G   U   C   U   G   A   A   U          
SEQRES  32 A 2903    A   U   G   G   G   G   G   G   A   C   C   A   U          
SEQRES  33 A 2903    C   C   U   C   C   A   A   G   G   C   U   A   A          
SEQRES  34 A 2903    A   U   A   C   U   C   C   U   G   A   C   U   G          
SEQRES  35 A 2903    A   C   C   G   A   U   A   G   U   G   A   A   C          
SEQRES  36 A 2903    C   A   G   U   A   C   C   G   U   G   A   G   G          
SEQRES  37 A 2903    G   A   A   A   G   G   C   G   A   A   A   A   G          
SEQRES  38 A 2903    A   A   C   C   C   C   G   G   C   G   A   G   G          
SEQRES  39 A 2903    G   G   A   G   U   G   A   A   A   A   A   G   A          
SEQRES  40 A 2903    A   C   C   U   G   A   A   A   C   C   G   U   G          
SEQRES  41 A 2903    U   A   C   G   U   A   C   A   A   G   C   A   G          
SEQRES  42 A 2903    U   G   G   G   A   G   C   A   C   G   C   U   U          
SEQRES  43 A 2903    A   G   G   C   G   U   G   U   G   A   C   U   G          
SEQRES  44 A 2903    C   G   U   A   C   C   U   U   U   U   G   U   A          
SEQRES  45 A 2903    U   A   A   U   G   G   G   U   C   A   G   C   G          
SEQRES  46 A 2903    A   C   U   U   A   U   A   U   U   C   U   G   U          
SEQRES  47 A 2903    A   G   C   A   A   G   G   U   U   A   A   C   C          
SEQRES  48 A 2903    G   A   A   U   A   G   G   G   G   A   G   C   C          
SEQRES  49 A 2903    G   A   A   G   G   G   A   A   A   C   C   G   A          
SEQRES  50 A 2903    G   U   C   U   U   A   A   C   U   G   G   G   C          
SEQRES  51 A 2903    G   U   U   A   A   G   U   U   G   C   A   G   G          
SEQRES  52 A 2903    G   U   A   U   A   G   A   C   C   C   G   A   A          
SEQRES  53 A 2903    A   C   C   C   G   G   U   G   A   U   C   U   A          
SEQRES  54 A 2903    G   C   C   A   U   G   G   G   C   A   G   G   U          
SEQRES  55 A 2903    U   G   A   A   G   G   U   U   G   G   G   U   A          
SEQRES  56 A 2903    A   C   A   C   U   A   A   C   U   G   G   A   G          
SEQRES  57 A 2903    G   A   C   C   G   A   A   C   C   G   A   C   U          
SEQRES  58 A 2903    A   A   U   G   U   U   G   A   A   A   A   A   U          
SEQRES  59 A 2903    U   A   G   C   G   G   A   U   G   A   C   U   U          
SEQRES  60 A 2903    G   U   G   G   C   U   G   G   G   G   G   U   G          
SEQRES  61 A 2903    A   A   A   G   G   C   C   A   A   U   C   A   A          
SEQRES  62 A 2903    A   C   C   G   G   G   A   G   A   U   A   G   C          
SEQRES  63 A 2903    U   G   G   U   U   C   U   C   C   C   C   G   A          
SEQRES  64 A 2903    A   A   G   C   U   A   U   U   U   A   G   G   U          
SEQRES  65 A 2903    A   G   C   G   C   C   U   C   G   U   G   A   A          
SEQRES  66 A 2903    U   U   C   A   U   C   U   C   C   G   G   G   G          
SEQRES  67 A 2903    G   U   A   G   A   G   C   A   C   U   G   U   U          
SEQRES  68 A 2903    U   C   G   G   C   A   A   G   G   G   G   G   U          
SEQRES  69 A 2903    C   A   U   C   C   C   G   A   C   U   U   A   C          
SEQRES  70 A 2903    C   A   A   C   C   C   G   A   U   G   C   A   A          
SEQRES  71 A 2903    A   C   U   G   C   G   A   A   U   A   C   C   G          
SEQRES  72 A 2903    G   A   G   A   A   U   G   U   U   A   U   C   A          
SEQRES  73 A 2903    C   G   G   G   A   G   A   C   A   C   A   C   G          
SEQRES  74 A 2903    G   C   G   G   G   U   G   C   U   A   A   C   G          
SEQRES  75 A 2903    U   C   C   G   U   C   G   U   G   A   A   G   A          
SEQRES  76 A 2903    G   G   G   A   A   A   C   A   A   C   C   C   A          
SEQRES  77 A 2903    G   A   C   C   G   C   C   A   G   C   U   A   A          
SEQRES  78 A 2903    G   G   U   C   C   C   A   A   A   G   U   C   A          
SEQRES  79 A 2903    U   G   G   U   U   A   A   G   U   G   G   G   A          
SEQRES  80 A 2903    A   A   C   G   A   U   G   U   G   G   G   A   A          
SEQRES  81 A 2903    G   G   C   C   C   A   G   A   C   A   G   C   C          
SEQRES  82 A 2903    A   G   G   A   U   G   U   U   G   G   C   U   U          
SEQRES  83 A 2903    A   G   A   A   G   C   A   G   C   C   A   U   C          
SEQRES  84 A 2903    A   U   U   U   A   A   A   G   A   A   A   G   C          
SEQRES  85 A 2903    G   U   A   A   U   A   G   C   U   C   A   C   U          
SEQRES  86 A 2903    G   G   U   C   G   A   G   U   C   G   G   C   C          
SEQRES  87 A 2903    U   G   C   G   C   G   G   A   A   G   A   U   G          
SEQRES  88 A 2903    U   A   A   C   G   G   G   G   C   U   A   A   A          
SEQRES  89 A 2903    C   C   A   U   G   C   A   C   C   G   A   A   G          
SEQRES  90 A 2903    C   U   G   C   G   G   C   A   G   C   G   A   C          
SEQRES  91 A 2903    G   C   U   U   A   U   G   C   G   U   U   G   U          
SEQRES  92 A 2903    U   G   G   G   U   A   G   G   G   G   A   G   C          
SEQRES  93 A 2903    G   U   U   C   U   G   U   A   A   G   C   C   U          
SEQRES  94 A 2903    G   C   G   A   A   G   G   U   G   U   G   C   U          
SEQRES  95 A 2903    G   U   G   A   G   G   C   A   U   G   C   U   G          
SEQRES  96 A 2903    G   A   G   G   U   A   U   C   A   G   A   A   G          
SEQRES  97 A 2903    U   G   C   G   A   A   U   G   C   U   G   A   C          
SEQRES  98 A 2903    A   U   A   A   G   U   A   A   C   G   A   U   A          
SEQRES  99 A 2903    A   A   G   C   G   G   G   U   G   A   A   A   A          
SEQRES 100 A 2903    G   C   C   C   G   C   U   C   G   C   C   G   G          
SEQRES 101 A 2903    A   A   G   A   C   C   A   A   G   G   G   U   U          
SEQRES 102 A 2903    C   C   U   G   U   C   C   A   A   C   G   U   U          
SEQRES 103 A 2903    A   A   U   C   G   G   G   G   C   A   G   G   G          
SEQRES 104 A 2903    U   G   A   G   U   C   G   A   C   C   C   C   U          
SEQRES 105 A 2903    A   A   G   G   C   G   A   G   G   C   C   G   A          
SEQRES 106 A 2903    A   A   G   G   C   G   U   A   G   U   C   G   A          
SEQRES 107 A 2903    U   G   G   G   A   A   A   C   A   G   G   U   U          
SEQRES 108 A 2903    A   A   U   A   U   U   C   C   U   G   U   A   C          
SEQRES 109 A 2903    U   U   G   G   U   G   U   U   A   C   U   G   C          
SEQRES 110 A 2903    G   A   A   G   G   G   G   G   G   A   C   G   G          
SEQRES 111 A 2903    A   G   A   A   G   G   C   U   A   U   G   U   U          
SEQRES 112 A 2903    G   G   C   C   G   G   G   C   G   A   C   G   G          
SEQRES 113 A 2903    U   U   G   U   C   C   C   G   G   U   U   U   A          
SEQRES 114 A 2903    A   G   C   G   U   G   U   A   G   G   C   U   G          
SEQRES 115 A 2903    G   U   U   U   U   C   C   A   G   G   C   A   A          
SEQRES 116 A 2903    A   U   C   C   G   G   A   A   A   A   U   C   A          
SEQRES 117 A 2903    A   G   G   C   U   G   A   G   G   C   G   U   G          
SEQRES 118 A 2903    A   U   G   A   C   G   A   G   G   C   A   C   U          
SEQRES 119 A 2903    A   C   G   G   U   G   C   U   G   A   A   G   C          
SEQRES 120 A 2903    A   A   C   A   A   A   U   G   C   C   C   U   G          
SEQRES 121 A 2903    C   U   U   C   C   A   G   G   A   A   A   A   G          
SEQRES 122 A 2903    C   C   U   C   U   A   A   G   C   A   U   C   A          
SEQRES 123 A 2903    G   G   U   A   A   C   A   U   C   A   A   A   U          
SEQRES 124 A 2903    C   G   U   A   C   C   C   C   A   A   A   C   C          
SEQRES 125 A 2903    G   A   C   A   C   A   G   G   U   G   G   U   C          
SEQRES 126 A 2903    A   G   G   U   A   G   A   G   A   A   U   A   C          
SEQRES 127 A 2903    C   A   A   G   G   C   G   C   U   U   G   A   G          
SEQRES 128 A 2903    A   G   A   A   C   U   C   G   G   G   U   G   A          
SEQRES 129 A 2903    A   G   G   A   A   C   U   A   G   G   C   A   A          
SEQRES 130 A 2903    A   A   U   G   G   U   G   C   C   G   U   A   A          
SEQRES 131 A 2903    C   U   U   C   G   G   G   A   G   A   A   G   G          
SEQRES 132 A 2903    C   A   C   G   C   U   G   A   U   A   U   G   U          
SEQRES 133 A 2903    A   G   G   U   G   A   G   G   U   C   C   C   U          
SEQRES 134 A 2903    C   G   C   G   G   A   U   G   G   A   G   C   U          
SEQRES 135 A 2903    G   A   A   A   U   C   A   G   U   C   G   A   A          
SEQRES 136 A 2903    G   A   U   A   C   C   A   G   C   U   G   G   C          
SEQRES 137 A 2903    U   G   C   A   A   C   U   G   U   U   U   A   U          
SEQRES 138 A 2903    U   A   A   A   A   A   C   A   C   A   G   C   A          
SEQRES 139 A 2903    C   U   G   U   G   C   A   A   A   C   A   C   G          
SEQRES 140 A 2903    A   A   A   G   U   G   G   A   C   G   U   A   U          
SEQRES 141 A 2903    A   C   G   G   U   G   U   G   A   C   G   C   C          
SEQRES 142 A 2903    U   G   C   C   C   G   G   U   G   C   C   G   G          
SEQRES 143 A 2903    A   A   G   G   U   U   A   A   U   U   G   A   U          
SEQRES 144 A 2903    G   G   G   G   U   U   A   G   C   G   C   A   A          
SEQRES 145 A 2903    G   C   G   A   A   G   C   U   C   U   U   G   A          
SEQRES 146 A 2903    U   C   G   A   A   G   C   C   C   C   G   G   U          
SEQRES 147 A 2903    A   A   A   C   G   G   C   G   G   C   C   G   U          
SEQRES 148 A 2903    A   A   C   U   A   U   A   A   C   G   G   U   C          
SEQRES 149 A 2903    C   U   A   A   G   G   U   A   G   C   G   A   A          
SEQRES 150 A 2903    A   U   U   C   C   U   U   G   U   C   G   G   G          
SEQRES 151 A 2903    U   A   A   G   U   U   C   C   G   A   C   C   U          
SEQRES 152 A 2903    G   C   A   C   G   A   A   U   G   G   C   G   U          
SEQRES 153 A 2903    A   A   U   G   A   U   G   G   C   C   A   G   G          
SEQRES 154 A 2903    C   U   G   U   C   U   C   C   A   C   C   C   G          
SEQRES 155 A 2903    A   G   A   C   U   C   A   G   U   G   A   A   A          
SEQRES 156 A 2903    U   U   G   A   A   C   U   C   G   C   U   G   U          
SEQRES 157 A 2903    G   A   A   G   A   U   G   C   A   G   U   G   U          
SEQRES 158 A 2903    A   C   C   C   G   C   G   G   C   A   A   G   A          
SEQRES 159 A 2903    C   G   G   A   A   A   G   A   C   C   C   C   G          
SEQRES 160 A 2903    U   G   A   A   C   C   U   U   U   A   C   U   A          
SEQRES 161 A 2903    U   A   G   C   U   U   G   A   C   A   C   U   G          
SEQRES 162 A 2903    A   A   C   A   U   U   G   A   G   C   C   U   U          
SEQRES 163 A 2903    G   A   U   G   U   G   U   A   G   G   A   U   A          
SEQRES 164 A 2903    G   G   U   G   G   G   A   G   G   C   U   U   U          
SEQRES 165 A 2903    G   A   A   G   U   G   U   G   G   A   C   G   C          
SEQRES 166 A 2903    C   A   G   U   C   U   G   C   A   U   G   G   A          
SEQRES 167 A 2903    G   C   C   G   A   C   C   U   U   G   A   A   A          
SEQRES 168 A 2903    U   A   C   C   A   C   C   C   U   U   U   A   A          
SEQRES 169 A 2903    U   G   U   U   U   G   A   U   G   U   U   C   U          
SEQRES 170 A 2903    A   A   C   G   U   U   G   A   C   C   C   G   U          
SEQRES 171 A 2903    A   A   U   C   C   G   G   G   U   U   G   C   G          
SEQRES 172 A 2903    G   A   C   A   G   U   G   U   C   U   G   G   U          
SEQRES 173 A 2903    G   G   G   U   A   G   U   U   U   G   A   C   U          
SEQRES 174 A 2903    G   G   G   G   C   G   G   U   C   U   C   C   U          
SEQRES 175 A 2903    C   C   U   A   A   A   G   A   G   U   A   A   C          
SEQRES 176 A 2903    G   G   A   G   G   A   G   C   A   C   G   A   A          
SEQRES 177 A 2903    G   G   U   U   G   G   C   U   A   A   U   C   C          
SEQRES 178 A 2903    U   G   G   U   C   G   G   A   C   A   U   C   A          
SEQRES 179 A 2903    G   G   A   G   G   U   U   A   G   U   G   C   A          
SEQRES 180 A 2903    A   U   G   G   C   A   U   A   A   G   C   C   A          
SEQRES 181 A 2903    G   C   U   U   G   A   C   U   G   C   G   A   G          
SEQRES 182 A 2903    C   G   U   G   A   C   G   G   C   G   C   G   A          
SEQRES 183 A 2903    G   C   A   G   G   U   G   C   G   A   A   A   G          
SEQRES 184 A 2903    C   A   G   G   U   C   A   U   A   G   U   G   A          
SEQRES 185 A 2903    U   C   C   G   G   U   G   G   U   U   C   U   G          
SEQRES 186 A 2903    A   A   U   G   G   A   A   G   G   G   C   C   A          
SEQRES 187 A 2903    U   C   G   C   U   C   A   A   C   G   G   A   U          
SEQRES 188 A 2903    A   A   A   A   G   G   U   A   C   U   C   C   G          
SEQRES 189 A 2903    G   G   G   A   U   A   A   C   A   G   G   C   U          
SEQRES 190 A 2903    G   A   U   A   C   C   G   C   C   C   A   A   G          
SEQRES 191 A 2903    A   G   U   U   C   A   U   A   U   C   G   A   C          
SEQRES 192 A 2903    G   G   C   G   G   U   G   U   U   U   G   G   C          
SEQRES 193 A 2903    A   C   C   U   C   G   A   U   G   U   C   G   G          
SEQRES 194 A 2903    C   U   C   A   U   C   A   C   A   U   C   C   U          
SEQRES 195 A 2903    G   G   G   G   C   U   G   A   A   G   U   A   G          
SEQRES 196 A 2903    G   U   C   C   C   A   A   G   G   G   U   A   U          
SEQRES 197 A 2903    G   G   C   U   G   U   U   C   G   C   C   A   U          
SEQRES 198 A 2903    U   U   A   A   A   G   U   G   G   U   A   C   G          
SEQRES 199 A 2903    C   G   A   G   C   U   G   G   G   U   U   U   A          
SEQRES 200 A 2903    G   A   A   C   G   U   C   G   U   G   A   G   A          
SEQRES 201 A 2903    C   A   G   U   U   C   G   G   U   C   C   C   U          
SEQRES 202 A 2903    A   U   C   U   G   C   C   G   U   G   G   G   C          
SEQRES 203 A 2903    G   C   U   G   G   A   G   A   A   C   U   G   A          
SEQRES 204 A 2903    G   G   G   G   G   G   C   U   G   C   U   C   C          
SEQRES 205 A 2903    U   A   G   U   A   C   G   A   G   A   G   G   A          
SEQRES 206 A 2903    C   C   G   G   A   G   U   G   G   A   C   G   C          
SEQRES 207 A 2903    A   U   C   A   C   U   G   G   U   G   U   U   C          
SEQRES 208 A 2903    G   G   G   U   U   G   U   C   A   U   G   C   C          
SEQRES 209 A 2903    A   A   U   G   G   C   A   C   U   G   C   C   C          
SEQRES 210 A 2903    G   G   U   A   G   C   U   A   A   A   U   G   C          
SEQRES 211 A 2903    G   G   A   A   G   A   G   A   U   A   A   G   U          
SEQRES 212 A 2903    G   C   U   G   A   A   A   G   C   A   U   C   U          
SEQRES 213 A 2903    A   A   G   C   A   C   G   A   A   A   C   U   U          
SEQRES 214 A 2903    G   C   C   C   C   G   A   G   A   U   G   A   G          
SEQRES 215 A 2903    U   U   C   U   C   C   C   U   G   A   C   C   C          
SEQRES 216 A 2903    U   U   U   A   A   G   G   G   U   C   C   U   G          
SEQRES 217 A 2903    A   A   G   G   A   A   C   G   U   U   G   A   A          
SEQRES 218 A 2903    G   A   C   G   A   C   G   A   C   G   U   U   G          
SEQRES 219 A 2903    A   U   A   G   G   C   C   G   G   G   U   G   U          
SEQRES 220 A 2903    G   U   A   A   G   C   G   C   A   G   C   G   A          
SEQRES 221 A 2903    U   G   C   G   U   U   G   A   G   C   U   A   A          
SEQRES 222 A 2903    C   C   G   G   U   A   C   U   A   A   U   G   A          
SEQRES 223 A 2903    A   C   C   G   U   G   A   G   G   C   U   U   A          
SEQRES 224 A 2903    A   C   C   U                                              
SEQRES   1 B  120    U   G   C   C   U   G   G   C   G   G   C   C   G          
SEQRES   2 B  120    U   A   G   C   G   C   G   G   U   G   G   U   C          
SEQRES   3 B  120    C   C   A   C   C   U   G   A   C   C   C   C   A          
SEQRES   4 B  120    U   G   C   C   G   A   A   C   U   C   A   G   A          
SEQRES   5 B  120    A   G   U   G   A   A   A   C   G   C   C   G   U          
SEQRES   6 B  120    A   G   C   G   C   C   G   A   U   G   G   U   A          
SEQRES   7 B  120    G   U   G   U   G   G   G   G   U   C   U   C   C          
SEQRES   8 B  120    C   C   A   U   G   C   G   A   G   A   G   U   A          
SEQRES   9 B  120    G   G   G   A   A   C   U   G   C   C   A   G   G          
SEQRES  10 B  120    C   A   U                                                  
SEQRES   1 C  273  MET ALA VAL VAL LYS CYS LYS PRO THR SER PRO GLY ARG          
SEQRES   2 C  273  ARG HIS VAL VAL LYS VAL VAL ASN PRO GLU LEU HIS LYS          
SEQRES   3 C  273  GLY LYS PRO PHE ALA PRO LEU LEU GLU LYS ASN SER LYS          
SEQRES   4 C  273  SER GLY GLY ARG ASN ASN ASN GLY ARG ILE THR THR ARG          
SEQRES   5 C  273  HIS ILE GLY GLY GLY HIS LYS GLN ALA TYR ARG ILE VAL          
SEQRES   6 C  273  ASP PHE LYS ARG ASN LYS ASP GLY ILE PRO ALA VAL VAL          
SEQRES   7 C  273  GLU ARG LEU GLU TYR ASP PRO ASN ARG SER ALA ASN ILE          
SEQRES   8 C  273  ALA LEU VAL LEU TYR LYS ASP GLY GLU ARG ARG TYR ILE          
SEQRES   9 C  273  LEU ALA PRO LYS GLY LEU LYS ALA GLY ASP GLN ILE GLN          
SEQRES  10 C  273  SER GLY VAL ASP ALA ALA ILE LYS PRO GLY ASN THR LEU          
SEQRES  11 C  273  PRO MET ARG ASN ILE PRO VAL GLY SER THR VAL HIS ASN          
SEQRES  12 C  273  VAL GLU MET LYS PRO GLY LYS GLY GLY GLN LEU ALA ARG          
SEQRES  13 C  273  SER ALA GLY THR TYR VAL GLN ILE VAL ALA ARG ASP GLY          
SEQRES  14 C  273  ALA TYR VAL THR LEU ARG LEU ARG SER GLY GLU MET ARG          
SEQRES  15 C  273  LYS VAL GLU ALA ASP CYS ARG ALA THR LEU GLY GLU VAL          
SEQRES  16 C  273  GLY ASN ALA GLU HIS MET LEU ARG VAL LEU GLY LYS ALA          
SEQRES  17 C  273  GLY ALA ALA ARG TRP ARG GLY VAL ARG PRO THR VAL ARG          
SEQRES  18 C  273  GLY THR ALA MET ASN PRO VAL ASP HIS PRO HIS GLY GLY          
SEQRES  19 C  273  GLY GLU GLY ARG ASN PHE GLY LYS HIS PRO VAL THR PRO          
SEQRES  20 C  273  TRP GLY VAL GLN THR LYS GLY LYS LYS THR ARG SER ASN          
SEQRES  21 C  273  LYS ARG THR ASP LYS PHE ILE VAL ARG ARG ARG SER LYS          
SEQRES   1 D  209  MET ILE GLY LEU VAL GLY LYS LYS VAL GLY MET THR ARG          
SEQRES   2 D  209  ILE PHE THR GLU ASP GLY VAL SER ILE PRO VAL THR VAL          
SEQRES   3 D  209  ILE GLU VAL GLU ALA ASN ARG VAL THR GLN VAL LYS ASP          
SEQRES   4 D  209  LEU ALA ASN ASP GLY TYR ARG ALA ILE GLN VAL THR THR          
SEQRES   5 D  209  GLY ALA LYS LYS ALA ASN ARG VAL THR LYS PRO GLU ALA          
SEQRES   6 D  209  GLY HIS PHE ALA LYS ALA GLY VAL GLU ALA GLY ARG GLY          
SEQRES   7 D  209  LEU TRP GLU PHE ARG LEU ALA GLU GLY GLU GLU PHE THR          
SEQRES   8 D  209  VAL GLY GLN SER ILE SER VAL GLU LEU PHE ALA ASP VAL          
SEQRES   9 D  209  LYS LYS VAL ASP VAL THR GLY THR SER LYS GLY LYS GLY          
SEQRES  10 D  209  PHE ALA GLY THR VAL LYS ARG TRP ASN PHE ARG THR GLN          
SEQRES  11 D  209  ASP ALA THR HIS GLY ASN SER LEU SER HIS ARG VAL PRO          
SEQRES  12 D  209  GLY SER ILE GLY GLN ASN GLN THR PRO GLY LYS VAL PHE          
SEQRES  13 D  209  LYS GLY LYS LYS MET ALA GLY GLN MET GLY ASN GLU ARG          
SEQRES  14 D  209  VAL THR VAL GLN SER LEU ASP VAL VAL ARG VAL ASP ALA          
SEQRES  15 D  209  GLU ARG ASN LEU LEU LEU VAL LYS GLY ALA VAL PRO GLY          
SEQRES  16 D  209  ALA THR GLY SER ASP LEU ILE VAL LYS PRO ALA VAL LYS          
SEQRES  17 D  209  ALA                                                          
SEQRES   1 E  201  MET GLU LEU VAL LEU LYS ASP ALA GLN SER ALA LEU THR          
SEQRES   2 E  201  VAL SER GLU THR THR PHE GLY ARG ASP PHE ASN GLU ALA          
SEQRES   3 E  201  LEU VAL HIS GLN VAL VAL VAL ALA TYR ALA ALA GLY ALA          
SEQRES   4 E  201  ARG GLN GLY THR ARG ALA GLN LYS THR ARG ALA GLU VAL          
SEQRES   5 E  201  THR GLY SER GLY LYS LYS PRO TRP ARG GLN LYS GLY THR          
SEQRES   6 E  201  GLY ARG ALA ARG SER GLY SER ILE LYS SER PRO ILE TRP          
SEQRES   7 E  201  ARG SER GLY GLY VAL THR PHE ALA ALA ARG PRO GLN ASP          
SEQRES   8 E  201  HIS SER GLN LYS VAL ASN LYS LYS MET TYR ARG GLY ALA          
SEQRES   9 E  201  LEU LYS SER ILE LEU SER GLU LEU VAL ARG GLN ASP ARG          
SEQRES  10 E  201  LEU ILE VAL VAL GLU LYS PHE SER VAL GLU ALA PRO LYS          
SEQRES  11 E  201  THR LYS LEU LEU ALA GLN LYS LEU LYS ASP MET ALA LEU          
SEQRES  12 E  201  GLU ASP VAL LEU ILE ILE THR GLY GLU LEU ASP GLU ASN          
SEQRES  13 E  201  LEU PHE LEU ALA ALA ARG ASN LEU HIS LYS VAL ASP VAL          
SEQRES  14 E  201  ARG ASP ALA THR GLY ILE ASP PRO VAL SER LEU ILE ALA          
SEQRES  15 E  201  PHE ASP LYS VAL VAL MET THR ALA ASP ALA VAL LYS GLN          
SEQRES  16 E  201  VAL GLU GLU MET LEU ALA                                      
SEQRES   1 F  179  MET ALA LYS LEU HIS ASP TYR TYR LYS ASP GLU VAL VAL          
SEQRES   2 F  179  LYS LYS LEU MET THR GLU PHE ASN TYR ASN SER VAL MET          
SEQRES   3 F  179  GLN VAL PRO ARG VAL GLU LYS ILE THR LEU ASN MET GLY          
SEQRES   4 F  179  VAL GLY GLU ALA ILE ALA ASP LYS LYS LEU LEU ASP ASN          
SEQRES   5 F  179  ALA ALA ALA ASP LEU ALA ALA ILE SER GLY GLN LYS PRO          
SEQRES   6 F  179  LEU ILE THR LYS ALA ARG LYS SER VAL ALA GLY PHE LYS          
SEQRES   7 F  179  ILE ARG GLN GLY TYR PRO ILE GLY CYS LYS VAL THR LEU          
SEQRES   8 F  179  ARG GLY GLU ARG MET TRP GLU PHE PHE GLU ARG LEU ILE          
SEQRES   9 F  179  THR ILE ALA VAL PRO ARG ILE ARG ASP PHE ARG GLY LEU          
SEQRES  10 F  179  SER ALA LYS SER PHE ASP GLY ARG GLY ASN TYR SER MET          
SEQRES  11 F  179  GLY VAL ARG GLU GLN ILE ILE PHE PRO GLU ILE ASP TYR          
SEQRES  12 F  179  ASP LYS VAL ASP ARG VAL ARG GLY LEU ASP ILE THR ILE          
SEQRES  13 F  179  THR THR THR ALA LYS SER ASP GLU GLU GLY ARG ALA LEU          
SEQRES  14 F  179  LEU ALA ALA PHE ASP PHE PRO PHE ARG LYS                      
SEQRES   1 G  177  MET SER ARG VAL ALA LYS ALA PRO VAL VAL VAL PRO ALA          
SEQRES   2 G  177  GLY VAL ASP VAL LYS ILE ASN GLY GLN VAL ILE THR ILE          
SEQRES   3 G  177  LYS GLY LYS ASN GLY GLU LEU THR ARG THR LEU ASN ASP          
SEQRES   4 G  177  ALA VAL GLU VAL LYS HIS ALA ASP ASN THR LEU THR PHE          
SEQRES   5 G  177  GLY PRO ARG ASP GLY TYR ALA ASP GLY TRP ALA GLN ALA          
SEQRES   6 G  177  GLY THR ALA ARG ALA LEU LEU ASN SER MET VAL ILE GLY          
SEQRES   7 G  177  VAL THR GLU GLY PHE THR LYS LYS LEU GLN LEU VAL GLY          
SEQRES   8 G  177  VAL GLY TYR ARG ALA ALA VAL LYS GLY ASN VAL ILE ASN          
SEQRES   9 G  177  LEU SER LEU GLY PHE SER HIS PRO VAL ASP HIS GLN LEU          
SEQRES  10 G  177  PRO ALA GLY ILE THR ALA GLU CYS PRO THR GLN THR GLU          
SEQRES  11 G  177  ILE VAL LEU LYS GLY ALA ASP LYS GLN VAL ILE GLY GLN          
SEQRES  12 G  177  VAL ALA ALA ASP LEU ARG ALA TYR ARG ARG PRO GLU PRO          
SEQRES  13 G  177  TYR LYS GLY LYS GLY VAL ARG TYR ALA ASP GLU VAL VAL          
SEQRES  14 G  177  ARG THR LYS GLU ALA LYS LYS LYS                              
SEQRES   1 H  149  MET GLN VAL ILE LEU LEU ASP LYS VAL ALA ASN LEU GLY          
SEQRES   2 H  149  SER LEU GLY ASP GLN VAL ASN VAL LYS ALA GLY TYR ALA          
SEQRES   3 H  149  ARG ASN PHE LEU VAL PRO GLN GLY LYS ALA VAL PRO ALA          
SEQRES   4 H  149  THR LYS LYS ASN ILE GLU PHE PHE GLU ALA ARG ARG ALA          
SEQRES   5 H  149  GLU LEU GLU ALA LYS LEU ALA GLU VAL LEU ALA ALA ALA          
SEQRES   6 H  149  ASN ALA ARG ALA GLU LYS ILE ASN ALA LEU GLU THR VAL          
SEQRES   7 H  149  THR ILE ALA SER LYS ALA GLY ASP GLU GLY LYS LEU PHE          
SEQRES   8 H  149  GLY SER ILE GLY THR ARG ASP ILE ALA ASP ALA VAL THR          
SEQRES   9 H  149  ALA ALA GLY VAL GLU VAL ALA LYS SER GLU VAL ARG LEU          
SEQRES  10 H  149  PRO ASN GLY VAL LEU ARG THR THR GLY GLU HIS GLU VAL          
SEQRES  11 H  149  SER PHE GLN VAL HIS SER GLU VAL PHE ALA LYS VAL ILE          
SEQRES  12 H  149  VAL ASN VAL VAL ALA GLU                                      
SEQRES   1 I  165  MET ALA LEU ASN LEU GLN ASP LYS GLN ALA ILE VAL ALA          
SEQRES   2 I  165  GLU VAL SER GLU VAL ALA LYS GLY ALA LEU SER ALA VAL          
SEQRES   3 I  165  VAL ALA ASP SER ARG GLY VAL THR VAL ASP LYS MET THR          
SEQRES   4 I  165  GLU LEU ARG LYS ALA GLY ARG GLU ALA GLY VAL TYR MET          
SEQRES   5 I  165  ARG VAL VAL ARG ASN THR LEU LEU ARG ARG ALA VAL GLU          
SEQRES   6 I  165  GLY THR PRO PHE GLU CYS LEU LYS ASP ALA PHE VAL GLY          
SEQRES   7 I  165  PRO THR LEU ILE ALA TYR VAL THR GLU HIS PRO GLY ALA          
SEQRES   8 I  165  ALA ALA ARG LEU PHE LYS GLU PHE ALA LYS ALA ASN ALA          
SEQRES   9 I  165  LYS PHE GLU VAL LYS ALA ALA ALA PHE GLU GLY GLU LEU          
SEQRES  10 I  165  ILE PRO ALA SER GLN ILE ASP ARG LEU ALA THR LEU PRO          
SEQRES  11 I  165  THR TYR GLU GLU ALA ILE ALA ARG LEU MET ALA THR MET          
SEQRES  12 I  165  LYS GLU ALA SER ALA GLY LYS LEU VAL ARG THR LEU ALA          
SEQRES  13 I  165  ALA VAL ARG ASP ALA LYS GLU ALA ALA                          
SEQRES   1 J  142  MET ALA LYS LYS VAL GLN ALA TYR VAL LYS LEU GLN VAL          
SEQRES   2 J  142  ALA ALA GLY MET ALA ASN PRO SER PRO PRO VAL GLY PRO          
SEQRES   3 J  142  ALA LEU GLY GLN GLN GLY VAL ASN ILE MET GLU PHE CYS          
SEQRES   4 J  142  LYS ALA PHE ASN ALA LYS THR ASP SER ILE GLU LYS GLY          
SEQRES   5 J  142  LEU PRO ILE PRO VAL VAL ILE THR VAL TYR ALA ASP ARG          
SEQRES   6 J  142  SER PHE THR PHE VAL THR LYS THR PRO PRO ALA ALA VAL          
SEQRES   7 J  142  LEU LEU LYS LYS ALA ALA GLY ILE LYS SER GLY SER GLY          
SEQRES   8 J  142  LYS PRO ASN LYS ASP LYS VAL GLY LYS ILE SER ARG ALA          
SEQRES   9 J  142  GLN LEU GLN GLU ILE ALA GLN THR LYS ALA ALA ASP MET          
SEQRES  10 J  142  THR GLY ALA ASP ILE GLU ALA MET THR ARG SER ILE GLU          
SEQRES  11 J  142  GLY THR ALA ARG SER MET GLY LEU VAL VAL GLU ASP              
SEQRES   1 K  142  MET LYS THR PHE THR ALA LYS PRO GLU THR VAL LYS ARG          
SEQRES   2 K  142  ASP TRP TYR VAL VAL ASP ALA THR GLY LYS THR LEU GLY          
SEQRES   3 K  142  ARG LEU ALA THR GLU LEU ALA ARG ARG LEU ARG GLY LYS          
SEQRES   4 K  142  HIS LYS ALA GLU TYR THR PRO HIS VAL ASP THR GLY ASP          
SEQRES   5 K  142  TYR ILE ILE VAL LEU ASN ALA ASP LYS VAL ALA VAL THR          
SEQRES   6 K  142  GLY ASN LYS ARG THR ASP LYS VAL TYR TYR HIS HIS THR          
SEQRES   7 K  142  GLY HIS ILE GLY GLY ILE LYS GLN ALA THR PHE GLU GLU          
SEQRES   8 K  142  MET ILE ALA ARG ARG PRO GLU ARG VAL ILE GLU ILE ALA          
SEQRES   9 K  142  VAL LYS GLY MET LEU PRO LYS GLY PRO LEU GLY ARG ALA          
SEQRES  10 K  142  MET PHE ARG LYS LEU LYS VAL TYR ALA GLY ASN GLU HIS          
SEQRES  11 K  142  ASN HIS ALA ALA GLN GLN PRO GLN VAL LEU ASP ILE              
SEQRES   1 L  123  MET ILE GLN GLU GLN THR MET LEU ASN VAL ALA ASP ASN          
SEQRES   2 L  123  SER GLY ALA ARG ARG VAL MET CYS ILE LYS VAL LEU GLY          
SEQRES   3 L  123  GLY SER HIS ARG ARG TYR ALA GLY VAL GLY ASP ILE ILE          
SEQRES   4 L  123  LYS ILE THR ILE LYS GLU ALA ILE PRO ARG GLY LYS VAL          
SEQRES   5 L  123  LYS LYS GLY ASP VAL LEU LYS ALA VAL VAL VAL ARG THR          
SEQRES   6 L  123  LYS LYS GLY VAL ARG ARG PRO ASP GLY SER VAL ILE ARG          
SEQRES   7 L  123  PHE ASP GLY ASN ALA CYS VAL LEU LEU ASN ASN ASN SER          
SEQRES   8 L  123  GLU GLN PRO ILE GLY THR ARG ILE PHE GLY PRO VAL THR          
SEQRES   9 L  123  ARG GLU LEU ARG SER GLU LYS PHE MET LYS ILE ILE SER          
SEQRES  10 L  123  LEU ALA PRO GLU VAL LEU                                      
SEQRES   1 M  144  MET ARG LEU ASN THR LEU SER PRO ALA GLU GLY SER LYS          
SEQRES   2 M  144  LYS ALA GLY LYS ARG LEU GLY ARG GLY ILE GLY SER GLY          
SEQRES   3 M  144  LEU GLY LYS THR GLY GLY ARG GLY HIS LYS GLY GLN LYS          
SEQRES   4 M  144  SER ARG SER GLY GLY GLY VAL ARG ARG GLY PHE GLU GLY          
SEQRES   5 M  144  GLY GLN MET PRO LEU TYR ARG ARG LEU PRO LYS PHE GLY          
SEQRES   6 M  144  PHE THR SER ARG LYS ALA ALA ILE THR ALA GLU ILE ARG          
SEQRES   7 M  144  LEU SER ASP LEU ALA LYS VAL GLU GLY GLY VAL VAL ASP          
SEQRES   8 M  144  LEU ASN THR LEU LYS ALA ALA ASN ILE ILE GLY ILE GLN          
SEQRES   9 M  144  ILE GLU PHE ALA LYS VAL ILE LEU ALA GLY GLU VAL THR          
SEQRES  10 M  144  THR PRO VAL THR VAL ARG GLY LEU ARG VAL THR LYS GLY          
SEQRES  11 M  144  ALA ARG ALA ALA ILE GLU ALA ALA GLY GLY LYS ILE GLU          
SEQRES  12 M  144  GLU                                                          
SEQRES   1 N  136  MET LEU GLN PRO LYS ARG THR LYS PHE ARG LYS MET HIS          
SEQRES   2 N  136  LYS GLY ARG ASN ARG GLY LEU ALA GLN GLY THR ASP VAL          
SEQRES   3 N  136  SER PHE GLY SER PHE GLY LEU LYS ALA VAL GLY ARG GLY          
SEQRES   4 N  136  ARG LEU THR ALA ARG GLN ILE GLU ALA ALA ARG ARG ALA          
SEQRES   5 N  136  MET THR ARG ALA VAL LYS ARG GLN GLY LYS ILE TRP ILE          
SEQRES   6 N  136  ARG VAL PHE PRO ASP LYS PRO ILE THR GLU LYS PRO LEU          
SEQRES   7 N  136  ALA VAL ARG MET GLY LYS GLY LYS GLY ASN VAL GLU TYR          
SEQRES   8 N  136  TRP VAL ALA LEU ILE GLN PRO GLY LYS VAL LEU TYR GLU          
SEQRES   9 N  136  MET ASP GLY VAL PRO GLU GLU LEU ALA ARG GLU ALA PHE          
SEQRES  10 N  136  LYS LEU ALA ALA ALA LYS LEU PRO ILE LYS THR THR PHE          
SEQRES  11 N  136  VAL THR LYS THR VAL MET                                      
SEQRES   1 O  127  MET ARG HIS ARG LYS SER GLY ARG GLN LEU ASN ARG ASN          
SEQRES   2 O  127  SER SER HIS ARG GLN ALA MET PHE ARG ASN MET ALA GLY          
SEQRES   3 O  127  SER LEU VAL ARG HIS GLU ILE ILE LYS THR THR LEU PRO          
SEQRES   4 O  127  LYS ALA LYS GLU LEU ARG ARG VAL VAL GLU PRO LEU ILE          
SEQRES   5 O  127  THR LEU ALA LYS THR ASP SER VAL ALA ASN ARG ARG LEU          
SEQRES   6 O  127  ALA PHE ALA ARG THR ARG ASP ASN GLU ILE VAL ALA LYS          
SEQRES   7 O  127  LEU PHE ASN GLU LEU GLY PRO ARG PHE ALA SER ARG ALA          
SEQRES   8 O  127  GLY GLY TYR THR ARG ILE LEU LYS CYS GLY PHE ARG ALA          
SEQRES   9 O  127  GLY ASP ASN ALA PRO MET ALA TYR ILE GLU LEU VAL ASP          
SEQRES  10 O  127  ARG SER GLU LYS ALA GLU ALA ALA ALA GLU                      
SEQRES   1 P  117  MET ASP LYS LYS SER ALA ARG ILE ARG ARG ALA THR ARG          
SEQRES   2 P  117  ALA ARG ARG LYS LEU GLN GLU LEU GLY ALA THR ARG LEU          
SEQRES   3 P  117  VAL VAL HIS ARG THR PRO ARG HIS ILE TYR ALA GLN VAL          
SEQRES   4 P  117  ILE ALA PRO ASN GLY SER GLU VAL LEU VAL ALA ALA SER          
SEQRES   5 P  117  THR VAL GLU LYS ALA ILE ALA GLU GLN LEU LYS TYR THR          
SEQRES   6 P  117  GLY ASN LYS ASP ALA ALA ALA ALA VAL GLY LYS ALA VAL          
SEQRES   7 P  117  ALA GLU ARG ALA LEU GLU LYS GLY ILE LYS ASP VAL SER          
SEQRES   8 P  117  PHE ASP ARG SER GLY PHE GLN TYR HIS GLY ARG VAL GLN          
SEQRES   9 P  117  ALA LEU ALA ASP ALA ALA ARG GLU ALA GLY LEU GLN PHE          
SEQRES   1 Q  115  MET SER ASN ILE ILE LYS GLN LEU GLU GLN GLU GLN MET          
SEQRES   2 Q  115  LYS GLN ASP VAL PRO SER PHE ARG PRO GLY ASP THR VAL          
SEQRES   3 Q  115  GLU VAL LYS VAL TRP VAL VAL GLU GLY SER LYS LYS ARG          
SEQRES   4 Q  115  LEU GLN ALA PHE GLU GLY VAL VAL ILE ALA ILE ARG ASN          
SEQRES   5 Q  115  ARG GLY LEU HIS SER ALA PHE THR VAL ARG LYS ILE SER          
SEQRES   6 Q  115  ASN GLY GLU GLY VAL GLU ARG VAL PHE GLN THR HIS SER          
SEQRES   7 Q  115  PRO VAL VAL ASP SER ILE SER VAL LYS ARG ARG GLY ALA          
SEQRES   8 Q  115  VAL ARG LYS ALA LYS LEU TYR TYR LEU ARG GLU ARG THR          
SEQRES   9 Q  115  GLY LYS ALA ALA ARG ILE LYS GLU ARG LEU ASN                  
SEQRES   1 R  118  MET ALA ARG VAL LYS ARG GLY VAL ILE ALA ARG ALA ARG          
SEQRES   2 R  118  HIS LYS LYS ILE LEU LYS GLN ALA LYS GLY TYR TYR GLY          
SEQRES   3 R  118  ALA ARG SER ARG VAL TYR ARG VAL ALA PHE GLN ALA VAL          
SEQRES   4 R  118  ILE LYS ALA GLY GLN TYR ALA TYR ARG ASP ARG ARG GLN          
SEQRES   5 R  118  ARG LYS ARG GLN PHE ARG GLN LEU TRP ILE ALA ARG ILE          
SEQRES   6 R  118  ASN ALA ALA ALA ARG GLN ASN GLY ILE SER TYR SER LYS          
SEQRES   7 R  118  PHE ILE ASN GLY LEU LYS LYS ALA SER VAL GLU ILE ASP          
SEQRES   8 R  118  ARG LYS ILE LEU ALA ASP ILE ALA VAL PHE ASP LYS VAL          
SEQRES   9 R  118  ALA PHE THR ALA LEU VAL GLU LYS ALA LYS ALA ALA LEU          
SEQRES  10 R  118  ALA                                                          
SEQRES   1 S  103  MET TYR ALA VAL PHE GLN SER GLY GLY LYS GLN HIS ARG          
SEQRES   2 S  103  VAL SER GLU GLY GLN THR VAL ARG LEU GLU LYS LEU ASP          
SEQRES   3 S  103  ILE ALA THR GLY GLU THR VAL GLU PHE ALA GLU VAL LEU          
SEQRES   4 S  103  MET ILE ALA ASN GLY GLU GLU VAL LYS ILE GLY VAL PRO          
SEQRES   5 S  103  PHE VAL ASP GLY GLY VAL ILE LYS ALA GLU VAL VAL ALA          
SEQRES   6 S  103  HIS GLY ARG GLY GLU LYS VAL LYS ILE VAL LYS PHE ARG          
SEQRES   7 S  103  ARG ARG LYS HIS TYR ARG LYS GLN GLN GLY HIS ARG GLN          
SEQRES   8 S  103  TRP PHE THR ASP VAL LYS ILE THR GLY ILE SER ALA              
SEQRES   1 T  110  MET GLU THR ILE ALA LYS HIS ARG HIS ALA ARG SER SER          
SEQRES   2 T  110  ALA GLN LYS VAL ARG LEU VAL ALA ASP LEU ILE ARG GLY          
SEQRES   3 T  110  LYS LYS VAL SER GLN ALA LEU ASP ILE LEU THR TYR THR          
SEQRES   4 T  110  ASN LYS LYS ALA ALA VAL LEU VAL LYS LYS VAL LEU GLU          
SEQRES   5 T  110  SER ALA ILE ALA ASN ALA GLU HIS ASN ASP GLY ALA ASP          
SEQRES   6 T  110  ILE ASP ASP LEU LYS VAL THR LYS ILE PHE VAL ASP GLU          
SEQRES   7 T  110  GLY PRO SER MET LYS ARG ILE MET PRO ARG ALA LYS GLY          
SEQRES   8 T  110  ARG ALA ASP ARG ILE LEU LYS ARG THR SER HIS ILE THR          
SEQRES   9 T  110  VAL VAL VAL SER ASP ARG                                      
SEQRES   1 U  100  MET ILE ARG GLU GLU ARG LEU LEU LYS VAL LEU ARG ALA          
SEQRES   2 U  100  PRO HIS VAL SER GLU LYS ALA SER THR ALA MET GLU LYS          
SEQRES   3 U  100  SER ASN THR ILE VAL LEU LYS VAL ALA LYS ASP ALA THR          
SEQRES   4 U  100  LYS ALA GLU ILE LYS ALA ALA VAL GLN LYS LEU PHE GLU          
SEQRES   5 U  100  VAL GLU VAL GLU VAL VAL ASN THR LEU VAL VAL LYS GLY          
SEQRES   6 U  100  LYS VAL LYS ARG HIS GLY GLN ARG ILE GLY ARG ARG SER          
SEQRES   7 U  100  ASP TRP LYS LYS ALA TYR VAL THR LEU LYS GLU GLY GLN          
SEQRES   8 U  100  ASN LEU ASP PHE VAL GLY GLY ALA GLU                          
SEQRES   1 V  104  MET ALA ALA LYS ILE ARG ARG ASP ASP GLU VAL ILE VAL          
SEQRES   2 V  104  LEU THR GLY LYS ASP LYS GLY LYS ARG GLY LYS VAL LYS          
SEQRES   3 V  104  ASN VAL LEU SER SER GLY LYS VAL ILE VAL GLU GLY ILE          
SEQRES   4 V  104  ASN LEU VAL LYS LYS HIS GLN LYS PRO VAL PRO ALA LEU          
SEQRES   5 V  104  ASN GLN PRO GLY GLY ILE VAL GLU LYS GLU ALA ALA ILE          
SEQRES   6 V  104  GLN VAL SER ASN VAL ALA ILE PHE ASN ALA ALA THR GLY          
SEQRES   7 V  104  LYS ALA ASP ARG VAL GLY PHE ARG PHE GLU ASP GLY LYS          
SEQRES   8 V  104  LYS VAL ARG PHE PHE LYS SER ASN SER GLU THR ILE LYS          
SEQRES   1 W   94  MET PHE THR ILE ASN ALA GLU VAL ARG LYS GLU GLN GLY          
SEQRES   2 W   94  LYS GLY ALA SER ARG ARG LEU ARG ALA ALA ASN LYS PHE          
SEQRES   3 W   94  PRO ALA ILE ILE TYR GLY GLY LYS GLU ALA PRO LEU ALA          
SEQRES   4 W   94  ILE GLU LEU ASP HIS ASP LYS VAL MET ASN MET GLN ALA          
SEQRES   5 W   94  LYS ALA GLU PHE TYR SER GLU VAL LEU THR ILE VAL VAL          
SEQRES   6 W   94  ASP GLY LYS GLU ILE LYS VAL LYS ALA GLN ASP VAL GLN          
SEQRES   7 W   94  ARG HIS PRO TYR LYS PRO LYS LEU GLN HIS ILE ASP PHE          
SEQRES   8 W   94  VAL ARG ALA                                                  
SEQRES   1 X   85  MET ALA HIS LYS LYS ALA GLY GLY SER THR ARG ASN GLY          
SEQRES   2 X   85  ARG ASP SER GLU ALA LYS ARG LEU GLY VAL LYS ARG PHE          
SEQRES   3 X   85  GLY GLY GLU SER VAL LEU ALA GLY SER ILE ILE VAL ARG          
SEQRES   4 X   85  GLN ARG GLY THR LYS PHE HIS ALA GLY ALA ASN VAL GLY          
SEQRES   5 X   85  CYS GLY ARG ASP HIS THR LEU PHE ALA LYS ALA ASP GLY          
SEQRES   6 X   85  LYS VAL LYS PHE GLU VAL LYS GLY PRO LYS ASN ARG LYS          
SEQRES   7 X   85  PHE ILE SER ILE GLU ALA GLU                                  
SEQRES   1 Y   78  MET SER ARG VAL CYS GLN VAL THR GLY LYS ARG PRO VAL          
SEQRES   2 Y   78  THR GLY ASN ASN ARG SER HIS ALA LEU ASN ALA THR LYS          
SEQRES   3 Y   78  ARG ARG PHE LEU PRO ASN LEU HIS SER HIS ARG PHE TRP          
SEQRES   4 Y   78  VAL GLU SER GLU LYS ARG PHE VAL THR LEU ARG VAL SER          
SEQRES   5 Y   78  ALA LYS GLY MET ARG VAL ILE ASP LYS LYS GLY ILE ASP          
SEQRES   6 Y   78  THR VAL LEU ALA GLU LEU ARG ALA ARG GLY GLU LYS TYR          
SEQRES   1 Z   63  MET LYS ALA LYS GLU LEU ARG GLU LYS SER VAL GLU GLU          
SEQRES   2 Z   63  LEU ASN THR GLU LEU LEU ASN LEU LEU ARG GLU GLN PHE          
SEQRES   3 Z   63  ASN LEU ARG MET GLN ALA ALA SER GLY GLN LEU GLN GLN          
SEQRES   4 Z   63  SER HIS LEU LEU LYS GLN VAL ARG ARG ASP VAL ALA ARG          
SEQRES   5 Z   63  VAL LYS THR LEU LEU ASN GLU LYS ALA GLY ALA                  
SEQRES   1 a   59  MET ALA LYS THR ILE LYS ILE THR GLN THR ARG SER ALA          
SEQRES   2 a   59  ILE GLY ARG LEU PRO LYS HIS LYS ALA THR LEU LEU GLY          
SEQRES   3 a   59  LEU GLY LEU ARG ARG ILE GLY HIS THR VAL GLU ARG GLU          
SEQRES   4 a   59  ASP THR PRO ALA ILE ARG GLY MET ILE ASN ALA VAL SER          
SEQRES   5 a   59  PHE MET VAL LYS VAL GLU GLU                                  
SEQRES   1 b   57  MET ALA VAL GLN GLN ASN LYS PRO THR ARG SER LYS ARG          
SEQRES   2 b   57  GLY MET ARG ARG SER HIS ASP ALA LEU THR ALA VAL THR          
SEQRES   3 b   57  SER LEU SER VAL ASP LYS THR SER GLY GLU LYS HIS LEU          
SEQRES   4 b   57  ARG HIS HIS ILE THR ALA ASP GLY TYR TYR ARG GLY ARG          
SEQRES   5 b   57  LYS VAL ILE ALA LYS                                          
SEQRES   1 c   55  MET ALA LYS GLY ILE ARG GLU LYS ILE LYS LEU VAL SER          
SEQRES   2 c   55  SER ALA GLY THR GLY HIS PHE TYR THR THR THR LYS ASN          
SEQRES   3 c   55  LYS ARG THR LYS PRO GLU LYS LEU GLU LEU LYS LYS PHE          
SEQRES   4 c   55  ASP PRO VAL VAL ARG GLN HIS VAL ILE TYR LYS GLU ALA          
SEQRES   5 c   55  LYS ILE LYS                                                  
SEQRES   1 d   46  MET LYS ARG THR PHE GLN PRO SER VAL LEU LYS ARG ASN          
SEQRES   2 d   46  ARG SER HIS GLY PHE ARG ALA ARG MET ALA THR LYS ASN          
SEQRES   3 d   46  GLY ARG GLN VAL LEU ALA ARG ARG ARG ALA LYS GLY ARG          
SEQRES   4 d   46  ALA ARG LEU THR VAL SER LYS                                  
SEQRES   1 e   65  MET PRO LYS ILE LYS THR VAL ARG GLY ALA ALA LYS ARG          
SEQRES   2 e   65  PHE LYS LYS THR GLY LYS GLY GLY PHE LYS HIS LYS HIS          
SEQRES   3 e   65  ALA ASN LEU ARG HIS ILE LEU THR LYS LYS ALA THR LYS          
SEQRES   4 e   65  ARG LYS ARG HIS LEU ARG PRO LYS ALA MET VAL SER LYS          
SEQRES   5 e   65  GLY ASP LEU GLY LEU VAL ILE ALA CYS LEU PRO TYR ALA          
SEQRES   1 f   38  MET LYS VAL ARG ALA SER VAL LYS LYS LEU CYS ARG ASN          
SEQRES   2 f   38  CYS LYS ILE VAL LYS ARG ASP GLY VAL ILE ARG VAL ILE          
SEQRES   3 f   38  CYS SER ALA GLU PRO LYS HIS LYS GLN ARG GLN GLY              
SEQRES   1 i  450  ASN LEU THR ASP ARG LEU SER ARG THR LEU ARG ASN ILE          
SEQRES   2 i  450  SER GLY ARG GLY ARG LEU THR GLU ASP ASN VAL LYS ASP          
SEQRES   3 i  450  THR LEU ARG GLU VAL ARG MET ALA LEU LEU GLU ALA ASP          
SEQRES   4 i  450  VAL ALA LEU PRO VAL VAL ARG GLU PHE ILE ASN ARG VAL          
SEQRES   5 i  450  LYS GLU LYS ALA VAL GLY HIS GLU VAL ASN LYS SER LEU          
SEQRES   6 i  450  THR PRO GLY GLN GLU PHE VAL LYS ILE VAL ARG ASN GLU          
SEQRES   7 i  450  LEU VAL ALA ALA MET GLY GLU GLU ASN GLN THR LEU ASN          
SEQRES   8 i  450  LEU ALA ALA GLN PRO PRO ALA VAL VAL LEU MET ALA GLY          
SEQRES   9 i  450  LEU GLN GLY ALA GLY LYS THR THR SER VAL GLY LYS LEU          
SEQRES  10 i  450  GLY LYS PHE LEU ARG GLU LYS HIS LYS LYS LYS VAL LEU          
SEQRES  11 i  450  VAL VAL SER ALA ASP VAL TYR ARG PRO ALA ALA ILE LYS          
SEQRES  12 i  450  GLN LEU GLU THR LEU ALA GLU GLN VAL GLY VAL ASP PHE          
SEQRES  13 i  450  PHE PRO SER ASP VAL GLY GLN LYS PRO VAL ASP ILE VAL          
SEQRES  14 i  450  ASN ALA ALA LEU LYS GLU ALA LYS LEU LYS PHE TYR ASP          
SEQRES  15 i  450  VAL LEU LEU VAL ASP THR ALA GLY ARG LEU HIS VAL ASP          
SEQRES  16 i  450  GLU ALA MET MET ASP GLU ILE LYS GLN VAL HIS ALA SER          
SEQRES  17 i  450  ILE ASN PRO VAL GLU THR LEU PHE VAL VAL ASP ALA MET          
SEQRES  18 i  450  THR GLY GLN ASP ALA ALA ASN THR ALA LYS ALA PHE ASN          
SEQRES  19 i  450  GLU ALA LEU PRO LEU THR GLY VAL VAL LEU THR LYS VAL          
SEQRES  20 i  450  ASP GLY ASP ALA ARG GLY GLY ALA ALA LEU SER ILE ARG          
SEQRES  21 i  450  HIS ILE THR GLY LYS PRO ILE LYS PHE LEU GLY VAL GLY          
SEQRES  22 i  450  GLU LYS THR GLU ALA LEU GLU PRO PHE HIS PRO ASP ARG          
SEQRES  23 i  450  ILE ALA SER ARG ILE LEU GLY MET UNK UNK UNK UNK UNK          
SEQRES  24 i  450  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  25 i  450  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK GLY          
SEQRES  26 i  450  PHE ASP LEU ASN ASP PHE LEU GLU GLN LEU ARG GLN MET          
SEQRES  27 i  450  LYS ASN MET GLY GLY UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  28 i  450  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  29 i  450  UNK ASP ASP LYS VAL LEU VAL ARG MET GLU ALA ILE ILE          
SEQRES  30 i  450  ASN SER MET THR MET LYS GLU ARG ALA LYS PRO GLU ILE          
SEQRES  31 i  450  ILE LYS GLY SER ARG LYS ARG ARG ILE ALA ALA GLY CYS          
SEQRES  32 i  450  GLY MET GLN VAL GLN ASP VAL ASN ARG LEU LEU LYS GLN          
SEQRES  33 i  450  PHE ASP ASP MET GLN ARG MET MET LYS LYS MET LYS LYS          
SEQRES  34 i  450  GLY GLY UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  35 i  450  UNK UNK UNK UNK UNK UNK UNK UNK                              
SEQRES   1 k   18  MET LYS GLN SER THR LEU ALA LEU LEU LEU LEU LEU LEU          
SEQRES   2 k   18  LEU LEU THR PRO VAL                                          
HET     MG  2 101       1                                                       
HET     MG  A3001       1                                                       
HET     MG  A3002       1                                                       
HET     MG  A3003       1                                                       
HET     MG  A3004       1                                                       
HET     MG  A3005       1                                                       
HET     MG  A3006       1                                                       
HET     MG  A3007       1                                                       
HET     MG  A3008       1                                                       
HET     MG  A3009       1                                                       
HET     MG  A3010       1                                                       
HET     MG  A3011       1                                                       
HET     MG  A3012       1                                                       
HET     MG  A3013       1                                                       
HET     MG  A3014       1                                                       
HET     MG  A3015       1                                                       
HET     MG  A3016       1                                                       
HET     MG  A3017       1                                                       
HET     MG  A3018       1                                                       
HET     MG  A3019       1                                                       
HET     MG  A3020       1                                                       
HET     MG  A3021       1                                                       
HET     MG  A3022       1                                                       
HET     MG  A3023       1                                                       
HET     MG  A3024       1                                                       
HET     MG  A3025       1                                                       
HET     MG  A3026       1                                                       
HET     MG  A3027       1                                                       
HET     MG  A3028       1                                                       
HET     MG  A3029       1                                                       
HET     MG  A3030       1                                                       
HET     MG  A3031       1                                                       
HET     MG  A3032       1                                                       
HET     MG  A3033       1                                                       
HET     MG  A3034       1                                                       
HET     MG  A3035       1                                                       
HET     MG  A3036       1                                                       
HET     MG  A3037       1                                                       
HET     MG  A3038       1                                                       
HET     MG  A3039       1                                                       
HET     MG  A3040       1                                                       
HET     MG  A3041       1                                                       
HET     MG  A3042       1                                                       
HET     MG  A3043       1                                                       
HET     MG  A3044       1                                                       
HET     MG  A3045       1                                                       
HET     MG  A3046       1                                                       
HET     MG  A3047       1                                                       
HET     MG  A3048       1                                                       
HET     MG  A3049       1                                                       
HET     MG  A3050       1                                                       
HET     MG  A3051       1                                                       
HET     MG  A3052       1                                                       
HET     MG  A3053       1                                                       
HET     MG  A3054       1                                                       
HET     MG  A3055       1                                                       
HET     MG  A3056       1                                                       
HET     MG  A3057       1                                                       
HET     MG  A3058       1                                                       
HET     MG  A3059       1                                                       
HET     MG  A3060       1                                                       
HET     MG  A3061       1                                                       
HET     MG  A3062       1                                                       
HET     MG  A3063       1                                                       
HET     MG  A3064       1                                                       
HET     MG  A3065       1                                                       
HET     MG  A3066       1                                                       
HET     MG  A3067       1                                                       
HET     MG  A3068       1                                                       
HET     MG  A3069       1                                                       
HET     MG  A3070       1                                                       
HET     MG  A3071       1                                                       
HET     MG  A3072       1                                                       
HET     MG  A3073       1                                                       
HET     MG  A3074       1                                                       
HET     MG  A3075       1                                                       
HET     MG  A3076       1                                                       
HET     MG  A3077       1                                                       
HET     MG  A3078       1                                                       
HET     MG  A3079       1                                                       
HET     MG  A3080       1                                                       
HET     MG  A3081       1                                                       
HET     MG  A3082       1                                                       
HET     MG  A3083       1                                                       
HET     MG  A3084       1                                                       
HET     MG  A3085       1                                                       
HET     MG  A3086       1                                                       
HET     MG  A3087       1                                                       
HET     MG  A3088       1                                                       
HET     MG  A3089       1                                                       
HET     MG  A3090       1                                                       
HET     MG  A3091       1                                                       
HET     MG  A3092       1                                                       
HET     MG  A3093       1                                                       
HET     MG  A3094       1                                                       
HET     MG  A3095       1                                                       
HET     MG  A3096       1                                                       
HET     MG  A3097       1                                                       
HET     MG  A3098       1                                                       
HET     MG  A3099       1                                                       
HET     MG  A3100       1                                                       
HET     MG  A3101       1                                                       
HET     MG  A3102       1                                                       
HET     MG  A3103       1                                                       
HET     MG  A3104       1                                                       
HET     MG  A3105       1                                                       
HET     MG  A3106       1                                                       
HET     MG  A3107       1                                                       
HET     MG  A3108       1                                                       
HET     MG  A3109       1                                                       
HET     MG  A3110       1                                                       
HET     MG  A3111       1                                                       
HET     MG  A3112       1                                                       
HET     MG  A3113       1                                                       
HET     MG  A3114       1                                                       
HET     MG  A3115       1                                                       
HET     MG  A3116       1                                                       
HET     MG  A3117       1                                                       
HET     MG  A3118       1                                                       
HET     MG  A3119       1                                                       
HET     MG  A3120       1                                                       
HET     MG  A3121       1                                                       
HET     MG  A3122       1                                                       
HET     MG  A3123       1                                                       
HET     MG  A3124       1                                                       
HET     MG  A3125       1                                                       
HET     MG  A3126       1                                                       
HET     MG  A3127       1                                                       
HET     MG  A3128       1                                                       
HET     MG  A3129       1                                                       
HET     MG  A3130       1                                                       
HET     MG  A3131       1                                                       
HET     MG  A3132       1                                                       
HET     MG  A3133       1                                                       
HET     MG  A3134       1                                                       
HET     MG  A3135       1                                                       
HET     MG  A3136       1                                                       
HET     MG  A3137       1                                                       
HET     MG  A3138       1                                                       
HET     MG  A3139       1                                                       
HET     MG  A3140       1                                                       
HET     MG  A3141       1                                                       
HET     MG  A3142       1                                                       
HET     MG  A3143       1                                                       
HET     MG  A3144       1                                                       
HET     MG  A3145       1                                                       
HET     MG  A3146       1                                                       
HET     MG  A3147       1                                                       
HET     MG  A3148       1                                                       
HET     MG  A3149       1                                                       
HET     MG  A3150       1                                                       
HET     MG  A3151       1                                                       
HET     MG  A3152       1                                                       
HET     MG  A3153       1                                                       
HET     MG  A3154       1                                                       
HET     MG  A3155       1                                                       
HET     MG  A3156       1                                                       
HET     MG  A3157       1                                                       
HET     MG  A3158       1                                                       
HET     MG  A3159       1                                                       
HET     MG  A3160       1                                                       
HET     MG  A3161       1                                                       
HET     MG  A3162       1                                                       
HET     MG  A3163       1                                                       
HET     MG  A3164       1                                                       
HET     MG  A3165       1                                                       
HET     MG  A3166       1                                                       
HET     MG  A3167       1                                                       
HET     MG  A3168       1                                                       
HET     MG  A3169       1                                                       
HET     MG  A3170       1                                                       
HET     MG  A3171       1                                                       
HET     MG  A3172       1                                                       
HET     MG  A3173       1                                                       
HET     MG  A3174       1                                                       
HET     MG  A3175       1                                                       
HET     MG  A3176       1                                                       
HET     MG  A3177       1                                                       
HET     MG  A3178       1                                                       
HET     MG  A3179       1                                                       
HET     MG  A3180       1                                                       
HET     MG  A3181       1                                                       
HET     MG  A3182       1                                                       
HET     MG  A3183       1                                                       
HET     MG  A3184       1                                                       
HET     MG  A3185       1                                                       
HET     MG  A3186       1                                                       
HET     MG  A3187       1                                                       
HET     MG  A3188       1                                                       
HET     MG  A3189       1                                                       
HET     MG  A3190       1                                                       
HET     MG  A3191       1                                                       
HET     MG  A3192       1                                                       
HET     MG  A3193       1                                                       
HET     MG  A3194       1                                                       
HET     MG  A3195       1                                                       
HET     MG  A3196       1                                                       
HET     MG  A3197       1                                                       
HET     MG  A3198       1                                                       
HET     MG  A3199       1                                                       
HET     MG  A3200       1                                                       
HET     MG  A3201       1                                                       
HET     MG  A3202       1                                                       
HET     MG  A3203       1                                                       
HET     MG  A3204       1                                                       
HET     MG  A3205       1                                                       
HET     MG  A3206       1                                                       
HET     MG  A3207       1                                                       
HET     MG  A3208       1                                                       
HET     MG  A3209       1                                                       
HET     MG  A3210       1                                                       
HET     MG  A3211       1                                                       
HET     MG  A3212       1                                                       
HET     MG  A3213       1                                                       
HET     MG  A3214       1                                                       
HET     MG  A3215       1                                                       
HET     MG  A3216       1                                                       
HET     MG  A3217       1                                                       
HET     MG  A3218       1                                                       
HET     MG  A3219       1                                                       
HET     MG  A3220       1                                                       
HET     MG  A3221       1                                                       
HET     MG  A3222       1                                                       
HET     MG  A3223       1                                                       
HET     MG  A3224       1                                                       
HET     MG  A3225       1                                                       
HET     MG  A3226       1                                                       
HET     MG  A3227       1                                                       
HET     MG  A3228       1                                                       
HET     MG  A3229       1                                                       
HET     MG  A3230       1                                                       
HET     MG  A3231       1                                                       
HET     MG  A3232       1                                                       
HET     MG  A3233       1                                                       
HET     MG  A3234       1                                                       
HET     MG  A3235       1                                                       
HET     MG  A3236       1                                                       
HET     MG  A3237       1                                                       
HET     MG  A3238       1                                                       
HET     MG  A3239       1                                                       
HET     MG  A3240       1                                                       
HET     MG  A3241       1                                                       
HET     MG  A3242       1                                                       
HET     MG  A3243       1                                                       
HET     MG  A3244       1                                                       
HET     MG  A3245       1                                                       
HET     MG  A3246       1                                                       
HET     MG  A3247       1                                                       
HET     MG  A3248       1                                                       
HET     MG  A3249       1                                                       
HET     MG  A3250       1                                                       
HET     MG  A3251       1                                                       
HET     MG  A3252       1                                                       
HET     MG  A3253       1                                                       
HET     MG  A3254       1                                                       
HET     MG  A3255       1                                                       
HET     MG  A3256       1                                                       
HET     MG  A3257       1                                                       
HET     MG  A3258       1                                                       
HET     MG  A3259       1                                                       
HET     MG  A3260       1                                                       
HET     MG  A3261       1                                                       
HET     MG  A3262       1                                                       
HET     MG  A3263       1                                                       
HET     MG  A3264       1                                                       
HET     MG  A3265       1                                                       
HET     MG  A3266       1                                                       
HET     MG  A3267       1                                                       
HET     MG  A3268       1                                                       
HET     MG  A3269       1                                                       
HET     MG  A3270       1                                                       
HET     MG  A3271       1                                                       
HET     MG  A3272       1                                                       
HET     MG  A3273       1                                                       
HET     MG  A3274       1                                                       
HET     MG  A3275       1                                                       
HET     MG  A3276       1                                                       
HET     MG  A3277       1                                                       
HET     MG  A3278       1                                                       
HET     MG  A3279       1                                                       
HET     MG  A3280       1                                                       
HET     MG  A3281       1                                                       
HET     MG  A3282       1                                                       
HET     MG  A3283       1                                                       
HET     MG  A3284       1                                                       
HET     MG  A3285       1                                                       
HET     MG  A3286       1                                                       
HET     MG  A3287       1                                                       
HET     MG  A3288       1                                                       
HET     MG  A3289       1                                                       
HET     MG  A3290       1                                                       
HET     MG  A3291       1                                                       
HET     MG  A3292       1                                                       
HET     MG  A3293       1                                                       
HET     MG  A3294       1                                                       
HET     MG  A3295       1                                                       
HET     MG  A3296       1                                                       
HET     MG  A3297       1                                                       
HET     MG  A3298       1                                                       
HET     MG  A3299       1                                                       
HET     MG  A3300       1                                                       
HET     MG  A3301       1                                                       
HET     MG  A3302       1                                                       
HET     MG  A3303       1                                                       
HET     MG  A3304       1                                                       
HET     MG  A3305       1                                                       
HET     MG  A3306       1                                                       
HET     MG  A3307       1                                                       
HET     MG  A3308       1                                                       
HET     MG  A3309       1                                                       
HET     MG  A3310       1                                                       
HET     MG  A3311       1                                                       
HET     MG  A3312       1                                                       
HET     MG  A3313       1                                                       
HET     MG  A3314       1                                                       
HET     MG  A3315       1                                                       
HET     MG  A3316       1                                                       
HET     MG  A3317       1                                                       
HET     MG  A3318       1                                                       
HET     MG  A3319       1                                                       
HET     MG  A3320       1                                                       
HET     MG  A3321       1                                                       
HET     MG  A3322       1                                                       
HET     MG  A3323       1                                                       
HET     MG  A3324       1                                                       
HET     MG  A3325       1                                                       
HET     MG  A3326       1                                                       
HET     MG  A3327       1                                                       
HET     MG  A3328       1                                                       
HET     MG  A3329       1                                                       
HET     MG  A3330       1                                                       
HET     MG  A3331       1                                                       
HET     MG  A3332       1                                                       
HET     MG  A3333       1                                                       
HET     MG  A3334       1                                                       
HET     MG  A3335       1                                                       
HET     MG  A3336       1                                                       
HET     MG  A3337       1                                                       
HET     MG  A3338       1                                                       
HET     MG  A3339       1                                                       
HET     MG  A3340       1                                                       
HET     MG  A3341       1                                                       
HET     MG  A3342       1                                                       
HET     MG  A3343       1                                                       
HET     MG  A3344       1                                                       
HET     MG  A3345       1                                                       
HET     MG  A3346       1                                                       
HET     MG  A3347       1                                                       
HET     MG  A3348       1                                                       
HET     MG  A3349       1                                                       
HET     MG  A3350       1                                                       
HET     MG  A3351       1                                                       
HET     MG  A3352       1                                                       
HET     MG  A3353       1                                                       
HET     MG  A3354       1                                                       
HET     MG  A3355       1                                                       
HET     MG  A3356       1                                                       
HET     MG  A3357       1                                                       
HET     MG  A3358       1                                                       
HET     MG  A3359       1                                                       
HET     MG  A3360       1                                                       
HET     MG  A3361       1                                                       
HET     MG  A3362       1                                                       
HET     MG  A3363       1                                                       
HET     MG  A3364       1                                                       
HET     MG  A3365       1                                                       
HET     MG  A3366       1                                                       
HET     MG  A3367       1                                                       
HET     MG  A3368       1                                                       
HET     MG  A3369       1                                                       
HET     MG  A3370       1                                                       
HET     MG  A3371       1                                                       
HET     MG  A3372       1                                                       
HET     MG  A3373       1                                                       
HET     MG  A3374       1                                                       
HET     MG  A3375       1                                                       
HET     MG  A3376       1                                                       
HET     MG  A3377       1                                                       
HET     MG  A3378       1                                                       
HET     MG  A3379       1                                                       
HET     MG  A3380       1                                                       
HET     MG  A3381       1                                                       
HET     MG  A3382       1                                                       
HET     MG  A3383       1                                                       
HET     MG  A3384       1                                                       
HET     MG  A3385       1                                                       
HET     MG  A3386       1                                                       
HET     MG  A3387       1                                                       
HET     MG  A3388       1                                                       
HET     MG  A3389       1                                                       
HET     MG  A3390       1                                                       
HET     MG  A3391       1                                                       
HET     MG  A3392       1                                                       
HET     MG  A3393       1                                                       
HET     MG  A3394       1                                                       
HET     MG  A3395       1                                                       
HET     MG  A3396       1                                                       
HET     MG  A3397       1                                                       
HET     MG  A3398       1                                                       
HET     MG  A3399       1                                                       
HET     MG  A3400       1                                                       
HET     MG  A3401       1                                                       
HET     MG  A3402       1                                                       
HET     MG  A3403       1                                                       
HET     MG  A3404       1                                                       
HET     MG  A3405       1                                                       
HET     MG  A3406       1                                                       
HET     MG  A3407       1                                                       
HET     MG  A3408       1                                                       
HET     MG  A3409       1                                                       
HET     MG  A3410       1                                                       
HET     MG  A3411       1                                                       
HET     MG  B 201       1                                                       
HET     MG  B 202       1                                                       
HET     MG  B 203       1                                                       
HET     MG  B 204       1                                                       
HET     MG  B 205       1                                                       
HET     MG  B 206       1                                                       
HET     MG  B 207       1                                                       
HET     MG  B 208       1                                                       
HET     MG  B 209       1                                                       
HET     MG  B 210       1                                                       
HET     MG  B 211       1                                                       
HET     MG  B 212       1                                                       
HET     MG  C 301       1                                                       
HET     MG  C 302       1                                                       
HET     MG  D 301       1                                                       
HET     MG  O 201       1                                                       
HET     MG  R 201       1                                                       
HET     MG  Y 101       1                                                       
HET     MG  b 101       1                                                       
HET     ZN  f 101       1                                                       
HETNAM      MG MAGNESIUM ION                                                    
HETNAM      ZN ZINC ION                                                         
FORMUL  37   MG    431(MG 2+)                                                   
FORMUL  68   ZN    ZN 2+                                                        
HELIX    1 AA1 GLY C   12  HIS C   15  5                                   4    
HELIX    2 AA2 LYS C  207  ARG C  214  1                                   8    
HELIX    3 AA3 ARG C  221  MET C  225  5                                   5    
HELIX    4 AA4 THR C  263  LYS C  265  5                                   3    
HELIX    5 AA5 LYS D   56  VAL D   60  5                                   5    
HELIX    6 AA6 THR D   61  GLY D   72  1                                  12    
HELIX    7 AA7 SER D   97  ALA D  102  5                                   6    
HELIX    8 AA8 GLY D  120  TRP D  125  1                                   6    
HELIX    9 AA9 ASN E   24  ALA E   39  1                                  16    
HELIX   10 AB1 ASN E   97  GLN E  115  1                                  19    
HELIX   11 AB2 LYS E  130  ALA E  142  1                                  13    
HELIX   12 AB3 ASP E  154  ALA E  161  1                                   8    
HELIX   13 AB4 ARG E  162  LEU E  164  5                                   3    
HELIX   14 AB5 THR E  173  ILE E  175  5                                   3    
HELIX   15 AB6 ASP E  176  ALA E  182  1                                   7    
HELIX   16 AB7 ALA E  190  ALA E  201  1                                  12    
HELIX   17 AB8 LYS F    3  GLU F   11  1                                   9    
HELIX   18 AB9 GLU F   11  PHE F   20  1                                  10    
HELIX   19 AC1 SER F   24  VAL F   28  5                                   5    
HELIX   20 AC2 LYS F   47  GLY F   62  1                                  16    
HELIX   21 AC3 GLY F   93  ILE F  106  1                                  14    
HELIX   22 AC4 ALA F  107  ILE F  111  5                                   5    
HELIX   23 AC5 ASP F  142  VAL F  146  5                                   5    
HELIX   24 AC6 SER F  162  PHE F  173  1                                  12    
HELIX   25 AC7 ASP G   60  VAL G   79  1                                  20    
HELIX   26 AC8 ASP G  137  ALA G  150  1                                  14    
HELIX   27 AC9 LYS H   22  PHE H   29  1                                   8    
HELIX   28 AD1 THR H   40  ASN H   73  1                                  34    
HELIX   29 AD2 GLY H   85  LYS H   89  5                                   5    
HELIX   30 AD3 GLY H   95  THR H  104  1                                  10    
HELIX   31 AD4 ASN I    4  LYS I   20  1                                  17    
HELIX   32 AD5 THR I   34  GLU I   47  1                                  14    
HELIX   33 AD6 ARG I   56  GLU I   65  1                                  10    
HELIX   34 AD7 ARG I   94  ASN I  103  1                                  10    
HELIX   35 AD8 VAL J   24  GLN J   30  1                                   7    
HELIX   36 AD9 ASN J   34  THR J   46  1                                  13    
HELIX   37 AE1 ASP J   47  ILE J   49  5                                   3    
HELIX   38 AE2 PRO J   75  ALA J   84  1                                  10    
HELIX   39 AE3 SER J  102  MET J  117  1                                  16    
HELIX   40 AE4 ASP J  121  MET J  136  1                                  16    
HELIX   41 AE5 THR K   24  GLY K   38  1                                  15    
HELIX   42 AE6 ASN K   58  VAL K   62  5                                   5    
HELIX   43 AE7 ASN K   67  LYS K   72  1                                   6    
HELIX   44 AE8 PHE K   89  ARG K   96  1                                   8    
HELIX   45 AE9 PRO K   97  GLY K  107  1                                  11    
HELIX   46 AF1 GLY K  112  ARG K  120  1                                   9    
HELIX   47 AF2 HIS K  132  GLN K  136  5                                   5    
HELIX   48 AF3 THR L  104  ARG L  108  5                                   5    
HELIX   49 AF4 PHE L  112  LEU L  118  1                                   7    
HELIX   50 AF5 PRO M   56  LEU M   61  1                                   6    
HELIX   51 AF6 SER M   68  ALA M   72  5                                   5    
HELIX   52 AF7 SER M   80  LYS M   84  5                                   5    
HELIX   53 AF8 ASP M   91  ALA M   98  1                                   8    
HELIX   54 AF9 THR M  128  GLU M  136  1                                   9    
HELIX   55 AG1 ALA N   43  VAL N   57  1                                  15    
HELIX   56 AG2 PRO N  109  ALA N  122  1                                  14    
HELIX   57 AG3 ASN O   13  HIS O   31  1                                  19    
HELIX   58 AG4 LEU O   38  LYS O   56  1                                  19    
HELIX   59 AG5 SER O   59  ARG O   71  1                                  13    
HELIX   60 AG6 ASP O   72  GLU O   82  1                                  11    
HELIX   61 AG7 GLU O   82  PHE O   87  1                                   6    
HELIX   62 AG8 ASP O  117  ALA O  125  1                                   9    
HELIX   63 AG9 ASP P    2  GLY P   22  1                                  21    
HELIX   64 AH1 GLU P   55  GLU P   60  1                                   6    
HELIX   65 AH2 ASN P   67  GLU P   84  1                                  18    
HELIX   66 AH3 HIS P  100  ALA P  113  1                                  14    
HELIX   67 AH4 ASN Q    3  GLN Q   10  1                                   8    
HELIX   68 AH5 ARG Q   53  HIS Q   56  5                                   4    
HELIX   69 AH6 LEU Q   97  GLU Q  102  5                                   6    
HELIX   70 AH7 THR Q  104  ARG Q  109  5                                   6    
HELIX   71 AH8 ARG R    6  ALA R   21  1                                  16    
HELIX   72 AH9 TYR R   25  ARG R   30  5                                   6    
HELIX   73 AI1 VAL R   31  ASN R   72  1                                  42    
HELIX   74 AI2 SER R   75  ALA R   86  1                                  12    
HELIX   75 AI3 ASP R   91  ASP R  102  1                                  12    
HELIX   76 AI4 ASP R  102  LEU R  117  1                                  16    
HELIX   77 AI5 SER T   13  ASP T   22  1                                  10    
HELIX   78 AI6 LYS T   28  THR T   39  1                                  12    
HELIX   79 AI7 LYS T   41  GLY T   63  1                                  23    
HELIX   80 AI8 ASP T   65  LEU T   69  5                                   5    
HELIX   81 AI9 ALA T   89  GLY T   91  5                                   3    
HELIX   82 AJ1 ARG U    3  LEU U    8  1                                   6    
HELIX   83 AJ2 SER U   17  ASN U   28  1                                  12    
HELIX   84 AJ3 THR U   39  PHE U   51  1                                  13    
HELIX   85 AJ4 GLY W   13  ALA W   23  1                                  11    
HELIX   86 AJ5 HIS W   44  GLN W   51  1                                   8    
HELIX   87 AJ6 ALA W   54  GLU W   59  1                                   6    
HELIX   88 AJ7 ALA Y   53  GLY Y   63  1                                  11    
HELIX   89 AJ8 GLY Y   63  GLY Y   75  1                                  13    
HELIX   90 AJ9 SER Z   10  GLY Z   35  1                                  26    
HELIX   91 AK1 SER Z   40  ALA Z   63  1                                  24    
HELIX   92 AK2 LEU a   17  GLY a   28  1                                  12    
HELIX   93 AK3 THR a   41  SER a   52  1                                  12    
HELIX   94 AK4 THR b    9  ARG b   17  1                                   9    
HELIX   95 AK5 SER b   18  ALA b   21  5                                   4    
HELIX   96 AK6 SER d    8  GLY d   17  1                                  10    
HELIX   97 AK7 GLY d   17  MET d   22  1                                   6    
HELIX   98 AK8 THR d   24  LYS d   37  1                                  14    
HELIX   99 AK9 VAL e    7  PHE e   14  1                                   8    
HELIX  100 AL1 ALA e   37  ARG e   45  1                                   9    
HELIX  101 AL2 ASP e   54  LEU e   62  1                                   9    
HELIX  102 AL3 GLU f   30  HIS f   33  5                                   4    
HELIX  103 AL4 ASN i  332  GLY i  345  1                                  14    
HELIX  104 AL5 GLY i  346  UNK i  351  1                                   6    
HELIX  105 AL6 UNK i  368  SER i  382  1                                  15    
HELIX  106 AL7 THR i  384  ALA i  389  1                                   6    
HELIX  107 AL8 LYS i  395  CYS i  406  1                                  12    
HELIX  108 AL9 GLN i  409  GLY i  433  1                                  25    
HELIX  109 AM1 GLY i  434  UNK i  441  1                                   8    
HELIX  110 AM2 LYS k   28  THR k   42  1                                  15    
SHEET    1 AA1 2 VAL C   3  LYS C   5  0                                        
SHEET    2 AA1 2 VAL C  17  VAL C  19 -1  O  LYS C  18   N  VAL C   4           
SHEET    1 AA2 2 LEU C  34  GLU C  35  0                                        
SHEET    2 AA2 2 TYR C  62  ARG C  63 -1  O  TYR C  62   N  GLU C  35           
SHEET    1 AA3 4 ARG C 101  LEU C 105  0                                        
SHEET    2 AA3 4 ILE C  91  TYR C  96 -1  N  VAL C  94   O  ARG C 102           
SHEET    3 AA3 4 ALA C  76  GLU C  82 -1  N  VAL C  77   O  LEU C  95           
SHEET    4 AA3 4 GLN C 115  ILE C 116 -1  O  ILE C 116   N  ALA C  76           
SHEET    1 AA4 7 THR C 129  PRO C 131  0                                        
SHEET    2 AA4 7 ARG C 189  LEU C 192 -1  O  ALA C 190   N  LEU C 130           
SHEET    3 AA4 7 THR C 140  HIS C 142 -1  N  HIS C 142   O  THR C 191           
SHEET    4 AA4 7 VAL C 162  ASP C 168 -1  O  VAL C 162   N  VAL C 141           
SHEET    5 AA4 7 TYR C 171  ARG C 175 -1  O  TYR C 171   N  ASP C 168           
SHEET    6 AA4 7 MET C 181  GLU C 185 -1  O  VAL C 184   N  VAL C 172           
SHEET    7 AA4 7 ILE C 267  ARG C 269 -1  O  VAL C 268   N  MET C 181           
SHEET    1 AA5 2 VAL C 144  GLU C 145  0                                        
SHEET    2 AA5 2 GLY C 152  LEU C 154 -1  O  GLN C 153   N  VAL C 144           
SHEET    1 AA6 7 LEU D   4  PHE D  15  0                                        
SHEET    2 AA6 7 SER D  21  GLU D  28 -1  O  ILE D  22   N  ILE D  14           
SHEET    3 AA6 7 LEU D 186  LYS D 190 -1  O  LEU D 187   N  ILE D  27           
SHEET    4 AA6 7 ARG D 169  ASP D 181 -1  N  ASP D 181   O  LEU D 186           
SHEET    5 AA6 7 LYS D 106  THR D 112 -1  N  VAL D 109   O  VAL D 172           
SHEET    6 AA6 7 ASP D 200  PRO D 205 -1  O  LYS D 204   N  ASP D 108           
SHEET    7 AA6 7 LEU D   4  PHE D  15 -1  N  LEU D   4   O  VAL D 203           
SHEET    1 AA7 4 TRP D  80  ARG D  83  0                                        
SHEET    2 AA7 4 ALA D  47  THR D  51 -1  N  VAL D  50   O  TRP D  80           
SHEET    3 AA7 4 ASN D  32  LYS D  38 -1  N  GLN D  36   O  GLN D  49           
SHEET    4 AA7 4 SER D  95  ILE D  96 -1  O  ILE D  96   N  ASN D  32           
SHEET    1 AA8 2 PHE D 118  ALA D 119  0                                        
SHEET    2 AA8 2 GLY D 163  GLN D 164 -1  O  GLY D 163   N  ALA D 119           
SHEET    1 AA9 2 GLU E   2  VAL E   4  0                                        
SHEET    2 AA9 2 ALA E  11  THR E  13 -1  O  LEU E  12   N  LEU E   3           
SHEET    1 AB1 4 LEU E 118  VAL E 121  0                                        
SHEET    2 AB1 4 LYS E 185  THR E 189  1  O  MET E 188   N  VAL E 121           
SHEET    3 AB1 4 VAL E 146  THR E 150  1  N  ILE E 149   O  VAL E 187           
SHEET    4 AB1 4 VAL E 167  ASP E 171  1  O  ARG E 170   N  ILE E 148           
SHEET    1 AB2 5 LEU F  66  LYS F  69  0                                        
SHEET    2 AB2 5 PRO F  84  ARG F  92 -1  O  LYS F  88   N  LEU F  66           
SHEET    3 AB2 5 VAL F  31  GLY F  39 -1  N  ILE F  34   O  LEU F  91           
SHEET    4 AB2 5 LEU F 152  THR F 158 -1  O  THR F 155   N  THR F  35           
SHEET    5 AB2 5 TYR F 128  VAL F 132 -1  N  MET F 130   O  ILE F 154           
SHEET    1 AB3 3 ASP G  16  ASN G  20  0                                        
SHEET    2 AB3 3 VAL G  23  GLY G  28 -1  O  VAL G  23   N  ASN G  20           
SHEET    3 AB3 3 GLY G  31  THR G  36 -1  O  LEU G  33   N  ILE G  26           
SHEET    1 AB4 2 VAL G  41  HIS G  45  0                                        
SHEET    2 AB4 2 LEU G  50  PRO G  54 -1  O  GLY G  53   N  GLU G  42           
SHEET    1 AB5 4 THR G 122  GLU G 124  0                                        
SHEET    2 AB5 4 GLU G 130  GLY G 135 -1  O  LYS G 134   N  THR G 122           
SHEET    3 AB5 4 PHE G  83  VAL G  90 -1  N  LEU G  87   O  ILE G 131           
SHEET    4 AB5 4 GLY G 161  TYR G 164 -1  O  GLY G 161   N  VAL G  90           
SHEET    1 AB6 3 ARG G  95  LYS G  99  0                                        
SHEET    2 AB6 3 VAL G 102  SER G 106 -1  O  VAL G 102   N  LYS G  99           
SHEET    3 AB6 3 VAL G 113  GLN G 116 -1  O  HIS G 115   N  ILE G 103           
SHEET    1 AB7 3 GLN H  18  ASN H  20  0                                        
SHEET    2 AB7 3 GLN H   2  ILE H   4 -1  N  VAL H   3   O  VAL H  19           
SHEET    3 AB7 3 VAL H  37  PRO H  38 -1  O  VAL H  37   N  ILE H   4           
SHEET    1 AB8 4 THR H  77  SER H  82  0                                        
SHEET    2 AB8 4 PHE H 139  ALA H 148  1  O  ASN H 145   N  VAL H  78           
SHEET    3 AB8 4 GLU H 127  GLN H 133 -1  N  HIS H 128   O  VAL H 144           
SHEET    4 AB8 4 VAL H 115  ARG H 116 -1  N  ARG H 116   O  SER H 131           
SHEET    1 AB9 5 VAL I  50  VAL I  54  0                                        
SHEET    2 AB9 5 LEU I  81  VAL I  85 -1  O  ILE I  82   N  ARG I  53           
SHEET    3 AB9 5 SER I  24  ALA I  28 -1  N  SER I  24   O  VAL I  85           
SHEET    4 AB9 5 ALA I 110  PHE I 113 -1  O  ALA I 112   N  ALA I  25           
SHEET    5 AB9 5 GLU I 116  ILE I 118 -1  O  ILE I 118   N  ALA I 111           
SHEET    1 AC1 3 VAL J   9  ALA J  14  0                                        
SHEET    2 AC1 3 PRO J  54  VAL J  61 -1  O  ILE J  55   N  VAL J  13           
SHEET    3 AC1 3 PHE J  67  THR J  71 -1  O  VAL J  70   N  VAL J  58           
SHEET    1 AC2 2 LYS J 100  ILE J 101  0                                        
SHEET    2 AC2 2 VAL J 139  VAL J 140  1  O  VAL J 139   N  ILE J 101           
SHEET    1 AC3 4 LEU K 122  VAL K 124  0                                        
SHEET    2 AC3 4 TYR K  53  LEU K  57  1  N  ILE K  54   O  LYS K 123           
SHEET    3 AC3 4 TRP K  15  ASP K  19  1  N  VAL K  18   O  ILE K  55           
SHEET    4 AC3 4 GLN K 138  VAL K 139  1  O  GLN K 138   N  TRP K  15           
SHEET    1 AC4 2 VAL K  73  HIS K  77  0                                        
SHEET    2 AC4 2 ILE K  84  THR K  88 -1  O  ALA K  87   N  TYR K  74           
SHEET    1 AC5 6 MET L   7  VAL L  10  0                                        
SHEET    2 AC5 6 ARG L  18  VAL L  24 -1  O  VAL L  19   N  LEU L   8           
SHEET    3 AC5 6 ILE L  38  ILE L  43 -1  O  THR L  42   N  MET L  20           
SHEET    4 AC5 6 VAL L  57  ARG L  64 -1  O  LEU L  58   N  ILE L  41           
SHEET    5 AC5 6 ALA L  83  LEU L  87 -1  O  VAL L  85   N  VAL L  61           
SHEET    6 AC5 6 MET L   7  VAL L  10  1  N  ASN L   9   O  CYS L  84           
SHEET    1 AC6 7 VAL L  69  ARG L  70  0                                        
SHEET    2 AC6 7 VAL L  76  PHE L  79 -1  O  ILE L  77   N  VAL L  69           
SHEET    3 AC6 7 GLU Q  68  GLN Q  75 -1  O  VAL Q  73   N  VAL L  76           
SHEET    4 AC6 7 ALA Q  58  SER Q  65 -1  N  PHE Q  59   O  PHE Q  74           
SHEET    5 AC6 7 LYS Q  37  ARG Q  51 -1  N  VAL Q  46   O  ARG Q  62           
SHEET    6 AC6 7 THR Q  25  GLU Q  34 -1  N  VAL Q  26   O  GLY Q  45           
SHEET    7 AC6 7 VAL Q  81  ARG Q  88 -1  O  SER Q  85   N  GLU Q  27           
SHEET    1 AC7 2 PRO L 102  VAL L 103  0                                        
SHEET    2 AC7 2 GLU L 121  VAL L 122  1  O  GLU L 121   N  VAL L 103           
SHEET    1 AC8 3 THR M  74  ARG M  78  0                                        
SHEET    2 AC8 3 PHE M 107  ILE M 111  1  O  LYS M 109   N  ILE M  77           
SHEET    3 AC8 3 ARG M 126  VAL M 127  1  O  ARG M 126   N  VAL M 110           
SHEET    1 AC9 3 VAL M  89  VAL M  90  0                                        
SHEET    2 AC9 3 THR M 121  ARG M 123  1  O  THR M 121   N  VAL M  90           
SHEET    3 AC9 3 LYS M 141  GLU M 143  1  O  GLU M 143   N  VAL M 122           
SHEET    1 AD1 4 LYS N  62  ILE N  65  0                                        
SHEET    2 AD1 4 VAL N 101  ASP N 106 -1  O  ASP N 106   N  LYS N  62           
SHEET    3 AD1 4 PHE N  31  ALA N  35 -1  N  PHE N  31   O  MET N 105           
SHEET    4 AD1 4 THR N 128  THR N 132 -1  O  THR N 129   N  LYS N  34           
SHEET    1 AD2 3 GLY N  39  THR N  42  0                                        
SHEET    2 AD2 3 ASN N  88  ILE N  96 -1  O  ALA N  94   N  LEU N  41           
SHEET    3 AD2 3 LYS N  71  GLU N  75 -1  N  LYS N  71   O  VAL N  93           
SHEET    1 AD3 3 ILE O  33  THR O  37  0                                        
SHEET    2 AD3 3 PRO O 109  LEU O 115 -1  O  ALA O 111   N  THR O  36           
SHEET    3 AD3 3 THR O  95  PHE O 102 -1  N  ARG O  96   O  GLU O 114           
SHEET    1 AD4 4 VAL P  47  SER P  52  0                                        
SHEET    2 AD4 4 ILE P  35  ILE P  40 -1  N  VAL P  39   O  VAL P  49           
SHEET    3 AD4 4 ARG P  25  ARG P  30 -1  N  VAL P  27   O  GLN P  38           
SHEET    4 AD4 4 SER P  91  ASP P  93  1  O  ASP P  93   N  LEU P  26           
SHEET    1 AD5 4 LYS S  10  VAL S  14  0                                        
SHEET    2 AD5 4 TYR S   2  SER S   7 -1  N  SER S   7   O  LYS S  10           
SHEET    3 AD5 4 VAL S  38  ASN S  43 -1  O  MET S  40   N  VAL S   4           
SHEET    4 AD5 4 GLU S  46  ILE S  49 -1  O  LYS S  48   N  ILE S  41           
SHEET    1 AD6 4 THR S  19  GLU S  23  0                                        
SHEET    2 AD6 4 TRP S  92  SER S 102 -1  O  VAL S  96   N  VAL S  20           
SHEET    3 AD6 4 VAL S  58  ARG S  68 -1  N  VAL S  58   O  SER S 102           
SHEET    4 AD6 4 THR S  32  PHE S  35 -1  N  PHE S  35   O  ILE S  59           
SHEET    1 AD7 2 VAL S  72  ARG S  78  0                                        
SHEET    2 AD7 2 TYR S  83  HIS S  89 -1  O  LYS S  85   N  LYS S  76           
SHEET    1 AD8 3 GLU T   2  ARG T  11  0                                        
SHEET    2 AD8 3 THR T 100  SER T 108 -1  O  VAL T 105   N  ALA T   5           
SHEET    3 AD8 3 LYS T  70  ASP T  77 -1  N  PHE T  75   O  THR T 104           
SHEET    1 AD9 2 MET T  82  PRO T  87  0                                        
SHEET    2 AD9 2 ALA T  93  LYS T  98 -1  O  ASP T  94   N  MET T  86           
SHEET    1 AE1 4 LEU U  11  PRO U  14  0                                        
SHEET    2 AE1 4 THR U  29  VAL U  34 -1  O  LYS U  33   N  ALA U  13           
SHEET    3 AE1 4 TRP U  80  LEU U  87 -1  O  LYS U  81   N  VAL U  34           
SHEET    4 AE1 4 VAL U  55  VAL U  63 -1  N  GLU U  56   O  THR U  86           
SHEET    1 AE2 2 VAL U  67  HIS U  70  0                                        
SHEET    2 AE2 2 ARG U  73  ARG U  76 -1  O  GLY U  75   N  LYS U  68           
SHEET    1 AE3 6 ILE V  65  GLN V  66  0                                        
SHEET    2 AE3 6 LYS V  33  VAL V  36 -1  N  VAL V  34   O  ILE V  65           
SHEET    3 AE3 6 ARG V  22  LEU V  29 -1  N  LEU V  29   O  LYS V  33           
SHEET    4 AE3 6 GLU V  10  VAL V  13 -1  N  VAL V  11   O  GLY V  23           
SHEET    5 AE3 6 VAL V  70  ASN V  74 -1  O  ALA V  71   N  ILE V  12           
SHEET    6 AE3 6 LYS V  79  ALA V  80 -1  O  LYS V  79   N  ASN V  74           
SHEET    1 AE4 2 LEU V  41  GLN V  46  0                                        
SHEET    2 AE4 2 GLY V  57  GLU V  62 -1  O  VAL V  59   N  LYS V  44           
SHEET    1 AE5 2 VAL V  83  GLU V  88  0                                        
SHEET    2 AE5 2 LYS V  91  PHE V  96 -1  O  LYS V  91   N  GLU V  88           
SHEET    1 AE6 7 THR W   3  VAL W   8  0                                        
SHEET    2 AE6 7 LEU W  38  ASP W  43 -1  O  GLU W  41   N  GLU W   7           
SHEET    3 AE6 7 LYS W  25  TYR W  31 -1  N  ILE W  30   O  LEU W  38           
SHEET    4 AE6 7 LEU W  86  ARG W  93  1  O  PHE W  91   N  TYR W  31           
SHEET    5 AE6 7 LYS W  68  ARG W  79 -1  N  ASP W  76   O  ASP W  90           
SHEET    6 AE6 7 VAL W  60  VAL W  65 -1  N  VAL W  65   O  LYS W  68           
SHEET    7 AE6 7 THR W   3  VAL W   8  1  N  ILE W   4   O  VAL W  64           
SHEET    1 AE7 4 GLY X  22  VAL X  23  0                                        
SHEET    2 AE7 4 ILE X  36  ARG X  39 -1  O  ARG X  39   N  GLY X  22           
SHEET    3 AE7 4 LEU X  59  ALA X  61 -1  O  LEU X  59   N  ILE X  37           
SHEET    4 AE7 4 VAL X  51  CYS X  53 -1  N  GLY X  52   O  PHE X  60           
SHEET    1 AE8 4 SER X  30  VAL X  31  0                                        
SHEET    2 AE8 4 GLY X  65  LYS X  72 -1  O  GLY X  65   N  VAL X  31           
SHEET    3 AE8 4 ARG X  77  GLU X  83 -1  O  PHE X  79   N  GLU X  70           
SHEET    4 AE8 4 HIS X  46  ALA X  47  1  N  HIS X  46   O  ILE X  80           
SHEET    1 AE9 2 VAL Y  13  ARG Y  18  0                                        
SHEET    2 AE9 2 ALA Y  24  PHE Y  29 -1  O  ARG Y  27   N  GLY Y  15           
SHEET    1 AF1 2 LEU Y  33  VAL Y  40  0                                        
SHEET    2 AF1 2 ARG Y  45  SER Y  52 -1  O  VAL Y  47   N  PHE Y  38           
SHEET    1 AF2 3 THR a  35  GLU a  39  0                                        
SHEET    2 AF2 3 THR a   4  GLN a   9 -1  N  ILE a   5   O  ARG a  38           
SHEET    3 AF2 3 VAL a  55  GLU a  58 -1  O  GLU a  58   N  LYS a   6           
SHEET    1 AF3 2 SER b  29  VAL b  30  0                                        
SHEET    2 AF3 2 LYS b  37  HIS b  38 -1  O  HIS b  38   N  SER b  29           
SHEET    1 AF4 2 TYR b  48  TYR b  49  0                                        
SHEET    2 AF4 2 ARG b  52  LYS b  53 -1  O  ARG b  52   N  TYR b  49           
SHEET    1 AF5 4 PHE c  20  LYS c  25  0                                        
SHEET    2 AF5 4 GLU c   7  SER c  13 -1  N  ILE c   9   O  THR c  23           
SHEET    3 AF5 4 GLN c  45  LYS c  53 -1  O  ALA c  52   N  LYS c  10           
SHEET    4 AF5 4 LEU c  36  ASP c  40 -1  N  LYS c  38   O  VAL c  47           
SHEET    1 AF6 3 LYS e  15  LYS e  16  0                                        
SHEET    2 AF6 3 PHE e  22  HIS e  24 -1  O  LYS e  23   N  LYS e  15           
SHEET    3 AF6 3 ALA e  48  MET e  49 -1  O  ALA e  48   N  HIS e  24           
SHEET    1 AF7 4 LYS f   2  ARG f   4  0                                        
SHEET    2 AF7 4 GLN f  35  GLN f  37  1  O  ARG f  36   N  LYS f   2           
SHEET    3 AF7 4 VAL f  22  CYS f  27 -1  N  ILE f  23   O  GLN f  37           
SHEET    4 AF7 4 CYS f  14  ARG f  19 -1  N  LYS f  15   O  ILE f  26           
LINK         OP1   A 2  76                MG    MG 2 101     1555   1555  2.46  
LINK         OP1   C A  31                MG    MG A3088     1555   1555  2.47  
LINK         OP2   A A  64                MG    MG A3344     1555   1555  2.55  
LINK         OP1   U A 120                MG    MG A3003     1555   1555  2.07  
LINK         OP2   U A 120                MG    MG A3002     1555   1555  1.97  
LINK         OP2   C A 163                MG    MG A3134     1555   1555  2.66  
LINK         OP2   C A 164                MG    MG A3134     1555   1555  2.76  
LINK         OP1   C A 192                MG    MG A3095     1555   1555  2.07  
LINK         OP2   C A 192                MG    MG A3271     1555   1555  2.51  
LINK         OP1   A A 197                MG    MG A3098     1555   1555  2.23  
LINK         OP2   C A 198                MG    MG A3098     1555   1555  2.40  
LINK         OP2   G A 214                MG    MG A3114     1555   1555  2.99  
LINK         OP2   A A 218                MG    MG A3004     1555   1555  2.86  
LINK         OP2   G A 248                MG    MG A3353     1555   1555  2.84  
LINK         O4    U A 284                MG    MG A3377     1555   1555  2.59  
LINK         O6    G A 285                MG    MG A3377     1555   1555  2.78  
LINK         O4    U A 290                MG    MG A3378     1555   1555  1.89  
LINK         OP2   G A 297                MG    MG A3202     1555   1555  2.42  
LINK         OP2   A A 299                MG    MG A3065     1555   1555  2.43  
LINK         O4    U A 355                MG    MG A3377     1555   1555  2.06  
LINK         O6    G A 356                MG    MG A3377     1555   1555  2.83  
LINK         OP2   G A 370                MG    MG A3066     1555   1555  1.84  
LINK         OP1   G A 375                MG    MG A3133     1555   1555  1.90  
LINK         OP1   C A 393                MG    MG A3133     1555   1555  2.76  
LINK         O4    U A 403                MG    MG A3321     1555   1555  2.62  
LINK         OP2   G A 410                MG    MG A3295     1555   1555  2.75  
LINK         OP1   G A 411                MG    MG A3067     1555   1555  2.08  
LINK         OP1   U A 419                MG    MG A3005     1555   1555  2.34  
LINK         OP2   A A 422                MG    MG A3066     1555   1555  1.80  
LINK         OP2   G A 446                MG    MG A3186     1555   1555  2.46  
LINK         OP2   G A 450                MG    MG A3006     1555   1555  2.10  
LINK         O6    G A 450                MG    MG A3007     1555   1555  2.17  
LINK         O4'   G A 452                MG    MG A3302     1555   1555  2.94  
LINK         O3'   G A 452                MG    MG A3225     1555   1555  2.78  
LINK         OP1   A A 453                MG    MG A3225     1555   1555  2.09  
LINK         OP1   A A 453                MG    MG A3007     1555   1555  2.59  
LINK         OP2   A A 470                MG    MG A3302     1555   1555  2.57  
LINK         OP1   A A 471                MG    MG A3225     1555   1555  3.00  
LINK         OP2   A A 505                MG    MG A3147     1555   1555  2.95  
LINK         OP1   C A 509                MG    MG A3400     1555   1555  2.28  
LINK         OP1   C A 510                MG    MG A3101     1555   1555  2.21  
LINK         OP2   U A 511                MG    MG A3101     1555   1555  2.65  
LINK         OP2   A A 514                MG    MG A3276     1555   1555  2.92  
LINK         OP1   A A 526                MG    MG A3008     1555   1555  2.02  
LINK         OP1   C A 527                MG    MG A3008     1555   1555  2.30  
LINK         O6    G A 530                MG    MG A3264     1555   1555  2.84  
LINK         OP2   G A 536                MG    MG A3345     1555   1555  2.88  
LINK         OP2   G A 543                MG    MG A3379     1555   1555  2.09  
LINK         O6    G A 551                MG    MG A3401     1555   1555  2.56  
LINK         O4    U A 558                MG    MG A3216     1555   1555  2.17  
LINK         OP1   U A 567                MG    MG A3010     1555   1555  2.28  
LINK         O6    G A 570                MG    MG A3085     1555   1555  2.01  
LINK         OP1   A A 572                MG    MG A3068     1555   1555  2.15  
LINK         OP1   A A 574                MG    MG A3012     1555   1555  2.81  
LINK         OP2   A A 574                MG    MG A3012     1555   1555  2.50  
LINK         OP1   U A 576                MG    MG A3082     1555   1555  2.06  
LINK         OP2   G A 578                MG    MG A3107     1555   1555  1.98  
LINK         OP2   A A 586                MG    MG A3177     1555   1555  2.92  
LINK         O4    U A 594                MG    MG A3257     1555   1555  2.85  
LINK         O6    G A 597                MG    MG A3142     1555   1555  2.66  
LINK         O4    U A 598                MG    MG A3142     1555   1555  2.96  
LINK         OP1   G A 622                MG    MG A3016     1555   1555  2.79  
LINK         O6    G A 638                MG    MG A3331     1555   1555  2.55  
LINK         O6    G A 649                MG    MG A3331     1555   1555  2.81  
LINK         O6    G A 656                MG    MG A3262     1555   1555  3.00  
LINK         O6    G A 662                MG    MG A3257     1555   1555  2.99  
LINK         OP1   A A 670                MG    MG A3188     1555   1555  2.93  
LINK         OP2   A A 670                MG    MG A3407     1555   1555  2.94  
LINK         OP2   U A 686                MG    MG A3091     1555   1555  2.74  
LINK         O6    G A 695                MG    MG A3341     1555   1555  2.54  
LINK         OP2   C A 698                MG    MG A3309     1555   1555  2.94  
LINK         O6    G A 711                MG    MG A3334     1555   1555  2.77  
LINK         O6    G A 712                MG    MG A3334     1555   1555  2.42  
LINK         OP1   C A 737                MG    MG A3337     1555   1555  2.49  
LINK         OP1   A A 739                MG    MG A3178     1555   1555  2.83  
LINK         OP2   C A 740                MG    MG A3087     1555   1555  1.99  
LINK         O4    U A 746                MG    MG A3019     1555   1555  1.92  
LINK         OP1   A A 751                MG    MG A3020     1555   1555  1.81  
LINK         OP1   G A 760                MG    MG A3203     1555   1555  2.65  
LINK         O4    U A 767                MG    MG A3341     1555   1555  2.63  
LINK         OP2   G A 776                MG    MG A3367     1555   1555  2.61  
LINK         OP2   A A 783                MG    MG A3021     1555   1555  2.57  
LINK         OP1   G A 784                MG    MG A3022     1555   1555  2.50  
LINK         OP2   G A 784                MG    MG A3021     1555   1555  2.29  
LINK         OP1   C A 787                MG    MG A3174     1555   1555  1.79  
LINK         OP2   U A 790                MG    MG A3174     1555   1555  1.84  
LINK         OP1   A A 800                MG    MG A3023     1555   1555  2.19  
LINK         OP1   A A 802                MG    MG A3024     1555   1555  2.12  
LINK         OP1   U A 810                MG    MG A3025     1555   1555  2.45  
LINK         OP2   G A 818                MG    MG A3070     1555   1555  2.55  
LINK         OP1   U A 827                MG    MG A3027     1555   1555  1.86  
LINK         OP2   U A 827                MG    MG A3213     1555   1555  2.77  
LINK         O2'   G A 830                MG    MG A3166     1555   1555  2.46  
LINK         O6    G A 834                MG    MG A3297     1555   1555  2.59  
LINK         OP2   C A 835                MG    MG A3409     1555   1555  2.80  
LINK         OP2   G A 862                MG    MG A3093     1555   1555  1.94  
LINK         O2'   C A 865                MG    MG A3237     1555   1555  2.93  
LINK         O6    G A 869                MG    MG A3236     1555   1555  2.27  
LINK         O4    U A 870                MG    MG A3236     1555   1555  2.65  
LINK         OP1   A A 911                MG    MG A3300     1555   1555  2.67  
LINK         OP2   A A 943                MG    MG A3105     1555   1555  2.10  
LINK         OP1   A A 945                MG    MG A3029     1555   1555  1.97  
LINK         OP2   A A 945                MG    MG A3028     1555   1555  2.41  
LINK         OP2   C A 946                MG    MG A3028     1555   1555  2.04  
LINK         OP1   C A 948                MG    MG A3030     1555   1555  1.97  
LINK         O6    G A 949                MG    MG A3211     1555   1555  2.69  
LINK         O6    G A 950                MG    MG A3211     1555   1555  2.93  
LINK         OP1   G A 953                MG    MG A3228     1555   1555  2.45  
LINK         O5'   G A 953                MG    MG A3228     1555   1555  2.80  
LINK         OP1   G A 962                MG    MG A3030     1555   1555  2.27  
LINK         OP1   U A 963                MG    MG A3108     1555   1555  2.08  
LINK         OP2   U A 963                MG    MG A3030     1555   1555  2.02  
LINK         O4    U A 963                MG    MG A3283     1555   1555  2.89  
LINK         OP2   A A 975                MG    MG A3168     1555   1555  2.47  
LINK         OP1   A A 980                MG    MG A3195     1555   1555  2.77  
LINK         OP1   A A 981                MG    MG A3071     1555   1555  2.03  
LINK         OP2   A A 990                MG    MG A3072     1555   1555  1.83  
LINK         OP2   C A 991                MG    MG A3072     1555   1555  2.59  
LINK         OP2   U A 999                MG    MG A3169     1555   1555  2.20  
LINK         OP2   A A1009                MG    MG A3103     1555   1555  2.26  
LINK         OP2   A A1010                MG    MG A3103     1555   1555  2.07  
LINK         OP2   C A1013                MG    MG A3224     1555   1555  1.92  
LINK         OP2   A A1014                MG    MG A3224     1555   1555  2.62  
LINK         OP2   U A1023                MG    MG A3212     1555   1555  1.79  
LINK         O2'   G A1025                MG    MG A3212     1555   1555  2.02  
LINK         OP2   G A1124                MG    MG A3137     1555   1555  2.74  
LINK         OP1   U A1132                MG    MG A3200     1555   1555  2.43  
LINK         OP2   C A1153                MG    MG A3169     1555   1555  2.22  
LINK         OP2   A A1156                MG    MG A3031     1555   1555  2.02  
LINK         OP2   G A1186                MG    MG A3072     1555   1555  2.30  
LINK         OP2   G A1187                MG    MG A3183     1555   1555  2.15  
LINK         O6    G A1187                MG    MG A3070     1555   1555  1.96  
LINK         OP2   A A1189                MG    MG A3173     1555   1555  1.92  
LINK         O4    U A1203                MG    MG A3360     1555   1555  2.65  
LINK         OP1   G A1235                MG    MG A3147     1555   1555  2.96  
LINK         O6    G A1235                MG    MG A3370     1555   1555  2.84  
LINK         OP1   A A1237                MG    MG A3199     1555   1555  2.45  
LINK         OP2   A A1237                MG    MG A3115     1555   1555  2.26  
LINK         OP1   U A1249                MG    MG A3177     1555   1555  2.29  
LINK         OP1   G A1250                MG    MG A3177     1555   1555  2.40  
LINK         O4    U A1263                MG    MG A3180     1555   1555  2.15  
LINK         OP2   A A1265                MG    MG A3097     1555   1555  2.45  
LINK         O2'   A A1265                MG    MG A3235     1555   1555  2.65  
LINK         OP1   A A1268                MG    MG A3033     1555   1555  2.47  
LINK         OP2   A A1269                MG    MG A3034     1555   1555  1.90  
LINK         OP2   G A1271                MG    MG A3035     1555   1555  2.40  
LINK         OP1   A A1272                MG    MG A3035     1555   1555  1.84  
LINK         OP2   C A1298                MG    MG A3171     1555   1555  2.00  
LINK         OP2   G A1303                MG    MG A3140     1555   1555  2.97  
LINK         OP1   U A1313                MG    MG A3036     1555   1555  2.29  
LINK         OP1   C A1314                MG    MG A3099     1555   1555  2.28  
LINK         OP2   C A1315                MG    MG A3099     1555   1555  2.01  
LINK         O4    U A1318                MG    MG A3343     1555   1555  2.58  
LINK         O2    U A1326                MG    MG A3319     1555   1555  2.92  
LINK         OP2   A A1327                MG    MG A3073     1555   1555  1.98  
LINK         OP1   A A1328                MG    MG A3132     1555   1555  2.01  
LINK         OP2   G A1331                MG    MG A3343     1555   1555  2.98  
LINK         OP1   G A1332                MG    MG A3099     1555   1555  1.88  
LINK         OP2   G A1333                MG    MG A3037     1555   1555  1.95  
LINK         OP2   A A1342                MG    MG A3090     1555   1555  2.12  
LINK         OP2   G A1346                MG    MG A3247     1555   1555  2.30  
LINK         O6    G A1355                MG    MG A3265     1555   1555  2.53  
LINK         OP1   A A1359                MG    MG A3074     1555   1555  2.41  
LINK         OP2   G A1360                MG    MG A3074     1555   1555  2.07  
LINK         OP1   C A1376                MG    MG A3128     1555   1555  2.02  
LINK         OP2   U A1379                MG    MG A3138     1555   1555  1.81  
LINK         OP2   G A1380                MG    MG A3138     1555   1555  2.75  
LINK         OP1   U A1394                MG    MG A3040     1555   1555  2.09  
LINK         OP1   A A1395                MG    MG A3041     1555   1555  1.96  
LINK         O5'   A A1395                MG    MG A3193     1555   1555  2.70  
LINK         OP1   C A1398                MG    MG A3119     1555   1555  2.40  
LINK         OP2   A A1439                MG    MG A3076     1555   1555  2.49  
LINK         O4    U A1440                MG    MG A3076     1555   1555  2.44  
LINK         O4    U A1602                MG    MG A3090     1555   1555  2.06  
LINK         OP1   A A1603                MG    MG A3193     1555   1555  2.77  
LINK         OP1   A A1603                MG    MG A3041     1555   1555  2.49  
LINK         OP1   C A1604                MG    MG A3040     1555   1555  2.64  
LINK         OP2   C A1604                MG    MG A3041     1555   1555  1.97  
LINK         OP1   C A1607                MG    MG A3140     1555   1555  2.94  
LINK         OP1   A A1614                MG    MG A3020     1555   1555  1.81  
LINK         OP1   G A1622                MG    MG A3336     1555   1555  2.94  
LINK         OP2   G A1622                MG    MG A3336     1555   1555  3.00  
LINK         OP2   U A1636                MG    MG A3079     1555   1555  2.10  
LINK         OP1   C A1639                MG    MG A3175     1555   1555  2.48  
LINK         OP2   C A1639                MG    MG A3171     1555   1555  2.75  
LINK         OP2   A A1641                MG    MG A3232     1555   1555  2.71  
LINK         OP1   U A1647                MG    MG A3035     1555   1555  2.18  
LINK         OP2   U A1647                MG    MG A3042     1555   1555  2.19  
LINK         OP1   U A1648                MG    MG A3035     1555   1555  1.94  
LINK         OP1   C A1658                MG    MG A3163     1555   1555  1.84  
LINK         OP2   U A1662                MG    MG A3294     1555   1555  2.40  
LINK         OP1   A A1664                MG    MG A3110     1555   1555  2.98  
LINK         OP2   A A1664                MG    MG A3043     1555   1555  2.10  
LINK         OP2   A A1665                MG    MG A3110     1555   1555  2.23  
LINK         OP2   A A1669                MG    MG A3092     1555   1555  2.21  
LINK         OP1   C A1670                MG    MG A3045     1555   1555  2.11  
LINK         OP2   C A1670                MG    MG A3092     1555   1555  2.14  
LINK         OP2   U A1671                MG    MG A3045     1555   1555  2.43  
LINK         O4    U A1671                MG    MG A3092     1555   1555  2.35  
LINK         OP1   G A1673                MG    MG A3281     1555   1555  2.64  
LINK         OP2   A A1676                MG    MG A3100     1555   1555  1.99  
LINK         OP2   A A1678                MG    MG A3046     1555   1555  2.22  
LINK         OP1   C A1774                MG    MG A3047     1555   1555  1.94  
LINK         OP2   G A1776                MG    MG A3048     1555   1555  2.24  
LINK         OP1   A A1780                MG    MG A3086     1555   1555  2.47  
LINK         OP1   U A1782                MG    MG A3086     1555   1555  2.21  
LINK         OP1   A A1783                MG    MG A3087     1555   1555  2.09  
LINK         OP2   A A1783                MG    MG A3086     1555   1555  2.01  
LINK         OP2   A A1784                MG    MG A3087     1555   1555  2.58  
LINK         OP2   G A1824                MG    MG A3411     1555   1555  2.27  
LINK         OP1   G A1828                MG    MG A3192     1555   1555  2.34  
LINK         OP2   G A1828                MG    MG A3096     1555   1555  1.94  
LINK         O4    U A1841                MG    MG A3329     1555   1555  2.88  
LINK         OP2   A A1938                MG    MG A3094     1555   1555  2.23  
LINK         OP1   U A1956                MG    MG A3278     1555   1555  2.58  
LINK         OP1   G A1968                MG    MG A3190     1555   1555  1.98  
LINK         OP1   A A1970                MG    MG A3245     1555   1555  2.50  
LINK         OP2   A A1970                MG    MG A3050     1555   1555  2.18  
LINK         OP1   U A1971                MG    MG A3245     1555   1555  2.53  
LINK         O4    U A1982                MG    MG A3219     1555   1555  2.95  
LINK         OP1   A A2005                MG    MG A3034     1555   1555  2.03  
LINK         OP1   C A2006                MG    MG A3033     1555   1555  1.94  
LINK         OP1   U A2022                MG    MG A3080     1555   1555  2.10  
LINK         O2    U A2022                MG    MG A3340     1555   1555  2.91  
LINK         OP2   C A2025                MG    MG A3051     1555   1555  2.14  
LINK         OP2   A A2031                MG    MG A3215     1555   1555  2.24  
LINK         OP1   A A2033                MG    MG A3185     1555   1555  2.40  
LINK         OP2   A A2051                MG    MG A3301     1555   1555  2.28  
LINK         OP2   G A2056                MG    MG A3052     1555   1555  2.88  
LINK         OP2   G A2057                MG    MG A3052     1555   1555  2.37  
LINK         OP2   G A2061                MG    MG A3053     1555   1555  2.31  
LINK         OP1   A A2062                MG    MG A3054     1555   1555  2.18  
LINK         OP1   A A2071                MG    MG A3320     1555   1555  2.23  
LINK         OP1   U A2074                MG    MG A3164     1555   1555  2.05  
LINK         O4    U A2202                MG    MG A3405     1555   1555  2.66  
LINK         O6    G A2221                MG    MG A3405     1555   1555  2.60  
LINK         OP2   A A2227                MG    MG A3131     1555   1555  2.67  
LINK         OP1   U A2243                MG    MG A3095     1555   1555  2.11  
LINK         OP2   U A2243                MG    MG A3320     1555   1555  1.85  
LINK         OP2   C A2248                MG    MG A3056     1555   1555  2.52  
LINK         O4    U A2249                MG    MG A3056     1555   1555  2.48  
LINK         O2'   G A2250                MG    MG A3214     1555   1555  2.67  
LINK         OP1   G A2251                MG    MG A3356     1555   1555  2.96  
LINK         OP2   G A2251                MG    MG A3214     1555   1555  2.54  
LINK         OP1   A A2268                MG    MG A3057     1555   1555  2.13  
LINK         OP1   G A2269                MG    MG A3057     1555   1555  1.96  
LINK         OP2   A A2270                MG    MG A3058     1555   1555  2.42  
LINK         OP2   A A2274                MG    MG A3251     1555   1555  2.53  
LINK         O6    G A2290                MG    MG A3330     1555   1555  2.77  
LINK         O6    G A2304                MG    MG A3059     1555   1555  2.97  
LINK         OP2   U A2305                MG    MG A3323     1555   1555  2.92  
LINK         OP2   G A2353                MG    MG A3363     1555   1555  2.73  
LINK         O6    G A2371                MG    MG A3346     1555   1555  2.23  
LINK         OP1   A A2377                MG    MG A3139     1555   1555  2.96  
LINK         OP1   C A2385                MG    MG A3118     1555   1555  1.87  
LINK         OP1   A A2406                MG    MG A3112     1555   1555  2.19  
LINK         OP1   A A2407                MG    MG A3067     1555   1555  2.12  
LINK         O4    U A2419                MG    MG A3081     1555   1555  2.25  
LINK         OP1   C A2427                MG    MG A3213     1555   1555  2.35  
LINK         OP1   G A2429                MG    MG A3213     1555   1555  2.82  
LINK         OP2   G A2429                MG    MG A3027     1555   1555  2.14  
LINK         OP2   G A2429                MG    MG A3213     1555   1555  2.83  
LINK         OP2   A A2430                MG    MG A3027     1555   1555  1.93  
LINK         OP1   A A2448                MG    MG A3085     1555   1555  2.00  
LINK         OP2   A A2448                MG    MG A3084     1555   1555  1.96  
LINK         O6    G A2494                MG    MG A3317     1555   1555  2.89  
LINK         O3'   A A2497                MG    MG A3084     1555   1555  2.98  
LINK         OP2   C A2498                MG    MG A3084     1555   1555  2.56  
LINK         OP1   C A2499                MG    MG A3085     1555   1555  2.30  
LINK         OP2   C A2499                MG    MG A3084     1555   1555  2.61  
LINK         O2    C A2499                MG    MG A3061     1555   1555  2.38  
LINK         OP2   G A2502                MG    MG A3053     1555   1555  2.10  
LINK         OP1   A A2503                MG    MG A3082     1555   1555  1.97  
LINK         OP2   A A2503                MG    MG A3082     1555   1555  2.95  
LINK         OP1   C A2507                MG    MG A3089     1555   1555  2.89  
LINK         OP2   A A2518                MG    MG A3062     1555   1555  2.43  
LINK         O6    G A2526                MG    MG A3310     1555   1555  2.98  
LINK         OP1   A A2531                MG    MG A3364     1555   1555  2.34  
LINK         OP1   G A2550                MG    MG A3092     1555   1555  1.98  
LINK         OP2   U A2552                MG    MG A3281     1555   1555  2.56  
LINK         OP1   C A2573                MG    MG A3089     1555   1555  2.80  
LINK         OP1   G A2574                MG    MG A3089     1555   1555  2.88  
LINK         OP2   C A2575                MG    MG A3089     1555   1555  2.71  
LINK         OP1   G A2576                MG    MG A3129     1555   1555  2.05  
LINK         OP1   A A2577                MG    MG A3129     1555   1555  2.34  
LINK         OP1   C A2579                MG    MG A3307     1555   1555  2.02  
LINK         OP2   G A2582                MG    MG A3296     1555   1555  2.44  
LINK         OP2   G A2583                MG    MG A3296     1555   1555  2.06  
LINK         OP1   G A2588                MG    MG A3022     1555   1555  2.08  
LINK         OP2   G A2588                MG    MG A3063     1555   1555  2.23  
LINK         OP1   A A2589                MG    MG A3021     1555   1555  2.23  
LINK         OP1   G A2592                MG    MG A3190     1555   1555  2.34  
LINK         O4    U A2593                MG    MG A3172     1555   1555  2.36  
LINK         OP2   C A2611                MG    MG A3307     1555   1555  1.90  
LINK         OP1   U A2615                MG    MG A3097     1555   1555  2.57  
LINK         OP1   C A2646                MG    MG A3242     1555   1555  2.78  
LINK         OP2   U A2647                MG    MG A3242     1555   1555  2.56  
LINK         OP2   A A2682                MG    MG A3204     1555   1555  2.17  
LINK         OP2   G A2686                MG    MG A3167     1555   1555  2.03  
LINK         O6    G A2686                MG    MG A3182     1555   1555  2.96  
LINK         O6    G A2697                MG    MG A3369     1555   1555  2.42  
LINK         OP2   A A2705                MG    MG A3083     1555   1555  2.09  
LINK         OP2   A A2711                MG    MG A3064     1555   1555  1.92  
LINK         OP2   G A2714                MG    MG A3064     1555   1555  2.54  
LINK         O6    G A2719                MG    MG A3179     1555   1555  1.93  
LINK         OP2   A A2748                MG    MG A3206     1555   1555  2.07  
LINK         O4    U A2754                MG    MG A3206     1555   1555  2.74  
LINK         OP1   A A2766                MG    MG A3231     1555   1555  1.95  
LINK         OP2   C A2767                MG    MG A3231     1555   1555  2.83  
LINK         O2'   A A2776                MG    MG A3273     1555   1555  2.97  
LINK         O2'   A A2781                MG    MG A3273     1555   1555  2.81  
LINK         OP2   A A2821                MG    MG A3116     1555   1555  2.51  
LINK         OP2   G A2822                MG    MG A3116     1555   1555  2.17  
LINK         O4    U A2847                MG    MG A3338     1555   1555  2.81  
LINK         OP2   A A2850                MG    MG A3165     1555   1555  2.81  
LINK         OP2   A B  57                MG    MG B 208     1555   1555  2.32  
LINK         OP2   A B  58                MG    MG B 208     1555   1555  2.13  
LINK         O4    U B  95                MG    MG B 202     1555   1555  1.91  
LINK         OP2   G B 100                MG    MG B 203     1555   1555  2.66  
LINK         OP2   G B 106                MG    MG B 206     1555   1555  2.70  
LINK         O   GLY D 115                MG    MG A3116     1555   1555  2.29  
LINK         OD1 ASN M  99                MG    MG A3016     1555   1555  2.15  
LINK         O   GLY O 105                MG    MG A3319     1555   1555  2.75  
LINK         OD1 ASP b  20                MG    MG b 101     1555   1555  2.95  
LINK         OD2 ASP b  20                MG    MG b 101     1555   1555  2.85  
LINK         SG  CYS f  11                ZN    ZN f 101     1555   1555  2.34  
LINK         SG  CYS f  14                ZN    ZN f 101     1555   1555  2.38  
LINK         SG  CYS f  27                ZN    ZN f 101     1555   1555  2.31  
LINK         ND1 HIS f  33                ZN    ZN f 101     1555   1555  2.29  
CISPEP   1 THR D  151    PRO D  152          0         1.54                     
CISPEP   2 THR I   67    PRO I   68          0       -16.67                     
CISPEP   3 VAL S   51    PRO S   52          0        -2.15                     
SITE     1 AC1  3   C 2  75    A 2  76    A A2602                               
SITE     1 AC2  1   U A 120                                                     
SITE     1 AC3  2   U A 120    G A 123                                          
SITE     1 AC4  2   A A 218    A A 219                                          
SITE     1 AC5  1   U A 419                                                     
SITE     1 AC6  2   G A 450    G A 452                                          
SITE     1 AC7  4   A A 449    G A 450    A A 453   MG A3225                    
SITE     1 AC8  3   A A 526    C A 527    A A 528                               
SITE     1 AC9  1   U A 567                                                     
SITE     1 AD1  1   G A 831                                                     
SITE     1 AD2  1   A A 574                                                     
SITE     1 AD3  1   A A 582                                                     
SITE     1 AD4  3   A A 621    G A 622  ASN M  99                               
SITE     1 AD5  2   G A 733    A A 761                                          
SITE     1 AD6  1   U A 746                                                     
SITE     1 AD7  2   A A 751    A A1614                                          
SITE     1 AD8  3   A A 783    G A 784    A A2589                               
SITE     1 AD9  2   G A 784    G A2588                                          
SITE     1 AE1  2   C A 192    A A 800                                          
SITE     1 AE2  3   A A 675    A A 802    U A 803                               
SITE     1 AE3  2   U A 810    A A1253                                          
SITE     1 AE4  1   G A 822                                                     
SITE     1 AE5  5   U A 826    U A 827    G A2429    A A2430                    
SITE     2 AE5  5  MG A3213                                                     
SITE     1 AE6  3   C A 944    A A 945    C A 946                               
SITE     1 AE7  1   A A 945                                                     
SITE     1 AE8  4   A A 947    C A 948    G A 962    U A 963                    
SITE     1 AE9  1   A A1156                                                     
SITE     1 AF1  4   U A1267    A A1268    C A2006    G A2048                    
SITE     1 AF2  2   A A1269    A A2005                                          
SITE     1 AF3  4   G A1271    A A1272    U A1647    U A1648                    
SITE     1 AF4  3   U A1313    G A1333    G A1334                               
SITE     1 AF5  1   G A1333                                                     
SITE     1 AF6  1   C A1376                                                     
SITE     1 AF7  2   G A1358    G A1371                                          
SITE     1 AF8  3   A A1393    U A1394    C A1604                               
SITE     1 AF9  3   A A1395    A A1603    C A1604                               
SITE     1 AG1  1   U A1647                                                     
SITE     1 AG2  3   A A1664    A A1665    G A1992                               
SITE     1 AG3  2   C A1670    U A1671                                          
SITE     1 AG4  1   A A1678                                                     
SITE     1 AG5  1   C A1774                                                     
SITE     1 AG6  1   G A1776                                                     
SITE     1 AG7  2   A A1900    A A1970                                          
SITE     1 AG8  1   C A2025                                                     
SITE     1 AG9  2   G A2056    G A2057                                          
SITE     1 AH1  2   G A2061    G A2502                                          
SITE     1 AH2  2   A A2062    C A2443                                          
SITE     1 AH3  3   C A2066    C A2248    U A2249                               
SITE     1 AH4  2   A A2268    G A2269                                          
SITE     1 AH5  2   A A2267    A A2270                                          
SITE     1 AH6  2   G A2304    C A2310                                          
SITE     1 AH7  1   A A2453                                                     
SITE     1 AH8  1   C A2499                                                     
SITE     1 AH9  3   A A2518    U A2519    A A2541                               
SITE     1 AI1  2   G A2588  GLU C 236                                          
SITE     1 AI2  2   A A2711    G A2714                                          
SITE     1 AI3  2   A A 299    G A 338                                          
SITE     1 AI4  2   G A 370    A A 422                                          
SITE     1 AI5  3   G A 411    A A 412    A A2407                               
SITE     1 AI6  1   A A 572                                                     
SITE     1 AI7  2   G A 818    G A1187                                          
SITE     1 AI8  1   A A 981                                                     
SITE     1 AI9  3   A A 990    C A 991    G A1186                               
SITE     1 AJ1  1   A A1327                                                     
SITE     1 AJ2  2   A A1359    G A1360                                          
SITE     1 AJ3  1   G A1425                                                     
SITE     1 AJ4  2   A A1439    U A1440                                          
SITE     1 AJ5  1   U A1636                                                     
SITE     1 AJ6  1   U A2022                                                     
SITE     1 AJ7  1   U A2419                                                     
SITE     1 AJ8  2   U A 576    A A2503                                          
SITE     1 AJ9  1   A A2705                                                     
SITE     1 AK1  4   A A2448    A A2497    C A2498    C A2499                    
SITE     1 AK2  3   G A 570    A A2448    C A2499                               
SITE     1 AK3  3   A A1780    U A1782    A A1783                               
SITE     1 AK4  3   C A 740    A A1783    A A1784                               
SITE     1 AK5  2   C A  31    G A1239                                          
SITE     1 AK6  4   C A2507    C A2573    G A2574    C A2575                    
SITE     1 AK7  3   A A1342    U A1602  THR U  60                               
SITE     1 AK8  3   U A 686    C A 687    U A 688                               
SITE     1 AK9  4   A A1669    C A1670    U A1671    G A2550                    
SITE     1 AL1  3   A A 861    G A 862    A A 910                               
SITE     1 AL2  3   A A1938    C A1957    C A1958                               
SITE     1 AL3  3   C A 192    A A 199    U A2243                               
SITE     1 AL4  2   G A1828  ARG C 221                                          
SITE     1 AL5  2   A A1265    U A2615                                          
SITE     1 AL6  4   G A 194    A A 195    A A 197    C A 198                    
SITE     1 AL7  3   C A1314    C A1315    G A1332                               
SITE     1 AL8  1   A A1676                                                     
SITE     1 AL9  4   C A 509    C A 510    U A 511    G A 512                    
SITE     1 AM1  1   A A 973                                                     
SITE     1 AM2  3   A A1008    A A1009    A A1010                               
SITE     1 AM3  2   A A2741    G A2742                                          
SITE     1 AM4  1   A A 943                                                     
SITE     1 AM5  1   G A2843                                                     
SITE     1 AM6  2   G A 578    U A2017                                          
SITE     1 AM7  1   U A 963                                                     
SITE     1 AM8  2   A A1664    A A1665                                          
SITE     1 AM9  1   G A1989                                                     
SITE     1 AN1  2   A A2406    U A2408                                          
SITE     1 AN2  1   G A 214                                                     
SITE     1 AN3  1   A A1237                                                     
SITE     1 AN4  5   A A2820    A A2821    G A2822  GLY D 115                    
SITE     2 AN4  5 HIS O   3                                                     
SITE     1 AN5  4   G A2289    G A2325    U A2384    C A2385                    
SITE     1 AN6  1   C A1398                                                     
SITE     1 AN7  1   A A2335                                                     
SITE     1 AN8  1   U A 665                                                     
SITE     1 AN9  1   U A1240                                                     
SITE     1 AO1  1   C A1376                                                     
SITE     1 AO2  4   G A2053    G A2576    A A2577   MG A3392                    
SITE     1 AO3  1  MG A3257                                                     
SITE     1 AO4  3   C A2226    A A2227    G A2228                               
SITE     1 AO5  3   A A1284    A A1285    A A1328                               
SITE     1 AO6  3   A A 374    G A 375    C A 393                               
SITE     1 AO7  2   C A 163    C A 164                                          
SITE     1 AO8  2   G A1124    G A1125                                          
SITE     1 AO9  3   A A1378    U A1379    G A1380                               
SITE     1 AP1  1   A A2377                                                     
SITE     1 AP2  3   G A1303    C A1607   MG A3210                               
SITE     1 AP3  1   C A1167                                                     
SITE     1 AP4  3   G A 597    U A 598    G A 659                               
SITE     1 AP5  1   A A 515                                                     
SITE     1 AP6  2   U A1995  THR D 129                                          
SITE     1 AP7  1   G A2640                                                     
SITE     1 AP8  4   A A 505    G A1235    G A1236   MG A3387                    
SITE     1 AP9  4   G A1529    G A1530    C A1541    U A1542                    
SITE     1 AQ1  2   U A2076    G A2238                                          
SITE     1 AQ2  1   U A2865                                                     
SITE     1 AQ3  1   G A2524                                                     
SITE     1 AQ4  1   G A2775                                                     
SITE     1 AQ5  1   G A  55                                                     
SITE     1 AQ6  1   G A 500                                                     
SITE     1 AQ7  1   G A2414                                                     
SITE     1 AQ8  1   G A2396                                                     
SITE     1 AQ9  1   U A2236                                                     
SITE     1 AR1  1   G A2545                                                     
SITE     1 AR2  1   G A 261                                                     
SITE     1 AR3  2   G A1429    U A1563                                          
SITE     1 AR4  2   C A1658  HIS D 140                                          
SITE     1 AR5  3   U A2074    G A2239    U A2240                               
SITE     1 AR6  3   A A2850    A A2851    G A2852                               
SITE     1 AR7  3   G A 805    G A 830    U A2068                               
SITE     1 AR8  1   G A2686                                                     
SITE     1 AR9  2   A A 975    G A 976                                          
SITE     1 AS1  2   U A 999    C A1153                                          
SITE     1 AS2  4   C A2681    U A2684    G A2685    U A2724                    
SITE     1 AS3  2   C A1298    C A1639                                          
SITE     1 AS4  1   U A2593                                                     
SITE     1 AS5  2   A A1189    G A1190                                          
SITE     1 AS6  2   C A 787    U A 790                                          
SITE     1 AS7  3   C A1297    C A1639    G A2709                               
SITE     1 AS8  4   G A2061    G A2447    C A2501    U A2504                    
SITE     1 AS9  3   A A 586    U A1249    G A1250                               
SITE     1 AT1  2   A A 739    U A1779                                          
SITE     1 AT2  1   G A2719                                                     
SITE     1 AT3  2   U A1263    A A2015                                          
SITE     1 AT4  4   G A2686    U A2687    G A2688    G A2722                    
SITE     1 AT5  2   C A 816    G A1187                                          
SITE     1 AT6  2   U A2028    A A2033                                          
SITE     1 AT7  1   G A 446                                                     
SITE     1 AT8  1  MG A3362                                                     
SITE     1 AT9  2   A A 670    A A 804                                          
SITE     1 AU1  2   G A1968    G A2592                                          
SITE     1 AU2  2   C A2055  GLN b   5                                          
SITE     1 AU3  2   G A1828    G A1973                                          
SITE     1 AU4  5   U A1394    A A1395    U A1397    U A1602                    
SITE     2 AU4  5   A A1603                                                     
SITE     1 AU5  1   G A2595                                                     
SITE     1 AU6  1   A A 980                                                     
SITE     1 AU7  2   G A 463    G A 465                                          
SITE     1 AU8  1   U A2571                                                     
SITE     1 AU9  1   A A1237                                                     
SITE     1 AV1  1   U A1132                                                     
SITE     1 AV2  2   A A 861   MG A3300                                          
SITE     1 AV3  2   G A 297    G A 338                                          
SITE     1 AV4  2   C A 731    G A 760                                          
SITE     1 AV5  2   A A2682    G A2722                                          
SITE     1 AV6  2   G A2693    U A2707                                          
SITE     1 AV7  2   A A2748    U A2754                                          
SITE     1 AV8  2   G A2337    C A2385                                          
SITE     1 AV9  1   A A2386                                                     
SITE     1 AW1  4   G A1303    A A1304    C A1606   MG A3140                    
SITE     1 AW2  2   G A 949    G A 950                                          
SITE     1 AW3  4   G A1022    U A1023    G A1025    C A1135                    
SITE     1 AW4  5   U A 827    A A2426    C A2427    G A2429                    
SITE     2 AW4  5  MG A3027                                                     
SITE     1 AW5  3   G A2250    G A2251    A A2497                               
SITE     1 AW6  2   A A 574    A A2031                                          
SITE     1 AW7  4   G A 533    U A 534    G A 535    U A 558                    
SITE     1 AW8  1   G A2846                                                     
SITE     1 AW9  3   U A1769    G A1980    U A1982                               
SITE     1 AX1  4   A A 374    G A 375    G A 376   MG A3288                    
SITE     1 AX2  1  MG A3301                                                     
SITE     1 AX3  1   G A1631                                                     
SITE     1 AX4  1   C A 961                                                     
SITE     1 AX5  2   C A1013    A A1014                                          
SITE     1 AX6  5   G A 452    A A 453    A A 471   MG A3007                    
SITE     2 AX6  5 SER E  80                                                     
SITE     1 AX7  2   G A2864    U A2866                                          
SITE     1 AX8  1   G A 953                                                     
SITE     1 AX9  1   G A 974                                                     
SITE     1 AY1  2   G A2446    G A2502                                          
SITE     1 AY2  2   A A2766    C A2767                                          
SITE     1 AY3  2   A A1641    G A1642                                          
SITE     1 AY4  1   G A 759                                                     
SITE     1 AY5  2   A A 743    G A2581                                          
SITE     1 AY6  2   A A1265  ARG b  17                                          
SITE     1 AY7  4   U A 868    G A 869    U A 870   MG A3237                    
SITE     1 AY8  4   C A 865    U A 868    G A 869   MG A3236                    
SITE     1 AY9  1   A A2432                                                     
SITE     1 AZ1  3   C A1838    G A1839    G A1897                               
SITE     1 AZ2  1   G A  58                                                     
SITE     1 AZ3  2   C A2646    U A2647                                          
SITE     1 AZ4  1   G A 628                                                     
SITE     1 AZ5  4   G A1215    U A1234    G A1235   MG A3348                    
SITE     1 AZ6  2   A A1970    U A1971                                          
SITE     1 AZ7  2   C A1345    G A1346                                          
SITE     1 AZ8  1   G A1163                                                     
SITE     1 AZ9  1   C A 671                                                     
SITE     1 BC1  1   A A2274                                                     
SITE     1 BC2  1   G A 189                                                     
SITE     1 BC3  1   U A2779                                                     
SITE     1 BC4  1   C A1967                                                     
SITE     1 BC5  1  MG A3257                                                     
SITE     1 BC6  7   U A 593    U A 594    G A 662    G A 663                    
SITE     2 BC6  7   G A 664   MG A3130   MG A3256                               
SITE     1 BC7  4   U A 839    G A 938    G A 939    G A 940                    
SITE     1 BC8  4   A A 599    G A 600    G A 656    U A 657                    
SITE     1 BC9  2   G A2791    A A2792                                          
SITE     1 BD1  3   G A 530    G A2038    U A2039                               
SITE     1 BD2  1   G A1355                                                     
SITE     1 BD3  1   G A1271                                                     
SITE     1 BD4  2   G A1807    A A1809                                          
SITE     1 BD5  1   A A1001                                                     
SITE     1 BD6  2   C A 192    U A 193                                          
SITE     1 BD7  4   C A2628    A A2776    A A2781    G A2782                    
SITE     1 BD8  1   A A 513                                                     
SITE     1 BD9  2   G A  26   MG A3400                                          
SITE     1 BE1  3   G A  24    U A  25    A A 514                               
SITE     1 BE2  1   G A2290                                                     
SITE     1 BE3  1   U A1956                                                     
SITE     1 BE4  2   C A2710   MG A3369                                          
SITE     1 BE5  3   U A 448    A A 472   MG A3313                               
SITE     1 BE6  5   A A1672    G A1673    U A2552    G A2553                    
SITE     2 BE6  5   U A2554                                                     
SITE     1 BE7  2   A A 181    A A 182                                          
SITE     1 BE8  4   G A 953    G A 954    G A 962    U A 963                    
SITE     1 BE9  1   G A 561                                                     
SITE     1 BF1  1   G A  58                                                     
SITE     1 BF2  2   C A1607    G A1622                                          
SITE     1 BF3  2   G A 375   MG A3220                                          
SITE     1 BF4  2   A A2810    G A2811                                          
SITE     1 BF5  1   A A 945                                                     
SITE     1 BF6  2   G A 185    G A 186                                          
SITE     1 BF7  1   G A 189                                                     
SITE     1 BF8  2   A A 793    C A2072                                          
SITE     1 BF9  1   U A1662                                                     
SITE     1 BG1  1   G A 410                                                     
SITE     1 BG2  2   G A2582    G A2583                                          
SITE     1 BG3  6   A A 833    G A 834    C A 835    A A 943                    
SITE     2 BG3  6   C A 944   MG A3408                                          
SITE     1 BG4  1   G A 707                                                     
SITE     1 BG5  4   G A 775    G A 776    A A 793    A A 794                    
SITE     1 BG6  3   A A 910    A A 911   MG A3201                               
SITE     1 BG7  2   A A2051   MG A3221                                          
SITE     1 BG8  3   G A 452    A A 470  THR E  53                               
SITE     1 BG9  1   G A 379                                                     
SITE     1 BH1  1   G A2549                                                     
SITE     1 BH2  1   A A 863                                                     
SITE     1 BH3  2   C A2579    C A2611                                          
SITE     1 BH4  1   U A 554                                                     
SITE     1 BH5  1   C A 698                                                     
SITE     1 BH6  5   G A2525    G A2526    C A2527    G A2536                    
SITE     2 BH6  5   U A2537                                                     
SITE     1 BH7  2   U A 562    C A 982                                          
SITE     1 BH8  1   A A 800                                                     
SITE     1 BH9  2   A A 472   MG A3280                                          
SITE     1 BI1  1   C A1135                                                     
SITE     1 BI2  2   G A1449    G A1450                                          
SITE     1 BI3  3   U A 827    G A2067    U A2068                               
SITE     1 BI4  1   G A2494                                                     
SITE     1 BI5  2   C A1348    G A1377                                          
SITE     1 BI6  5   A A1287    G A1288    U A1326    A A1327                    
SITE     2 BI6  5 GLY O 105                                                     
SITE     1 BI7  2   A A2071    U A2243                                          
SITE     1 BI8  2   A A 371    U A 403                                          
SITE     1 BI9  2   G A 830    U A2449                                          
SITE     1 BJ1  2   G A2304    U A2305                                          
SITE     1 BJ2  1   G A1311                                                     
SITE     1 BJ3  1   G A2458                                                     
SITE     1 BJ4  1   G A2490                                                     
SITE     1 BJ5  1   G A1356                                                     
SITE     1 BJ6  4   C A1838    U A1841    G A1842    U A1898                    
SITE     1 BJ7  2   G A2289    G A2290                                          
SITE     1 BJ8  6   G A 638    U A 639    U A 646    G A 648                    
SITE     2 BJ8  6   G A 649    C A 650                                          
SITE     1 BJ9  4   G A1041    G A1042    C A1043    G A1112                    
SITE     1 BK1  2   U A1476    G A1478                                          
SITE     1 BK2  3   G A 711    G A 712    C A 719                               
SITE     1 BK3  1   A A2518                                                     
SITE     1 BK4  1   G A1622                                                     
SITE     1 BK5  2   C A 737    U A1621                                          
SITE     1 BK6  3   G A2846    U A2847    G A2848                               
SITE     1 BK7  1   G A2375                                                     
SITE     1 BK8  2   U A2022    C A2616                                          
SITE     1 BK9  4   G A 695    G A 696    U A 766    U A 767                    
SITE     1 BL1  2   U A1318    G A1331                                          
SITE     1 BL2  3   U A  62    A A  63    A A  64                               
SITE     1 BL3  1   G A 536                                                     
SITE     1 BL4  3   G A2345    G A2370    G A2371                               
SITE     1 BL5  3   C A1658    G A1659    G A1660                               
SITE     1 BL6  1  MG A3244                                                     
SITE     1 BL7  1   U A2818                                                     
SITE     1 BL8  2   U A2259   MG A3375                                          
SITE     1 BL9  3   G A 695    G A1380    C A1428                               
SITE     1 BM1  1   G A2315                                                     
SITE     1 BM2  1   G A 248                                                     
SITE     1 BM3  2   G A 248    C A 249                                          
SITE     1 BM4  1   A A1810                                                     
SITE     1 BM5  1   G A2251                                                     
SITE     1 BM6  3   U A1716    A A1717    G A1718                               
SITE     1 BM7  2   U A1720    G A1721                                          
SITE     1 BM8  1   U A1203                                                     
SITE     1 BM9  2   G A2857    G A2859                                          
SITE     1 BN1  3   G A1281    A A1286   MG A3187                               
SITE     1 BN2  2   A A2352    G A2353                                          
SITE     1 BN3  2   A A2531    U A2533                                          
SITE     1 BN4  2   U A1856    G A1857                                          
SITE     1 BN5  2   U A 779  ASP C 229                                          
SITE     1 BN6  2   C A 680    G A 776                                          
SITE     1 BN7  4   U A2696    G A2697    U A2698   MG A3279                    
SITE     1 BN8  1   G A1235                                                     
SITE     1 BN9  2   G A1715    U A1742                                          
SITE     1 BO1  2   A A1711    U A1714                                          
SITE     1 BO2  2   A A 654    A A 655                                          
SITE     1 BO3  3   A A 825    G A2428   MG A3350                               
SITE     1 BO4  1   A A1978                                                     
SITE     1 BO5  5   U A 284    G A 285    A A 354    U A 355                    
SITE     2 BO5  5   G A 356                                                     
SITE     1 BO6  4   G A 289    U A 290    G A 291    G A 350                    
SITE     1 BO7  1   G A 543                                                     
SITE     1 BO8  1   G A1823                                                     
SITE     1 BO9  1   G A2223                                                     
SITE     1 BP1  1   G A1753                                                     
SITE     1 BP2  1   G A1756                                                     
SITE     1 BP3  1   G A2255                                                     
SITE     1 BP4  2   U A1209    A A1213                                          
SITE     1 BP5  2   A A1213    A A1214                                          
SITE     1 BP6  3   G A1235    G A1236   MG A3147                               
SITE     1 BP7  2   C A1771    C A1974                                          
SITE     1 BP8  2   A A1773    U A1976                                          
SITE     1 BP9  3   G A2053    A A2577   MG A3129                               
SITE     1 BQ1  3   U A2746    U A2754    C A2755                               
SITE     1 BQ2  1   G A2029                                                     
SITE     1 BQ3  2   G A1814    C A1816                                          
SITE     1 BQ4  1   G A1814                                                     
SITE     1 BQ5  2   G A2839    U A2878                                          
SITE     1 BQ6  1   G A2877                                                     
SITE     1 BQ7  3   G A  27    C A 509   MG A3275                               
SITE     1 BQ8  3   C A 542    C A 550    G A 551                               
SITE     1 BQ9  1   U A 769                                                     
SITE     1 BR1  3   C A 249    U A2431    A A2432                               
SITE     1 BR2  3   U A2584    U A2585    G A2608                               
SITE     1 BR3  4   G A2201    U A2202    U A2220    G A2221                    
SITE     1 BR4  1   A A 670                                                     
SITE     1 BR5  4   C A 835    G A 942    A A 943   MG A3297                    
SITE     1 BR6  2   C A 835    G A 836                                          
SITE     1 BR7  1   G A2828                                                     
SITE     1 BR8  3   G A1823    G A1824  HIS C  53                               
SITE     1 BR9  2   C B  97    G B  98                                          
SITE     1 BS1  2   U B  80    U B  95                                          
SITE     1 BS2  3   A B  73    G B 100    G B 102                               
SITE     1 BS3  1   G B  76                                                     
SITE     1 BS4  2   G B 106    G B 107                                          
SITE     1 BS5  2   G B  72    G B 102                                          
SITE     1 BS6  3   G B  56    A B  57    A B  58                               
SITE     1 BS7  1   G B  84                                                     
SITE     1 BS8  3   G B  64    A B 108    A B 109                               
SITE     1 BS9  1   G B   7                                                     
SITE     1 BT1  4   A A2590  GLY C 234  GLY C 235  GLY C 237                    
SITE     1 BT2  1 GLN C  60                                                     
SITE     1 BT3  1 ASN O  11                                                     
SITE     1 BT4  2 LYS R  41  TYR R  45                                          
SITE     1 BT5  2   C A2047  ASP b  20                                          
SITE     1 BT6  4 CYS f  11  CYS f  14  CYS f  27  HIS f  33                    
CRYST1    1.000    1.000    1.000  90.00  90.00  90.00 P 1           1          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.001000  0.000000  0.000000        0.00000                         
SCALE2      0.000000  0.001000  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.001000        0.00000                         
ATOM      1  P     U 1  32     316.601 211.059 274.484  1.00189.03           P  
ATOM      2  OP1   U 1  32     317.238 212.254 273.861  1.00171.35           O  
ATOM      3  OP2   U 1  32     315.126 210.882 274.392  1.00166.09           O1-
ATOM      4  O5'   U 1  32     317.283 209.743 273.890  1.00183.80           O  
ATOM      5  C5'   U 1  32     318.468 209.195 274.461  1.00183.87           C  
ATOM      6  C4'   U 1  32     318.574 207.699 274.229  1.00190.59           C  
ATOM      7  O4'   U 1  32     317.611 206.997 275.064  1.00185.08           O  
ATOM      8  C3'   U 1  32     318.284 207.199 272.811  1.00194.28           C  
ATOM      9  O3'   U 1  32     319.400 207.337 271.932  1.00191.65           O  
ATOM     10  C2'   U 1  32     317.849 205.747 273.042  1.00187.98           C  
ATOM     11  O2'   U 1  32     318.974 204.889 273.189  1.00176.75           O  
ATOM     12  C1'   U 1  32     317.125 205.847 274.394  1.00185.84           C  
ATOM     13  N1    U 1  32     315.645 205.963 274.262  1.00176.02           N  
ATOM     14  C2    U 1  32     314.906 204.836 273.913  1.00167.24           C  
ATOM     15  O2    U 1  32     315.396 203.735 273.689  1.00159.32           O  
ATOM     16  N3    U 1  32     313.550 205.059 273.828  1.00158.78           N  
ATOM     17  C4    U 1  32     312.864 206.240 274.052  1.00152.40           C  
ATOM     18  O4    U 1  32     311.640 206.258 273.933  1.00151.37           O  
ATOM     19  C5    U 1  32     313.686 207.352 274.415  1.00150.53           C  
ATOM     20  C6    U 1  32     315.007 207.171 274.507  1.00164.28           C  
ATOM     21  P     C 1  33     319.211 207.438 270.329  1.00202.61           P  
ATOM     22  OP1   C 1  33     319.982 208.622 269.855  1.00184.46           O  
ATOM     23  OP2   C 1  33     317.761 207.335 269.997  1.00182.78           O1-
ATOM     24  O5'   C 1  33     319.946 206.130 269.778  1.00187.38           O  
ATOM     25  C5'   C 1  33     319.909 205.791 268.397  1.00189.27           C  
ATOM     26  C4'   C 1  33     319.752 204.301 268.186  1.00193.14           C  
ATOM     27  O4'   C 1  33     319.016 203.721 269.303  1.00188.15           O  
ATOM     28  C3'   C 1  33     318.957 203.885 266.948  1.00197.14           C  
ATOM     29  O3'   C 1  33     319.741 203.868 265.753  1.00196.32           O  
ATOM     30  C2'   C 1  33     318.395 202.519 267.346  1.00192.45           C  
ATOM     31  O2'   C 1  33     319.383 201.504 267.201  1.00185.16           O  
ATOM     32  C1'   C 1  33     318.130 202.719 268.844  1.00189.08           C  
ATOM     33  N1    C 1  33     316.740 203.161 269.152  1.00179.88           N  
ATOM     34  C2    C 1  33     315.601 202.330 269.029  1.00168.16           C  
ATOM     35  O2    C 1  33     315.702 201.158 268.612  1.00157.06           O  
ATOM     36  N3    C 1  33     314.388 202.859 269.358  1.00168.03           N  
ATOM     37  C4    C 1  33     314.279 204.125 269.800  1.00171.10           C  
ATOM     38  N4    C 1  33     313.078 204.614 270.118  1.00166.06           N  
ATOM     39  C5    C 1  33     315.406 204.974 269.946  1.00172.97           C  
ATOM     40  C6    C 1  33     316.588 204.445 269.620  1.00178.75           C  
ATOM     41  P     U 1  34     319.289 204.684 264.431  1.00207.10           P  
ATOM     42  OP1   U 1  34     320.402 204.616 263.445  1.00190.50           O  
ATOM     43  OP2   U 1  34     318.779 206.022 264.844  1.00185.91           O1-
ATOM     44  O5'   U 1  34     318.068 203.837 263.837  1.00187.63           O  
ATOM     45  C5'   U 1  34     318.273 202.602 263.156  1.00180.26           C  
ATOM     46  C4'   U 1  34     316.980 201.835 262.976  1.00182.89           C  
ATOM     47  O4'   U 1  34     316.351 201.622 264.275  1.00178.92           O  
ATOM     48  C3'   U 1  34     315.887 202.514 262.153  1.00190.35           C  
ATOM     49  O3'   U 1  34     316.076 202.436 260.743  1.00190.83           O  
ATOM     50  C2'   U 1  34     314.626 201.820 262.657  1.00186.41           C  
ATOM     51  O2'   U 1  34     314.521 200.506 262.120  1.00175.87           O  
ATOM     52  C1'   U 1  34     314.941 201.708 264.150  1.00180.72           C  
ATOM     53  N1    U 1  34     314.460 202.901 264.903  1.00178.05           N  
ATOM     54  C2    U 1  34     313.106 202.988 265.202  1.00175.44           C  
ATOM     55  O2    U 1  34     312.300 202.123 264.879  1.00171.16           O  
ATOM     56  N3    U 1  34     312.729 204.129 265.894  1.00171.32           N  
ATOM     57  C4    U 1  34     313.537 205.178 266.312  1.00166.08           C  
ATOM     58  O4    U 1  34     313.051 206.132 266.926  1.00160.53           O  
ATOM     59  C5    U 1  34     314.917 205.021 265.967  1.00169.50           C  
ATOM     60  C6    U 1  34     315.309 203.924 265.297  1.00177.16           C  
ATOM     61  P     G 1  35     315.483 203.580 259.765  1.00202.78           P  
ATOM     62  OP1   G 1  35     316.096 203.378 258.423  1.00186.35           O  
ATOM     63  OP2   G 1  35     315.610 204.911 260.421  1.00181.05           O1-
ATOM     64  O5'   G 1  35     313.920 203.258 259.676  1.00191.95           O  
ATOM     65  C5'   G 1  35     313.436 201.994 259.225  1.00192.10           C  
ATOM     66  C4'   G 1  35     311.942 201.854 259.432  1.00190.31           C  
ATOM     67  O4'   G 1  35     311.623 202.006 260.846  1.00184.66           O  
ATOM     68  C3'   G 1  35     311.055 202.883 258.728  1.00193.62           C  
ATOM     69  O3'   G 1  35     310.784 202.543 257.364  1.00194.15           O  
ATOM     70  C2'   G 1  35     309.799 202.904 259.603  1.00186.47           C  
ATOM     71  O2'   G 1  35     308.931 201.828 259.271  1.00174.88           O  
ATOM     72  C1'   G 1  35     310.375 202.648 261.002  1.00185.45           C  
ATOM     73  N9    G 1  35     310.566 203.891 261.796  1.00187.18           N  
ATOM     74  C8    G 1  35     311.777 204.423 262.210  1.00181.26           C  
ATOM     75  N7    G 1  35     311.669 205.526 262.908  1.00178.41           N  
ATOM     76  C5    G 1  35     310.291 205.756 262.977  1.00188.03           C  
ATOM     77  C6    G 1  35     309.557 206.820 263.610  1.00183.72           C  
ATOM     78  O6    G 1  35     309.997 207.795 264.259  1.00170.12           O  
ATOM     79  N1    G 1  35     308.167 206.656 263.421  1.00185.71           N  
ATOM     80  C2    G 1  35     307.542 205.622 262.725  1.00184.52           C  
ATOM     81  N2    G 1  35     306.189 205.655 262.664  1.00165.64           N  
ATOM     82  N3    G 1  35     308.229 204.632 262.141  1.00187.07           N  
ATOM     83  C4    G 1  35     309.587 204.752 262.298  1.00191.68           C  
ATOM     84  P     U 1  36     311.179 203.494 256.110  1.00206.77           P  
ATOM     85  OP1   U 1  36     310.065 203.386 255.130  1.00188.30           O  
ATOM     86  OP2   U 1  36     312.563 203.180 255.672  1.00192.61           O1-
ATOM     87  O5'   U 1  36     311.160 204.990 256.664  1.00186.15           O  
ATOM     88  C5'   U 1  36     310.431 206.011 255.987  1.00184.32           C  
ATOM     89  C4'   U 1  36     309.101 206.253 256.663  1.00193.48           C  
ATOM     90  O4'   U 1  36     309.266 206.047 258.089  1.00190.29           O  
ATOM     91  C3'   U 1  36     308.499 207.655 256.527  1.00193.47           C  
ATOM     92  O3'   U 1  36     307.746 207.789 255.317  1.00194.85           O  
ATOM     93  C2'   U 1  36     307.703 207.826 257.828  1.00183.75           C  
ATOM     94  O2'   U 1  36     306.410 207.235 257.731  1.00172.91           O  
ATOM     95  C1'   U 1  36     308.526 206.997 258.819  1.00185.89           C  
ATOM     96  N1    U 1  36     309.481 207.771 259.661  1.00181.65           N  
ATOM     97  C2    U 1  36     308.972 208.603 260.648  1.00175.61           C  
ATOM     98  O2    U 1  36     307.770 208.764 260.819  1.00167.53           O  
ATOM     99  N3    U 1  36     309.932 209.250 261.410  1.00171.58           N  
ATOM    100  C4    U 1  36     311.315 209.147 261.316  1.00168.86           C  
ATOM    101  O4    U 1  36     312.021 209.805 262.089  1.00157.29           O  
ATOM    102  C5    U 1  36     311.771 208.248 260.290  1.00169.16           C  
ATOM    103  C6    U 1  36     310.860 207.608 259.532  1.00176.40           C  
ATOM    104  P     U 1  37     306.558 208.869 255.097  1.00209.53           P  
ATOM    105  OP1   U 1  37     305.413 208.580 256.007  1.00188.98           O  
ATOM    106  OP2   U 1  37     306.297 208.884 253.634  1.00193.46           O1-
ATOM    107  O5'   U 1  37     307.197 210.288 255.458  1.00188.99           O  
ATOM    108  C5'   U 1  37     306.469 211.497 255.246  1.00181.53           C  
ATOM    109  C4'   U 1  37     305.570 211.810 256.421  1.00184.97           C  
ATOM    110  O4'   U 1  37     306.095 211.155 257.607  1.00181.36           O  
ATOM    111  C3'   U 1  37     305.443 213.286 256.802  1.00183.74           C  
ATOM    112  O3'   U 1  37     304.408 213.940 256.069  1.00186.19           O  
ATOM    113  C2'   U 1  37     305.200 213.240 258.313  1.00176.74           C  
ATOM    114  O2'   U 1  37     303.827 213.004 258.610  1.00164.32           O  
ATOM    115  C1'   U 1  37     306.003 212.004 258.727  1.00179.05           C  
ATOM    116  N1    U 1  37     307.391 212.289 259.189  1.00177.59           N  
ATOM    117  C2    U 1  37     307.664 213.174 260.230  1.00172.72           C  
ATOM    118  O2    U 1  37     306.816 213.829 260.825  1.00164.10           O  
ATOM    119  N3    U 1  37     309.011 213.283 260.541  1.00171.59           N  
ATOM    120  C4    U 1  37     310.091 212.622 259.970  1.00170.04           C  
ATOM    121  O4    U 1  37     311.240 212.838 260.375  1.00162.29           O  
ATOM    122  C5    U 1  37     309.728 211.718 258.921  1.00168.92           C  
ATOM    123  C6    U 1  37     308.432 211.589 258.597  1.00175.73           C  
ATOM    124  P     U 1  38     304.291 215.549 255.996  1.00189.87           P  
ATOM    125  OP1   U 1  38     303.025 215.878 255.283  1.00167.92           O1-
ATOM    126  OP2   U 1  38     305.574 216.070 255.446  1.00168.04           O  
ATOM    127  O5'   U 1  38     304.152 216.000 257.527  1.00174.40           O  
ATOM    128  C5'   U 1  38     303.299 217.068 257.931  1.00170.03           C  
ATOM    129  C4'   U 1  38     304.085 218.225 258.515  1.00170.45           C  
ATOM    130  O4'   U 1  38     305.083 217.725 259.442  1.00166.30           O  
ATOM    131  C3'   U 1  38     304.873 219.068 257.516  1.00165.71           C  
ATOM    132  O3'   U 1  38     304.066 220.073 256.921  1.00164.62           O  
ATOM    133  C2'   U 1  38     306.032 219.629 258.346  1.00156.56           C  
ATOM    134  O2'   U 1  38     305.668 220.840 258.995  1.00147.49           O  
ATOM    135  C1'   U 1  38     306.242 218.534 259.403  1.00164.71           C  
ATOM    136  N1    U 1  38     307.421 217.671 259.133  1.00164.04           N  
ATOM    137  C2    U 1  38     308.574 217.921 259.857  1.00158.99           C  
ATOM    138  O2    U 1  38     308.672 218.810 260.691  1.00155.19           O  
ATOM    139  N3    U 1  38     309.621 217.080 259.567  1.00157.34           N  
ATOM    140  C4    U 1  38     309.652 216.039 258.658  1.00158.10           C  
ATOM    141  O4    U 1  38     310.693 215.386 258.532  1.00156.13           O  
ATOM    142  C5    U 1  38     308.423 215.840 257.950  1.00160.20           C  
ATOM    143  C6    U 1  38     307.383 216.642 258.212  1.00165.28           C  
ATOM    144  P     A 1  39     304.254 220.485 255.379  1.00170.99           P  
ATOM    145  OP1   A 1  39     303.483 221.745 255.192  1.00155.13           O  
ATOM    146  OP2   A 1  39     303.983 219.320 254.495  1.00158.14           O1-
ATOM    147  O5'   A 1  39     305.804 220.829 255.268  1.00155.99           O  
ATOM    148  C5'   A 1  39     306.265 222.148 255.499  1.00153.76           C  
ATOM    149  C4'   A 1  39     306.682 222.815 254.214  1.00154.15           C  
ATOM    150  O4'   A 1  39     305.542 222.953 253.315  1.00151.20           O  
ATOM    151  C3'   A 1  39     307.202 224.234 254.354  1.00152.29           C  
ATOM    152  O3'   A 1  39     308.538 224.292 254.823  1.00153.59           O  
ATOM    153  C2'   A 1  39     306.992 224.795 252.950  1.00148.95           C  
ATOM    154  O2'   A 1  39     307.968 224.292 252.045  1.00145.30           O  
ATOM    155  C1'   A 1  39     305.646 224.166 252.589  1.00146.79           C  
ATOM    156  N9    A 1  39     304.510 225.035 252.970  1.00143.95           N  
ATOM    157  C8    A 1  39     303.408 224.633 253.692  1.00145.43           C  
ATOM    158  N7    A 1  39     302.536 225.585 253.918  1.00142.62           N  
ATOM    159  C5    A 1  39     303.096 226.700 253.305  1.00146.36           C  
ATOM    160  C6    A 1  39     302.638 228.030 253.195  1.00143.35           C  
ATOM    161  N6    A 1  39     301.478 228.449 253.724  1.00135.72           N  
ATOM    162  N1    A 1  39     303.427 228.906 252.518  1.00137.36           N  
ATOM    163  C2    A 1  39     304.589 228.465 251.996  1.00131.07           C  
ATOM    164  N3    A 1  39     305.121 227.240 252.031  1.00132.21           N  
ATOM    165  C4    A 1  39     304.319 226.386 252.709  1.00142.00           C  
ATOM    166  P     C 1  40     308.877 225.089 256.176  1.00158.20           P  
ATOM    167  OP1   C 1  40     310.340 224.956 256.434  1.00149.22           O  
ATOM    168  OP2   C 1  40     307.941 224.636 257.233  1.00148.21           O1-
ATOM    169  O5'   C 1  40     308.525 226.603 255.799  1.00157.09           O  
ATOM    170  C5'   C 1  40     309.134 227.228 254.671  1.00157.18           C  
ATOM    171  C4'   C 1  40     308.738 228.679 254.504  1.00156.02           C  
ATOM    172  O4'   C 1  40     307.369 228.779 254.044  1.00149.19           O  
ATOM    173  C3'   C 1  40     308.780 229.566 255.745  1.00166.47           C  
ATOM    174  O3'   C 1  40     310.094 230.015 256.054  1.00173.16           O  
ATOM    175  C2'   C 1  40     307.829 230.701 255.371  1.00159.92           C  
ATOM    176  O2'   C 1  40     308.480 231.667 254.538  1.00149.07           O  
ATOM    177  C1'   C 1  40     306.765 229.968 254.532  1.00155.44           C  
ATOM    178  N1    C 1  40     305.509 229.624 255.263  1.00155.15           N  
ATOM    179  C2    C 1  40     304.516 230.590 255.556  1.00147.55           C  
ATOM    180  O2    C 1  40     304.681 231.775 255.220  1.00141.91           O  
ATOM    181  N3    C 1  40     303.394 230.191 256.209  1.00139.83           N  
ATOM    182  C4    C 1  40     303.221 228.907 256.569  1.00135.77           C  
ATOM    183  N4    C 1  40     302.099 228.551 257.211  1.00126.78           N  
ATOM    184  C5    C 1  40     304.203 227.911 256.287  1.00141.55           C  
ATOM    185  C6    C 1  40     305.307 228.317 255.647  1.00150.13           C  
ATOM    186  P     C 1  41     311.034 229.292 257.160  1.00192.69           P  
ATOM    187  OP1   C 1  41     312.442 229.669 256.865  1.00167.34           O  
ATOM    188  OP2   C 1  41     310.684 227.867 257.390  1.00176.33           O1-
ATOM    189  O5'   C 1  41     310.654 230.016 258.520  1.00174.28           O  
ATOM    190  C5'   C 1  41     309.344 229.916 259.055  1.00173.27           C  
ATOM    191  C4'   C 1  41     308.716 231.272 259.168  1.00172.26           C  
ATOM    192  O4'   C 1  41     307.475 231.311 258.406  1.00164.71           O  
ATOM    193  C3'   C 1  41     308.271 231.684 260.559  1.00177.72           C  
ATOM    194  O3'   C 1  41     309.342 232.016 261.435  1.00177.70           O  
ATOM    195  C2'   C 1  41     307.269 232.780 260.239  1.00168.52           C  
ATOM    196  O2'   C 1  41     307.921 233.928 259.697  1.00155.41           O  
ATOM    197  C1'   C 1  41     306.519 232.095 259.092  1.00167.18           C  
ATOM    198  N1    C 1  41     305.445 231.190 259.589  1.00168.59           N  
ATOM    199  C2    C 1  41     304.267 231.755 260.086  1.00165.46           C  
ATOM    200  O2    C 1  41     304.140 232.987 260.097  1.00161.58           O  
ATOM    201  N3    C 1  41     303.292 230.937 260.535  1.00159.43           N  
ATOM    202  C4    C 1  41     303.452 229.606 260.511  1.00158.76           C  
ATOM    203  N4    C 1  41     302.443 228.854 260.974  1.00154.69           N  
ATOM    204  C5    C 1  41     304.646 228.991 260.017  1.00157.83           C  
ATOM    205  C6    C 1  41     305.599 229.820 259.578  1.00163.48           C  
ATOM    206  P     A 1  42     309.704 231.037 262.683  1.00196.39           P  
ATOM    207  OP1   A 1  42     308.426 230.740 263.390  1.00176.15           O  
ATOM    208  OP2   A 1  42     310.820 231.653 263.445  1.00184.72           O1-
ATOM    209  O5'   A 1  42     310.166 229.633 262.035  1.00189.73           O  
ATOM    210  C5'   A 1  42     311.364 228.918 262.389  1.00192.78           C  
ATOM    211  C4'   A 1  42     311.494 228.630 263.868  1.00194.28           C  
ATOM    212  O4'   A 1  42     311.227 227.222 264.151  1.00187.41           O  
ATOM    213  C3'   A 1  42     312.892 228.820 264.458  1.00197.16           C  
ATOM    214  O3'   A 1  42     313.368 230.166 264.568  1.00193.87           O  
ATOM    215  C2'   A 1  42     312.783 228.042 265.767  1.00190.97           C  
ATOM    216  O2'   A 1  42     312.045 228.744 266.762  1.00179.72           O  
ATOM    217  C1'   A 1  42     311.968 226.818 265.307  1.00193.18           C  
ATOM    218  N9    A 1  42     312.884 225.675 265.051  1.00192.29           N  
ATOM    219  C8    A 1  42     314.039 225.608 265.799  1.00187.42           C  
ATOM    220  N7    A 1  42     314.823 224.605 265.566  1.00181.20           N  
ATOM    221  C5    A 1  42     314.138 223.914 264.585  1.00183.67           C  
ATOM    222  C6    A 1  42     314.499 222.718 263.934  1.00168.79           C  
ATOM    223  N6    A 1  42     315.641 222.081 264.231  1.00158.20           N  
ATOM    224  N1    A 1  42     313.656 222.226 262.981  1.00164.43           N  
ATOM    225  C2    A 1  42     312.524 222.935 262.739  1.00173.34           C  
ATOM    226  N3    A 1  42     312.077 224.084 263.297  1.00183.99           N  
ATOM    227  C4    A 1  42     312.934 224.537 264.241  1.00190.23           C  
ATOM    228  P     G 1  43     314.862 230.565 264.058  1.00200.90           P  
ATOM    229  OP1   G 1  43     315.390 231.515 265.073  1.00187.21           O  
ATOM    230  OP2   G 1  43     314.835 230.973 262.631  1.00184.62           O1-
ATOM    231  O5'   G 1  43     315.716 229.209 264.116  1.00184.57           O  
ATOM    232  C5'   G 1  43     316.834 228.982 263.254  1.00174.70           C  
ATOM    233  C4'   G 1  43     317.822 227.988 263.832  1.00174.51           C  
ATOM    234  O4'   G 1  43     317.153 226.727 264.109  1.00171.11           O  
ATOM    235  C3'   G 1  43     318.965 227.602 262.911  1.00175.86           C  
ATOM    236  O3'   G 1  43     319.999 228.577 262.877  1.00174.36           O  
ATOM    237  C2'   G 1  43     319.382 226.232 263.450  1.00170.45           C  
ATOM    238  O2'   G 1  43     320.127 226.368 264.650  1.00163.94           O  
ATOM    239  C1'   G 1  43     318.013 225.644 263.804  1.00168.19           C  
ATOM    240  N9    G 1  43     317.415 224.891 262.681  1.00165.94           N  
ATOM    241  C8    G 1  43     316.312 225.303 261.966  1.00164.95           C  
ATOM    242  N7    G 1  43     315.947 224.479 261.025  1.00161.85           N  
ATOM    243  C5    G 1  43     316.872 223.446 261.115  1.00160.97           C  
ATOM    244  C6    G 1  43     316.975 222.260 260.337  1.00153.68           C  
ATOM    245  O6    G 1  43     316.247 221.886 259.399  1.00147.75           O  
ATOM    246  N1    G 1  43     318.063 221.485 260.758  1.00151.25           N  
ATOM    247  C2    G 1  43     318.938 221.796 261.781  1.00150.18           C  
ATOM    248  N2    G 1  43     319.914 220.899 262.015  1.00145.34           N  
ATOM    249  N3    G 1  43     318.843 222.898 262.516  1.00152.37           N  
ATOM    250  C4    G 1  43     317.796 223.676 262.132  1.00160.94           C  
ATOM    251  P     G 1  44     320.668 229.022 261.478  1.00187.73           P  
ATOM    252  OP1   G 1  44     321.530 230.206 261.747  1.00177.61           O  
ATOM    253  OP2   G 1  44     319.600 229.139 260.449  1.00168.92           O1-
ATOM    254  O5'   G 1  44     321.618 227.798 261.106  1.00164.11           O  
ATOM    255  C5'   G 1  44     322.697 227.436 261.957  1.00156.92           C  
ATOM    256  C4'   G 1  44     323.359 226.164 261.494  1.00163.36           C  
ATOM    257  O4'   G 1  44     322.470 225.029 261.714  1.00162.46           O  
ATOM    258  C3'   G 1  44     323.680 226.077 260.009  1.00164.50           C  
ATOM    259  O3'   G 1  44     324.813 226.831 259.595  1.00160.57           O  
ATOM    260  C2'   G 1  44     323.804 224.571 259.805  1.00164.77           C  
ATOM    261  O2'   G 1  44     325.025 224.077 260.342  1.00159.47           O  
ATOM    262  C1'   G 1  44     322.649 224.075 260.679  1.00162.09           C  
ATOM    263  N9    G 1  44     321.412 223.986 259.877  1.00151.80           N  
ATOM    264  C8    G 1  44     320.393 224.908 259.762  1.00146.50           C  
ATOM    265  N7    G 1  44     319.455 224.542 258.935  1.00141.66           N  
ATOM    266  C5    G 1  44     319.889 223.311 258.463  1.00144.45           C  
ATOM    267  C6    G 1  44     319.283 222.429 257.531  1.00145.89           C  
ATOM    268  O6    G 1  44     318.208 222.583 256.928  1.00143.52           O  
ATOM    269  N1    G 1  44     320.065 221.289 257.316  1.00145.86           N  
ATOM    270  C2    G 1  44     321.273 221.018 257.924  1.00144.53           C  
ATOM    271  N2    G 1  44     321.872 219.860 257.581  1.00138.63           N  
ATOM    272  N3    G 1  44     321.843 221.838 258.799  1.00145.77           N  
ATOM    273  C4    G 1  44     321.103 222.956 259.017  1.00147.71           C  
ATOM    274  P     U 1  45     324.862 227.458 258.108  1.00163.74           P  
ATOM    275  OP1   U 1  45     326.027 228.380 258.007  1.00150.86           O  
ATOM    276  OP2   U 1  45     323.497 227.935 257.758  1.00158.35           O1-
ATOM    277  O5'   U 1  45     325.121 226.199 257.168  1.00160.17           O  
ATOM    278  C5'   U 1  45     326.219 225.325 257.394  1.00167.96           C  
ATOM    279  C4'   U 1  45     326.158 224.110 256.495  1.00172.68           C  
ATOM    280  O4'   U 1  45     324.990 223.301 256.826  1.00162.90           O  
ATOM    281  C3'   U 1  45     326.006 224.387 255.001  1.00175.73           C  
ATOM    282  O3'   U 1  45     327.228 224.765 254.357  1.00175.43           O  
ATOM    283  C2'   U 1  45     325.393 223.081 254.488  1.00166.01           C  
ATOM    284  O2'   U 1  45     326.388 222.067 254.375  1.00151.84           O  
ATOM    285  C1'   U 1  45     324.462 222.708 255.652  1.00163.49           C  
ATOM    286  N1    U 1  45     323.054 223.173 255.468  1.00154.80           N  
ATOM    287  C2    U 1  45     322.185 222.476 254.627  1.00145.24           C  
ATOM    288  O2    U 1  45     322.500 221.486 253.985  1.00142.94           O  
ATOM    289  N3    U 1  45     320.910 222.994 254.554  1.00141.91           N  
ATOM    290  C4    U 1  45     320.393 224.100 255.205  1.00145.66           C  
ATOM    291  O4    U 1  45     319.213 224.431 255.033  1.00144.15           O  
ATOM    292  C5    U 1  45     321.334 224.761 256.057  1.00145.20           C  
ATOM    293  C6    U 1  45     322.584 224.283 256.154  1.00149.19           C  
ATOM    294  P     C 1  46     327.551 226.306 253.954  1.00185.20           P  
ATOM    295  OP1   C 1  46     329.018 226.415 253.754  1.00166.49           O  
ATOM    296  OP2   C 1  46     326.890 227.248 254.899  1.00168.39           O1-
ATOM    297  O5'   C 1  46     326.881 226.490 252.520  1.00160.90           O  
ATOM    298  C5'   C 1  46     325.610 227.107 252.380  1.00154.76           C  
ATOM    299  C4'   C 1  46     324.599 226.147 251.808  1.00153.37           C  
ATOM    300  O4'   C 1  46     323.644 225.769 252.834  1.00153.03           O  
ATOM    301  C3'   C 1  46     323.754 226.695 250.670  1.00153.28           C  
ATOM    302  O3'   C 1  46     324.427 226.561 249.429  1.00156.33           O  
ATOM    303  C2'   C 1  46     322.463 225.883 250.774  1.00151.09           C  
ATOM    304  O2'   C 1  46     322.610 224.609 250.158  1.00142.97           O  
ATOM    305  C1'   C 1  46     322.350 225.670 252.286  1.00152.87           C  
ATOM    306  N1    C 1  46     321.495 226.668 252.982  1.00156.00           N  
ATOM    307  C2    C 1  46     320.105 226.766 252.769  1.00156.58           C  
ATOM    308  O2    C 1  46     319.534 226.028 251.943  1.00149.83           O  
ATOM    309  N3    C 1  46     319.411 227.698 253.476  1.00154.39           N  
ATOM    310  C4    C 1  46     320.027 228.494 254.364  1.00152.49           C  
ATOM    311  N4    C 1  46     319.299 229.393 255.034  1.00148.71           N  
ATOM    312  C5    C 1  46     321.426 228.405 254.610  1.00149.63           C  
ATOM    313  C6    C 1  46     322.101 227.486 253.909  1.00150.02           C  
ATOM    314  P     A 1  47     324.175 227.576 248.205  1.00168.42           P  
ATOM    315  OP1   A 1  47     325.307 228.538 248.097  1.00149.93           O  
ATOM    316  OP2   A 1  47     322.776 228.064 248.287  1.00157.51           O1-
ATOM    317  O5'   A 1  47     324.269 226.613 246.946  1.00158.75           O  
ATOM    318  C5'   A 1  47     325.056 225.433 247.011  1.00157.47           C  
ATOM    319  C4'   A 1  47     324.621 224.417 245.985  1.00166.48           C  
ATOM    320  O4'   A 1  47     323.535 223.598 246.504  1.00161.44           O  
ATOM    321  C3'   A 1  47     324.061 224.978 244.685  1.00168.68           C  
ATOM    322  O3'   A 1  47     325.056 225.474 243.794  1.00165.18           O  
ATOM    323  C2'   A 1  47     323.254 223.796 244.146  1.00163.39           C  
ATOM    324  O2'   A 1  47     324.100 222.825 243.543  1.00157.52           O  
ATOM    325  C1'   A 1  47     322.677 223.213 245.444  1.00163.65           C  
ATOM    326  N9    A 1  47     321.315 223.726 245.702  1.00156.72           N  
ATOM    327  C8    A 1  47     320.850 224.548 246.708  1.00149.25           C  
ATOM    328  N7    A 1  47     319.565 224.814 246.603  1.00147.98           N  
ATOM    329  C5    A 1  47     319.161 224.132 245.453  1.00152.50           C  
ATOM    330  C6    A 1  47     317.920 223.996 244.788  1.00146.09           C  
ATOM    331  N6    A 1  47     316.781 224.568 245.191  1.00138.92           N  
ATOM    332  N1    A 1  47     317.886 223.234 243.669  1.00145.35           N  
ATOM    333  C2    A 1  47     319.015 222.651 243.243  1.00145.41           C  
ATOM    334  N3    A 1  47     320.230 222.697 243.777  1.00146.26           N  
ATOM    335  C4    A 1  47     320.235 223.458 244.892  1.00154.18           C  
ATOM    336  P     G 1  48     324.933 226.954 243.156  1.00164.56           P  
ATOM    337  OP1   G 1  48     326.051 227.132 242.197  1.00157.05           O  
ATOM    338  OP2   G 1  48     324.757 227.958 244.245  1.00150.41           O1-
ATOM    339  O5'   G 1  48     323.596 226.878 242.289  1.00157.97           O  
ATOM    340  C5'   G 1  48     323.433 225.893 241.273  1.00157.64           C  
ATOM    341  C4'   G 1  48     321.994 225.801 240.827  1.00158.25           C  
ATOM    342  O4'   G 1  48     321.165 225.353 241.936  1.00151.25           O  
ATOM    343  C3'   G 1  48     321.357 227.118 240.386  1.00159.17           C  
ATOM    344  O3'   G 1  48     321.658 227.465 239.037  1.00156.48           O  
ATOM    345  C2'   G 1  48     319.872 226.879 240.647  1.00154.68           C  
ATOM    346  O2'   G 1  48     319.287 226.112 239.600  1.00146.99           O  
ATOM    347  C1'   G 1  48     319.920 226.023 241.919  1.00150.85           C  
ATOM    348  N9    G 1  48     319.814 226.834 243.157  1.00147.51           N  
ATOM    349  C8    G 1  48     320.799 226.973 244.115  1.00143.96           C  
ATOM    350  N7    G 1  48     320.458 227.739 245.115  1.00144.26           N  
ATOM    351  C5    G 1  48     319.157 228.143 244.815  1.00150.96           C  
ATOM    352  C6    G 1  48     318.258 228.995 245.535  1.00151.26           C  
ATOM    353  O6    G 1  48     318.437 229.581 246.616  1.00147.27           O  
ATOM    354  N1    G 1  48     317.034 229.141 244.878  1.00145.39           N  
ATOM    355  C2    G 1  48     316.712 228.548 243.678  1.00144.44           C  
ATOM    356  N2    G 1  48     315.483 228.812 243.204  1.00137.34           N  
ATOM    357  N3    G 1  48     317.539 227.755 242.997  1.00146.80           N  
ATOM    358  C4    G 1  48     318.740 227.589 243.611  1.00150.14           C  
ATOM    359  P     G 1  49     322.570 228.751 238.677  1.00164.58           P  
ATOM    360  OP1   G 1  49     322.851 228.682 237.221  1.00154.81           O  
ATOM    361  OP2   G 1  49     323.726 228.827 239.613  1.00153.26           O1-
ATOM    362  O5'   G 1  49     321.623 230.010 238.949  1.00155.57           O  
ATOM    363  C5'   G 1  49     320.411 230.202 238.225  1.00155.42           C  
ATOM    364  C4'   G 1  49     319.363 230.900 239.066  1.00158.62           C  
ATOM    365  O4'   G 1  49     319.141 230.138 240.283  1.00151.65           O  
ATOM    366  C3'   G 1  49     319.713 232.306 239.555  1.00158.25           C  
ATOM    367  O3'   G 1  49     319.411 233.310 238.597  1.00158.37           O  
ATOM    368  C2'   G 1  49     318.900 232.439 240.842  1.00147.84           C  
ATOM    369  O2'   G 1  49     317.550 232.803 240.569  1.00143.74           O  
ATOM    370  C1'   G 1  49     318.920 231.006 241.373  1.00146.13           C  
ATOM    371  N9    G 1  49     319.985 230.784 242.373  1.00147.53           N  
ATOM    372  C8    G 1  49     321.161 230.061 242.255  1.00148.96           C  
ATOM    373  N7    G 1  49     321.882 230.060 243.348  1.00149.19           N  
ATOM    374  C5    G 1  49     321.130 230.830 244.237  1.00153.78           C  
ATOM    375  C6    G 1  49     321.381 231.210 245.584  1.00150.90           C  
ATOM    376  O6    G 1  49     322.362 230.918 246.292  1.00144.60           O  
ATOM    377  N1    G 1  49     320.334 231.999 246.098  1.00148.44           N  
ATOM    378  C2    G 1  49     319.196 232.392 245.420  1.00144.64           C  
ATOM    379  N2    G 1  49     318.314 233.154 246.094  1.00136.03           N  
ATOM    380  N3    G 1  49     318.962 232.051 244.160  1.00144.11           N  
ATOM    381  C4    G 1  49     319.958 231.283 243.648  1.00150.60           C  
ATOM    382  P     U 1  50     320.398 234.560 238.357  1.00169.59           P  
ATOM    383  OP1   U 1  50     319.999 235.194 237.068  1.00157.40           O  
ATOM    384  OP2   U 1  50     321.800 234.095 238.555  1.00150.81           O1-
ATOM    385  O5'   U 1  50     320.051 235.577 239.543  1.00158.22           O  
ATOM    386  C5'   U 1  50     318.723 236.045 239.762  1.00153.68           C  
ATOM    387  C4'   U 1  50     318.560 236.672 241.132  1.00155.88           C  
ATOM    388  O4'   U 1  50     318.633 235.648 242.168  1.00149.74           O  
ATOM    389  C3'   U 1  50     319.622 237.685 241.548  1.00160.15           C  
ATOM    390  O3'   U 1  50     319.446 238.972 240.978  1.00160.63           O  
ATOM    391  C2'   U 1  50     319.525 237.656 243.070  1.00154.81           C  
ATOM    392  O2'   U 1  50     318.392 238.379 243.531  1.00152.37           O  
ATOM    393  C1'   U 1  50     319.285 236.167 243.315  1.00149.39           C  
ATOM    394  N1    U 1  50     320.577 235.465 243.469  1.00149.21           N  
ATOM    395  C2    U 1  50     321.242 235.604 244.673  1.00148.56           C  
ATOM    396  O2    U 1  50     320.803 236.247 245.617  1.00144.05           O  
ATOM    397  N3    U 1  50     322.449 234.943 244.720  1.00151.80           N  
ATOM    398  C4    U 1  50     323.046 234.190 243.717  1.00154.80           C  
ATOM    399  O4    U 1  50     324.140 233.654 243.926  1.00151.92           O  
ATOM    400  C5    U 1  50     322.296 234.111 242.497  1.00151.43           C  
ATOM    401  C6    U 1  50     321.119 234.740 242.427  1.00150.23           C  
ATOM    402  P     C 1  51     320.722 239.928 240.755  1.00167.95           P  
ATOM    403  OP1   C 1  51     320.378 240.945 239.725  1.00161.44           O  
ATOM    404  OP2   C 1  51     321.910 239.052 240.564  1.00154.73           O1-
ATOM    405  O5'   C 1  51     320.903 240.662 242.156  1.00165.12           O  
ATOM    406  C5'   C 1  51     319.827 241.354 242.781  1.00168.33           C  
ATOM    407  C4'   C 1  51     320.225 241.857 244.151  1.00182.64           C  
ATOM    408  O4'   C 1  51     320.395 240.735 245.067  1.00175.11           O  
ATOM    409  C3'   C 1  51     321.554 242.607 244.226  1.00187.68           C  
ATOM    410  O3'   C 1  51     321.450 243.969 243.823  1.00186.39           O  
ATOM    411  C2'   C 1  51     321.974 242.412 245.686  1.00179.86           C  
ATOM    412  O2'   C 1  51     321.292 243.319 246.545  1.00172.72           O  
ATOM    413  C1'   C 1  51     321.460 240.995 245.968  1.00175.62           C  
ATOM    414  N1    C 1  51     322.502 239.960 245.759  1.00162.93           N  
ATOM    415  C2    C 1  51     323.600 239.810 246.626  1.00155.10           C  
ATOM    416  O2    C 1  51     323.753 240.559 247.612  1.00149.61           O  
ATOM    417  N3    C 1  51     324.497 238.833 246.343  1.00157.78           N  
ATOM    418  C4    C 1  51     324.335 238.034 245.278  1.00158.99           C  
ATOM    419  N4    C 1  51     325.237 237.081 245.033  1.00152.97           N  
ATOM    420  C5    C 1  51     323.230 238.167 244.396  1.00158.85           C  
ATOM    421  C6    C 1  51     322.352 239.126 244.682  1.00160.31           C  
ATOM    422  P     C 1  52     322.581 244.656 242.896  1.00194.11           P  
ATOM    423  OP1   C 1  52     322.093 246.021 242.554  1.00181.45           O  
ATOM    424  OP2   C 1  52     322.965 243.719 241.803  1.00175.05           O1-
ATOM    425  O5'   C 1  52     323.830 244.823 243.876  1.00187.14           O  
ATOM    426  C5'   C 1  52     323.770 245.693 245.003  1.00188.81           C  
ATOM    427  C4'   C 1  52     325.067 245.715 245.783  1.00189.89           C  
ATOM    428  O4'   C 1  52     325.254 244.454 246.496  1.00180.72           O  
ATOM    429  C3'   C 1  52     326.355 245.867 244.979  1.00191.36           C  
ATOM    430  O3'   C 1  52     326.603 247.194 244.517  1.00190.38           O  
ATOM    431  C2'   C 1  52     327.400 245.322 245.951  1.00183.64           C  
ATOM    432  O2'   C 1  52     327.682 246.266 246.976  1.00174.44           O  
ATOM    433  C1'   C 1  52     326.637 244.146 246.573  1.00181.39           C  
ATOM    434  N1    C 1  52     326.890 242.874 245.843  1.00175.39           N  
ATOM    435  C2    C 1  52     328.049 242.122 246.115  1.00169.82           C  
ATOM    436  O2    C 1  52     328.862 242.513 246.980  1.00160.17           O  
ATOM    437  N3    C 1  52     328.244 240.970 245.410  1.00170.85           N  
ATOM    438  C4    C 1  52     327.365 240.554 244.476  1.00169.37           C  
ATOM    439  N4    C 1  52     327.599 239.412 243.812  1.00157.16           N  
ATOM    440  C5    C 1  52     326.190 241.302 244.182  1.00169.13           C  
ATOM    441  C6    C 1  52     326.006 242.432 244.883  1.00173.86           C  
ATOM    442  P     G 1  53     327.184 247.464 243.028  1.00195.78           P  
ATOM    443  OP1   G 1  53     327.308 248.935 242.848  1.00180.38           O  
ATOM    444  OP2   G 1  53     326.410 246.675 242.031  1.00183.85           O1-
ATOM    445  O5'   G 1  53     328.654 246.842 243.065  1.00187.60           O  
ATOM    446  C5'   G 1  53     329.626 247.306 243.994  1.00189.42           C  
ATOM    447  C4'   G 1  53     330.919 246.524 243.904  1.00193.33           C  
ATOM    448  O4'   G 1  53     330.765 245.190 244.474  1.00184.87           O  
ATOM    449  C3'   G 1  53     331.451 246.240 242.509  1.00191.80           C  
ATOM    450  O3'   G 1  53     332.005 247.356 241.831  1.00187.70           O  
ATOM    451  C2'   G 1  53     332.428 245.104 242.780  1.00182.97           C  
ATOM    452  O2'   G 1  53     333.592 245.590 243.436  1.00177.06           O  
ATOM    453  C1'   G 1  53     331.620 244.283 243.787  1.00179.92           C  
ATOM    454  N9    G 1  53     330.810 243.258 243.090  1.00171.84           N  
ATOM    455  C8    G 1  53     329.490 243.292 242.680  1.00168.23           C  
ATOM    456  N7    G 1  53     329.107 242.203 242.058  1.00162.69           N  
ATOM    457  C5    G 1  53     330.246 241.400 242.040  1.00167.89           C  
ATOM    458  C6    G 1  53     330.472 240.093 241.507  1.00167.32           C  
ATOM    459  O6    G 1  53     329.677 239.340 240.918  1.00156.79           O  
ATOM    460  N1    G 1  53     331.793 239.680 241.720  1.00169.17           N  
ATOM    461  C2    G 1  53     332.774 240.416 242.357  1.00167.72           C  
ATOM    462  N2    G 1  53     333.987 239.853 242.471  1.00164.54           N  
ATOM    463  N3    G 1  53     332.574 241.623 242.857  1.00165.52           N  
ATOM    464  C4    G 1  53     331.303 242.046 242.664  1.00168.09           C  
ATOM    465  P     G 1  54     331.703 247.536 240.259  1.00195.81           P  
ATOM    466  OP1   G 1  54     332.617 248.587 239.737  1.00185.24           O  
ATOM    467  OP2   G 1  54     330.230 247.698 240.095  1.00178.75           O1-
ATOM    468  O5'   G 1  54     332.113 246.120 239.637  1.00186.15           O  
ATOM    469  C5'   G 1  54     331.768 245.750 238.304  1.00183.82           C  
ATOM    470  C4'   G 1  54     332.992 245.359 237.502  1.00193.07           C  
ATOM    471  O4'   G 1  54     333.989 246.408 237.616  1.00194.38           O  
ATOM    472  C3'   G 1  54     333.717 244.079 237.933  1.00192.95           C  
ATOM    473  O3'   G 1  54     333.152 242.913 237.335  1.00189.11           O  
ATOM    474  C2'   G 1  54     335.172 244.329 237.510  1.00192.56           C  
ATOM    475  O2'   G 1  54     335.386 243.936 236.158  1.00185.30           O  
ATOM    476  C1'   G 1  54     335.290 245.860 237.600  1.00197.11           C  
ATOM    477  N9    G 1  54     336.047 246.369 238.777  1.00189.32           N  
ATOM    478  C8    G 1  54     335.572 247.311 239.675  1.00180.58           C  
ATOM    479  N7    G 1  54     336.417 247.635 240.616  1.00174.80           N  
ATOM    480  C5    G 1  54     337.547 246.880 240.322  1.00181.54           C  
ATOM    481  C6    G 1  54     338.795 246.817 241.005  1.00180.05           C  
ATOM    482  O6    G 1  54     339.143 247.436 242.024  1.00174.48           O  
ATOM    483  N1    G 1  54     339.675 245.922 240.384  1.00176.33           N  
ATOM    484  C2    G 1  54     339.401 245.180 239.256  1.00175.20           C  
ATOM    485  N2    G 1  54     340.387 244.374 238.820  1.00162.64           N  
ATOM    486  N3    G 1  54     338.237 245.233 238.609  1.00182.41           N  
ATOM    487  C4    G 1  54     337.353 246.098 239.186  1.00187.30           C  
ATOM    488  P     A 1  55     333.118 241.489 238.096  1.00191.35           P  
ATOM    489  OP1   A 1  55     332.937 240.414 237.083  1.00174.57           O  
ATOM    490  OP2   A 1  55     332.160 241.593 239.228  1.00178.55           O1-
ATOM    491  O5'   A 1  55     334.580 241.326 238.706  1.00178.16           O  
ATOM    492  C5'   A 1  55     335.552 240.495 238.083  1.00176.15           C  
ATOM    493  C4'   A 1  55     336.822 240.454 238.895  1.00180.47           C  
ATOM    494  O4'   A 1  55     337.200 241.807 239.260  1.00173.05           O  
ATOM    495  C3'   A 1  55     336.746 239.710 240.226  1.00185.85           C  
ATOM    496  O3'   A 1  55     336.914 238.302 240.074  1.00189.36           O  
ATOM    497  C2'   A 1  55     337.847 240.378 241.051  1.00180.53           C  
ATOM    498  O2'   A 1  55     339.125 239.851 240.719  1.00178.94           O  
ATOM    499  C1'   A 1  55     337.788 241.819 240.545  1.00176.51           C  
ATOM    500  N9    A 1  55     337.010 242.717 241.430  1.00178.28           N  
ATOM    501  C8    A 1  55     335.683 243.075 241.330  1.00173.73           C  
ATOM    502  N7    A 1  55     335.295 243.914 242.263  1.00175.45           N  
ATOM    503  C5    A 1  55     336.435 244.137 243.040  1.00185.09           C  
ATOM    504  C6    A 1  55     336.687 244.935 244.194  1.00181.14           C  
ATOM    505  N6    A 1  55     335.769 245.699 244.807  1.00170.72           N  
ATOM    506  N1    A 1  55     337.947 244.917 244.710  1.00175.48           N  
ATOM    507  C2    A 1  55     338.880 244.156 244.109  1.00176.67           C  
ATOM    508  N3    A 1  55     338.764 243.373 243.029  1.00178.38           N  
ATOM    509  C4    A 1  55     337.503 243.401 242.531  1.00184.52           C  
ATOM    510  P     A 1  56     336.337 237.244 241.153  1.00200.04           P  
ATOM    511  OP1   A 1  56     336.696 235.882 240.669  1.00182.04           O  
ATOM    512  OP2   A 1  56     334.907 237.552 241.437  1.00179.21           O1-
ATOM    513  O5'   A 1  56     337.189 237.527 242.476  1.00184.79           O  
ATOM    514  C5'   A 1  56     338.581 237.223 242.556  1.00181.04           C  
ATOM    515  C4'   A 1  56     339.163 237.645 243.888  1.00183.42           C  
ATOM    516  O4'   A 1  56     339.111 239.096 244.010  1.00178.59           O  
ATOM    517  C3'   A 1  56     338.420 237.138 245.121  1.00187.29           C  
ATOM    518  O3'   A 1  56     338.750 235.796 245.476  1.00188.28           O  
ATOM    519  C2'   A 1  56     338.771 238.184 246.182  1.00174.95           C  
ATOM    520  O2'   A 1  56     340.069 237.954 246.719  1.00163.74           O  
ATOM    521  C1'   A 1  56     338.809 239.466 245.344  1.00176.54           C  
ATOM    522  N9    A 1  56     337.515 240.194 245.351  1.00176.07           N  
ATOM    523  C8    A 1  56     336.479 240.091 244.441  1.00171.05           C  
ATOM    524  N7    A 1  56     335.446 240.863 244.694  1.00168.56           N  
ATOM    525  C5    A 1  56     335.818 241.536 245.856  1.00176.99           C  
ATOM    526  C6    A 1  56     335.163 242.512 246.647  1.00178.30           C  
ATOM    527  N6    A 1  56     333.941 242.996 246.379  1.00170.29           N  
ATOM    528  N1    A 1  56     335.818 242.979 247.742  1.00173.31           N  
ATOM    529  C2    A 1  56     337.041 242.499 248.023  1.00171.85           C  
ATOM    530  N3    A 1  56     337.756 241.588 247.357  1.00174.18           N  
ATOM    531  C4    A 1  56     337.087 241.136 246.272  1.00178.20           C  
ATOM    532  P     G 1  57     337.735 234.568 245.176  1.00196.20           P  
ATOM    533  OP1   G 1  57     338.515 233.533 244.443  1.00177.46           O  
ATOM    534  OP2   G 1  57     336.470 235.079 244.577  1.00181.06           O1-
ATOM    535  O5'   G 1  57     337.395 233.986 246.625  1.00183.63           O  
ATOM    536  C5'   G 1  57     336.126 234.203 247.235  1.00183.12           C  
ATOM    537  C4'   G 1  57     336.091 235.501 248.017  1.00189.75           C  
ATOM    538  O4'   G 1  57     336.058 236.619 247.087  1.00183.79           O  
ATOM    539  C3'   G 1  57     334.869 235.708 248.911  1.00191.58           C  
ATOM    540  O3'   G 1  57     335.015 235.108 250.195  1.00193.38           O  
ATOM    541  C2'   G 1  57     334.720 237.230 248.945  1.00180.06           C  
ATOM    542  O2'   G 1  57     335.634 237.822 249.862  1.00166.35           O  
ATOM    543  C1'   G 1  57     335.150 237.602 247.527  1.00180.45           C  
ATOM    544  N9    G 1  57     334.018 237.602 246.576  1.00177.38           N  
ATOM    545  C8    G 1  57     333.797 236.654 245.593  1.00172.87           C  
ATOM    546  N7    G 1  57     332.728 236.882 244.882  1.00171.64           N  
ATOM    547  C5    G 1  57     332.212 238.057 245.431  1.00176.85           C  
ATOM    548  C6    G 1  57     331.052 238.798 245.076  1.00173.27           C  
ATOM    549  O6    G 1  57     330.234 238.542 244.175  1.00165.89           O  
ATOM    550  N1    G 1  57     330.897 239.930 245.892  1.00168.53           N  
ATOM    551  C2    G 1  57     331.732 240.315 246.922  1.00162.21           C  
ATOM    552  N2    G 1  57     331.394 241.437 247.586  1.00149.68           N  
ATOM    553  N3    G 1  57     332.816 239.625 247.260  1.00167.24           N  
ATOM    554  C4    G 1  57     332.994 238.522 246.480  1.00175.68           C  
ATOM    555  P     G 1  58     334.096 233.860 250.647  1.00206.92           P  
ATOM    556  OP1   G 1  58     334.993 232.745 251.062  1.00182.28           O  
ATOM    557  OP2   G 1  58     333.072 233.614 249.592  1.00186.28           O1-
ATOM    558  O5'   G 1  58     333.362 234.398 251.958  1.00183.10           O  
ATOM    559  C5'   G 1  58     331.993 234.775 251.929  1.00181.72           C  
ATOM    560  C4'   G 1  58     331.796 236.250 252.208  1.00185.77           C  
ATOM    561  O4'   G 1  58     332.101 237.022 251.010  1.00179.36           O  
ATOM    562  C3'   G 1  58     330.366 236.649 252.568  1.00187.60           C  
ATOM    563  O3'   G 1  58     330.082 236.492 253.952  1.00190.50           O  
ATOM    564  C2'   G 1  58     330.266 238.087 252.064  1.00181.92           C  
ATOM    565  O2'   G 1  58     330.880 238.995 252.969  1.00175.73           O  
ATOM    566  C1'   G 1  58     331.118 238.015 250.800  1.00178.42           C  
ATOM    567  N9    G 1  58     330.332 237.589 249.623  1.00176.78           N  
ATOM    568  C8    G 1  58     330.670 236.509 248.826  1.00170.89           C  
ATOM    569  N7    G 1  58     329.854 236.295 247.835  1.00163.76           N  
ATOM    570  C5    G 1  58     328.909 237.304 247.986  1.00173.16           C  
ATOM    571  C6    G 1  58     327.771 237.568 247.183  1.00166.86           C  
ATOM    572  O6    G 1  58     327.416 236.924 246.181  1.00152.86           O  
ATOM    573  N1    G 1  58     327.059 238.682 247.666  1.00168.05           N  
ATOM    574  C2    G 1  58     327.391 239.453 248.771  1.00165.58           C  
ATOM    575  N2    G 1  58     326.561 240.482 249.058  1.00156.55           N  
ATOM    576  N3    G 1  58     328.463 239.208 249.528  1.00169.11           N  
ATOM    577  C4    G 1  58     329.174 238.127 249.081  1.00177.46           C  
ATOM    578  P     A 1  59     329.013 235.394 254.448  1.00204.69           P  
ATOM    579  OP1   A 1  59     329.211 235.177 255.909  1.00185.36           O  
ATOM    580  OP2   A 1  59     329.101 234.220 253.532  1.00183.51           O1-
ATOM    581  O5'   A 1  59     327.599 236.104 254.205  1.00181.44           O  
ATOM    582  C5'   A 1  59     327.397 237.488 254.489  1.00170.73           C  
ATOM    583  C4'   A 1  59     326.193 238.046 253.759  1.00168.80           C  
ATOM    584  O4'   A 1  59     326.461 238.120 252.332  1.00163.58           O  
ATOM    585  C3'   A 1  59     324.903 237.236 253.859  1.00176.82           C  
ATOM    586  O3'   A 1  59     324.205 237.462 255.084  1.00176.24           O  
ATOM    587  C2'   A 1  59     324.133 237.668 252.605  1.00166.41           C  
ATOM    588  O2'   A 1  59     323.457 238.903 252.807  1.00155.83           O  
ATOM    589  C1'   A 1  59     325.269 237.898 251.598  1.00163.09           C  
ATOM    590  N9    A 1  59     325.468 236.750 250.676  1.00167.46           N  
ATOM    591  C8    A 1  59     326.458 235.789 250.738  1.00169.65           C  
ATOM    592  N7    A 1  59     326.402 234.882 249.786  1.00170.72           N  
ATOM    593  C5    A 1  59     325.295 235.260 249.025  1.00170.48           C  
ATOM    594  C6    A 1  59     324.701 234.702 247.864  1.00158.89           C  
ATOM    595  N6    A 1  59     325.149 233.602 247.238  1.00149.46           N  
ATOM    596  N1    A 1  59     323.607 235.333 247.367  1.00152.88           N  
ATOM    597  C2    A 1  59     323.146 236.437 247.985  1.00151.31           C  
ATOM    598  N3    A 1  59     323.616 237.054 249.074  1.00153.95           N  
ATOM    599  C4    A 1  59     324.707 236.412 249.560  1.00166.25           C  
ATOM    600  P     A 1  60     323.624 236.254 255.994  1.00184.88           P  
ATOM    601  OP1   A 1  60     323.637 236.747 257.400  1.00163.48           O  
ATOM    602  OP2   A 1  60     324.263 234.948 255.674  1.00167.45           O1-
ATOM    603  O5'   A 1  60     322.094 236.165 255.562  1.00167.97           O  
ATOM    604  C5'   A 1  60     321.246 237.297 255.690  1.00164.15           C  
ATOM    605  C4'   A 1  60     320.045 237.193 254.788  1.00159.84           C  
ATOM    606  O4'   A 1  60     320.424 237.451 253.409  1.00156.33           O  
ATOM    607  C3'   A 1  60     319.372 235.832 254.726  1.00159.47           C  
ATOM    608  O3'   A 1  60     318.556 235.551 255.857  1.00160.43           O  
ATOM    609  C2'   A 1  60     318.610 235.913 253.409  1.00157.50           C  
ATOM    610  O2'   A 1  60     317.415 236.667 253.557  1.00150.91           O  
ATOM    611  C1'   A 1  60     319.588 236.710 252.540  1.00158.85           C  
ATOM    612  N9    A 1  60     320.415 235.838 251.669  1.00157.12           N  
ATOM    613  C8    A 1  60     321.682 235.346 251.896  1.00150.54           C  
ATOM    614  N7    A 1  60     322.144 234.595 250.921  1.00147.70           N  
ATOM    615  C5    A 1  60     321.117 234.586 249.979  1.00151.58           C  
ATOM    616  C6    A 1  60     320.977 233.966 248.717  1.00147.18           C  
ATOM    617  N6    A 1  60     321.932 233.208 248.168  1.00143.11           N  
ATOM    618  N1    A 1  60     319.816 234.149 248.036  1.00144.33           N  
ATOM    619  C2    A 1  60     318.863 234.908 248.592  1.00144.65           C  
ATOM    620  N3    A 1  60     318.879 235.539 249.767  1.00153.84           N  
ATOM    621  C4    A 1  60     320.044 235.342 250.426  1.00157.94           C  
ATOM    622  P     G 1  61     318.602 234.103 256.568  1.00170.85           P  
ATOM    623  OP1   G 1  61     317.651 234.125 257.717  1.00157.83           O  
ATOM    624  OP2   G 1  61     320.025 233.725 256.796  1.00151.01           O1-
ATOM    625  O5'   G 1  61     318.014 233.109 255.464  1.00163.84           O  
ATOM    626  C5'   G 1  61     316.680 233.242 254.977  1.00160.96           C  
ATOM    627  C4'   G 1  61     316.549 232.742 253.555  1.00154.82           C  
ATOM    628  O4'   G 1  61     317.660 233.239 252.762  1.00155.54           O  
ATOM    629  C3'   G 1  61     316.600 231.231 253.354  1.00156.67           C  
ATOM    630  O3'   G 1  61     315.357 230.594 253.638  1.00159.89           O  
ATOM    631  C2'   G 1  61     317.059 231.114 251.903  1.00154.07           C  
ATOM    632  O2'   G 1  61     315.984 231.411 251.017  1.00147.82           O  
ATOM    633  C1'   G 1  61     318.054 232.271 251.813  1.00158.93           C  
ATOM    634  N9    G 1  61     319.476 231.889 252.064  1.00161.92           N  
ATOM    635  C8    G 1  61     320.270 232.120 253.179  1.00155.61           C  
ATOM    636  N7    G 1  61     321.504 231.683 253.070  1.00148.54           N  
ATOM    637  C5    G 1  61     321.559 231.133 251.794  1.00153.02           C  
ATOM    638  C6    G 1  61     322.626 230.500 251.087  1.00146.89           C  
ATOM    639  O6    G 1  61     323.793 230.277 251.447  1.00140.22           O  
ATOM    640  N1    G 1  61     322.210 230.103 249.814  1.00152.51           N  
ATOM    641  C2    G 1  61     320.947 230.281 249.283  1.00155.77           C  
ATOM    642  N2    G 1  61     320.735 229.823 248.041  1.00151.32           N  
ATOM    643  N3    G 1  61     319.952 230.864 249.927  1.00157.01           N  
ATOM    644  C4    G 1  61     320.321 231.261 251.166  1.00160.78           C  
ATOM    645  P     C 1  62     315.232 228.991 253.808  1.00174.26           P  
ATOM    646  OP1   C 1  62     314.418 228.663 255.007  1.00159.96           O  
ATOM    647  OP2   C 1  62     316.552 228.342 253.594  1.00156.88           O1-
ATOM    648  O5'   C 1  62     314.324 228.577 252.577  1.00152.76           O  
ATOM    649  C5'   C 1  62     313.237 229.385 252.164  1.00144.07           C  
ATOM    650  C4'   C 1  62     312.824 228.948 250.795  1.00140.23           C  
ATOM    651  O4'   C 1  62     313.748 229.506 249.817  1.00141.25           O  
ATOM    652  C3'   C 1  62     312.948 227.452 250.585  1.00145.00           C  
ATOM    653  O3'   C 1  62     311.896 226.684 251.155  1.00141.38           O  
ATOM    654  C2'   C 1  62     313.096 227.354 249.075  1.00145.27           C  
ATOM    655  O2'   C 1  62     311.851 227.605 248.439  1.00140.50           O  
ATOM    656  C1'   C 1  62     314.011 228.551 248.804  1.00141.23           C  
ATOM    657  N1    C 1  62     315.455 228.179 248.829  1.00145.22           N  
ATOM    658  C2    C 1  62     315.977 227.300 247.863  1.00146.44           C  
ATOM    659  O2    C 1  62     315.228 226.834 246.989  1.00140.44           O  
ATOM    660  N3    C 1  62     317.296 226.957 247.898  1.00147.01           N  
ATOM    661  C4    C 1  62     318.121 227.440 248.829  1.00140.98           C  
ATOM    662  N4    C 1  62     319.410 227.068 248.804  1.00133.47           N  
ATOM    663  C5    C 1  62     317.629 228.338 249.819  1.00143.07           C  
ATOM    664  C6    C 1  62     316.321 228.665 249.773  1.00147.20           C  
ATOM    665  P     A 1  63     312.253 225.362 252.009  1.00144.42           P  
ATOM    666  OP1   A 1  63     311.011 224.801 252.594  1.00139.13           O  
ATOM    667  OP2   A 1  63     313.401 225.665 252.902  1.00141.64           O1-
ATOM    668  O5'   A 1  63     312.752 224.326 250.906  1.00142.94           O  
ATOM    669  C5'   A 1  63     311.825 223.731 250.005  1.00139.92           C  
ATOM    670  C4'   A 1  63     312.501 223.101 248.808  1.00145.22           C  
ATOM    671  O4'   A 1  63     313.532 223.985 248.291  1.00139.14           O  
ATOM    672  C3'   A 1  63     313.222 221.779 249.049  1.00152.21           C  
ATOM    673  O3'   A 1  63     312.342 220.659 249.057  1.00152.24           O  
ATOM    674  C2'   A 1  63     314.249 221.747 247.918  1.00145.55           C  
ATOM    675  O2'   A 1  63     313.660 221.328 246.693  1.00139.77           O  
ATOM    676  C1'   A 1  63     314.617 223.227 247.799  1.00139.79           C  
ATOM    677  N9    A 1  63     315.826 223.568 248.580  1.00143.33           N  
ATOM    678  C8    A 1  63     315.961 224.480 249.609  1.00138.63           C  
ATOM    679  N7    A 1  63     317.179 224.554 250.098  1.00139.33           N  
ATOM    680  C5    A 1  63     317.900 223.627 249.342  1.00147.03           C  
ATOM    681  C6    A 1  63     319.257 223.217 249.356  1.00144.71           C  
ATOM    682  N6    A 1  63     320.175 223.706 250.196  1.00141.21           N  
ATOM    683  N1    A 1  63     319.647 222.263 248.467  1.00139.79           N  
ATOM    684  C2    A 1  63     318.735 221.756 247.622  1.00139.60           C  
ATOM    685  N3    A 1  63     317.441 222.064 247.507  1.00142.61           N  
ATOM    686  C4    A 1  63     317.077 223.012 248.404  1.00147.58           C  
ATOM    687  P     G 1  64     312.307 219.626 250.298  1.00161.58           P  
ATOM    688  OP1   G 1  64     311.144 218.716 250.099  1.00145.35           O  
ATOM    689  OP2   G 1  64     312.415 220.387 251.571  1.00152.16           O1-
ATOM    690  O5'   G 1  64     313.629 218.758 250.103  1.00155.61           O  
ATOM    691  C5'   G 1  64     313.792 217.949 248.945  1.00159.80           C  
ATOM    692  C4'   G 1  64     315.189 217.390 248.824  1.00164.88           C  
ATOM    693  O4'   G 1  64     316.110 218.435 248.400  1.00158.83           O  
ATOM    694  C3'   G 1  64     315.800 216.848 250.111  1.00169.14           C  
ATOM    695  O3'   G 1  64     315.372 215.530 250.434  1.00169.15           O  
ATOM    696  C2'   G 1  64     317.296 216.979 249.848  1.00165.48           C  
ATOM    697  O2'   G 1  64     317.759 215.948 248.985  1.00161.02           O  
ATOM    698  C1'   G 1  64     317.339 218.306 249.089  1.00160.72           C  
ATOM    699  N9    G 1  64     317.447 219.443 250.020  1.00154.51           N  
ATOM    700  C8    G 1  64     316.444 220.339 250.326  1.00149.70           C  
ATOM    701  N7    G 1  64     316.802 221.245 251.192  1.00147.70           N  
ATOM    702  C5    G 1  64     318.125 220.922 251.480  1.00155.72           C  
ATOM    703  C6    G 1  64     319.043 221.560 252.358  1.00153.76           C  
ATOM    704  O6    G 1  64     318.827 222.561 253.059  1.00145.86           O  
ATOM    705  N1    G 1  64     320.289 220.912 252.358  1.00151.40           N  
ATOM    706  C2    G 1  64     320.609 219.793 251.606  1.00151.02           C  
ATOM    707  N2    G 1  64     321.856 219.306 251.737  1.00140.11           N  
ATOM    708  N3    G 1  64     319.755 219.194 250.782  1.00149.41           N  
ATOM    709  C4    G 1  64     318.543 219.808 250.769  1.00155.17           C  
ATOM    710  P     C 1  65     314.944 215.161 251.944  1.00185.50           P  
ATOM    711  OP1   C 1  65     314.275 213.828 251.937  1.00168.03           O  
ATOM    712  OP2   C 1  65     314.239 216.342 252.521  1.00162.64           O1-
ATOM    713  O5'   C 1  65     316.337 215.004 252.707  1.00171.75           O  
ATOM    714  C5'   C 1  65     317.362 214.150 252.208  1.00168.91           C  
ATOM    715  C4'   C 1  65     318.665 214.352 252.949  1.00169.06           C  
ATOM    716  O4'   C 1  65     319.222 215.659 252.620  1.00161.91           O  
ATOM    717  C3'   C 1  65     318.570 214.357 254.474  1.00169.25           C  
ATOM    718  O3'   C 1  65     318.533 213.047 255.036  1.00169.05           O  
ATOM    719  C2'   C 1  65     319.785 215.193 254.881  1.00161.56           C  
ATOM    720  O2'   C 1  65     320.986 214.435 254.809  1.00153.82           O  
ATOM    721  C1'   C 1  65     319.816 216.240 253.764  1.00158.80           C  
ATOM    722  N1    C 1  65     319.047 217.461 254.110  1.00154.16           N  
ATOM    723  C2    C 1  65     319.627 218.441 254.931  1.00149.39           C  
ATOM    724  O2    C 1  65     320.784 218.281 255.367  1.00142.53           O  
ATOM    725  N3    C 1  65     318.887 219.545 255.223  1.00151.05           N  
ATOM    726  C4    C 1  65     317.638 219.691 254.740  1.00154.02           C  
ATOM    727  N4    C 1  65     316.957 220.798 255.055  1.00152.40           N  
ATOM    728  C5    C 1  65     317.026 218.713 253.905  1.00147.26           C  
ATOM    729  C6    C 1  65     317.769 217.635 253.625  1.00151.07           C  
ATOM    730  P     C 1  66     317.607 212.697 256.314  1.00170.97           P  
ATOM    731  OP1   C 1  66     317.523 211.213 256.403  1.00155.32           O  
ATOM    732  OP2   C 1  66     316.336 213.459 256.233  1.00157.03           O1-
ATOM    733  O5'   C 1  66     318.430 213.290 257.553  1.00164.75           O  
ATOM    734  C5'   C 1  66     319.775 212.894 257.821  1.00167.27           C  
ATOM    735  C4'   C 1  66     320.470 213.811 258.822  1.00167.01           C  
ATOM    736  O4'   C 1  66     320.682 215.130 258.240  1.00158.53           O  
ATOM    737  C3'   C 1  66     319.740 214.088 260.124  1.00161.98           C  
ATOM    738  O3'   C 1  66     319.856 213.022 261.049  1.00158.65           O  
ATOM    739  C2'   C 1  66     320.383 215.409 260.585  1.00154.45           C  
ATOM    740  O2'   C 1  66     321.673 215.199 261.154  1.00145.43           O  
ATOM    741  C1'   C 1  66     320.563 216.123 259.244  1.00156.05           C  
ATOM    742  N1    C 1  66     319.413 217.009 258.903  1.00159.28           N  
ATOM    743  C2    C 1  66     319.326 218.287 259.479  1.00157.60           C  
ATOM    744  O2    C 1  66     320.223 218.680 260.250  1.00149.58           O  
ATOM    745  N3    C 1  66     318.244 219.048 259.155  1.00156.48           N  
ATOM    746  C4    C 1  66     317.285 218.604 258.311  1.00154.65           C  
ATOM    747  N4    C 1  66     316.237 219.396 258.029  1.00146.77           N  
ATOM    748  C5    C 1  66     317.353 217.306 257.722  1.00155.18           C  
ATOM    749  C6    C 1  66     318.421 216.564 258.052  1.00159.75           C  
ATOM    750  P     A 1  67     318.629 212.617 262.021  1.00165.68           P  
ATOM    751  OP1   A 1  67     319.224 211.802 263.134  1.00160.75           O  
ATOM    752  OP2   A 1  67     317.496 212.048 261.216  1.00163.15           O1-
ATOM    753  O5'   A 1  67     318.118 214.016 262.603  1.00160.44           O  
ATOM    754  C5'   A 1  67     317.994 214.238 264.004  1.00168.08           C  
ATOM    755  C4'   A 1  67     318.767 215.468 264.439  1.00179.26           C  
ATOM    756  O4'   A 1  67     318.896 216.409 263.328  1.00168.87           O  
ATOM    757  C3'   A 1  67     318.166 216.304 265.568  1.00182.02           C  
ATOM    758  O3'   A 1  67     318.348 215.743 266.874  1.00177.52           O  
ATOM    759  C2'   A 1  67     318.822 217.676 265.353  1.00170.19           C  
ATOM    760  O2'   A 1  67     320.145 217.701 265.872  1.00163.19           O  
ATOM    761  C1'   A 1  67     318.904 217.738 263.822  1.00167.65           C  
ATOM    762  N9    A 1  67     317.791 218.518 263.215  1.00167.07           N  
ATOM    763  C8    A 1  67     317.449 219.796 263.593  1.00160.24           C  
ATOM    764  N7    A 1  67     316.444 220.305 262.918  1.00156.43           N  
ATOM    765  C5    A 1  67     316.060 219.300 262.038  1.00159.22           C  
ATOM    766  C6    A 1  67     315.039 219.228 261.055  1.00152.72           C  
ATOM    767  N6    A 1  67     314.185 220.228 260.790  1.00145.97           N  
ATOM    768  N1    A 1  67     314.924 218.071 260.348  1.00149.86           N  
ATOM    769  C2    A 1  67     315.766 217.059 260.614  1.00150.08           C  
ATOM    770  N3    A 1  67     316.766 217.022 261.503  1.00159.68           N  
ATOM    771  C4    A 1  67     316.876 218.180 262.207  1.00166.33           C  
ATOM    772  P     A 1  68     317.102 215.122 267.707  1.00178.68           P  
ATOM    773  OP1   A 1  68     317.529 214.883 269.112  1.00168.55           O  
ATOM    774  OP2   A 1  68     316.574 213.954 266.954  1.00157.28           O1-
ATOM    775  O5'   A 1  68     315.986 216.270 267.675  1.00172.45           O  
ATOM    776  C5'   A 1  68     316.240 217.588 268.154  1.00170.29           C  
ATOM    777  C4'   A 1  68     315.216 218.574 267.632  1.00171.22           C  
ATOM    778  O4'   A 1  68     315.410 218.771 266.204  1.00163.12           O  
ATOM    779  C3'   A 1  68     313.757 218.147 267.752  1.00178.48           C  
ATOM    780  O3'   A 1  68     313.213 218.344 269.054  1.00181.08           O  
ATOM    781  C2'   A 1  68     313.086 218.955 266.642  1.00167.64           C  
ATOM    782  O2'   A 1  68     312.937 220.318 267.023  1.00160.34           O  
ATOM    783  C1'   A 1  68     314.156 218.881 265.553  1.00163.76           C  
ATOM    784  N9    A 1  68     313.973 217.721 264.638  1.00167.42           N  
ATOM    785  C8    A 1  68     314.670 216.526 264.597  1.00164.49           C  
ATOM    786  N7    A 1  68     314.308 215.674 263.667  1.00154.61           N  
ATOM    787  C5    A 1  68     313.281 216.348 263.026  1.00161.18           C  
ATOM    788  C6    A 1  68     312.462 215.990 261.928  1.00159.70           C  
ATOM    789  N6    A 1  68     312.548 214.828 261.250  1.00151.85           N  
ATOM    790  N1    A 1  68     311.529 216.905 261.548  1.00164.41           N  
ATOM    791  C2    A 1  68     311.426 218.075 262.203  1.00166.79           C  
ATOM    792  N3    A 1  68     312.136 218.520 263.238  1.00166.38           N  
ATOM    793  C4    A 1  68     313.058 217.604 263.609  1.00169.03           C  
ATOM    794  P     G 1  69     312.402 217.165 269.807  1.00194.39           P  
ATOM    795  OP1   G 1  69     312.599 217.345 271.271  1.00180.31           O  
ATOM    796  OP2   G 1  69     312.730 215.845 269.199  1.00170.62           O1-
ATOM    797  O5'   G 1  69     310.872 217.463 269.457  1.00178.34           O  
ATOM    798  C5'   G 1  69     310.268 218.716 269.757  1.00174.68           C  
ATOM    799  C4'   G 1  69     309.174 219.047 268.767  1.00176.73           C  
ATOM    800  O4'   G 1  69     309.729 219.059 267.424  1.00174.71           O  
ATOM    801  C3'   G 1  69     308.019 218.056 268.687  1.00178.53           C  
ATOM    802  O3'   G 1  69     307.057 218.236 269.724  1.00177.43           O  
ATOM    803  C2'   G 1  69     307.486 218.279 267.268  1.00174.04           C  
ATOM    804  O2'   G 1  69     306.682 219.450 267.196  1.00167.87           O  
ATOM    805  C1'   G 1  69     308.790 218.543 266.501  1.00175.79           C  
ATOM    806  N9    G 1  69     309.346 217.314 265.884  1.00173.14           N  
ATOM    807  C8    G 1  69     310.495 216.628 266.237  1.00170.88           C  
ATOM    808  N7    G 1  69     310.739 215.570 265.512  1.00163.19           N  
ATOM    809  C5    G 1  69     309.681 215.548 264.614  1.00167.35           C  
ATOM    810  C6    G 1  69     309.400 214.627 263.568  1.00164.67           C  
ATOM    811  O6    G 1  69     310.047 213.620 263.222  1.00159.47           O  
ATOM    812  N1    G 1  69     308.221 214.978 262.900  1.00163.92           N  
ATOM    813  C2    G 1  69     307.412 216.059 263.182  1.00162.25           C  
ATOM    814  N2    G 1  69     306.316 216.206 262.414  1.00153.12           N  
ATOM    815  N3    G 1  69     307.670 216.923 264.156  1.00165.56           N  
ATOM    816  C4    G 1  69     308.811 216.611 264.825  1.00170.38           C  
ATOM    817  P     G 1  70     306.106 217.023 270.215  1.00182.25           P  
ATOM    818  OP1   G 1  70     305.301 217.519 271.368  1.00169.68           O  
ATOM    819  OP2   G 1  70     306.922 215.791 270.409  1.00170.14           O1-
ATOM    820  O5'   G 1  70     305.120 216.779 268.983  1.00170.18           O  
ATOM    821  C5'   G 1  70     305.192 215.588 268.212  1.00166.57           C  
ATOM    822  C4'   G 1  70     304.012 215.458 267.283  1.00171.08           C  
ATOM    823  O4'   G 1  70     304.451 215.656 265.911  1.00166.84           O  
ATOM    824  C3'   G 1  70     303.327 214.091 267.282  1.00174.09           C  
ATOM    825  O3'   G 1  70     302.346 213.983 268.305  1.00171.73           O  
ATOM    826  C2'   G 1  70     302.766 213.991 265.866  1.00167.46           C  
ATOM    827  O2'   G 1  70     301.549 214.724 265.746  1.00159.16           O  
ATOM    828  C1'   G 1  70     303.853 214.703 265.060  1.00168.62           C  
ATOM    829  N9    G 1  70     304.927 213.783 264.631  1.00168.79           N  
ATOM    830  C8    G 1  70     306.184 213.780 265.194  1.00164.01           C  
ATOM    831  N7    G 1  70     306.983 212.895 264.682  1.00165.09           N  
ATOM    832  C5    G 1  70     306.209 212.260 263.714  1.00171.42           C  
ATOM    833  C6    G 1  70     306.562 211.189 262.831  1.00169.98           C  
ATOM    834  O6    G 1  70     307.653 210.597 262.733  1.00165.22           O  
ATOM    835  N1    G 1  70     305.494 210.823 262.001  1.00165.77           N  
ATOM    836  C2    G 1  70     304.248 211.411 262.018  1.00163.24           C  
ATOM    837  N2    G 1  70     303.360 210.910 261.143  1.00152.29           N  
ATOM    838  N3    G 1  70     303.907 212.408 262.837  1.00167.05           N  
ATOM    839  C4    G 1  70     304.925 212.790 263.660  1.00171.14           C  
ATOM    840  P     C 1  71     302.392 212.800 269.401  1.00176.92           P  
ATOM    841  OP1   C 1  71     301.198 212.983 270.269  1.00162.76           O  
ATOM    842  OP2   C 1  71     303.743 212.744 270.025  1.00162.92           O1-
ATOM    843  O5'   C 1  71     302.192 211.467 268.545  1.00173.08           O  
ATOM    844  C5'   C 1  71     301.065 211.303 267.692  1.00168.03           C  
ATOM    845  C4'   C 1  71     301.245 210.154 266.725  1.00172.73           C  
ATOM    846  O4'   C 1  71     302.273 210.468 265.742  1.00170.05           O  
ATOM    847  C3'   C 1  71     301.711 208.829 267.312  1.00182.16           C  
ATOM    848  O3'   C 1  71     300.694 208.114 268.004  1.00176.81           O  
ATOM    849  C2'   C 1  71     302.270 208.110 266.082  1.00178.79           C  
ATOM    850  O2'   C 1  71     301.221 207.597 265.271  1.00170.26           O  
ATOM    851  C1'   C 1  71     302.921 209.273 265.326  1.00172.53           C  
ATOM    852  N1    C 1  71     304.390 209.379 265.568  1.00172.72           N  
ATOM    853  C2    C 1  71     305.282 208.654 264.744  1.00168.67           C  
ATOM    854  O2    C 1  71     304.828 207.929 263.830  1.00156.28           O  
ATOM    855  N3    C 1  71     306.629 208.770 264.977  1.00174.24           N  
ATOM    856  C4    C 1  71     307.115 209.552 265.966  1.00174.82           C  
ATOM    857  N4    C 1  71     308.447 209.627 266.146  1.00161.88           N  
ATOM    858  C5    C 1  71     306.231 210.293 266.814  1.00174.69           C  
ATOM    859  C6    C 1  71     304.907 210.174 266.576  1.00175.64           C  
ATOM    860  P     A 1  72     301.082 207.032 269.136  1.00181.39           P  
ATOM    861  OP1   A 1  72     299.895 206.868 270.020  1.00166.08           O  
ATOM    862  OP2   A 1  72     302.384 207.437 269.742  1.00171.82           O1-
ATOM    863  O5'   A 1  72     301.291 205.679 268.308  1.00178.11           O  
ATOM    864  C5'   A 1  72     302.366 204.784 268.585  1.00180.69           C  
ATOM    865  C4'   A 1  72     302.834 204.064 267.336  1.00186.32           C  
ATOM    866  O4'   A 1  72     303.496 205.012 266.447  1.00180.02           O  
ATOM    867  C3'   A 1  72     303.875 202.961 267.544  1.00191.88           C  
ATOM    868  O3'   A 1  72     303.326 201.707 267.940  1.00192.39           O  
ATOM    869  C2'   A 1  72     304.604 202.940 266.204  1.00184.54           C  
ATOM    870  O2'   A 1  72     303.825 202.305 265.196  1.00176.34           O  
ATOM    871  C1'   A 1  72     304.659 204.431 265.894  1.00179.46           C  
ATOM    872  N9    A 1  72     305.827 205.062 266.549  1.00186.37           N  
ATOM    873  C8    A 1  72     305.820 206.064 267.501  1.00181.26           C  
ATOM    874  N7    A 1  72     307.016 206.423 267.919  1.00181.44           N  
ATOM    875  C5    A 1  72     307.885 205.594 267.204  1.00188.71           C  
ATOM    876  C6    A 1  72     309.301 205.468 267.182  1.00179.49           C  
ATOM    877  N6    A 1  72     310.139 206.208 267.924  1.00172.67           N  
ATOM    878  N1    A 1  72     309.837 204.535 266.351  1.00176.67           N  
ATOM    879  C2    A 1  72     309.010 203.787 265.596  1.00182.99           C  
ATOM    880  N3    A 1  72     307.674 203.812 265.523  1.00186.88           N  
ATOM    881  C4    A 1  72     307.161 204.747 266.360  1.00192.02           C  
ATOM    882  P     G 1  73     304.048 200.807 269.074  1.00204.00           P  
ATOM    883  OP1   G 1  73     303.020 199.911 269.667  1.00185.35           O  
ATOM    884  OP2   G 1  73     304.823 201.711 269.973  1.00185.87           O1-
ATOM    885  O5'   G 1  73     305.105 199.915 268.264  1.00197.39           O  
ATOM    886  C5'   G 1  73     304.713 199.044 267.200  1.00200.14           C  
ATOM    887  C4'   G 1  73     305.901 198.313 266.594  1.00203.13           C  
ATOM    888  O4'   G 1  73     306.749 199.255 265.867  1.00194.26           O  
ATOM    889  C3'   G 1  73     306.847 197.629 267.587  1.00203.86           C  
ATOM    890  O3'   G 1  73     306.404 196.333 267.989  1.00201.34           O  
ATOM    891  C2'   G 1  73     308.188 197.639 266.848  1.00195.67           C  
ATOM    892  O2'   G 1  73     308.256 196.587 265.892  1.00187.62           O  
ATOM    893  C1'   G 1  73     308.115 198.976 266.106  1.00192.72           C  
ATOM    894  N9    G 1  73     308.653 200.095 266.912  1.00186.55           N  
ATOM    895  C8    G 1  73     307.850 201.064 267.476  1.00184.52           C  
ATOM    896  N7    G 1  73     308.493 201.963 268.159  1.00179.17           N  
ATOM    897  C5    G 1  73     309.818 201.573 268.033  1.00178.40           C  
ATOM    898  C6    G 1  73     310.970 202.193 268.571  1.00169.11           C  
ATOM    899  O6    G 1  73     311.009 203.215 269.262  1.00166.55           O  
ATOM    900  N1    G 1  73     312.134 201.506 268.236  1.00165.49           N  
ATOM    901  C2    G 1  73     312.186 200.363 267.475  1.00167.23           C  
ATOM    902  N2    G 1  73     313.417 199.864 267.273  1.00159.52           N  
ATOM    903  N3    G 1  73     311.109 199.770 266.958  1.00174.85           N  
ATOM    904  C4    G 1  73     309.955 200.423 267.270  1.00182.60           C  
ATOM    905  P     A 1  74     306.439 195.874 269.540  1.00209.04           P  
ATOM    906  OP1   A 1  74     305.710 194.579 269.638  1.00186.42           O1-
ATOM    907  OP2   A 1  74     306.005 197.016 270.392  1.00189.80           O  
ATOM    908  O5'   A 1  74     307.987 195.597 269.822  1.00192.00           O  
ATOM    909  C5'   A 1  74     308.506 195.568 271.148  1.00186.61           C  
ATOM    910  C4'   A 1  74     309.938 196.050 271.197  1.00186.14           C  
ATOM    911  O4'   A 1  74     310.045 197.355 270.566  1.00184.62           O  
ATOM    912  C3'   A 1  74     310.527 196.263 272.588  1.00184.71           C  
ATOM    913  O3'   A 1  74     310.969 195.059 273.194  1.00173.70           O  
ATOM    914  C2'   A 1  74     311.648 197.272 272.333  1.00183.23           C  
ATOM    915  O2'   A 1  74     312.818 196.620 271.853  1.00171.63           O  
ATOM    916  C1'   A 1  74     311.057 198.119 271.196  1.00184.71           C  
ATOM    917  N9    A 1  74     310.489 199.417 271.651  1.00183.65           N  
ATOM    918  C8    A 1  74     309.158 199.802 271.702  1.00178.89           C  
ATOM    919  N7    A 1  74     308.955 201.027 272.139  1.00173.66           N  
ATOM    920  C5    A 1  74     310.243 201.500 272.391  1.00181.43           C  
ATOM    921  C6    A 1  74     310.727 202.738 272.874  1.00174.03           C  
ATOM    922  N6    A 1  74     309.936 203.768 273.205  1.00164.91           N  
ATOM    923  N1    A 1  74     312.073 202.877 273.007  1.00169.21           N  
ATOM    924  C2    A 1  74     312.880 201.854 272.681  1.00170.12           C  
ATOM    925  N3    A 1  74     312.545 200.648 272.216  1.00174.30           N  
ATOM    926  C4    A 1  74     311.200 200.527 272.090  1.00183.99           C  
TER     927        A 1  74                                                      
ATOM    928  P     C 2  74     199.303 235.438 233.708  1.00109.15           P  
ATOM    929  OP1   C 2  74     198.210 234.938 232.833  1.00110.57           O  
ATOM    930  OP2   C 2  74     199.366 234.999 235.126  1.00113.84           O1-
ATOM    931  O5'   C 2  74     200.725 235.127 233.045  1.00113.86           O  
ATOM    932  C5'   C 2  74     200.844 234.768 231.671  1.00118.57           C  
ATOM    933  C4'   C 2  74     201.622 235.801 230.886  1.00116.46           C  
ATOM    934  O4'   C 2  74     200.980 237.095 231.021  1.00119.18           O  
ATOM    935  C3'   C 2  74     203.056 236.041 231.332  1.00108.56           C  
ATOM    936  O3'   C 2  74     203.955 235.092 230.780  1.00108.86           O  
ATOM    937  C2'   C 2  74     203.329 237.480 230.886  1.00104.10           C  
ATOM    938  O2'   C 2  74     203.708 237.527 229.517  1.00103.81           O  
ATOM    939  C1'   C 2  74     201.948 238.125 231.025  1.00108.60           C  
ATOM    940  N1    C 2  74     201.767 238.940 232.254  1.00 93.66           N  
ATOM    941  C2    C 2  74     202.448 240.152 232.401  1.00 85.16           C  
ATOM    942  O2    C 2  74     203.234 240.506 231.507  1.00 85.15           O  
ATOM    943  N3    C 2  74     202.248 240.896 233.520  1.00 78.76           N  
ATOM    944  C4    C 2  74     201.392 240.481 234.455  1.00 76.15           C  
ATOM    945  N4    C 2  74     201.225 241.239 235.536  1.00 76.33           N  
ATOM    946  C5    C 2  74     200.667 239.265 234.330  1.00 82.89           C  
ATOM    947  C6    C 2  74     200.881 238.543 233.223  1.00 91.89           C  
ATOM    948  P     C 2  75     205.296 234.704 231.575  1.00116.31           P  
ATOM    949  OP1   C 2  75     206.140 233.790 230.754  1.00100.72           O  
ATOM    950  OP2   C 2  75     204.901 234.338 232.964  1.00113.35           O1-
ATOM    951  O5'   C 2  75     206.076 236.080 231.640  1.00101.29           O  
ATOM    952  C5'   C 2  75     207.044 236.412 230.663  1.00 94.66           C  
ATOM    953  C4'   C 2  75     208.030 237.375 231.253  1.00 93.36           C  
ATOM    954  O4'   C 2  75     207.325 238.588 231.614  1.00 87.45           O  
ATOM    955  C3'   C 2  75     208.673 236.914 232.554  1.00 94.60           C  
ATOM    956  O3'   C 2  75     209.803 236.063 232.353  1.00 95.26           O  
ATOM    957  C2'   C 2  75     209.020 238.235 233.247  1.00 85.13           C  
ATOM    958  O2'   C 2  75     210.241 238.758 232.742  1.00 85.13           O  
ATOM    959  C1'   C 2  75     207.890 239.152 232.776  1.00 79.75           C  
ATOM    960  N1    C 2  75     206.833 239.378 233.794  1.00 75.65           N  
ATOM    961  C2    C 2  75     206.747 240.674 234.307  1.00 73.56           C  
ATOM    962  O2    C 2  75     207.543 241.521 233.885  1.00 76.14           O  
ATOM    963  N3    C 2  75     205.817 240.993 235.226  1.00 70.92           N  
ATOM    964  C4    C 2  75     204.983 240.051 235.639  1.00 69.57           C  
ATOM    965  N4    C 2  75     204.079 240.405 236.551  1.00 74.75           N  
ATOM    966  C5    C 2  75     205.039 238.712 235.144  1.00 76.66           C  
ATOM    967  C6    C 2  75     205.970 238.413 234.229  1.00 77.28           C  
ATOM    968  P     A 2  76     209.660 234.467 232.130  1.00 98.26           P  
ATOM    969  OP1   A 2  76     209.984 234.196 230.705  1.00 94.67           O  
ATOM    970  OP2   A 2  76     208.377 233.967 232.685  1.00101.40           O1-
ATOM    971  O5'   A 2  76     210.841 233.843 232.999  1.00 84.80           O  
ATOM    972  C5'   A 2  76     210.941 234.085 234.399  1.00 81.33           C  
ATOM    973  C4'   A 2  76     211.796 235.295 234.685  1.00 82.82           C  
ATOM    974  O4'   A 2  76     210.918 236.412 234.976  1.00 81.10           O  
ATOM    975  C3'   A 2  76     212.761 235.174 235.870  1.00 89.79           C  
ATOM    976  O3'   A 2  76     214.000 235.830 235.578  1.00 78.59           O  
ATOM    977  C2'   A 2  76     212.031 235.910 236.993  1.00 86.90           C  
ATOM    978  O2'   A 2  76     212.895 236.492 237.947  1.00 79.45           O  
ATOM    979  C1'   A 2  76     211.241 236.977 236.229  1.00 79.06           C  
ATOM    980  N9    A 2  76     209.980 237.367 236.874  1.00 69.57           N  
ATOM    981  C8    A 2  76     208.997 236.542 237.353  1.00 68.10           C  
ATOM    982  N7    A 2  76     207.982 237.185 237.873  1.00 68.53           N  
ATOM    983  C5    A 2  76     208.307 238.525 237.722  1.00 64.33           C  
ATOM    984  C6    A 2  76     207.637 239.717 238.070  1.00 63.41           C  
ATOM    985  N6    A 2  76     206.447 239.764 238.670  1.00 65.58           N  
ATOM    986  N1    A 2  76     208.231 240.891 237.781  1.00 62.67           N  
ATOM    987  C2    A 2  76     209.423 240.853 237.179  1.00 67.73           C  
ATOM    988  N3    A 2  76     210.151 239.801 236.805  1.00 69.01           N  
ATOM    989  C4    A 2  76     209.532 238.649 237.105  1.00 65.96           C  
TER     990        A 2  76                                                      
ATOM    991  P     G A   1     269.214 239.628 310.177  1.00142.38           P  
ATOM    992  OP1   G A   1     270.069 239.990 311.339  1.00131.60           O  
ATOM    993  OP2   G A   1     267.742 239.821 310.253  1.00132.46           O1-
ATOM    994  O5'   G A   1     269.486 238.096 309.822  1.00145.77           O  
ATOM    995  C5'   G A   1     270.778 237.647 309.431  1.00149.80           C  
ATOM    996  C4'   G A   1     271.152 236.340 310.104  1.00155.49           C  
ATOM    997  O4'   G A   1     271.234 236.539 311.547  1.00152.07           O  
ATOM    998  C3'   G A   1     270.170 235.178 309.938  1.00151.83           C  
ATOM    999  O3'   G A   1     270.301 234.483 308.700  1.00145.68           O  
ATOM   1000  C2'   G A   1     270.453 234.323 311.174  1.00143.89           C  
ATOM   1001  O2'   G A   1     271.628 233.539 311.003  1.00131.05           O  
ATOM   1002  C1'   G A   1     270.727 235.406 312.227  1.00152.98           C  
ATOM   1003  N9    G A   1     269.486 235.816 312.926  1.00147.72           N  
ATOM   1004  C8    G A   1     268.970 237.095 313.040  1.00140.12           C  
ATOM   1005  N7    G A   1     267.842 237.142 313.700  1.00138.43           N  
ATOM   1006  C5    G A   1     267.593 235.816 314.047  1.00140.99           C  
ATOM   1007  C6    G A   1     266.513 235.237 314.773  1.00135.53           C  
ATOM   1008  O6    G A   1     265.528 235.803 315.274  1.00132.10           O  
ATOM   1009  N1    G A   1     266.667 233.852 314.892  1.00133.18           N  
ATOM   1010  C2    G A   1     267.717 233.118 314.380  1.00130.60           C  
ATOM   1011  N2    G A   1     267.703 231.794 314.588  1.00130.75           N  
ATOM   1012  N3    G A   1     268.722 233.645 313.707  1.00131.83           N  
ATOM   1013  C4    G A   1     268.598 234.987 313.578  1.00141.95           C  
ATOM   1014  P     G A   2     269.003 234.159 307.792  1.00144.47           P  
ATOM   1015  OP1   G A   2     269.398 234.061 306.362  1.00136.55           O  
ATOM   1016  OP2   G A   2     267.921 235.101 308.185  1.00135.88           O1-
ATOM   1017  O5'   G A   2     268.572 232.697 308.242  1.00128.74           O  
ATOM   1018  C5'   G A   2     269.506 231.629 308.267  1.00119.93           C  
ATOM   1019  C4'   G A   2     268.986 230.518 309.130  1.00119.85           C  
ATOM   1020  O4'   G A   2     268.858 231.000 310.496  1.00126.69           O  
ATOM   1021  C3'   G A   2     267.587 230.035 308.776  1.00122.47           C  
ATOM   1022  O3'   G A   2     267.569 229.095 307.712  1.00124.68           O  
ATOM   1023  C2'   G A   2     267.080 229.477 310.098  1.00126.79           C  
ATOM   1024  O2'   G A   2     267.628 228.188 310.338  1.00131.19           O  
ATOM   1025  C1'   G A   2     267.699 230.458 311.094  1.00128.26           C  
ATOM   1026  N9    G A   2     266.780 231.566 311.430  1.00128.63           N  
ATOM   1027  C8    G A   2     267.001 232.912 311.244  1.00129.06           C  
ATOM   1028  N7    G A   2     266.003 233.658 311.640  1.00126.91           N  
ATOM   1029  C5    G A   2     265.062 232.752 312.118  1.00128.89           C  
ATOM   1030  C6    G A   2     263.772 232.976 312.677  1.00127.34           C  
ATOM   1031  O6    G A   2     263.190 234.056 312.868  1.00123.64           O  
ATOM   1032  N1    G A   2     263.153 231.773 313.031  1.00127.19           N  
ATOM   1033  C2    G A   2     263.702 230.517 312.867  1.00123.96           C  
ATOM   1034  N2    G A   2     262.940 229.486 313.275  1.00121.42           N  
ATOM   1035  N3    G A   2     264.903 230.299 312.349  1.00121.24           N  
ATOM   1036  C4    G A   2     265.526 231.452 311.998  1.00127.08           C  
ATOM   1037  P     U A   3     266.577 229.298 306.458  1.00133.77           P  
ATOM   1038  OP1   U A   3     267.128 228.549 305.300  1.00131.45           O  
ATOM   1039  OP2   U A   3     266.294 230.752 306.336  1.00130.64           O1-
ATOM   1040  O5'   U A   3     265.229 228.567 306.885  1.00120.82           O  
ATOM   1041  C5'   U A   3     265.212 227.177 307.165  1.00118.76           C  
ATOM   1042  C4'   U A   3     264.084 226.836 308.100  1.00122.51           C  
ATOM   1043  O4'   U A   3     264.104 227.737 309.237  1.00122.00           O  
ATOM   1044  C3'   U A   3     262.685 226.995 307.525  1.00124.49           C  
ATOM   1045  O3'   U A   3     262.287 225.870 306.754  1.00123.82           O  
ATOM   1046  C2'   U A   3     261.828 227.216 308.769  1.00120.88           C  
ATOM   1047  O2'   U A   3     261.510 225.979 309.392  1.00121.18           O  
ATOM   1048  C1'   U A   3     262.787 227.983 309.683  1.00119.73           C  
ATOM   1049  N1    U A   3     262.533 229.442 309.681  1.00115.79           N  
ATOM   1050  C2    U A   3     261.472 229.886 310.446  1.00116.34           C  
ATOM   1051  O2    U A   3     260.762 229.134 311.095  1.00115.10           O  
ATOM   1052  N3    U A   3     261.270 231.245 310.424  1.00114.36           N  
ATOM   1053  C4    U A   3     262.010 232.180 309.733  1.00109.87           C  
ATOM   1054  O4    U A   3     261.700 233.369 309.816  1.00105.89           O  
ATOM   1055  C5    U A   3     263.092 231.639 308.966  1.00113.56           C  
ATOM   1056  C6    U A   3     263.312 230.319 308.967  1.00114.24           C  
ATOM   1057  P     U A   4     261.724 226.055 305.258  1.00131.12           P  
ATOM   1058  OP1   U A   4     261.707 224.710 304.625  1.00114.30           O  
ATOM   1059  OP2   U A   4     262.493 227.158 304.620  1.00125.78           O1-
ATOM   1060  O5'   U A   4     260.214 226.541 305.464  1.00126.02           O  
ATOM   1061  C5'   U A   4     259.186 225.615 305.797  1.00122.41           C  
ATOM   1062  C4'   U A   4     258.064 226.234 306.611  1.00121.63           C  
ATOM   1063  O4'   U A   4     258.582 227.017 307.725  1.00118.62           O  
ATOM   1064  C3'   U A   4     257.129 227.202 305.902  1.00119.06           C  
ATOM   1065  O3'   U A   4     256.206 226.565 305.030  1.00117.49           O  
ATOM   1066  C2'   U A   4     256.478 227.927 307.079  1.00112.89           C  
ATOM   1067  O2'   U A   4     255.485 227.115 307.695  1.00103.81           O  
ATOM   1068  C1'   U A   4     257.667 228.057 308.039  1.00113.37           C  
ATOM   1069  N1    U A   4     258.341 229.369 307.880  1.00110.51           N  
ATOM   1070  C2    U A   4     257.729 230.463 308.471  1.00105.71           C  
ATOM   1071  O2    U A   4     256.696 230.378 309.118  1.00100.70           O  
ATOM   1072  N3    U A   4     258.376 231.658 308.278  1.00104.60           N  
ATOM   1073  C4    U A   4     259.543 231.855 307.568  1.00106.70           C  
ATOM   1074  O4    U A   4     260.003 232.990 307.489  1.00106.36           O  
ATOM   1075  C5    U A   4     260.117 230.681 306.981  1.00107.02           C  
ATOM   1076  C6    U A   4     259.505 229.507 307.153  1.00108.19           C  
ATOM   1077  P     A A   5     255.739 227.285 303.665  1.00117.23           P  
ATOM   1078  OP1   A A   5     255.092 226.256 302.804  1.00109.94           O  
ATOM   1079  OP2   A A   5     256.879 228.091 303.140  1.00101.74           O1-
ATOM   1080  O5'   A A   5     254.603 228.301 304.134  1.00108.74           O  
ATOM   1081  C5'   A A   5     253.527 227.894 304.974  1.00102.18           C  
ATOM   1082  C4'   A A   5     252.844 229.093 305.584  1.00 99.42           C  
ATOM   1083  O4'   A A   5     253.737 229.722 306.544  1.00103.03           O  
ATOM   1084  C3'   A A   5     252.500 230.217 304.614  1.00 99.84           C  
ATOM   1085  O3'   A A   5     251.307 229.986 303.875  1.00 95.04           O  
ATOM   1086  C2'   A A   5     252.439 231.436 305.527  1.00 98.15           C  
ATOM   1087  O2'   A A   5     251.217 231.455 306.251  1.00 95.42           O  
ATOM   1088  C1'   A A   5     253.572 231.128 306.510  1.00100.07           C  
ATOM   1089  N9    A A   5     254.857 231.770 306.133  1.00 97.03           N  
ATOM   1090  C8    A A   5     256.010 231.186 305.662  1.00 96.82           C  
ATOM   1091  N7    A A   5     256.993 232.018 305.426  1.00 89.94           N  
ATOM   1092  C5    A A   5     256.458 233.246 305.766  1.00 85.76           C  
ATOM   1093  C6    A A   5     256.982 234.544 305.750  1.00 85.33           C  
ATOM   1094  N6    A A   5     258.216 234.828 305.356  1.00 91.49           N  
ATOM   1095  N1    A A   5     256.204 235.568 306.151  1.00 87.77           N  
ATOM   1096  C2    A A   5     254.959 235.280 306.539  1.00 91.20           C  
ATOM   1097  N3    A A   5     254.347 234.099 306.607  1.00 92.60           N  
ATOM   1098  C4    A A   5     255.157 233.110 306.202  1.00 90.52           C  
ATOM   1099  P     A A   6     251.278 230.187 302.276  1.00 94.38           P  
ATOM   1100  OP1   A A   6     250.288 229.228 301.731  1.00 96.09           O  
ATOM   1101  OP2   A A   6     252.663 230.190 301.743  1.00 95.04           O1-
ATOM   1102  O5'   A A   6     250.687 231.648 302.074  1.00 87.76           O  
ATOM   1103  C5'   A A   6     249.415 231.990 302.596  1.00 85.19           C  
ATOM   1104  C4'   A A   6     249.380 233.438 302.983  1.00 84.78           C  
ATOM   1105  O4'   A A   6     250.420 233.688 303.964  1.00 84.08           O  
ATOM   1106  C3'   A A   6     249.686 234.418 301.860  1.00 87.29           C  
ATOM   1107  O3'   A A   6     248.557 234.698 301.038  1.00 87.65           O  
ATOM   1108  C2'   A A   6     250.214 235.628 302.617  1.00 86.86           C  
ATOM   1109  O2'   A A   6     249.142 236.357 303.194  1.00 90.45           O  
ATOM   1110  C1'   A A   6     250.990 234.960 303.750  1.00 82.25           C  
ATOM   1111  N9    A A   6     252.415 234.792 303.416  1.00 82.58           N  
ATOM   1112  C8    A A   6     253.055 233.663 302.984  1.00 87.12           C  
ATOM   1113  N7    A A   6     254.340 233.823 302.767  1.00 88.41           N  
ATOM   1114  C5    A A   6     254.566 235.154 303.071  1.00 83.82           C  
ATOM   1115  C6    A A   6     255.719 235.960 303.044  1.00 80.12           C  
ATOM   1116  N6    A A   6     256.923 235.532 302.685  1.00 80.91           N  
ATOM   1117  N1    A A   6     255.600 237.252 303.409  1.00 81.78           N  
ATOM   1118  C2    A A   6     254.384 237.678 303.772  1.00 84.03           C  
ATOM   1119  N3    A A   6     253.223 237.025 303.839  1.00 80.74           N  
ATOM   1120  C4    A A   6     253.385 235.753 303.470  1.00 81.08           C  
ATOM   1121  P     G A   7     248.687 234.727 299.430  1.00 90.39           P  
ATOM   1122  OP1   G A   7     247.349 234.468 298.840  1.00 78.60           O  
ATOM   1123  OP2   G A   7     249.828 233.863 299.055  1.00 95.00           O1-
ATOM   1124  O5'   G A   7     249.088 236.230 299.101  1.00 75.47           O  
ATOM   1125  C5'   G A   7     248.257 237.285 299.537  1.00 75.16           C  
ATOM   1126  C4'   G A   7     249.042 238.523 299.874  1.00 78.07           C  
ATOM   1127  O4'   G A   7     250.055 238.246 300.869  1.00 78.53           O  
ATOM   1128  C3'   G A   7     249.821 239.150 298.740  1.00 79.34           C  
ATOM   1129  O3'   G A   7     248.994 239.889 297.868  1.00 81.06           O  
ATOM   1130  C2'   G A   7     250.851 240.002 299.475  1.00 79.80           C  
ATOM   1131  O2'   G A   7     250.285 241.228 299.913  1.00 79.30           O  
ATOM   1132  C1'   G A   7     251.138 239.137 300.704  1.00 77.84           C  
ATOM   1133  N9    G A   7     252.381 238.366 300.561  1.00 79.01           N  
ATOM   1134  C8    G A   7     252.483 236.999 300.513  1.00 78.34           C  
ATOM   1135  N7    G A   7     253.714 236.594 300.390  1.00 82.26           N  
ATOM   1136  C5    G A   7     254.463 237.764 300.356  1.00 81.80           C  
ATOM   1137  C6    G A   7     255.861 237.935 300.234  1.00 79.18           C  
ATOM   1138  O6    G A   7     256.716 237.057 300.130  1.00 82.08           O  
ATOM   1139  N1    G A   7     256.226 239.272 300.238  1.00 76.04           N  
ATOM   1140  C2    G A   7     255.342 240.315 300.348  1.00 76.92           C  
ATOM   1141  N2    G A   7     255.898 241.534 300.334  1.00 83.10           N  
ATOM   1142  N3    G A   7     254.026 240.178 300.466  1.00 73.33           N  
ATOM   1143  C4    G A   7     253.659 238.876 300.462  1.00 78.91           C  
ATOM   1144  P     C A   8     249.009 239.551 296.307  1.00 84.20           P  
ATOM   1145  OP1   C A   8     247.689 239.950 295.738  1.00 73.50           O  
ATOM   1146  OP2   C A   8     249.477 238.141 296.219  1.00 79.58           O1-
ATOM   1147  O5'   C A   8     250.146 240.513 295.740  1.00 78.91           O  
ATOM   1148  C5'   C A   8     250.146 241.886 296.093  1.00 76.11           C  
ATOM   1149  C4'   C A   8     251.527 242.479 296.078  1.00 76.07           C  
ATOM   1150  O4'   C A   8     252.297 242.011 297.215  1.00 75.66           O  
ATOM   1151  C3'   C A   8     252.403 242.127 294.891  1.00 78.92           C  
ATOM   1152  O3'   C A   8     252.073 242.825 293.705  1.00 84.90           O  
ATOM   1153  C2'   C A   8     253.785 242.451 295.424  1.00 78.25           C  
ATOM   1154  O2'   C A   8     253.997 243.855 295.455  1.00 76.71           O  
ATOM   1155  C1'   C A   8     253.663 241.944 296.859  1.00 76.06           C  
ATOM   1156  N1    C A   8     254.113 240.542 296.933  1.00 76.13           N  
ATOM   1157  C2    C A   8     255.488 240.326 296.965  1.00 76.55           C  
ATOM   1158  O2    C A   8     256.247 241.302 296.967  1.00 80.00           O  
ATOM   1159  N3    C A   8     255.964 239.070 297.010  1.00 76.67           N  
ATOM   1160  C4    C A   8     255.110 238.055 297.007  1.00 77.59           C  
ATOM   1161  N4    C A   8     255.631 236.831 297.052  1.00 82.04           N  
ATOM   1162  C5    C A   8     253.698 238.240 296.958  1.00 77.40           C  
ATOM   1163  C6    C A   8     253.243 239.494 296.915  1.00 77.45           C  
ATOM   1164  P     G A   9     252.132 242.066 292.287  1.00 94.28           P  
ATOM   1165  OP1   G A   9     251.338 242.862 291.322  1.00 96.17           O  
ATOM   1166  OP2   G A   9     251.782 240.638 292.497  1.00 86.39           O1-
ATOM   1167  O5'   G A   9     253.668 242.137 291.864  1.00 88.09           O  
ATOM   1168  C5'   G A   9     254.426 243.326 292.042  1.00 85.84           C  
ATOM   1169  C4'   G A   9     255.892 243.007 292.153  1.00 86.70           C  
ATOM   1170  O4'   G A   9     256.107 242.094 293.252  1.00 86.70           O  
ATOM   1171  C3'   G A   9     256.482 242.304 290.943  1.00 92.39           C  
ATOM   1172  O3'   G A   9     256.938 243.242 289.987  1.00 95.86           O  
ATOM   1173  C2'   G A   9     257.627 241.470 291.520  1.00 90.82           C  
ATOM   1174  O2'   G A   9     258.829 242.222 291.545  1.00 92.36           O  
ATOM   1175  C1'   G A   9     257.180 241.229 292.963  1.00 86.68           C  
ATOM   1176  N9    G A   9     256.796 239.833 293.249  1.00 79.04           N  
ATOM   1177  C8    G A   9     255.549 239.376 293.586  1.00 79.74           C  
ATOM   1178  N7    G A   9     255.520 238.092 293.811  1.00 80.86           N  
ATOM   1179  C5    G A   9     256.832 237.678 293.624  1.00 78.88           C  
ATOM   1180  C6    G A   9     257.417 236.386 293.733  1.00 80.85           C  
ATOM   1181  O6    G A   9     256.883 235.310 294.022  1.00 82.91           O  
ATOM   1182  N1    G A   9     258.775 236.402 293.464  1.00 77.17           N  
ATOM   1183  C2    G A   9     259.482 237.523 293.130  1.00 79.21           C  
ATOM   1184  N2    G A   9     260.788 237.341 292.904  1.00 83.36           N  
ATOM   1185  N3    G A   9     258.959 238.732 293.026  1.00 78.58           N  
ATOM   1186  C4    G A   9     257.635 238.741 293.284  1.00 76.27           C  
ATOM   1187  P     A A  10     256.138 243.522 288.625  1.00103.71           P  
ATOM   1188  OP1   A A  10     255.268 244.704 288.852  1.00 96.72           O  
ATOM   1189  OP2   A A  10     255.523 242.250 288.161  1.00 99.09           O1-
ATOM   1190  O5'   A A  10     257.301 243.947 287.617  1.00102.29           O  
ATOM   1191  C5'   A A  10     258.403 243.081 287.362  1.00103.79           C  
ATOM   1192  C4'   A A  10     259.738 243.763 287.565  1.00102.85           C  
ATOM   1193  O4'   A A  10     260.221 243.493 288.911  1.00 97.31           O  
ATOM   1194  C3'   A A  10     260.870 243.277 286.663  1.00105.71           C  
ATOM   1195  O3'   A A  10     260.868 243.876 285.379  1.00111.76           O  
ATOM   1196  C2'   A A  10     262.105 243.593 287.490  1.00 97.17           C  
ATOM   1197  O2'   A A  10     262.382 244.985 287.463  1.00 92.86           O  
ATOM   1198  C1'   A A  10     261.609 243.230 288.883  1.00 94.78           C  
ATOM   1199  N9    A A  10     261.784 241.792 289.122  1.00 86.52           N  
ATOM   1200  C8    A A  10     260.813 240.844 289.287  1.00 83.08           C  
ATOM   1201  N7    A A  10     261.282 239.636 289.457  1.00 86.13           N  
ATOM   1202  C5    A A  10     262.653 239.808 289.388  1.00 86.29           C  
ATOM   1203  C6    A A  10     263.724 238.908 289.489  1.00 90.07           C  
ATOM   1204  N6    A A  10     263.582 237.598 289.692  1.00 87.29           N  
ATOM   1205  N1    A A  10     264.970 239.405 289.374  1.00 95.41           N  
ATOM   1206  C2    A A  10     265.112 240.721 289.171  1.00 99.38           C  
ATOM   1207  N3    A A  10     264.187 241.667 289.056  1.00 93.10           N  
ATOM   1208  C4    A A  10     262.970 241.132 289.175  1.00 85.80           C  
ATOM   1209  P     C A  11     260.644 242.976 284.063  1.00121.95           P  
ATOM   1210  OP1   C A  11     260.179 243.870 282.970  1.00123.59           O  
ATOM   1211  OP2   C A  11     259.812 241.804 284.432  1.00107.70           O1-
ATOM   1212  O5'   C A  11     262.101 242.427 283.714  1.00113.87           O  
ATOM   1213  C5'   C A  11     263.234 243.283 283.697  1.00109.58           C  
ATOM   1214  C4'   C A  11     264.493 242.501 283.967  1.00111.92           C  
ATOM   1215  O4'   C A  11     264.405 241.923 285.298  1.00106.92           O  
ATOM   1216  C3'   C A  11     264.740 241.303 283.054  1.00118.02           C  
ATOM   1217  O3'   C A  11     265.345 241.647 281.809  1.00117.16           O  
ATOM   1218  C2'   C A  11     265.598 240.385 283.926  1.00113.54           C  
ATOM   1219  O2'   C A  11     266.958 240.803 283.928  1.00106.56           O  
ATOM   1220  C1'   C A  11     265.007 240.645 285.315  1.00111.04           C  
ATOM   1221  N1    C A  11     263.977 239.643 285.689  1.00105.50           N  
ATOM   1222  C2    C A  11     264.387 238.436 286.277  1.00106.21           C  
ATOM   1223  O2    C A  11     265.596 238.234 286.471  1.00104.37           O  
ATOM   1224  N3    C A  11     263.454 237.516 286.620  1.00 97.60           N  
ATOM   1225  C4    C A  11     262.162 237.758 286.398  1.00 94.18           C  
ATOM   1226  N4    C A  11     261.282 236.817 286.755  1.00 84.84           N  
ATOM   1227  C5    C A  11     261.719 238.977 285.804  1.00 97.09           C  
ATOM   1228  C6    C A  11     262.647 239.884 285.473  1.00 98.78           C  
ATOM   1229  P     U A  12     264.602 241.372 280.399  1.00117.79           P  
ATOM   1230  OP1   U A  12     265.016 242.471 279.484  1.00109.01           O  
ATOM   1231  OP2   U A  12     263.156 241.118 280.641  1.00106.62           O1-
ATOM   1232  O5'   U A  12     265.253 240.020 279.852  1.00108.42           O  
ATOM   1233  C5'   U A  12     265.381 238.868 280.676  1.00104.51           C  
ATOM   1234  C4'   U A  12     264.863 237.620 280.003  1.00109.09           C  
ATOM   1235  O4'   U A  12     263.619 237.195 280.629  1.00104.89           O  
ATOM   1236  C3'   U A  12     264.509 237.716 278.519  1.00109.19           C  
ATOM   1237  O3'   U A  12     265.637 237.692 277.646  1.00103.34           O  
ATOM   1238  C2'   U A  12     263.558 236.532 278.339  1.00104.05           C  
ATOM   1239  O2'   U A  12     264.267 235.305 278.202  1.00 96.26           O  
ATOM   1240  C1'   U A  12     262.807 236.531 279.678  1.00103.88           C  
ATOM   1241  N1    U A  12     261.506 237.232 279.565  1.00 97.34           N  
ATOM   1242  C2    U A  12     260.487 236.551 278.915  1.00 86.03           C  
ATOM   1243  O2    U A  12     260.623 235.432 278.464  1.00 83.68           O  
ATOM   1244  N3    U A  12     259.293 237.215 278.793  1.00 78.38           N  
ATOM   1245  C4    U A  12     259.026 238.481 279.257  1.00 85.86           C  
ATOM   1246  O4    U A  12     257.899 238.950 279.079  1.00 81.83           O  
ATOM   1247  C5    U A  12     260.131 239.128 279.915  1.00 95.82           C  
ATOM   1248  C6    U A  12     261.310 238.507 280.047  1.00 98.02           C  
ATOM   1249  P     A A  13     265.559 238.342 276.170  1.00 82.47           P  
ATOM   1250  OP1   A A  13     266.642 237.760 275.338  1.00 81.63           O  
ATOM   1251  OP2   A A  13     265.477 239.819 276.308  1.00 77.51           O1-
ATOM   1252  O5'   A A  13     264.174 237.808 275.594  1.00 78.46           O  
ATOM   1253  C5'   A A  13     264.105 236.615 274.822  1.00 71.00           C  
ATOM   1254  C4'   A A  13     263.180 236.804 273.648  1.00 70.03           C  
ATOM   1255  O4'   A A  13     261.869 237.180 274.156  1.00 68.11           O  
ATOM   1256  C3'   A A  13     263.598 237.906 272.670  1.00 76.14           C  
ATOM   1257  O3'   A A  13     263.325 237.514 271.316  1.00 70.80           O  
ATOM   1258  C2'   A A  13     262.721 239.095 273.091  1.00 69.04           C  
ATOM   1259  O2'   A A  13     262.450 240.038 272.073  1.00 63.06           O  
ATOM   1260  C1'   A A  13     261.451 238.405 273.581  1.00 60.85           C  
ATOM   1261  N9    A A  13     260.732 239.169 274.608  1.00 58.87           N  
ATOM   1262  C8    A A  13     261.271 239.704 275.746  1.00 64.96           C  
ATOM   1263  N7    A A  13     260.412 240.348 276.497  1.00 68.41           N  
ATOM   1264  C5    A A  13     259.214 240.235 275.814  1.00 59.11           C  
ATOM   1265  C6    A A  13     257.918 240.704 276.085  1.00 54.91           C  
ATOM   1266  N6    A A  13     257.599 241.413 277.162  1.00 56.70           N  
ATOM   1267  N1    A A  13     256.936 240.423 275.213  1.00 53.34           N  
ATOM   1268  C2    A A  13     257.261 239.712 274.135  1.00 54.31           C  
ATOM   1269  N3    A A  13     258.442 239.220 273.768  1.00 58.69           N  
ATOM   1270  C4    A A  13     259.398 239.513 274.656  1.00 58.40           C  
ATOM   1271  P     A A  14     264.426 236.707 270.442  1.00 82.71           P  
ATOM   1272  OP1   A A  14     265.400 236.081 271.377  1.00 75.03           O  
ATOM   1273  OP2   A A  14     264.932 237.567 269.334  1.00 68.42           O1-
ATOM   1274  O5'   A A  14     263.569 235.565 269.732  1.00 78.26           O  
ATOM   1275  C5'   A A  14     263.921 234.187 269.816  1.00 75.46           C  
ATOM   1276  C4'   A A  14     262.814 233.332 269.255  1.00 61.24           C  
ATOM   1277  O4'   A A  14     261.812 233.108 270.281  1.00 57.36           O  
ATOM   1278  C3'   A A  14     262.050 233.958 268.095  1.00 63.61           C  
ATOM   1279  O3'   A A  14     262.689 233.728 266.840  1.00 71.28           O  
ATOM   1280  C2'   A A  14     260.674 233.308 268.200  1.00 58.17           C  
ATOM   1281  O2'   A A  14     260.682 232.027 267.593  1.00 60.67           O  
ATOM   1282  C1'   A A  14     260.522 233.123 269.717  1.00 57.49           C  
ATOM   1283  N9    A A  14     259.750 234.212 270.349  1.00 57.29           N  
ATOM   1284  C8    A A  14     260.234 235.129 271.237  1.00 58.05           C  
ATOM   1285  N7    A A  14     259.343 235.995 271.642  1.00 56.92           N  
ATOM   1286  C5    A A  14     258.186 235.630 270.986  1.00 50.80           C  
ATOM   1287  C6    A A  14     256.896 236.170 270.994  1.00 48.41           C  
ATOM   1288  N6    A A  14     256.554 237.221 271.731  1.00 52.41           N  
ATOM   1289  N1    A A  14     255.952 235.585 270.240  1.00 46.80           N  
ATOM   1290  C2    A A  14     256.316 234.525 269.520  1.00 47.96           C  
ATOM   1291  N3    A A  14     257.501 233.925 269.420  1.00 55.08           N  
ATOM   1292  C4    A A  14     258.416 234.531 270.190  1.00 55.11           C  
ATOM   1293  P     G A  15     263.479 234.885 266.026  1.00 82.78           P  
ATOM   1294  OP1   G A  15     264.357 234.170 265.065  1.00 79.90           O  
ATOM   1295  OP2   G A  15     264.074 235.929 266.911  1.00 67.78           O1-
ATOM   1296  O5'   G A  15     262.352 235.550 265.128  1.00 67.66           O  
ATOM   1297  C5'   G A  15     261.863 236.849 265.408  1.00 69.34           C  
ATOM   1298  C4'   G A  15     260.361 236.835 265.519  1.00 65.41           C  
ATOM   1299  O4'   G A  15     259.978 236.419 266.856  1.00 59.35           O  
ATOM   1300  C3'   G A  15     259.664 238.175 265.329  1.00 59.49           C  
ATOM   1301  O3'   G A  15     259.468 238.506 263.965  1.00 56.29           O  
ATOM   1302  C2'   G A  15     258.372 237.978 266.101  1.00 56.97           C  
ATOM   1303  O2'   G A  15     257.471 237.160 265.366  1.00 57.20           O  
ATOM   1304  C1'   G A  15     258.880 237.183 267.300  1.00 55.48           C  
ATOM   1305  N9    G A  15     259.378 238.095 268.332  1.00 51.72           N  
ATOM   1306  C8    G A  15     260.683 238.263 268.714  1.00 53.38           C  
ATOM   1307  N7    G A  15     260.812 239.164 269.643  1.00 56.52           N  
ATOM   1308  C5    G A  15     259.520 239.619 269.866  1.00 55.35           C  
ATOM   1309  C6    G A  15     259.048 240.604 270.766  1.00 55.54           C  
ATOM   1310  O6    G A  15     259.705 241.286 271.570  1.00 55.41           O  
ATOM   1311  N1    G A  15     257.667 240.742 270.662  1.00 50.70           N  
ATOM   1312  C2    G A  15     256.856 240.033 269.813  1.00 46.09           C  
ATOM   1313  N2    G A  15     255.552 240.320 269.872  1.00 46.17           N  
ATOM   1314  N3    G A  15     257.284 239.116 268.971  1.00 47.64           N  
ATOM   1315  C4    G A  15     258.619 238.969 269.055  1.00 51.04           C  
ATOM   1316  P     C A  16     259.936 239.938 263.405  1.00 57.94           P  
ATOM   1317  OP1   C A  16     259.778 239.952 261.932  1.00 55.82           O  
ATOM   1318  OP2   C A  16     261.272 240.240 263.985  1.00 59.35           O1-
ATOM   1319  O5'   C A  16     258.841 240.940 263.980  1.00 50.65           O  
ATOM   1320  C5'   C A  16     257.494 240.853 263.544  1.00 50.94           C  
ATOM   1321  C4'   C A  16     256.558 241.629 264.432  1.00 47.12           C  
ATOM   1322  O4'   C A  16     256.671 241.181 265.808  1.00 48.89           O  
ATOM   1323  C3'   C A  16     256.803 243.119 264.520  1.00 44.18           C  
ATOM   1324  O3'   C A  16     256.323 243.828 263.394  1.00 49.59           O  
ATOM   1325  C2'   C A  16     256.100 243.472 265.816  1.00 47.56           C  
ATOM   1326  O2'   C A  16     254.693 243.449 265.641  1.00 47.81           O  
ATOM   1327  C1'   C A  16     256.479 242.274 266.679  1.00 46.06           C  
ATOM   1328  N1    C A  16     257.742 242.514 267.410  1.00 46.15           N  
ATOM   1329  C2    C A  16     257.786 243.488 268.410  1.00 46.84           C  
ATOM   1330  O2    C A  16     256.763 244.133 268.673  1.00 49.39           O  
ATOM   1331  N3    C A  16     258.936 243.718 269.078  1.00 48.13           N  
ATOM   1332  C4    C A  16     260.023 243.018 268.783  1.00 50.95           C  
ATOM   1333  N4    C A  16     261.138 243.280 269.467  1.00 50.52           N  
ATOM   1334  C5    C A  16     260.011 242.019 267.769  1.00 53.07           C  
ATOM   1335  C6    C A  16     258.863 241.799 267.116  1.00 50.04           C  
ATOM   1336  P     G A  17     257.143 245.089 262.831  1.00 51.13           P  
ATOM   1337  OP1   G A  17     256.752 245.356 261.428  1.00 55.21           O  
ATOM   1338  OP2   G A  17     258.569 244.876 263.170  1.00 50.23           O1-
ATOM   1339  O5'   G A  17     256.592 246.299 263.694  1.00 45.67           O  
ATOM   1340  C5'   G A  17     255.203 246.419 263.928  1.00 44.26           C  
ATOM   1341  C4'   G A  17     254.932 247.376 265.051  1.00 45.95           C  
ATOM   1342  O4'   G A  17     255.351 246.806 266.310  1.00 45.34           O  
ATOM   1343  C3'   G A  17     255.678 248.688 264.970  1.00 45.81           C  
ATOM   1344  O3'   G A  17     255.029 249.592 264.110  1.00 47.28           O  
ATOM   1345  C2'   G A  17     255.700 249.151 266.414  1.00 45.27           C  
ATOM   1346  O2'   G A  17     254.453 249.730 266.766  1.00 47.23           O  
ATOM   1347  C1'   G A  17     255.834 247.824 267.155  1.00 41.83           C  
ATOM   1348  N9    G A  17     257.225 247.505 267.496  1.00 41.09           N  
ATOM   1349  C8    G A  17     257.980 246.504 266.951  1.00 43.85           C  
ATOM   1350  N7    G A  17     259.176 246.439 267.460  1.00 45.69           N  
ATOM   1351  C5    G A  17     259.196 247.461 268.398  1.00 45.65           C  
ATOM   1352  C6    G A  17     260.225 247.874 269.270  1.00 47.51           C  
ATOM   1353  O6    G A  17     261.359 247.406 269.374  1.00 52.42           O  
ATOM   1354  N1    G A  17     259.857 248.941 270.057  1.00 43.88           N  
ATOM   1355  C2    G A  17     258.632 249.520 269.999  1.00 45.29           C  
ATOM   1356  N2    G A  17     258.448 250.535 270.838  1.00 53.44           N  
ATOM   1357  N3    G A  17     257.654 249.156 269.203  1.00 44.26           N  
ATOM   1358  C4    G A  17     258.003 248.123 268.432  1.00 41.86           C  
ATOM   1359  P     U A  18     255.860 250.310 262.958  1.00 42.40           P  
ATOM   1360  OP1   U A  18     254.911 250.764 261.910  1.00 46.94           O  
ATOM   1361  OP2   U A  18     256.981 249.415 262.583  1.00 48.58           O1-
ATOM   1362  O5'   U A  18     256.407 251.607 263.690  1.00 46.47           O  
ATOM   1363  C5'   U A  18     255.492 252.616 264.081  1.00 49.99           C  
ATOM   1364  C4'   U A  18     255.972 253.394 265.280  1.00 55.19           C  
ATOM   1365  O4'   U A  18     256.315 252.485 266.352  1.00 53.12           O  
ATOM   1366  C3'   U A  18     257.223 254.240 265.096  1.00 51.65           C  
ATOM   1367  O3'   U A  18     256.951 255.476 264.455  1.00 50.20           O  
ATOM   1368  C2'   U A  18     257.732 254.386 266.524  1.00 49.68           C  
ATOM   1369  O2'   U A  18     256.989 255.377 267.225  1.00 46.81           O  
ATOM   1370  C1'   U A  18     257.372 253.021 267.116  1.00 51.17           C  
ATOM   1371  N1    U A  18     258.495 252.059 267.095  1.00 47.50           N  
ATOM   1372  C2    U A  18     259.445 252.176 268.076  1.00 49.08           C  
ATOM   1373  O2    U A  18     259.387 253.048 268.911  1.00 58.38           O  
ATOM   1374  N3    U A  18     260.463 251.279 268.065  1.00 42.58           N  
ATOM   1375  C4    U A  18     260.596 250.272 267.159  1.00 44.81           C  
ATOM   1376  O4    U A  18     261.562 249.523 267.242  1.00 50.20           O  
ATOM   1377  C5    U A  18     259.568 250.197 266.175  1.00 47.71           C  
ATOM   1378  C6    U A  18     258.568 251.067 266.168  1.00 46.31           C  
ATOM   1379  P     A A  19     257.863 255.988 263.232  1.00 51.69           P  
ATOM   1380  OP1   A A  19     257.174 257.162 262.633  1.00 55.06           O  
ATOM   1381  OP2   A A  19     258.220 254.843 262.362  1.00 55.68           O1-
ATOM   1382  O5'   A A  19     259.178 256.520 263.948  1.00 57.26           O  
ATOM   1383  C5'   A A  19     259.078 257.617 264.839  1.00 63.65           C  
ATOM   1384  C4'   A A  19     260.314 257.790 265.672  1.00 60.53           C  
ATOM   1385  O4'   A A  19     260.464 256.685 266.594  1.00 58.61           O  
ATOM   1386  C3'   A A  19     261.610 257.803 264.903  1.00 59.73           C  
ATOM   1387  O3'   A A  19     261.843 259.057 264.292  1.00 65.48           O  
ATOM   1388  C2'   A A  19     262.623 257.419 265.971  1.00 60.38           C  
ATOM   1389  O2'   A A  19     262.907 258.514 266.825  1.00 61.55           O  
ATOM   1390  C1'   A A  19     261.830 256.396 266.770  1.00 53.84           C  
ATOM   1391  N9    A A  19     262.073 255.044 266.277  1.00 50.95           N  
ATOM   1392  C8    A A  19     261.308 254.265 265.457  1.00 50.50           C  
ATOM   1393  N7    A A  19     261.857 253.098 265.237  1.00 54.04           N  
ATOM   1394  C5    A A  19     263.052 253.132 265.950  1.00 53.14           C  
ATOM   1395  C6    A A  19     264.102 252.207 266.132  1.00 54.15           C  
ATOM   1396  N6    A A  19     264.145 250.986 265.585  1.00 54.43           N  
ATOM   1397  N1    A A  19     265.132 252.586 266.918  1.00 53.48           N  
ATOM   1398  C2    A A  19     265.098 253.807 267.467  1.00 52.27           C  
ATOM   1399  N3    A A  19     264.178 254.758 267.373  1.00 49.44           N  
ATOM   1400  C4    A A  19     263.183 254.339 266.592  1.00 49.72           C  
ATOM   1401  P     C A  20     262.432 259.123 262.801  1.00 76.31           P  
ATOM   1402  OP1   C A  20     262.216 260.496 262.272  1.00 74.11           O  
ATOM   1403  OP2   C A  20     261.886 257.955 262.055  1.00 67.15           O1-
ATOM   1404  O5'   C A  20     264.002 258.951 263.027  1.00 72.13           O  
ATOM   1405  C5'   C A  20     264.707 259.882 263.840  1.00 73.15           C  
ATOM   1406  C4'   C A  20     265.913 259.278 264.522  1.00 65.05           C  
ATOM   1407  O4'   C A  20     265.551 258.061 265.219  1.00 59.16           O  
ATOM   1408  C3'   C A  20     267.060 258.852 263.625  1.00 66.15           C  
ATOM   1409  O3'   C A  20     267.865 259.943 263.221  1.00 74.64           O  
ATOM   1410  C2'   C A  20     267.799 257.864 264.504  1.00 63.18           C  
ATOM   1411  O2'   C A  20     268.558 258.552 265.485  1.00 66.62           O  
ATOM   1412  C1'   C A  20     266.636 257.165 265.201  1.00 56.63           C  
ATOM   1413  N1    C A  20     266.229 255.955 264.471  1.00 53.82           N  
ATOM   1414  C2    C A  20     267.020 254.819 264.612  1.00 59.26           C  
ATOM   1415  O2    C A  20     268.024 254.857 265.346  1.00 60.47           O  
ATOM   1416  N3    C A  20     266.680 253.698 263.947  1.00 59.31           N  
ATOM   1417  C4    C A  20     265.602 253.699 263.174  1.00 55.03           C  
ATOM   1418  N4    C A  20     265.312 252.565 262.543  1.00 55.68           N  
ATOM   1419  C5    C A  20     264.781 254.848 263.013  1.00 54.72           C  
ATOM   1420  C6    C A  20     265.129 255.951 263.675  1.00 53.52           C  
ATOM   1421  P     A A  21     268.612 259.914 261.801  1.00 79.09           P  
ATOM   1422  OP1   A A  21     269.230 261.248 261.588  1.00 77.63           O  
ATOM   1423  OP2   A A  21     267.674 259.352 260.794  1.00 74.35           O1-
ATOM   1424  O5'   A A  21     269.793 258.871 262.015  1.00 74.55           O  
ATOM   1425  C5'   A A  21     270.859 259.146 262.911  1.00 78.53           C  
ATOM   1426  C4'   A A  21     271.852 258.014 262.904  1.00 84.46           C  
ATOM   1427  O4'   A A  21     271.284 256.855 263.575  1.00 78.75           O  
ATOM   1428  C3'   A A  21     272.222 257.489 261.526  1.00 86.24           C  
ATOM   1429  O3'   A A  21     273.183 258.288 260.855  1.00 83.95           O  
ATOM   1430  C2'   A A  21     272.670 256.062 261.824  1.00 78.30           C  
ATOM   1431  O2'   A A  21     273.984 256.033 262.368  1.00 74.10           O  
ATOM   1432  C1'   A A  21     271.671 255.669 262.908  1.00 73.48           C  
ATOM   1433  N9    A A  21     270.471 255.067 262.308  1.00 67.14           N  
ATOM   1434  C8    A A  21     269.264 255.663 262.051  1.00 66.03           C  
ATOM   1435  N7    A A  21     268.398 254.856 261.490  1.00 65.47           N  
ATOM   1436  C5    A A  21     269.092 253.663 261.362  1.00 66.73           C  
ATOM   1437  C6    A A  21     268.735 252.406 260.842  1.00 66.94           C  
ATOM   1438  N6    A A  21     267.530 252.151 260.334  1.00 65.91           N  
ATOM   1439  N1    A A  21     269.655 251.412 260.860  1.00 65.51           N  
ATOM   1440  C2    A A  21     270.862 251.685 261.375  1.00 67.69           C  
ATOM   1441  N3    A A  21     271.315 252.826 261.894  1.00 70.01           N  
ATOM   1442  C4    A A  21     270.372 253.782 261.856  1.00 66.95           C  
ATOM   1443  P     C A  22     273.087 258.485 259.262  1.00 83.30           P  
ATOM   1444  OP1   C A  22     274.158 259.434 258.878  1.00 83.05           O  
ATOM   1445  OP2   C A  22     271.677 258.777 258.883  1.00 70.82           O1-
ATOM   1446  O5'   C A  22     273.488 257.050 258.689  1.00 87.71           O  
ATOM   1447  C5'   C A  22     274.663 256.387 259.148  1.00 86.91           C  
ATOM   1448  C4'   C A  22     274.680 254.922 258.771  1.00 83.55           C  
ATOM   1449  O4'   C A  22     273.599 254.200 259.416  1.00 76.31           O  
ATOM   1450  C3'   C A  22     274.490 254.614 257.298  1.00 84.08           C  
ATOM   1451  O3'   C A  22     275.659 254.845 256.534  1.00 90.16           O  
ATOM   1452  C2'   C A  22     274.035 253.158 257.321  1.00 75.65           C  
ATOM   1453  O2'   C A  22     275.138 252.285 257.507  1.00 79.25           O  
ATOM   1454  C1'   C A  22     273.179 253.128 258.589  1.00 73.60           C  
ATOM   1455  N1    C A  22     271.736 253.274 258.287  1.00 71.47           N  
ATOM   1456  C2    C A  22     270.984 252.120 258.030  1.00 67.19           C  
ATOM   1457  O2    C A  22     271.540 251.011 258.069  1.00 65.70           O  
ATOM   1458  N3    C A  22     269.665 252.240 257.755  1.00 64.21           N  
ATOM   1459  C4    C A  22     269.105 253.453 257.729  1.00 63.37           C  
ATOM   1460  N4    C A  22     267.805 253.545 257.455  1.00 59.93           N  
ATOM   1461  C5    C A  22     269.846 254.640 257.977  1.00 68.49           C  
ATOM   1462  C6    C A  22     271.146 254.508 258.250  1.00 71.07           C  
ATOM   1463  P     G A  23     275.536 255.122 254.959  1.00 98.57           P  
ATOM   1464  OP1   G A  23     276.752 255.856 254.510  1.00 95.46           O  
ATOM   1465  OP2   G A  23     274.191 255.720 254.739  1.00 89.94           O1-
ATOM   1466  O5'   G A  23     275.546 253.654 254.330  1.00 89.67           O  
ATOM   1467  C5'   G A  23     274.665 253.298 253.274  1.00 83.75           C  
ATOM   1468  C4'   G A  23     274.358 251.821 253.275  1.00 76.35           C  
ATOM   1469  O4'   G A  23     273.457 251.515 254.372  1.00 72.23           O  
ATOM   1470  C3'   G A  23     273.628 251.308 252.042  1.00 78.37           C  
ATOM   1471  O3'   G A  23     274.490 251.051 250.941  1.00 82.39           O  
ATOM   1472  C2'   G A  23     272.907 250.074 252.567  1.00 70.72           C  
ATOM   1473  O2'   G A  23     273.800 248.976 252.672  1.00 70.87           O  
ATOM   1474  C1'   G A  23     272.524 250.533 253.974  1.00 67.93           C  
ATOM   1475  N9    G A  23     271.177 251.125 254.002  1.00 64.06           N  
ATOM   1476  C8    G A  23     270.835 252.436 254.215  1.00 65.98           C  
ATOM   1477  N7    G A  23     269.546 252.636 254.169  1.00 64.32           N  
ATOM   1478  C5    G A  23     269.004 251.382 253.909  1.00 60.91           C  
ATOM   1479  C6    G A  23     267.657 250.958 253.747  1.00 59.27           C  
ATOM   1480  O6    G A  23     266.612 251.616 253.801  1.00 61.11           O  
ATOM   1481  N1    G A  23     267.569 249.599 253.493  1.00 58.11           N  
ATOM   1482  C2    G A  23     268.642 248.756 253.406  1.00 60.84           C  
ATOM   1483  N2    G A  23     268.367 247.471 253.156  1.00 63.14           N  
ATOM   1484  N3    G A  23     269.899 249.130 253.552  1.00 60.57           N  
ATOM   1485  C4    G A  23     270.004 250.446 253.802  1.00 60.46           C  
ATOM   1486  P     G A  24     274.112 251.593 249.471  1.00 91.49           P  
ATOM   1487  OP1   G A  24     275.328 251.537 248.618  1.00 84.22           O  
ATOM   1488  OP2   G A  24     273.398 252.887 249.643  1.00 81.49           O1-
ATOM   1489  O5'   G A  24     273.091 250.507 248.905  1.00 74.36           O  
ATOM   1490  C5'   G A  24     273.491 249.156 248.746  1.00 70.52           C  
ATOM   1491  C4'   G A  24     272.313 248.220 248.769  1.00 66.45           C  
ATOM   1492  O4'   G A  24     271.484 248.470 249.934  1.00 64.92           O  
ATOM   1493  C3'   G A  24     271.345 248.340 247.608  1.00 61.57           C  
ATOM   1494  O3'   G A  24     271.806 247.693 246.440  1.00 60.61           O  
ATOM   1495  C2'   G A  24     270.077 247.712 248.167  1.00 65.10           C  
ATOM   1496  O2'   G A  24     270.153 246.297 248.092  1.00 65.14           O  
ATOM   1497  C1'   G A  24     270.140 248.133 249.641  1.00 65.16           C  
ATOM   1498  N9    G A  24     269.250 249.278 249.927  1.00 64.74           N  
ATOM   1499  C8    G A  24     269.604 250.579 250.181  1.00 71.24           C  
ATOM   1500  N7    G A  24     268.588 251.376 250.388  1.00 67.14           N  
ATOM   1501  C5    G A  24     267.491 250.549 250.263  1.00 60.14           C  
ATOM   1502  C6    G A  24     266.122 250.855 250.377  1.00 61.41           C  
ATOM   1503  O6    G A  24     265.586 251.942 250.622  1.00 64.35           O  
ATOM   1504  N1    G A  24     265.345 249.725 250.175  1.00 62.79           N  
ATOM   1505  C2    G A  24     265.815 248.467 249.896  1.00 60.84           C  
ATOM   1506  N2    G A  24     264.892 247.502 249.731  1.00 62.40           N  
ATOM   1507  N3    G A  24     267.096 248.177 249.782  1.00 59.03           N  
ATOM   1508  C4    G A  24     267.874 249.258 249.976  1.00 58.70           C  
ATOM   1509  P     U A  25     271.553 248.375 245.014  1.00 63.57           P  
ATOM   1510  OP1   U A  25     272.191 247.564 243.946  1.00 62.86           O  
ATOM   1511  OP2   U A  25     271.893 249.809 245.196  1.00 67.42           O1-
ATOM   1512  O5'   U A  25     269.981 248.283 244.798  1.00 55.44           O  
ATOM   1513  C5'   U A  25     269.358 247.063 244.440  1.00 51.98           C  
ATOM   1514  C4'   U A  25     267.876 247.137 244.680  1.00 50.83           C  
ATOM   1515  O4'   U A  25     267.644 247.718 245.984  1.00 57.56           O  
ATOM   1516  C3'   U A  25     267.104 248.032 243.729  1.00 54.08           C  
ATOM   1517  O3'   U A  25     266.762 247.362 242.532  1.00 55.55           O  
ATOM   1518  C2'   U A  25     265.889 248.458 244.547  1.00 56.61           C  
ATOM   1519  O2'   U A  25     264.862 247.479 244.470  1.00 58.38           O  
ATOM   1520  C1'   U A  25     266.451 248.470 245.975  1.00 61.40           C  
ATOM   1521  N1    U A  25     266.706 249.830 246.537  1.00 57.74           N  
ATOM   1522  C2    U A  25     265.619 250.599 246.915  1.00 56.64           C  
ATOM   1523  O2    U A  25     264.473 250.227 246.771  1.00 63.35           O  
ATOM   1524  N3    U A  25     265.881 251.825 247.457  1.00 56.26           N  
ATOM   1525  C4    U A  25     267.113 252.366 247.674  1.00 58.66           C  
ATOM   1526  O4    U A  25     267.191 253.489 248.170  1.00 61.61           O  
ATOM   1527  C5    U A  25     268.199 251.524 247.278  1.00 61.15           C  
ATOM   1528  C6    U A  25     267.971 250.315 246.752  1.00 59.19           C  
ATOM   1529  P     G A  26     267.280 247.924 241.122  1.00 57.76           P  
ATOM   1530  OP1   G A  26     267.043 246.884 240.089  1.00 61.05           O  
ATOM   1531  OP2   G A  26     268.653 248.450 241.333  1.00 57.98           O1-
ATOM   1532  O5'   G A  26     266.312 249.153 240.816  1.00 58.35           O  
ATOM   1533  C5'   G A  26     264.902 248.985 240.766  1.00 54.44           C  
ATOM   1534  C4'   G A  26     264.199 250.263 241.133  1.00 48.89           C  
ATOM   1535  O4'   G A  26     264.556 250.607 242.493  1.00 49.78           O  
ATOM   1536  C3'   G A  26     264.590 251.484 240.313  1.00 48.56           C  
ATOM   1537  O3'   G A  26     263.846 251.590 239.102  1.00 54.58           O  
ATOM   1538  C2'   G A  26     264.337 252.637 241.273  1.00 46.94           C  
ATOM   1539  O2'   G A  26     262.959 252.965 241.263  1.00 52.03           O  
ATOM   1540  C1'   G A  26     264.659 252.003 242.631  1.00 49.01           C  
ATOM   1541  N9    G A  26     266.001 252.340 243.162  1.00 51.14           N  
ATOM   1542  C8    G A  26     267.181 251.692 242.905  1.00 56.50           C  
ATOM   1543  N7    G A  26     268.216 252.194 243.522  1.00 54.30           N  
ATOM   1544  C5    G A  26     267.686 253.234 244.253  1.00 52.78           C  
ATOM   1545  C6    G A  26     268.324 254.143 245.127  1.00 59.19           C  
ATOM   1546  O6    G A  26     269.523 254.207 245.420  1.00 61.88           O  
ATOM   1547  N1    G A  26     267.427 255.057 245.667  1.00 54.68           N  
ATOM   1548  C2    G A  26     266.086 255.075 245.401  1.00 51.52           C  
ATOM   1549  N2    G A  26     265.365 256.023 246.010  1.00 49.87           N  
ATOM   1550  N3    G A  26     265.484 254.228 244.591  1.00 53.54           N  
ATOM   1551  C4    G A  26     266.331 253.336 244.052  1.00 52.28           C  
ATOM   1552  P     G A  27     264.590 251.749 237.679  1.00 70.26           P  
ATOM   1553  OP1   G A  27     263.883 250.992 236.602  1.00 59.96           O  
ATOM   1554  OP2   G A  27     266.022 251.483 237.950  1.00 64.10           O1-
ATOM   1555  O5'   G A  27     264.448 253.291 237.325  1.00 56.15           O  
ATOM   1556  C5'   G A  27     263.191 253.942 237.419  1.00 52.72           C  
ATOM   1557  C4'   G A  27     263.336 255.269 238.110  1.00 52.51           C  
ATOM   1558  O4'   G A  27     264.236 255.106 239.245  1.00 47.23           O  
ATOM   1559  C3'   G A  27     263.936 256.373 237.241  1.00 53.41           C  
ATOM   1560  O3'   G A  27     263.327 257.630 237.545  1.00 54.26           O  
ATOM   1561  C2'   G A  27     265.397 256.388 237.674  1.00 52.36           C  
ATOM   1562  O2'   G A  27     266.061 257.618 237.482  1.00 52.35           O  
ATOM   1563  C1'   G A  27     265.291 256.034 239.151  1.00 45.36           C  
ATOM   1564  N9    G A  27     266.523 255.439 239.665  1.00 48.70           N  
ATOM   1565  C8    G A  27     267.299 254.532 239.000  1.00 53.07           C  
ATOM   1566  N7    G A  27     268.375 254.194 239.659  1.00 58.66           N  
ATOM   1567  C5    G A  27     268.327 254.937 240.832  1.00 57.95           C  
ATOM   1568  C6    G A  27     269.232 254.982 241.940  1.00 57.12           C  
ATOM   1569  O6    G A  27     270.294 254.368 242.141  1.00 55.52           O  
ATOM   1570  N1    G A  27     268.785 255.879 242.893  1.00 55.32           N  
ATOM   1571  C2    G A  27     267.631 256.613 242.811  1.00 56.73           C  
ATOM   1572  N2    G A  27     267.387 257.415 243.855  1.00 57.08           N  
ATOM   1573  N3    G A  27     266.781 256.580 241.793  1.00 55.95           N  
ATOM   1574  C4    G A  27     267.186 255.719 240.840  1.00 53.55           C  
ATOM   1575  P     A A  28     262.873 258.619 236.356  1.00 63.07           P  
ATOM   1576  OP1   A A  28     261.773 257.961 235.608  1.00 55.31           O  
ATOM   1577  OP2   A A  28     264.093 259.052 235.621  1.00 56.97           O1-
ATOM   1578  O5'   A A  28     262.266 259.895 237.105  1.00 54.22           O  
ATOM   1579  C5'   A A  28     260.888 259.975 237.446  1.00 44.47           C  
ATOM   1580  C4'   A A  28     260.683 260.680 238.764  1.00 46.23           C  
ATOM   1581  O4'   A A  28     261.492 260.055 239.792  1.00 49.47           O  
ATOM   1582  C3'   A A  28     261.078 262.145 238.811  1.00 45.69           C  
ATOM   1583  O3'   A A  28     260.052 262.987 238.316  1.00 46.85           O  
ATOM   1584  C2'   A A  28     261.385 262.382 240.294  1.00 51.31           C  
ATOM   1585  O2'   A A  28     260.215 262.724 241.026  1.00 50.63           O  
ATOM   1586  C1'   A A  28     261.878 261.008 240.757  1.00 47.60           C  
ATOM   1587  N9    A A  28     263.340 260.962 240.916  1.00 45.09           N  
ATOM   1588  C8    A A  28     264.201 260.165 240.225  1.00 48.08           C  
ATOM   1589  N7    A A  28     265.455 260.324 240.551  1.00 49.26           N  
ATOM   1590  C5    A A  28     265.404 261.293 241.528  1.00 44.43           C  
ATOM   1591  C6    A A  28     266.411 261.887 242.273  1.00 46.16           C  
ATOM   1592  N6    A A  28     267.690 261.558 242.117  1.00 51.96           N  
ATOM   1593  N1    A A  28     266.067 262.817 243.180  1.00 46.88           N  
ATOM   1594  C2    A A  28     264.773 263.113 243.311  1.00 48.54           C  
ATOM   1595  N3    A A  28     263.726 262.615 242.661  1.00 48.98           N  
ATOM   1596  C4    A A  28     264.118 261.694 241.772  1.00 45.10           C  
ATOM   1597  P     U A  29     260.414 264.315 237.493  1.00 50.89           P  
ATOM   1598  OP1   U A  29     259.156 265.051 237.189  1.00 49.56           O  
ATOM   1599  OP2   U A  29     261.349 263.894 236.420  1.00 46.86           O1-
ATOM   1600  O5'   U A  29     261.230 265.209 238.527  1.00 52.52           O  
ATOM   1601  C5'   U A  29     260.578 265.856 239.610  1.00 53.40           C  
ATOM   1602  C4'   U A  29     261.581 266.511 240.524  1.00 50.59           C  
ATOM   1603  O4'   U A  29     262.416 265.494 241.137  1.00 50.22           O  
ATOM   1604  C3'   U A  29     262.567 267.429 239.828  1.00 52.53           C  
ATOM   1605  O3'   U A  29     262.032 268.719 239.585  1.00 57.03           O  
ATOM   1606  C2'   U A  29     263.771 267.403 240.765  1.00 49.62           C  
ATOM   1607  O2'   U A  29     263.560 268.241 241.886  1.00 57.43           O  
ATOM   1608  C1'   U A  29     263.743 265.960 241.255  1.00 44.31           C  
ATOM   1609  N1    U A  29     264.633 265.095 240.455  1.00 41.79           N  
ATOM   1610  C2    U A  29     265.953 265.125 240.786  1.00 42.86           C  
ATOM   1611  O2    U A  29     266.367 265.819 241.692  1.00 46.51           O  
ATOM   1612  N3    U A  29     266.762 264.324 240.029  1.00 47.35           N  
ATOM   1613  C4    U A  29     266.372 263.514 238.990  1.00 46.79           C  
ATOM   1614  O4    U A  29     267.211 262.845 238.395  1.00 51.36           O  
ATOM   1615  C5    U A  29     264.982 263.542 238.702  1.00 43.63           C  
ATOM   1616  C6    U A  29     264.184 264.314 239.430  1.00 43.76           C  
ATOM   1617  P     G A  30     262.374 269.511 238.223  1.00 64.29           P  
ATOM   1618  OP1   G A  30     261.469 270.682 238.163  1.00 65.70           O  
ATOM   1619  OP2   G A  30     262.427 268.578 237.069  1.00 54.78           O1-
ATOM   1620  O5'   G A  30     263.827 270.093 238.493  1.00 57.54           O  
ATOM   1621  C5'   G A  30     264.069 270.881 239.647  1.00 58.46           C  
ATOM   1622  C4'   G A  30     265.540 271.023 239.909  1.00 51.51           C  
ATOM   1623  O4'   G A  30     266.086 269.751 240.337  1.00 45.86           O  
ATOM   1624  C3'   G A  30     266.377 271.399 238.699  1.00 56.37           C  
ATOM   1625  O3'   G A  30     266.343 272.798 238.426  1.00 60.61           O  
ATOM   1626  C2'   G A  30     267.749 270.877 239.089  1.00 52.92           C  
ATOM   1627  O2'   G A  30     268.353 271.744 240.033  1.00 56.91           O  
ATOM   1628  C1'   G A  30     267.381 269.587 239.814  1.00 47.04           C  
ATOM   1629  N9    G A  30     267.381 268.423 238.911  1.00 50.91           N  
ATOM   1630  C8    G A  30     266.295 267.874 238.284  1.00 50.99           C  
ATOM   1631  N7    G A  30     266.583 266.839 237.544  1.00 49.21           N  
ATOM   1632  C5    G A  30     267.951 266.699 237.696  1.00 50.74           C  
ATOM   1633  C6    G A  30     268.835 265.753 237.133  1.00 54.42           C  
ATOM   1634  O6    G A  30     268.566 264.821 236.368  1.00 56.01           O  
ATOM   1635  N1    G A  30     270.149 265.959 237.536  1.00 53.06           N  
ATOM   1636  C2    G A  30     270.556 266.955 238.380  1.00 50.94           C  
ATOM   1637  N2    G A  30     271.865 267.001 238.663  1.00 51.39           N  
ATOM   1638  N3    G A  30     269.743 267.846 238.912  1.00 53.65           N  
ATOM   1639  C4    G A  30     268.463 267.663 238.530  1.00 52.67           C  
ATOM   1640  P     C A  31     266.036 273.362 236.943  1.00 62.45           P  
ATOM   1641  OP1   C A  31     265.704 274.808 237.027  1.00 57.84           O  
ATOM   1642  OP2   C A  31     265.064 272.463 236.274  1.00 58.85           O1-
ATOM   1643  O5'   C A  31     267.442 273.249 236.212  1.00 56.44           O  
ATOM   1644  C5'   C A  31     268.546 273.977 236.716  1.00 55.60           C  
ATOM   1645  C4'   C A  31     269.860 273.333 236.374  1.00 54.18           C  
ATOM   1646  O4'   C A  31     269.944 272.005 236.939  1.00 52.09           O  
ATOM   1647  C3'   C A  31     270.142 273.109 234.906  1.00 58.08           C  
ATOM   1648  O3'   C A  31     270.533 274.286 234.236  1.00 64.28           O  
ATOM   1649  C2'   C A  31     271.233 272.059 234.953  1.00 59.56           C  
ATOM   1650  O2'   C A  31     272.477 272.645 235.307  1.00 64.41           O  
ATOM   1651  C1'   C A  31     270.760 271.199 236.117  1.00 52.75           C  
ATOM   1652  N1    C A  31     269.951 270.075 235.639  1.00 54.58           N  
ATOM   1653  C2    C A  31     270.555 269.035 234.928  1.00 57.88           C  
ATOM   1654  O2    C A  31     271.771 269.048 234.702  1.00 60.13           O  
ATOM   1655  N3    C A  31     269.789 268.011 234.497  1.00 61.48           N  
ATOM   1656  C4    C A  31     268.480 268.021 234.759  1.00 65.43           C  
ATOM   1657  N4    C A  31     267.734 266.998 234.323  1.00 62.41           N  
ATOM   1658  C5    C A  31     267.858 269.082 235.483  1.00 63.97           C  
ATOM   1659  C6    C A  31     268.625 270.088 235.900  1.00 56.13           C  
ATOM   1660  P     C A  32     270.033 274.547 232.739  1.00 72.10           P  
ATOM   1661  OP1   C A  32     270.556 275.885 232.347  1.00 71.57           O  
ATOM   1662  OP2   C A  32     268.562 274.329 232.741  1.00 71.14           O1-
ATOM   1663  O5'   C A  32     270.741 273.392 231.877  1.00 75.01           O  
ATOM   1664  C5'   C A  32     272.162 273.327 231.781  1.00 79.45           C  
ATOM   1665  C4'   C A  32     272.683 272.081 231.088  1.00 75.57           C  
ATOM   1666  O4'   C A  32     272.275 270.871 231.771  1.00 70.39           O  
ATOM   1667  C3'   C A  32     272.258 271.844 229.651  1.00 74.56           C  
ATOM   1668  O3'   C A  32     272.973 272.661 228.743  1.00 83.11           O  
ATOM   1669  C2'   C A  32     272.547 270.357 229.459  1.00 71.43           C  
ATOM   1670  O2'   C A  32     273.912 270.146 229.143  1.00 79.67           O  
ATOM   1671  C1'   C A  32     272.279 269.793 230.859  1.00 63.20           C  
ATOM   1672  N1    C A  32     270.989 269.093 230.921  1.00 60.71           N  
ATOM   1673  C2    C A  32     270.935 267.793 230.431  1.00 59.74           C  
ATOM   1674  O2    C A  32     271.969 267.277 229.977  1.00 57.20           O  
ATOM   1675  N3    C A  32     269.752 267.141 230.469  1.00 61.25           N  
ATOM   1676  C4    C A  32     268.677 267.759 230.968  1.00 58.65           C  
ATOM   1677  N4    C A  32     267.529 267.086 230.992  1.00 57.07           N  
ATOM   1678  C5    C A  32     268.715 269.088 231.469  1.00 61.02           C  
ATOM   1679  C6    C A  32     269.891 269.717 231.422  1.00 64.03           C  
ATOM   1680  P     C A  33     272.178 273.612 227.725  1.00 97.18           P  
ATOM   1681  OP1   C A  33     272.984 274.847 227.540  1.00 88.20           O  
ATOM   1682  OP2   C A  33     270.784 273.714 228.228  1.00 84.80           O1-
ATOM   1683  O5'   C A  33     272.158 272.793 226.354  1.00 88.49           O  
ATOM   1684  C5'   C A  33     273.357 272.258 225.797  1.00 84.05           C  
ATOM   1685  C4'   C A  33     273.089 271.069 224.904  1.00 89.68           C  
ATOM   1686  O4'   C A  33     272.337 270.064 225.645  1.00 85.37           O  
ATOM   1687  C3'   C A  33     272.275 271.356 223.634  1.00 97.87           C  
ATOM   1688  O3'   C A  33     272.726 270.502 222.572  1.00113.92           O  
ATOM   1689  C2'   C A  33     270.869 270.927 224.048  1.00 84.62           C  
ATOM   1690  O2'   C A  33     270.007 270.593 222.982  1.00 80.41           O  
ATOM   1691  C1'   C A  33     271.180 269.715 224.911  1.00 79.45           C  
ATOM   1692  N1    C A  33     270.100 269.333 225.829  1.00 76.18           N  
ATOM   1693  C2    C A  33     269.847 267.967 225.927  1.00 72.56           C  
ATOM   1694  O2    C A  33     270.568 267.204 225.263  1.00 70.67           O  
ATOM   1695  N3    C A  33     268.853 267.529 226.741  1.00 67.74           N  
ATOM   1696  C4    C A  33     268.117 268.408 227.430  1.00 65.11           C  
ATOM   1697  N4    C A  33     267.152 267.925 228.215  1.00 56.92           N  
ATOM   1698  C5    C A  33     268.349 269.815 227.340  1.00 69.24           C  
ATOM   1699  C6    C A  33     269.340 270.234 226.531  1.00 75.62           C  
ATOM   1700  P     U A  34     273.727 271.043 221.427  1.00134.79           P  
ATOM   1701  OP1   U A  34     274.905 270.130 221.387  1.00116.36           O  
ATOM   1702  OP2   U A  34     273.923 272.503 221.642  1.00116.16           O1-
ATOM   1703  O5'   U A  34     272.914 270.874 220.060  1.00120.66           O  
ATOM   1704  C5'   U A  34     272.231 269.664 219.745  1.00115.35           C  
ATOM   1705  C4'   U A  34     272.669 269.093 218.418  1.00120.59           C  
ATOM   1706  O4'   U A  34     274.071 268.704 218.510  1.00132.77           O  
ATOM   1707  C3'   U A  34     271.908 267.839 217.970  1.00118.96           C  
ATOM   1708  O3'   U A  34     271.744 267.846 216.550  1.00111.43           O  
ATOM   1709  C2'   U A  34     272.849 266.705 218.381  1.00134.64           C  
ATOM   1710  O2'   U A  34     272.691 265.495 217.659  1.00126.33           O  
ATOM   1711  C1'   U A  34     274.214 267.343 218.140  1.00138.96           C  
ATOM   1712  N1    U A  34     275.306 266.737 218.920  1.00139.56           N  
ATOM   1713  C2    U A  34     276.474 266.448 218.236  1.00142.02           C  
ATOM   1714  O2    U A  34     276.631 266.700 217.053  1.00137.80           O  
ATOM   1715  N3    U A  34     277.462 265.871 218.994  1.00146.95           N  
ATOM   1716  C4    U A  34     277.397 265.546 220.333  1.00149.33           C  
ATOM   1717  O4    U A  34     278.378 265.025 220.874  1.00143.96           O  
ATOM   1718  C5    U A  34     276.148 265.864 220.967  1.00143.09           C  
ATOM   1719  C6    U A  34     275.166 266.431 220.257  1.00135.40           C  
ATOM   1720  P     G A  35     270.269 267.861 215.914  1.00 97.52           P  
ATOM   1721  OP1   G A  35     270.262 267.116 214.628  1.00 86.85           O  
ATOM   1722  OP2   G A  35     269.804 269.272 215.963  1.00 99.92           O1-
ATOM   1723  O5'   G A  35     269.407 267.026 216.949  1.00 81.13           O  
ATOM   1724  C5'   G A  35     269.126 265.658 216.721  1.00 73.76           C  
ATOM   1725  C4'   G A  35     267.797 265.311 217.318  1.00 67.86           C  
ATOM   1726  O4'   G A  35     267.779 265.745 218.701  1.00 63.05           O  
ATOM   1727  C3'   G A  35     266.607 266.018 216.699  1.00 65.67           C  
ATOM   1728  O3'   G A  35     266.146 265.382 215.520  1.00 69.08           O  
ATOM   1729  C2'   G A  35     265.593 266.012 217.833  1.00 63.48           C  
ATOM   1730  O2'   G A  35     265.000 264.727 217.953  1.00 63.74           O  
ATOM   1731  C1'   G A  35     266.496 266.220 219.043  1.00 56.96           C  
ATOM   1732  N9    G A  35     266.611 267.634 219.447  1.00 55.09           N  
ATOM   1733  C8    G A  35     267.648 268.460 219.125  1.00 64.45           C  
ATOM   1734  N7    G A  35     267.522 269.657 219.621  1.00 65.23           N  
ATOM   1735  C5    G A  35     266.333 269.622 220.323  1.00 55.38           C  
ATOM   1736  C6    G A  35     265.698 270.643 221.066  1.00 52.10           C  
ATOM   1737  O6    G A  35     266.068 271.808 221.252  1.00 54.56           O  
ATOM   1738  N1    G A  35     264.513 270.201 221.617  1.00 49.28           N  
ATOM   1739  C2    G A  35     264.023 268.936 221.462  1.00 50.10           C  
ATOM   1740  N2    G A  35     262.858 268.705 222.073  1.00 52.30           N  
ATOM   1741  N3    G A  35     264.604 267.967 220.775  1.00 52.70           N  
ATOM   1742  C4    G A  35     265.757 268.379 220.229  1.00 52.60           C  
ATOM   1743  P     G A  36     265.250 266.191 214.455  1.00 75.87           P  
ATOM   1744  OP1   G A  36     265.397 265.525 213.137  1.00 76.44           O  
ATOM   1745  OP2   G A  36     265.571 267.634 214.585  1.00 74.56           O1-
ATOM   1746  O5'   G A  36     263.751 265.979 214.954  1.00 62.24           O  
ATOM   1747  C5'   G A  36     262.793 267.022 214.855  1.00 55.60           C  
ATOM   1748  C4'   G A  36     261.986 267.137 216.124  1.00 58.88           C  
ATOM   1749  O4'   G A  36     262.832 267.568 217.225  1.00 58.21           O  
ATOM   1750  C3'   G A  36     260.863 268.155 216.107  1.00 60.83           C  
ATOM   1751  O3'   G A  36     259.705 267.665 215.453  1.00 63.47           O  
ATOM   1752  C2'   G A  36     260.656 268.442 217.588  1.00 53.61           C  
ATOM   1753  O2'   G A  36     259.917 267.390 218.188  1.00 54.42           O  
ATOM   1754  C1'   G A  36     262.090 268.372 218.117  1.00 50.72           C  
ATOM   1755  N9    G A  36     262.739 269.695 218.210  1.00 50.63           N  
ATOM   1756  C8    G A  36     263.940 270.044 217.650  1.00 56.56           C  
ATOM   1757  N7    G A  36     264.297 271.278 217.887  1.00 57.71           N  
ATOM   1758  C5    G A  36     263.271 271.788 218.669  1.00 56.58           C  
ATOM   1759  C6    G A  36     263.104 273.090 219.232  1.00 54.48           C  
ATOM   1760  O6    G A  36     263.840 274.085 219.160  1.00 51.73           O  
ATOM   1761  N1    G A  36     261.919 273.168 219.952  1.00 53.22           N  
ATOM   1762  C2    G A  36     261.029 272.131 220.096  1.00 50.32           C  
ATOM   1763  N2    G A  36     259.943 272.397 220.825  1.00 53.71           N  
ATOM   1764  N3    G A  36     261.169 270.925 219.578  1.00 49.21           N  
ATOM   1765  C4    G A  36     262.306 270.816 218.879  1.00 51.38           C  
ATOM   1766  P     C A  37     258.980 268.542 214.317  1.00 73.18           P  
ATOM   1767  OP1   C A  37     257.870 267.742 213.734  1.00 60.14           O  
ATOM   1768  OP2   C A  37     260.026 269.076 213.402  1.00 69.46           O1-
ATOM   1769  O5'   C A  37     258.310 269.721 215.152  1.00 62.24           O  
ATOM   1770  C5'   C A  37     257.425 269.402 216.213  1.00 58.76           C  
ATOM   1771  C4'   C A  37     256.938 270.618 216.959  1.00 56.44           C  
ATOM   1772  O4'   C A  37     257.972 271.119 217.839  1.00 53.53           O  
ATOM   1773  C3'   C A  37     256.547 271.825 216.129  1.00 53.78           C  
ATOM   1774  O3'   C A  37     255.258 271.703 215.562  1.00 56.44           O  
ATOM   1775  C2'   C A  37     256.640 272.953 217.139  1.00 55.83           C  
ATOM   1776  O2'   C A  37     255.494 272.949 217.975  1.00 56.15           O  
ATOM   1777  C1'   C A  37     257.844 272.514 217.973  1.00 52.12           C  
ATOM   1778  N1    C A  37     259.108 273.138 217.529  1.00 55.85           N  
ATOM   1779  C2    C A  37     259.334 274.506 217.751  1.00 59.71           C  
ATOM   1780  O2    C A  37     258.459 275.194 218.307  1.00 59.65           O  
ATOM   1781  N3    C A  37     260.503 275.063 217.348  1.00 59.64           N  
ATOM   1782  C4    C A  37     261.430 274.310 216.757  1.00 59.30           C  
ATOM   1783  N4    C A  37     262.571 274.897 216.377  1.00 57.67           N  
ATOM   1784  C5    C A  37     261.218 272.917 216.526  1.00 61.81           C  
ATOM   1785  C6    C A  37     260.062 272.371 216.927  1.00 58.89           C  
ATOM   1786  P     A A  38     254.999 272.186 214.054  1.00 66.75           P  
ATOM   1787  OP1   A A  38     253.706 271.612 213.605  1.00 64.57           O  
ATOM   1788  OP2   A A  38     256.230 271.923 213.264  1.00 64.43           O1-
ATOM   1789  O5'   A A  38     254.832 273.762 214.182  1.00 61.52           O  
ATOM   1790  C5'   A A  38     253.805 274.314 214.985  1.00 55.74           C  
ATOM   1791  C4'   A A  38     254.062 275.768 215.278  1.00 56.17           C  
ATOM   1792  O4'   A A  38     255.297 275.909 216.023  1.00 61.11           O  
ATOM   1793  C3'   A A  38     254.259 276.673 214.080  1.00 54.54           C  
ATOM   1794  O3'   A A  38     253.043 277.052 213.471  1.00 61.29           O  
ATOM   1795  C2'   A A  38     255.017 277.842 214.683  1.00 57.96           C  
ATOM   1796  O2'   A A  38     254.124 278.668 215.416  1.00 58.47           O  
ATOM   1797  C1'   A A  38     255.928 277.122 215.677  1.00 58.89           C  
ATOM   1798  N9    A A  38     257.268 276.809 215.132  1.00 58.91           N  
ATOM   1799  C8    A A  38     257.669 275.624 214.563  1.00 59.26           C  
ATOM   1800  N7    A A  38     258.925 275.602 214.181  1.00 58.94           N  
ATOM   1801  C5    A A  38     259.397 276.859 214.531  1.00 62.96           C  
ATOM   1802  C6    A A  38     260.661 277.468 214.387  1.00 63.86           C  
ATOM   1803  N6    A A  38     261.719 276.869 213.836  1.00 63.56           N  
ATOM   1804  N1    A A  38     260.803 278.735 214.835  1.00 64.67           N  
ATOM   1805  C2    A A  38     259.741 279.333 215.385  1.00 63.61           C  
ATOM   1806  N3    A A  38     258.507 278.868 215.574  1.00 62.54           N  
ATOM   1807  C4    A A  38     258.392 277.609 215.120  1.00 61.63           C  
ATOM   1808  P     G A  39     253.017 277.410 211.907  1.00 77.12           P  
ATOM   1809  OP1   G A  39     251.642 277.154 211.399  1.00 78.38           O  
ATOM   1810  OP2   G A  39     254.182 276.755 211.253  1.00 65.90           O1-
ATOM   1811  O5'   G A  39     253.283 278.978 211.873  1.00 71.54           O  
ATOM   1812  C5'   G A  39     254.346 279.513 211.100  1.00 70.36           C  
ATOM   1813  C4'   G A  39     255.095 280.562 211.876  1.00 75.21           C  
ATOM   1814  O4'   G A  39     256.116 279.940 212.696  1.00 75.26           O  
ATOM   1815  C3'   G A  39     255.856 281.569 211.044  1.00 77.47           C  
ATOM   1816  O3'   G A  39     255.009 282.584 210.546  1.00 78.86           O  
ATOM   1817  C2'   G A  39     256.931 282.061 212.010  1.00 76.15           C  
ATOM   1818  O2'   G A  39     256.395 283.012 212.922  1.00 68.41           O  
ATOM   1819  C1'   G A  39     257.244 280.783 212.788  1.00 71.01           C  
ATOM   1820  N9    G A  39     258.410 280.043 212.263  1.00 67.45           N  
ATOM   1821  C8    G A  39     258.388 278.761 211.778  1.00 64.48           C  
ATOM   1822  N7    G A  39     259.558 278.338 211.397  1.00 65.90           N  
ATOM   1823  C5    G A  39     260.415 279.398 211.652  1.00 67.78           C  
ATOM   1824  C6    G A  39     261.814 279.523 211.439  1.00 69.64           C  
ATOM   1825  O6    G A  39     262.608 278.703 210.969  1.00 70.64           O  
ATOM   1826  N1    G A  39     262.275 280.766 211.836  1.00 72.50           N  
ATOM   1827  C2    G A  39     261.493 281.761 212.364  1.00 79.57           C  
ATOM   1828  N2    G A  39     262.123 282.903 212.682  1.00 82.48           N  
ATOM   1829  N3    G A  39     260.190 281.660 212.567  1.00 76.77           N  
ATOM   1830  C4    G A  39     259.718 280.457 212.193  1.00 69.85           C  
ATOM   1831  P     U A  40     254.924 282.838 208.967  1.00 81.93           P  
ATOM   1832  OP1   U A  40     253.563 283.361 208.678  1.00 80.52           O  
ATOM   1833  OP2   U A  40     255.426 281.613 208.292  1.00 75.83           O1-
ATOM   1834  O5'   U A  40     255.974 284.013 208.739  1.00 84.11           O  
ATOM   1835  C5'   U A  40     255.961 285.142 209.602  1.00 89.28           C  
ATOM   1836  C4'   U A  40     257.327 285.763 209.770  1.00 88.43           C  
ATOM   1837  O4'   U A  40     258.218 284.884 210.506  1.00 82.36           O  
ATOM   1838  C3'   U A  40     258.088 286.073 208.496  1.00 88.27           C  
ATOM   1839  O3'   U A  40     257.633 287.256 207.865  1.00 89.76           O  
ATOM   1840  C2'   U A  40     259.526 286.172 208.990  1.00 90.51           C  
ATOM   1841  O2'   U A  40     259.768 287.442 209.574  1.00 95.23           O  
ATOM   1842  C1'   U A  40     259.550 285.111 210.098  1.00 79.00           C  
ATOM   1843  N1    U A  40     260.127 283.844 209.619  1.00 74.43           N  
ATOM   1844  C2    U A  40     261.487 283.812 209.367  1.00 79.29           C  
ATOM   1845  O2    U A  40     262.230 284.764 209.528  1.00 81.03           O  
ATOM   1846  N3    U A  40     261.966 282.610 208.917  1.00 80.70           N  
ATOM   1847  C4    U A  40     261.224 281.469 208.701  1.00 81.01           C  
ATOM   1848  O4    U A  40     261.797 280.453 208.295  1.00 81.47           O  
ATOM   1849  C5    U A  40     259.822 281.598 208.982  1.00 76.81           C  
ATOM   1850  C6    U A  40     259.326 282.755 209.422  1.00 71.67           C  
ATOM   1851  P     C A  41     257.619 287.375 206.263  1.00102.20           P  
ATOM   1852  OP1   C A  41     256.978 288.676 205.947  1.00103.02           O  
ATOM   1853  OP2   C A  41     257.043 286.135 205.690  1.00100.86           O1-
ATOM   1854  O5'   C A  41     259.162 287.421 205.855  1.00 94.00           O  
ATOM   1855  C5'   C A  41     259.998 288.492 206.269  1.00 93.91           C  
ATOM   1856  C4'   C A  41     261.398 288.340 205.731  1.00 99.59           C  
ATOM   1857  O4'   C A  41     262.114 287.327 206.486  1.00 97.52           O  
ATOM   1858  C3'   C A  41     261.509 287.866 204.293  1.00103.24           C  
ATOM   1859  O3'   C A  41     261.299 288.894 203.348  1.00104.16           O  
ATOM   1860  C2'   C A  41     262.908 287.264 204.246  1.00 99.59           C  
ATOM   1861  O2'   C A  41     263.897 288.277 204.130  1.00 94.34           O  
ATOM   1862  C1'   C A  41     263.008 286.636 205.636  1.00 96.63           C  
ATOM   1863  N1    C A  41     262.625 285.209 205.614  1.00 90.08           N  
ATOM   1864  C2    C A  41     263.588 284.264 205.253  1.00 88.46           C  
ATOM   1865  O2    C A  41     264.735 284.638 204.968  1.00 92.54           O  
ATOM   1866  N3    C A  41     263.258 282.958 205.223  1.00 85.16           N  
ATOM   1867  C4    C A  41     262.015 282.600 205.534  1.00 86.82           C  
ATOM   1868  N4    C A  41     261.718 281.302 205.492  1.00 89.75           N  
ATOM   1869  C5    C A  41     261.012 283.541 205.901  1.00 87.29           C  
ATOM   1870  C6    C A  41     261.354 284.830 205.927  1.00 86.66           C  
ATOM   1871  P     A A  42     260.917 288.505 201.840  1.00114.60           P  
ATOM   1872  OP1   A A  42     260.386 289.720 201.172  1.00103.71           O  
ATOM   1873  OP2   A A  42     260.095 287.264 201.892  1.00105.91           O1-
ATOM   1874  O5'   A A  42     262.315 288.131 201.177  1.00106.29           O  
ATOM   1875  C5'   A A  42     262.387 287.194 200.116  1.00102.41           C  
ATOM   1876  C4'   A A  42     263.766 286.603 199.997  1.00101.00           C  
ATOM   1877  O4'   A A  42     264.180 286.048 201.280  1.00 95.51           O  
ATOM   1878  C3'   A A  42     263.900 285.431 199.037  1.00102.38           C  
ATOM   1879  O3'   A A  42     263.960 285.810 197.668  1.00106.55           O  
ATOM   1880  C2'   A A  42     265.139 284.726 199.570  1.00 95.63           C  
ATOM   1881  O2'   A A  42     266.314 285.460 199.250  1.00 88.15           O  
ATOM   1882  C1'   A A  42     264.889 284.842 201.073  1.00 95.27           C  
ATOM   1883  N9    A A  42     264.028 283.735 201.538  1.00 94.06           N  
ATOM   1884  C8    A A  42     262.728 283.828 201.976  1.00 93.15           C  
ATOM   1885  N7    A A  42     262.191 282.675 202.302  1.00 92.71           N  
ATOM   1886  C5    A A  42     263.197 281.749 202.059  1.00 90.11           C  
ATOM   1887  C6    A A  42     263.260 280.349 202.205  1.00 87.48           C  
ATOM   1888  N6    A A  42     262.255 279.598 202.649  1.00 89.81           N  
ATOM   1889  N1    A A  42     264.409 279.722 201.878  1.00 88.54           N  
ATOM   1890  C2    A A  42     265.424 280.473 201.430  1.00 93.55           C  
ATOM   1891  N3    A A  42     265.493 281.794 201.247  1.00 94.05           N  
ATOM   1892  C4    A A  42     264.333 282.388 201.584  1.00 93.50           C  
ATOM   1893  P     G A  43     262.984 285.116 196.585  1.00113.18           P  
ATOM   1894  OP1   G A  43     263.086 285.866 195.309  1.00108.88           O  
ATOM   1895  OP2   G A  43     261.645 284.914 197.199  1.00100.93           O1-
ATOM   1896  O5'   G A  43     263.659 283.696 196.327  1.00101.27           O  
ATOM   1897  C5'   G A  43     265.054 283.601 196.070  1.00 99.68           C  
ATOM   1898  C4'   G A  43     265.609 282.242 196.421  1.00 96.50           C  
ATOM   1899  O4'   G A  43     265.255 281.882 197.782  1.00 92.35           O  
ATOM   1900  C3'   G A  43     265.103 281.072 195.593  1.00 97.29           C  
ATOM   1901  O3'   G A  43     265.718 280.997 194.312  1.00103.03           O  
ATOM   1902  C2'   G A  43     265.400 279.878 196.500  1.00 88.13           C  
ATOM   1903  O2'   G A  43     266.772 279.516 196.420  1.00 82.95           O  
ATOM   1904  C1'   G A  43     265.146 280.475 197.892  1.00 88.76           C  
ATOM   1905  N9    G A  43     263.826 280.107 198.472  1.00 85.91           N  
ATOM   1906  C8    G A  43     262.792 280.935 198.867  1.00 84.60           C  
ATOM   1907  N7    G A  43     261.753 280.314 199.363  1.00 78.31           N  
ATOM   1908  C5    G A  43     262.124 278.980 199.306  1.00 81.21           C  
ATOM   1909  C6    G A  43     261.425 277.805 199.695  1.00 85.12           C  
ATOM   1910  O6    G A  43     260.295 277.701 200.191  1.00 83.34           O  
ATOM   1911  N1    G A  43     262.165 276.644 199.463  1.00 85.54           N  
ATOM   1912  C2    G A  43     263.425 276.614 198.919  1.00 83.86           C  
ATOM   1913  N2    G A  43     263.993 275.409 198.766  1.00 83.17           N  
ATOM   1914  N3    G A  43     264.087 277.697 198.557  1.00 83.54           N  
ATOM   1915  C4    G A  43     263.390 278.834 198.772  1.00 83.15           C  
ATOM   1916  P     A A  44     264.838 280.897 192.960  1.00109.15           P  
ATOM   1917  OP1   A A  44     265.756 281.158 191.820  1.00100.29           O  
ATOM   1918  OP2   A A  44     263.604 281.721 193.093  1.00 98.25           O1-
ATOM   1919  O5'   A A  44     264.442 279.355 192.883  1.00 96.32           O  
ATOM   1920  C5'   A A  44     265.439 278.348 192.993  1.00 91.07           C  
ATOM   1921  C4'   A A  44     264.867 277.039 193.481  1.00 90.18           C  
ATOM   1922  O4'   A A  44     264.452 277.146 194.871  1.00 90.34           O  
ATOM   1923  C3'   A A  44     263.611 276.562 192.780  1.00 89.18           C  
ATOM   1924  O3'   A A  44     263.839 275.988 191.514  1.00 89.78           O  
ATOM   1925  C2'   A A  44     263.023 275.597 193.791  1.00 90.11           C  
ATOM   1926  O2'   A A  44     263.775 274.391 193.814  1.00 87.27           O  
ATOM   1927  C1'   A A  44     263.300 276.348 195.088  1.00 87.55           C  
ATOM   1928  N9    A A  44     262.178 277.233 195.473  1.00 84.85           N  
ATOM   1929  C8    A A  44     262.103 278.584 195.254  1.00 86.32           C  
ATOM   1930  N7    A A  44     261.014 279.155 195.704  1.00 82.79           N  
ATOM   1931  C5    A A  44     260.311 278.103 196.259  1.00 81.13           C  
ATOM   1932  C6    A A  44     259.073 278.056 196.911  1.00 81.06           C  
ATOM   1933  N6    A A  44     258.315 279.136 197.097  1.00 79.43           N  
ATOM   1934  N1    A A  44     258.629 276.858 197.353  1.00 80.01           N  
ATOM   1935  C2    A A  44     259.407 275.789 197.154  1.00 79.11           C  
ATOM   1936  N3    A A  44     260.599 275.712 196.563  1.00 82.17           N  
ATOM   1937  C4    A A  44     261.007 276.915 196.128  1.00 82.18           C  
ATOM   1938  P     G A  45     262.761 276.260 190.363  1.00105.12           P  
ATOM   1939  OP1   G A  45     263.199 275.537 189.138  1.00100.71           O  
ATOM   1940  OP2   G A  45     262.549 277.731 190.325  1.00100.10           O1-
ATOM   1941  O5'   G A  45     261.424 275.583 190.909  1.00 86.98           O  
ATOM   1942  C5'   G A  45     261.283 274.174 190.878  1.00 84.21           C  
ATOM   1943  C4'   G A  45     260.103 273.686 191.677  1.00 80.59           C  
ATOM   1944  O4'   G A  45     260.043 274.363 192.953  1.00 83.39           O  
ATOM   1945  C3'   G A  45     258.720 273.903 191.091  1.00 78.86           C  
ATOM   1946  O3'   G A  45     258.396 272.959 190.080  1.00 83.04           O  
ATOM   1947  C2'   G A  45     257.830 273.765 192.326  1.00 78.62           C  
ATOM   1948  O2'   G A  45     257.613 272.399 192.646  1.00 78.02           O  
ATOM   1949  C1'   G A  45     258.713 274.367 193.420  1.00 78.55           C  
ATOM   1950  N9    G A  45     258.291 275.733 193.764  1.00 72.86           N  
ATOM   1951  C8    G A  45     258.730 276.948 193.305  1.00 69.67           C  
ATOM   1952  N7    G A  45     258.070 277.931 193.850  1.00 68.62           N  
ATOM   1953  C5    G A  45     257.143 277.323 194.694  1.00 69.43           C  
ATOM   1954  C6    G A  45     256.149 277.861 195.561  1.00 72.45           C  
ATOM   1955  O6    G A  45     255.858 279.044 195.773  1.00 74.76           O  
ATOM   1956  N1    G A  45     255.446 276.880 196.243  1.00 67.69           N  
ATOM   1957  C2    G A  45     255.674 275.540 196.100  1.00 69.47           C  
ATOM   1958  N2    G A  45     254.890 274.741 196.834  1.00 74.57           N  
ATOM   1959  N3    G A  45     256.589 275.021 195.305  1.00 69.20           N  
ATOM   1960  C4    G A  45     257.277 275.967 194.645  1.00 67.87           C  
ATOM   1961  P     G A  46     258.697 273.231 188.520  1.00 88.50           P  
ATOM   1962  OP1   G A  46     259.487 274.483 188.381  1.00 83.87           O  
ATOM   1963  OP2   G A  46     257.413 273.119 187.785  1.00 81.60           O1-
ATOM   1964  O5'   G A  46     259.551 271.950 188.080  1.00 84.78           O  
ATOM   1965  C5'   G A  46     260.940 271.836 188.382  1.00 86.20           C  
ATOM   1966  C4'   G A  46     261.224 270.831 189.482  1.00 80.43           C  
ATOM   1967  O4'   G A  46     260.005 270.510 190.205  1.00 79.19           O  
ATOM   1968  C3'   G A  46     261.759 269.481 189.037  1.00 74.00           C  
ATOM   1969  O3'   G A  46     263.151 269.505 188.768  1.00 74.07           O  
ATOM   1970  C2'   G A  46     261.371 268.563 190.191  1.00 69.38           C  
ATOM   1971  O2'   G A  46     262.279 268.696 191.273  1.00 66.85           O  
ATOM   1972  C1'   G A  46     260.025 269.155 190.613  1.00 71.83           C  
ATOM   1973  N9    G A  46     258.883 268.473 189.975  1.00 70.83           N  
ATOM   1974  C8    G A  46     258.033 269.054 189.065  1.00 72.34           C  
ATOM   1975  N7    G A  46     257.094 268.254 188.644  1.00 73.29           N  
ATOM   1976  C5    G A  46     257.335 267.068 189.318  1.00 68.94           C  
ATOM   1977  C6    G A  46     256.636 265.841 189.253  1.00 65.15           C  
ATOM   1978  O6    G A  46     255.640 265.560 188.576  1.00 65.84           O  
ATOM   1979  N1    G A  46     257.201 264.893 190.093  1.00 63.76           N  
ATOM   1980  C2    G A  46     258.301 265.109 190.887  1.00 63.10           C  
ATOM   1981  N2    G A  46     258.713 264.081 191.637  1.00 64.60           N  
ATOM   1982  N3    G A  46     258.965 266.248 190.954  1.00 65.84           N  
ATOM   1983  C4    G A  46     258.431 267.182 190.150  1.00 67.93           C  
ATOM   1984  P     C A  47     263.709 268.940 187.371  1.00 85.29           P  
ATOM   1985  OP1   C A  47     265.032 269.563 187.119  1.00 84.06           O  
ATOM   1986  OP2   C A  47     262.642 269.110 186.354  1.00 82.08           O1-
ATOM   1987  O5'   C A  47     263.892 267.369 187.630  1.00 86.39           O  
ATOM   1988  C5'   C A  47     264.767 266.888 188.647  1.00 88.60           C  
ATOM   1989  C4'   C A  47     264.466 265.464 189.079  1.00 82.29           C  
ATOM   1990  O4'   C A  47     263.161 265.376 189.721  1.00 74.51           O  
ATOM   1991  C3'   C A  47     264.397 264.402 187.991  1.00 79.07           C  
ATOM   1992  O3'   C A  47     265.655 264.000 187.485  1.00 77.20           O  
ATOM   1993  C2'   C A  47     263.621 263.292 188.687  1.00 75.65           C  
ATOM   1994  O2'   C A  47     264.445 262.619 189.630  1.00 70.70           O  
ATOM   1995  C1'   C A  47     262.581 264.111 189.451  1.00 71.48           C  
ATOM   1996  N1    C A  47     261.353 264.315 188.640  1.00 70.34           N  
ATOM   1997  C2    C A  47     260.393 263.303 188.605  1.00 66.43           C  
ATOM   1998  O2    C A  47     260.595 262.274 189.262  1.00 69.08           O  
ATOM   1999  N3    C A  47     259.275 263.465 187.868  1.00 60.33           N  
ATOM   2000  C4    C A  47     259.103 264.587 187.183  1.00 59.08           C  
ATOM   2001  N4    C A  47     257.991 264.709 186.473  1.00 63.79           N  
ATOM   2002  C5    C A  47     260.055 265.636 187.177  1.00 64.70           C  
ATOM   2003  C6    C A  47     261.154 265.456 187.912  1.00 71.37           C  
ATOM   2004  P     G A  48     265.873 263.943 185.894  1.00 76.31           P  
ATOM   2005  OP1   G A  48     267.272 263.528 185.624  1.00 75.01           O  
ATOM   2006  OP2   G A  48     265.327 265.204 185.322  1.00 75.15           O1-
ATOM   2007  O5'   G A  48     264.953 262.734 185.423  1.00 70.02           O  
ATOM   2008  C5'   G A  48     265.257 261.417 185.841  1.00 69.66           C  
ATOM   2009  C4'   G A  48     264.229 260.421 185.376  1.00 67.31           C  
ATOM   2010  O4'   G A  48     262.953 260.664 186.027  1.00 66.25           O  
ATOM   2011  C3'   G A  48     263.882 260.447 183.902  1.00 66.79           C  
ATOM   2012  O3'   G A  48     264.866 259.847 183.082  1.00 68.59           O  
ATOM   2013  C2'   G A  48     262.544 259.728 183.889  1.00 64.23           C  
ATOM   2014  O2'   G A  48     262.730 258.335 184.073  1.00 63.27           O  
ATOM   2015  C1'   G A  48     261.902 260.292 185.157  1.00 63.62           C  
ATOM   2016  N9    G A  48     261.100 261.478 184.832  1.00 61.04           N  
ATOM   2017  C8    G A  48     261.408 262.798 185.033  1.00 67.79           C  
ATOM   2018  N7    G A  48     260.485 263.602 184.585  1.00 68.73           N  
ATOM   2019  C5    G A  48     259.523 262.753 184.047  1.00 62.59           C  
ATOM   2020  C6    G A  48     258.288 263.033 183.408  1.00 62.03           C  
ATOM   2021  O6    G A  48     257.758 264.121 183.179  1.00 66.04           O  
ATOM   2022  N1    G A  48     257.626 261.886 183.019  1.00 56.38           N  
ATOM   2023  C2    G A  48     258.103 260.627 183.215  1.00 59.47           C  
ATOM   2024  N2    G A  48     257.324 259.639 182.767  1.00 66.88           N  
ATOM   2025  N3    G A  48     259.246 260.342 183.803  1.00 57.63           N  
ATOM   2026  C4    G A  48     259.897 261.446 184.189  1.00 56.39           C  
ATOM   2027  P     A A  49     265.347 260.583 181.736  1.00 72.91           P  
ATOM   2028  OP1   A A  49     266.748 261.031 181.940  1.00 73.69           O  
ATOM   2029  OP2   A A  49     264.324 261.602 181.381  1.00 66.78           O1-
ATOM   2030  O5'   A A  49     265.350 259.412 180.648  1.00 70.80           O  
ATOM   2031  C5'   A A  49     264.576 258.230 180.853  1.00 65.17           C  
ATOM   2032  C4'   A A  49     264.831 257.175 179.802  1.00 63.63           C  
ATOM   2033  O4'   A A  49     263.896 256.076 179.992  1.00 62.42           O  
ATOM   2034  C3'   A A  49     264.649 257.633 178.360  1.00 67.06           C  
ATOM   2035  O3'   A A  49     265.518 256.879 177.525  1.00 69.73           O  
ATOM   2036  C2'   A A  49     263.216 257.226 178.058  1.00 68.55           C  
ATOM   2037  O2'   A A  49     262.943 257.058 176.683  1.00 67.42           O  
ATOM   2038  C1'   A A  49     263.106 255.912 178.826  1.00 63.37           C  
ATOM   2039  N9    A A  49     261.738 255.554 179.235  1.00 63.32           N  
ATOM   2040  C8    A A  49     261.037 254.455 178.821  1.00 64.43           C  
ATOM   2041  N7    A A  49     259.833 254.361 179.329  1.00 65.73           N  
ATOM   2042  C5    A A  49     259.714 255.477 180.143  1.00 59.87           C  
ATOM   2043  C6    A A  49     258.671 255.951 180.962  1.00 58.02           C  
ATOM   2044  N6    A A  49     257.494 255.348 181.125  1.00 63.61           N  
ATOM   2045  N1    A A  49     258.868 257.080 181.644  1.00 55.93           N  
ATOM   2046  C2    A A  49     260.041 257.686 181.497  1.00 60.49           C  
ATOM   2047  N3    A A  49     261.095 257.350 180.761  1.00 64.96           N  
ATOM   2048  C4    A A  49     260.875 256.216 180.090  1.00 60.32           C  
ATOM   2049  P     U A  50     266.406 257.621 176.417  1.00 79.51           P  
ATOM   2050  OP1   U A  50     265.670 258.827 175.956  1.00 77.90           O  
ATOM   2051  OP2   U A  50     266.791 256.575 175.436  1.00 76.78           O1-
ATOM   2052  O5'   U A  50     267.713 258.078 177.218  1.00 85.68           O  
ATOM   2053  C5'   U A  50     268.522 257.124 177.912  1.00 90.43           C  
ATOM   2054  C4'   U A  50     269.625 257.763 178.741  1.00 95.76           C  
ATOM   2055  O4'   U A  50     270.356 258.733 177.933  1.00100.95           O  
ATOM   2056  C3'   U A  50     269.181 258.516 180.002  1.00 93.96           C  
ATOM   2057  O3'   U A  50     270.202 258.407 181.003  1.00 95.57           O  
ATOM   2058  C2'   U A  50     269.136 259.961 179.515  1.00 95.76           C  
ATOM   2059  O2'   U A  50     269.225 260.938 180.533  1.00 90.94           O  
ATOM   2060  C1'   U A  50     270.349 259.991 178.586  1.00101.39           C  
ATOM   2061  N1    U A  50     270.300 261.049 177.572  1.00102.63           N  
ATOM   2062  C2    U A  50     271.150 262.123 177.756  1.00102.10           C  
ATOM   2063  O2    U A  50     271.916 262.207 178.708  1.00 93.49           O  
ATOM   2064  N3    U A  50     271.054 263.085 176.775  1.00111.86           N  
ATOM   2065  C4    U A  50     270.216 263.072 175.668  1.00112.79           C  
ATOM   2066  O4    U A  50     270.249 264.017 174.875  1.00111.50           O  
ATOM   2067  C5    U A  50     269.367 261.921 175.558  1.00102.63           C  
ATOM   2068  C6    U A  50     269.439 260.971 176.496  1.00101.64           C  
ATOM   2069  P     G A  51     270.122 257.310 182.181  1.00 92.64           P  
ATOM   2070  OP1   G A  51     270.693 257.908 183.421  1.00 78.79           O  
ATOM   2071  OP2   G A  51     270.702 256.054 181.637  1.00 82.42           O1-
ATOM   2072  O5'   G A  51     268.559 257.055 182.381  1.00 82.41           O  
ATOM   2073  C5'   G A  51     267.828 257.662 183.446  1.00 79.25           C  
ATOM   2074  C4'   G A  51     266.861 256.689 184.078  1.00 69.02           C  
ATOM   2075  O4'   G A  51     266.064 256.071 183.030  1.00 63.93           O  
ATOM   2076  C3'   G A  51     267.519 255.550 184.849  1.00 67.74           C  
ATOM   2077  O3'   G A  51     266.765 255.237 186.018  1.00 67.17           O  
ATOM   2078  C2'   G A  51     267.493 254.387 183.857  1.00 62.93           C  
ATOM   2079  O2'   G A  51     267.467 253.110 184.455  1.00 61.94           O  
ATOM   2080  C1'   G A  51     266.222 254.665 183.052  1.00 59.89           C  
ATOM   2081  N9    G A  51     266.312 254.207 181.659  1.00 61.06           N  
ATOM   2082  C8    G A  51     267.382 254.431 180.828  1.00 68.12           C  
ATOM   2083  N7    G A  51     267.250 253.930 179.630  1.00 70.00           N  
ATOM   2084  C5    G A  51     266.004 253.326 179.661  1.00 66.26           C  
ATOM   2085  C6    G A  51     265.317 252.614 178.643  1.00 64.62           C  
ATOM   2086  O6    G A  51     265.697 252.379 177.489  1.00 62.49           O  
ATOM   2087  N1    G A  51     264.075 252.159 179.082  1.00 65.06           N  
ATOM   2088  C2    G A  51     263.556 252.357 180.343  1.00 61.78           C  
ATOM   2089  N2    G A  51     262.339 251.841 180.596  1.00 56.41           N  
ATOM   2090  N3    G A  51     264.198 253.024 181.293  1.00 61.42           N  
ATOM   2091  C4    G A  51     265.407 253.483 180.900  1.00 62.68           C  
ATOM   2092  P     A A  52     267.527 255.041 187.423  1.00 86.35           P  
ATOM   2093  OP1   A A  52     268.960 255.394 187.233  1.00 83.32           O  
ATOM   2094  OP2   A A  52     267.175 253.690 187.933  1.00 74.66           O1-
ATOM   2095  O5'   A A  52     266.865 256.123 188.390  1.00 66.17           O  
ATOM   2096  C5'   A A  52     267.038 257.509 188.152  1.00 65.96           C  
ATOM   2097  C4'   A A  52     265.797 258.286 188.508  1.00 69.49           C  
ATOM   2098  O4'   A A  52     264.710 257.904 187.638  1.00 62.48           O  
ATOM   2099  C3'   A A  52     265.263 258.063 189.915  1.00 65.26           C  
ATOM   2100  O3'   A A  52     265.908 258.904 190.853  1.00 63.44           O  
ATOM   2101  C2'   A A  52     263.768 258.351 189.789  1.00 62.04           C  
ATOM   2102  O2'   A A  52     263.510 259.734 189.978  1.00 61.93           O  
ATOM   2103  C1'   A A  52     263.484 257.995 188.325  1.00 62.28           C  
ATOM   2104  N9    A A  52     262.735 256.740 188.118  1.00 58.40           N  
ATOM   2105  C8    A A  52     263.171 255.734 187.311  1.00 60.46           C  
ATOM   2106  N7    A A  52     262.348 254.727 187.216  1.00 57.57           N  
ATOM   2107  C5    A A  52     261.287 255.104 187.998  1.00 49.65           C  
ATOM   2108  C6    A A  52     260.108 254.434 188.277  1.00 48.72           C  
ATOM   2109  N6    A A  52     259.842 253.231 187.770  1.00 52.80           N  
ATOM   2110  N1    A A  52     259.233 255.044 189.088  1.00 54.36           N  
ATOM   2111  C2    A A  52     259.556 256.250 189.563  1.00 57.64           C  
ATOM   2112  N3    A A  52     260.643 256.989 189.367  1.00 57.72           N  
ATOM   2113  C4    A A  52     261.491 256.346 188.558  1.00 54.13           C  
ATOM   2114  P     A A  53     266.390 258.307 192.255  1.00 69.32           P  
ATOM   2115  OP1   A A  53     267.201 259.329 192.970  1.00 69.24           O  
ATOM   2116  OP2   A A  53     266.925 256.944 191.971  1.00 65.56           O1-
ATOM   2117  O5'   A A  53     265.047 258.206 193.092  1.00 62.01           O  
ATOM   2118  C5'   A A  53     264.391 259.390 193.499  1.00 64.86           C  
ATOM   2119  C4'   A A  53     262.979 259.120 193.937  1.00 63.03           C  
ATOM   2120  O4'   A A  53     262.222 258.532 192.848  1.00 60.58           O  
ATOM   2121  C3'   A A  53     262.812 258.123 195.065  1.00 61.07           C  
ATOM   2122  O3'   A A  53     263.108 258.670 196.335  1.00 65.61           O  
ATOM   2123  C2'   A A  53     261.365 257.696 194.893  1.00 63.84           C  
ATOM   2124  O2'   A A  53     260.492 258.728 195.334  1.00 61.46           O  
ATOM   2125  C1'   A A  53     261.272 257.626 193.370  1.00 64.27           C  
ATOM   2126  N9    A A  53     261.551 256.272 192.831  1.00 63.14           N  
ATOM   2127  C8    A A  53     262.709 255.787 192.270  1.00 61.44           C  
ATOM   2128  N7    A A  53     262.634 254.543 191.862  1.00 56.46           N  
ATOM   2129  C5    A A  53     261.334 254.178 192.164  1.00 52.97           C  
ATOM   2130  C6    A A  53     260.608 252.989 191.989  1.00 55.42           C  
ATOM   2131  N6    A A  53     261.105 251.886 191.444  1.00 61.16           N  
ATOM   2132  N1    A A  53     259.329 252.942 192.400  1.00 54.93           N  
ATOM   2133  C2    A A  53     258.817 254.038 192.957  1.00 60.04           C  
ATOM   2134  N3    A A  53     259.389 255.216 193.177  1.00 62.17           N  
ATOM   2135  C4    A A  53     260.663 255.224 192.756  1.00 58.60           C  
ATOM   2136  P     G A  54     264.413 258.173 197.130  1.00 75.31           P  
ATOM   2137  OP1   G A  54     264.521 258.969 198.375  1.00 74.17           O  
ATOM   2138  OP2   G A  54     265.571 258.146 196.197  1.00 69.60           O1-
ATOM   2139  O5'   G A  54     264.040 256.689 197.560  1.00 65.39           O  
ATOM   2140  C5'   G A  54     262.892 256.446 198.356  1.00 62.62           C  
ATOM   2141  C4'   G A  54     262.366 255.051 198.160  1.00 66.49           C  
ATOM   2142  O4'   G A  54     262.058 254.840 196.757  1.00 64.77           O  
ATOM   2143  C3'   G A  54     263.320 253.914 198.499  1.00 73.19           C  
ATOM   2144  O3'   G A  54     263.411 253.650 199.896  1.00 78.71           O  
ATOM   2145  C2'   G A  54     262.751 252.761 197.675  1.00 68.99           C  
ATOM   2146  O2'   G A  54     261.599 252.207 198.296  1.00 62.50           O  
ATOM   2147  C1'   G A  54     262.312 253.496 196.407  1.00 66.34           C  
ATOM   2148  N9    G A  54     263.362 253.469 195.377  1.00 61.28           N  
ATOM   2149  C8    G A  54     264.163 254.494 194.950  1.00 60.70           C  
ATOM   2150  N7    G A  54     265.006 254.122 194.024  1.00 59.24           N  
ATOM   2151  C5    G A  54     264.742 252.774 193.834  1.00 56.41           C  
ATOM   2152  C6    G A  54     265.326 251.823 192.961  1.00 55.55           C  
ATOM   2153  O6    G A  54     266.235 252.001 192.145  1.00 58.28           O  
ATOM   2154  N1    G A  54     264.760 250.560 193.092  1.00 52.60           N  
ATOM   2155  C2    G A  54     263.746 250.258 193.964  1.00 54.92           C  
ATOM   2156  N2    G A  54     263.305 248.994 193.963  1.00 54.48           N  
ATOM   2157  N3    G A  54     263.192 251.130 194.787  1.00 59.63           N  
ATOM   2158  C4    G A  54     263.734 252.359 194.666  1.00 58.78           C  
ATOM   2159  P     G A  55     264.814 253.226 200.579  1.00 95.07           P  
ATOM   2160  OP1   G A  55     264.819 253.763 201.967  1.00 87.27           O  
ATOM   2161  OP2   G A  55     265.931 253.610 199.667  1.00 76.75           O1-
ATOM   2162  O5'   G A  55     264.703 251.636 200.695  1.00 81.56           O  
ATOM   2163  C5'   G A  55     265.757 250.774 200.283  1.00 76.53           C  
ATOM   2164  C4'   G A  55     265.250 249.689 199.360  1.00 66.36           C  
ATOM   2165  O4'   G A  55     265.058 250.226 198.028  1.00 62.36           O  
ATOM   2166  C3'   G A  55     266.178 248.503 199.162  1.00 58.47           C  
ATOM   2167  O3'   G A  55     266.030 247.547 200.200  1.00 61.52           O  
ATOM   2168  C2'   G A  55     265.763 247.965 197.795  1.00 54.95           C  
ATOM   2169  O2'   G A  55     264.623 247.129 197.929  1.00 53.34           O  
ATOM   2170  C1'   G A  55     265.330 249.237 197.061  1.00 57.61           C  
ATOM   2171  N9    G A  55     266.321 249.767 196.093  1.00 53.36           N  
ATOM   2172  C8    G A  55     266.670 251.092 196.039  1.00 52.76           C  
ATOM   2173  N7    G A  55     267.530 251.373 195.105  1.00 55.37           N  
ATOM   2174  C5    G A  55     267.757 250.159 194.474  1.00 52.33           C  
ATOM   2175  C6    G A  55     268.614 249.866 193.380  1.00 49.42           C  
ATOM   2176  O6    G A  55     269.348 250.625 192.739  1.00 49.27           O  
ATOM   2177  N1    G A  55     268.575 248.541 193.034  1.00 46.40           N  
ATOM   2178  C2    G A  55     267.804 247.631 193.670  1.00 44.68           C  
ATOM   2179  N2    G A  55     267.907 246.405 193.176  1.00 50.47           N  
ATOM   2180  N3    G A  55     267.000 247.868 194.688  1.00 46.06           N  
ATOM   2181  C4    G A  55     267.014 249.158 195.056  1.00 49.38           C  
ATOM   2182  P     A A  56     267.311 246.970 200.982  1.00 66.32           P  
ATOM   2183  OP1   A A  56     266.896 246.486 202.326  1.00 60.60           O  
ATOM   2184  OP2   A A  56     268.332 248.050 200.901  1.00 61.16           O1-
ATOM   2185  O5'   A A  56     267.747 245.692 200.119  1.00 61.43           O  
ATOM   2186  C5'   A A  56     266.826 244.640 199.837  1.00 54.32           C  
ATOM   2187  C4'   A A  56     267.271 243.786 198.671  1.00 50.96           C  
ATOM   2188  O4'   A A  56     267.168 244.535 197.437  1.00 54.16           O  
ATOM   2189  C3'   A A  56     268.716 243.324 198.708  1.00 52.00           C  
ATOM   2190  O3'   A A  56     268.891 242.172 199.502  1.00 58.80           O  
ATOM   2191  C2'   A A  56     269.049 243.094 197.240  1.00 50.26           C  
ATOM   2192  O2'   A A  56     268.565 241.837 196.801  1.00 50.92           O  
ATOM   2193  C1'   A A  56     268.226 244.186 196.566  1.00 54.42           C  
ATOM   2194  N9    A A  56     269.014 245.401 196.262  1.00 57.95           N  
ATOM   2195  C8    A A  56     268.783 246.670 196.735  1.00 56.67           C  
ATOM   2196  N7    A A  56     269.615 247.575 196.286  1.00 53.33           N  
ATOM   2197  C5    A A  56     270.456 246.863 195.451  1.00 53.34           C  
ATOM   2198  C6    A A  56     271.552 247.253 194.670  1.00 51.99           C  
ATOM   2199  N6    A A  56     271.989 248.506 194.622  1.00 53.58           N  
ATOM   2200  N1    A A  56     272.187 246.314 193.941  1.00 55.15           N  
ATOM   2201  C2    A A  56     271.728 245.057 194.004  1.00 56.33           C  
ATOM   2202  N3    A A  56     270.710 244.557 194.705  1.00 58.63           N  
ATOM   2203  C4    A A  56     270.100 245.524 195.418  1.00 59.02           C  
ATOM   2204  P     C A  57     270.189 242.044 200.432  1.00 75.33           P  
ATOM   2205  OP1   C A  57     270.096 240.773 201.202  1.00 67.50           O  
ATOM   2206  OP2   C A  57     270.348 243.340 201.150  1.00 62.74           O1-
ATOM   2207  O5'   C A  57     271.385 241.868 199.394  1.00 64.95           O  
ATOM   2208  C5'   C A  57     271.567 240.645 198.699  1.00 59.08           C  
ATOM   2209  C4'   C A  57     272.425 240.819 197.471  1.00 62.57           C  
ATOM   2210  O4'   C A  57     271.997 241.981 196.707  1.00 60.58           O  
ATOM   2211  C3'   C A  57     273.905 241.070 197.702  1.00 67.03           C  
ATOM   2212  O3'   C A  57     274.625 239.894 198.042  1.00 71.61           O  
ATOM   2213  C2'   C A  57     274.328 241.692 196.376  1.00 63.87           C  
ATOM   2214  O2'   C A  57     274.430 240.697 195.367  1.00 62.60           O  
ATOM   2215  C1'   C A  57     273.111 242.560 196.054  1.00 57.21           C  
ATOM   2216  N1    C A  57     273.277 243.952 196.532  1.00 54.71           N  
ATOM   2217  C2    C A  57     274.181 244.811 195.899  1.00 51.72           C  
ATOM   2218  O2    C A  57     274.831 244.400 194.934  1.00 55.22           O  
ATOM   2219  N3    C A  57     274.318 246.081 196.336  1.00 54.47           N  
ATOM   2220  C4    C A  57     273.599 246.504 197.372  1.00 55.87           C  
ATOM   2221  N4    C A  57     273.767 247.760 197.779  1.00 57.49           N  
ATOM   2222  C5    C A  57     272.674 245.662 198.041  1.00 56.46           C  
ATOM   2223  C6    C A  57     272.548 244.409 197.588  1.00 58.64           C  
ATOM   2224  P     G A  58     275.869 239.952 199.066  1.00 78.26           P  
ATOM   2225  OP1   G A  58     276.573 238.651 198.946  1.00 70.92           O  
ATOM   2226  OP2   G A  58     275.393 240.406 200.399  1.00 70.48           O1-
ATOM   2227  O5'   G A  58     276.809 241.101 198.481  1.00 67.75           O  
ATOM   2228  C5'   G A  58     278.082 240.801 197.929  1.00 62.57           C  
ATOM   2229  C4'   G A  58     278.422 241.721 196.782  1.00 59.46           C  
ATOM   2230  O4'   G A  58     277.356 242.688 196.577  1.00 59.49           O  
ATOM   2231  C3'   G A  58     279.655 242.583 196.969  1.00 62.43           C  
ATOM   2232  O3'   G A  58     280.869 241.886 196.749  1.00 63.70           O  
ATOM   2233  C2'   G A  58     279.405 243.725 195.990  1.00 61.29           C  
ATOM   2234  O2'   G A  58     279.660 243.302 194.658  1.00 59.40           O  
ATOM   2235  C1'   G A  58     277.900 243.921 196.142  1.00 56.14           C  
ATOM   2236  N9    G A  58     277.551 244.966 197.130  1.00 55.56           N  
ATOM   2237  C8    G A  58     276.898 244.686 198.297  1.00 57.01           C  
ATOM   2238  N7    G A  58     276.673 245.737 199.024  1.00 60.70           N  
ATOM   2239  C5    G A  58     277.200 246.796 198.302  1.00 57.66           C  
ATOM   2240  C6    G A  58     277.229 248.182 198.626  1.00 57.58           C  
ATOM   2241  O6    G A  58     276.798 248.771 199.624  1.00 61.58           O  
ATOM   2242  N1    G A  58     277.839 248.927 197.650  1.00 53.07           N  
ATOM   2243  C2    G A  58     278.351 248.397 196.515  1.00 53.68           C  
ATOM   2244  N2    G A  58     278.896 249.309 195.710  1.00 60.61           N  
ATOM   2245  N3    G A  58     278.338 247.111 196.188  1.00 55.06           N  
ATOM   2246  C4    G A  58     277.745 246.346 197.123  1.00 54.82           C  
ATOM   2247  P     U A  59     282.017 241.894 197.879  1.00 71.93           P  
ATOM   2248  OP1   U A  59     283.067 240.930 197.470  1.00 71.11           O  
ATOM   2249  OP2   U A  59     281.362 241.760 199.206  1.00 64.49           O1-
ATOM   2250  O5'   U A  59     282.662 243.350 197.784  1.00 68.17           O  
ATOM   2251  C5'   U A  59     283.241 243.816 196.573  1.00 65.48           C  
ATOM   2252  C4'   U A  59     283.476 245.305 196.613  1.00 61.00           C  
ATOM   2253  O4'   U A  59     282.210 246.008 196.641  1.00 56.57           O  
ATOM   2254  C3'   U A  59     284.205 245.824 197.836  1.00 61.99           C  
ATOM   2255  O3'   U A  59     285.609 245.650 197.748  1.00 68.92           O  
ATOM   2256  C2'   U A  59     283.777 247.281 197.881  1.00 57.01           C  
ATOM   2257  O2'   U A  59     284.509 248.036 196.931  1.00 64.20           O  
ATOM   2258  C1'   U A  59     282.336 247.191 197.395  1.00 51.84           C  
ATOM   2259  N1    U A  59     281.378 247.163 198.515  1.00 50.45           N  
ATOM   2260  C2    U A  59     280.921 248.384 198.952  1.00 56.61           C  
ATOM   2261  O2    U A  59     281.270 249.436 198.462  1.00 62.56           O  
ATOM   2262  N3    U A  59     280.034 248.355 199.986  1.00 57.14           N  
ATOM   2263  C4    U A  59     279.568 247.234 200.621  1.00 56.89           C  
ATOM   2264  O4    U A  59     278.766 247.372 201.547  1.00 57.67           O  
ATOM   2265  C5    U A  59     280.092 246.001 200.113  1.00 55.02           C  
ATOM   2266  C6    U A  59     280.963 246.003 199.104  1.00 53.97           C  
ATOM   2267  P     G A  60     286.425 244.987 198.965  1.00 82.52           P  
ATOM   2268  OP1   G A  60     287.672 244.391 198.417  1.00 70.87           O  
ATOM   2269  OP2   G A  60     285.473 244.155 199.752  1.00 74.37           O1-
ATOM   2270  O5'   G A  60     286.839 246.226 199.874  1.00 70.20           O  
ATOM   2271  C5'   G A  60     287.432 247.378 199.292  1.00 70.18           C  
ATOM   2272  C4'   G A  60     288.230 248.171 200.294  1.00 71.35           C  
ATOM   2273  O4'   G A  60     287.353 248.660 201.344  1.00 69.02           O  
ATOM   2274  C3'   G A  60     289.345 247.410 201.002  1.00 74.11           C  
ATOM   2275  O3'   G A  60     290.388 248.335 201.294  1.00 75.20           O  
ATOM   2276  C2'   G A  60     288.678 246.991 202.305  1.00 69.57           C  
ATOM   2277  O2'   G A  60     289.573 246.708 203.359  1.00 74.20           O  
ATOM   2278  C1'   G A  60     287.829 248.217 202.599  1.00 67.62           C  
ATOM   2279  N9    G A  60     286.667 247.954 203.426  1.00 65.92           N  
ATOM   2280  C8    G A  60     286.089 246.755 203.728  1.00 72.89           C  
ATOM   2281  N7    G A  60     285.036 246.896 204.487  1.00 73.18           N  
ATOM   2282  C5    G A  60     284.928 248.267 204.669  1.00 65.62           C  
ATOM   2283  C6    G A  60     283.983 249.021 205.396  1.00 63.88           C  
ATOM   2284  O6    G A  60     283.018 248.606 206.049  1.00 65.03           O  
ATOM   2285  N1    G A  60     284.263 250.380 205.309  1.00 61.89           N  
ATOM   2286  C2    G A  60     285.310 250.925 204.611  1.00 60.14           C  
ATOM   2287  N2    G A  60     285.414 252.254 204.640  1.00 67.56           N  
ATOM   2288  N3    G A  60     286.195 250.236 203.932  1.00 57.88           N  
ATOM   2289  C4    G A  60     285.931 248.930 204.014  1.00 61.25           C  
ATOM   2290  P     C A  61     291.907 247.963 200.960  1.00 81.62           P  
ATOM   2291  OP1   C A  61     292.727 249.171 201.232  1.00 79.62           O  
ATOM   2292  OP2   C A  61     291.969 247.320 199.620  1.00 78.68           O1-
ATOM   2293  O5'   C A  61     292.248 246.860 202.054  1.00 77.07           O  
ATOM   2294  C5'   C A  61     293.076 245.754 201.747  1.00 73.34           C  
ATOM   2295  C4'   C A  61     293.519 245.065 203.006  1.00 72.24           C  
ATOM   2296  O4'   C A  61     294.271 246.003 203.809  1.00 71.08           O  
ATOM   2297  C3'   C A  61     292.395 244.601 203.916  1.00 77.70           C  
ATOM   2298  O3'   C A  61     291.888 243.328 203.538  1.00 83.79           O  
ATOM   2299  C2'   C A  61     293.039 244.626 205.299  1.00 76.32           C  
ATOM   2300  O2'   C A  61     293.807 243.454 205.526  1.00 78.08           O  
ATOM   2301  C1'   C A  61     293.993 245.812 205.174  1.00 70.16           C  
ATOM   2302  N1    C A  61     293.427 247.073 205.692  1.00 70.22           N  
ATOM   2303  C2    C A  61     293.350 247.273 207.062  1.00 76.09           C  
ATOM   2304  O2    C A  61     293.738 246.382 207.826  1.00 83.73           O  
ATOM   2305  N3    C A  61     292.851 248.432 207.529  1.00 76.58           N  
ATOM   2306  C4    C A  61     292.445 249.369 206.683  1.00 72.43           C  
ATOM   2307  N4    C A  61     291.958 250.496 207.199  1.00 74.70           N  
ATOM   2308  C5    C A  61     292.515 249.196 205.278  1.00 71.64           C  
ATOM   2309  C6    C A  61     293.016 248.044 204.832  1.00 70.86           C  
ATOM   2310  P     U A  62     290.303 243.065 203.430  1.00 84.69           P  
ATOM   2311  OP1   U A  62     290.076 241.599 203.282  1.00 76.31           O  
ATOM   2312  OP2   U A  62     289.724 244.021 202.450  1.00 79.47           O1-
ATOM   2313  O5'   U A  62     289.785 243.424 204.881  1.00 81.74           O  
ATOM   2314  C5'   U A  62     290.231 242.653 205.984  1.00 88.33           C  
ATOM   2315  C4'   U A  62     289.146 242.488 207.005  1.00 95.60           C  
ATOM   2316  O4'   U A  62     289.185 243.626 207.896  1.00 92.61           O  
ATOM   2317  C3'   U A  62     287.735 242.405 206.433  1.00 91.90           C  
ATOM   2318  O3'   U A  62     286.991 241.360 207.040  1.00 88.24           O  
ATOM   2319  C2'   U A  62     287.111 243.761 206.745  1.00 90.01           C  
ATOM   2320  O2'   U A  62     285.737 243.698 207.075  1.00 82.71           O  
ATOM   2321  C1'   U A  62     287.941 244.284 207.924  1.00 90.29           C  
ATOM   2322  N1    U A  62     288.227 245.716 207.789  1.00 89.29           N  
ATOM   2323  C2    U A  62     287.195 246.575 208.089  1.00 91.01           C  
ATOM   2324  O2    U A  62     286.104 246.176 208.471  1.00 88.58           O  
ATOM   2325  N3    U A  62     287.491 247.903 207.924  1.00 86.36           N  
ATOM   2326  C4    U A  62     288.683 248.438 207.495  1.00 82.55           C  
ATOM   2327  O4    U A  62     288.767 249.664 207.410  1.00 83.91           O  
ATOM   2328  C5    U A  62     289.707 247.478 207.195  1.00 82.86           C  
ATOM   2329  C6    U A  62     289.450 246.175 207.347  1.00 84.66           C  
ATOM   2330  P     A A  63     286.380 240.226 206.087  1.00 90.18           P  
ATOM   2331  OP1   A A  63     287.271 239.039 206.155  1.00 91.11           O  
ATOM   2332  OP2   A A  63     286.091 240.825 204.758  1.00 85.81           O1-
ATOM   2333  O5'   A A  63     284.987 239.885 206.761  1.00 87.45           O  
ATOM   2334  C5'   A A  63     284.754 238.609 207.325  1.00 87.26           C  
ATOM   2335  C4'   A A  63     283.866 238.725 208.526  1.00 77.41           C  
ATOM   2336  O4'   A A  63     284.671 238.975 209.702  1.00 81.28           O  
ATOM   2337  C3'   A A  63     282.898 239.894 208.495  1.00 77.39           C  
ATOM   2338  O3'   A A  63     281.745 239.640 207.719  1.00 77.21           O  
ATOM   2339  C2'   A A  63     282.607 240.107 209.967  1.00 82.46           C  
ATOM   2340  O2'   A A  63     281.730 239.096 210.441  1.00 83.70           O  
ATOM   2341  C1'   A A  63     283.984 239.849 210.571  1.00 85.41           C  
ATOM   2342  N9    A A  63     284.774 241.087 210.716  1.00 90.48           N  
ATOM   2343  C8    A A  63     285.945 241.409 210.074  1.00 93.95           C  
ATOM   2344  N7    A A  63     286.426 242.577 210.427  1.00 95.80           N  
ATOM   2345  C5    A A  63     285.516 243.054 211.357  1.00 89.46           C  
ATOM   2346  C6    A A  63     285.462 244.240 212.100  1.00 83.76           C  
ATOM   2347  N6    A A  63     286.383 245.200 212.019  1.00 87.57           N  
ATOM   2348  N1    A A  63     284.418 244.406 212.935  1.00 81.40           N  
ATOM   2349  C2    A A  63     283.500 243.437 213.014  1.00 77.36           C  
ATOM   2350  N3    A A  63     283.444 242.278 212.373  1.00 77.10           N  
ATOM   2351  C4    A A  63     284.494 242.146 211.550  1.00 84.02           C  
ATOM   2352  P     A A  64     281.129 240.804 206.799  1.00 83.48           P  
ATOM   2353  OP1   A A  64     280.314 240.137 205.748  1.00 77.94           O  
ATOM   2354  OP2   A A  64     282.231 241.734 206.425  1.00 82.36           O1-
ATOM   2355  O5'   A A  64     280.134 241.589 207.766  1.00 73.02           O  
ATOM   2356  C5'   A A  64     278.904 241.009 208.169  1.00 67.11           C  
ATOM   2357  C4'   A A  64     278.451 241.555 209.494  1.00 62.73           C  
ATOM   2358  O4'   A A  64     279.595 241.752 210.364  1.00 71.01           O  
ATOM   2359  C3'   A A  64     277.790 242.916 209.452  1.00 62.89           C  
ATOM   2360  O3'   A A  64     276.432 242.847 209.077  1.00 66.72           O  
ATOM   2361  C2'   A A  64     277.998 243.431 210.865  1.00 71.34           C  
ATOM   2362  O2'   A A  64     277.064 242.833 211.749  1.00 74.37           O  
ATOM   2363  C1'   A A  64     279.388 242.879 211.186  1.00 73.00           C  
ATOM   2364  N9    A A  64     280.455 243.863 210.908  1.00 73.94           N  
ATOM   2365  C8    A A  64     281.471 243.743 209.991  1.00 78.68           C  
ATOM   2366  N7    A A  64     282.284 244.772 209.938  1.00 76.56           N  
ATOM   2367  C5    A A  64     281.768 245.632 210.889  1.00 71.40           C  
ATOM   2368  C6    A A  64     282.181 246.895 211.318  1.00 71.08           C  
ATOM   2369  N6    A A  64     283.236 247.523 210.809  1.00 71.22           N  
ATOM   2370  N1    A A  64     281.461 247.507 212.280  1.00 74.89           N  
ATOM   2371  C2    A A  64     280.399 246.860 212.778  1.00 75.82           C  
ATOM   2372  N3    A A  64     279.908 245.665 212.460  1.00 73.83           N  
ATOM   2373  C4    A A  64     280.649 245.092 211.498  1.00 73.16           C  
ATOM   2374  P     U A  65     275.973 243.468 207.676  1.00 80.21           P  
ATOM   2375  OP1   U A  65     274.974 242.546 207.072  1.00 80.51           O  
ATOM   2376  OP2   U A  65     277.208 243.806 206.920  1.00 71.12           O1-
ATOM   2377  O5'   U A  65     275.238 244.821 208.077  1.00 68.83           O  
ATOM   2378  C5'   U A  65     274.229 244.819 209.066  1.00 60.14           C  
ATOM   2379  C4'   U A  65     274.314 246.045 209.929  1.00 66.37           C  
ATOM   2380  O4'   U A  65     275.506 245.998 210.763  1.00 67.32           O  
ATOM   2381  C3'   U A  65     274.447 247.374 209.205  1.00 74.34           C  
ATOM   2382  O3'   U A  65     273.247 247.843 208.603  1.00 78.15           O  
ATOM   2383  C2'   U A  65     274.989 248.271 210.312  1.00 75.81           C  
ATOM   2384  O2'   U A  65     273.961 248.616 211.228  1.00 81.45           O  
ATOM   2385  C1'   U A  65     275.962 247.316 211.012  1.00 67.13           C  
ATOM   2386  N1    U A  65     277.334 247.489 210.472  1.00 66.83           N  
ATOM   2387  C2    U A  65     278.072 248.532 210.989  1.00 67.78           C  
ATOM   2388  O2    U A  65     277.639 249.245 211.871  1.00 71.64           O  
ATOM   2389  N3    U A  65     279.329 248.708 210.456  1.00 66.10           N  
ATOM   2390  C4    U A  65     279.918 247.965 209.460  1.00 62.80           C  
ATOM   2391  O4    U A  65     281.056 248.235 209.081  1.00 63.47           O  
ATOM   2392  C5    U A  65     279.091 246.916 208.962  1.00 67.11           C  
ATOM   2393  C6    U A  65     277.862 246.721 209.462  1.00 69.07           C  
ATOM   2394  P     C A  66     273.296 248.690 207.226  1.00 91.21           P  
ATOM   2395  OP1   C A  66     271.909 248.800 206.700  1.00 86.36           O  
ATOM   2396  OP2   C A  66     274.358 248.140 206.348  1.00 79.92           O1-
ATOM   2397  O5'   C A  66     273.762 250.142 207.680  1.00 74.52           O  
ATOM   2398  C5'   C A  66     273.026 250.855 208.658  1.00 78.24           C  
ATOM   2399  C4'   C A  66     273.792 252.043 209.168  1.00 72.21           C  
ATOM   2400  O4'   C A  66     275.037 251.602 209.761  1.00 68.72           O  
ATOM   2401  C3'   C A  66     274.222 253.051 208.119  1.00 69.39           C  
ATOM   2402  O3'   C A  66     273.188 253.951 207.758  1.00 75.23           O  
ATOM   2403  C2'   C A  66     275.406 253.733 208.780  1.00 67.64           C  
ATOM   2404  O2'   C A  66     274.951 254.693 209.721  1.00 66.79           O  
ATOM   2405  C1'   C A  66     276.040 252.568 209.543  1.00 68.76           C  
ATOM   2406  N1    C A  66     277.147 251.927 208.798  1.00 65.53           N  
ATOM   2407  C2    C A  66     278.428 252.486 208.819  1.00 64.53           C  
ATOM   2408  O2    C A  66     278.624 253.531 209.452  1.00 70.33           O  
ATOM   2409  N3    C A  66     279.426 251.885 208.145  1.00 61.48           N  
ATOM   2410  C4    C A  66     279.183 250.766 207.475  1.00 59.07           C  
ATOM   2411  N4    C A  66     280.189 250.195 206.823  1.00 61.91           N  
ATOM   2412  C5    C A  66     277.900 250.169 207.437  1.00 65.35           C  
ATOM   2413  C6    C A  66     276.920 250.776 208.110  1.00 66.32           C  
ATOM   2414  P     U A  67     272.838 254.196 206.209  1.00 90.31           P  
ATOM   2415  OP1   U A  67     271.523 254.882 206.139  1.00 80.40           O  
ATOM   2416  OP2   U A  67     272.980 252.888 205.510  1.00 77.63           O1-
ATOM   2417  O5'   U A  67     273.973 255.213 205.715  1.00 76.20           O  
ATOM   2418  C5'   U A  67     274.163 256.462 206.372  1.00 73.27           C  
ATOM   2419  C4'   U A  67     275.463 257.137 205.999  1.00 73.90           C  
ATOM   2420  O4'   U A  67     276.584 256.464 206.629  1.00 73.03           O  
ATOM   2421  C3'   U A  67     275.836 257.168 204.524  1.00 72.40           C  
ATOM   2422  O3'   U A  67     275.167 258.178 203.795  1.00 74.91           O  
ATOM   2423  C2'   U A  67     277.340 257.379 204.575  1.00 71.54           C  
ATOM   2424  O2'   U A  67     277.641 258.737 204.864  1.00 68.01           O  
ATOM   2425  C1'   U A  67     277.716 256.526 205.786  1.00 71.67           C  
ATOM   2426  N1    U A  67     278.067 255.146 205.392  1.00 64.51           N  
ATOM   2427  C2    U A  67     279.279 254.906 204.792  1.00 61.92           C  
ATOM   2428  O2    U A  67     280.095 255.778 204.566  1.00 67.70           O  
ATOM   2429  N3    U A  67     279.499 253.597 204.454  1.00 61.10           N  
ATOM   2430  C4    U A  67     278.665 252.520 204.659  1.00 59.97           C  
ATOM   2431  O4    U A  67     279.000 251.392 204.303  1.00 63.50           O  
ATOM   2432  C5    U A  67     277.438 252.852 205.284  1.00 66.01           C  
ATOM   2433  C6    U A  67     277.193 254.118 205.617  1.00 67.96           C  
ATOM   2434  P     G A  68     274.580 257.848 202.339  1.00 85.43           P  
ATOM   2435  OP1   G A  68     273.693 258.974 201.935  1.00 83.77           O  
ATOM   2436  OP2   G A  68     274.058 256.456 202.385  1.00 73.93           O1-
ATOM   2437  O5'   G A  68     275.859 257.845 201.391  1.00 74.20           O  
ATOM   2438  C5'   G A  68     276.691 258.988 201.282  1.00 71.71           C  
ATOM   2439  C4'   G A  68     278.053 258.614 200.759  1.00 72.91           C  
ATOM   2440  O4'   G A  68     278.674 257.675 201.671  1.00 69.85           O  
ATOM   2441  C3'   G A  68     278.085 257.902 199.411  1.00 75.30           C  
ATOM   2442  O3'   G A  68     278.031 258.799 198.311  1.00 80.96           O  
ATOM   2443  C2'   G A  68     279.392 257.122 199.468  1.00 69.27           C  
ATOM   2444  O2'   G A  68     280.493 257.946 199.121  1.00 68.44           O  
ATOM   2445  C1'   G A  68     279.485 256.770 200.955  1.00 68.48           C  
ATOM   2446  N9    G A  68     279.043 255.389 201.222  1.00 68.29           N  
ATOM   2447  C8    G A  68     277.995 254.924 201.983  1.00 69.92           C  
ATOM   2448  N7    G A  68     277.903 253.620 201.987  1.00 65.79           N  
ATOM   2449  C5    G A  68     278.955 253.207 201.180  1.00 66.48           C  
ATOM   2450  C6    G A  68     279.383 251.910 200.791  1.00 67.37           C  
ATOM   2451  O6    G A  68     278.893 250.811 201.102  1.00 64.81           O  
ATOM   2452  N1    G A  68     280.509 251.970 199.951  1.00 70.40           N  
ATOM   2453  C2    G A  68     281.145 253.128 199.533  1.00 69.19           C  
ATOM   2454  N2    G A  68     282.217 253.029 198.723  1.00 66.85           N  
ATOM   2455  N3    G A  68     280.747 254.330 199.895  1.00 66.80           N  
ATOM   2456  C4    G A  68     279.665 254.288 200.705  1.00 66.80           C  
ATOM   2457  P     C A  69     277.016 258.537 197.090  1.00 88.58           P  
ATOM   2458  OP1   C A  69     276.836 259.830 196.374  1.00 83.32           O  
ATOM   2459  OP2   C A  69     275.846 257.802 197.645  1.00 79.49           O1-
ATOM   2460  O5'   C A  69     277.793 257.539 196.119  1.00 80.17           O  
ATOM   2461  C5'   C A  69     278.979 257.931 195.445  1.00 73.80           C  
ATOM   2462  C4'   C A  69     279.896 256.750 195.239  1.00 77.40           C  
ATOM   2463  O4'   C A  69     280.046 256.016 196.490  1.00 74.94           O  
ATOM   2464  C3'   C A  69     279.421 255.690 194.253  1.00 75.38           C  
ATOM   2465  O3'   C A  69     279.625 256.045 192.891  1.00 73.60           O  
ATOM   2466  C2'   C A  69     280.203 254.457 194.703  1.00 74.39           C  
ATOM   2467  O2'   C A  69     281.553 254.524 194.265  1.00 72.60           O  
ATOM   2468  C1'   C A  69     280.191 254.633 196.225  1.00 68.50           C  
ATOM   2469  N1    C A  69     279.088 253.881 196.889  1.00 64.79           N  
ATOM   2470  C2    C A  69     279.144 252.481 196.927  1.00 61.66           C  
ATOM   2471  O2    C A  69     280.099 251.906 196.397  1.00 67.22           O  
ATOM   2472  N3    C A  69     278.167 251.764 197.524  1.00 58.50           N  
ATOM   2473  C4    C A  69     277.147 252.392 198.093  1.00 59.13           C  
ATOM   2474  N4    C A  69     276.219 251.630 198.673  1.00 59.47           N  
ATOM   2475  C5    C A  69     277.044 253.815 198.089  1.00 63.37           C  
ATOM   2476  C6    C A  69     278.023 254.509 197.486  1.00 66.31           C  
ATOM   2477  P     G A  70     278.565 255.611 191.752  1.00 77.62           P  
ATOM   2478  OP1   G A  70     278.849 256.404 190.527  1.00 76.89           O  
ATOM   2479  OP2   G A  70     277.199 255.625 192.333  1.00 74.73           O1-
ATOM   2480  O5'   G A  70     278.927 254.094 191.430  1.00 72.37           O  
ATOM   2481  C5'   G A  70     280.128 253.755 190.745  1.00 70.08           C  
ATOM   2482  C4'   G A  70     280.371 252.268 190.770  1.00 64.59           C  
ATOM   2483  O4'   G A  70     279.803 251.734 191.997  1.00 63.57           O  
ATOM   2484  C3'   G A  70     279.715 251.488 189.637  1.00 64.63           C  
ATOM   2485  O3'   G A  70     280.471 250.298 189.392  1.00 66.70           O  
ATOM   2486  C2'   G A  70     278.374 251.107 190.248  1.00 67.55           C  
ATOM   2487  O2'   G A  70     277.741 250.005 189.635  1.00 68.94           O  
ATOM   2488  C1'   G A  70     278.790 250.799 191.680  1.00 64.55           C  
ATOM   2489  N9    G A  70     277.735 250.914 192.687  1.00 62.06           N  
ATOM   2490  C8    G A  70     277.270 252.066 193.267  1.00 62.21           C  
ATOM   2491  N7    G A  70     276.351 251.841 194.164  1.00 62.81           N  
ATOM   2492  C5    G A  70     276.215 250.462 194.187  1.00 58.09           C  
ATOM   2493  C6    G A  70     275.370 249.631 194.965  1.00 57.66           C  
ATOM   2494  O6    G A  70     274.541 249.961 195.815  1.00 62.26           O  
ATOM   2495  N1    G A  70     275.545 248.283 194.682  1.00 57.03           N  
ATOM   2496  C2    G A  70     276.428 247.796 193.757  1.00 58.29           C  
ATOM   2497  N2    G A  70     276.450 246.464 193.628  1.00 59.60           N  
ATOM   2498  N3    G A  70     277.225 248.554 193.022  1.00 60.23           N  
ATOM   2499  C4    G A  70     277.069 249.870 193.289  1.00 59.91           C  
ATOM   2500  P     A A  71     281.479 250.192 188.143  1.00 66.31           P  
ATOM   2501  OP1   A A  71     281.804 251.566 187.690  1.00 70.77           O  
ATOM   2502  OP2   A A  71     280.928 249.198 187.186  1.00 68.70           O1-
ATOM   2503  O5'   A A  71     282.818 249.610 188.773  1.00 68.73           O  
ATOM   2504  C5'   A A  71     282.795 248.463 189.611  1.00 69.35           C  
ATOM   2505  C4'   A A  71     283.552 247.337 188.972  1.00 69.17           C  
ATOM   2506  O4'   A A  71     283.255 246.104 189.680  1.00 66.02           O  
ATOM   2507  C3'   A A  71     283.168 247.097 187.520  1.00 73.99           C  
ATOM   2508  O3'   A A  71     284.305 246.601 186.806  1.00 78.08           O  
ATOM   2509  C2'   A A  71     282.093 246.019 187.647  1.00 72.65           C  
ATOM   2510  O2'   A A  71     281.880 245.242 186.491  1.00 77.98           O  
ATOM   2511  C1'   A A  71     282.647 245.185 188.796  1.00 69.28           C  
ATOM   2512  N9    A A  71     281.645 244.427 189.551  1.00 68.39           N  
ATOM   2513  C8    A A  71     281.794 243.145 190.010  1.00 71.67           C  
ATOM   2514  N7    A A  71     280.772 242.682 190.680  1.00 66.84           N  
ATOM   2515  C5    A A  71     279.881 243.737 190.670  1.00 64.08           C  
ATOM   2516  C6    A A  71     278.598 243.870 191.217  1.00 64.38           C  
ATOM   2517  N6    A A  71     277.986 242.903 191.899  1.00 61.93           N  
ATOM   2518  N1    A A  71     277.960 245.045 191.038  1.00 66.09           N  
ATOM   2519  C2    A A  71     278.593 246.007 190.354  1.00 68.49           C  
ATOM   2520  N3    A A  71     279.800 245.999 189.790  1.00 68.13           N  
ATOM   2521  C4    A A  71     280.403 244.820 189.985  1.00 65.25           C  
ATOM   2522  P     U A  72     285.253 247.607 185.970  1.00 78.47           P  
ATOM   2523  OP1   U A  72     284.425 248.311 184.956  1.00 77.32           O  
ATOM   2524  OP2   U A  72     286.468 246.867 185.544  1.00 78.02           O1-
ATOM   2525  O5'   U A  72     285.743 248.674 187.038  1.00 69.08           O  
ATOM   2526  C5'   U A  72     287.096 248.681 187.466  1.00 67.30           C  
ATOM   2527  C4'   U A  72     287.471 249.997 188.088  1.00 71.24           C  
ATOM   2528  O4'   U A  72     287.584 251.001 187.043  1.00 75.17           O  
ATOM   2529  C3'   U A  72     286.469 250.548 189.106  1.00 74.50           C  
ATOM   2530  O3'   U A  72     287.174 251.218 190.159  1.00 75.22           O  
ATOM   2531  C2'   U A  72     285.670 251.559 188.275  1.00 74.13           C  
ATOM   2532  O2'   U A  72     285.054 252.587 189.021  1.00 75.49           O  
ATOM   2533  C1'   U A  72     286.753 252.103 187.350  1.00 75.47           C  
ATOM   2534  N1    U A  72     286.271 252.701 186.092  1.00 76.51           N  
ATOM   2535  C2    U A  72     286.092 254.067 186.095  1.00 77.48           C  
ATOM   2536  O2    U A  72     286.291 254.744 187.089  1.00 75.10           O  
ATOM   2537  N3    U A  72     285.660 254.607 184.908  1.00 79.33           N  
ATOM   2538  C4    U A  72     285.407 253.932 183.734  1.00 79.95           C  
ATOM   2539  O4    U A  72     285.021 254.557 182.750  1.00 82.73           O  
ATOM   2540  C5    U A  72     285.629 252.521 183.802  1.00 77.77           C  
ATOM   2541  C6    U A  72     286.048 251.968 184.948  1.00 78.78           C  
ATOM   2542  P     A A  73     287.528 250.445 191.532  1.00 74.39           P  
ATOM   2543  OP1   A A  73     288.586 251.177 192.283  1.00 74.23           O  
ATOM   2544  OP2   A A  73     287.675 249.001 191.219  1.00 72.34           O1-
ATOM   2545  O5'   A A  73     286.217 250.615 192.397  1.00 67.57           O  
ATOM   2546  C5'   A A  73     285.676 251.902 192.604  1.00 71.53           C  
ATOM   2547  C4'   A A  73     284.354 251.798 193.301  1.00 70.69           C  
ATOM   2548  O4'   A A  73     283.490 250.910 192.548  1.00 65.07           O  
ATOM   2549  C3'   A A  73     284.396 251.192 194.693  1.00 65.63           C  
ATOM   2550  O3'   A A  73     284.717 252.160 195.676  1.00 72.32           O  
ATOM   2551  C2'   A A  73     282.994 250.634 194.846  1.00 63.81           C  
ATOM   2552  O2'   A A  73     282.092 251.691 195.144  1.00 68.35           O  
ATOM   2553  C1'   A A  73     282.703 250.146 193.426  1.00 58.73           C  
ATOM   2554  N9    A A  73     283.049 248.727 193.228  1.00 59.76           N  
ATOM   2555  C8    A A  73     284.240 248.222 192.779  1.00 67.05           C  
ATOM   2556  N7    A A  73     284.268 246.912 192.689  1.00 71.26           N  
ATOM   2557  C5    A A  73     283.004 246.528 193.107  1.00 65.62           C  
ATOM   2558  C6    A A  73     282.397 245.269 193.247  1.00 64.83           C  
ATOM   2559  N6    A A  73     282.992 244.106 192.976  1.00 64.60           N  
ATOM   2560  N1    A A  73     281.126 245.237 193.685  1.00 62.64           N  
ATOM   2561  C2    A A  73     280.525 246.397 193.964  1.00 61.46           C  
ATOM   2562  N3    A A  73     280.988 247.636 193.875  1.00 59.58           N  
ATOM   2563  C4    A A  73     282.248 247.635 193.437  1.00 58.74           C  
ATOM   2564  P     A A  74     285.635 251.802 196.945  1.00 69.02           P  
ATOM   2565  OP1   A A  74     287.069 251.804 196.549  1.00 68.95           O  
ATOM   2566  OP2   A A  74     285.070 250.588 197.575  1.00 69.97           O1-
ATOM   2567  O5'   A A  74     285.362 253.025 197.925  1.00 71.02           O  
ATOM   2568  C5'   A A  74     286.406 253.601 198.697  1.00 76.85           C  
ATOM   2569  C4'   A A  74     285.963 254.901 199.316  1.00 79.97           C  
ATOM   2570  O4'   A A  74     284.631 254.726 199.865  1.00 71.84           O  
ATOM   2571  C3'   A A  74     286.833 255.404 200.466  1.00 80.82           C  
ATOM   2572  O3'   A A  74     286.767 256.840 200.510  1.00 86.51           O  
ATOM   2573  C2'   A A  74     286.124 254.811 201.685  1.00 70.08           C  
ATOM   2574  O2'   A A  74     286.381 255.479 202.901  1.00 68.80           O  
ATOM   2575  C1'   A A  74     284.656 254.927 201.267  1.00 67.47           C  
ATOM   2576  N9    A A  74     283.750 253.934 201.844  1.00 62.44           N  
ATOM   2577  C8    A A  74     282.603 254.177 202.546  1.00 61.13           C  
ATOM   2578  N7    A A  74     281.974 253.084 202.900  1.00 65.24           N  
ATOM   2579  C5    A A  74     282.739 252.047 202.387  1.00 62.07           C  
ATOM   2580  C6    A A  74     282.604 250.643 202.424  1.00 54.26           C  
ATOM   2581  N6    A A  74     281.611 249.993 203.023  1.00 56.73           N  
ATOM   2582  N1    A A  74     283.538 249.903 201.815  1.00 55.37           N  
ATOM   2583  C2    A A  74     284.535 250.551 201.214  1.00 64.25           C  
ATOM   2584  N3    A A  74     284.779 251.856 201.105  1.00 66.84           N  
ATOM   2585  C4    A A  74     283.831 252.566 201.724  1.00 64.00           C  
ATOM   2586  P     G A  75     287.708 257.772 199.576  1.00 97.24           P  
ATOM   2587  OP1   G A  75     288.987 257.923 200.310  1.00 89.41           O  
ATOM   2588  OP2   G A  75     286.962 258.981 199.120  1.00 87.85           O1-
ATOM   2589  O5'   G A  75     288.007 256.890 198.287  1.00 81.66           O  
ATOM   2590  C5'   G A  75     288.087 257.473 196.999  1.00 73.13           C  
ATOM   2591  C4'   G A  75     287.826 256.436 195.942  1.00 77.77           C  
ATOM   2592  O4'   G A  75     286.411 256.130 195.885  1.00 78.48           O  
ATOM   2593  C3'   G A  75     288.177 256.832 194.520  1.00 82.24           C  
ATOM   2594  O3'   G A  75     289.555 256.691 194.246  1.00 82.68           O  
ATOM   2595  C2'   G A  75     287.294 255.913 193.683  1.00 81.59           C  
ATOM   2596  O2'   G A  75     287.866 254.618 193.569  1.00 77.55           O  
ATOM   2597  C1'   G A  75     286.040 255.820 194.556  1.00 81.88           C  
ATOM   2598  N9    G A  75     284.993 256.761 194.126  1.00 76.88           N  
ATOM   2599  C8    G A  75     284.639 257.943 194.722  1.00 75.86           C  
ATOM   2600  N7    G A  75     283.668 258.555 194.106  1.00 73.40           N  
ATOM   2601  C5    G A  75     283.368 257.720 193.044  1.00 73.57           C  
ATOM   2602  C6    G A  75     282.392 257.856 192.027  1.00 79.74           C  
ATOM   2603  O6    G A  75     281.571 258.773 191.852  1.00 78.18           O  
ATOM   2604  N1    G A  75     282.437 256.770 191.150  1.00 81.70           N  
ATOM   2605  C2    G A  75     283.296 255.696 191.242  1.00 77.25           C  
ATOM   2606  N2    G A  75     283.184 254.747 190.299  1.00 74.69           N  
ATOM   2607  N3    G A  75     284.207 255.567 192.189  1.00 72.22           N  
ATOM   2608  C4    G A  75     284.178 256.607 193.041  1.00 71.83           C  
ATOM   2609  P     C A  76     290.393 257.956 193.732  1.00 94.17           P  
ATOM   2610  OP1   C A  76     291.824 257.675 194.018  1.00 88.36           O  
ATOM   2611  OP2   C A  76     289.740 259.174 194.287  1.00 86.05           O1-
ATOM   2612  O5'   C A  76     290.189 257.951 192.146  1.00 81.58           O  
ATOM   2613  C5'   C A  76     291.064 257.219 191.295  1.00 78.51           C  
ATOM   2614  C4'   C A  76     290.680 257.353 189.842  1.00 75.44           C  
ATOM   2615  O4'   C A  76     289.272 257.047 189.665  1.00 74.45           O  
ATOM   2616  C3'   C A  76     290.832 258.736 189.237  1.00 76.16           C  
ATOM   2617  O3'   C A  76     292.169 259.023 188.864  1.00 80.36           O  
ATOM   2618  C2'   C A  76     289.874 258.687 188.058  1.00 75.41           C  
ATOM   2619  O2'   C A  76     290.465 257.970 186.985  1.00 78.55           O  
ATOM   2620  C1'   C A  76     288.737 257.833 188.622  1.00 72.78           C  
ATOM   2621  N1    C A  76     287.605 258.628 189.160  1.00 75.92           N  
ATOM   2622  C2    C A  76     286.719 259.335 188.323  1.00 75.49           C  
ATOM   2623  O2    C A  76     286.885 259.341 187.094  1.00 75.93           O  
ATOM   2624  N3    C A  76     285.690 260.026 188.879  1.00 78.14           N  
ATOM   2625  C4    C A  76     285.505 260.019 190.207  1.00 78.97           C  
ATOM   2626  N4    C A  76     284.476 260.710 190.711  1.00 77.52           N  
ATOM   2627  C5    C A  76     286.379 259.301 191.077  1.00 75.74           C  
ATOM   2628  C6    C A  76     287.393 258.627 190.513  1.00 77.48           C  
ATOM   2629  P     G A  77     292.771 260.500 189.074  1.00 90.02           P  
ATOM   2630  OP1   G A  77     294.253 260.433 189.007  1.00 92.23           O  
ATOM   2631  OP2   G A  77     292.142 261.067 190.290  1.00 89.09           O1-
ATOM   2632  O5'   G A  77     292.244 261.322 187.815  1.00 76.74           O  
ATOM   2633  C5'   G A  77     292.508 260.865 186.502  1.00 75.89           C  
ATOM   2634  C4'   G A  77     291.712 261.618 185.467  1.00 82.54           C  
ATOM   2635  O4'   G A  77     290.291 261.430 185.676  1.00 84.83           O  
ATOM   2636  C3'   G A  77     291.879 263.122 185.460  1.00 85.75           C  
ATOM   2637  O3'   G A  77     293.083 263.522 184.835  1.00 92.68           O  
ATOM   2638  C2'   G A  77     290.618 263.594 184.742  1.00 82.49           C  
ATOM   2639  O2'   G A  77     290.754 263.456 183.334  1.00 81.01           O  
ATOM   2640  C1'   G A  77     289.587 262.575 185.232  1.00 84.08           C  
ATOM   2641  N9    G A  77     288.754 263.081 186.343  1.00 81.03           N  
ATOM   2642  C8    G A  77     288.795 262.634 187.641  1.00 79.15           C  
ATOM   2643  N7    G A  77     287.946 263.235 188.421  1.00 78.46           N  
ATOM   2644  C5    G A  77     287.294 264.129 187.588  1.00 79.85           C  
ATOM   2645  C6    G A  77     286.263 265.055 187.887  1.00 85.87           C  
ATOM   2646  O6    G A  77     285.715 265.269 188.982  1.00 85.50           O  
ATOM   2647  N1    G A  77     285.877 265.777 186.754  1.00 86.08           N  
ATOM   2648  C2    G A  77     286.412 265.630 185.497  1.00 84.66           C  
ATOM   2649  N2    G A  77     285.894 266.426 184.546  1.00 81.61           N  
ATOM   2650  N3    G A  77     287.380 264.763 185.212  1.00 85.16           N  
ATOM   2651  C4    G A  77     287.774 264.051 186.297  1.00 81.28           C  
ATOM   2652  P     U A  78     294.044 264.574 185.570  1.00102.64           P  
ATOM   2653  OP1   U A  78     295.373 264.550 184.899  1.00101.68           O  
ATOM   2654  OP2   U A  78     293.948 264.286 187.027  1.00 88.01           O1-
ATOM   2655  O5'   U A  78     293.359 265.979 185.242  1.00 93.08           O  
ATOM   2656  C5'   U A  78     292.958 266.284 183.913  1.00 92.81           C  
ATOM   2657  C4'   U A  78     291.783 267.227 183.873  1.00 85.97           C  
ATOM   2658  O4'   U A  78     290.608 266.612 184.452  1.00 85.21           O  
ATOM   2659  C3'   U A  78     291.945 268.502 184.665  1.00 85.83           C  
ATOM   2660  O3'   U A  78     292.724 269.453 183.980  1.00 88.02           O  
ATOM   2661  C2'   U A  78     290.508 268.949 184.888  1.00 85.28           C  
ATOM   2662  O2'   U A  78     290.009 269.613 183.738  1.00 85.02           O  
ATOM   2663  C1'   U A  78     289.786 267.608 185.024  1.00 84.82           C  
ATOM   2664  N1    U A  78     289.478 267.263 186.429  1.00 78.75           N  
ATOM   2665  C2    U A  78     288.399 267.907 186.994  1.00 81.42           C  
ATOM   2666  O2    U A  78     287.733 268.730 186.383  1.00 80.96           O  
ATOM   2667  N3    U A  78     288.121 267.561 188.296  1.00 83.47           N  
ATOM   2668  C4    U A  78     288.790 266.651 189.083  1.00 78.51           C  
ATOM   2669  O4    U A  78     288.406 266.450 190.246  1.00 76.14           O  
ATOM   2670  C5    U A  78     289.892 266.030 188.410  1.00 77.19           C  
ATOM   2671  C6    U A  78     290.195 266.342 187.142  1.00 74.76           C  
ATOM   2672  P     C A  79     293.805 270.294 184.804  1.00100.59           P  
ATOM   2673  OP1   C A  79     294.768 270.887 183.841  1.00101.27           O  
ATOM   2674  OP2   C A  79     294.298 269.398 185.884  1.00 91.40           O1-
ATOM   2675  O5'   C A  79     292.949 271.474 185.461  1.00 97.74           O  
ATOM   2676  C5'   C A  79     292.610 272.637 184.713  1.00 94.42           C  
ATOM   2677  C4'   C A  79     291.218 273.141 185.029  1.00 94.34           C  
ATOM   2678  O4'   C A  79     290.350 272.042 185.417  1.00 90.20           O  
ATOM   2679  C3'   C A  79     291.093 274.123 186.181  1.00 93.22           C  
ATOM   2680  O3'   C A  79     291.490 275.438 185.830  1.00 92.83           O  
ATOM   2681  C2'   C A  79     289.619 274.001 186.552  1.00 90.39           C  
ATOM   2682  O2'   C A  79     288.811 274.721 185.632  1.00 89.29           O  
ATOM   2683  C1'   C A  79     289.379 272.500 186.337  1.00 88.44           C  
ATOM   2684  N1    C A  79     289.491 271.715 187.595  1.00 86.78           N  
ATOM   2685  C2    C A  79     288.440 271.752 188.530  1.00 87.54           C  
ATOM   2686  O2    C A  79     287.437 272.443 188.301  1.00 87.75           O  
ATOM   2687  N3    C A  79     288.539 271.044 189.675  1.00 82.64           N  
ATOM   2688  C4    C A  79     289.633 270.315 189.890  1.00 81.33           C  
ATOM   2689  N4    C A  79     289.683 269.632 191.029  1.00 83.10           N  
ATOM   2690  C5    C A  79     290.716 270.244 188.968  1.00 80.39           C  
ATOM   2691  C6    C A  79     290.602 270.953 187.843  1.00 84.10           C  
ATOM   2692  P     G A  80     292.827 276.070 186.461  1.00 94.73           P  
ATOM   2693  OP1   G A  80     293.577 276.745 185.371  1.00 97.40           O  
ATOM   2694  OP2   G A  80     293.488 275.014 187.265  1.00 94.39           O1-
ATOM   2695  O5'   G A  80     292.293 277.181 187.471  1.00 92.24           O  
ATOM   2696  C5'   G A  80     292.498 277.055 188.870  1.00 89.94           C  
ATOM   2697  C4'   G A  80     291.233 277.357 189.635  1.00 91.89           C  
ATOM   2698  O4'   G A  80     290.254 276.293 189.431  1.00 89.21           O  
ATOM   2699  C3'   G A  80     291.360 277.441 191.148  1.00 87.34           C  
ATOM   2700  O3'   G A  80     291.943 278.653 191.608  1.00 86.92           O  
ATOM   2701  C2'   G A  80     289.919 277.206 191.593  1.00 84.16           C  
ATOM   2702  O2'   G A  80     289.121 278.353 191.336  1.00 81.47           O  
ATOM   2703  C1'   G A  80     289.503 276.098 190.618  1.00 84.89           C  
ATOM   2704  N9    G A  80     289.840 274.757 191.162  1.00 84.64           N  
ATOM   2705  C8    G A  80     290.853 273.934 190.704  1.00 83.92           C  
ATOM   2706  N7    G A  80     290.974 272.816 191.364  1.00 80.54           N  
ATOM   2707  C5    G A  80     289.980 272.895 192.328  1.00 79.41           C  
ATOM   2708  C6    G A  80     289.632 271.968 193.341  1.00 78.60           C  
ATOM   2709  O6    G A  80     290.142 270.873 193.584  1.00 81.54           O  
ATOM   2710  N1    G A  80     288.576 272.408 194.128  1.00 77.17           N  
ATOM   2711  C2    G A  80     287.927 273.598 193.953  1.00 77.13           C  
ATOM   2712  N2    G A  80     286.933 273.837 194.824  1.00 77.28           N  
ATOM   2713  N3    G A  80     288.237 274.481 193.012  1.00 80.71           N  
ATOM   2714  C4    G A  80     289.268 274.076 192.230  1.00 81.64           C  
ATOM   2715  P     G A  81     293.133 278.633 192.697  1.00 81.81           P  
ATOM   2716  OP1   G A  81     293.769 279.972 192.715  1.00 82.51           O  
ATOM   2717  OP2   G A  81     294.008 277.455 192.478  1.00 77.40           O1-
ATOM   2718  O5'   G A  81     292.355 278.476 194.077  1.00 82.46           O  
ATOM   2719  C5'   G A  81     291.194 279.255 194.325  1.00 81.06           C  
ATOM   2720  C4'   G A  81     290.307 278.635 195.374  1.00 85.59           C  
ATOM   2721  O4'   G A  81     289.849 277.333 194.935  1.00 84.65           O  
ATOM   2722  C3'   G A  81     290.953 278.350 196.720  1.00 90.81           C  
ATOM   2723  O3'   G A  81     291.088 279.501 197.529  1.00 89.48           O  
ATOM   2724  C2'   G A  81     290.031 277.288 197.307  1.00 87.23           C  
ATOM   2725  O2'   G A  81     288.844 277.878 197.819  1.00 81.96           O  
ATOM   2726  C1'   G A  81     289.669 276.486 196.056  1.00 85.36           C  
ATOM   2727  N9    G A  81     290.506 275.278 195.892  1.00 81.67           N  
ATOM   2728  C8    G A  81     291.348 274.947 194.855  1.00 81.58           C  
ATOM   2729  N7    G A  81     291.940 273.792 195.000  1.00 75.82           N  
ATOM   2730  C5    G A  81     291.453 273.334 196.209  1.00 74.86           C  
ATOM   2731  C6    G A  81     291.731 272.138 196.901  1.00 76.28           C  
ATOM   2732  O6    G A  81     292.488 271.217 196.570  1.00 76.36           O  
ATOM   2733  N1    G A  81     291.017 272.079 198.095  1.00 77.66           N  
ATOM   2734  C2    G A  81     290.158 273.051 198.555  1.00 73.91           C  
ATOM   2735  N2    G A  81     289.555 272.829 199.727  1.00 78.86           N  
ATOM   2736  N3    G A  81     289.889 274.163 197.921  1.00 70.17           N  
ATOM   2737  C4    G A  81     290.570 274.231 196.768  1.00 74.60           C  
ATOM   2738  P     U A  82     292.556 280.022 197.911  1.00 95.27           P  
ATOM   2739  OP1   U A  82     292.427 281.411 198.427  1.00 86.56           O  
ATOM   2740  OP2   U A  82     293.447 279.727 196.754  1.00 84.46           O1-
ATOM   2741  O5'   U A  82     292.999 279.069 199.110  1.00 85.79           O  
ATOM   2742  C5'   U A  82     292.241 279.007 200.307  1.00 79.45           C  
ATOM   2743  C4'   U A  82     292.214 277.609 200.858  1.00 79.52           C  
ATOM   2744  O4'   U A  82     291.945 276.669 199.787  1.00 82.76           O  
ATOM   2745  C3'   U A  82     293.512 277.104 201.462  1.00 83.17           C  
ATOM   2746  O3'   U A  82     293.720 277.558 202.785  1.00 87.25           O  
ATOM   2747  C2'   U A  82     293.362 275.592 201.367  1.00 90.14           C  
ATOM   2748  O2'   U A  82     292.560 275.099 202.430  1.00 91.67           O  
ATOM   2749  C1'   U A  82     292.583 275.438 200.060  1.00 85.17           C  
ATOM   2750  N1    U A  82     293.451 275.062 198.919  1.00 83.66           N  
ATOM   2751  C2    U A  82     293.881 273.748 198.882  1.00 81.74           C  
ATOM   2752  O2    U A  82     293.579 272.934 199.734  1.00 81.34           O  
ATOM   2753  N3    U A  82     294.679 273.413 197.819  1.00 81.79           N  
ATOM   2754  C4    U A  82     295.080 274.250 196.804  1.00 86.47           C  
ATOM   2755  O4    U A  82     295.802 273.794 195.915  1.00 86.42           O  
ATOM   2756  C5    U A  82     294.593 275.599 196.907  1.00 87.13           C  
ATOM   2757  C6    U A  82     293.813 275.954 197.936  1.00 82.96           C  
ATOM   2758  P     A A  83     295.219 277.721 203.340  1.00 99.25           P  
ATOM   2759  OP1   A A  83     295.162 278.409 204.657  1.00 99.09           O  
ATOM   2760  OP2   A A  83     296.033 278.294 202.239  1.00 97.04           O1-
ATOM   2761  O5'   A A  83     295.738 276.227 203.550  1.00 96.23           O  
ATOM   2762  C5'   A A  83     295.368 275.460 204.689  1.00100.02           C  
ATOM   2763  C4'   A A  83     295.803 274.024 204.537  1.00 98.68           C  
ATOM   2764  O4'   A A  83     295.493 273.581 203.194  1.00 97.14           O  
ATOM   2765  C3'   A A  83     297.294 273.765 204.698  1.00 94.58           C  
ATOM   2766  O3'   A A  83     297.630 273.523 206.050  1.00 92.95           O  
ATOM   2767  C2'   A A  83     297.551 272.550 203.811  1.00 94.39           C  
ATOM   2768  O2'   A A  83     297.285 271.351 204.525  1.00 94.71           O  
ATOM   2769  C1'   A A  83     296.493 272.711 202.719  1.00 95.38           C  
ATOM   2770  N9    A A  83     297.008 273.243 201.441  1.00 94.73           N  
ATOM   2771  C8    A A  83     297.126 274.555 201.051  1.00 93.97           C  
ATOM   2772  N7    A A  83     297.582 274.695 199.829  1.00 95.27           N  
ATOM   2773  C5    A A  83     297.761 273.393 199.379  1.00 93.97           C  
ATOM   2774  C6    A A  83     298.223 272.861 198.162  1.00 94.33           C  
ATOM   2775  N6    A A  83     298.606 273.605 197.121  1.00 97.76           N  
ATOM   2776  N1    A A  83     298.283 271.518 198.043  1.00 93.53           N  
ATOM   2777  C2    A A  83     297.898 270.768 199.082  1.00 89.37           C  
ATOM   2778  N3    A A  83     297.447 271.150 200.272  1.00 91.13           N  
ATOM   2779  C4    A A  83     297.404 272.490 200.361  1.00 93.16           C  
ATOM   2780  P     A A  84     298.678 274.465 206.806  1.00 95.19           P  
ATOM   2781  OP1   A A  84     297.908 275.503 207.539  1.00 92.77           O  
ATOM   2782  OP2   A A  84     299.720 274.866 205.826  1.00 94.84           O1-
ATOM   2783  O5'   A A  84     299.348 273.493 207.873  1.00 98.68           O  
ATOM   2784  C5'   A A  84     298.550 272.605 208.652  1.00 99.12           C  
ATOM   2785  C4'   A A  84     299.131 271.209 208.701  1.00 99.54           C  
ATOM   2786  O4'   A A  84     299.179 270.661 207.353  1.00 95.53           O  
ATOM   2787  C3'   A A  84     300.561 271.094 209.249  1.00107.83           C  
ATOM   2788  O3'   A A  84     300.721 269.819 209.893  1.00101.68           O  
ATOM   2789  C2'   A A  84     301.393 271.105 207.963  1.00102.61           C  
ATOM   2790  O2'   A A  84     302.696 270.568 208.085  1.00 98.03           O  
ATOM   2791  C1'   A A  84     300.506 270.259 207.061  1.00 98.97           C  
ATOM   2792  N9    A A  84     300.737 270.384 205.622  1.00 94.84           N  
ATOM   2793  C8    A A  84     300.942 271.487 204.832  1.00 99.60           C  
ATOM   2794  N7    A A  84     301.088 271.178 203.558  1.00104.04           N  
ATOM   2795  C5    A A  84     300.967 269.787 203.522  1.00 97.59           C  
ATOM   2796  C6    A A  84     301.021 268.827 202.488  1.00 94.94           C  
ATOM   2797  N6    A A  84     301.228 269.126 201.207  1.00100.65           N  
ATOM   2798  N1    A A  84     300.858 267.524 202.802  1.00 88.03           N  
ATOM   2799  C2    A A  84     300.652 267.207 204.080  1.00 86.32           C  
ATOM   2800  N3    A A  84     300.580 268.011 205.135  1.00 90.58           N  
ATOM   2801  C4    A A  84     300.748 269.297 204.787  1.00 93.18           C  
ATOM   2802  P     G A  85     300.277 269.575 211.425  1.00 93.10           P  
ATOM   2803  OP1   G A  85     300.677 270.772 212.211  1.00 90.33           O  
ATOM   2804  OP2   G A  85     300.803 268.244 211.829  1.00 90.38           O1-
ATOM   2805  O5'   G A  85     298.678 269.523 211.364  1.00 89.34           O  
ATOM   2806  C5'   G A  85     297.970 268.304 211.156  1.00 89.99           C  
ATOM   2807  C4'   G A  85     297.493 268.166 209.729  1.00 88.21           C  
ATOM   2808  O4'   G A  85     298.640 267.911 208.878  1.00 89.36           O  
ATOM   2809  C3'   G A  85     296.551 266.998 209.446  1.00 91.07           C  
ATOM   2810  O3'   G A  85     295.190 267.295 209.702  1.00 96.41           O  
ATOM   2811  C2'   G A  85     296.827 266.694 207.985  1.00 86.53           C  
ATOM   2812  O2'   G A  85     296.192 267.660 207.158  1.00 87.61           O  
ATOM   2813  C1'   G A  85     298.326 266.928 207.918  1.00 85.90           C  
ATOM   2814  N9    G A  85     299.094 265.716 208.254  1.00 80.84           N  
ATOM   2815  C8    G A  85     299.670 265.468 209.472  1.00 82.04           C  
ATOM   2816  N7    G A  85     300.312 264.339 209.514  1.00 83.64           N  
ATOM   2817  C5    G A  85     300.152 263.805 208.248  1.00 80.71           C  
ATOM   2818  C6    G A  85     300.637 262.586 207.714  1.00 78.08           C  
ATOM   2819  O6    G A  85     301.313 261.721 208.279  1.00 78.22           O  
ATOM   2820  N1    G A  85     300.258 262.414 206.392  1.00 77.37           N  
ATOM   2821  C2    G A  85     299.510 263.316 205.684  1.00 78.43           C  
ATOM   2822  N2    G A  85     299.251 262.969 204.419  1.00 80.64           N  
ATOM   2823  N3    G A  85     299.050 264.461 206.166  1.00 80.09           N  
ATOM   2824  C4    G A  85     299.401 264.642 207.453  1.00 79.57           C  
ATOM   2825  P     G A  86     294.122 266.099 209.858  1.00 98.86           P  
ATOM   2826  OP1   G A  86     292.804 266.696 210.193  1.00 92.13           O  
ATOM   2827  OP2   G A  86     294.722 265.073 210.754  1.00 93.65           O1-
ATOM   2828  O5'   G A  86     294.025 265.461 208.399  1.00 88.17           O  
ATOM   2829  C5'   G A  86     293.546 264.136 208.223  1.00 86.86           C  
ATOM   2830  C4'   G A  86     293.884 263.567 206.864  1.00 92.14           C  
ATOM   2831  O4'   G A  86     295.316 263.625 206.621  1.00 89.37           O  
ATOM   2832  C3'   G A  86     293.539 262.098 206.687  1.00 91.30           C  
ATOM   2833  O3'   G A  86     292.178 261.898 206.376  1.00 87.19           O  
ATOM   2834  C2'   G A  86     294.499 261.644 205.595  1.00 84.53           C  
ATOM   2835  O2'   G A  86     294.040 262.045 204.314  1.00 84.76           O  
ATOM   2836  C1'   G A  86     295.743 262.457 205.941  1.00 83.85           C  
ATOM   2837  N9    G A  86     296.622 261.713 206.851  1.00 79.05           N  
ATOM   2838  C8    G A  86     296.985 262.119 208.105  1.00 83.53           C  
ATOM   2839  N7    G A  86     297.765 261.276 208.711  1.00 80.75           N  
ATOM   2840  C5    G A  86     297.911 260.258 207.791  1.00 74.54           C  
ATOM   2841  C6    G A  86     298.652 259.071 207.895  1.00 77.35           C  
ATOM   2842  O6    G A  86     299.333 258.683 208.846  1.00 80.76           O  
ATOM   2843  N1    G A  86     298.544 258.303 206.749  1.00 77.64           N  
ATOM   2844  C2    G A  86     297.815 258.647 205.646  1.00 79.56           C  
ATOM   2845  N2    G A  86     297.840 257.769 204.638  1.00 82.83           N  
ATOM   2846  N3    G A  86     297.116 259.759 205.533  1.00 75.62           N  
ATOM   2847  C4    G A  86     297.213 260.507 206.639  1.00 72.47           C  
ATOM   2848  P     U A  87     291.400 260.697 207.081  1.00 93.22           P  
ATOM   2849  OP1   U A  87     289.946 260.987 207.027  1.00 88.57           O  
ATOM   2850  OP2   U A  87     292.070 260.441 208.384  1.00 93.94           O1-
ATOM   2851  O5'   U A  87     291.718 259.465 206.135  1.00 82.91           O  
ATOM   2852  C5'   U A  87     291.348 259.487 204.769  1.00 78.03           C  
ATOM   2853  C4'   U A  87     291.623 258.151 204.145  1.00 85.11           C  
ATOM   2854  O4'   U A  87     293.054 258.028 203.930  1.00 81.20           O  
ATOM   2855  C3'   U A  87     291.281 256.945 205.015  1.00 89.26           C  
ATOM   2856  O3'   U A  87     289.907 256.586 205.019  1.00 87.79           O  
ATOM   2857  C2'   U A  87     292.210 255.880 204.461  1.00 85.92           C  
ATOM   2858  O2'   U A  87     291.736 255.406 203.208  1.00 85.41           O  
ATOM   2859  C1'   U A  87     293.470 256.712 204.227  1.00 82.93           C  
ATOM   2860  N1    U A  87     294.312 256.749 205.447  1.00 77.92           N  
ATOM   2861  C2    U A  87     295.261 255.763 205.510  1.00 75.60           C  
ATOM   2862  O2    U A  87     295.400 254.948 204.616  1.00 76.87           O  
ATOM   2863  N3    U A  87     296.043 255.768 206.630  1.00 72.46           N  
ATOM   2864  C4    U A  87     295.956 256.647 207.679  1.00 72.44           C  
ATOM   2865  O4    U A  87     296.742 256.510 208.615  1.00 75.95           O  
ATOM   2866  C5    U A  87     294.939 257.647 207.555  1.00 72.96           C  
ATOM   2867  C6    U A  87     294.169 257.664 206.468  1.00 75.04           C  
ATOM   2868  P     G A  88     289.207 256.070 206.377  1.00 88.95           P  
ATOM   2869  OP1   G A  88     289.982 256.530 207.561  1.00 83.42           O  
ATOM   2870  OP2   G A  88     288.933 254.624 206.209  1.00 82.11           O1-
ATOM   2871  O5'   G A  88     287.818 256.842 206.398  1.00 79.89           O  
ATOM   2872  C5'   G A  88     287.791 258.258 206.452  1.00 78.26           C  
ATOM   2873  C4'   G A  88     286.466 258.757 206.948  1.00 71.85           C  
ATOM   2874  O4'   G A  88     285.442 258.419 205.978  1.00 71.88           O  
ATOM   2875  C3'   G A  88     285.969 258.134 208.245  1.00 72.99           C  
ATOM   2876  O3'   G A  88     286.531 258.725 209.408  1.00 81.43           O  
ATOM   2877  C2'   G A  88     284.466 258.312 208.132  1.00 70.89           C  
ATOM   2878  O2'   G A  88     284.099 259.656 208.404  1.00 75.29           O  
ATOM   2879  C1'   G A  88     284.256 258.050 206.644  1.00 71.37           C  
ATOM   2880  N9    G A  88     284.041 256.618 206.418  1.00 66.54           N  
ATOM   2881  C8    G A  88     284.927 255.730 205.876  1.00 67.74           C  
ATOM   2882  N7    G A  88     284.454 254.522 205.839  1.00 67.66           N  
ATOM   2883  C5    G A  88     283.192 254.627 206.401  1.00 66.16           C  
ATOM   2884  C6    G A  88     282.211 253.632 206.627  1.00 70.12           C  
ATOM   2885  O6    G A  88     282.271 252.422 206.364  1.00 70.60           O  
ATOM   2886  N1    G A  88     281.068 254.165 207.217  1.00 68.19           N  
ATOM   2887  C2    G A  88     280.904 255.488 207.546  1.00 66.77           C  
ATOM   2888  N2    G A  88     279.736 255.804 208.113  1.00 67.07           N  
ATOM   2889  N3    G A  88     281.815 256.424 207.342  1.00 66.47           N  
ATOM   2890  C4    G A  88     282.925 255.919 206.770  1.00 65.11           C  
ATOM   2891  P     A A  89     286.858 257.826 210.703  1.00 82.88           P  
ATOM   2892  OP1   A A  89     287.481 258.693 211.737  1.00 80.73           O  
ATOM   2893  OP2   A A  89     287.599 256.628 210.227  1.00 75.74           O1-
ATOM   2894  O5'   A A  89     285.418 257.423 211.271  1.00 77.26           O  
ATOM   2895  C5'   A A  89     284.613 258.382 211.947  1.00 76.28           C  
ATOM   2896  C4'   A A  89     283.288 257.816 212.423  1.00 80.64           C  
ATOM   2897  O4'   A A  89     282.553 257.237 211.314  1.00 76.89           O  
ATOM   2898  C3'   A A  89     283.343 256.697 213.454  1.00 79.01           C  
ATOM   2899  O3'   A A  89     283.559 257.177 214.771  1.00 85.59           O  
ATOM   2900  C2'   A A  89     281.995 256.014 213.274  1.00 73.48           C  
ATOM   2901  O2'   A A  89     280.975 256.769 213.911  1.00 74.76           O  
ATOM   2902  C1'   A A  89     281.792 256.135 211.764  1.00 71.63           C  
ATOM   2903  N9    A A  89     282.225 254.933 211.018  1.00 71.27           N  
ATOM   2904  C8    A A  89     283.262 254.864 210.121  1.00 69.95           C  
ATOM   2905  N7    A A  89     283.430 253.686 209.573  1.00 67.60           N  
ATOM   2906  C5    A A  89     282.426 252.916 210.137  1.00 67.39           C  
ATOM   2907  C6    A A  89     282.072 251.571 209.960  1.00 65.85           C  
ATOM   2908  N6    A A  89     282.718 250.746 209.141  1.00 65.73           N  
ATOM   2909  N1    A A  89     281.023 251.099 210.663  1.00 67.01           N  
ATOM   2910  C2    A A  89     280.386 251.942 211.485  1.00 70.68           C  
ATOM   2911  N3    A A  89     280.621 253.229 211.736  1.00 72.77           N  
ATOM   2912  C4    A A  89     281.671 253.668 211.024  1.00 71.13           C  
ATOM   2913  P     U A  90     284.569 256.411 215.761  1.00 91.52           P  
ATOM   2914  OP1   U A  90     284.893 257.279 216.924  1.00 87.88           O  
ATOM   2915  OP2   U A  90     285.673 255.875 214.929  1.00 88.15           O1-
ATOM   2916  O5'   U A  90     283.700 255.202 216.318  1.00 87.42           O  
ATOM   2917  C5'   U A  90     282.558 255.453 217.122  1.00 90.03           C  
ATOM   2918  C4'   U A  90     281.787 254.188 217.402  1.00 90.08           C  
ATOM   2919  O4'   U A  90     281.201 253.687 216.174  1.00 85.33           O  
ATOM   2920  C3'   U A  90     282.592 253.014 217.940  1.00 88.64           C  
ATOM   2921  O3'   U A  90     282.830 253.118 219.336  1.00 88.59           O  
ATOM   2922  C2'   U A  90     281.728 251.821 217.546  1.00 86.29           C  
ATOM   2923  O2'   U A  90     280.637 251.678 218.444  1.00 82.54           O  
ATOM   2924  C1'   U A  90     281.181 252.277 216.189  1.00 82.62           C  
ATOM   2925  N1    U A  90     281.994 251.788 215.050  1.00 74.62           N  
ATOM   2926  C2    U A  90     281.712 250.532 214.562  1.00 71.22           C  
ATOM   2927  O2    U A  90     280.841 249.826 215.030  1.00 75.18           O  
ATOM   2928  N3    U A  90     282.479 250.122 213.508  1.00 70.49           N  
ATOM   2929  C4    U A  90     283.485 250.839 212.908  1.00 72.30           C  
ATOM   2930  O4    U A  90     284.094 250.338 211.964  1.00 75.18           O  
ATOM   2931  C5    U A  90     283.719 252.134 213.464  1.00 71.54           C  
ATOM   2932  C6    U A  90     282.982 252.557 214.489  1.00 71.74           C  
ATOM   2933  P     A A  91     284.098 252.409 220.030  1.00 90.63           P  
ATOM   2934  OP1   A A  91     284.011 250.950 219.777  1.00 88.07           O  
ATOM   2935  OP2   A A  91     284.147 252.902 221.430  1.00 95.40           O1-
ATOM   2936  O5'   A A  91     285.377 252.999 219.280  1.00 83.84           O  
ATOM   2937  C5'   A A  91     286.702 252.666 219.701  1.00 85.78           C  
ATOM   2938  C4'   A A  91     287.681 252.662 218.550  1.00 86.14           C  
ATOM   2939  O4'   A A  91     287.585 251.397 217.842  1.00 87.98           O  
ATOM   2940  C3'   A A  91     287.424 253.737 217.508  1.00 98.30           C  
ATOM   2941  O3'   A A  91     288.654 254.065 216.867  1.00104.99           O  
ATOM   2942  C2'   A A  91     286.512 253.017 216.521  1.00 93.90           C  
ATOM   2943  O2'   A A  91     286.469 253.572 215.224  1.00 95.39           O  
ATOM   2944  C1'   A A  91     287.112 251.621 216.521  1.00 88.51           C  
ATOM   2945  N9    A A  91     286.130 250.584 216.214  1.00 84.34           N  
ATOM   2946  C8    A A  91     285.026 250.237 216.947  1.00 87.97           C  
ATOM   2947  N7    A A  91     284.326 249.258 216.437  1.00 82.31           N  
ATOM   2948  C5    A A  91     285.021 248.950 215.290  1.00 73.98           C  
ATOM   2949  C6    A A  91     284.787 247.998 214.309  1.00 76.65           C  
ATOM   2950  N6    A A  91     283.752 247.160 214.342  1.00 81.34           N  
ATOM   2951  N1    A A  91     285.662 247.943 213.287  1.00 82.18           N  
ATOM   2952  C2    A A  91     286.695 248.798 213.270  1.00 81.71           C  
ATOM   2953  N3    A A  91     287.026 249.741 214.140  1.00 79.59           N  
ATOM   2954  C4    A A  91     286.131 249.754 215.134  1.00 76.57           C  
ATOM   2955  P     U A  92     289.396 255.442 217.229  1.00116.93           P  
ATOM   2956  OP1   U A  92     288.543 256.118 218.243  1.00103.01           O  
ATOM   2957  OP2   U A  92     289.734 256.191 215.982  1.00101.11           O1-
ATOM   2958  O5'   U A  92     290.743 254.948 217.924  1.00100.53           O  
ATOM   2959  C5'   U A  92     291.603 254.019 217.275  1.00103.63           C  
ATOM   2960  C4'   U A  92     291.803 252.774 218.101  1.00 98.72           C  
ATOM   2961  O4'   U A  92     290.795 251.787 217.752  1.00 92.09           O  
ATOM   2962  C3'   U A  92     293.122 252.025 217.911  1.00107.12           C  
ATOM   2963  O3'   U A  92     294.225 252.609 218.599  1.00108.55           O  
ATOM   2964  C2'   U A  92     292.769 250.632 218.419  1.00100.00           C  
ATOM   2965  O2'   U A  92     292.770 250.606 219.839  1.00 99.09           O  
ATOM   2966  C1'   U A  92     291.320 250.486 217.933  1.00100.00           C  
ATOM   2967  N1    U A  92     291.240 249.709 216.664  1.00108.91           N  
ATOM   2968  C2    U A  92     290.944 248.357 216.785  1.00118.54           C  
ATOM   2969  O2    U A  92     290.725 247.856 217.876  1.00118.71           O  
ATOM   2970  N3    U A  92     290.886 247.622 215.615  1.00110.50           N  
ATOM   2971  C4    U A  92     291.111 248.090 214.339  1.00101.77           C  
ATOM   2972  O4    U A  92     291.029 247.297 213.395  1.00 93.10           O  
ATOM   2973  C5    U A  92     291.426 249.494 214.290  1.00105.08           C  
ATOM   2974  C6    U A  92     291.486 250.235 215.413  1.00105.64           C  
ATOM   2975  P     G A  93     295.409 253.391 217.821  1.00120.58           P  
ATOM   2976  OP1   G A  93     296.342 253.866 218.876  1.00115.49           O  
ATOM   2977  OP2   G A  93     294.830 254.379 216.870  1.00103.99           O1-
ATOM   2978  O5'   G A  93     296.156 252.272 216.963  1.00107.99           O  
ATOM   2979  C5'   G A  93     297.252 251.539 217.495  1.00105.86           C  
ATOM   2980  C4'   G A  93     297.323 250.168 216.878  1.00105.50           C  
ATOM   2981  O4'   G A  93     295.964 249.714 216.612  1.00102.33           O  
ATOM   2982  C3'   G A  93     298.028 250.081 215.523  1.00106.32           C  
ATOM   2983  O3'   G A  93     299.448 249.953 215.621  1.00107.52           O  
ATOM   2984  C2'   G A  93     297.344 248.882 214.870  1.00106.01           C  
ATOM   2985  O2'   G A  93     297.867 247.666 215.378  1.00104.75           O  
ATOM   2986  C1'   G A  93     295.909 249.032 215.378  1.00103.18           C  
ATOM   2987  N9    G A  93     295.067 249.802 214.435  1.00103.35           N  
ATOM   2988  C8    G A  93     294.620 251.097 214.582  1.00103.55           C  
ATOM   2989  N7    G A  93     293.909 251.533 213.578  1.00 94.77           N  
ATOM   2990  C5    G A  93     293.895 250.460 212.699  1.00 91.67           C  
ATOM   2991  C6    G A  93     293.274 250.331 211.435  1.00 86.10           C  
ATOM   2992  O6    G A  93     292.603 251.158 210.808  1.00 82.78           O  
ATOM   2993  N1    G A  93     293.499 249.076 210.889  1.00 87.43           N  
ATOM   2994  C2    G A  93     294.219 248.073 211.483  1.00 86.51           C  
ATOM   2995  N2    G A  93     294.329 246.930 210.805  1.00 91.15           N  
ATOM   2996  N3    G A  93     294.798 248.173 212.658  1.00 90.75           N  
ATOM   2997  C4    G A  93     294.593 249.383 213.211  1.00 95.85           C  
ATOM   2998  P     A A  94     300.435 250.483 214.451  1.00115.82           P  
ATOM   2999  OP1   A A  94     301.837 250.349 214.926  1.00107.81           O  
ATOM   3000  OP2   A A  94     299.942 251.789 213.938  1.00101.45           O1-
ATOM   3001  O5'   A A  94     300.308 249.399 213.298  1.00 99.06           O  
ATOM   3002  C5'   A A  94     300.829 248.092 213.467  1.00 90.39           C  
ATOM   3003  C4'   A A  94     300.306 247.192 212.384  1.00 97.72           C  
ATOM   3004  O4'   A A  94     298.865 247.356 212.306  1.00 99.74           O  
ATOM   3005  C3'   A A  94     300.804 247.533 210.986  1.00 99.92           C  
ATOM   3006  O3'   A A  94     302.067 246.951 210.697  1.00103.36           O  
ATOM   3007  C2'   A A  94     299.670 247.052 210.089  1.00 97.53           C  
ATOM   3008  O2'   A A  94     299.743 245.644 209.912  1.00 95.47           O  
ATOM   3009  C1'   A A  94     298.445 247.362 210.957  1.00101.24           C  
ATOM   3010  N9    A A  94     297.803 248.675 210.667  1.00 92.14           N  
ATOM   3011  C8    A A  94     297.789 249.786 211.480  1.00 89.69           C  
ATOM   3012  N7    A A  94     297.132 250.815 211.007  1.00 82.95           N  
ATOM   3013  C5    A A  94     296.657 250.357 209.797  1.00 76.95           C  
ATOM   3014  C6    A A  94     295.885 250.977 208.814  1.00 73.59           C  
ATOM   3015  N6    A A  94     295.449 252.226 208.911  1.00 70.93           N  
ATOM   3016  N1    A A  94     295.573 250.268 207.715  1.00 78.03           N  
ATOM   3017  C2    A A  94     296.020 249.013 207.626  1.00 77.19           C  
ATOM   3018  N3    A A  94     296.755 248.314 208.485  1.00 79.60           N  
ATOM   3019  C4    A A  94     297.048 249.048 209.571  1.00 83.25           C  
ATOM   3020  P     A A  95     303.310 247.879 210.269  1.00109.99           P  
ATOM   3021  OP1   A A  95     304.553 247.063 210.262  1.00104.38           O  
ATOM   3022  OP2   A A  95     303.247 249.112 211.107  1.00 98.95           O1-
ATOM   3023  O5'   A A  95     303.020 248.196 208.736  1.00 96.29           O  
ATOM   3024  C5'   A A  95     302.883 247.139 207.796  1.00 91.71           C  
ATOM   3025  C4'   A A  95     301.997 247.547 206.649  1.00 92.91           C  
ATOM   3026  O4'   A A  95     300.692 247.918 207.163  1.00 88.54           O  
ATOM   3027  C3'   A A  95     302.452 248.771 205.862  1.00 93.15           C  
ATOM   3028  O3'   A A  95     303.417 248.461 204.871  1.00 94.08           O  
ATOM   3029  C2'   A A  95     301.149 249.306 205.288  1.00 87.16           C  
ATOM   3030  O2'   A A  95     300.769 248.557 204.140  1.00 82.94           O  
ATOM   3031  C1'   A A  95     300.168 248.998 206.422  1.00 88.05           C  
ATOM   3032  N9    A A  95     299.979 250.141 207.338  1.00 84.86           N  
ATOM   3033  C8    A A  95     300.445 250.293 208.620  1.00 85.86           C  
ATOM   3034  N7    A A  95     300.096 251.422 209.185  1.00 81.48           N  
ATOM   3035  C5    A A  95     299.345 252.051 208.206  1.00 77.59           C  
ATOM   3036  C6    A A  95     298.681 253.285 208.168  1.00 78.04           C  
ATOM   3037  N6    A A  95     298.664 254.149 209.180  1.00 79.85           N  
ATOM   3038  N1    A A  95     298.023 253.621 207.041  1.00 77.45           N  
ATOM   3039  C2    A A  95     298.038 252.756 206.023  1.00 75.39           C  
ATOM   3040  N3    A A  95     298.622 251.568 205.932  1.00 76.35           N  
ATOM   3041  C4    A A  95     299.264 251.276 207.070  1.00 78.95           C  
ATOM   3042  P     C A  96     304.758 249.338 204.728  1.00102.80           P  
ATOM   3043  OP1   C A  96     305.788 248.454 204.121  1.00 93.93           O  
ATOM   3044  OP2   C A  96     305.023 249.989 206.039  1.00101.47           O1-
ATOM   3045  O5'   C A  96     304.383 250.476 203.672  1.00 95.92           O  
ATOM   3046  C5'   C A  96     304.125 251.818 204.076  1.00 90.36           C  
ATOM   3047  C4'   C A  96     302.860 252.342 203.437  1.00 91.09           C  
ATOM   3048  O4'   C A  96     301.781 252.335 204.410  1.00 85.45           O  
ATOM   3049  C3'   C A  96     302.893 253.776 202.926  1.00 90.15           C  
ATOM   3050  O3'   C A  96     303.497 253.890 201.648  1.00 92.43           O  
ATOM   3051  C2'   C A  96     301.419 254.157 202.938  1.00 84.97           C  
ATOM   3052  O2'   C A  96     300.746 253.581 201.826  1.00 81.63           O  
ATOM   3053  C1'   C A  96     300.944 253.451 204.208  1.00 82.56           C  
ATOM   3054  N1    C A  96     301.071 254.320 205.397  1.00 82.39           N  
ATOM   3055  C2    C A  96     300.180 255.377 205.607  1.00 79.82           C  
ATOM   3056  O2    C A  96     299.278 255.572 204.783  1.00 78.33           O  
ATOM   3057  N3    C A  96     300.329 256.155 206.705  1.00 79.42           N  
ATOM   3058  C4    C A  96     301.316 255.908 207.572  1.00 80.40           C  
ATOM   3059  N4    C A  96     301.442 256.689 208.646  1.00 77.93           N  
ATOM   3060  C5    C A  96     302.232 254.836 207.381  1.00 83.53           C  
ATOM   3061  C6    C A  96     302.072 254.077 206.295  1.00 84.26           C  
ATOM   3062  P     C A  97     304.505 255.101 201.320  1.00 99.32           P  
ATOM   3063  OP1   C A  97     305.228 254.754 200.067  1.00 93.74           O  
ATOM   3064  OP2   C A  97     305.278 255.398 202.555  1.00100.03           O1-
ATOM   3065  O5'   C A  97     303.542 256.330 200.998  1.00 87.75           O  
ATOM   3066  C5'   C A  97     302.634 256.263 199.909  1.00 88.24           C  
ATOM   3067  C4'   C A  97     301.656 257.410 199.920  1.00 88.69           C  
ATOM   3068  O4'   C A  97     300.785 257.316 201.080  1.00 88.04           O  
ATOM   3069  C3'   C A  97     302.262 258.794 200.044  1.00 89.31           C  
ATOM   3070  O3'   C A  97     302.825 259.283 198.846  1.00 90.50           O  
ATOM   3071  C2'   C A  97     301.095 259.613 200.570  1.00 88.32           C  
ATOM   3072  O2'   C A  97     300.164 259.879 199.529  1.00 77.80           O  
ATOM   3073  C1'   C A  97     300.470 258.615 201.549  1.00 87.76           C  
ATOM   3074  N1    C A  97     301.012 258.767 202.929  1.00 81.81           N  
ATOM   3075  C2    C A  97     300.408 259.667 203.824  1.00 77.92           C  
ATOM   3076  O2    C A  97     299.425 260.326 203.466  1.00 79.72           O  
ATOM   3077  N3    C A  97     300.902 259.804 205.070  1.00 78.32           N  
ATOM   3078  C4    C A  97     301.958 259.082 205.437  1.00 79.17           C  
ATOM   3079  N4    C A  97     302.415 259.245 206.678  1.00 83.46           N  
ATOM   3080  C5    C A  97     302.600 258.164 204.562  1.00 76.18           C  
ATOM   3081  C6    C A  97     302.099 258.040 203.334  1.00 79.06           C  
ATOM   3082  P     G A  98     304.274 259.966 198.912  1.00101.31           P  
ATOM   3083  OP1   G A  98     304.737 260.211 197.519  1.00 95.45           O  
ATOM   3084  OP2   G A  98     305.089 259.116 199.822  1.00 90.61           O1-
ATOM   3085  O5'   G A  98     304.005 261.363 199.652  1.00104.31           O  
ATOM   3086  C5'   G A  98     303.146 262.343 199.071  1.00106.21           C  
ATOM   3087  C4'   G A  98     302.579 263.340 200.068  1.00 97.98           C  
ATOM   3088  O4'   G A  98     302.095 262.680 201.268  1.00 92.44           O  
ATOM   3089  C3'   G A  98     303.506 264.416 200.612  1.00 97.80           C  
ATOM   3090  O3'   G A  98     303.794 265.451 199.687  1.00 95.54           O  
ATOM   3091  C2'   G A  98     302.742 264.900 201.836  1.00 96.10           C  
ATOM   3092  O2'   G A  98     301.678 265.761 201.449  1.00 91.88           O  
ATOM   3093  C1'   G A  98     302.144 263.587 202.356  1.00 89.28           C  
ATOM   3094  N9    G A  98     302.959 263.018 203.447  1.00 84.17           N  
ATOM   3095  C8    G A  98     303.804 261.933 203.415  1.00 80.17           C  
ATOM   3096  N7    G A  98     304.383 261.720 204.567  1.00 83.35           N  
ATOM   3097  C5    G A  98     303.899 262.724 205.411  1.00 87.40           C  
ATOM   3098  C6    G A  98     304.162 263.022 206.787  1.00 81.97           C  
ATOM   3099  O6    G A  98     304.901 262.453 207.596  1.00 82.02           O  
ATOM   3100  N1    G A  98     303.455 264.126 207.230  1.00 79.51           N  
ATOM   3101  C2    G A  98     302.602 264.860 206.455  1.00 85.14           C  
ATOM   3102  N2    G A  98     302.026 265.893 207.078  1.00 88.27           N  
ATOM   3103  N3    G A  98     302.341 264.609 205.182  1.00 85.81           N  
ATOM   3104  C4    G A  98     303.018 263.531 204.724  1.00 85.86           C  
ATOM   3105  P     U A  99     305.261 266.111 199.673  1.00100.58           P  
ATOM   3106  OP1   U A  99     305.463 266.818 198.385  1.00104.27           O  
ATOM   3107  OP2   U A  99     306.222 265.060 200.094  1.00 99.61           O1-
ATOM   3108  O5'   U A  99     305.214 267.202 200.834  1.00100.68           O  
ATOM   3109  C5'   U A  99     304.493 268.417 200.679  1.00101.18           C  
ATOM   3110  C4'   U A  99     304.446 269.192 201.974  1.00102.35           C  
ATOM   3111  O4'   U A  99     303.975 268.323 203.037  1.00 98.28           O  
ATOM   3112  C3'   U A  99     305.780 269.718 202.485  1.00105.14           C  
ATOM   3113  O3'   U A  99     306.156 270.940 201.875  1.00109.20           O  
ATOM   3114  C2'   U A  99     305.552 269.829 203.989  1.00101.60           C  
ATOM   3115  O2'   U A  99     304.844 271.020 204.303  1.00 98.56           O  
ATOM   3116  C1'   U A  99     304.631 268.633 204.247  1.00 94.84           C  
ATOM   3117  N1    U A  99     305.358 267.428 204.711  1.00 89.50           N  
ATOM   3118  C2    U A  99     305.564 267.305 206.068  1.00 93.18           C  
ATOM   3119  O2    U A  99     305.190 268.145 206.869  1.00 97.51           O  
ATOM   3120  N3    U A  99     306.223 266.168 206.458  1.00 90.66           N  
ATOM   3121  C4    U A  99     306.687 265.156 205.644  1.00 88.52           C  
ATOM   3122  O4    U A  99     307.264 264.197 206.159  1.00 87.23           O  
ATOM   3123  C5    U A  99     306.434 265.351 204.247  1.00 84.17           C  
ATOM   3124  C6    U A  99     305.792 266.450 203.841  1.00 85.90           C  
ATOM   3125  P     U A 100     307.574 271.061 201.128  1.00122.64           P  
ATOM   3126  OP1   U A 100     307.882 269.756 200.488  1.00114.47           O  
ATOM   3127  OP2   U A 100     308.538 271.656 202.090  1.00120.11           O1-
ATOM   3128  O5'   U A 100     307.313 272.122 199.965  1.00122.87           O  
ATOM   3129  C5'   U A 100     306.534 271.793 198.817  1.00121.56           C  
ATOM   3130  C4'   U A 100     305.913 273.023 198.187  1.00127.36           C  
ATOM   3131  O4'   U A 100     304.811 273.490 199.012  1.00122.84           O  
ATOM   3132  C3'   U A 100     306.849 274.223 198.006  1.00131.74           C  
ATOM   3133  O3'   U A 100     306.505 274.942 196.815  1.00132.03           O  
ATOM   3134  C2'   U A 100     306.528 275.086 199.226  1.00126.13           C  
ATOM   3135  O2'   U A 100     306.813 276.461 199.069  1.00117.81           O  
ATOM   3136  C1'   U A 100     305.030 274.838 199.394  1.00122.68           C  
ATOM   3137  N1    U A 100     304.540 274.991 200.771  1.00118.95           N  
ATOM   3138  C2    U A 100     303.575 275.951 200.978  1.00115.12           C  
ATOM   3139  O2    U A 100     303.158 276.655 200.075  1.00113.15           O  
ATOM   3140  N3    U A 100     303.128 276.046 202.273  1.00117.13           N  
ATOM   3141  C4    U A 100     303.546 275.290 203.353  1.00119.16           C  
ATOM   3142  O4    U A 100     303.046 275.499 204.461  1.00118.40           O  
ATOM   3143  C5    U A 100     304.551 274.311 203.055  1.00115.53           C  
ATOM   3144  C6    U A 100     305.000 274.198 201.800  1.00117.39           C  
ATOM   3145  P     A A 101     306.279 274.184 195.411  1.00139.11           P  
ATOM   3146  OP1   A A 101     307.106 272.942 195.378  1.00128.86           O  
ATOM   3147  OP2   A A 101     306.458 275.184 194.324  1.00133.82           O1-
ATOM   3148  O5'   A A 101     304.729 273.808 195.448  1.00127.19           O  
ATOM   3149  C5'   A A 101     304.018 273.434 194.273  1.00126.75           C  
ATOM   3150  C4'   A A 101     303.358 272.091 194.457  1.00128.75           C  
ATOM   3151  O4'   A A 101     303.323 271.780 195.879  1.00124.70           O  
ATOM   3152  C3'   A A 101     301.916 271.979 193.950  1.00129.80           C  
ATOM   3153  O3'   A A 101     301.709 270.684 193.386  1.00128.67           O  
ATOM   3154  C2'   A A 101     301.090 272.116 195.232  1.00125.94           C  
ATOM   3155  O2'   A A 101     299.820 271.496 195.182  1.00116.99           O  
ATOM   3156  C1'   A A 101     302.003 271.452 196.261  1.00123.19           C  
ATOM   3157  N9    A A 101     301.789 271.864 197.657  1.00113.08           N  
ATOM   3158  C8    A A 101     301.891 271.015 198.723  1.00111.78           C  
ATOM   3159  N7    A A 101     301.656 271.564 199.884  1.00106.74           N  
ATOM   3160  C5    A A 101     301.379 272.879 199.578  1.00102.01           C  
ATOM   3161  C6    A A 101     301.049 273.962 200.405  1.00101.05           C  
ATOM   3162  N6    A A 101     300.945 273.881 201.735  1.00101.48           N  
ATOM   3163  N1    A A 101     300.826 275.147 199.807  1.00103.82           N  
ATOM   3164  C2    A A 101     300.938 275.208 198.474  1.00105.79           C  
ATOM   3165  N3    A A 101     301.240 274.257 197.591  1.00107.03           N  
ATOM   3166  C4    A A 101     301.460 273.089 198.211  1.00104.97           C  
ATOM   3167  P     U A 102     301.714 270.478 191.790  1.00129.77           P  
ATOM   3168  OP1   U A 102     303.122 270.439 191.318  1.00122.99           O  
ATOM   3169  OP2   U A 102     300.770 271.465 191.202  1.00129.55           O1-
ATOM   3170  O5'   U A 102     301.089 269.024 191.599  1.00134.31           O  
ATOM   3171  C5'   U A 102     301.319 267.994 192.558  1.00135.05           C  
ATOM   3172  C4'   U A 102     300.028 267.315 192.962  1.00140.00           C  
ATOM   3173  O4'   U A 102     299.229 267.084 191.768  1.00138.64           O  
ATOM   3174  C3'   U A 102     300.179 265.951 193.644  1.00135.83           C  
ATOM   3175  O3'   U A 102     299.092 265.755 194.557  1.00124.79           O  
ATOM   3176  C2'   U A 102     300.022 264.984 192.473  1.00136.05           C  
ATOM   3177  O2'   U A 102     299.624 263.676 192.835  1.00129.18           O  
ATOM   3178  C1'   U A 102     298.956 265.700 191.641  1.00140.89           C  
ATOM   3179  N1    U A 102     298.912 265.360 190.205  1.00134.97           N  
ATOM   3180  C2    U A 102     300.048 265.339 189.393  1.00132.10           C  
ATOM   3181  O2    U A 102     301.191 265.586 189.757  1.00126.79           O  
ATOM   3182  N3    U A 102     299.789 265.006 188.083  1.00129.07           N  
ATOM   3183  C4    U A 102     298.566 264.705 187.513  1.00122.83           C  
ATOM   3184  O4    U A 102     298.502 264.425 186.315  1.00118.72           O  
ATOM   3185  C5    U A 102     297.456 264.751 188.411  1.00123.75           C  
ATOM   3186  C6    U A 102     297.670 265.072 189.686  1.00128.19           C  
ATOM   3187  P     A A 103     299.261 266.030 196.134  1.00113.74           P  
ATOM   3188  OP1   A A 103     298.581 267.314 196.453  1.00106.46           O  
ATOM   3189  OP2   A A 103     300.686 265.834 196.508  1.00111.73           O1-
ATOM   3190  O5'   A A 103     298.440 264.847 196.811  1.00103.14           O  
ATOM   3191  C5'   A A 103     299.015 263.560 196.978  1.00100.52           C  
ATOM   3192  C4'   A A 103     298.665 262.990 198.326  1.00 91.39           C  
ATOM   3193  O4'   A A 103     299.344 263.748 199.361  1.00 90.00           O  
ATOM   3194  C3'   A A 103     297.199 263.083 198.712  1.00 87.67           C  
ATOM   3195  O3'   A A 103     296.393 262.070 198.140  1.00 89.06           O  
ATOM   3196  C2'   A A 103     297.262 263.028 200.225  1.00 84.67           C  
ATOM   3197  O2'   A A 103     297.524 261.699 200.646  1.00 89.10           O  
ATOM   3198  C1'   A A 103     298.507 263.868 200.493  1.00 86.31           C  
ATOM   3199  N9    A A 103     298.178 265.294 200.689  1.00 83.96           N  
ATOM   3200  C8    A A 103     298.292 266.305 199.772  1.00 88.34           C  
ATOM   3201  N7    A A 103     297.925 267.479 200.230  1.00 87.77           N  
ATOM   3202  C5    A A 103     297.541 267.234 201.541  1.00 80.78           C  
ATOM   3203  C6    A A 103     297.049 268.068 202.567  1.00 79.02           C  
ATOM   3204  N6    A A 103     296.847 269.377 202.447  1.00 84.09           N  
ATOM   3205  N1    A A 103     296.763 267.511 203.755  1.00 79.57           N  
ATOM   3206  C2    A A 103     296.965 266.194 203.883  1.00 82.99           C  
ATOM   3207  N3    A A 103     297.420 265.302 203.003  1.00 81.24           N  
ATOM   3208  C4    A A 103     297.694 265.891 201.832  1.00 78.89           C  
ATOM   3209  P     A A 104     294.917 262.429 197.606  1.00103.73           P  
ATOM   3210  OP1   A A 104     294.294 261.156 197.155  1.00 95.93           O  
ATOM   3211  OP2   A A 104     295.040 263.571 196.662  1.00 96.79           O1-
ATOM   3212  O5'   A A 104     294.142 262.973 198.895  1.00 90.64           O  
ATOM   3213  C5'   A A 104     293.700 262.088 199.917  1.00 87.46           C  
ATOM   3214  C4'   A A 104     293.406 262.801 201.219  1.00 80.12           C  
ATOM   3215  O4'   A A 104     294.460 263.745 201.536  1.00 79.39           O  
ATOM   3216  C3'   A A 104     292.143 263.639 201.266  1.00 74.84           C  
ATOM   3217  O3'   A A 104     290.985 262.866 201.478  1.00 80.95           O  
ATOM   3218  C2'   A A 104     292.428 264.590 202.411  1.00 74.28           C  
ATOM   3219  O2'   A A 104     292.267 263.927 203.653  1.00 78.64           O  
ATOM   3220  C1'   A A 104     293.913 264.865 202.197  1.00 76.54           C  
ATOM   3221  N9    A A 104     294.108 266.041 201.338  1.00 78.44           N  
ATOM   3222  C8    A A 104     294.644 266.076 200.076  1.00 81.59           C  
ATOM   3223  N7    A A 104     294.678 267.275 199.555  1.00 81.44           N  
ATOM   3224  C5    A A 104     294.124 268.075 200.544  1.00 79.28           C  
ATOM   3225  C6    A A 104     293.874 269.448 200.611  1.00 82.22           C  
ATOM   3226  N6    A A 104     294.168 270.294 199.621  1.00 83.45           N  
ATOM   3227  N1    A A 104     293.312 269.933 201.741  1.00 80.02           N  
ATOM   3228  C2    A A 104     293.020 269.084 202.729  1.00 73.93           C  
ATOM   3229  N3    A A 104     293.205 267.773 202.782  1.00 75.66           N  
ATOM   3230  C4    A A 104     293.766 267.329 201.647  1.00 76.45           C  
ATOM   3231  P     C A 105     289.646 263.221 200.679  1.00 93.21           P  
ATOM   3232  OP1   C A 105     288.678 262.119 200.915  1.00 90.09           O  
ATOM   3233  OP2   C A 105     290.031 263.607 199.294  1.00 84.71           O1-
ATOM   3234  O5'   C A 105     289.096 264.531 201.396  1.00 80.57           O  
ATOM   3235  C5'   C A 105     288.709 264.531 202.762  1.00 76.61           C  
ATOM   3236  C4'   C A 105     288.459 265.937 203.227  1.00 74.98           C  
ATOM   3237  O4'   C A 105     289.710 266.675 203.170  1.00 77.13           O  
ATOM   3238  C3'   C A 105     287.517 266.753 202.350  1.00 79.62           C  
ATOM   3239  O3'   C A 105     286.140 266.518 202.595  1.00 86.95           O  
ATOM   3240  C2'   C A 105     287.966 268.175 202.629  1.00 75.03           C  
ATOM   3241  O2'   C A 105     287.514 268.603 203.905  1.00 77.67           O  
ATOM   3242  C1'   C A 105     289.478 267.982 202.693  1.00 73.44           C  
ATOM   3243  N1    C A 105     290.098 268.098 201.352  1.00 72.38           N  
ATOM   3244  C2    C A 105     290.141 269.346 200.739  1.00 75.05           C  
ATOM   3245  O2    C A 105     289.670 270.322 201.335  1.00 79.63           O  
ATOM   3246  N3    C A 105     290.691 269.492 199.512  1.00 73.40           N  
ATOM   3247  C4    C A 105     291.191 268.441 198.883  1.00 71.67           C  
ATOM   3248  N4    C A 105     291.719 268.649 197.678  1.00 69.43           N  
ATOM   3249  C5    C A 105     291.164 267.144 199.473  1.00 78.83           C  
ATOM   3250  C6    C A 105     290.618 267.020 200.693  1.00 76.07           C  
ATOM   3251  P     C A 106     285.089 266.514 201.371  1.00 94.42           P  
ATOM   3252  OP1   C A 106     283.787 266.008 201.886  1.00 83.98           O  
ATOM   3253  OP2   C A 106     285.716 265.834 200.212  1.00 87.43           O1-
ATOM   3254  O5'   C A 106     284.950 268.051 200.969  1.00 88.90           O  
ATOM   3255  C5'   C A 106     284.453 269.007 201.894  1.00 90.29           C  
ATOM   3256  C4'   C A 106     284.311 270.368 201.263  1.00 84.87           C  
ATOM   3257  O4'   C A 106     285.622 270.937 201.027  1.00 78.88           O  
ATOM   3258  C3'   C A 106     283.643 270.397 199.898  1.00 85.52           C  
ATOM   3259  O3'   C A 106     282.231 270.379 199.976  1.00 84.56           O  
ATOM   3260  C2'   C A 106     284.189 271.676 199.285  1.00 85.90           C  
ATOM   3261  O2'   C A 106     283.502 272.805 199.805  1.00 90.15           O  
ATOM   3262  C1'   C A 106     285.611 271.693 199.836  1.00 79.51           C  
ATOM   3263  N1    C A 106     286.585 271.102 198.896  1.00 75.21           N  
ATOM   3264  C2    C A 106     287.091 271.886 197.849  1.00 76.69           C  
ATOM   3265  O2    C A 106     286.705 273.058 197.714  1.00 78.81           O  
ATOM   3266  N3    C A 106     287.995 271.354 196.999  1.00 76.19           N  
ATOM   3267  C4    C A 106     288.389 270.096 197.181  1.00 73.72           C  
ATOM   3268  N4    C A 106     289.285 269.607 196.324  1.00 74.52           N  
ATOM   3269  C5    C A 106     287.887 269.279 198.236  1.00 74.16           C  
ATOM   3270  C6    C A 106     286.996 269.815 199.069  1.00 74.58           C  
ATOM   3271  P     G A 107     281.373 269.745 198.777  1.00 94.96           P  
ATOM   3272  OP1   G A 107     279.958 269.764 199.214  1.00 93.85           O  
ATOM   3273  OP2   G A 107     282.021 268.467 198.371  1.00 91.16           O1-
ATOM   3274  O5'   G A 107     281.533 270.780 197.569  1.00 89.20           O  
ATOM   3275  C5'   G A 107     280.619 271.857 197.397  1.00 88.51           C  
ATOM   3276  C4'   G A 107     281.035 272.781 196.276  1.00 84.76           C  
ATOM   3277  O4'   G A 107     282.463 273.050 196.354  1.00 82.26           O  
ATOM   3278  C3'   G A 107     280.837 272.269 194.855  1.00 87.12           C  
ATOM   3279  O3'   G A 107     279.490 272.373 194.395  1.00 91.67           O  
ATOM   3280  C2'   G A 107     281.830 273.118 194.063  1.00 84.71           C  
ATOM   3281  O2'   G A 107     281.305 274.414 193.818  1.00 86.42           O  
ATOM   3282  C1'   G A 107     282.993 273.237 195.055  1.00 80.67           C  
ATOM   3283  N9    G A 107     284.016 272.204 194.803  1.00 75.19           N  
ATOM   3284  C8    G A 107     284.284 271.127 195.608  1.00 76.48           C  
ATOM   3285  N7    G A 107     285.216 270.352 195.132  1.00 79.80           N  
ATOM   3286  C5    G A 107     285.586 270.949 193.932  1.00 79.75           C  
ATOM   3287  C6    G A 107     286.553 270.545 192.970  1.00 80.03           C  
ATOM   3288  O6    G A 107     287.299 269.559 192.994  1.00 81.09           O  
ATOM   3289  N1    G A 107     286.628 271.423 191.899  1.00 76.22           N  
ATOM   3290  C2    G A 107     285.858 272.542 191.768  1.00 75.35           C  
ATOM   3291  N2    G A 107     286.082 273.244 190.654  1.00 79.75           N  
ATOM   3292  N3    G A 107     284.943 272.932 192.648  1.00 75.61           N  
ATOM   3293  C4    G A 107     284.852 272.093 193.706  1.00 76.12           C  
ATOM   3294  P     G A 108     278.897 271.356 193.284  1.00 97.20           P  
ATOM   3295  OP1   G A 108     277.423 271.519 193.215  1.00 92.91           O  
ATOM   3296  OP2   G A 108     279.460 269.998 193.511  1.00 93.28           O1-
ATOM   3297  O5'   G A 108     279.473 271.911 191.911  1.00 85.49           O  
ATOM   3298  C5'   G A 108     279.297 273.274 191.565  1.00 85.57           C  
ATOM   3299  C4'   G A 108     279.984 273.597 190.269  1.00 88.44           C  
ATOM   3300  O4'   G A 108     281.415 273.684 190.468  1.00 83.77           O  
ATOM   3301  C3'   G A 108     279.824 272.562 189.170  1.00 93.53           C  
ATOM   3302  O3'   G A 108     278.584 272.689 188.489  1.00100.93           O  
ATOM   3303  C2'   G A 108     281.034 272.827 188.285  1.00 90.64           C  
ATOM   3304  O2'   G A 108     280.799 273.944 187.444  1.00 96.41           O  
ATOM   3305  C1'   G A 108     282.088 273.226 189.316  1.00 85.69           C  
ATOM   3306  N9    G A 108     282.945 272.095 189.695  1.00 81.36           N  
ATOM   3307  C8    G A 108     282.939 271.452 190.896  1.00 84.76           C  
ATOM   3308  N7    G A 108     283.811 270.492 190.972  1.00 82.55           N  
ATOM   3309  C5    G A 108     284.423 270.516 189.739  1.00 76.79           C  
ATOM   3310  C6    G A 108     285.450 269.700 189.250  1.00 81.28           C  
ATOM   3311  O6    G A 108     286.018 268.775 189.846  1.00 84.35           O  
ATOM   3312  N1    G A 108     285.785 270.051 187.949  1.00 80.12           N  
ATOM   3313  C2    G A 108     285.196 271.056 187.229  1.00 78.44           C  
ATOM   3314  N2    G A 108     285.662 271.248 185.992  1.00 82.15           N  
ATOM   3315  N3    G A 108     284.236 271.830 187.682  1.00 78.69           N  
ATOM   3316  C4    G A 108     283.906 271.497 188.936  1.00 76.68           C  
ATOM   3317  P     C A 109     277.763 271.389 188.012  1.00107.74           P  
ATOM   3318  OP1   C A 109     276.437 271.858 187.532  1.00101.51           O  
ATOM   3319  OP2   C A 109     277.827 270.367 189.095  1.00 98.36           O1-
ATOM   3320  O5'   C A 109     278.577 270.871 186.743  1.00102.45           O  
ATOM   3321  C5'   C A 109     278.921 271.759 185.685  1.00 97.62           C  
ATOM   3322  C4'   C A 109     280.013 271.188 184.810  1.00 97.37           C  
ATOM   3323  O4'   C A 109     281.277 271.148 185.529  1.00 93.93           O  
ATOM   3324  C3'   C A 109     279.824 269.752 184.368  1.00 96.42           C  
ATOM   3325  O3'   C A 109     278.869 269.575 183.347  1.00103.77           O  
ATOM   3326  C2'   C A 109     281.236 269.350 183.985  1.00 88.55           C  
ATOM   3327  O2'   C A 109     281.598 269.951 182.751  1.00 87.40           O  
ATOM   3328  C1'   C A 109     282.030 270.026 185.099  1.00 90.84           C  
ATOM   3329  N1    C A 109     282.247 269.109 186.248  1.00 87.61           N  
ATOM   3330  C2    C A 109     283.415 268.338 186.294  1.00 84.01           C  
ATOM   3331  O2    C A 109     284.257 268.440 185.391  1.00 83.33           O  
ATOM   3332  N3    C A 109     283.614 267.497 187.335  1.00 85.02           N  
ATOM   3333  C4    C A 109     282.708 267.387 188.308  1.00 85.55           C  
ATOM   3334  N4    C A 109     282.957 266.539 189.314  1.00 82.14           N  
ATOM   3335  C5    C A 109     281.507 268.147 188.285  1.00 86.80           C  
ATOM   3336  C6    C A 109     281.324 268.979 187.252  1.00 88.81           C  
ATOM   3337  P     G A 110     278.180 268.135 183.203  1.00119.30           P  
ATOM   3338  OP1   G A 110     276.857 268.301 182.546  1.00116.54           O  
ATOM   3339  OP2   G A 110     278.238 267.488 184.543  1.00106.50           O1-
ATOM   3340  O5'   G A 110     279.170 267.353 182.228  1.00107.10           O  
ATOM   3341  C5'   G A 110     279.329 265.948 182.326  1.00104.04           C  
ATOM   3342  C4'   G A 110     280.749 265.534 182.048  1.00102.11           C  
ATOM   3343  O4'   G A 110     281.635 266.063 183.072  1.00 99.99           O  
ATOM   3344  C3'   G A 110     281.006 264.039 182.080  1.00100.54           C  
ATOM   3345  O3'   G A 110     280.605 263.383 180.891  1.00 96.38           O  
ATOM   3346  C2'   G A 110     282.503 263.963 182.365  1.00103.69           C  
ATOM   3347  O2'   G A 110     283.258 264.200 181.186  1.00104.28           O  
ATOM   3348  C1'   G A 110     282.693 265.152 183.312  1.00100.21           C  
ATOM   3349  N9    G A 110     282.666 264.739 184.730  1.00 90.82           N  
ATOM   3350  C8    G A 110     281.816 265.205 185.702  1.00 91.17           C  
ATOM   3351  N7    G A 110     282.024 264.658 186.865  1.00 88.43           N  
ATOM   3352  C5    G A 110     283.076 263.777 186.655  1.00 85.29           C  
ATOM   3353  C6    G A 110     283.735 262.905 187.568  1.00 83.26           C  
ATOM   3354  O6    G A 110     283.506 262.737 188.776  1.00 81.03           O  
ATOM   3355  N1    G A 110     284.754 262.183 186.945  1.00 82.26           N  
ATOM   3356  C2    G A 110     285.091 262.290 185.615  1.00 83.66           C  
ATOM   3357  N2    G A 110     286.101 261.507 185.203  1.00 81.78           N  
ATOM   3358  N3    G A 110     284.485 263.102 184.757  1.00 85.10           N  
ATOM   3359  C4    G A 110     283.492 263.815 185.339  1.00 86.27           C  
ATOM   3360  P     A A 111     279.896 261.945 180.979  1.00 92.65           P  
ATOM   3361  OP1   A A 111     279.603 261.484 179.597  1.00 94.56           O  
ATOM   3362  OP2   A A 111     278.794 262.038 181.967  1.00 91.58           O1-
ATOM   3363  O5'   A A 111     281.034 261.008 181.575  1.00 90.10           O  
ATOM   3364  C5'   A A 111     282.231 260.783 180.845  1.00 91.47           C  
ATOM   3365  C4'   A A 111     283.106 259.761 181.515  1.00 86.37           C  
ATOM   3366  O4'   A A 111     283.763 260.354 182.668  1.00 85.18           O  
ATOM   3367  C3'   A A 111     282.390 258.548 182.087  1.00 85.05           C  
ATOM   3368  O3'   A A 111     282.036 257.575 181.108  1.00 88.77           O  
ATOM   3369  C2'   A A 111     283.375 258.066 183.149  1.00 80.77           C  
ATOM   3370  O2'   A A 111     284.479 257.394 182.565  1.00 82.07           O  
ATOM   3371  C1'   A A 111     283.871 259.398 183.704  1.00 83.17           C  
ATOM   3372  N9    A A 111     283.029 259.840 184.828  1.00 87.29           N  
ATOM   3373  C8    A A 111     282.107 260.863 184.881  1.00 89.08           C  
ATOM   3374  N7    A A 111     281.513 260.979 186.049  1.00 85.83           N  
ATOM   3375  C5    A A 111     282.077 259.957 186.810  1.00 86.37           C  
ATOM   3376  C6    A A 111     281.882 259.537 188.141  1.00 83.21           C  
ATOM   3377  N6    A A 111     281.028 260.110 188.998  1.00 81.12           N  
ATOM   3378  N1    A A 111     282.615 258.482 188.572  1.00 83.95           N  
ATOM   3379  C2    A A 111     283.484 257.900 187.725  1.00 84.06           C  
ATOM   3380  N3    A A 111     283.755 258.197 186.457  1.00 81.55           N  
ATOM   3381  C4    A A 111     283.009 259.247 186.063  1.00 86.69           C  
ATOM   3382  P     U A 112     280.491 257.147 180.876  1.00 96.23           P  
ATOM   3383  OP1   U A 112     280.343 256.705 179.465  1.00 96.05           O  
ATOM   3384  OP2   U A 112     279.598 258.226 181.374  1.00 84.22           O1-
ATOM   3385  O5'   U A 112     280.298 255.864 181.806  1.00 85.86           O  
ATOM   3386  C5'   U A 112     281.146 254.730 181.671  1.00 80.41           C  
ATOM   3387  C4'   U A 112     281.665 254.256 183.008  1.00 77.45           C  
ATOM   3388  O4'   U A 112     282.009 255.386 183.851  1.00 80.28           O  
ATOM   3389  C3'   U A 112     280.700 253.463 183.862  1.00 74.91           C  
ATOM   3390  O3'   U A 112     280.570 252.121 183.443  1.00 80.98           O  
ATOM   3391  C2'   U A 112     281.309 253.601 185.248  1.00 76.57           C  
ATOM   3392  O2'   U A 112     282.427 252.738 185.379  1.00 77.79           O  
ATOM   3393  C1'   U A 112     281.824 255.039 185.210  1.00 78.06           C  
ATOM   3394  N1    U A 112     280.885 255.994 185.850  1.00 73.68           N  
ATOM   3395  C2    U A 112     280.889 256.088 187.231  1.00 71.49           C  
ATOM   3396  O2    U A 112     281.624 255.430 187.941  1.00 72.42           O  
ATOM   3397  N3    U A 112     280.008 256.985 187.768  1.00 71.23           N  
ATOM   3398  C4    U A 112     279.131 257.787 187.078  1.00 73.72           C  
ATOM   3399  O4    U A 112     278.391 258.552 187.695  1.00 78.30           O  
ATOM   3400  C5    U A 112     279.180 257.634 185.662  1.00 74.12           C  
ATOM   3401  C6    U A 112     280.031 256.766 185.111  1.00 74.26           C  
ATOM   3402  P     U A 113     279.144 251.582 182.949  1.00100.24           P  
ATOM   3403  OP1   U A 113     279.223 250.102 182.828  1.00 88.54           O  
ATOM   3404  OP2   U A 113     278.701 252.427 181.808  1.00 94.54           O1-
ATOM   3405  O5'   U A 113     278.178 251.876 184.173  1.00 79.38           O  
ATOM   3406  C5'   U A 113     278.367 251.188 185.391  1.00 75.20           C  
ATOM   3407  C4'   U A 113     277.721 251.912 186.539  1.00 76.44           C  
ATOM   3408  O4'   U A 113     278.067 253.323 186.520  1.00 77.28           O  
ATOM   3409  C3'   U A 113     276.208 251.929 186.556  1.00 76.07           C  
ATOM   3410  O3'   U A 113     275.641 250.691 186.939  1.00 72.86           O  
ATOM   3411  C2'   U A 113     275.915 253.080 187.510  1.00 78.98           C  
ATOM   3412  O2'   U A 113     276.077 252.672 188.860  1.00 76.83           O  
ATOM   3413  C1'   U A 113     277.041 254.064 187.152  1.00 77.33           C  
ATOM   3414  N1    U A 113     276.556 255.138 186.252  1.00 76.52           N  
ATOM   3415  C2    U A 113     275.986 256.244 186.866  1.00 77.74           C  
ATOM   3416  O2    U A 113     275.904 256.375 188.081  1.00 75.07           O  
ATOM   3417  N3    U A 113     275.520 257.206 186.002  1.00 84.38           N  
ATOM   3418  C4    U A 113     275.550 257.181 184.620  1.00 86.59           C  
ATOM   3419  O4    U A 113     275.086 258.135 183.987  1.00 85.11           O  
ATOM   3420  C5    U A 113     276.148 255.999 184.066  1.00 82.38           C  
ATOM   3421  C6    U A 113     276.614 255.038 184.879  1.00 78.16           C  
ATOM   3422  P     U A 114     274.721 249.898 185.891  1.00 73.46           P  
ATOM   3423  OP1   U A 114     275.322 250.051 184.538  1.00 74.44           O  
ATOM   3424  OP2   U A 114     273.324 250.351 186.118  1.00 71.06           O1-
ATOM   3425  O5'   U A 114     274.859 248.369 186.329  1.00 73.02           O  
ATOM   3426  C5'   U A 114     275.752 247.480 185.663  1.00 73.23           C  
ATOM   3427  C4'   U A 114     275.795 246.126 186.337  1.00 72.80           C  
ATOM   3428  O4'   U A 114     276.400 246.269 187.646  1.00 71.20           O  
ATOM   3429  C3'   U A 114     274.443 245.471 186.601  1.00 67.12           C  
ATOM   3430  O3'   U A 114     273.992 244.702 185.499  1.00 66.75           O  
ATOM   3431  C2'   U A 114     274.692 244.633 187.848  1.00 62.00           C  
ATOM   3432  O2'   U A 114     275.288 243.390 187.512  1.00 65.87           O  
ATOM   3433  C1'   U A 114     275.723 245.477 188.590  1.00 64.71           C  
ATOM   3434  N1    U A 114     275.106 246.390 189.568  1.00 58.16           N  
ATOM   3435  C2    U A 114     274.642 245.856 190.739  1.00 56.59           C  
ATOM   3436  O2    U A 114     274.712 244.668 190.983  1.00 58.61           O  
ATOM   3437  N3    U A 114     274.086 246.767 191.604  1.00 61.31           N  
ATOM   3438  C4    U A 114     273.972 248.129 191.403  1.00 63.24           C  
ATOM   3439  O4    U A 114     273.450 248.834 192.268  1.00 60.11           O  
ATOM   3440  C5    U A 114     274.489 248.601 190.158  1.00 64.56           C  
ATOM   3441  C6    U A 114     275.031 247.733 189.307  1.00 62.11           C  
ATOM   3442  P     C A 115     272.611 245.057 184.755  1.00 78.95           P  
ATOM   3443  OP1   C A 115     272.592 244.331 183.463  1.00 76.16           O  
ATOM   3444  OP2   C A 115     272.401 246.527 184.785  1.00 71.60           O1-
ATOM   3445  O5'   C A 115     271.498 244.399 185.675  1.00 66.17           O  
ATOM   3446  C5'   C A 115     271.574 243.032 186.035  1.00 58.96           C  
ATOM   3447  C4'   C A 115     270.862 242.794 187.335  1.00 54.04           C  
ATOM   3448  O4'   C A 115     271.549 243.495 188.401  1.00 55.63           O  
ATOM   3449  C3'   C A 115     269.443 243.328 187.415  1.00 52.78           C  
ATOM   3450  O3'   C A 115     268.500 242.489 186.766  1.00 52.73           O  
ATOM   3451  C2'   C A 115     269.229 243.457 188.918  1.00 49.02           C  
ATOM   3452  O2'   C A 115     268.945 242.188 189.487  1.00 50.50           O  
ATOM   3453  C1'   C A 115     270.621 243.884 189.389  1.00 51.03           C  
ATOM   3454  N1    C A 115     270.742 245.341 189.648  1.00 51.24           N  
ATOM   3455  C2    C A 115     270.243 245.819 190.859  1.00 49.50           C  
ATOM   3456  O2    C A 115     269.717 245.010 191.622  1.00 52.96           O  
ATOM   3457  N3    C A 115     270.322 247.121 191.190  1.00 48.95           N  
ATOM   3458  C4    C A 115     270.896 247.953 190.336  1.00 53.21           C  
ATOM   3459  N4    C A 115     270.954 249.235 190.696  1.00 54.03           N  
ATOM   3460  C5    C A 115     271.428 247.507 189.087  1.00 56.57           C  
ATOM   3461  C6    C A 115     271.341 246.204 188.780  1.00 55.05           C  
ATOM   3462  P     C A 116     267.146 243.093 186.137  1.00 48.60           P  
ATOM   3463  OP1   C A 116     266.368 241.951 185.613  1.00 53.88           O  
ATOM   3464  OP2   C A 116     267.439 244.240 185.239  1.00 51.44           O1-
ATOM   3465  O5'   C A 116     266.321 243.583 187.401  1.00 49.06           O  
ATOM   3466  C5'   C A 116     265.789 242.631 188.306  1.00 46.62           C  
ATOM   3467  C4'   C A 116     264.959 243.287 189.373  1.00 45.95           C  
ATOM   3468  O4'   C A 116     265.789 244.109 190.211  1.00 49.27           O  
ATOM   3469  C3'   C A 116     263.875 244.229 188.888  1.00 45.45           C  
ATOM   3470  O3'   C A 116     262.707 243.522 188.547  1.00 50.03           O  
ATOM   3471  C2'   C A 116     263.654 245.145 190.076  1.00 45.26           C  
ATOM   3472  O2'   C A 116     262.741 244.554 190.982  1.00 51.80           O  
ATOM   3473  C1'   C A 116     265.032 245.171 190.732  1.00 48.29           C  
ATOM   3474  N1    C A 116     265.748 246.439 190.512  1.00 49.60           N  
ATOM   3475  C2    C A 116     265.473 247.480 191.399  1.00 53.48           C  
ATOM   3476  O2    C A 116     264.649 247.296 192.300  1.00 56.45           O  
ATOM   3477  N3    C A 116     266.097 248.657 191.268  1.00 54.31           N  
ATOM   3478  C4    C A 116     266.974 248.796 190.281  1.00 57.63           C  
ATOM   3479  N4    C A 116     267.576 249.984 190.177  1.00 63.74           N  
ATOM   3480  C5    C A 116     267.279 247.746 189.361  1.00 53.21           C  
ATOM   3481  C6    C A 116     266.650 246.580 189.508  1.00 48.57           C  
ATOM   3482  P     G A 117     261.668 244.138 187.504  1.00 54.04           P  
ATOM   3483  OP1   G A 117     260.450 243.285 187.567  1.00 51.41           O  
ATOM   3484  OP2   G A 117     262.383 244.318 186.210  1.00 58.16           O1-
ATOM   3485  O5'   G A 117     261.300 245.563 188.114  1.00 52.71           O  
ATOM   3486  C5'   G A 117     260.239 245.691 189.048  1.00 52.76           C  
ATOM   3487  C4'   G A 117     260.215 247.054 189.694  1.00 50.47           C  
ATOM   3488  O4'   G A 117     261.546 247.407 190.147  1.00 50.38           O  
ATOM   3489  C3'   G A 117     259.808 248.222 188.815  1.00 50.74           C  
ATOM   3490  O3'   G A 117     258.410 248.321 188.653  1.00 55.26           O  
ATOM   3491  C2'   G A 117     260.417 249.405 189.546  1.00 51.83           C  
ATOM   3492  O2'   G A 117     259.623 249.765 190.671  1.00 51.16           O  
ATOM   3493  C1'   G A 117     261.736 248.800 190.037  1.00 52.58           C  
ATOM   3494  N9    G A 117     262.829 249.039 189.073  1.00 54.65           N  
ATOM   3495  C8    G A 117     263.187 248.222 188.030  1.00 56.64           C  
ATOM   3496  N7    G A 117     264.181 248.691 187.325  1.00 57.26           N  
ATOM   3497  C5    G A 117     264.497 249.893 187.935  1.00 49.62           C  
ATOM   3498  C6    G A 117     265.486 250.840 187.613  1.00 44.82           C  
ATOM   3499  O6    G A 117     266.306 250.817 186.698  1.00 51.60           O  
ATOM   3500  N1    G A 117     265.468 251.910 188.481  1.00 47.99           N  
ATOM   3501  C2    G A 117     264.609 252.054 189.533  1.00 51.35           C  
ATOM   3502  N2    G A 117     264.744 253.165 190.269  1.00 56.39           N  
ATOM   3503  N3    G A 117     263.682 251.174 189.847  1.00 52.48           N  
ATOM   3504  C4    G A 117     263.678 250.123 189.013  1.00 50.86           C  
ATOM   3505  P     A A 118     257.708 247.594 187.408  1.00 62.83           P  
ATOM   3506  OP1   A A 118     256.597 246.767 187.935  1.00 63.13           O  
ATOM   3507  OP2   A A 118     258.760 246.968 186.573  1.00 59.97           O1-
ATOM   3508  O5'   A A 118     257.081 248.792 186.577  1.00 65.98           O  
ATOM   3509  C5'   A A 118     257.324 250.136 186.964  1.00 73.40           C  
ATOM   3510  C4'   A A 118     256.604 251.100 186.060  1.00 71.22           C  
ATOM   3511  O4'   A A 118     257.353 252.334 185.959  1.00 63.57           O  
ATOM   3512  C3'   A A 118     256.451 250.650 184.622  1.00 65.58           C  
ATOM   3513  O3'   A A 118     255.371 249.757 184.453  1.00 64.76           O  
ATOM   3514  C2'   A A 118     256.278 251.963 183.873  1.00 59.51           C  
ATOM   3515  O2'   A A 118     254.948 252.432 183.982  1.00 62.94           O  
ATOM   3516  C1'   A A 118     257.177 252.895 184.680  1.00 59.19           C  
ATOM   3517  N9    A A 118     258.483 253.079 184.044  1.00 57.27           N  
ATOM   3518  C8    A A 118     259.159 252.230 183.213  1.00 57.62           C  
ATOM   3519  N7    A A 118     260.300 252.718 182.790  1.00 58.66           N  
ATOM   3520  C5    A A 118     260.348 253.971 183.387  1.00 57.10           C  
ATOM   3521  C6    A A 118     261.279 255.003 183.353  1.00 56.99           C  
ATOM   3522  N6    A A 118     262.401 254.912 182.654  1.00 61.40           N  
ATOM   3523  N1    A A 118     261.040 256.128 184.057  1.00 55.63           N  
ATOM   3524  C2    A A 118     259.917 256.205 184.758  1.00 56.29           C  
ATOM   3525  N3    A A 118     258.958 255.300 184.867  1.00 61.54           N  
ATOM   3526  C4    A A 118     259.239 254.203 184.155  1.00 59.22           C  
ATOM   3527  P     A A 119     255.366 248.756 183.207  1.00 70.81           P  
ATOM   3528  OP1   A A 119     254.694 249.472 182.087  1.00 64.33           O  
ATOM   3529  OP2   A A 119     254.837 247.450 183.679  1.00 70.13           O1-
ATOM   3530  O5'   A A 119     256.914 248.576 182.858  1.00 64.58           O  
ATOM   3531  C5'   A A 119     257.667 247.472 183.355  1.00 58.12           C  
ATOM   3532  C4'   A A 119     259.021 247.379 182.692  1.00 58.81           C  
ATOM   3533  O4'   A A 119     259.720 248.641 182.892  1.00 60.35           O  
ATOM   3534  C3'   A A 119     259.947 246.292 183.254  1.00 62.96           C  
ATOM   3535  O3'   A A 119     260.837 245.805 182.242  1.00 64.91           O  
ATOM   3536  C2'   A A 119     260.784 247.078 184.251  1.00 59.10           C  
ATOM   3537  O2'   A A 119     262.027 246.495 184.574  1.00 62.52           O  
ATOM   3538  C1'   A A 119     260.967 248.380 183.494  1.00 57.74           C  
ATOM   3539  N9    A A 119     261.386 249.495 184.335  1.00 55.01           N  
ATOM   3540  C8    A A 119     260.799 250.047 185.440  1.00 56.61           C  
ATOM   3541  N7    A A 119     261.501 251.034 185.959  1.00 58.29           N  
ATOM   3542  C5    A A 119     262.631 251.108 185.152  1.00 54.05           C  
ATOM   3543  C6    A A 119     263.772 251.929 185.156  1.00 51.28           C  
ATOM   3544  N6    A A 119     264.002 252.891 186.039  1.00 53.99           N  
ATOM   3545  N1    A A 119     264.697 251.734 184.203  1.00 55.92           N  
ATOM   3546  C2    A A 119     264.479 250.767 183.309  1.00 59.11           C  
ATOM   3547  N3    A A 119     263.455 249.932 183.192  1.00 55.18           N  
ATOM   3548  C4    A A 119     262.562 250.161 184.156  1.00 53.80           C  
ATOM   3549  P     U A 120     260.414 244.686 181.162  1.00 67.83           P  
ATOM   3550  OP1   U A 120     259.262 243.866 181.634  1.00 56.58           O  
ATOM   3551  OP2   U A 120     261.666 243.979 180.779  1.00 59.00           O1-
ATOM   3552  O5'   U A 120     259.961 245.583 179.927  1.00 64.73           O  
ATOM   3553  C5'   U A 120     260.194 245.158 178.592  1.00 68.68           C  
ATOM   3554  C4'   U A 120     260.653 246.282 177.694  1.00 65.64           C  
ATOM   3555  O4'   U A 120     259.678 247.366 177.696  1.00 62.13           O  
ATOM   3556  C3'   U A 120     261.999 246.912 178.052  1.00 67.17           C  
ATOM   3557  O3'   U A 120     262.739 247.147 176.855  1.00 68.59           O  
ATOM   3558  C2'   U A 120     261.598 248.247 178.686  1.00 65.57           C  
ATOM   3559  O2'   U A 120     262.566 249.271 178.586  1.00 65.62           O  
ATOM   3560  C1'   U A 120     260.348 248.593 177.897  1.00 60.11           C  
ATOM   3561  N1    U A 120     259.449 249.530 178.577  1.00 58.56           N  
ATOM   3562  C2    U A 120     259.545 250.862 178.230  1.00 55.20           C  
ATOM   3563  O2    U A 120     260.325 251.272 177.400  1.00 61.94           O  
ATOM   3564  N3    U A 120     258.692 251.710 178.873  1.00 57.27           N  
ATOM   3565  C4    U A 120     257.765 251.371 179.833  1.00 64.75           C  
ATOM   3566  O4    U A 120     257.054 252.243 180.343  1.00 66.20           O  
ATOM   3567  C5    U A 120     257.733 249.970 180.141  1.00 69.32           C  
ATOM   3568  C6    U A 120     258.552 249.111 179.521  1.00 64.32           C  
ATOM   3569  P     G A 121     263.815 246.065 176.352  1.00 71.19           P  
ATOM   3570  OP1   G A 121     264.461 245.468 177.549  1.00 62.22           O  
ATOM   3571  OP2   G A 121     264.645 246.738 175.314  1.00 68.38           O1-
ATOM   3572  O5'   G A 121     262.936 244.906 175.689  1.00 70.51           O  
ATOM   3573  C5'   G A 121     262.341 245.060 174.406  1.00 69.11           C  
ATOM   3574  C4'   G A 121     262.074 243.728 173.748  1.00 64.28           C  
ATOM   3575  O4'   G A 121     263.336 243.033 173.541  1.00 68.21           O  
ATOM   3576  C3'   G A 121     261.247 242.739 174.556  1.00 64.48           C  
ATOM   3577  O3'   G A 121     259.847 242.956 174.514  1.00 69.43           O  
ATOM   3578  C2'   G A 121     261.688 241.406 173.979  1.00 65.82           C  
ATOM   3579  O2'   G A 121     261.132 241.211 172.688  1.00 64.14           O  
ATOM   3580  C1'   G A 121     263.180 241.660 173.829  1.00 68.19           C  
ATOM   3581  N9    G A 121     263.874 241.398 175.106  1.00 73.76           N  
ATOM   3582  C8    G A 121     264.429 242.347 175.935  1.00 73.79           C  
ATOM   3583  N7    G A 121     264.965 241.856 177.018  1.00 70.83           N  
ATOM   3584  C5    G A 121     264.745 240.492 176.907  1.00 74.67           C  
ATOM   3585  C6    G A 121     265.105 239.440 177.786  1.00 76.28           C  
ATOM   3586  O6    G A 121     265.708 239.522 178.862  1.00 77.90           O  
ATOM   3587  N1    G A 121     264.695 238.196 177.312  1.00 74.70           N  
ATOM   3588  C2    G A 121     264.021 237.992 176.134  1.00 73.84           C  
ATOM   3589  N2    G A 121     263.712 236.717 175.856  1.00 72.31           N  
ATOM   3590  N3    G A 121     263.678 238.964 175.298  1.00 75.80           N  
ATOM   3591  C4    G A 121     264.070 240.185 175.739  1.00 77.27           C  
ATOM   3592  P     G A 122     258.934 242.419 175.728  1.00 74.97           P  
ATOM   3593  OP1   G A 122     257.540 242.913 175.585  1.00 69.59           O  
ATOM   3594  OP2   G A 122     259.679 242.639 176.990  1.00 69.48           O1-
ATOM   3595  O5'   G A 122     258.924 240.845 175.528  1.00 70.21           O  
ATOM   3596  C5'   G A 122     257.926 240.220 174.744  1.00 69.93           C  
ATOM   3597  C4'   G A 122     257.764 238.783 175.150  1.00 68.47           C  
ATOM   3598  O4'   G A 122     259.062 238.122 175.105  1.00 67.90           O  
ATOM   3599  C3'   G A 122     257.292 238.549 176.575  1.00 67.99           C  
ATOM   3600  O3'   G A 122     255.889 238.717 176.752  1.00 67.43           O  
ATOM   3601  C2'   G A 122     257.796 237.138 176.842  1.00 66.25           C  
ATOM   3602  O2'   G A 122     256.994 236.193 176.153  1.00 66.27           O  
ATOM   3603  C1'   G A 122     259.161 237.187 176.160  1.00 63.56           C  
ATOM   3604  N9    G A 122     260.217 237.637 177.090  1.00 60.98           N  
ATOM   3605  C8    G A 122     260.809 238.873 177.118  1.00 63.23           C  
ATOM   3606  N7    G A 122     261.703 239.001 178.055  1.00 62.81           N  
ATOM   3607  C5    G A 122     261.701 237.771 178.692  1.00 60.78           C  
ATOM   3608  C6    G A 122     262.465 237.316 179.793  1.00 62.73           C  
ATOM   3609  O6    G A 122     263.320 237.926 180.436  1.00 67.14           O  
ATOM   3610  N1    G A 122     262.168 236.011 180.143  1.00 60.26           N  
ATOM   3611  C2    G A 122     261.239 235.247 179.493  1.00 62.39           C  
ATOM   3612  N2    G A 122     261.088 234.009 179.975  1.00 68.74           N  
ATOM   3613  N3    G A 122     260.510 235.652 178.464  1.00 61.20           N  
ATOM   3614  C4    G A 122     260.791 236.920 178.114  1.00 59.35           C  
ATOM   3615  P     G A 123     255.300 239.293 178.141  1.00 73.81           P  
ATOM   3616  OP1   G A 123     253.821 239.292 178.013  1.00 65.01           O  
ATOM   3617  OP2   G A 123     255.985 240.569 178.485  1.00 70.66           O1-
ATOM   3618  O5'   G A 123     255.718 238.196 179.226  1.00 67.69           O  
ATOM   3619  C5'   G A 123     255.166 236.885 179.180  1.00 62.98           C  
ATOM   3620  C4'   G A 123     255.969 235.862 179.955  1.00 56.54           C  
ATOM   3621  O4'   G A 123     257.390 235.981 179.666  1.00 58.30           O  
ATOM   3622  C3'   G A 123     255.907 235.942 181.467  1.00 57.82           C  
ATOM   3623  O3'   G A 123     254.692 235.442 182.008  1.00 56.58           O  
ATOM   3624  C2'   G A 123     257.149 235.151 181.870  1.00 58.34           C  
ATOM   3625  O2'   G A 123     256.947 233.759 181.684  1.00 59.13           O  
ATOM   3626  C1'   G A 123     258.142 235.617 180.810  1.00 56.31           C  
ATOM   3627  N9    G A 123     258.895 236.796 181.277  1.00 56.61           N  
ATOM   3628  C8    G A 123     258.771 238.070 180.795  1.00 62.68           C  
ATOM   3629  N7    G A 123     259.536 238.933 181.396  1.00 61.05           N  
ATOM   3630  C5    G A 123     260.203 238.178 182.340  1.00 55.29           C  
ATOM   3631  C6    G A 123     261.167 238.579 183.282  1.00 60.21           C  
ATOM   3632  O6    G A 123     261.628 239.710 183.469  1.00 66.75           O  
ATOM   3633  N1    G A 123     261.604 237.524 184.057  1.00 54.44           N  
ATOM   3634  C2    G A 123     261.165 236.244 183.933  1.00 55.03           C  
ATOM   3635  N2    G A 123     261.714 235.370 184.780  1.00 58.52           N  
ATOM   3636  N3    G A 123     260.264 235.851 183.056  1.00 55.02           N  
ATOM   3637  C4    G A 123     259.826 236.863 182.290  1.00 52.43           C  
ATOM   3638  P     G A 124     253.821 236.314 183.050  1.00 56.18           P  
ATOM   3639  OP1   G A 124     252.425 235.810 182.981  1.00 56.47           O  
ATOM   3640  OP2   G A 124     254.095 237.760 182.846  1.00 55.61           O1-
ATOM   3641  O5'   G A 124     254.423 235.938 184.479  1.00 61.53           O  
ATOM   3642  C5'   G A 124     254.840 234.612 184.786  1.00 59.68           C  
ATOM   3643  C4'   G A 124     255.869 234.601 185.895  1.00 61.49           C  
ATOM   3644  O4'   G A 124     257.154 235.064 185.395  1.00 63.66           O  
ATOM   3645  C3'   G A 124     255.572 235.515 187.070  1.00 62.20           C  
ATOM   3646  O3'   G A 124     254.645 234.936 187.977  1.00 67.11           O  
ATOM   3647  C2'   G A 124     256.962 235.781 187.654  1.00 59.98           C  
ATOM   3648  O2'   G A 124     257.400 234.691 188.451  1.00 63.25           O  
ATOM   3649  C1'   G A 124     257.822 235.822 186.387  1.00 57.75           C  
ATOM   3650  N9    G A 124     258.015 237.194 185.870  1.00 54.83           N  
ATOM   3651  C8    G A 124     257.321 237.750 184.826  1.00 57.01           C  
ATOM   3652  N7    G A 124     257.659 238.972 184.548  1.00 54.69           N  
ATOM   3653  C5    G A 124     258.650 239.251 185.467  1.00 54.21           C  
ATOM   3654  C6    G A 124     259.400 240.439 185.651  1.00 59.14           C  
ATOM   3655  O6    G A 124     259.338 241.501 185.022  1.00 61.31           O  
ATOM   3656  N1    G A 124     260.310 240.326 186.688  1.00 55.78           N  
ATOM   3657  C2    G A 124     260.476 239.203 187.450  1.00 59.53           C  
ATOM   3658  N2    G A 124     261.411 239.285 188.409  1.00 59.97           N  
ATOM   3659  N3    G A 124     259.781 238.084 187.290  1.00 61.24           N  
ATOM   3660  C4    G A 124     258.888 238.172 186.287  1.00 54.38           C  
ATOM   3661  P     A A 125     253.873 235.836 189.064  1.00 73.02           P  
ATOM   3662  OP1   A A 125     252.539 235.231 189.333  1.00 64.79           O  
ATOM   3663  OP2   A A 125     253.915 237.244 188.590  1.00 63.29           O1-
ATOM   3664  O5'   A A 125     254.796 235.684 190.362  1.00 71.31           O  
ATOM   3665  C5'   A A 125     254.260 235.750 191.683  1.00 68.30           C  
ATOM   3666  C4'   A A 125     255.328 235.568 192.742  1.00 66.59           C  
ATOM   3667  O4'   A A 125     255.481 234.154 193.064  1.00 63.13           O  
ATOM   3668  C3'   A A 125     256.731 236.072 192.377  1.00 65.98           C  
ATOM   3669  O3'   A A 125     257.373 236.548 193.568  1.00 63.13           O  
ATOM   3670  C2'   A A 125     257.419 234.783 191.923  1.00 65.68           C  
ATOM   3671  O2'   A A 125     258.831 234.819 191.937  1.00 63.43           O  
ATOM   3672  C1'   A A 125     256.844 233.798 192.937  1.00 67.01           C  
ATOM   3673  N9    A A 125     256.934 232.378 192.592  1.00 70.63           N  
ATOM   3674  C8    A A 125     256.683 231.742 191.404  1.00 74.59           C  
ATOM   3675  N7    A A 125     256.860 230.440 191.466  1.00 79.84           N  
ATOM   3676  C5    A A 125     257.243 230.206 192.784  1.00 80.82           C  
ATOM   3677  C6    A A 125     257.575 229.034 193.494  1.00 76.63           C  
ATOM   3678  N6    A A 125     257.572 227.819 192.940  1.00 73.12           N  
ATOM   3679  N1    A A 125     257.918 229.149 194.799  1.00 68.01           N  
ATOM   3680  C2    A A 125     257.920 230.371 195.348  1.00 65.99           C  
ATOM   3681  N3    A A 125     257.624 231.542 194.786  1.00 69.55           N  
ATOM   3682  C4    A A 125     257.289 231.393 193.488  1.00 74.77           C  
ATOM   3683  P     A A 126     257.164 238.055 194.104  1.00 54.72           P  
ATOM   3684  OP1   A A 126     257.798 238.161 195.444  1.00 55.34           O  
ATOM   3685  OP2   A A 126     255.752 238.482 193.927  1.00 56.55           O1-
ATOM   3686  O5'   A A 126     258.058 238.919 193.122  1.00 57.89           O  
ATOM   3687  C5'   A A 126     259.470 238.858 193.209  1.00 62.81           C  
ATOM   3688  C4'   A A 126     260.114 239.896 192.332  1.00 59.20           C  
ATOM   3689  O4'   A A 126     259.591 241.205 192.661  1.00 51.19           O  
ATOM   3690  C3'   A A 126     261.618 240.037 192.481  1.00 56.09           C  
ATOM   3691  O3'   A A 126     262.311 239.087 191.687  1.00 53.39           O  
ATOM   3692  C2'   A A 126     261.861 241.476 192.049  1.00 55.33           C  
ATOM   3693  O2'   A A 126     261.850 241.576 190.635  1.00 61.32           O  
ATOM   3694  C1'   A A 126     260.606 242.169 192.564  1.00 49.01           C  
ATOM   3695  N9    A A 126     260.798 242.751 193.892  1.00 46.51           N  
ATOM   3696  C8    A A 126     260.792 242.101 195.085  1.00 55.69           C  
ATOM   3697  N7    A A 126     260.977 242.895 196.107  1.00 59.52           N  
ATOM   3698  C5    A A 126     261.113 244.145 195.530  1.00 53.84           C  
ATOM   3699  C6    A A 126     261.336 245.417 196.071  1.00 59.03           C  
ATOM   3700  N6    A A 126     261.466 245.644 197.380  1.00 61.78           N  
ATOM   3701  N1    A A 126     261.423 246.463 195.221  1.00 53.25           N  
ATOM   3702  C2    A A 126     261.295 246.221 193.916  1.00 50.62           C  
ATOM   3703  N3    A A 126     261.079 245.066 193.294  1.00 51.45           N  
ATOM   3704  C4    A A 126     261.004 244.063 194.167  1.00 47.11           C  
ATOM   3705  P     A A 127     263.107 237.861 192.355  1.00 51.64           P  
ATOM   3706  OP1   A A 127     262.881 236.677 191.495  1.00 57.92           O  
ATOM   3707  OP2   A A 127     262.791 237.754 193.803  1.00 57.49           O1-
ATOM   3708  O5'   A A 127     264.628 238.303 192.205  1.00 60.84           O  
ATOM   3709  C5'   A A 127     265.074 238.965 191.028  1.00 59.43           C  
ATOM   3710  C4'   A A 127     266.064 240.067 191.335  1.00 60.71           C  
ATOM   3711  O4'   A A 127     265.383 241.182 191.955  1.00 53.96           O  
ATOM   3712  C3'   A A 127     267.189 239.715 192.298  1.00 56.65           C  
ATOM   3713  O3'   A A 127     268.276 239.099 191.634  1.00 59.23           O  
ATOM   3714  C2'   A A 127     267.556 241.057 192.920  1.00 49.04           C  
ATOM   3715  O2'   A A 127     268.479 241.757 192.100  1.00 53.07           O  
ATOM   3716  C1'   A A 127     266.219 241.798 192.901  1.00 48.16           C  
ATOM   3717  N9    A A 127     265.547 241.751 194.198  1.00 48.02           N  
ATOM   3718  C8    A A 127     265.196 240.661 194.938  1.00 57.26           C  
ATOM   3719  N7    A A 127     264.600 240.972 196.059  1.00 63.40           N  
ATOM   3720  C5    A A 127     264.563 242.361 196.033  1.00 59.58           C  
ATOM   3721  C6    A A 127     264.069 243.320 196.930  1.00 61.08           C  
ATOM   3722  N6    A A 127     263.477 243.012 198.087  1.00 61.84           N  
ATOM   3723  N1    A A 127     264.197 244.621 196.597  1.00 57.28           N  
ATOM   3724  C2    A A 127     264.781 244.929 195.436  1.00 54.12           C  
ATOM   3725  N3    A A 127     265.286 244.118 194.516  1.00 52.46           N  
ATOM   3726  C4    A A 127     265.138 242.843 194.883  1.00 51.08           C  
ATOM   3727  P     C A 128     269.052 237.875 192.320  1.00 68.04           P  
ATOM   3728  OP1   C A 128     268.653 237.864 193.754  1.00 60.65           O  
ATOM   3729  OP2   C A 128     270.486 237.937 191.941  1.00 69.58           O1-
ATOM   3730  O5'   C A 128     268.447 236.587 191.611  1.00 63.98           O  
ATOM   3731  C5'   C A 128     268.449 236.427 190.197  1.00 62.19           C  
ATOM   3732  C4'   C A 128     267.289 235.554 189.793  1.00 61.85           C  
ATOM   3733  O4'   C A 128     266.080 236.351 189.771  1.00 56.09           O  
ATOM   3734  C3'   C A 128     267.326 234.899 188.419  1.00 64.86           C  
ATOM   3735  O3'   C A 128     268.099 233.706 188.391  1.00 63.68           O  
ATOM   3736  C2'   C A 128     265.852 234.633 188.157  1.00 63.22           C  
ATOM   3737  O2'   C A 128     265.423 233.498 188.894  1.00 61.30           O  
ATOM   3738  C1'   C A 128     265.205 235.867 188.782  1.00 57.23           C  
ATOM   3739  N1    C A 128     264.967 236.944 187.797  1.00 58.44           N  
ATOM   3740  C2    C A 128     263.875 236.846 186.930  1.00 59.84           C  
ATOM   3741  O2    C A 128     263.140 235.852 186.996  1.00 61.84           O  
ATOM   3742  N3    C A 128     263.641 237.825 186.037  1.00 57.49           N  
ATOM   3743  C4    C A 128     264.448 238.877 185.995  1.00 56.67           C  
ATOM   3744  N4    C A 128     264.176 239.822 185.097  1.00 58.74           N  
ATOM   3745  C5    C A 128     265.565 239.008 186.866  1.00 58.89           C  
ATOM   3746  C6    C A 128     265.788 238.029 187.746  1.00 59.90           C  
ATOM   3747  P     C A 129     268.879 233.257 187.052  1.00 72.86           P  
ATOM   3748  OP1   C A 129     269.664 232.049 187.408  1.00 65.58           O  
ATOM   3749  OP2   C A 129     269.545 234.448 186.459  1.00 69.90           O1-
ATOM   3750  O5'   C A 129     267.745 232.760 186.051  1.00 65.11           O  
ATOM   3751  C5'   C A 129     267.254 231.434 186.144  1.00 63.55           C  
ATOM   3752  C4'   C A 129     266.059 231.210 185.259  1.00 60.97           C  
ATOM   3753  O4'   C A 129     265.080 232.266 185.449  1.00 59.16           O  
ATOM   3754  C3'   C A 129     266.322 231.238 183.769  1.00 66.12           C  
ATOM   3755  O3'   C A 129     266.904 230.047 183.278  1.00 68.59           O  
ATOM   3756  C2'   C A 129     264.936 231.518 183.213  1.00 67.96           C  
ATOM   3757  O2'   C A 129     264.123 230.361 183.309  1.00 68.52           O  
ATOM   3758  C1'   C A 129     264.421 232.529 184.226  1.00 59.02           C  
ATOM   3759  N1    C A 129     264.731 233.908 183.795  1.00 60.25           N  
ATOM   3760  C2    C A 129     263.901 234.533 182.859  1.00 59.34           C  
ATOM   3761  O2    C A 129     262.912 233.932 182.422  1.00 63.91           O  
ATOM   3762  N3    C A 129     264.178 235.788 182.455  1.00 59.53           N  
ATOM   3763  C4    C A 129     265.252 236.404 182.950  1.00 60.46           C  
ATOM   3764  N4    C A 129     265.515 237.644 182.542  1.00 63.03           N  
ATOM   3765  C5    C A 129     266.122 235.797 183.890  1.00 60.24           C  
ATOM   3766  C6    C A 129     265.829 234.557 184.277  1.00 62.63           C  
ATOM   3767  P     C A 130     268.091 230.135 182.202  1.00 74.57           P  
ATOM   3768  OP1   C A 130     268.651 228.768 182.084  1.00 74.32           O  
ATOM   3769  OP2   C A 130     268.958 231.283 182.586  1.00 67.68           O1-
ATOM   3770  O5'   C A 130     267.362 230.498 180.826  1.00 73.04           O  
ATOM   3771  C5'   C A 130     266.531 229.546 180.174  1.00 74.44           C  
ATOM   3772  C4'   C A 130     265.547 230.182 179.213  1.00 77.69           C  
ATOM   3773  O4'   C A 130     264.854 231.293 179.845  1.00 74.92           O  
ATOM   3774  C3'   C A 130     266.126 230.798 177.951  1.00 84.07           C  
ATOM   3775  O3'   C A 130     266.481 229.855 176.961  1.00 87.82           O  
ATOM   3776  C2'   C A 130     265.022 231.755 177.522  1.00 78.85           C  
ATOM   3777  O2'   C A 130     263.947 231.063 176.903  1.00 80.10           O  
ATOM   3778  C1'   C A 130     264.553 232.283 178.877  1.00 70.50           C  
ATOM   3779  N1    C A 130     265.285 233.516 179.221  1.00 70.86           N  
ATOM   3780  C2    C A 130     264.891 234.704 178.604  1.00 70.71           C  
ATOM   3781  O2    C A 130     263.928 234.695 177.819  1.00 70.25           O  
ATOM   3782  N3    C A 130     265.568 235.837 178.888  1.00 72.22           N  
ATOM   3783  C4    C A 130     266.598 235.801 179.738  1.00 71.34           C  
ATOM   3784  N4    C A 130     267.235 236.944 179.990  1.00 72.79           N  
ATOM   3785  C5    C A 130     267.025 234.602 180.374  1.00 71.32           C  
ATOM   3786  C6    C A 130     266.348 233.490 180.081  1.00 72.99           C  
ATOM   3787  P     A A 131     267.924 229.961 176.265  1.00 96.37           P  
ATOM   3788  OP1   A A 131     267.855 229.192 174.998  1.00 86.37           O  
ATOM   3789  OP2   A A 131     268.959 229.663 177.292  1.00 91.07           O1-
ATOM   3790  O5'   A A 131     268.064 231.499 175.883  1.00 86.34           O  
ATOM   3791  C5'   A A 131     268.141 231.897 174.525  1.00 88.85           C  
ATOM   3792  C4'   A A 131     266.814 232.401 174.013  1.00 89.65           C  
ATOM   3793  O4'   A A 131     266.291 233.399 174.931  1.00 84.95           O  
ATOM   3794  C3'   A A 131     266.869 233.108 172.663  1.00 87.67           C  
ATOM   3795  O3'   A A 131     266.827 232.205 171.563  1.00 82.50           O  
ATOM   3796  C2'   A A 131     265.689 234.076 172.733  1.00 84.75           C  
ATOM   3797  O2'   A A 131     264.465 233.412 172.443  1.00 80.05           O  
ATOM   3798  C1'   A A 131     265.680 234.451 174.218  1.00 84.22           C  
ATOM   3799  N9    A A 131     266.402 235.709 174.537  1.00 81.63           N  
ATOM   3800  C8    A A 131     267.390 235.829 175.490  1.00 79.01           C  
ATOM   3801  N7    A A 131     267.877 237.038 175.618  1.00 77.51           N  
ATOM   3802  C5    A A 131     267.155 237.779 174.694  1.00 77.55           C  
ATOM   3803  C6    A A 131     267.204 239.140 174.347  1.00 73.20           C  
ATOM   3804  N6    A A 131     268.041 240.003 174.918  1.00 71.11           N  
ATOM   3805  N1    A A 131     266.364 239.591 173.389  1.00 74.42           N  
ATOM   3806  C2    A A 131     265.532 238.709 172.826  1.00 77.23           C  
ATOM   3807  N3    A A 131     265.389 237.404 173.070  1.00 79.53           N  
ATOM   3808  C4    A A 131     266.239 236.985 174.025  1.00 80.67           C  
ATOM   3809  P     G A 132     267.974 232.243 170.431  1.00 78.54           P  
ATOM   3810  OP1   G A 132     268.115 230.913 169.776  1.00 79.76           O  
ATOM   3811  OP2   G A 132     269.148 232.874 171.084  1.00 83.43           O1-
ATOM   3812  O5'   G A 132     267.423 233.280 169.351  1.00 87.55           O  
ATOM   3813  C5'   G A 132     266.190 233.070 168.674  1.00 94.12           C  
ATOM   3814  C4'   G A 132     265.639 234.369 168.139  1.00 94.66           C  
ATOM   3815  O4'   G A 132     265.381 235.286 169.242  1.00 91.71           O  
ATOM   3816  C3'   G A 132     266.571 235.153 167.228  1.00101.54           C  
ATOM   3817  O3'   G A 132     266.618 234.653 165.902  1.00103.65           O  
ATOM   3818  C2'   G A 132     266.034 236.574 167.356  1.00 98.65           C  
ATOM   3819  O2'   G A 132     264.848 236.730 166.588  1.00 96.27           O  
ATOM   3820  C1'   G A 132     265.666 236.614 168.843  1.00 91.71           C  
ATOM   3821  N9    G A 132     266.766 237.140 169.686  1.00 83.54           N  
ATOM   3822  C8    G A 132     267.482 236.462 170.643  1.00 83.62           C  
ATOM   3823  N7    G A 132     268.394 237.193 171.223  1.00 81.41           N  
ATOM   3824  C5    G A 132     268.278 238.436 170.619  1.00 77.54           C  
ATOM   3825  C6    G A 132     269.002 239.639 170.830  1.00 80.84           C  
ATOM   3826  O6    G A 132     269.924 239.863 171.622  1.00 82.03           O  
ATOM   3827  N1    G A 132     268.556 240.657 170.000  1.00 84.55           N  
ATOM   3828  C2    G A 132     267.544 240.526 169.084  1.00 85.74           C  
ATOM   3829  N2    G A 132     267.259 241.629 168.370  1.00 90.15           N  
ATOM   3830  N3    G A 132     266.864 239.412 168.879  1.00 80.72           N  
ATOM   3831  C4    G A 132     267.278 238.415 169.675  1.00 76.66           C  
ATOM   3832  P     U A 133     268.040 234.461 165.169  1.00113.86           P  
ATOM   3833  OP1   U A 133     267.850 233.548 164.012  1.00114.51           O  
ATOM   3834  OP2   U A 133     269.065 234.143 166.201  1.00 97.71           O1-
ATOM   3835  O5'   U A 133     268.356 235.905 164.577  1.00101.06           O  
ATOM   3836  C5'   U A 133     267.418 236.567 163.745  1.00 99.99           C  
ATOM   3837  C4'   U A 133     267.678 238.049 163.701  1.00104.59           C  
ATOM   3838  O4'   U A 133     267.510 238.622 165.026  1.00100.26           O  
ATOM   3839  C3'   U A 133     269.085 238.469 163.317  1.00109.16           C  
ATOM   3840  O3'   U A 133     269.365 238.377 161.934  1.00111.29           O  
ATOM   3841  C2'   U A 133     269.152 239.879 163.873  1.00105.49           C  
ATOM   3842  O2'   U A 133     268.379 240.763 163.074  1.00104.60           O  
ATOM   3843  C1'   U A 133     268.426 239.689 165.200  1.00 99.02           C  
ATOM   3844  N1    U A 133     269.380 239.344 166.280  1.00 91.23           N  
ATOM   3845  C2    U A 133     269.981 240.414 166.902  1.00 89.60           C  
ATOM   3846  O2    U A 133     269.728 241.567 166.601  1.00 91.06           O  
ATOM   3847  N3    U A 133     270.867 240.093 167.892  1.00 87.45           N  
ATOM   3848  C4    U A 133     271.205 238.826 168.297  1.00 87.30           C  
ATOM   3849  O4    U A 133     272.021 238.702 169.206  1.00 91.89           O  
ATOM   3850  C5    U A 133     270.555 237.763 167.600  1.00 85.60           C  
ATOM   3851  C6    U A 133     269.687 238.051 166.633  1.00 87.77           C  
ATOM   3852  P     G A 134     270.814 237.866 161.464  1.00118.21           P  
ATOM   3853  OP1   G A 134     270.718 237.455 160.039  1.00117.16           O  
ATOM   3854  OP2   G A 134     271.326 236.921 162.491  1.00111.25           O1-
ATOM   3855  O5'   G A 134     271.737 239.158 161.568  1.00110.43           O  
ATOM   3856  C5'   G A 134     271.350 240.376 160.957  1.00112.25           C  
ATOM   3857  C4'   G A 134     272.006 241.557 161.626  1.00116.39           C  
ATOM   3858  O4'   G A 134     271.736 241.536 163.050  1.00112.14           O  
ATOM   3859  C3'   G A 134     273.521 241.622 161.550  1.00121.98           C  
ATOM   3860  O3'   G A 134     273.982 242.092 160.292  1.00131.85           O  
ATOM   3861  C2'   G A 134     273.873 242.537 162.721  1.00116.13           C  
ATOM   3862  O2'   G A 134     273.692 243.902 162.370  1.00114.38           O  
ATOM   3863  C1'   G A 134     272.798 242.154 163.746  1.00111.47           C  
ATOM   3864  N9    G A 134     273.297 241.253 164.807  1.00104.30           N  
ATOM   3865  C8    G A 134     273.045 239.913 165.027  1.00 95.09           C  
ATOM   3866  N7    G A 134     273.656 239.451 166.086  1.00 89.83           N  
ATOM   3867  C5    G A 134     274.342 240.553 166.594  1.00 94.17           C  
ATOM   3868  C6    G A 134     275.185 240.694 167.728  1.00 95.06           C  
ATOM   3869  O6    G A 134     275.517 239.840 168.554  1.00 98.10           O  
ATOM   3870  N1    G A 134     275.671 241.988 167.870  1.00 93.59           N  
ATOM   3871  C2    G A 134     275.388 243.030 167.030  1.00 94.62           C  
ATOM   3872  N2    G A 134     275.958 244.202 167.335  1.00 96.44           N  
ATOM   3873  N3    G A 134     274.610 242.923 165.969  1.00 99.73           N  
ATOM   3874  C4    G A 134     274.126 241.668 165.818  1.00100.87           C  
ATOM   3875  P     U A 135     275.307 241.473 159.618  1.00148.69           P  
ATOM   3876  OP1   U A 135     275.076 241.355 158.154  1.00142.93           O  
ATOM   3877  OP2   U A 135     275.724 240.265 160.384  1.00133.56           O1-
ATOM   3878  O5'   U A 135     276.401 242.604 159.861  1.00135.55           O  
ATOM   3879  C5'   U A 135     277.574 242.319 160.601  1.00133.22           C  
ATOM   3880  C4'   U A 135     277.901 243.405 161.600  1.00131.89           C  
ATOM   3881  O4'   U A 135     276.984 243.333 162.731  1.00119.93           O  
ATOM   3882  C3'   U A 135     279.276 243.269 162.234  1.00131.61           C  
ATOM   3883  O3'   U A 135     280.319 243.759 161.412  1.00141.77           O  
ATOM   3884  C2'   U A 135     279.097 243.969 163.573  1.00120.24           C  
ATOM   3885  O2'   U A 135     279.071 245.380 163.412  1.00116.78           O  
ATOM   3886  C1'   U A 135     277.696 243.490 163.942  1.00112.41           C  
ATOM   3887  N1    U A 135     277.752 242.154 164.580  1.00114.47           N  
ATOM   3888  C2    U A 135     278.142 242.048 165.902  1.00111.26           C  
ATOM   3889  O2    U A 135     278.426 243.013 166.591  1.00106.40           O  
ATOM   3890  N3    U A 135     278.169 240.754 166.376  1.00112.88           N  
ATOM   3891  C4    U A 135     277.863 239.591 165.678  1.00114.05           C  
ATOM   3892  O4    U A 135     277.932 238.498 166.233  1.00112.26           O  
ATOM   3893  C5    U A 135     277.479 239.777 164.317  1.00113.17           C  
ATOM   3894  C6    U A 135     277.440 241.021 163.847  1.00116.70           C  
ATOM   3895  P     G A 136     281.181 242.723 160.528  1.00154.93           P  
ATOM   3896  OP1   G A 136     281.422 243.340 159.196  1.00149.08           O  
ATOM   3897  OP2   G A 136     280.559 241.370 160.604  1.00138.27           O1-
ATOM   3898  O5'   G A 136     282.563 242.657 161.314  1.00154.08           O  
ATOM   3899  C5'   G A 136     283.056 243.804 161.989  1.00155.16           C  
ATOM   3900  C4'   G A 136     283.723 243.445 163.293  1.00154.62           C  
ATOM   3901  O4'   G A 136     282.727 243.215 164.331  1.00142.83           O  
ATOM   3902  C3'   G A 136     284.551 242.168 163.314  1.00153.32           C  
ATOM   3903  O3'   G A 136     285.815 242.277 162.670  1.00164.18           O  
ATOM   3904  C2'   G A 136     284.633 241.883 164.806  1.00140.80           C  
ATOM   3905  O2'   G A 136     285.556 242.768 165.429  1.00140.26           O  
ATOM   3906  C1'   G A 136     283.217 242.257 165.251  1.00134.96           C  
ATOM   3907  N9    G A 136     282.322 241.079 165.255  1.00125.35           N  
ATOM   3908  C8    G A 136     281.399 240.693 164.312  1.00126.24           C  
ATOM   3909  N7    G A 136     280.778 239.582 164.620  1.00121.05           N  
ATOM   3910  C5    G A 136     281.325 239.207 165.842  1.00117.98           C  
ATOM   3911  C6    G A 136     281.049 238.094 166.679  1.00112.64           C  
ATOM   3912  O6    G A 136     280.247 237.171 166.493  1.00109.27           O  
ATOM   3913  N1    G A 136     281.842 238.109 167.826  1.00113.15           N  
ATOM   3914  C2    G A 136     282.778 239.070 168.127  1.00116.50           C  
ATOM   3915  N2    G A 136     283.449 238.919 169.277  1.00114.98           N  
ATOM   3916  N3    G A 136     283.039 240.112 167.358  1.00120.23           N  
ATOM   3917  C4    G A 136     282.281 240.119 166.240  1.00121.18           C  
ATOM   3918  P     U A 137     286.218 241.268 161.471  1.00184.95           P  
ATOM   3919  OP1   U A 137     286.727 242.104 160.348  1.00174.13           O  
ATOM   3920  OP2   U A 137     285.104 240.311 161.227  1.00160.65           O1-
ATOM   3921  O5'   U A 137     287.435 240.421 162.057  1.00164.58           O  
ATOM   3922  C5'   U A 137     287.216 239.419 163.046  1.00155.00           C  
ATOM   3923  C4'   U A 137     287.741 239.852 164.394  1.00155.52           C  
ATOM   3924  O4'   U A 137     286.651 239.861 165.344  1.00145.82           O  
ATOM   3925  C3'   U A 137     288.821 238.956 164.973  1.00163.75           C  
ATOM   3926  O3'   U A 137     289.880 239.713 165.545  1.00177.65           O  
ATOM   3927  C2'   U A 137     288.103 238.122 166.037  1.00151.06           C  
ATOM   3928  O2'   U A 137     288.871 237.835 167.189  1.00148.31           O  
ATOM   3929  C1'   U A 137     286.879 238.949 166.399  1.00142.26           C  
ATOM   3930  N1    U A 137     285.708 238.078 166.431  1.00135.81           N  
ATOM   3931  C2    U A 137     285.408 237.329 167.548  1.00125.69           C  
ATOM   3932  O2    U A 137     286.048 237.382 168.586  1.00123.26           O  
ATOM   3933  N3    U A 137     284.302 236.533 167.374  1.00120.81           N  
ATOM   3934  C4    U A 137     283.541 236.418 166.220  1.00124.25           C  
ATOM   3935  O4    U A 137     282.565 235.685 166.183  1.00121.92           O  
ATOM   3936  C5    U A 137     283.936 237.219 165.116  1.00131.95           C  
ATOM   3937  C6    U A 137     284.998 237.990 165.263  1.00137.51           C  
ATOM   3938  P     U A 138     291.348 239.074 165.448  1.00198.31           P  
ATOM   3939  OP1   U A 138     291.908 238.979 166.826  1.00183.80           O  
ATOM   3940  OP2   U A 138     292.118 239.818 164.413  1.00177.22           O1-
ATOM   3941  O5'   U A 138     291.014 237.615 164.884  1.00173.14           O  
ATOM   3942  C5'   U A 138     291.860 236.498 165.110  1.00176.94           C  
ATOM   3943  C4'   U A 138     291.354 235.588 166.216  1.00177.59           C  
ATOM   3944  O4'   U A 138     289.965 235.853 166.534  1.00163.08           O  
ATOM   3945  C3'   U A 138     291.377 234.090 165.943  1.00173.25           C  
ATOM   3946  O3'   U A 138     292.683 233.528 166.027  1.00184.45           O  
ATOM   3947  C2'   U A 138     290.397 233.548 166.993  1.00156.14           C  
ATOM   3948  O2'   U A 138     291.037 233.393 168.254  1.00152.88           O  
ATOM   3949  C1'   U A 138     289.377 234.695 167.097  1.00154.90           C  
ATOM   3950  N1    U A 138     288.083 234.400 166.426  1.00150.39           N  
ATOM   3951  C2    U A 138     287.117 233.807 167.216  1.00143.28           C  
ATOM   3952  O2    U A 138     287.331 233.549 168.386  1.00138.62           O  
ATOM   3953  N3    U A 138     285.913 233.526 166.603  1.00136.47           N  
ATOM   3954  C4    U A 138     285.575 233.777 165.289  1.00131.69           C  
ATOM   3955  O4    U A 138     284.453 233.467 164.876  1.00121.06           O  
ATOM   3956  C5    U A 138     286.625 234.403 164.532  1.00142.02           C  
ATOM   3957  C6    U A 138     287.808 234.687 165.104  1.00148.02           C  
ATOM   3958  P     U A 139     293.736 233.662 164.802  1.00208.38           P  
ATOM   3959  OP1   U A 139     294.917 234.433 165.281  1.00189.05           O  
ATOM   3960  OP2   U A 139     293.030 234.102 163.571  1.00187.13           O1-
ATOM   3961  O5'   U A 139     294.217 232.167 164.543  1.00191.45           O  
ATOM   3962  C5'   U A 139     293.266 231.123 164.399  1.00188.06           C  
ATOM   3963  C4'   U A 139     293.555 229.982 165.340  1.00193.23           C  
ATOM   3964  O4'   U A 139     293.741 230.469 166.690  1.00185.11           O  
ATOM   3965  C3'   U A 139     292.468 228.931 165.490  1.00194.65           C  
ATOM   3966  O3'   U A 139     292.425 228.030 164.385  1.00199.18           O  
ATOM   3967  C2'   U A 139     292.812 228.269 166.835  1.00188.94           C  
ATOM   3968  O2'   U A 139     293.743 227.208 166.652  1.00186.96           O  
ATOM   3969  C1'   U A 139     293.508 229.414 167.600  1.00185.79           C  
ATOM   3970  N1    U A 139     292.789 229.892 168.816  1.00168.41           N  
ATOM   3971  C2    U A 139     293.426 230.905 169.533  1.00160.30           C  
ATOM   3972  O2    U A 139     294.466 231.424 169.163  1.00166.53           O  
ATOM   3973  N3    U A 139     292.805 231.335 170.673  1.00140.68           N  
ATOM   3974  C4    U A 139     291.638 230.836 171.190  1.00139.78           C  
ATOM   3975  O4    U A 139     291.215 231.335 172.234  1.00132.75           O  
ATOM   3976  C5    U A 139     291.052 229.765 170.426  1.00152.55           C  
ATOM   3977  C6    U A 139     291.626 229.325 169.297  1.00158.60           C  
ATOM   3978  P     C A 140     291.051 227.288 163.985  1.00217.90           P  
ATOM   3979  OP1   C A 140     291.397 225.964 163.395  1.00203.98           O1-
ATOM   3980  OP2   C A 140     290.227 228.232 163.173  1.00185.38           O  
ATOM   3981  O5'   C A 140     290.348 227.057 165.402  1.00183.95           O  
ATOM   3982  C5'   C A 140     289.332 226.081 165.592  1.00171.46           C  
ATOM   3983  C4'   C A 140     288.277 226.598 166.528  1.00157.61           C  
ATOM   3984  O4'   C A 140     288.380 228.046 166.568  1.00156.20           O  
ATOM   3985  C3'   C A 140     286.850 226.272 166.106  1.00153.93           C  
ATOM   3986  O3'   C A 140     286.047 226.009 167.258  1.00149.29           O  
ATOM   3987  C2'   C A 140     286.403 227.543 165.368  1.00144.63           C  
ATOM   3988  O2'   C A 140     285.013 227.792 165.392  1.00136.45           O  
ATOM   3989  C1'   C A 140     287.190 228.648 166.083  1.00152.23           C  
ATOM   3990  N1    C A 140     287.590 229.750 165.178  1.00155.68           N  
ATOM   3991  C2    C A 140     288.588 230.685 165.552  1.00158.53           C  
ATOM   3992  O2    C A 140     289.165 230.606 166.654  1.00153.12           O  
ATOM   3993  N3    C A 140     288.931 231.673 164.682  1.00159.54           N  
ATOM   3994  C4    C A 140     288.333 231.779 163.488  1.00156.70           C  
ATOM   3995  N4    C A 140     288.708 232.776 162.675  1.00150.99           N  
ATOM   3996  C5    C A 140     287.317 230.857 163.087  1.00151.17           C  
ATOM   3997  C6    C A 140     286.983 229.878 163.948  1.00150.27           C  
ATOM   3998  P     G A 141     286.284 224.670 168.135  1.00149.95           P  
ATOM   3999  OP1   G A 141     287.508 224.876 168.964  1.00138.37           O  
ATOM   4000  OP2   G A 141     286.248 223.487 167.236  1.00131.96           O1-
ATOM   4001  O5'   G A 141     284.985 224.620 169.070  1.00141.84           O  
ATOM   4002  C5'   G A 141     284.969 223.924 170.313  1.00134.53           C  
ATOM   4003  C4'   G A 141     285.146 224.859 171.499  1.00134.53           C  
ATOM   4004  O4'   G A 141     286.083 225.933 171.153  1.00130.20           O  
ATOM   4005  C3'   G A 141     283.912 225.612 172.005  1.00129.58           C  
ATOM   4006  O3'   G A 141     282.990 224.862 172.798  1.00124.22           O  
ATOM   4007  C2'   G A 141     284.557 226.792 172.728  1.00123.54           C  
ATOM   4008  O2'   G A 141     285.187 226.351 173.921  1.00113.84           O  
ATOM   4009  C1'   G A 141     285.660 227.151 171.741  1.00117.45           C  
ATOM   4010  N9    G A 141     285.145 228.031 170.664  1.00125.94           N  
ATOM   4011  C8    G A 141     283.902 227.956 170.058  1.00129.70           C  
ATOM   4012  N7    G A 141     283.663 228.828 169.130  1.00129.04           N  
ATOM   4013  C5    G A 141     284.842 229.545 169.095  1.00136.53           C  
ATOM   4014  C6    G A 141     285.177 230.638 168.258  1.00138.58           C  
ATOM   4015  O6    G A 141     284.494 231.187 167.375  1.00129.10           O  
ATOM   4016  N1    G A 141     286.468 231.076 168.541  1.00145.49           N  
ATOM   4017  C2    G A 141     287.323 230.554 169.488  1.00147.68           C  
ATOM   4018  N2    G A 141     288.521 231.159 169.568  1.00149.02           N  
ATOM   4019  N3    G A 141     287.020 229.528 170.278  1.00136.28           N  
ATOM   4020  C4    G A 141     285.770 229.077 170.029  1.00132.44           C  
ATOM   4021  P     A A 142     281.386 225.130 172.730  1.00124.43           P  
ATOM   4022  OP1   A A 142     280.840 224.994 174.104  1.00116.72           O  
ATOM   4023  OP2   A A 142     280.853 224.236 171.674  1.00118.00           O1-
ATOM   4024  O5'   A A 142     281.196 226.643 172.213  1.00122.91           O  
ATOM   4025  C5'   A A 142     280.517 227.662 172.966  1.00117.16           C  
ATOM   4026  C4'   A A 142     281.443 228.847 173.186  1.00117.70           C  
ATOM   4027  O4'   A A 142     282.141 229.143 171.954  1.00119.13           O  
ATOM   4028  C3'   A A 142     280.879 230.203 173.612  1.00109.31           C  
ATOM   4029  O3'   A A 142     280.563 230.278 175.000  1.00113.36           O  
ATOM   4030  C2'   A A 142     282.015 231.148 173.223  1.00110.00           C  
ATOM   4031  O2'   A A 142     283.056 231.104 174.188  1.00107.91           O  
ATOM   4032  C1'   A A 142     282.540 230.494 171.944  1.00114.26           C  
ATOM   4033  N9    A A 142     282.020 231.129 170.727  1.00117.20           N  
ATOM   4034  C8    A A 142     280.957 230.717 169.967  1.00118.38           C  
ATOM   4035  N7    A A 142     280.740 231.493 168.935  1.00124.22           N  
ATOM   4036  C5    A A 142     281.725 232.471 169.020  1.00131.03           C  
ATOM   4037  C6    A A 142     282.026 233.585 168.210  1.00133.76           C  
ATOM   4038  N6    A A 142     281.315 233.891 167.119  1.00134.20           N  
ATOM   4039  N1    A A 142     283.076 234.368 168.564  1.00125.59           N  
ATOM   4040  C2    A A 142     283.771 234.036 169.659  1.00123.41           C  
ATOM   4041  N3    A A 142     283.580 233.016 170.504  1.00124.98           N  
ATOM   4042  C4    A A 142     282.529 232.258 170.124  1.00125.02           C  
ATOM   4043  P     C A 143     279.687 231.492 175.617  1.00127.64           P  
ATOM   4044  OP1   C A 143     279.548 231.262 177.078  1.00117.24           O  
ATOM   4045  OP2   C A 143     278.453 231.660 174.810  1.00119.94           O1-
ATOM   4046  O5'   C A 143     280.577 232.804 175.406  1.00115.38           O  
ATOM   4047  C5'   C A 143     281.641 233.142 176.287  1.00104.42           C  
ATOM   4048  C4'   C A 143     282.423 234.343 175.796  1.00101.71           C  
ATOM   4049  O4'   C A 143     282.906 234.125 174.438  1.00105.12           O  
ATOM   4050  C3'   C A 143     281.669 235.655 175.672  1.00105.99           C  
ATOM   4051  O3'   C A 143     281.364 236.296 176.893  1.00110.65           O  
ATOM   4052  C2'   C A 143     282.593 236.452 174.767  1.00104.29           C  
ATOM   4053  O2'   C A 143     283.755 236.861 175.477  1.00100.27           O  
ATOM   4054  C1'   C A 143     282.992 235.374 173.764  1.00108.11           C  
ATOM   4055  N1    C A 143     282.078 235.398 172.587  1.00113.36           N  
ATOM   4056  C2    C A 143     282.412 236.228 171.500  1.00116.48           C  
ATOM   4057  O2    C A 143     283.473 236.867 171.539  1.00117.38           O  
ATOM   4058  N3    C A 143     281.602 236.302 170.411  1.00113.74           N  
ATOM   4059  C4    C A 143     280.470 235.605 170.384  1.00111.50           C  
ATOM   4060  N4    C A 143     279.705 235.710 169.297  1.00106.03           N  
ATOM   4061  C5    C A 143     280.082 234.768 171.471  1.00113.18           C  
ATOM   4062  C6    C A 143     280.896 234.701 172.539  1.00113.27           C  
ATOM   4063  P     A A 144     280.131 237.330 176.943  1.00113.01           P  
ATOM   4064  OP1   A A 144     279.881 237.687 178.362  1.00111.60           O  
ATOM   4065  OP2   A A 144     279.016 236.775 176.137  1.00102.15           O1-
ATOM   4066  O5'   A A 144     280.669 238.617 176.165  1.00107.53           O  
ATOM   4067  C5'   A A 144     281.844 239.301 176.586  1.00109.78           C  
ATOM   4068  C4'   A A 144     282.201 240.428 175.645  1.00108.39           C  
ATOM   4069  O4'   A A 144     282.573 239.901 174.345  1.00104.07           O  
ATOM   4070  C3'   A A 144     281.087 241.418 175.338  1.00107.66           C  
ATOM   4071  O3'   A A 144     280.915 242.385 176.357  1.00105.94           O  
ATOM   4072  C2'   A A 144     281.517 242.002 173.998  1.00103.14           C  
ATOM   4073  O2'   A A 144     282.524 242.988 174.168  1.00102.15           O  
ATOM   4074  C1'   A A 144     282.137 240.779 173.326  1.00101.34           C  
ATOM   4075  N9    A A 144     281.146 240.069 172.508  1.00100.77           N  
ATOM   4076  C8    A A 144     280.410 238.961 172.843  1.00100.23           C  
ATOM   4077  N7    A A 144     279.600 238.569 171.892  1.00101.38           N  
ATOM   4078  C5    A A 144     279.819 239.488 170.877  1.00102.38           C  
ATOM   4079  C6    A A 144     279.267 239.624 169.599  1.00103.71           C  
ATOM   4080  N6    A A 144     278.345 238.793 169.124  1.00104.04           N  
ATOM   4081  N1    A A 144     279.695 240.647 168.827  1.00105.81           N  
ATOM   4082  C2    A A 144     280.624 241.471 169.332  1.00107.14           C  
ATOM   4083  N3    A A 144     281.225 241.450 170.522  1.00101.76           N  
ATOM   4084  C4    A A 144     280.766 240.421 171.247  1.00101.20           C  
ATOM   4085  P     C A 145     279.439 242.822 176.809  1.00104.57           P  
ATOM   4086  OP1   C A 145     279.538 243.414 178.165  1.00106.39           O  
ATOM   4087  OP2   C A 145     278.526 241.669 176.589  1.00 98.20           O1-
ATOM   4088  O5'   C A 145     279.045 243.972 175.773  1.00108.48           O  
ATOM   4089  C5'   C A 145     279.932 245.047 175.481  1.00106.57           C  
ATOM   4090  C4'   C A 145     279.666 245.642 174.113  1.00112.04           C  
ATOM   4091  O4'   C A 145     279.999 244.685 173.067  1.00101.76           O  
ATOM   4092  C3'   C A 145     278.226 246.031 173.799  1.00111.69           C  
ATOM   4093  O3'   C A 145     277.811 247.249 174.402  1.00111.44           O  
ATOM   4094  C2'   C A 145     278.229 246.056 172.273  1.00103.79           C  
ATOM   4095  O2'   C A 145     278.856 247.234 171.782  1.00100.64           O  
ATOM   4096  C1'   C A 145     279.128 244.858 171.964  1.00 96.19           C  
ATOM   4097  N1    C A 145     278.320 243.629 171.799  1.00 96.83           N  
ATOM   4098  C2    C A 145     277.667 243.398 170.581  1.00101.45           C  
ATOM   4099  O2    C A 145     277.796 244.212 169.655  1.00105.06           O  
ATOM   4100  N3    C A 145     276.911 242.288 170.423  1.00100.50           N  
ATOM   4101  C4    C A 145     276.783 241.425 171.429  1.00102.32           C  
ATOM   4102  N4    C A 145     276.032 240.339 171.235  1.00 98.58           N  
ATOM   4103  C5    C A 145     277.426 241.636 172.683  1.00104.15           C  
ATOM   4104  C6    C A 145     278.172 242.738 172.824  1.00100.59           C  
ATOM   4105  P     A A 146     276.275 247.458 174.853  1.00113.32           P  
ATOM   4106  OP1   A A 146     276.169 248.703 175.657  1.00111.13           O  
ATOM   4107  OP2   A A 146     275.784 246.186 175.444  1.00 99.24           O1-
ATOM   4108  O5'   A A 146     275.504 247.713 173.479  1.00111.13           O  
ATOM   4109  C5'   A A 146     275.864 248.784 172.612  1.00110.37           C  
ATOM   4110  C4'   A A 146     275.111 248.719 171.302  1.00107.28           C  
ATOM   4111  O4'   A A 146     275.581 247.591 170.512  1.00105.25           O  
ATOM   4112  C3'   A A 146     273.607 248.498 171.408  1.00107.38           C  
ATOM   4113  O3'   A A 146     272.886 249.686 171.692  1.00104.24           O  
ATOM   4114  C2'   A A 146     273.266 247.870 170.058  1.00105.67           C  
ATOM   4115  O2'   A A 146     273.197 248.856 169.039  1.00106.44           O  
ATOM   4116  C1'   A A 146     274.501 247.007 169.806  1.00102.77           C  
ATOM   4117  N9    A A 146     274.312 245.624 170.292  1.00102.49           N  
ATOM   4118  C8    A A 146     274.860 245.040 171.410  1.00105.25           C  
ATOM   4119  N7    A A 146     274.512 243.788 171.602  1.00100.34           N  
ATOM   4120  C5    A A 146     273.669 243.519 170.535  1.00 97.18           C  
ATOM   4121  C6    A A 146     272.961 242.365 170.157  1.00 92.73           C  
ATOM   4122  N6    A A 146     272.985 241.218 170.832  1.00 89.09           N  
ATOM   4123  N1    A A 146     272.211 242.427 169.037  1.00 95.78           N  
ATOM   4124  C2    A A 146     272.186 243.583 168.358  1.00100.23           C  
ATOM   4125  N3    A A 146     272.804 244.740 168.608  1.00 96.99           N  
ATOM   4126  C4    A A 146     273.538 244.640 169.725  1.00 98.08           C  
ATOM   4127  P     C A 147     271.572 249.634 172.620  1.00108.49           P  
ATOM   4128  OP1   C A 147     271.259 251.033 173.007  1.00107.43           O  
ATOM   4129  OP2   C A 147     271.794 248.625 173.690  1.00100.85           O1-
ATOM   4130  O5'   C A 147     270.425 249.101 171.638  1.00106.11           O  
ATOM   4131  C5'   C A 147     269.969 249.891 170.540  1.00105.30           C  
ATOM   4132  C4'   C A 147     269.260 249.074 169.477  1.00 98.71           C  
ATOM   4133  O4'   C A 147     270.092 247.951 169.075  1.00 96.21           O  
ATOM   4134  C3'   C A 147     267.936 248.426 169.869  1.00 90.09           C  
ATOM   4135  O3'   C A 147     266.831 249.318 169.837  1.00 94.50           O  
ATOM   4136  C2'   C A 147     267.826 247.282 168.872  1.00 82.70           C  
ATOM   4137  O2'   C A 147     267.428 247.760 167.594  1.00 78.80           O  
ATOM   4138  C1'   C A 147     269.283 246.830 168.787  1.00 89.71           C  
ATOM   4139  N1    C A 147     269.597 245.764 169.774  1.00 92.06           N  
ATOM   4140  C2    C A 147     269.090 244.468 169.589  1.00 91.08           C  
ATOM   4141  O2    C A 147     268.373 244.226 168.601  1.00 88.61           O  
ATOM   4142  N3    C A 147     269.387 243.501 170.501  1.00 89.53           N  
ATOM   4143  C4    C A 147     270.158 243.777 171.559  1.00 86.59           C  
ATOM   4144  N4    C A 147     270.415 242.785 172.416  1.00 82.94           N  
ATOM   4145  C5    C A 147     270.695 245.079 171.774  1.00 88.81           C  
ATOM   4146  C6    C A 147     270.393 246.023 170.866  1.00 92.60           C  
ATOM   4147  P     U A 148     265.607 249.138 170.870  1.00108.65           P  
ATOM   4148  OP1   U A 148     264.628 250.230 170.634  1.00101.18           O  
ATOM   4149  OP2   U A 148     266.149 248.943 172.240  1.00100.84           O1-
ATOM   4150  O5'   U A 148     264.936 247.768 170.422  1.00 91.08           O  
ATOM   4151  C5'   U A 148     264.428 247.595 169.110  1.00 83.44           C  
ATOM   4152  C4'   U A 148     263.856 246.215 168.955  1.00 81.58           C  
ATOM   4153  O4'   U A 148     264.922 245.234 169.033  1.00 80.71           O  
ATOM   4154  C3'   U A 148     262.889 245.795 170.050  1.00 82.46           C  
ATOM   4155  O3'   U A 148     261.580 246.318 169.862  1.00 84.09           O  
ATOM   4156  C2'   U A 148     262.971 244.272 169.999  1.00 75.79           C  
ATOM   4157  O2'   U A 148     262.190 243.768 168.926  1.00 71.97           O  
ATOM   4158  C1'   U A 148     264.446 244.055 169.650  1.00 77.71           C  
ATOM   4159  N1    U A 148     265.302 243.735 170.823  1.00 80.45           N  
ATOM   4160  C2    U A 148     265.328 242.429 171.303  1.00 77.92           C  
ATOM   4161  O2    U A 148     264.658 241.527 170.839  1.00 80.16           O  
ATOM   4162  N3    U A 148     266.158 242.198 172.368  1.00 73.38           N  
ATOM   4163  C4    U A 148     266.966 243.119 172.988  1.00 73.58           C  
ATOM   4164  O4    U A 148     267.659 242.763 173.936  1.00 78.74           O  
ATOM   4165  C5    U A 148     266.904 244.437 172.443  1.00 76.85           C  
ATOM   4166  C6    U A 148     266.103 244.692 171.404  1.00 82.32           C  
ATOM   4167  P     A A 149     260.972 247.396 170.895  1.00 83.91           P  
ATOM   4168  OP1   A A 149     260.774 248.690 170.192  1.00 83.63           O  
ATOM   4169  OP2   A A 149     261.821 247.360 172.119  1.00 78.72           O1-
ATOM   4170  O5'   A A 149     259.527 246.820 171.234  1.00 68.13           O  
ATOM   4171  C5'   A A 149     259.383 245.528 171.798  1.00 68.45           C  
ATOM   4172  C4'   A A 149     258.323 245.514 172.869  1.00 68.82           C  
ATOM   4173  O4'   A A 149     258.781 246.242 174.039  1.00 70.04           O  
ATOM   4174  C3'   A A 149     257.023 246.198 172.506  1.00 71.98           C  
ATOM   4175  O3'   A A 149     256.189 245.407 171.680  1.00 68.73           O  
ATOM   4176  C2'   A A 149     256.431 246.527 173.872  1.00 73.20           C  
ATOM   4177  O2'   A A 149     255.851 245.372 174.460  1.00 73.98           O  
ATOM   4178  C1'   A A 149     257.687 246.887 174.663  1.00 67.37           C  
ATOM   4179  N9    A A 149     257.935 248.343 174.689  1.00 64.00           N  
ATOM   4180  C8    A A 149     258.724 249.092 173.855  1.00 65.93           C  
ATOM   4181  N7    A A 149     258.741 250.371 174.136  1.00 66.11           N  
ATOM   4182  C5    A A 149     257.904 250.475 175.237  1.00 66.20           C  
ATOM   4183  C6    A A 149     257.491 251.569 176.024  1.00 67.10           C  
ATOM   4184  N6    A A 149     257.880 252.827 175.836  1.00 68.16           N  
ATOM   4185  N1    A A 149     256.650 251.326 177.042  1.00 65.62           N  
ATOM   4186  C2    A A 149     256.253 250.064 177.237  1.00 70.03           C  
ATOM   4187  N3    A A 149     256.568 248.953 176.577  1.00 67.19           N  
ATOM   4188  C4    A A 149     257.404 249.234 175.577  1.00 62.58           C  
ATOM   4189  P     U A 150     255.417 246.093 170.453  1.00 73.37           P  
ATOM   4190  OP1   U A 150     254.710 245.023 169.708  1.00 76.36           O  
ATOM   4191  OP2   U A 150     256.393 246.955 169.733  1.00 72.84           O1-
ATOM   4192  O5'   U A 150     254.307 246.980 171.173  1.00 71.10           O  
ATOM   4193  C5'   U A 150     253.379 246.350 172.038  1.00 69.07           C  
ATOM   4194  C4'   U A 150     252.720 247.301 173.008  1.00 74.25           C  
ATOM   4195  O4'   U A 150     253.683 247.940 173.889  1.00 70.59           O  
ATOM   4196  C3'   U A 150     251.963 248.473 172.423  1.00 77.76           C  
ATOM   4197  O3'   U A 150     250.746 248.111 171.808  1.00 79.21           O  
ATOM   4198  C2'   U A 150     251.804 249.364 173.642  1.00 80.02           C  
ATOM   4199  O2'   U A 150     250.829 248.823 174.526  1.00 77.58           O  
ATOM   4200  C1'   U A 150     253.183 249.206 174.286  1.00 70.82           C  
ATOM   4201  N1    U A 150     254.105 250.260 173.810  1.00 67.82           N  
ATOM   4202  C2    U A 150     254.016 251.517 174.391  1.00 69.72           C  
ATOM   4203  O2    U A 150     253.242 251.799 175.288  1.00 70.93           O  
ATOM   4204  N3    U A 150     254.879 252.454 173.896  1.00 72.74           N  
ATOM   4205  C4    U A 150     255.800 252.256 172.893  1.00 74.67           C  
ATOM   4206  O4    U A 150     256.518 253.195 172.548  1.00 78.35           O  
ATOM   4207  C5    U A 150     255.822 250.938 172.333  1.00 69.73           C  
ATOM   4208  C6    U A 150     254.990 250.008 172.795  1.00 65.58           C  
ATOM   4209  P     C A 151     250.463 248.618 170.315  1.00 91.82           P  
ATOM   4210  OP1   C A 151     249.450 247.720 169.693  1.00 84.05           O  
ATOM   4211  OP2   C A 151     251.799 248.767 169.680  1.00 82.21           O1-
ATOM   4212  O5'   C A 151     249.851 250.080 170.515  1.00 77.81           O  
ATOM   4213  C5'   C A 151     248.800 250.313 171.444  1.00 72.42           C  
ATOM   4214  C4'   C A 151     248.820 251.725 171.978  1.00 79.49           C  
ATOM   4215  O4'   C A 151     250.061 251.976 172.689  1.00 80.59           O  
ATOM   4216  C3'   C A 151     248.766 252.844 170.950  1.00 82.78           C  
ATOM   4217  O3'   C A 151     247.472 253.073 170.419  1.00 83.52           O  
ATOM   4218  C2'   C A 151     249.336 254.025 171.727  1.00 78.28           C  
ATOM   4219  O2'   C A 151     248.371 254.561 172.619  1.00 74.18           O  
ATOM   4220  C1'   C A 151     250.424 253.338 172.554  1.00 75.82           C  
ATOM   4221  N1    C A 151     251.746 253.430 171.890  1.00 73.88           N  
ATOM   4222  C2    C A 151     252.482 254.597 172.081  1.00 75.86           C  
ATOM   4223  O2    C A 151     252.010 255.484 172.802  1.00 82.56           O  
ATOM   4224  N3    C A 151     253.684 254.744 171.491  1.00 75.14           N  
ATOM   4225  C4    C A 151     254.146 253.768 170.722  1.00 74.38           C  
ATOM   4226  N4    C A 151     255.338 253.955 170.164  1.00 80.12           N  
ATOM   4227  C5    C A 151     253.425 252.560 170.500  1.00 73.09           C  
ATOM   4228  C6    C A 151     252.235 252.434 171.094  1.00 73.08           C  
ATOM   4229  P     A A 152     247.318 253.545 168.889  1.00 88.94           P  
ATOM   4230  OP1   A A 152     245.895 253.402 168.484  1.00 86.03           O  
ATOM   4231  OP2   A A 152     248.381 252.849 168.117  1.00 82.20           O1-
ATOM   4232  O5'   A A 152     247.675 255.101 168.928  1.00 89.73           O  
ATOM   4233  C5'   A A 152     246.890 256.012 169.686  1.00 93.01           C  
ATOM   4234  C4'   A A 152     247.530 257.378 169.764  1.00 92.91           C  
ATOM   4235  O4'   A A 152     248.782 257.292 170.492  1.00 90.61           O  
ATOM   4236  C3'   A A 152     247.918 258.010 168.434  1.00 97.67           C  
ATOM   4237  O3'   A A 152     246.830 258.633 167.777  1.00101.21           O  
ATOM   4238  C2'   A A 152     249.027 258.973 168.833  1.00 96.62           C  
ATOM   4239  O2'   A A 152     248.479 260.149 169.408  1.00 99.90           O  
ATOM   4240  C1'   A A 152     249.728 258.181 169.934  1.00 89.52           C  
ATOM   4241  N9    A A 152     250.865 257.386 169.432  1.00 85.81           N  
ATOM   4242  C8    A A 152     250.883 256.062 169.063  1.00 83.40           C  
ATOM   4243  N7    A A 152     252.061 255.641 168.677  1.00 82.46           N  
ATOM   4244  C5    A A 152     252.874 256.761 168.804  1.00 87.00           C  
ATOM   4245  C6    A A 152     254.244 256.979 168.553  1.00 89.67           C  
ATOM   4246  N6    A A 152     255.080 256.044 168.100  1.00 88.77           N  
ATOM   4247  N1    A A 152     254.738 258.217 168.785  1.00 91.96           N  
ATOM   4248  C2    A A 152     253.901 259.166 169.234  1.00 94.86           C  
ATOM   4249  N3    A A 152     252.599 259.085 169.518  1.00 90.85           N  
ATOM   4250  C4    A A 152     252.146 257.842 169.271  1.00 88.47           C  
ATOM   4251  P     U A 153     246.617 258.405 166.200  1.00115.56           P  
ATOM   4252  OP1   U A 153     245.187 258.657 165.879  1.00114.84           O  
ATOM   4253  OP2   U A 153     247.221 257.090 165.857  1.00 98.32           O1-
ATOM   4254  O5'   U A 153     247.510 259.544 165.528  1.00109.53           O  
ATOM   4255  C5'   U A 153     247.388 260.904 165.927  1.00107.19           C  
ATOM   4256  C4'   U A 153     248.631 261.690 165.598  1.00107.53           C  
ATOM   4257  O4'   U A 153     249.725 261.294 166.474  1.00104.29           O  
ATOM   4258  C3'   U A 153     249.202 261.480 164.207  1.00117.77           C  
ATOM   4259  O3'   U A 153     248.489 262.153 163.181  1.00121.24           O  
ATOM   4260  C2'   U A 153     250.648 261.933 164.382  1.00114.93           C  
ATOM   4261  O2'   U A 153     250.732 263.352 164.441  1.00108.63           O  
ATOM   4262  C1'   U A 153     250.954 261.374 165.772  1.00105.38           C  
ATOM   4263  N1    U A 153     251.563 260.019 165.695  1.00100.12           N  
ATOM   4264  C2    U A 153     252.911 259.938 165.379  1.00 99.92           C  
ATOM   4265  O2    U A 153     253.602 260.920 165.182  1.00101.51           O  
ATOM   4266  N3    U A 153     253.427 258.668 165.307  1.00 95.06           N  
ATOM   4267  C4    U A 153     252.737 257.493 165.515  1.00 93.44           C  
ATOM   4268  O4    U A 153     253.336 256.426 165.417  1.00 94.53           O  
ATOM   4269  C5    U A 153     251.351 257.645 165.831  1.00 92.70           C  
ATOM   4270  C6    U A 153     250.829 258.872 165.903  1.00 96.37           C  
ATOM   4271  P     U A 154     248.299 261.450 161.743  1.00132.07           P  
ATOM   4272  OP1   U A 154     247.315 262.249 160.968  1.00129.21           O  
ATOM   4273  OP2   U A 154     248.044 260.001 161.972  1.00114.67           O1-
ATOM   4274  O5'   U A 154     249.722 261.621 161.034  1.00117.12           O  
ATOM   4275  C5'   U A 154     250.256 262.912 160.759  1.00114.40           C  
ATOM   4276  C4'   U A 154     251.746 262.866 160.514  1.00113.45           C  
ATOM   4277  O4'   U A 154     252.415 262.260 161.648  1.00111.44           O  
ATOM   4278  C3'   U A 154     252.197 262.033 159.322  1.00119.79           C  
ATOM   4279  O3'   U A 154     252.097 262.743 158.099  1.00123.07           O  
ATOM   4280  C2'   U A 154     253.626 261.651 159.694  1.00116.00           C  
ATOM   4281  O2'   U A 154     254.527 262.713 159.416  1.00111.86           O  
ATOM   4282  C1'   U A 154     253.514 261.488 161.211  1.00110.30           C  
ATOM   4283  N1    U A 154     253.277 260.082 161.600  1.00101.44           N  
ATOM   4284  C2    U A 154     254.373 259.253 161.689  1.00 98.51           C  
ATOM   4285  O2    U A 154     255.504 259.635 161.458  1.00100.17           O  
ATOM   4286  N3    U A 154     254.098 257.965 162.052  1.00 98.63           N  
ATOM   4287  C4    U A 154     252.847 257.448 162.328  1.00 99.96           C  
ATOM   4288  O4    U A 154     252.740 256.263 162.646  1.00102.08           O  
ATOM   4289  C5    U A 154     251.761 258.370 162.218  1.00 97.04           C  
ATOM   4290  C6    U A 154     252.008 259.627 161.864  1.00 98.62           C  
ATOM   4291  P     A A 155     251.382 262.074 156.822  1.00137.69           P  
ATOM   4292  OP1   A A 155     250.804 263.166 155.991  1.00128.45           O  
ATOM   4293  OP2   A A 155     250.511 260.972 157.310  1.00125.90           O1-
ATOM   4294  O5'   A A 155     252.582 261.399 156.018  1.00125.93           O  
ATOM   4295  C5'   A A 155     253.735 262.142 155.652  1.00118.68           C  
ATOM   4296  C4'   A A 155     254.956 261.258 155.596  1.00120.20           C  
ATOM   4297  O4'   A A 155     255.248 260.733 156.919  1.00117.61           O  
ATOM   4298  C3'   A A 155     254.853 260.009 154.729  1.00122.25           C  
ATOM   4299  O3'   A A 155     254.993 260.272 153.336  1.00125.65           O  
ATOM   4300  C2'   A A 155     255.950 259.125 155.316  1.00118.76           C  
ATOM   4301  O2'   A A 155     257.236 259.556 154.891  1.00115.40           O  
ATOM   4302  C1'   A A 155     255.810 259.439 156.806  1.00114.54           C  
ATOM   4303  N9    A A 155     254.934 258.466 157.489  1.00107.94           N  
ATOM   4304  C8    A A 155     253.598 258.556 157.795  1.00104.02           C  
ATOM   4305  N7    A A 155     253.125 257.495 158.404  1.00102.10           N  
ATOM   4306  C5    A A 155     254.225 256.649 158.498  1.00104.85           C  
ATOM   4307  C6    A A 155     254.404 255.361 159.040  1.00101.84           C  
ATOM   4308  N6    A A 155     253.427 254.666 159.616  1.00100.54           N  
ATOM   4309  N1    A A 155     255.631 254.796 158.971  1.00 99.36           N  
ATOM   4310  C2    A A 155     256.615 255.494 158.389  1.00103.25           C  
ATOM   4311  N3    A A 155     256.578 256.711 157.845  1.00105.65           N  
ATOM   4312  C4    A A 155     255.342 257.236 157.935  1.00107.17           C  
ATOM   4313  P     A A 156     254.176 259.422 152.230  1.00124.72           P  
ATOM   4314  OP1   A A 156     253.996 260.284 151.032  1.00123.22           O  
ATOM   4315  OP2   A A 156     252.990 258.791 152.869  1.00119.17           O1-
ATOM   4316  O5'   A A 156     255.177 258.247 151.826  1.00125.65           O  
ATOM   4317  C5'   A A 156     256.550 258.505 151.568  1.00124.84           C  
ATOM   4318  C4'   A A 156     257.403 257.284 151.817  1.00124.14           C  
ATOM   4319  O4'   A A 156     257.545 257.039 153.248  1.00125.83           O  
ATOM   4320  C3'   A A 156     256.850 255.970 151.296  1.00125.67           C  
ATOM   4321  O3'   A A 156     256.943 255.805 149.892  1.00129.75           O  
ATOM   4322  C2'   A A 156     257.633 254.959 152.121  1.00125.87           C  
ATOM   4323  O2'   A A 156     258.988 254.905 151.694  1.00122.08           O  
ATOM   4324  C1'   A A 156     257.591 255.639 153.488  1.00125.19           C  
ATOM   4325  N9    A A 156     256.375 255.236 154.236  1.00117.06           N  
ATOM   4326  C8    A A 156     255.197 255.931 154.390  1.00117.62           C  
ATOM   4327  N7    A A 156     254.277 255.317 155.091  1.00106.25           N  
ATOM   4328  C5    A A 156     254.885 254.121 155.415  1.00101.39           C  
ATOM   4329  C6    A A 156     254.434 253.025 156.152  1.00100.87           C  
ATOM   4330  N6    A A 156     253.225 252.979 156.697  1.00103.88           N  
ATOM   4331  N1    A A 156     255.266 251.974 156.308  1.00102.49           N  
ATOM   4332  C2    A A 156     256.481 252.039 155.750  1.00106.51           C  
ATOM   4333  N3    A A 156     257.024 253.022 155.033  1.00109.80           N  
ATOM   4334  C4    A A 156     256.166 254.048 154.899  1.00108.01           C  
ATOM   4335  P     C A 157     255.668 255.246 149.079  1.00134.99           P  
ATOM   4336  OP1   C A 157     255.740 255.752 147.683  1.00134.31           O  
ATOM   4337  OP2   C A 157     254.448 255.500 149.893  1.00124.93           O1-
ATOM   4338  O5'   C A 157     255.886 253.666 149.067  1.00131.47           O  
ATOM   4339  C5'   C A 157     257.180 253.105 148.892  1.00135.14           C  
ATOM   4340  C4'   C A 157     257.338 251.816 149.663  1.00133.54           C  
ATOM   4341  O4'   C A 157     257.119 252.055 151.078  1.00128.42           O  
ATOM   4342  C3'   C A 157     256.360 250.704 149.315  1.00129.14           C  
ATOM   4343  O3'   C A 157     256.765 249.979 148.164  1.00137.14           O  
ATOM   4344  C2'   C A 157     256.335 249.863 150.590  1.00119.95           C  
ATOM   4345  O2'   C A 157     257.458 248.993 150.638  1.00123.18           O  
ATOM   4346  C1'   C A 157     256.505 250.934 151.672  1.00120.88           C  
ATOM   4347  N1    C A 157     255.221 251.369 152.277  1.00112.00           N  
ATOM   4348  C2    C A 157     254.649 250.586 153.284  1.00107.51           C  
ATOM   4349  O2    C A 157     255.213 249.539 153.636  1.00109.03           O  
ATOM   4350  N3    C A 157     253.490 250.978 153.852  1.00104.23           N  
ATOM   4351  C4    C A 157     252.918 252.110 153.448  1.00102.54           C  
ATOM   4352  N4    C A 157     251.774 252.451 154.037  1.00101.52           N  
ATOM   4353  C5    C A 157     253.477 252.939 152.433  1.00105.03           C  
ATOM   4354  C6    C A 157     254.623 252.536 151.882  1.00108.47           C  
ATOM   4355  P     U A 158     255.731 249.691 146.965  1.00144.81           P  
ATOM   4356  OP1   U A 158     256.488 249.701 145.683  1.00136.92           O  
ATOM   4357  OP2   U A 158     254.573 250.612 147.136  1.00135.17           O1-
ATOM   4358  O5'   U A 158     255.244 248.199 147.243  1.00135.32           O  
ATOM   4359  C5'   U A 158     253.910 247.931 147.648  1.00133.77           C  
ATOM   4360  C4'   U A 158     253.866 247.176 148.953  1.00128.64           C  
ATOM   4361  O4'   U A 158     253.851 248.109 150.064  1.00116.69           O  
ATOM   4362  C3'   U A 158     252.630 246.319 149.171  1.00126.60           C  
ATOM   4363  O3'   U A 158     252.729 245.059 148.515  1.00125.67           O  
ATOM   4364  C2'   U A 158     252.549 246.218 150.693  1.00118.05           C  
ATOM   4365  O2'   U A 158     253.428 245.217 151.187  1.00117.82           O  
ATOM   4366  C1'   U A 158     253.084 247.587 151.127  1.00110.52           C  
ATOM   4367  N1    U A 158     252.016 248.557 151.460  1.00102.60           N  
ATOM   4368  C2    U A 158     251.156 248.292 152.510  1.00 99.93           C  
ATOM   4369  O2    U A 158     251.186 247.279 153.191  1.00 99.83           O  
ATOM   4370  N3    U A 158     250.222 249.267 152.738  1.00 97.49           N  
ATOM   4371  C4    U A 158     250.050 250.456 152.070  1.00 95.06           C  
ATOM   4372  O4    U A 158     249.149 251.228 152.411  1.00 93.20           O  
ATOM   4373  C5    U A 158     250.984 250.658 151.010  1.00100.81           C  
ATOM   4374  C6    U A 158     251.911 249.730 150.755  1.00102.88           C  
ATOM   4375  P     G A 159     251.647 244.606 147.408  1.00121.22           P  
ATOM   4376  OP1   G A 159     252.151 243.349 146.796  1.00116.81           O  
ATOM   4377  OP2   G A 159     251.316 245.760 146.528  1.00110.78           O1-
ATOM   4378  O5'   G A 159     250.349 244.257 148.267  1.00116.52           O  
ATOM   4379  C5'   G A 159     250.445 243.590 149.520  1.00111.93           C  
ATOM   4380  C4'   G A 159     249.269 243.920 150.404  1.00105.58           C  
ATOM   4381  O4'   G A 159     249.391 245.265 150.936  1.00106.67           O  
ATOM   4382  C3'   G A 159     247.924 243.923 149.704  1.00104.46           C  
ATOM   4383  O3'   G A 159     247.413 242.612 149.538  1.00104.65           O  
ATOM   4384  C2'   G A 159     247.080 244.824 150.600  1.00100.75           C  
ATOM   4385  O2'   G A 159     246.648 244.120 151.752  1.00102.89           O  
ATOM   4386  C1'   G A 159     248.112 245.860 151.045  1.00102.39           C  
ATOM   4387  N9    G A 159     248.084 247.084 150.220  1.00100.08           N  
ATOM   4388  C8    G A 159     248.816 247.328 149.083  1.00100.36           C  
ATOM   4389  N7    G A 159     248.594 248.508 148.574  1.00 99.94           N  
ATOM   4390  C5    G A 159     247.658 249.086 149.423  1.00102.65           C  
ATOM   4391  C6    G A 159     247.031 250.369 149.378  1.00105.27           C  
ATOM   4392  O6    G A 159     247.176 251.285 148.556  1.00104.73           O  
ATOM   4393  N1    G A 159     246.147 250.542 150.437  1.00102.18           N  
ATOM   4394  C2    G A 159     245.896 249.609 151.411  1.00100.93           C  
ATOM   4395  N2    G A 159     245.006 249.978 152.343  1.00100.17           N  
ATOM   4396  N3    G A 159     246.466 248.412 151.467  1.00 99.62           N  
ATOM   4397  C4    G A 159     247.332 248.215 150.447  1.00100.25           C  
ATOM   4398  P     A A 160     246.344 242.293 148.381  1.00111.87           P  
ATOM   4399  OP1   A A 160     246.400 240.831 148.088  1.00 95.92           O  
ATOM   4400  OP2   A A 160     246.560 243.266 147.278  1.00105.88           O1-
ATOM   4401  O5'   A A 160     244.955 242.661 149.078  1.00107.07           O  
ATOM   4402  C5'   A A 160     243.708 242.207 148.568  1.00104.54           C  
ATOM   4403  C4'   A A 160     242.938 241.396 149.593  1.00 99.06           C  
ATOM   4404  O4'   A A 160     243.007 242.023 150.899  1.00 94.32           O  
ATOM   4405  C3'   A A 160     241.450 241.227 149.337  1.00 92.96           C  
ATOM   4406  O3'   A A 160     241.192 240.198 148.397  1.00 97.09           O  
ATOM   4407  C2'   A A 160     240.895 240.948 150.733  1.00 85.26           C  
ATOM   4408  O2'   A A 160     241.102 239.594 151.106  1.00 84.52           O  
ATOM   4409  C1'   A A 160     241.804 241.808 151.605  1.00 82.54           C  
ATOM   4410  N9    A A 160     241.232 243.121 151.944  1.00 81.40           N  
ATOM   4411  C8    A A 160     241.538 244.327 151.376  1.00 89.77           C  
ATOM   4412  N7    A A 160     240.905 245.349 151.896  1.00 91.40           N  
ATOM   4413  C5    A A 160     240.134 244.768 152.889  1.00 83.33           C  
ATOM   4414  C6    A A 160     239.234 245.304 153.818  1.00 84.59           C  
ATOM   4415  N6    A A 160     238.941 246.593 153.904  1.00 92.75           N  
ATOM   4416  N1    A A 160     238.626 244.474 154.671  1.00 84.15           N  
ATOM   4417  C2    A A 160     238.930 243.185 154.580  1.00 86.90           C  
ATOM   4418  N3    A A 160     239.759 242.553 153.759  1.00 85.93           N  
ATOM   4419  C4    A A 160     240.335 243.410 152.927  1.00 78.96           C  
ATOM   4420  P     A A 161     240.267 240.473 147.112  1.00 99.06           P  
ATOM   4421  OP1   A A 161     240.701 239.562 146.017  1.00 98.56           O  
ATOM   4422  OP2   A A 161     240.219 241.941 146.883  1.00 97.38           O1-
ATOM   4423  O5'   A A 161     238.835 239.995 147.606  1.00101.69           O  
ATOM   4424  C5'   A A 161     238.719 238.879 148.473  1.00101.15           C  
ATOM   4425  C4'   A A 161     237.517 239.009 149.368  1.00 99.70           C  
ATOM   4426  O4'   A A 161     237.830 239.808 150.536  1.00 96.99           O  
ATOM   4427  C3'   A A 161     236.324 239.716 148.761  1.00100.76           C  
ATOM   4428  O3'   A A 161     235.607 238.881 147.874  1.00110.23           O  
ATOM   4429  C2'   A A 161     235.543 240.136 149.997  1.00 95.96           C  
ATOM   4430  O2'   A A 161     234.878 239.013 150.556  1.00 96.78           O  
ATOM   4431  C1'   A A 161     236.679 240.522 150.942  1.00 92.57           C  
ATOM   4432  N9    A A 161     236.971 241.964 150.909  1.00 88.09           N  
ATOM   4433  C8    A A 161     237.829 242.646 150.088  1.00 92.21           C  
ATOM   4434  N7    A A 161     237.864 243.935 150.321  1.00 95.06           N  
ATOM   4435  C5    A A 161     236.967 244.101 151.368  1.00 91.84           C  
ATOM   4436  C6    A A 161     236.534 245.233 152.083  1.00 96.33           C  
ATOM   4437  N6    A A 161     236.978 246.465 151.830  1.00100.14           N  
ATOM   4438  N1    A A 161     235.624 245.061 153.072  1.00 92.58           N  
ATOM   4439  C2    A A 161     235.181 243.823 153.309  1.00 90.08           C  
ATOM   4440  N3    A A 161     235.510 242.685 152.703  1.00 89.49           N  
ATOM   4441  C4    A A 161     236.412 242.897 151.733  1.00 87.79           C  
ATOM   4442  P     U A 162     234.726 239.501 146.680  1.00133.24           P  
ATOM   4443  OP1   U A 162     233.672 240.352 147.291  1.00124.94           O  
ATOM   4444  OP2   U A 162     234.377 238.377 145.766  1.00117.87           O1-
ATOM   4445  O5'   U A 162     235.700 240.481 145.883  1.00116.51           O  
ATOM   4446  C5'   U A 162     235.296 241.012 144.621  1.00116.61           C  
ATOM   4447  C4'   U A 162     235.891 242.372 144.351  1.00116.65           C  
ATOM   4448  O4'   U A 162     235.140 243.386 145.081  1.00111.97           O  
ATOM   4449  C3'   U A 162     237.353 242.530 144.777  1.00120.37           C  
ATOM   4450  O3'   U A 162     238.048 243.361 143.845  1.00126.04           O  
ATOM   4451  C2'   U A 162     237.235 243.249 146.117  1.00113.40           C  
ATOM   4452  O2'   U A 162     238.375 243.994 146.492  1.00115.00           O  
ATOM   4453  C1'   U A 162     236.028 244.147 145.874  1.00112.40           C  
ATOM   4454  N1    U A 162     235.353 244.541 147.112  1.00104.36           N  
ATOM   4455  C2    U A 162     235.352 245.887 147.434  1.00100.02           C  
ATOM   4456  O2    U A 162     235.850 246.749 146.730  1.00101.58           O  
ATOM   4457  N3    U A 162     234.732 246.185 148.614  1.00 99.28           N  
ATOM   4458  C4    U A 162     234.142 245.280 149.476  1.00100.92           C  
ATOM   4459  O4    U A 162     233.620 245.707 150.506  1.00 96.36           O  
ATOM   4460  C5    U A 162     234.202 243.903 149.072  1.00 99.20           C  
ATOM   4461  C6    U A 162     234.802 243.583 147.926  1.00 98.94           C  
ATOM   4462  P     C A 163     239.083 242.722 142.785  1.00129.24           P  
ATOM   4463  OP1   C A 163     238.300 241.817 141.902  1.00130.16           O  
ATOM   4464  OP2   C A 163     240.270 242.185 143.508  1.00112.64           O1-
ATOM   4465  O5'   C A 163     239.551 243.973 141.914  1.00128.34           O  
ATOM   4466  C5'   C A 163     239.211 244.078 140.537  1.00129.35           C  
ATOM   4467  C4'   C A 163     238.977 245.512 140.110  1.00136.06           C  
ATOM   4468  O4'   C A 163     237.555 245.776 139.996  1.00127.49           O  
ATOM   4469  C3'   C A 163     239.490 246.605 141.042  1.00142.12           C  
ATOM   4470  O3'   C A 163     240.886 246.847 140.892  1.00138.85           O  
ATOM   4471  C2'   C A 163     238.619 247.809 140.671  1.00137.46           C  
ATOM   4472  O2'   C A 163     239.145 248.494 139.540  1.00130.03           O  
ATOM   4473  C1'   C A 163     237.295 247.139 140.267  1.00130.93           C  
ATOM   4474  N1    C A 163     236.231 247.240 141.299  1.00126.06           N  
ATOM   4475  C2    C A 163     235.514 248.442 141.446  1.00126.15           C  
ATOM   4476  O2    C A 163     235.788 249.421 140.730  1.00125.24           O  
ATOM   4477  N3    C A 163     234.532 248.516 142.379  1.00118.24           N  
ATOM   4478  C4    C A 163     234.254 247.453 143.137  1.00113.91           C  
ATOM   4479  N4    C A 163     233.282 247.576 144.042  1.00109.69           N  
ATOM   4480  C5    C A 163     234.955 246.217 143.007  1.00113.55           C  
ATOM   4481  C6    C A 163     235.922 246.156 142.081  1.00117.33           C  
ATOM   4482  P     C A 164     241.842 247.057 142.173  1.00136.81           P  
ATOM   4483  OP1   C A 164     243.208 246.617 141.782  1.00131.13           O  
ATOM   4484  OP2   C A 164     241.188 246.449 143.365  1.00125.00           O1-
ATOM   4485  O5'   C A 164     241.854 248.638 142.400  1.00134.33           O  
ATOM   4486  C5'   C A 164     242.306 249.536 141.393  1.00130.64           C  
ATOM   4487  C4'   C A 164     241.618 250.882 141.486  1.00135.59           C  
ATOM   4488  O4'   C A 164     240.175 250.712 141.381  1.00132.70           O  
ATOM   4489  C3'   C A 164     241.800 251.676 142.781  1.00142.92           C  
ATOM   4490  O3'   C A 164     243.058 252.351 142.872  1.00145.61           O  
ATOM   4491  C2'   C A 164     240.591 252.618 142.756  1.00136.16           C  
ATOM   4492  O2'   C A 164     240.828 253.727 141.895  1.00128.28           O  
ATOM   4493  C1'   C A 164     239.514 251.728 142.114  1.00134.28           C  
ATOM   4494  N1    C A 164     238.586 251.119 143.114  1.00129.23           N  
ATOM   4495  C2    C A 164     237.540 251.903 143.632  1.00124.80           C  
ATOM   4496  O2    C A 164     237.422 253.075 143.239  1.00126.03           O  
ATOM   4497  N3    C A 164     236.684 251.383 144.548  1.00116.52           N  
ATOM   4498  C4    C A 164     236.827 250.123 144.957  1.00115.44           C  
ATOM   4499  N4    C A 164     235.956 249.658 145.856  1.00109.93           N  
ATOM   4500  C5    C A 164     237.871 249.288 144.455  1.00120.08           C  
ATOM   4501  C6    C A 164     238.712 249.822 143.551  1.00126.60           C  
ATOM   4502  P     A A 165     243.975 252.301 144.210  1.00147.98           P  
ATOM   4503  OP1   A A 165     244.861 253.498 144.199  1.00134.83           O  
ATOM   4504  OP2   A A 165     244.597 250.954 144.316  1.00138.95           O1-
ATOM   4505  O5'   A A 165     242.948 252.498 145.415  1.00128.00           O  
ATOM   4506  C5'   A A 165     242.490 253.795 145.763  1.00122.75           C  
ATOM   4507  C4'   A A 165     241.261 253.760 146.640  1.00123.36           C  
ATOM   4508  O4'   A A 165     240.281 252.813 146.134  1.00118.58           O  
ATOM   4509  C3'   A A 165     241.463 253.324 148.079  1.00123.53           C  
ATOM   4510  O3'   A A 165     242.053 254.329 148.889  1.00128.17           O  
ATOM   4511  C2'   A A 165     240.046 252.939 148.494  1.00117.77           C  
ATOM   4512  O2'   A A 165     239.263 254.098 148.743  1.00116.05           O  
ATOM   4513  C1'   A A 165     239.533 252.281 147.214  1.00113.39           C  
ATOM   4514  N9    A A 165     239.705 250.814 147.244  1.00117.63           N  
ATOM   4515  C8    A A 165     240.594 250.044 146.522  1.00124.46           C  
ATOM   4516  N7    A A 165     240.518 248.751 146.760  1.00115.46           N  
ATOM   4517  C5    A A 165     239.510 248.655 147.708  1.00111.88           C  
ATOM   4518  C6    A A 165     238.951 247.548 148.369  1.00100.25           C  
ATOM   4519  N6    A A 165     239.343 246.291 148.170  1.00 93.90           N  
ATOM   4520  N1    A A 165     237.958 247.793 149.254  1.00104.69           N  
ATOM   4521  C2    A A 165     237.562 249.061 149.459  1.00110.62           C  
ATOM   4522  N3    A A 165     238.011 250.188 148.900  1.00110.99           N  
ATOM   4523  C4    A A 165     238.998 249.914 148.019  1.00116.47           C  
ATOM   4524  P     U A 166     243.275 253.973 149.876  1.00136.96           P  
ATOM   4525  OP1   U A 166     244.123 255.188 150.007  1.00138.34           O  
ATOM   4526  OP2   U A 166     243.904 252.700 149.425  1.00114.88           O1-
ATOM   4527  O5'   U A 166     242.566 253.732 151.287  1.00123.88           O  
ATOM   4528  C5'   U A 166     241.532 254.593 151.754  1.00118.08           C  
ATOM   4529  C4'   U A 166     240.476 253.824 152.517  1.00119.88           C  
ATOM   4530  O4'   U A 166     239.806 252.891 151.620  1.00117.35           O  
ATOM   4531  C3'   U A 166     240.982 252.940 153.652  1.00118.45           C  
ATOM   4532  O3'   U A 166     241.258 253.645 154.854  1.00113.03           O  
ATOM   4533  C2'   U A 166     239.873 251.899 153.772  1.00111.48           C  
ATOM   4534  O2'   U A 166     238.734 252.449 154.423  1.00108.27           O  
ATOM   4535  C1'   U A 166     239.526 251.682 152.300  1.00107.36           C  
ATOM   4536  N1    U A 166     240.342 250.595 151.701  1.00101.63           N  
ATOM   4537  C2    U A 166     239.928 249.314 151.951  1.00 97.95           C  
ATOM   4538  O2    U A 166     238.936 249.093 152.621  1.00 99.46           O  
ATOM   4539  N3    U A 166     240.698 248.316 151.393  1.00 98.09           N  
ATOM   4540  C4    U A 166     241.829 248.466 150.621  1.00 93.79           C  
ATOM   4541  O4    U A 166     242.414 247.474 150.188  1.00 89.95           O  
ATOM   4542  C5    U A 166     242.204 249.827 150.409  1.00103.29           C  
ATOM   4543  C6    U A 166     241.468 250.811 150.941  1.00106.56           C  
ATOM   4544  P     A A 167     242.462 253.176 155.821  1.00108.96           P  
ATOM   4545  OP1   A A 167     242.564 254.182 156.907  1.00106.18           O  
ATOM   4546  OP2   A A 167     243.676 252.879 155.014  1.00104.58           O1-
ATOM   4547  O5'   A A 167     241.946 251.800 156.446  1.00102.84           O  
ATOM   4548  C5'   A A 167     240.780 251.751 157.263  1.00 99.15           C  
ATOM   4549  C4'   A A 167     240.377 250.331 157.585  1.00 91.95           C  
ATOM   4550  O4'   A A 167     240.090 249.612 156.357  1.00 95.38           O  
ATOM   4551  C3'   A A 167     241.426 249.474 158.276  1.00 92.37           C  
ATOM   4552  O3'   A A 167     241.485 249.692 159.676  1.00 97.97           O  
ATOM   4553  C2'   A A 167     240.992 248.063 157.909  1.00 91.33           C  
ATOM   4554  O2'   A A 167     239.900 247.650 158.719  1.00 97.95           O  
ATOM   4555  C1'   A A 167     240.488 248.263 156.484  1.00 89.90           C  
ATOM   4556  N9    A A 167     241.552 248.005 155.507  1.00 86.78           N  
ATOM   4557  C8    A A 167     242.191 248.929 154.726  1.00 93.54           C  
ATOM   4558  N7    A A 167     243.108 248.405 153.956  1.00 95.83           N  
ATOM   4559  C5    A A 167     243.065 247.050 154.259  1.00 92.99           C  
ATOM   4560  C6    A A 167     243.796 245.951 153.774  1.00 94.61           C  
ATOM   4561  N6    A A 167     244.752 246.061 152.842  1.00 94.16           N  
ATOM   4562  N1    A A 167     243.501 244.729 154.287  1.00 90.67           N  
ATOM   4563  C2    A A 167     242.539 244.623 155.215  1.00 87.99           C  
ATOM   4564  N3    A A 167     241.789 245.588 155.746  1.00 88.14           N  
ATOM   4565  C4    A A 167     242.106 246.786 155.219  1.00 87.08           C  
ATOM   4566  P     G A 168     242.901 249.755 160.441  1.00107.25           P  
ATOM   4567  OP1   G A 168     242.612 249.744 161.899  1.00105.69           O  
ATOM   4568  OP2   G A 168     243.699 250.869 159.872  1.00100.68           O1-
ATOM   4569  O5'   G A 168     243.632 248.392 160.050  1.00 92.78           O  
ATOM   4570  C5'   G A 168     243.177 247.143 160.547  1.00 86.92           C  
ATOM   4571  C4'   G A 168     243.773 245.998 159.772  1.00 87.82           C  
ATOM   4572  O4'   G A 168     243.614 246.230 158.347  1.00 90.86           O  
ATOM   4573  C3'   G A 168     245.268 245.791 159.934  1.00 91.26           C  
ATOM   4574  O3'   G A 168     245.616 245.124 161.133  1.00 90.59           O  
ATOM   4575  C2'   G A 168     245.633 245.021 158.670  1.00 92.77           C  
ATOM   4576  O2'   G A 168     245.261 243.654 158.775  1.00 89.29           O  
ATOM   4577  C1'   G A 168     244.719 245.692 157.646  1.00 91.63           C  
ATOM   4578  N9    G A 168     245.410 246.786 156.942  1.00 89.53           N  
ATOM   4579  C8    G A 168     245.080 248.119 156.954  1.00 87.94           C  
ATOM   4580  N7    G A 168     245.889 248.846 156.238  1.00 89.27           N  
ATOM   4581  C5    G A 168     246.801 247.931 155.725  1.00 94.89           C  
ATOM   4582  C6    G A 168     247.911 248.135 154.872  1.00101.60           C  
ATOM   4583  O6    G A 168     248.295 249.215 154.405  1.00100.10           O  
ATOM   4584  N1    G A 168     248.582 246.936 154.588  1.00 99.58           N  
ATOM   4585  C2    G A 168     248.219 245.695 155.070  1.00 93.40           C  
ATOM   4586  N2    G A 168     248.980 244.659 154.690  1.00 89.44           N  
ATOM   4587  N3    G A 168     247.181 245.496 155.868  1.00 90.57           N  
ATOM   4588  C4    G A 168     246.524 246.649 156.147  1.00 92.41           C  
ATOM   4589  P     G A 169     246.902 245.599 161.970  1.00 93.68           P  
ATOM   4590  OP1   G A 169     246.960 244.734 163.173  1.00 95.15           O  
ATOM   4591  OP2   G A 169     246.839 247.076 162.126  1.00 88.30           O1-
ATOM   4592  O5'   G A 169     248.146 245.213 161.044  1.00 94.42           O  
ATOM   4593  C5'   G A 169     248.462 243.849 160.799  1.00 93.22           C  
ATOM   4594  C4'   G A 169     249.600 243.671 159.821  1.00 92.47           C  
ATOM   4595  O4'   G A 169     249.255 244.209 158.514  1.00 88.59           O  
ATOM   4596  C3'   G A 169     250.914 244.358 160.150  1.00 95.82           C  
ATOM   4597  O3'   G A 169     251.659 243.710 161.168  1.00 99.37           O  
ATOM   4598  C2'   G A 169     251.604 244.360 158.797  1.00 95.14           C  
ATOM   4599  O2'   G A 169     252.080 243.057 158.493  1.00 95.50           O  
ATOM   4600  C1'   G A 169     250.428 244.669 157.872  1.00 87.94           C  
ATOM   4601  N9    G A 169     250.305 246.119 157.626  1.00 91.47           N  
ATOM   4602  C8    G A 169     249.263 246.933 157.994  1.00 93.75           C  
ATOM   4603  N7    G A 169     249.435 248.185 157.647  1.00 95.64           N  
ATOM   4604  C5    G A 169     250.670 248.205 157.012  1.00 99.91           C  
ATOM   4605  C6    G A 169     251.383 249.287 156.421  1.00100.46           C  
ATOM   4606  O6    G A 169     251.045 250.476 156.344  1.00 99.05           O  
ATOM   4607  N1    G A 169     252.601 248.871 155.879  1.00102.98           N  
ATOM   4608  C2    G A 169     253.074 247.575 155.909  1.00103.51           C  
ATOM   4609  N2    G A 169     254.270 247.363 155.333  1.00 99.17           N  
ATOM   4610  N3    G A 169     252.413 246.560 156.457  1.00102.42           N  
ATOM   4611  C4    G A 169     251.223 246.936 156.990  1.00 99.54           C  
ATOM   4612  P     U A 170     252.680 244.547 162.098  1.00113.03           P  
ATOM   4613  OP1   U A 170     253.182 243.629 163.151  1.00107.62           O  
ATOM   4614  OP2   U A 170     252.032 245.824 162.504  1.00 99.68           O1-
ATOM   4615  O5'   U A 170     253.908 244.890 161.134  1.00108.24           O  
ATOM   4616  C5'   U A 170     254.779 243.868 160.655  1.00108.18           C  
ATOM   4617  C4'   U A 170     255.848 244.403 159.722  1.00108.50           C  
ATOM   4618  O4'   U A 170     255.244 245.066 158.575  1.00101.72           O  
ATOM   4619  C3'   U A 170     256.801 245.453 160.286  1.00115.95           C  
ATOM   4620  O3'   U A 170     257.823 244.913 161.116  1.00119.74           O  
ATOM   4621  C2'   U A 170     257.324 246.124 159.018  1.00112.13           C  
ATOM   4622  O2'   U A 170     258.301 245.313 158.382  1.00114.32           O  
ATOM   4623  C1'   U A 170     256.067 246.136 158.147  1.00101.54           C  
ATOM   4624  N1    U A 170     255.319 247.404 158.307  1.00 98.70           N  
ATOM   4625  C2    U A 170     255.765 248.507 157.605  1.00 97.12           C  
ATOM   4626  O2    U A 170     256.722 248.479 156.854  1.00 96.52           O  
ATOM   4627  N3    U A 170     255.030 249.644 157.805  1.00 95.94           N  
ATOM   4628  C4    U A 170     253.932 249.783 158.628  1.00 90.76           C  
ATOM   4629  O4    U A 170     253.375 250.869 158.713  1.00 94.06           O  
ATOM   4630  C5    U A 170     253.539 248.610 159.327  1.00 90.65           C  
ATOM   4631  C6    U A 170     254.232 247.488 159.145  1.00 96.29           C  
ATOM   4632  P     U A 171     258.473 245.790 162.307  1.00125.79           P  
ATOM   4633  OP1   U A 171     259.395 244.912 163.076  1.00119.12           O  
ATOM   4634  OP2   U A 171     257.384 246.498 163.029  1.00117.40           O1-
ATOM   4635  O5'   U A 171     259.352 246.885 161.550  1.00116.19           O  
ATOM   4636  C5'   U A 171     260.501 246.519 160.799  1.00114.24           C  
ATOM   4637  C4'   U A 171     260.999 247.667 159.956  1.00115.19           C  
ATOM   4638  O4'   U A 171     259.977 248.050 158.989  1.00111.91           O  
ATOM   4639  C3'   U A 171     261.288 248.973 160.687  1.00123.51           C  
ATOM   4640  O3'   U A 171     262.494 248.994 161.441  1.00121.16           O  
ATOM   4641  C2'   U A 171     261.238 249.982 159.549  1.00119.27           C  
ATOM   4642  O2'   U A 171     262.401 249.879 158.739  1.00114.71           O  
ATOM   4643  C1'   U A 171     260.042 249.449 158.756  1.00115.56           C  
ATOM   4644  N1    U A 171     258.775 250.095 159.197  1.00107.60           N  
ATOM   4645  C2    U A 171     258.553 251.410 158.798  1.00107.04           C  
ATOM   4646  O2    U A 171     259.330 252.038 158.095  1.00107.83           O  
ATOM   4647  N3    U A 171     257.387 251.983 159.241  1.00102.89           N  
ATOM   4648  C4    U A 171     256.429 251.398 160.034  1.00100.29           C  
ATOM   4649  O4    U A 171     255.434 252.054 160.342  1.00 94.54           O  
ATOM   4650  C5    U A 171     256.723 250.047 160.419  1.00104.92           C  
ATOM   4651  C6    U A 171     257.853 249.457 160.002  1.00104.11           C  
ATOM   4652  P     A A 172     262.593 249.896 162.781  1.00126.93           P  
ATOM   4653  OP1   A A 172     263.930 249.658 163.383  1.00121.39           O  
ATOM   4654  OP2   A A 172     261.388 249.665 163.624  1.00118.35           O1-
ATOM   4655  O5'   A A 172     262.540 251.400 162.243  1.00112.72           O  
ATOM   4656  C5'   A A 172     263.533 251.891 161.353  1.00108.92           C  
ATOM   4657  C4'   A A 172     263.208 253.275 160.852  1.00106.19           C  
ATOM   4658  O4'   A A 172     261.938 253.269 160.155  1.00102.61           O  
ATOM   4659  C3'   A A 172     263.040 254.352 161.915  1.00110.47           C  
ATOM   4660  O3'   A A 172     264.285 254.857 162.387  1.00114.19           O  
ATOM   4661  C2'   A A 172     262.181 255.397 161.204  1.00108.36           C  
ATOM   4662  O2'   A A 172     262.971 256.253 160.391  1.00109.14           O  
ATOM   4663  C1'   A A 172     261.307 254.524 160.298  1.00103.80           C  
ATOM   4664  N9    A A 172     259.958 254.333 160.854  1.00101.98           N  
ATOM   4665  C8    A A 172     259.381 253.198 161.371  1.00100.72           C  
ATOM   4666  N7    A A 172     258.148 253.390 161.780  1.00100.16           N  
ATOM   4667  C5    A A 172     257.904 254.736 161.521  1.00100.31           C  
ATOM   4668  C6    A A 172     256.783 255.564 161.729  1.00 95.28           C  
ATOM   4669  N6    A A 172     255.641 255.142 162.266  1.00 95.85           N  
ATOM   4670  N1    A A 172     256.870 256.861 161.358  1.00 96.91           N  
ATOM   4671  C2    A A 172     258.021 257.293 160.814  1.00100.17           C  
ATOM   4672  N3    A A 172     259.144 256.618 160.565  1.00 98.73           N  
ATOM   4673  C4    A A 172     259.015 255.330 160.948  1.00102.53           C  
ATOM   4674  P     A A 173     264.473 255.314 163.922  1.00113.69           P  
ATOM   4675  OP1   A A 173     265.929 255.435 164.200  1.00108.16           O  
ATOM   4676  OP2   A A 173     263.645 254.425 164.775  1.00109.56           O1-
ATOM   4677  O5'   A A 173     263.840 256.775 163.968  1.00108.18           O  
ATOM   4678  C5'   A A 173     264.298 257.792 163.090  1.00105.60           C  
ATOM   4679  C4'   A A 173     263.354 258.968 163.066  1.00107.62           C  
ATOM   4680  O4'   A A 173     262.104 258.588 162.430  1.00102.32           O  
ATOM   4681  C3'   A A 173     262.928 259.513 164.421  1.00110.50           C  
ATOM   4682  O3'   A A 173     263.901 260.358 165.015  1.00111.31           O  
ATOM   4683  C2'   A A 173     261.617 260.218 164.093  1.00107.18           C  
ATOM   4684  O2'   A A 173     261.865 261.483 163.494  1.00103.62           O  
ATOM   4685  C1'   A A 173     261.031 259.286 163.029  1.00103.43           C  
ATOM   4686  N9    A A 173     260.085 258.305 163.600  1.00101.75           N  
ATOM   4687  C8    A A 173     260.291 256.965 163.819  1.00100.31           C  
ATOM   4688  N7    A A 173     259.255 256.347 164.336  1.00 98.18           N  
ATOM   4689  C5    A A 173     258.298 257.344 164.467  1.00 97.15           C  
ATOM   4690  C6    A A 173     256.976 257.339 164.950  1.00 93.90           C  
ATOM   4691  N6    A A 173     256.367 256.250 165.414  1.00 95.48           N  
ATOM   4692  N1    A A 173     256.286 258.499 164.948  1.00 92.77           N  
ATOM   4693  C2    A A 173     256.896 259.594 164.485  1.00 98.86           C  
ATOM   4694  N3    A A 173     258.133 259.729 164.001  1.00102.07           N  
ATOM   4695  C4    A A 173     258.794 258.555 164.017  1.00101.45           C  
ATOM   4696  P     U A 174     264.067 260.420 166.615  1.00106.99           P  
ATOM   4697  OP1   U A 174     265.294 261.205 166.906  1.00106.80           O  
ATOM   4698  OP2   U A 174     263.961 259.038 167.144  1.00113.66           O1-
ATOM   4699  O5'   U A 174     262.794 261.251 167.108  1.00100.96           O  
ATOM   4700  C5'   U A 174     262.647 262.627 166.780  1.00103.95           C  
ATOM   4701  C4'   U A 174     261.283 263.171 167.145  1.00105.27           C  
ATOM   4702  O4'   U A 174     260.248 262.528 166.344  1.00105.97           O  
ATOM   4703  C3'   U A 174     260.803 262.944 168.571  1.00107.39           C  
ATOM   4704  O3'   U A 174     261.410 263.767 169.553  1.00109.03           O  
ATOM   4705  C2'   U A 174     259.306 263.152 168.424  1.00103.61           C  
ATOM   4706  O2'   U A 174     259.023 264.529 168.217  1.00 96.86           O  
ATOM   4707  C1'   U A 174     259.058 262.414 167.109  1.00105.28           C  
ATOM   4708  N1    U A 174     258.772 260.972 167.346  1.00103.18           N  
ATOM   4709  C2    U A 174     257.514 260.598 167.808  1.00 96.18           C  
ATOM   4710  O2    U A 174     256.610 261.388 168.027  1.00 92.20           O  
ATOM   4711  N3    U A 174     257.347 259.244 168.009  1.00 96.02           N  
ATOM   4712  C4    U A 174     258.279 258.239 167.808  1.00 97.10           C  
ATOM   4713  O4    U A 174     257.983 257.064 168.033  1.00 96.19           O  
ATOM   4714  C5    U A 174     259.547 258.695 167.338  1.00100.55           C  
ATOM   4715  C6    U A 174     259.736 260.005 167.132  1.00104.69           C  
ATOM   4716  P     G A 175     261.600 263.197 171.048  1.00112.68           P  
ATOM   4717  OP1   G A 175     262.295 264.245 171.844  1.00106.21           O  
ATOM   4718  OP2   G A 175     262.222 261.849 170.939  1.00104.88           O1-
ATOM   4719  O5'   G A 175     260.105 263.029 171.607  1.00105.43           O  
ATOM   4720  C5'   G A 175     259.425 264.113 172.241  1.00105.38           C  
ATOM   4721  C4'   G A 175     257.931 263.885 172.386  1.00101.12           C  
ATOM   4722  O4'   G A 175     257.426 263.083 171.285  1.00100.03           O  
ATOM   4723  C3'   G A 175     257.459 263.141 173.628  1.00 95.66           C  
ATOM   4724  O3'   G A 175     257.406 263.959 174.783  1.00 94.03           O  
ATOM   4725  C2'   G A 175     256.093 262.615 173.200  1.00 92.64           C  
ATOM   4726  O2'   G A 175     255.104 263.633 173.276  1.00 87.07           O  
ATOM   4727  C1'   G A 175     256.348 262.281 171.729  1.00 94.83           C  
ATOM   4728  N9    G A 175     256.720 260.866 171.554  1.00 92.30           N  
ATOM   4729  C8    G A 175     257.932 260.358 171.143  1.00 92.31           C  
ATOM   4730  N7    G A 175     257.940 259.052 171.096  1.00 91.61           N  
ATOM   4731  C5    G A 175     256.662 258.680 171.507  1.00 87.86           C  
ATOM   4732  C6    G A 175     256.073 257.398 171.661  1.00 80.45           C  
ATOM   4733  O6    G A 175     256.579 256.290 171.457  1.00 81.05           O  
ATOM   4734  N1    G A 175     254.754 257.484 172.099  1.00 79.64           N  
ATOM   4735  C2    G A 175     254.081 258.657 172.365  1.00 84.93           C  
ATOM   4736  N2    G A 175     252.806 258.546 172.775  1.00 83.86           N  
ATOM   4737  N3    G A 175     254.616 259.859 172.223  1.00 88.35           N  
ATOM   4738  C4    G A 175     255.899 259.792 171.795  1.00 90.45           C  
ATOM   4739  P     A A 176     257.884 263.374 176.204  1.00 97.89           P  
ATOM   4740  OP1   A A 176     258.106 264.508 177.136  1.00 90.22           O  
ATOM   4741  OP2   A A 176     258.983 262.406 175.937  1.00 91.42           O1-
ATOM   4742  O5'   A A 176     256.627 262.554 176.741  1.00 92.70           O  
ATOM   4743  C5'   A A 176     255.367 263.174 176.972  1.00 91.03           C  
ATOM   4744  C4'   A A 176     254.271 262.138 177.064  1.00 88.83           C  
ATOM   4745  O4'   A A 176     254.310 261.299 175.880  1.00 88.61           O  
ATOM   4746  C3'   A A 176     254.380 261.162 178.232  1.00 81.50           C  
ATOM   4747  O3'   A A 176     253.782 261.682 179.415  1.00 79.17           O  
ATOM   4748  C2'   A A 176     253.689 259.902 177.708  1.00 79.39           C  
ATOM   4749  O2'   A A 176     252.282 259.989 177.878  1.00 79.00           O  
ATOM   4750  C1'   A A 176     253.986 259.966 176.212  1.00 82.99           C  
ATOM   4751  N9    A A 176     255.083 259.076 175.780  1.00 75.69           N  
ATOM   4752  C8    A A 176     256.382 259.410 175.512  1.00 78.09           C  
ATOM   4753  N7    A A 176     257.118 258.407 175.110  1.00 76.14           N  
ATOM   4754  C5    A A 176     256.236 257.339 175.099  1.00 72.40           C  
ATOM   4755  C6    A A 176     256.396 255.981 174.769  1.00 76.13           C  
ATOM   4756  N6    A A 176     257.556 255.455 174.369  1.00 76.28           N  
ATOM   4757  N1    A A 176     255.326 255.163 174.872  1.00 75.39           N  
ATOM   4758  C2    A A 176     254.171 255.698 175.280  1.00 77.59           C  
ATOM   4759  N3    A A 176     253.898 256.960 175.616  1.00 75.76           N  
ATOM   4760  C4    A A 176     254.986 257.737 175.508  1.00 72.46           C  
ATOM   4761  P     G A 177     254.336 261.294 180.879  1.00 78.62           P  
ATOM   4762  OP1   G A 177     253.570 262.062 181.896  1.00 69.20           O  
ATOM   4763  OP2   G A 177     255.815 261.435 180.848  1.00 70.03           O1-
ATOM   4764  O5'   G A 177     253.965 259.745 181.052  1.00 76.26           O  
ATOM   4765  C5'   G A 177     252.621 259.281 180.910  1.00 78.43           C  
ATOM   4766  C4'   G A 177     252.481 257.769 180.973  1.00 74.12           C  
ATOM   4767  O4'   G A 177     253.054 257.120 179.793  1.00 75.29           O  
ATOM   4768  C3'   G A 177     253.106 257.078 182.190  1.00 72.68           C  
ATOM   4769  O3'   G A 177     252.212 256.086 182.679  1.00 77.06           O  
ATOM   4770  C2'   G A 177     254.327 256.380 181.600  1.00 74.68           C  
ATOM   4771  O2'   G A 177     254.784 255.254 182.324  1.00 71.42           O  
ATOM   4772  C1'   G A 177     253.815 256.006 180.216  1.00 73.69           C  
ATOM   4773  N9    G A 177     254.893 255.703 179.271  1.00 71.26           N  
ATOM   4774  C8    G A 177     255.104 254.485 178.670  1.00 65.93           C  
ATOM   4775  N7    G A 177     256.169 254.468 177.919  1.00 69.29           N  
ATOM   4776  C5    G A 177     256.705 255.747 178.058  1.00 73.43           C  
ATOM   4777  C6    G A 177     257.870 256.329 177.493  1.00 71.67           C  
ATOM   4778  O6    G A 177     258.682 255.817 176.713  1.00 70.61           O  
ATOM   4779  N1    G A 177     258.046 257.648 177.886  1.00 64.94           N  
ATOM   4780  C2    G A 177     257.216 258.323 178.728  1.00 63.05           C  
ATOM   4781  N2    G A 177     257.557 259.588 178.989  1.00 66.03           N  
ATOM   4782  N3    G A 177     256.136 257.801 179.272  1.00 69.46           N  
ATOM   4783  C4    G A 177     255.938 256.519 178.898  1.00 72.31           C  
ATOM   4784  P     G A 178     251.436 256.347 184.055  1.00 89.65           P  
ATOM   4785  OP1   G A 178     250.365 255.324 184.204  1.00 82.68           O  
ATOM   4786  OP2   G A 178     251.100 257.793 184.070  1.00 81.77           O1-
ATOM   4787  O5'   G A 178     252.546 256.125 185.180  1.00 74.55           O  
ATOM   4788  C5'   G A 178     252.902 254.824 185.621  1.00 68.07           C  
ATOM   4789  C4'   G A 178     254.175 254.855 186.418  1.00 54.99           C  
ATOM   4790  O4'   G A 178     255.208 255.502 185.632  1.00 57.33           O  
ATOM   4791  C3'   G A 178     254.135 255.683 187.691  1.00 59.63           C  
ATOM   4792  O3'   G A 178     253.522 255.033 188.788  1.00 65.66           O  
ATOM   4793  C2'   G A 178     255.600 255.989 187.909  1.00 61.21           C  
ATOM   4794  O2'   G A 178     256.276 254.825 188.358  1.00 59.17           O  
ATOM   4795  C1'   G A 178     256.043 256.264 186.480  1.00 62.62           C  
ATOM   4796  N9    G A 178     255.918 257.696 186.128  1.00 66.22           N  
ATOM   4797  C8    G A 178     254.925 258.277 185.373  1.00 67.55           C  
ATOM   4798  N7    G A 178     255.071 259.566 185.218  1.00 66.73           N  
ATOM   4799  C5    G A 178     256.237 259.856 185.914  1.00 63.05           C  
ATOM   4800  C6    G A 178     256.899 261.090 186.105  1.00 62.58           C  
ATOM   4801  O6    G A 178     256.578 262.199 185.681  1.00 67.16           O  
ATOM   4802  N1    G A 178     258.045 260.972 186.869  1.00 58.53           N  
ATOM   4803  C2    G A 178     258.494 259.797 187.392  1.00 57.66           C  
ATOM   4804  N2    G A 178     259.619 259.877 188.108  1.00 62.27           N  
ATOM   4805  N3    G A 178     257.894 258.631 187.230  1.00 59.09           N  
ATOM   4806  C4    G A 178     256.773 258.726 186.486  1.00 62.09           C  
ATOM   4807  P     C A 179     252.826 255.911 189.945  1.00 69.05           P  
ATOM   4808  OP1   C A 179     252.315 254.965 190.965  1.00 69.90           O  
ATOM   4809  OP2   C A 179     251.879 256.862 189.306  1.00 66.89           O1-
ATOM   4810  O5'   C A 179     254.026 256.728 190.614  1.00 61.10           O  
ATOM   4811  C5'   C A 179     254.978 256.062 191.430  1.00 60.99           C  
ATOM   4812  C4'   C A 179     256.140 256.943 191.824  1.00 61.08           C  
ATOM   4813  O4'   C A 179     256.724 257.589 190.664  1.00 64.93           O  
ATOM   4814  C3'   C A 179     255.817 258.091 192.749  1.00 59.50           C  
ATOM   4815  O3'   C A 179     255.678 257.677 194.081  1.00 62.25           O  
ATOM   4816  C2'   C A 179     256.982 259.035 192.525  1.00 60.93           C  
ATOM   4817  O2'   C A 179     258.136 258.586 193.220  1.00 58.63           O  
ATOM   4818  C1'   C A 179     257.211 258.865 191.024  1.00 61.94           C  
ATOM   4819  N1    C A 179     256.464 259.869 190.237  1.00 61.59           N  
ATOM   4820  C2    C A 179     256.798 261.222 190.301  1.00 65.18           C  
ATOM   4821  O2    C A 179     257.727 261.594 191.028  1.00 70.58           O  
ATOM   4822  N3    C A 179     256.102 262.116 189.570  1.00 64.93           N  
ATOM   4823  C4    C A 179     255.105 261.696 188.793  1.00 65.51           C  
ATOM   4824  N4    C A 179     254.436 262.609 188.087  1.00 71.24           N  
ATOM   4825  C5    C A 179     254.742 260.327 188.704  1.00 63.75           C  
ATOM   4826  C6    C A 179     255.443 259.458 189.435  1.00 62.08           C  
ATOM   4827  P     G A 180     254.371 258.134 194.866  1.00 84.16           P  
ATOM   4828  OP1   G A 180     254.236 257.233 196.036  1.00 80.51           O  
ATOM   4829  OP2   G A 180     253.274 258.242 193.868  1.00 71.14           O1-
ATOM   4830  O5'   G A 180     254.739 259.602 195.370  1.00 84.02           O  
ATOM   4831  C5'   G A 180     255.977 259.846 196.024  1.00 82.96           C  
ATOM   4832  C4'   G A 180     256.342 261.310 196.019  1.00 82.59           C  
ATOM   4833  O4'   G A 180     256.599 261.756 194.665  1.00 79.80           O  
ATOM   4834  C3'   G A 180     255.278 262.263 196.530  1.00 81.53           C  
ATOM   4835  O3'   G A 180     255.273 262.345 197.936  1.00 86.05           O  
ATOM   4836  C2'   G A 180     255.641 263.573 195.850  1.00 81.92           C  
ATOM   4837  O2'   G A 180     256.722 264.205 196.524  1.00 84.79           O  
ATOM   4838  C1'   G A 180     256.133 263.076 194.493  1.00 74.08           C  
ATOM   4839  N9    G A 180     255.053 263.031 193.498  1.00 69.83           N  
ATOM   4840  C8    G A 180     254.261 261.940 193.230  1.00 72.35           C  
ATOM   4841  N7    G A 180     253.384 262.173 192.296  1.00 75.00           N  
ATOM   4842  C5    G A 180     253.613 263.494 191.927  1.00 76.96           C  
ATOM   4843  C6    G A 180     252.958 264.297 190.955  1.00 76.63           C  
ATOM   4844  O6    G A 180     252.018 263.984 190.205  1.00 71.10           O  
ATOM   4845  N1    G A 180     253.511 265.578 190.913  1.00 74.35           N  
ATOM   4846  C2    G A 180     254.550 266.024 191.699  1.00 69.56           C  
ATOM   4847  N2    G A 180     254.936 267.289 191.497  1.00 67.39           N  
ATOM   4848  N3    G A 180     255.170 265.286 192.606  1.00 68.23           N  
ATOM   4849  C4    G A 180     254.648 264.041 192.664  1.00 71.57           C  
ATOM   4850  P     A A 181     253.910 262.072 198.721  1.00100.81           P  
ATOM   4851  OP1   A A 181     254.243 261.711 200.125  1.00 95.13           O  
ATOM   4852  OP2   A A 181     253.097 261.161 197.872  1.00 92.70           O1-
ATOM   4853  O5'   A A 181     253.184 263.487 198.711  1.00 95.96           O  
ATOM   4854  C5'   A A 181     252.209 263.803 199.689  1.00 96.39           C  
ATOM   4855  C4'   A A 181     252.717 264.855 200.641  1.00 96.25           C  
ATOM   4856  O4'   A A 181     254.079 265.217 200.295  1.00 91.93           O  
ATOM   4857  C3'   A A 181     251.967 266.176 200.625  1.00 90.35           C  
ATOM   4858  O3'   A A 181     250.774 266.134 201.387  1.00 93.71           O  
ATOM   4859  C2'   A A 181     253.001 267.147 201.171  1.00 87.72           C  
ATOM   4860  O2'   A A 181     253.087 267.029 202.585  1.00 84.60           O  
ATOM   4861  C1'   A A 181     254.291 266.587 200.560  1.00 92.27           C  
ATOM   4862  N9    A A 181     254.715 267.259 199.305  1.00 87.05           N  
ATOM   4863  C8    A A 181     255.320 266.648 198.231  1.00 79.10           C  
ATOM   4864  N7    A A 181     255.624 267.464 197.252  1.00 79.03           N  
ATOM   4865  C5    A A 181     255.209 268.711 197.702  1.00 80.80           C  
ATOM   4866  C6    A A 181     255.247 270.002 197.128  1.00 77.30           C  
ATOM   4867  N6    A A 181     255.746 270.273 195.922  1.00 80.04           N  
ATOM   4868  N1    A A 181     254.753 271.042 197.829  1.00 74.13           N  
ATOM   4869  C2    A A 181     254.255 270.796 199.038  1.00 77.97           C  
ATOM   4870  N3    A A 181     254.159 269.636 199.681  1.00 87.81           N  
ATOM   4871  C4    A A 181     254.657 268.606 198.964  1.00 87.11           C  
ATOM   4872  P     A A 182     249.355 265.916 200.659  1.00108.96           P  
ATOM   4873  OP1   A A 182     248.537 265.020 201.520  1.00100.58           O  
ATOM   4874  OP2   A A 182     249.596 265.539 199.241  1.00 97.57           O1-
ATOM   4875  O5'   A A 182     248.693 267.367 200.670  1.00 96.45           O  
ATOM   4876  C5'   A A 182     248.488 268.069 201.889  1.00 96.03           C  
ATOM   4877  C4'   A A 182     248.823 269.529 201.744  1.00 80.44           C  
ATOM   4878  O4'   A A 182     250.216 269.668 201.349  1.00 76.67           O  
ATOM   4879  C3'   A A 182     248.058 270.277 200.663  1.00 78.58           C  
ATOM   4880  O3'   A A 182     246.740 270.660 201.056  1.00 77.33           O  
ATOM   4881  C2'   A A 182     248.995 271.440 200.360  1.00 78.48           C  
ATOM   4882  O2'   A A 182     248.930 272.418 201.384  1.00 80.49           O  
ATOM   4883  C1'   A A 182     250.357 270.756 200.461  1.00 74.86           C  
ATOM   4884  N9    A A 182     250.805 270.259 199.148  1.00 73.52           N  
ATOM   4885  C8    A A 182     250.818 268.979 198.668  1.00 78.11           C  
ATOM   4886  N7    A A 182     251.272 268.872 197.443  1.00 75.10           N  
ATOM   4887  C5    A A 182     251.570 270.176 197.097  1.00 65.65           C  
ATOM   4888  C6    A A 182     252.091 270.744 195.932  1.00 64.73           C  
ATOM   4889  N6    A A 182     252.414 270.044 194.849  1.00 68.39           N  
ATOM   4890  N1    A A 182     252.269 272.078 195.910  1.00 68.34           N  
ATOM   4891  C2    A A 182     251.943 272.774 197.006  1.00 69.24           C  
ATOM   4892  N3    A A 182     251.446 272.359 198.161  1.00 66.12           N  
ATOM   4893  C4    A A 182     251.280 271.036 198.132  1.00 65.02           C  
ATOM   4894  P     C A 183     245.505 270.646 200.008  1.00 73.73           P  
ATOM   4895  OP1   C A 183     244.249 270.886 200.760  1.00 67.55           O  
ATOM   4896  OP2   C A 183     245.600 269.443 199.141  1.00 70.42           O1-
ATOM   4897  O5'   C A 183     245.740 271.946 199.109  1.00 77.98           O  
ATOM   4898  C5'   C A 183     245.721 273.252 199.682  1.00 75.58           C  
ATOM   4899  C4'   C A 183     246.436 274.256 198.810  1.00 66.18           C  
ATOM   4900  O4'   C A 183     247.770 273.776 198.506  1.00 67.19           O  
ATOM   4901  C3'   C A 183     245.814 274.499 197.448  1.00 57.35           C  
ATOM   4902  O3'   C A 183     244.742 275.409 197.507  1.00 58.57           O  
ATOM   4903  C2'   C A 183     246.989 274.990 196.626  1.00 60.70           C  
ATOM   4904  O2'   C A 183     247.254 276.356 196.902  1.00 63.40           O  
ATOM   4905  C1'   C A 183     248.130 274.153 197.197  1.00 61.78           C  
ATOM   4906  N1    C A 183     248.384 272.934 196.397  1.00 61.85           N  
ATOM   4907  C2    C A 183     249.216 273.062 195.289  1.00 69.89           C  
ATOM   4908  O2    C A 183     249.692 274.177 195.047  1.00 73.21           O  
ATOM   4909  N3    C A 183     249.496 271.999 194.510  1.00 67.96           N  
ATOM   4910  C4    C A 183     248.964 270.827 194.816  1.00 67.68           C  
ATOM   4911  N4    C A 183     249.268 269.805 194.018  1.00 72.24           N  
ATOM   4912  C5    C A 183     248.107 270.656 195.941  1.00 64.44           C  
ATOM   4913  C6    C A 183     247.842 271.724 196.700  1.00 60.45           C  
ATOM   4914  P     C A 184     243.269 274.884 197.181  1.00 62.65           P  
ATOM   4915  OP1   C A 184     242.261 275.815 197.746  1.00 65.48           O  
ATOM   4916  OP2   C A 184     243.223 273.449 197.549  1.00 69.91           O1-
ATOM   4917  O5'   C A 184     243.196 274.993 195.602  1.00 60.07           O  
ATOM   4918  C5'   C A 184     243.623 276.177 194.955  1.00 57.36           C  
ATOM   4919  C4'   C A 184     243.686 275.974 193.471  1.00 61.57           C  
ATOM   4920  O4'   C A 184     244.780 275.084 193.158  1.00 68.34           O  
ATOM   4921  C3'   C A 184     242.473 275.301 192.858  1.00 62.16           C  
ATOM   4922  O3'   C A 184     241.429 276.218 192.606  1.00 64.08           O  
ATOM   4923  C2'   C A 184     243.035 274.657 191.597  1.00 63.79           C  
ATOM   4924  O2'   C A 184     243.107 275.594 190.533  1.00 64.84           O  
ATOM   4925  C1'   C A 184     244.459 274.302 192.031  1.00 66.55           C  
ATOM   4926  N1    C A 184     244.607 272.879 192.386  1.00 63.91           N  
ATOM   4927  C2    C A 184     244.777 271.978 191.339  1.00 65.29           C  
ATOM   4928  O2    C A 184     244.790 272.409 190.176  1.00 65.60           O  
ATOM   4929  N3    C A 184     244.916 270.665 191.615  1.00 68.84           N  
ATOM   4930  C4    C A 184     244.897 270.256 192.882  1.00 72.43           C  
ATOM   4931  N4    C A 184     245.043 268.946 193.109  1.00 72.85           N  
ATOM   4932  C5    C A 184     244.728 271.170 193.970  1.00 69.87           C  
ATOM   4933  C6    C A 184     244.590 272.468 193.685  1.00 63.20           C  
ATOM   4934  P     G A 185     239.906 275.736 192.714  1.00 67.17           P  
ATOM   4935  OP1   G A 185     239.045 276.947 192.771  1.00 71.12           O  
ATOM   4936  OP2   G A 185     239.829 274.683 193.757  1.00 70.11           O1-
ATOM   4937  O5'   G A 185     239.634 275.040 191.317  1.00 64.64           O  
ATOM   4938  C5'   G A 185     239.799 275.779 190.125  1.00 70.72           C  
ATOM   4939  C4'   G A 185     239.809 274.875 188.927  1.00 70.35           C  
ATOM   4940  O4'   G A 185     240.983 274.024 188.948  1.00 66.75           O  
ATOM   4941  C3'   G A 185     238.660 273.896 188.848  1.00 65.76           C  
ATOM   4942  O3'   G A 185     237.464 274.491 188.386  1.00 67.55           O  
ATOM   4943  C2'   G A 185     239.212 272.827 187.921  1.00 67.56           C  
ATOM   4944  O2'   G A 185     239.179 273.279 186.576  1.00 68.58           O  
ATOM   4945  C1'   G A 185     240.673 272.775 188.367  1.00 66.16           C  
ATOM   4946  N9    G A 185     240.937 271.701 189.352  1.00 66.99           N  
ATOM   4947  C8    G A 185     241.116 271.843 190.709  1.00 68.24           C  
ATOM   4948  N7    G A 185     241.356 270.720 191.329  1.00 66.44           N  
ATOM   4949  C5    G A 185     241.338 269.776 190.318  1.00 62.03           C  
ATOM   4950  C6    G A 185     241.533 268.380 190.373  1.00 62.48           C  
ATOM   4951  O6    G A 185     241.766 267.680 191.362  1.00 67.60           O  
ATOM   4952  N1    G A 185     241.432 267.780 189.123  1.00 62.13           N  
ATOM   4953  C2    G A 185     241.176 268.441 187.953  1.00 62.78           C  
ATOM   4954  N2    G A 185     241.115 267.694 186.839  1.00 60.05           N  
ATOM   4955  N3    G A 185     240.992 269.748 187.890  1.00 67.05           N  
ATOM   4956  C4    G A 185     241.085 270.352 189.096  1.00 64.40           C  
ATOM   4957  P     G A 186     236.061 273.965 188.950  1.00 76.09           P  
ATOM   4958  OP1   G A 186     235.017 274.908 188.478  1.00 81.50           O  
ATOM   4959  OP2   G A 186     236.213 273.728 190.410  1.00 67.65           O1-
ATOM   4960  O5'   G A 186     235.848 272.571 188.196  1.00 71.48           O  
ATOM   4961  C5'   G A 186     235.774 272.520 186.777  1.00 65.92           C  
ATOM   4962  C4'   G A 186     236.050 271.139 186.238  1.00 63.52           C  
ATOM   4963  O4'   G A 186     237.363 270.685 186.659  1.00 66.55           O  
ATOM   4964  C3'   G A 186     235.131 270.027 186.705  1.00 68.81           C  
ATOM   4965  O3'   G A 186     233.863 270.020 186.073  1.00 78.70           O  
ATOM   4966  C2'   G A 186     235.965 268.784 186.416  1.00 68.58           C  
ATOM   4967  O2'   G A 186     235.959 268.473 185.032  1.00 69.74           O  
ATOM   4968  C1'   G A 186     237.359 269.274 186.791  1.00 65.88           C  
ATOM   4969  N9    G A 186     237.683 268.897 188.180  1.00 65.28           N  
ATOM   4970  C8    G A 186     237.855 269.691 189.288  1.00 66.70           C  
ATOM   4971  N7    G A 186     238.114 269.010 190.373  1.00 62.64           N  
ATOM   4972  C5    G A 186     238.100 267.688 189.954  1.00 60.96           C  
ATOM   4973  C6    G A 186     238.310 266.486 190.671  1.00 60.08           C  
ATOM   4974  O6    G A 186     238.562 266.347 191.871  1.00 62.81           O  
ATOM   4975  N1    G A 186     238.212 265.362 189.859  1.00 56.83           N  
ATOM   4976  C2    G A 186     237.937 265.395 188.519  1.00 57.19           C  
ATOM   4977  N2    G A 186     237.877 264.216 187.897  1.00 57.28           N  
ATOM   4978  N3    G A 186     237.738 266.502 187.832  1.00 61.70           N  
ATOM   4979  C4    G A 186     237.834 267.602 188.608  1.00 63.47           C  
ATOM   4980  P     G A 187     232.621 269.287 186.792  1.00 95.00           P  
ATOM   4981  OP1   G A 187     231.402 269.477 185.960  1.00 83.01           O  
ATOM   4982  OP2   G A 187     232.632 269.699 188.222  1.00 79.43           O1-
ATOM   4983  O5'   G A 187     232.990 267.737 186.735  1.00 78.69           O  
ATOM   4984  C5'   G A 187     232.839 266.986 185.537  1.00 73.80           C  
ATOM   4985  C4'   G A 187     232.888 265.499 185.802  1.00 70.53           C  
ATOM   4986  O4'   G A 187     234.191 265.133 186.335  1.00 64.98           O  
ATOM   4987  C3'   G A 187     231.922 264.966 186.848  1.00 64.34           C  
ATOM   4988  O3'   G A 187     230.592 264.819 186.399  1.00 65.56           O  
ATOM   4989  C2'   G A 187     232.575 263.662 187.248  1.00 56.93           C  
ATOM   4990  O2'   G A 187     232.397 262.702 186.216  1.00 56.57           O  
ATOM   4991  C1'   G A 187     234.041 264.085 187.275  1.00 59.75           C  
ATOM   4992  N9    G A 187     234.428 264.592 188.609  1.00 55.84           N  
ATOM   4993  C8    G A 187     234.458 265.895 189.044  1.00 59.52           C  
ATOM   4994  N7    G A 187     234.837 266.014 190.285  1.00 59.90           N  
ATOM   4995  C5    G A 187     235.072 264.707 190.697  1.00 54.96           C  
ATOM   4996  C6    G A 187     235.509 264.189 191.947  1.00 56.21           C  
ATOM   4997  O6    G A 187     235.789 264.788 192.992  1.00 58.59           O  
ATOM   4998  N1    G A 187     235.613 262.807 191.928  1.00 54.28           N  
ATOM   4999  C2    G A 187     235.331 262.022 190.845  1.00 53.68           C  
ATOM   5000  N2    G A 187     235.496 260.704 191.026  1.00 56.06           N  
ATOM   5001  N3    G A 187     234.925 262.486 189.677  1.00 52.16           N  
ATOM   5002  C4    G A 187     234.818 263.825 189.675  1.00 50.84           C  
ATOM   5003  P     G A 188     229.426 264.714 187.496  1.00 72.52           P  
ATOM   5004  OP1   G A 188     228.102 264.766 186.827  1.00 70.06           O  
ATOM   5005  OP2   G A 188     229.715 265.691 188.580  1.00 67.90           O1-
ATOM   5006  O5'   G A 188     229.620 263.253 188.089  1.00 58.65           O  
ATOM   5007  C5'   G A 188     228.967 262.872 189.280  1.00 57.24           C  
ATOM   5008  C4'   G A 188     229.638 261.694 189.918  1.00 51.66           C  
ATOM   5009  O4'   G A 188     231.067 261.936 190.010  1.00 55.77           O  
ATOM   5010  C3'   G A 188     229.235 261.427 191.353  1.00 62.42           C  
ATOM   5011  O3'   G A 188     227.980 260.782 191.490  1.00 67.29           O  
ATOM   5012  C2'   G A 188     230.417 260.625 191.863  1.00 64.37           C  
ATOM   5013  O2'   G A 188     230.403 259.317 191.313  1.00 66.30           O  
ATOM   5014  C1'   G A 188     231.561 261.394 191.219  1.00 58.27           C  
ATOM   5015  N9    G A 188     231.997 262.498 192.092  1.00 55.47           N  
ATOM   5016  C8    G A 188     231.863 263.845 191.875  1.00 55.95           C  
ATOM   5017  N7    G A 188     232.340 264.571 192.847  1.00 54.94           N  
ATOM   5018  C5    G A 188     232.811 263.645 193.767  1.00 53.77           C  
ATOM   5019  C6    G A 188     233.446 263.825 195.022  1.00 53.92           C  
ATOM   5020  O6    G A 188     233.727 264.872 195.609  1.00 58.91           O  
ATOM   5021  N1    G A 188     233.764 262.622 195.624  1.00 53.40           N  
ATOM   5022  C2    G A 188     233.508 261.391 195.087  1.00 54.72           C  
ATOM   5023  N2    G A 188     233.896 260.341 195.825  1.00 57.88           N  
ATOM   5024  N3    G A 188     232.919 261.202 193.919  1.00 52.26           N  
ATOM   5025  C4    G A 188     232.602 262.365 193.317  1.00 52.54           C  
ATOM   5026  P     G A 189     226.823 261.443 192.403  1.00 73.56           P  
ATOM   5027  OP1   G A 189     225.634 260.560 192.314  1.00 67.05           O  
ATOM   5028  OP2   G A 189     226.693 262.893 192.103  1.00 62.51           O1-
ATOM   5029  O5'   G A 189     227.392 261.342 193.882  1.00 64.86           O  
ATOM   5030  C5'   G A 189     227.805 260.097 194.421  1.00 64.65           C  
ATOM   5031  C4'   G A 189     228.447 260.293 195.767  1.00 60.79           C  
ATOM   5032  O4'   G A 189     229.767 260.879 195.606  1.00 58.60           O  
ATOM   5033  C3'   G A 189     227.734 261.267 196.682  1.00 54.30           C  
ATOM   5034  O3'   G A 189     226.614 260.715 197.332  1.00 54.65           O  
ATOM   5035  C2'   G A 189     228.841 261.695 197.622  1.00 52.59           C  
ATOM   5036  O2'   G A 189     229.117 260.648 198.540  1.00 51.69           O  
ATOM   5037  C1'   G A 189     230.008 261.805 196.644  1.00 55.72           C  
ATOM   5038  N9    G A 189     230.082 263.151 196.044  1.00 55.30           N  
ATOM   5039  C8    G A 189     229.493 263.543 194.866  1.00 56.37           C  
ATOM   5040  N7    G A 189     229.703 264.791 194.566  1.00 56.49           N  
ATOM   5041  C5    G A 189     230.479 265.254 195.613  1.00 58.50           C  
ATOM   5042  C6    G A 189     231.017 266.544 195.833  1.00 62.16           C  
ATOM   5043  O6    G A 189     230.903 267.546 195.113  1.00 61.33           O  
ATOM   5044  N1    G A 189     231.751 266.599 197.019  1.00 60.59           N  
ATOM   5045  C2    G A 189     231.938 265.550 197.887  1.00 56.20           C  
ATOM   5046  N2    G A 189     232.676 265.804 198.977  1.00 54.61           N  
ATOM   5047  N3    G A 189     231.437 264.340 197.690  1.00 55.86           N  
ATOM   5048  C4    G A 189     230.723 264.263 196.543  1.00 56.84           C  
ATOM   5049  P     A A 190     225.501 261.710 197.910  1.00 62.09           P  
ATOM   5050  OP1   A A 190     224.266 260.940 198.196  1.00 62.17           O  
ATOM   5051  OP2   A A 190     225.437 262.899 197.021  1.00 58.72           O1-
ATOM   5052  O5'   A A 190     226.135 262.188 199.284  1.00 60.42           O  
ATOM   5053  C5'   A A 190     225.598 261.756 200.520  1.00 58.89           C  
ATOM   5054  C4'   A A 190     226.263 260.500 201.029  1.00 50.42           C  
ATOM   5055  O4'   A A 190     227.706 260.594 200.919  1.00 46.93           O  
ATOM   5056  C3'   A A 190     226.026 260.216 202.497  1.00 50.91           C  
ATOM   5057  O3'   A A 190     224.743 259.653 202.738  1.00 51.15           O  
ATOM   5058  C2'   A A 190     227.197 259.307 202.853  1.00 47.29           C  
ATOM   5059  O2'   A A 190     226.946 257.981 202.413  1.00 48.36           O  
ATOM   5060  C1'   A A 190     228.315 259.890 201.985  1.00 43.60           C  
ATOM   5061  N9    A A 190     229.234 260.803 202.707  1.00 45.45           N  
ATOM   5062  C8    A A 190     229.615 262.038 202.262  1.00 49.63           C  
ATOM   5063  N7    A A 190     230.460 262.672 203.033  1.00 51.59           N  
ATOM   5064  C5    A A 190     230.683 261.795 204.077  1.00 46.74           C  
ATOM   5065  C6    A A 190     231.489 261.891 205.226  1.00 41.68           C  
ATOM   5066  N6    A A 190     232.245 262.936 205.538  1.00 45.99           N  
ATOM   5067  N1    A A 190     231.507 260.867 206.075  1.00 40.60           N  
ATOM   5068  C2    A A 190     230.753 259.822 205.764  1.00 45.10           C  
ATOM   5069  N3    A A 190     229.954 259.606 204.720  1.00 49.37           N  
ATOM   5070  C4    A A 190     229.949 260.642 203.882  1.00 46.24           C  
ATOM   5071  P     A A 191     223.562 260.535 203.400  1.00 53.71           P  
ATOM   5072  OP1   A A 191     222.281 260.074 202.816  1.00 57.38           O  
ATOM   5073  OP2   A A 191     223.880 261.984 203.316  1.00 51.10           O1-
ATOM   5074  O5'   A A 191     223.599 260.089 204.929  1.00 51.47           O  
ATOM   5075  C5'   A A 191     223.613 258.709 205.277  1.00 49.44           C  
ATOM   5076  C4'   A A 191     224.648 258.394 206.333  1.00 44.05           C  
ATOM   5077  O4'   A A 191     225.964 258.784 205.867  1.00 46.35           O  
ATOM   5078  C3'   A A 191     224.498 259.108 207.669  1.00 39.88           C  
ATOM   5079  O3'   A A 191     223.539 258.488 208.517  1.00 40.96           O  
ATOM   5080  C2'   A A 191     225.916 259.078 208.224  1.00 39.95           C  
ATOM   5081  O2'   A A 191     226.196 257.816 208.804  1.00 43.62           O  
ATOM   5082  C1'   A A 191     226.757 259.206 206.954  1.00 43.03           C  
ATOM   5083  N9    A A 191     227.247 260.578 206.687  1.00 42.37           N  
ATOM   5084  C8    A A 191     226.894 261.378 205.634  1.00 43.43           C  
ATOM   5085  N7    A A 191     227.488 262.537 205.602  1.00 41.21           N  
ATOM   5086  C5    A A 191     228.309 262.500 206.706  1.00 37.68           C  
ATOM   5087  C6    A A 191     229.200 263.437 207.224  1.00 39.22           C  
ATOM   5088  N6    A A 191     229.410 264.626 206.673  1.00 48.89           N  
ATOM   5089  N1    A A 191     229.881 263.130 208.332  1.00 40.03           N  
ATOM   5090  C2    A A 191     229.658 261.935 208.865  1.00 44.08           C  
ATOM   5091  N3    A A 191     228.840 260.966 208.480  1.00 43.85           N  
ATOM   5092  C4    A A 191     228.183 261.312 207.375  1.00 39.61           C  
ATOM   5093  P     C A 192     222.725 259.360 209.597  1.00 42.30           P  
ATOM   5094  OP1   C A 192     221.488 258.669 210.032  1.00 40.61           O  
ATOM   5095  OP2   C A 192     222.584 260.715 209.010  1.00 45.22           O1-
ATOM   5096  O5'   C A 192     223.724 259.434 210.841  1.00 43.55           O  
ATOM   5097  C5'   C A 192     224.338 258.262 211.365  1.00 41.14           C  
ATOM   5098  C4'   C A 192     225.567 258.577 212.185  1.00 38.23           C  
ATOM   5099  O4'   C A 192     226.625 259.082 211.329  1.00 40.88           O  
ATOM   5100  C3'   C A 192     225.415 259.662 213.233  1.00 41.00           C  
ATOM   5101  O3'   C A 192     224.760 259.233 214.411  1.00 42.51           O  
ATOM   5102  C2'   C A 192     226.853 260.101 213.450  1.00 39.99           C  
ATOM   5103  O2'   C A 192     227.558 259.140 214.217  1.00 43.74           O  
ATOM   5104  C1'   C A 192     227.389 260.046 212.029  1.00 37.58           C  
ATOM   5105  N1    C A 192     227.264 261.355 211.342  1.00 39.68           N  
ATOM   5106  C2    C A 192     228.159 262.380 211.636  1.00 42.70           C  
ATOM   5107  O2    C A 192     229.051 262.172 212.464  1.00 49.32           O  
ATOM   5108  N3    C A 192     228.054 263.566 211.011  1.00 40.75           N  
ATOM   5109  C4    C A 192     227.090 263.742 210.123  1.00 38.90           C  
ATOM   5110  N4    C A 192     227.002 264.917 209.524  1.00 46.76           N  
ATOM   5111  C5    C A 192     226.160 262.739 209.795  1.00 39.43           C  
ATOM   5112  C6    C A 192     226.287 261.576 210.425  1.00 40.54           C  
ATOM   5113  P     U A 193     223.537 260.089 215.001  1.00 38.87           P  
ATOM   5114  OP1   U A 193     223.323 259.713 216.423  1.00 44.24           O  
ATOM   5115  OP2   U A 193     222.430 259.975 214.013  1.00 39.03           O1-
ATOM   5116  O5'   U A 193     224.058 261.591 214.987  1.00 43.50           O  
ATOM   5117  C5'   U A 193     225.122 262.002 215.829  1.00 44.02           C  
ATOM   5118  C4'   U A 193     225.559 263.403 215.502  1.00 47.32           C  
ATOM   5119  O4'   U A 193     225.877 263.524 214.085  1.00 46.02           O  
ATOM   5120  C3'   U A 193     224.513 264.473 215.725  1.00 46.34           C  
ATOM   5121  O3'   U A 193     224.362 264.819 217.086  1.00 45.54           O  
ATOM   5122  C2'   U A 193     225.012 265.604 214.838  1.00 49.90           C  
ATOM   5123  O2'   U A 193     226.100 266.282 215.453  1.00 47.98           O  
ATOM   5124  C1'   U A 193     225.538 264.820 213.630  1.00 46.43           C  
ATOM   5125  N1    U A 193     224.513 264.700 212.566  1.00 40.60           N  
ATOM   5126  C2    U A 193     224.184 265.827 211.840  1.00 43.95           C  
ATOM   5127  O2    U A 193     224.705 266.908 212.028  1.00 48.95           O  
ATOM   5128  N3    U A 193     223.220 265.672 210.883  1.00 42.65           N  
ATOM   5129  C4    U A 193     222.585 264.487 210.598  1.00 41.86           C  
ATOM   5130  O4    U A 193     221.739 264.457 209.709  1.00 48.37           O  
ATOM   5131  C5    U A 193     222.969 263.370 211.388  1.00 38.97           C  
ATOM   5132  C6    U A 193     223.898 263.510 212.321  1.00 39.41           C  
ATOM   5133  P     G A 194     222.903 265.165 217.648  1.00 54.02           P  
ATOM   5134  OP1   G A 194     223.001 265.431 219.105  1.00 57.65           O  
ATOM   5135  OP2   G A 194     221.931 264.159 217.149  1.00 50.25           O1-
ATOM   5136  O5'   G A 194     222.582 266.551 216.948  1.00 53.30           O  
ATOM   5137  C5'   G A 194     223.414 267.675 217.175  1.00 53.69           C  
ATOM   5138  C4'   G A 194     222.807 268.912 216.579  1.00 50.03           C  
ATOM   5139  O4'   G A 194     223.006 268.896 215.143  1.00 48.28           O  
ATOM   5140  C3'   G A 194     221.301 269.032 216.736  1.00 49.33           C  
ATOM   5141  O3'   G A 194     220.900 269.518 218.005  1.00 51.61           O  
ATOM   5142  C2'   G A 194     220.936 269.940 215.579  1.00 50.02           C  
ATOM   5143  O2'   G A 194     221.337 271.275 215.858  1.00 55.08           O  
ATOM   5144  C1'   G A 194     221.857 269.395 214.496  1.00 46.79           C  
ATOM   5145  N9    G A 194     221.232 268.284 213.763  1.00 45.71           N  
ATOM   5146  C8    G A 194     221.421 266.940 213.952  1.00 44.76           C  
ATOM   5147  N7    G A 194     220.719 266.211 213.132  1.00 47.81           N  
ATOM   5148  C5    G A 194     220.022 267.135 212.361  1.00 48.67           C  
ATOM   5149  C6    G A 194     219.095 266.960 211.296  1.00 49.24           C  
ATOM   5150  O6    G A 194     218.668 265.920 210.783  1.00 52.04           O  
ATOM   5151  N1    G A 194     218.642 268.165 210.807  1.00 45.68           N  
ATOM   5152  C2    G A 194     219.030 269.379 211.279  1.00 46.65           C  
ATOM   5153  N2    G A 194     218.483 270.435 210.682  1.00 52.79           N  
ATOM   5154  N3    G A 194     219.883 269.570 212.256  1.00 47.47           N  
ATOM   5155  C4    G A 194     220.333 268.412 212.746  1.00 45.69           C  
ATOM   5156  P     A A 195     219.574 268.939 218.712  1.00 54.22           P  
ATOM   5157  OP1   A A 195     219.344 269.767 219.921  1.00 57.02           O  
ATOM   5158  OP2   A A 195     219.639 267.451 218.816  1.00 49.28           O1-
ATOM   5159  O5'   A A 195     218.411 269.347 217.712  1.00 50.79           O  
ATOM   5160  C5'   A A 195     218.026 270.705 217.587  1.00 49.57           C  
ATOM   5161  C4'   A A 195     217.189 270.922 216.357  1.00 44.69           C  
ATOM   5162  O4'   A A 195     217.775 270.218 215.241  1.00 44.00           O  
ATOM   5163  C3'   A A 195     215.772 270.401 216.435  1.00 43.02           C  
ATOM   5164  O3'   A A 195     214.928 271.343 217.068  1.00 48.43           O  
ATOM   5165  C2'   A A 195     215.416 270.154 214.977  1.00 44.33           C  
ATOM   5166  O2'   A A 195     214.959 271.347 214.372  1.00 52.79           O  
ATOM   5167  C1'   A A 195     216.770 269.784 214.365  1.00 42.54           C  
ATOM   5168  N9    A A 195     216.919 268.338 214.179  1.00 46.79           N  
ATOM   5169  C8    A A 195     217.557 267.455 215.010  1.00 52.15           C  
ATOM   5170  N7    A A 195     217.523 266.212 214.590  1.00 53.54           N  
ATOM   5171  C5    A A 195     216.813 266.296 213.397  1.00 53.87           C  
ATOM   5172  C6    A A 195     216.429 265.325 212.458  1.00 53.35           C  
ATOM   5173  N6    A A 195     216.732 264.035 212.593  1.00 53.33           N  
ATOM   5174  N1    A A 195     215.736 265.724 211.369  1.00 50.65           N  
ATOM   5175  C2    A A 195     215.446 267.027 211.257  1.00 49.79           C  
ATOM   5176  N3    A A 195     215.748 268.038 212.072  1.00 48.16           N  
ATOM   5177  C4    A A 195     216.441 267.601 213.132  1.00 49.11           C  
ATOM   5178  P     A A 196     213.474 270.939 217.617  1.00 57.93           P  
ATOM   5179  OP1   A A 196     212.643 270.524 216.456  1.00 56.94           O  
ATOM   5180  OP2   A A 196     213.027 272.071 218.464  1.00 61.66           O1-
ATOM   5181  O5'   A A 196     213.708 269.671 218.566  1.00 58.28           O  
ATOM   5182  C5'   A A 196     214.127 269.799 219.932  1.00 58.98           C  
ATOM   5183  C4'   A A 196     215.362 268.966 220.193  1.00 60.30           C  
ATOM   5184  O4'   A A 196     215.964 269.304 221.477  1.00 56.63           O  
ATOM   5185  C3'   A A 196     215.179 267.433 220.195  1.00 55.26           C  
ATOM   5186  O3'   A A 196     216.303 266.822 219.562  1.00 53.71           O  
ATOM   5187  C2'   A A 196     215.270 267.095 221.672  1.00 54.53           C  
ATOM   5188  O2'   A A 196     215.687 265.778 221.929  1.00 55.79           O  
ATOM   5189  C1'   A A 196     216.318 268.102 222.123  1.00 57.30           C  
ATOM   5190  N9    A A 196     216.451 268.284 223.569  1.00 52.19           N  
ATOM   5191  C8    A A 196     217.636 268.299 224.260  1.00 46.28           C  
ATOM   5192  N7    A A 196     217.508 268.442 225.548  1.00 43.35           N  
ATOM   5193  C5    A A 196     216.137 268.513 225.717  1.00 47.25           C  
ATOM   5194  C6    A A 196     215.341 268.666 226.856  1.00 51.84           C  
ATOM   5195  N6    A A 196     215.837 268.781 228.088  1.00 51.79           N  
ATOM   5196  N1    A A 196     214.002 268.702 226.689  1.00 53.44           N  
ATOM   5197  C2    A A 196     213.502 268.591 225.454  1.00 53.71           C  
ATOM   5198  N3    A A 196     214.146 268.443 224.305  1.00 53.70           N  
ATOM   5199  C4    A A 196     215.472 268.411 224.511  1.00 51.08           C  
ATOM   5200  P     A A 197     216.131 265.844 218.300  1.00 46.54           P  
ATOM   5201  OP1   A A 197     217.473 265.243 218.072  1.00 45.52           O  
ATOM   5202  OP2   A A 197     215.444 266.544 217.189  1.00 51.51           O1-
ATOM   5203  O5'   A A 197     215.125 264.723 218.796  1.00 51.09           O  
ATOM   5204  C5'   A A 197     215.613 263.442 219.143  1.00 61.79           C  
ATOM   5205  C4'   A A 197     214.661 262.333 218.757  1.00 60.18           C  
ATOM   5206  O4'   A A 197     213.296 262.673 219.141  1.00 55.75           O  
ATOM   5207  C3'   A A 197     214.548 261.988 217.276  1.00 57.41           C  
ATOM   5208  O3'   A A 197     215.633 261.206 216.783  1.00 56.90           O  
ATOM   5209  C2'   A A 197     213.205 261.274 217.239  1.00 55.60           C  
ATOM   5210  O2'   A A 197     213.320 259.983 217.825  1.00 58.03           O  
ATOM   5211  C1'   A A 197     212.392 262.158 218.187  1.00 52.44           C  
ATOM   5212  N9    A A 197     211.834 263.308 217.460  1.00 57.29           N  
ATOM   5213  C8    A A 197     212.123 264.636 217.679  1.00 59.82           C  
ATOM   5214  N7    A A 197     211.516 265.461 216.860  1.00 59.11           N  
ATOM   5215  C5    A A 197     210.787 264.605 216.046  1.00 57.95           C  
ATOM   5216  C6    A A 197     209.941 264.859 214.973  1.00 55.52           C  
ATOM   5217  N6    A A 197     209.696 266.099 214.553  1.00 58.61           N  
ATOM   5218  N1    A A 197     209.366 263.809 214.355  1.00 52.88           N  
ATOM   5219  C2    A A 197     209.646 262.581 214.796  1.00 52.28           C  
ATOM   5220  N3    A A 197     210.423 262.212 215.804  1.00 53.70           N  
ATOM   5221  C4    A A 197     210.972 263.283 216.393  1.00 56.33           C  
ATOM   5222  P     C A 198     216.485 261.665 215.486  1.00 51.97           P  
ATOM   5223  OP1   C A 198     217.477 260.590 215.270  1.00 55.34           O  
ATOM   5224  OP2   C A 198     216.966 263.071 215.612  1.00 46.38           O1-
ATOM   5225  O5'   C A 198     215.446 261.592 214.281  1.00 47.14           O  
ATOM   5226  C5'   C A 198     214.877 260.356 213.880  1.00 48.15           C  
ATOM   5227  C4'   C A 198     213.835 260.559 212.816  1.00 44.52           C  
ATOM   5228  O4'   C A 198     212.740 261.321 213.376  1.00 44.53           O  
ATOM   5229  C3'   C A 198     214.284 261.371 211.612  1.00 45.04           C  
ATOM   5230  O3'   C A 198     214.933 260.586 210.627  1.00 47.62           O  
ATOM   5231  C2'   C A 198     212.991 261.990 211.126  1.00 44.30           C  
ATOM   5232  O2'   C A 198     212.225 261.034 210.413  1.00 47.03           O  
ATOM   5233  C1'   C A 198     212.289 262.271 212.446  1.00 44.80           C  
ATOM   5234  N1    C A 198     212.618 263.607 212.982  1.00 49.80           N  
ATOM   5235  C2    C A 198     212.120 264.760 212.380  1.00 51.82           C  
ATOM   5236  O2    C A 198     211.413 264.653 211.372  1.00 55.72           O  
ATOM   5237  N3    C A 198     212.420 265.975 212.891  1.00 50.56           N  
ATOM   5238  C4    C A 198     213.184 266.056 213.975  1.00 50.95           C  
ATOM   5239  N4    C A 198     213.464 267.262 214.464  1.00 54.31           N  
ATOM   5240  C5    C A 198     213.707 264.902 214.614  1.00 52.77           C  
ATOM   5241  C6    C A 198     213.395 263.714 214.092  1.00 52.38           C  
ATOM   5242  P     A A 199     215.882 261.271 209.523  1.00 52.22           P  
ATOM   5243  OP1   A A 199     216.811 260.218 209.049  1.00 48.25           O  
ATOM   5244  OP2   A A 199     216.416 262.554 210.044  1.00 51.88           O1-
ATOM   5245  O5'   A A 199     214.894 261.685 208.347  1.00 53.19           O  
ATOM   5246  C5'   A A 199     213.999 260.741 207.773  1.00 56.39           C  
ATOM   5247  C4'   A A 199     213.318 261.289 206.541  1.00 55.73           C  
ATOM   5248  O4'   A A 199     211.893 261.032 206.644  1.00 52.19           O  
ATOM   5249  C3'   A A 199     213.469 262.795 206.308  1.00 52.44           C  
ATOM   5250  O3'   A A 199     213.548 263.068 204.905  1.00 54.79           O  
ATOM   5251  C2'   A A 199     212.165 263.355 206.857  1.00 48.06           C  
ATOM   5252  O2'   A A 199     211.773 264.581 206.281  1.00 52.17           O  
ATOM   5253  C1'   A A 199     211.180 262.243 206.519  1.00 48.95           C  
ATOM   5254  N9    A A 199     210.055 262.193 207.439  1.00 47.92           N  
ATOM   5255  C8    A A 199     209.885 262.974 208.537  1.00 54.20           C  
ATOM   5256  N7    A A 199     208.778 262.736 209.189  1.00 58.38           N  
ATOM   5257  C5    A A 199     208.189 261.722 208.461  1.00 52.91           C  
ATOM   5258  C6    A A 199     206.988 261.033 208.643  1.00 56.23           C  
ATOM   5259  N6    A A 199     206.140 261.262 209.647  1.00 57.85           N  
ATOM   5260  N1    A A 199     206.693 260.088 207.743  1.00 56.09           N  
ATOM   5261  C2    A A 199     207.560 259.884 206.750  1.00 55.18           C  
ATOM   5262  N3    A A 199     208.719 260.458 206.471  1.00 48.56           N  
ATOM   5263  C4    A A 199     208.969 261.383 207.383  1.00 45.16           C  
ATOM   5264  P     U A 200     214.803 263.876 204.291  1.00 59.98           P  
ATOM   5265  OP1   U A 200     215.172 263.243 202.999  1.00 57.86           O  
ATOM   5266  OP2   U A 200     215.845 264.042 205.334  1.00 57.73           O1-
ATOM   5267  O5'   U A 200     214.203 265.303 203.925  1.00 52.72           O  
ATOM   5268  C5'   U A 200     213.509 265.469 202.705  1.00 49.92           C  
ATOM   5269  C4'   U A 200     212.833 266.809 202.611  1.00 44.40           C  
ATOM   5270  O4'   U A 200     211.983 267.036 203.762  1.00 44.00           O  
ATOM   5271  C3'   U A 200     213.730 268.024 202.595  1.00 42.83           C  
ATOM   5272  O3'   U A 200     214.365 268.242 201.350  1.00 50.66           O  
ATOM   5273  C2'   U A 200     212.758 269.125 202.965  1.00 45.00           C  
ATOM   5274  O2'   U A 200     211.933 269.443 201.860  1.00 51.79           O  
ATOM   5275  C1'   U A 200     211.899 268.421 204.010  1.00 41.21           C  
ATOM   5276  N1    U A 200     212.388 268.712 205.372  1.00 47.38           N  
ATOM   5277  C2    U A 200     212.150 269.987 205.843  1.00 53.47           C  
ATOM   5278  O2    U A 200     211.557 270.837 205.199  1.00 55.60           O  
ATOM   5279  N3    U A 200     212.619 270.249 207.102  1.00 50.75           N  
ATOM   5280  C4    U A 200     213.297 269.388 207.924  1.00 49.31           C  
ATOM   5281  O4    U A 200     213.648 269.778 209.034  1.00 52.07           O  
ATOM   5282  C5    U A 200     213.516 268.094 207.365  1.00 47.80           C  
ATOM   5283  C6    U A 200     213.069 267.803 206.138  1.00 49.99           C  
ATOM   5284  P     C A 201     215.965 268.147 201.235  1.00 59.96           P  
ATOM   5285  OP1   C A 201     216.413 268.781 199.970  1.00 56.23           O  
ATOM   5286  OP2   C A 201     216.334 266.741 201.540  1.00 58.45           O1-
ATOM   5287  O5'   C A 201     216.508 269.085 202.399  1.00 51.64           O  
ATOM   5288  C5'   C A 201     216.546 270.492 202.232  1.00 46.07           C  
ATOM   5289  C4'   C A 201     216.593 271.194 203.561  1.00 46.05           C  
ATOM   5290  O4'   C A 201     215.767 270.492 204.529  1.00 49.92           O  
ATOM   5291  C3'   C A 201     217.947 271.239 204.228  1.00 43.69           C  
ATOM   5292  O3'   C A 201     218.805 272.207 203.682  1.00 47.73           O  
ATOM   5293  C2'   C A 201     217.587 271.483 205.681  1.00 44.52           C  
ATOM   5294  O2'   C A 201     217.239 272.841 205.889  1.00 48.57           O  
ATOM   5295  C1'   C A 201     216.327 270.629 205.820  1.00 44.69           C  
ATOM   5296  N1    C A 201     216.651 269.292 206.360  1.00 43.08           N  
ATOM   5297  C2    C A 201     216.938 269.195 207.711  1.00 44.87           C  
ATOM   5298  O2    C A 201     216.877 270.222 208.385  1.00 50.98           O  
ATOM   5299  N3    C A 201     217.270 268.012 208.264  1.00 46.14           N  
ATOM   5300  C4    C A 201     217.326 266.929 207.504  1.00 48.11           C  
ATOM   5301  N4    C A 201     217.649 265.771 208.090  1.00 49.30           N  
ATOM   5302  C5    C A 201     217.043 266.993 206.111  1.00 50.26           C  
ATOM   5303  C6    C A 201     216.716 268.180 205.583  1.00 48.20           C  
ATOM   5304  P     U A 202     220.313 271.775 203.392  1.00 56.23           P  
ATOM   5305  OP1   U A 202     221.030 272.859 202.669  1.00 55.19           O  
ATOM   5306  OP2   U A 202     220.215 270.424 202.789  1.00 53.19           O1-
ATOM   5307  O5'   U A 202     220.949 271.648 204.850  1.00 50.18           O  
ATOM   5308  C5'   U A 202     221.061 272.797 205.679  1.00 53.20           C  
ATOM   5309  C4'   U A 202     221.502 272.451 207.075  1.00 48.50           C  
ATOM   5310  O4'   U A 202     220.651 271.412 207.603  1.00 47.68           O  
ATOM   5311  C3'   U A 202     222.911 271.902 207.215  1.00 47.55           C  
ATOM   5312  O3'   U A 202     223.862 272.951 207.310  1.00 56.17           O  
ATOM   5313  C2'   U A 202     222.832 271.070 208.488  1.00 51.75           C  
ATOM   5314  O2'   U A 202     223.009 271.905 209.624  1.00 53.29           O  
ATOM   5315  C1'   U A 202     221.381 270.580 208.472  1.00 47.94           C  
ATOM   5316  N1    U A 202     221.209 269.190 208.006  1.00 45.05           N  
ATOM   5317  C2    U A 202     221.346 268.102 208.854  1.00 45.28           C  
ATOM   5318  O2    U A 202     221.673 268.133 210.029  1.00 48.13           O  
ATOM   5319  N3    U A 202     221.120 266.898 208.260  1.00 46.03           N  
ATOM   5320  C4    U A 202     220.760 266.659 206.960  1.00 46.49           C  
ATOM   5321  O4    U A 202     220.588 265.498 206.580  1.00 50.83           O  
ATOM   5322  C5    U A 202     220.619 267.833 206.169  1.00 46.87           C  
ATOM   5323  C6    U A 202     220.834 269.025 206.707  1.00 45.39           C  
ATOM   5324  P     A A 203     225.291 272.867 206.570  1.00 69.78           P  
ATOM   5325  OP1   A A 203     226.092 274.018 207.059  1.00 65.00           O  
ATOM   5326  OP2   A A 203     225.111 272.683 205.104  1.00 65.49           O1-
ATOM   5327  O5'   A A 203     225.966 271.553 207.169  1.00 68.78           O  
ATOM   5328  C5'   A A 203     226.647 271.574 208.419  1.00 70.25           C  
ATOM   5329  C4'   A A 203     226.901 270.174 208.930  1.00 62.53           C  
ATOM   5330  O4'   A A 203     225.671 269.404 208.843  1.00 58.78           O  
ATOM   5331  C3'   A A 203     227.915 269.344 208.155  1.00 56.16           C  
ATOM   5332  O3'   A A 203     229.256 269.622 208.530  1.00 60.91           O  
ATOM   5333  C2'   A A 203     227.485 267.919 208.462  1.00 52.38           C  
ATOM   5334  O2'   A A 203     227.962 267.530 209.741  1.00 54.07           O  
ATOM   5335  C1'   A A 203     225.958 268.061 208.531  1.00 52.27           C  
ATOM   5336  N9    A A 203     225.290 267.718 207.255  1.00 48.11           N  
ATOM   5337  C8    A A 203     225.186 268.499 206.134  1.00 51.81           C  
ATOM   5338  N7    A A 203     224.540 267.928 205.145  1.00 53.09           N  
ATOM   5339  C5    A A 203     224.186 266.683 205.640  1.00 47.76           C  
ATOM   5340  C6    A A 203     223.491 265.593 205.079  1.00 48.65           C  
ATOM   5341  N6    A A 203     222.993 265.567 203.842  1.00 51.10           N  
ATOM   5342  N1    A A 203     223.306 264.500 205.839  1.00 47.72           N  
ATOM   5343  C2    A A 203     223.800 264.513 207.078  1.00 50.02           C  
ATOM   5344  N3    A A 203     224.475 265.469 207.716  1.00 48.61           N  
ATOM   5345  C4    A A 203     224.640 266.545 206.936  1.00 46.38           C  
ATOM   5346  P     A A 204     230.327 270.070 207.415  1.00 75.02           P  
ATOM   5347  OP1   A A 204     231.019 268.854 206.920  1.00 69.02           O  
ATOM   5348  OP2   A A 204     231.153 271.176 207.961  1.00 73.60           O1-
ATOM   5349  O5'   A A 204     229.419 270.642 206.236  1.00 68.56           O  
ATOM   5350  C5'   A A 204     229.884 271.692 205.396  1.00 72.34           C  
ATOM   5351  C4'   A A 204     229.580 271.408 203.946  1.00 74.07           C  
ATOM   5352  O4'   A A 204     229.551 269.967 203.721  1.00 64.46           O  
ATOM   5353  C3'   A A 204     228.246 271.941 203.410  1.00 77.15           C  
ATOM   5354  O3'   A A 204     228.423 272.213 202.025  1.00 82.12           O  
ATOM   5355  C2'   A A 204     227.353 270.712 203.499  1.00 67.10           C  
ATOM   5356  O2'   A A 204     226.218 270.741 202.656  1.00 63.63           O  
ATOM   5357  C1'   A A 204     228.338 269.630 203.078  1.00 62.16           C  
ATOM   5358  N9    A A 204     227.939 268.289 203.461  1.00 53.21           N  
ATOM   5359  C8    A A 204     228.217 267.631 204.611  1.00 55.46           C  
ATOM   5360  N7    A A 204     227.692 266.432 204.656  1.00 56.00           N  
ATOM   5361  C5    A A 204     227.027 266.316 203.449  1.00 50.57           C  
ATOM   5362  C6    A A 204     226.263 265.286 202.888  1.00 47.88           C  
ATOM   5363  N6    A A 204     226.039 264.128 203.500  1.00 48.81           N  
ATOM   5364  N1    A A 204     225.735 265.481 201.666  1.00 49.66           N  
ATOM   5365  C2    A A 204     225.981 266.652 201.069  1.00 57.57           C  
ATOM   5366  N3    A A 204     226.679 267.703 201.495  1.00 56.64           N  
ATOM   5367  C4    A A 204     227.182 267.456 202.704  1.00 51.96           C  
ATOM   5368  P     G A 205     228.243 273.678 201.404  1.00 96.25           P  
ATOM   5369  OP1   G A 205     229.504 274.427 201.671  1.00 79.85           O  
ATOM   5370  OP2   G A 205     226.919 274.203 201.859  1.00 86.76           O1-
ATOM   5371  O5'   G A 205     228.176 273.383 199.833  1.00 84.47           O  
ATOM   5372  C5'   G A 205     229.351 273.077 199.074  1.00 82.03           C  
ATOM   5373  C4'   G A 205     229.831 271.651 199.267  1.00 72.31           C  
ATOM   5374  O4'   G A 205     228.822 270.709 198.783  1.00 60.79           O  
ATOM   5375  C3'   G A 205     231.138 271.294 198.535  1.00 71.56           C  
ATOM   5376  O3'   G A 205     231.968 270.460 199.351  1.00 68.11           O  
ATOM   5377  C2'   G A 205     230.642 270.490 197.337  1.00 67.95           C  
ATOM   5378  O2'   G A 205     231.578 269.586 196.787  1.00 68.02           O  
ATOM   5379  C1'   G A 205     229.446 269.766 197.937  1.00 59.24           C  
ATOM   5380  N9    G A 205     228.516 269.278 196.922  1.00 60.39           N  
ATOM   5381  C8    G A 205     228.093 269.936 195.796  1.00 66.43           C  
ATOM   5382  N7    G A 205     227.305 269.222 195.045  1.00 64.94           N  
ATOM   5383  C5    G A 205     227.232 268.011 195.710  1.00 62.45           C  
ATOM   5384  C6    G A 205     226.524 266.838 195.381  1.00 65.09           C  
ATOM   5385  O6    G A 205     225.801 266.635 194.406  1.00 71.88           O  
ATOM   5386  N1    G A 205     226.711 265.836 196.318  1.00 59.51           N  
ATOM   5387  C2    G A 205     227.490 265.952 197.434  1.00 58.87           C  
ATOM   5388  N2    G A 205     227.545 264.869 198.215  1.00 58.62           N  
ATOM   5389  N3    G A 205     228.160 267.042 197.763  1.00 60.42           N  
ATOM   5390  C4    G A 205     227.983 268.022 196.859  1.00 61.09           C  
ATOM   5391  P     U A 206     233.528 270.239 198.989  1.00 72.24           P  
ATOM   5392  OP1   U A 206     234.129 271.524 198.532  1.00 67.76           O  
ATOM   5393  OP2   U A 206     233.650 269.033 198.127  1.00 65.81           O1-
ATOM   5394  O5'   U A 206     234.172 269.854 200.389  1.00 71.21           O  
ATOM   5395  C5'   U A 206     234.103 270.748 201.487  1.00 70.59           C  
ATOM   5396  C4'   U A 206     234.172 270.007 202.795  1.00 68.76           C  
ATOM   5397  O4'   U A 206     232.829 269.702 203.258  1.00 62.81           O  
ATOM   5398  C3'   U A 206     234.861 268.652 202.750  1.00 68.87           C  
ATOM   5399  O3'   U A 206     236.279 268.736 202.784  1.00 71.81           O  
ATOM   5400  C2'   U A 206     234.261 267.951 203.953  1.00 64.22           C  
ATOM   5401  O2'   U A 206     234.839 268.454 205.147  1.00 65.63           O  
ATOM   5402  C1'   U A 206     232.814 268.436 203.877  1.00 60.48           C  
ATOM   5403  N1    U A 206     231.970 267.537 203.056  1.00 59.32           N  
ATOM   5404  C2    U A 206     231.678 266.265 203.509  1.00 57.89           C  
ATOM   5405  O2    U A 206     232.085 265.822 204.566  1.00 60.00           O  
ATOM   5406  N3    U A 206     230.891 265.506 202.680  1.00 54.58           N  
ATOM   5407  C4    U A 206     230.367 265.881 201.468  1.00 55.10           C  
ATOM   5408  O4    U A 206     229.676 265.090 200.832  1.00 54.04           O  
ATOM   5409  C5    U A 206     230.703 267.208 201.069  1.00 62.31           C  
ATOM   5410  C6    U A 206     231.472 267.966 201.854  1.00 61.40           C  
ATOM   5411  P     A A 207     237.175 267.744 201.884  1.00 78.15           P  
ATOM   5412  OP1   A A 207     238.576 268.249 201.887  1.00 74.48           O  
ATOM   5413  OP2   A A 207     236.487 267.544 200.577  1.00 68.49           O1-
ATOM   5414  O5'   A A 207     237.124 266.361 202.679  1.00 64.71           O  
ATOM   5415  C5'   A A 207     237.368 266.302 204.081  1.00 62.22           C  
ATOM   5416  C4'   A A 207     237.099 264.922 204.623  1.00 59.34           C  
ATOM   5417  O4'   A A 207     235.669 264.679 204.629  1.00 58.71           O  
ATOM   5418  C3'   A A 207     237.670 263.770 203.804  1.00 65.35           C  
ATOM   5419  O3'   A A 207     239.038 263.504 204.098  1.00 69.95           O  
ATOM   5420  C2'   A A 207     236.738 262.611 204.151  1.00 63.01           C  
ATOM   5421  O2'   A A 207     237.102 262.010 205.384  1.00 65.17           O  
ATOM   5422  C1'   A A 207     235.401 263.324 204.332  1.00 56.41           C  
ATOM   5423  N9    A A 207     234.581 263.256 203.110  1.00 53.95           N  
ATOM   5424  C8    A A 207     234.350 264.252 202.203  1.00 59.25           C  
ATOM   5425  N7    A A 207     233.579 263.898 201.207  1.00 59.55           N  
ATOM   5426  C5    A A 207     233.294 262.573 201.480  1.00 52.05           C  
ATOM   5427  C6    A A 207     232.524 261.635 200.795  1.00 49.62           C  
ATOM   5428  N6    A A 207     231.887 261.912 199.662  1.00 51.54           N  
ATOM   5429  N1    A A 207     232.428 260.403 201.322  1.00 49.50           N  
ATOM   5430  C2    A A 207     233.076 260.162 202.463  1.00 53.69           C  
ATOM   5431  N3    A A 207     233.833 260.960 203.205  1.00 52.39           N  
ATOM   5432  C4    A A 207     233.903 262.167 202.645  1.00 49.84           C  
ATOM   5433  P     C A 208     240.129 263.306 202.926  1.00 73.12           P  
ATOM   5434  OP1   C A 208     241.372 262.792 203.557  1.00 69.56           O  
ATOM   5435  OP2   C A 208     240.171 264.539 202.099  1.00 72.52           O1-
ATOM   5436  O5'   C A 208     239.552 262.113 202.054  1.00 61.22           O  
ATOM   5437  C5'   C A 208     239.497 260.809 202.602  1.00 62.80           C  
ATOM   5438  C4'   C A 208     238.486 259.963 201.885  1.00 59.62           C  
ATOM   5439  O4'   C A 208     237.196 260.630 201.881  1.00 56.18           O  
ATOM   5440  C3'   C A 208     238.776 259.724 200.420  1.00 57.68           C  
ATOM   5441  O3'   C A 208     239.735 258.706 200.212  1.00 57.45           O  
ATOM   5442  C2'   C A 208     237.396 259.409 199.864  1.00 55.79           C  
ATOM   5443  O2'   C A 208     237.008 258.089 200.198  1.00 58.03           O  
ATOM   5444  C1'   C A 208     236.526 260.371 200.668  1.00 52.03           C  
ATOM   5445  N1    C A 208     236.346 261.641 199.948  1.00 51.99           N  
ATOM   5446  C2    C A 208     235.461 261.657 198.873  1.00 54.07           C  
ATOM   5447  O2    C A 208     234.848 260.623 198.577  1.00 54.34           O  
ATOM   5448  N3    C A 208     235.292 262.800 198.180  1.00 55.57           N  
ATOM   5449  C4    C A 208     235.973 263.887 198.537  1.00 57.02           C  
ATOM   5450  N4    C A 208     235.763 264.999 197.829  1.00 59.65           N  
ATOM   5451  C5    C A 208     236.888 263.892 199.631  1.00 55.32           C  
ATOM   5452  C6    C A 208     237.048 262.752 200.304  1.00 54.55           C  
ATOM   5453  P     C A 209     240.954 258.950 199.197  1.00 60.12           P  
ATOM   5454  OP1   C A 209     242.064 258.071 199.632  1.00 58.77           O  
ATOM   5455  OP2   C A 209     241.199 260.414 199.096  1.00 60.17           O1-
ATOM   5456  O5'   C A 209     240.408 258.378 197.806  1.00 58.67           O  
ATOM   5457  C5'   C A 209     239.979 257.023 197.705  1.00 55.20           C  
ATOM   5458  C4'   C A 209     239.159 256.765 196.464  1.00 51.71           C  
ATOM   5459  O4'   C A 209     237.872 257.428 196.564  1.00 54.67           O  
ATOM   5460  C3'   C A 209     239.748 257.299 195.174  1.00 56.06           C  
ATOM   5461  O3'   C A 209     240.750 256.457 194.638  1.00 60.74           O  
ATOM   5462  C2'   C A 209     238.525 257.447 194.284  1.00 53.97           C  
ATOM   5463  O2'   C A 209     238.134 256.191 193.759  1.00 55.19           O  
ATOM   5464  C1'   C A 209     237.476 257.904 195.295  1.00 52.82           C  
ATOM   5465  N1    C A 209     237.380 259.378 195.361  1.00 51.11           N  
ATOM   5466  C2    C A 209     236.753 260.059 194.316  1.00 53.36           C  
ATOM   5467  O2    C A 209     236.298 259.408 193.364  1.00 53.88           O  
ATOM   5468  N3    C A 209     236.657 261.411 194.364  1.00 53.12           N  
ATOM   5469  C4    C A 209     237.154 262.080 195.402  1.00 50.39           C  
ATOM   5470  N4    C A 209     237.034 263.407 195.403  1.00 48.35           N  
ATOM   5471  C5    C A 209     237.800 261.411 196.479  1.00 51.17           C  
ATOM   5472  C6    C A 209     237.888 260.075 196.417  1.00 52.41           C  
ATOM   5473  P     C A 210     242.015 257.112 193.896  1.00 70.70           P  
ATOM   5474  OP1   C A 210     242.950 256.029 193.510  1.00 67.45           O  
ATOM   5475  OP2   C A 210     242.500 258.256 194.711  1.00 59.66           O1-
ATOM   5476  O5'   C A 210     241.399 257.661 192.541  1.00 61.21           O  
ATOM   5477  C5'   C A 210     240.723 256.778 191.661  1.00 61.47           C  
ATOM   5478  C4'   C A 210     240.038 257.537 190.564  1.00 57.10           C  
ATOM   5479  O4'   C A 210     239.064 258.443 191.131  1.00 52.45           O  
ATOM   5480  C3'   C A 210     240.946 258.429 189.740  1.00 56.86           C  
ATOM   5481  O3'   C A 210     241.623 257.694 188.730  1.00 59.31           O  
ATOM   5482  C2'   C A 210     239.986 259.487 189.205  1.00 51.48           C  
ATOM   5483  O2'   C A 210     239.295 259.014 188.062  1.00 56.66           O  
ATOM   5484  C1'   C A 210     238.979 259.609 190.348  1.00 47.73           C  
ATOM   5485  N1    C A 210     239.229 260.780 191.207  1.00 51.17           N  
ATOM   5486  C2    C A 210     238.759 262.020 190.782  1.00 54.11           C  
ATOM   5487  O2    C A 210     238.169 262.085 189.698  1.00 58.72           O  
ATOM   5488  N3    C A 210     238.949 263.119 191.535  1.00 50.27           N  
ATOM   5489  C4    C A 210     239.583 262.998 192.689  1.00 50.42           C  
ATOM   5490  N4    C A 210     239.756 264.102 193.416  1.00 51.83           N  
ATOM   5491  C5    C A 210     240.067 261.741 193.153  1.00 55.46           C  
ATOM   5492  C6    C A 210     239.876 260.658 192.395  1.00 52.84           C  
ATOM   5493  P     C A 211     243.132 258.053 188.307  1.00 55.25           P  
ATOM   5494  OP1   C A 211     243.676 256.924 187.516  1.00 56.19           O  
ATOM   5495  OP2   C A 211     243.860 258.521 189.511  1.00 58.81           O1-
ATOM   5496  O5'   C A 211     242.945 259.253 187.277  1.00 61.33           O  
ATOM   5497  C5'   C A 211     242.220 259.043 186.076  1.00 64.54           C  
ATOM   5498  C4'   C A 211     241.808 260.336 185.417  1.00 64.03           C  
ATOM   5499  O4'   C A 211     240.809 261.024 186.216  1.00 57.55           O  
ATOM   5500  C3'   C A 211     242.893 261.377 185.237  1.00 63.54           C  
ATOM   5501  O3'   C A 211     243.785 261.090 184.176  1.00 69.95           O  
ATOM   5502  C2'   C A 211     242.077 262.649 185.051  1.00 56.13           C  
ATOM   5503  O2'   C A 211     241.492 262.676 183.758  1.00 54.80           O  
ATOM   5504  C1'   C A 211     240.964 262.422 186.068  1.00 51.73           C  
ATOM   5505  N1    C A 211     241.306 262.994 187.387  1.00 50.20           N  
ATOM   5506  C2    C A 211     240.966 264.319 187.661  1.00 52.52           C  
ATOM   5507  O2    C A 211     240.388 264.990 186.801  1.00 55.20           O  
ATOM   5508  N3    C A 211     241.269 264.840 188.865  1.00 55.86           N  
ATOM   5509  C4    C A 211     241.891 264.087 189.770  1.00 56.03           C  
ATOM   5510  N4    C A 211     242.181 264.633 190.952  1.00 58.22           N  
ATOM   5511  C5    C A 211     242.251 262.736 189.518  1.00 53.67           C  
ATOM   5512  C6    C A 211     241.941 262.239 188.324  1.00 50.79           C  
ATOM   5513  P     G A 212     245.343 261.430 184.359  1.00 76.82           P  
ATOM   5514  OP1   G A 212     246.118 260.766 183.271  1.00 68.80           O  
ATOM   5515  OP2   G A 212     245.666 261.100 185.770  1.00 65.62           O1-
ATOM   5516  O5'   G A 212     245.393 263.021 184.184  1.00 74.59           O  
ATOM   5517  C5'   G A 212     244.787 263.638 183.052  1.00 71.89           C  
ATOM   5518  C4'   G A 212     244.591 265.131 183.208  1.00 66.23           C  
ATOM   5519  O4'   G A 212     243.586 265.429 184.214  1.00 67.24           O  
ATOM   5520  C3'   G A 212     245.783 265.946 183.664  1.00 68.60           C  
ATOM   5521  O3'   G A 212     246.775 266.124 182.673  1.00 76.20           O  
ATOM   5522  C2'   G A 212     245.112 267.230 184.116  1.00 66.99           C  
ATOM   5523  O2'   G A 212     244.642 267.964 182.997  1.00 68.70           O  
ATOM   5524  C1'   G A 212     243.898 266.662 184.839  1.00 64.95           C  
ATOM   5525  N9    G A 212     244.227 266.410 186.252  1.00 66.62           N  
ATOM   5526  C8    G A 212     244.483 265.210 186.876  1.00 65.42           C  
ATOM   5527  N7    G A 212     244.772 265.344 188.143  1.00 61.33           N  
ATOM   5528  C5    G A 212     244.713 266.718 188.362  1.00 64.20           C  
ATOM   5529  C6    G A 212     244.929 267.479 189.540  1.00 64.14           C  
ATOM   5530  O6    G A 212     245.230 267.082 190.669  1.00 66.54           O  
ATOM   5531  N1    G A 212     244.760 268.839 189.311  1.00 62.33           N  
ATOM   5532  C2    G A 212     244.432 269.397 188.105  1.00 63.06           C  
ATOM   5533  N2    G A 212     244.323 270.730 188.076  1.00 66.44           N  
ATOM   5534  N3    G A 212     244.230 268.707 186.999  1.00 63.73           N  
ATOM   5535  C4    G A 212     244.384 267.386 187.202  1.00 64.77           C  
ATOM   5536  P     A A 213     248.318 265.849 183.038  1.00 92.87           P  
ATOM   5537  OP1   A A 213     248.986 265.409 181.787  1.00 90.91           O  
ATOM   5538  OP2   A A 213     248.394 264.997 184.253  1.00 78.30           O1-
ATOM   5539  O5'   A A 213     248.885 267.284 183.427  1.00 83.90           O  
ATOM   5540  C5'   A A 213     248.952 268.308 182.449  1.00 82.59           C  
ATOM   5541  C4'   A A 213     248.779 269.678 183.053  1.00 85.50           C  
ATOM   5542  O4'   A A 213     247.607 269.724 183.913  1.00 83.55           O  
ATOM   5543  C3'   A A 213     249.890 270.169 183.956  1.00 87.39           C  
ATOM   5544  O3'   A A 213     251.047 270.572 183.242  1.00 87.68           O  
ATOM   5545  C2'   A A 213     249.196 271.294 184.721  1.00 85.56           C  
ATOM   5546  O2'   A A 213     249.061 272.455 183.914  1.00 85.44           O  
ATOM   5547  C1'   A A 213     247.805 270.697 184.923  1.00 77.09           C  
ATOM   5548  N9    A A 213     247.702 270.067 186.243  1.00 68.85           N  
ATOM   5549  C8    A A 213     247.581 268.746 186.562  1.00 69.75           C  
ATOM   5550  N7    A A 213     247.541 268.544 187.856  1.00 72.01           N  
ATOM   5551  C5    A A 213     247.656 269.813 188.408  1.00 72.67           C  
ATOM   5552  C6    A A 213     247.678 270.275 189.738  1.00 75.10           C  
ATOM   5553  N6    A A 213     247.584 269.467 190.802  1.00 70.08           N  
ATOM   5554  N1    A A 213     247.802 271.611 189.935  1.00 74.32           N  
ATOM   5555  C2    A A 213     247.893 272.412 188.862  1.00 73.26           C  
ATOM   5556  N3    A A 213     247.882 272.093 187.568  1.00 69.08           N  
ATOM   5557  C4    A A 213     247.760 270.764 187.416  1.00 68.70           C  
ATOM   5558  P     G A 214     252.493 270.550 183.948  1.00104.91           P  
ATOM   5559  OP1   G A 214     253.508 270.172 182.927  1.00 94.20           O  
ATOM   5560  OP2   G A 214     252.418 269.759 185.206  1.00 85.79           O1-
ATOM   5561  O5'   G A 214     252.725 272.078 184.344  1.00 94.39           O  
ATOM   5562  C5'   G A 214     251.948 273.122 183.765  1.00 85.08           C  
ATOM   5563  C4'   G A 214     251.753 274.252 184.738  1.00 79.71           C  
ATOM   5564  O4'   G A 214     250.774 273.890 185.748  1.00 77.62           O  
ATOM   5565  C3'   G A 214     252.993 274.611 185.533  1.00 84.89           C  
ATOM   5566  O3'   G A 214     253.864 275.435 184.777  1.00 86.66           O  
ATOM   5567  C2'   G A 214     252.418 275.257 186.791  1.00 79.57           C  
ATOM   5568  O2'   G A 214     252.037 276.601 186.528  1.00 76.57           O  
ATOM   5569  C1'   G A 214     251.141 274.435 187.001  1.00 75.62           C  
ATOM   5570  N9    G A 214     251.277 273.325 187.977  1.00 72.14           N  
ATOM   5571  C8    G A 214     251.618 272.034 187.662  1.00 75.11           C  
ATOM   5572  N7    G A 214     251.636 271.227 188.689  1.00 76.78           N  
ATOM   5573  C5    G A 214     251.268 272.015 189.774  1.00 71.08           C  
ATOM   5574  C6    G A 214     251.114 271.682 191.157  1.00 64.89           C  
ATOM   5575  O6    G A 214     251.272 270.604 191.738  1.00 69.22           O  
ATOM   5576  N1    G A 214     250.731 272.755 191.921  1.00 60.38           N  
ATOM   5577  C2    G A 214     250.527 273.993 191.407  1.00 65.67           C  
ATOM   5578  N2    G A 214     250.162 274.906 192.310  1.00 70.61           N  
ATOM   5579  N3    G A 214     250.663 274.334 190.132  1.00 71.25           N  
ATOM   5580  C4    G A 214     251.040 273.307 189.351  1.00 68.75           C  
ATOM   5581  P     G A 215     255.401 275.649 185.196  1.00 92.13           P  
ATOM   5582  OP1   G A 215     256.200 275.607 183.939  1.00 80.13           O  
ATOM   5583  OP2   G A 215     255.755 274.680 186.266  1.00 81.75           O1-
ATOM   5584  O5'   G A 215     255.382 277.146 185.773  1.00 96.40           O  
ATOM   5585  C5'   G A 215     256.116 277.533 186.937  1.00 93.04           C  
ATOM   5586  C4'   G A 215     255.255 278.240 187.964  1.00 80.16           C  
ATOM   5587  O4'   G A 215     254.385 277.258 188.601  1.00 77.07           O  
ATOM   5588  C3'   G A 215     256.049 278.867 189.104  1.00 81.04           C  
ATOM   5589  O3'   G A 215     255.244 279.850 189.760  1.00 84.01           O  
ATOM   5590  C2'   G A 215     256.159 277.693 190.060  1.00 81.76           C  
ATOM   5591  O2'   G A 215     256.509 278.030 191.385  1.00 81.19           O  
ATOM   5592  C1'   G A 215     254.740 277.146 189.969  1.00 76.17           C  
ATOM   5593  N9    G A 215     254.597 275.758 190.405  1.00 75.48           N  
ATOM   5594  C8    G A 215     254.956 274.618 189.739  1.00 80.52           C  
ATOM   5595  N7    G A 215     254.693 273.529 190.414  1.00 80.71           N  
ATOM   5596  C5    G A 215     254.126 273.974 191.599  1.00 74.32           C  
ATOM   5597  C6    G A 215     253.640 273.257 192.725  1.00 69.07           C  
ATOM   5598  O6    G A 215     253.604 272.039 192.920  1.00 68.94           O  
ATOM   5599  N1    G A 215     253.150 274.112 193.702  1.00 72.67           N  
ATOM   5600  C2    G A 215     253.136 275.485 193.603  1.00 76.46           C  
ATOM   5601  N2    G A 215     252.623 276.158 194.645  1.00 74.88           N  
ATOM   5602  N3    G A 215     253.586 276.165 192.560  1.00 75.13           N  
ATOM   5603  C4    G A 215     254.061 275.350 191.602  1.00 74.11           C  
ATOM   5604  P     A A 216     255.101 281.372 189.257  1.00 90.29           P  
ATOM   5605  OP1   A A 216     255.091 281.395 187.771  1.00 85.21           O  
ATOM   5606  OP2   A A 216     256.102 282.200 189.987  1.00 78.88           O1-
ATOM   5607  O5'   A A 216     253.662 281.789 189.835  1.00 85.04           O  
ATOM   5608  C5'   A A 216     252.431 281.422 189.201  1.00 87.18           C  
ATOM   5609  C4'   A A 216     252.073 279.945 189.342  1.00 79.56           C  
ATOM   5610  O4'   A A 216     252.009 279.556 190.745  1.00 72.16           O  
ATOM   5611  C3'   A A 216     250.715 279.516 188.780  1.00 71.22           C  
ATOM   5612  O3'   A A 216     250.712 279.337 187.369  1.00 74.52           O  
ATOM   5613  C2'   A A 216     250.438 278.239 189.558  1.00 64.70           C  
ATOM   5614  O2'   A A 216     251.232 277.179 189.053  1.00 69.06           O  
ATOM   5615  C1'   A A 216     250.969 278.617 190.939  1.00 62.90           C  
ATOM   5616  N9    A A 216     249.926 279.271 191.751  1.00 62.63           N  
ATOM   5617  C8    A A 216     249.808 280.616 191.975  1.00 70.78           C  
ATOM   5618  N7    A A 216     248.787 280.966 192.717  1.00 69.95           N  
ATOM   5619  C5    A A 216     248.176 279.763 193.004  1.00 61.57           C  
ATOM   5620  C6    A A 216     247.035 279.465 193.755  1.00 57.81           C  
ATOM   5621  N6    A A 216     246.293 280.375 194.372  1.00 60.97           N  
ATOM   5622  N1    A A 216     246.672 278.182 193.862  1.00 60.31           N  
ATOM   5623  C2    A A 216     247.431 277.279 193.237  1.00 66.05           C  
ATOM   5624  N3    A A 216     248.531 277.428 192.500  1.00 61.88           N  
ATOM   5625  C4    A A 216     248.862 278.716 192.417  1.00 59.92           C  
ATOM   5626  P     A A 217     249.488 279.873 186.459  1.00 76.37           P  
ATOM   5627  OP1   A A 217     249.865 279.706 185.031  1.00 74.72           O  
ATOM   5628  OP2   A A 217     249.023 281.206 186.942  1.00 59.93           O1-
ATOM   5629  O5'   A A 217     248.331 278.825 186.746  1.00 71.70           O  
ATOM   5630  C5'   A A 217     248.505 277.435 186.507  1.00 68.27           C  
ATOM   5631  C4'   A A 217     247.387 276.656 187.150  1.00 65.47           C  
ATOM   5632  O4'   A A 217     247.475 276.821 188.590  1.00 65.12           O  
ATOM   5633  C3'   A A 217     245.975 277.122 186.797  1.00 68.53           C  
ATOM   5634  O3'   A A 217     245.491 276.555 185.580  1.00 65.10           O  
ATOM   5635  C2'   A A 217     245.168 276.733 188.034  1.00 67.11           C  
ATOM   5636  O2'   A A 217     244.836 275.350 188.013  1.00 69.92           O  
ATOM   5637  C1'   A A 217     246.187 276.958 189.151  1.00 64.61           C  
ATOM   5638  N9    A A 217     246.090 278.302 189.759  1.00 66.62           N  
ATOM   5639  C8    A A 217     247.060 279.270 189.723  1.00 70.31           C  
ATOM   5640  N7    A A 217     246.746 280.381 190.339  1.00 68.23           N  
ATOM   5641  C5    A A 217     245.482 280.126 190.829  1.00 63.57           C  
ATOM   5642  C6    A A 217     244.608 280.917 191.573  1.00 63.01           C  
ATOM   5643  N6    A A 217     244.899 282.158 191.958  1.00 65.37           N  
ATOM   5644  N1    A A 217     243.415 280.390 191.907  1.00 66.85           N  
ATOM   5645  C2    A A 217     243.140 279.144 191.511  1.00 68.03           C  
ATOM   5646  N3    A A 217     243.884 278.299 190.801  1.00 66.88           N  
ATOM   5647  C4    A A 217     245.061 278.856 190.488  1.00 65.25           C  
ATOM   5648  P     A A 218     244.570 277.394 184.551  1.00 58.01           P  
ATOM   5649  OP1   A A 218     244.099 276.430 183.528  1.00 55.16           O  
ATOM   5650  OP2   A A 218     245.277 278.629 184.117  1.00 58.46           O1-
ATOM   5651  O5'   A A 218     243.292 277.808 185.405  1.00 60.57           O  
ATOM   5652  C5'   A A 218     242.261 276.872 185.699  1.00 58.50           C  
ATOM   5653  C4'   A A 218     241.322 277.418 186.747  1.00 63.44           C  
ATOM   5654  O4'   A A 218     242.100 277.886 187.876  1.00 64.58           O  
ATOM   5655  C3'   A A 218     240.486 278.621 186.328  1.00 64.08           C  
ATOM   5656  O3'   A A 218     239.291 278.242 185.654  1.00 67.69           O  
ATOM   5657  C2'   A A 218     240.244 279.358 187.647  1.00 61.26           C  
ATOM   5658  O2'   A A 218     239.152 278.794 188.358  1.00 61.94           O  
ATOM   5659  C1'   A A 218     241.526 279.050 188.422  1.00 63.33           C  
ATOM   5660  N9    A A 218     242.530 280.133 188.365  1.00 67.81           N  
ATOM   5661  C8    A A 218     243.752 280.126 187.726  1.00 67.03           C  
ATOM   5662  N7    A A 218     244.446 281.231 187.865  1.00 63.00           N  
ATOM   5663  C5    A A 218     243.632 282.017 188.662  1.00 65.55           C  
ATOM   5664  C6    A A 218     243.787 283.311 189.178  1.00 66.24           C  
ATOM   5665  N6    A A 218     244.859 284.063 188.956  1.00 69.51           N  
ATOM   5666  N1    A A 218     242.794 283.818 189.937  1.00 68.32           N  
ATOM   5667  C2    A A 218     241.714 283.056 190.157  1.00 71.76           C  
ATOM   5668  N3    A A 218     241.445 281.821 189.733  1.00 67.63           N  
ATOM   5669  C4    A A 218     242.457 281.355 188.983  1.00 68.50           C  
ATOM   5670  P     A A 219     238.943 278.807 184.182  1.00 79.86           P  
ATOM   5671  OP1   A A 219     237.774 278.060 183.652  1.00 75.96           O  
ATOM   5672  OP2   A A 219     240.187 278.874 183.369  1.00 72.13           O1-
ATOM   5673  O5'   A A 219     238.454 280.297 184.454  1.00 74.40           O  
ATOM   5674  C5'   A A 219     237.374 280.564 185.337  1.00 73.58           C  
ATOM   5675  C4'   A A 219     237.450 281.967 185.883  1.00 69.29           C  
ATOM   5676  O4'   A A 219     238.641 282.112 186.705  1.00 70.45           O  
ATOM   5677  C3'   A A 219     237.581 283.073 184.851  1.00 71.10           C  
ATOM   5678  O3'   A A 219     236.341 283.408 184.242  1.00 70.09           O  
ATOM   5679  C2'   A A 219     238.219 284.203 185.658  1.00 73.29           C  
ATOM   5680  O2'   A A 219     237.252 284.851 186.472  1.00 76.64           O  
ATOM   5681  C1'   A A 219     239.159 283.423 186.580  1.00 68.61           C  
ATOM   5682  N9    A A 219     240.539 283.338 186.059  1.00 66.19           N  
ATOM   5683  C8    A A 219     241.091 282.327 185.312  1.00 70.55           C  
ATOM   5684  N7    A A 219     242.349 282.502 184.989  1.00 67.37           N  
ATOM   5685  C5    A A 219     242.649 283.718 185.569  1.00 63.38           C  
ATOM   5686  C6    A A 219     243.827 284.466 185.590  1.00 67.83           C  
ATOM   5687  N6    A A 219     244.955 284.074 184.996  1.00 73.03           N  
ATOM   5688  N1    A A 219     243.807 285.642 186.251  1.00 70.56           N  
ATOM   5689  C2    A A 219     242.671 286.022 186.851  1.00 70.40           C  
ATOM   5690  N3    A A 219     241.494 285.404 186.902  1.00 67.24           N  
ATOM   5691  C4    A A 219     241.552 284.246 186.230  1.00 63.69           C  
ATOM   5692  P     G A 220     236.226 283.546 182.640  1.00 73.92           P  
ATOM   5693  OP1   G A 220     234.788 283.495 182.278  1.00 69.52           O  
ATOM   5694  OP2   G A 220     237.186 282.610 181.997  1.00 69.04           O1-
ATOM   5695  O5'   G A 220     236.721 285.031 182.355  1.00 73.51           O  
ATOM   5696  C5'   G A 220     236.218 286.119 183.117  1.00 73.93           C  
ATOM   5697  C4'   G A 220     237.189 287.273 183.142  1.00 66.38           C  
ATOM   5698  O4'   G A 220     238.377 286.918 183.893  1.00 64.87           O  
ATOM   5699  C3'   G A 220     237.726 287.703 181.794  1.00 64.11           C  
ATOM   5700  O3'   G A 220     236.817 288.519 181.097  1.00 67.64           O  
ATOM   5701  C2'   G A 220     239.024 288.404 182.164  1.00 66.68           C  
ATOM   5702  O2'   G A 220     238.778 289.713 182.655  1.00 69.81           O  
ATOM   5703  C1'   G A 220     239.509 287.537 183.321  1.00 64.26           C  
ATOM   5704  N9    G A 220     240.420 286.487 182.843  1.00 66.47           N  
ATOM   5705  C8    G A 220     240.065 285.250 182.365  1.00 66.90           C  
ATOM   5706  N7    G A 220     241.090 284.538 181.999  1.00 70.06           N  
ATOM   5707  C5    G A 220     242.173 285.369 182.245  1.00 66.57           C  
ATOM   5708  C6    G A 220     243.547 285.140 182.043  1.00 70.70           C  
ATOM   5709  O6    G A 220     244.084 284.123 181.594  1.00 76.42           O  
ATOM   5710  N1    G A 220     244.315 286.231 182.415  1.00 68.40           N  
ATOM   5711  C2    G A 220     243.824 287.398 182.921  1.00 65.93           C  
ATOM   5712  N2    G A 220     244.735 288.326 183.222  1.00 71.84           N  
ATOM   5713  N3    G A 220     242.542 287.631 183.118  1.00 66.19           N  
ATOM   5714  C4    G A 220     241.784 286.577 182.759  1.00 64.45           C  
ATOM   5715  P     A A 221     236.218 288.014 179.705  1.00 65.95           P  
ATOM   5716  OP1   A A 221     234.739 288.134 179.780  1.00 66.50           O  
ATOM   5717  OP2   A A 221     236.844 286.702 179.397  1.00 62.98           O1-
ATOM   5718  O5'   A A 221     236.756 289.096 178.668  1.00 71.94           O  
ATOM   5719  C5'   A A 221     235.859 289.989 178.020  1.00 72.77           C  
ATOM   5720  C4'   A A 221     236.152 291.430 178.354  1.00 69.12           C  
ATOM   5721  O4'   A A 221     237.169 291.511 179.398  1.00 63.97           O  
ATOM   5722  C3'   A A 221     236.666 292.266 177.184  1.00 69.17           C  
ATOM   5723  O3'   A A 221     236.106 293.577 177.252  1.00 76.73           O  
ATOM   5724  C2'   A A 221     238.164 292.336 177.455  1.00 68.25           C  
ATOM   5725  O2'   A A 221     238.819 293.446 176.879  1.00 75.52           O  
ATOM   5726  C1'   A A 221     238.196 292.381 178.979  1.00 63.76           C  
ATOM   5727  N9    A A 221     239.476 291.949 179.547  1.00 65.82           N  
ATOM   5728  C8    A A 221     240.098 290.742 179.403  1.00 69.47           C  
ATOM   5729  N7    A A 221     241.263 290.658 179.998  1.00 70.27           N  
ATOM   5730  C5    A A 221     241.426 291.904 180.574  1.00 70.80           C  
ATOM   5731  C6    A A 221     242.457 292.461 181.352  1.00 70.38           C  
ATOM   5732  N6    A A 221     243.568 291.815 181.704  1.00 68.91           N  
ATOM   5733  N1    A A 221     242.308 293.733 181.767  1.00 75.26           N  
ATOM   5734  C2    A A 221     241.196 294.389 181.413  1.00 78.08           C  
ATOM   5735  N3    A A 221     240.155 293.976 180.695  1.00 75.33           N  
ATOM   5736  C4    A A 221     240.335 292.708 180.300  1.00 70.77           C  
ATOM   5737  P     A A 222     234.799 293.948 176.387  1.00 86.37           P  
ATOM   5738  OP1   A A 222     235.131 293.761 174.951  1.00 80.14           O  
ATOM   5739  OP2   A A 222     234.288 295.259 176.868  1.00 79.32           O1-
ATOM   5740  O5'   A A 222     233.739 292.824 176.776  1.00 76.96           O  
ATOM   5741  C5'   A A 222     232.346 293.112 176.858  1.00 70.31           C  
ATOM   5742  C4'   A A 222     231.686 292.298 177.945  1.00 70.40           C  
ATOM   5743  O4'   A A 222     231.835 292.984 179.220  1.00 66.40           O  
ATOM   5744  C3'   A A 222     230.192 292.052 177.771  1.00 73.36           C  
ATOM   5745  O3'   A A 222     229.855 290.789 178.359  1.00 79.71           O  
ATOM   5746  C2'   A A 222     229.578 293.180 178.599  1.00 67.54           C  
ATOM   5747  O2'   A A 222     228.258 292.931 179.035  1.00 72.77           O  
ATOM   5748  C1'   A A 222     230.559 293.267 179.766  1.00 62.56           C  
ATOM   5749  N9    A A 222     230.649 294.583 180.401  1.00 60.32           N  
ATOM   5750  C8    A A 222     230.288 295.810 179.910  1.00 63.32           C  
ATOM   5751  N7    A A 222     230.532 296.807 180.724  1.00 64.60           N  
ATOM   5752  C5    A A 222     231.103 296.189 181.825  1.00 61.27           C  
ATOM   5753  C6    A A 222     231.590 296.681 183.042  1.00 64.90           C  
ATOM   5754  N6    A A 222     231.570 297.972 183.349  1.00 72.64           N  
ATOM   5755  N1    A A 222     232.104 295.813 183.939  1.00 64.12           N  
ATOM   5756  C2    A A 222     232.115 294.520 183.616  1.00 63.18           C  
ATOM   5757  N3    A A 222     231.687 293.933 182.501  1.00 65.49           N  
ATOM   5758  C4    A A 222     231.186 294.830 181.638  1.00 60.94           C  
ATOM   5759  P     A A 223     230.052 289.398 177.559  1.00 89.50           P  
ATOM   5760  OP1   A A 223     230.201 288.319 178.571  1.00 81.57           O  
ATOM   5761  OP2   A A 223     231.071 289.541 176.489  1.00 74.34           O1-
ATOM   5762  O5'   A A 223     228.640 289.162 176.874  1.00 73.02           O  
ATOM   5763  C5'   A A 223     227.465 289.213 177.659  1.00 64.88           C  
ATOM   5764  C4'   A A 223     226.579 290.355 177.250  1.00 61.53           C  
ATOM   5765  O4'   A A 223     226.059 290.104 175.925  1.00 64.16           O  
ATOM   5766  C3'   A A 223     225.356 290.538 178.126  1.00 60.23           C  
ATOM   5767  O3'   A A 223     225.642 291.381 179.219  1.00 63.40           O  
ATOM   5768  C2'   A A 223     224.307 291.111 177.185  1.00 61.58           C  
ATOM   5769  O2'   A A 223     224.425 292.520 177.110  1.00 63.79           O  
ATOM   5770  C1'   A A 223     224.714 290.509 175.838  1.00 66.47           C  
ATOM   5771  N9    A A 223     223.908 289.337 175.431  1.00 67.78           N  
ATOM   5772  C8    A A 223     223.823 288.098 176.019  1.00 68.66           C  
ATOM   5773  N7    A A 223     223.036 287.248 175.400  1.00 64.51           N  
ATOM   5774  C5    A A 223     222.587 287.968 174.310  1.00 61.12           C  
ATOM   5775  C6    A A 223     221.725 287.638 173.260  1.00 61.47           C  
ATOM   5776  N6    A A 223     221.132 286.457 173.107  1.00 65.16           N  
ATOM   5777  N1    A A 223     221.488 288.587 172.343  1.00 65.94           N  
ATOM   5778  C2    A A 223     222.078 289.782 172.485  1.00 65.92           C  
ATOM   5779  N3    A A 223     222.906 290.217 173.420  1.00 61.42           N  
ATOM   5780  C4    A A 223     223.123 289.245 174.311  1.00 63.04           C  
ATOM   5781  P     U A 224     224.589 291.530 180.413  1.00 70.94           P  
ATOM   5782  OP1   U A 224     224.020 290.187 180.668  1.00 75.37           O  
ATOM   5783  OP2   U A 224     223.682 292.659 180.092  1.00 65.48           O1-
ATOM   5784  O5'   U A 224     225.499 291.918 181.657  1.00 66.83           O  
ATOM   5785  C5'   U A 224     226.635 291.134 181.983  1.00 62.66           C  
ATOM   5786  C4'   U A 224     227.400 291.737 183.131  1.00 70.52           C  
ATOM   5787  O4'   U A 224     228.243 292.814 182.651  1.00 71.01           O  
ATOM   5788  C3'   U A 224     226.563 292.378 184.227  1.00 74.15           C  
ATOM   5789  O3'   U A 224     226.052 291.425 185.150  1.00 79.68           O  
ATOM   5790  C2'   U A 224     227.531 293.378 184.855  1.00 71.49           C  
ATOM   5791  O2'   U A 224     228.383 292.733 185.790  1.00 70.76           O  
ATOM   5792  C1'   U A 224     228.372 293.806 183.645  1.00 67.90           C  
ATOM   5793  N1    U A 224     227.963 295.108 183.071  1.00 62.33           N  
ATOM   5794  C2    U A 224     228.199 296.245 183.809  1.00 62.84           C  
ATOM   5795  O2    U A 224     228.703 296.225 184.916  1.00 65.36           O  
ATOM   5796  N3    U A 224     227.811 297.416 183.216  1.00 65.28           N  
ATOM   5797  C4    U A 224     227.235 297.560 181.974  1.00 65.44           C  
ATOM   5798  O4    U A 224     226.944 298.686 181.577  1.00 67.11           O  
ATOM   5799  C5    U A 224     227.033 296.335 181.262  1.00 62.88           C  
ATOM   5800  C6    U A 224     227.403 295.182 181.821  1.00 62.59           C  
ATOM   5801  P     C A 225     224.618 291.637 185.854  1.00 91.17           P  
ATOM   5802  OP1   C A 225     224.260 290.360 186.531  1.00 74.47           O  
ATOM   5803  OP2   C A 225     223.689 292.202 184.834  1.00 79.29           O1-
ATOM   5804  O5'   C A 225     224.909 292.727 186.990  1.00 89.56           O  
ATOM   5805  C5'   C A 225     224.209 293.972 187.054  1.00 83.16           C  
ATOM   5806  C4'   C A 225     225.041 295.031 187.745  1.00 70.28           C  
ATOM   5807  O4'   C A 225     225.955 295.634 186.789  1.00 67.94           O  
ATOM   5808  C3'   C A 225     224.299 296.220 188.345  1.00 67.53           C  
ATOM   5809  O3'   C A 225     223.727 295.942 189.619  1.00 72.26           O  
ATOM   5810  C2'   C A 225     225.392 297.280 188.399  1.00 69.95           C  
ATOM   5811  O2'   C A 225     226.275 297.030 189.481  1.00 71.18           O  
ATOM   5812  C1'   C A 225     226.153 296.995 187.105  1.00 67.15           C  
ATOM   5813  N1    C A 225     225.662 297.821 185.979  1.00 65.28           N  
ATOM   5814  C2    C A 225     225.898 299.200 185.977  1.00 67.30           C  
ATOM   5815  O2    C A 225     226.512 299.715 186.920  1.00 69.71           O  
ATOM   5816  N3    C A 225     225.451 299.959 184.955  1.00 65.79           N  
ATOM   5817  C4    C A 225     224.792 299.392 183.954  1.00 64.27           C  
ATOM   5818  N4    C A 225     224.361 300.174 182.962  1.00 64.36           N  
ATOM   5819  C5    C A 225     224.541 297.994 183.924  1.00 65.45           C  
ATOM   5820  C6    C A 225     224.989 297.252 184.943  1.00 64.88           C  
ATOM   5821  P     A A 226     222.344 296.628 190.097  1.00 72.84           P  
ATOM   5822  OP1   A A 226     222.215 296.453 191.567  1.00 67.61           O  
ATOM   5823  OP2   A A 226     221.263 296.061 189.244  1.00 71.05           O1-
ATOM   5824  O5'   A A 226     222.567 298.196 189.852  1.00 62.26           O  
ATOM   5825  C5'   A A 226     223.252 298.991 190.816  1.00 61.34           C  
ATOM   5826  C4'   A A 226     223.673 300.335 190.266  1.00 66.79           C  
ATOM   5827  O4'   A A 226     224.070 300.199 188.886  1.00 67.91           O  
ATOM   5828  C3'   A A 226     222.602 301.417 190.268  1.00 71.39           C  
ATOM   5829  O3'   A A 226     222.612 302.134 191.487  1.00 76.48           O  
ATOM   5830  C2'   A A 226     222.959 302.302 189.076  1.00 68.37           C  
ATOM   5831  O2'   A A 226     223.856 303.332 189.461  1.00 67.87           O  
ATOM   5832  C1'   A A 226     223.691 301.335 188.148  1.00 67.33           C  
ATOM   5833  N9    A A 226     222.886 300.875 187.010  1.00 64.60           N  
ATOM   5834  C8    A A 226     222.433 299.605 186.830  1.00 64.07           C  
ATOM   5835  N7    A A 226     221.780 299.433 185.718  1.00 62.37           N  
ATOM   5836  C5    A A 226     221.826 300.670 185.125  1.00 57.66           C  
ATOM   5837  C6    A A 226     221.321 301.124 183.916  1.00 56.52           C  
ATOM   5838  N6    A A 226     220.639 300.343 183.091  1.00 63.48           N  
ATOM   5839  N1    A A 226     221.519 302.410 183.586  1.00 63.48           N  
ATOM   5840  C2    A A 226     222.203 303.167 184.442  1.00 70.62           C  
ATOM   5841  N3    A A 226     222.742 302.853 185.618  1.00 70.20           N  
ATOM   5842  C4    A A 226     222.510 301.569 185.899  1.00 62.91           C  
ATOM   5843  P     A A 227     221.245 302.497 192.238  1.00 84.37           P  
ATOM   5844  OP1   A A 227     221.597 303.157 193.525  1.00 86.84           O  
ATOM   5845  OP2   A A 227     220.419 301.264 192.254  1.00 76.02           O1-
ATOM   5846  O5'   A A 227     220.563 303.586 191.291  1.00 80.46           O  
ATOM   5847  C5'   A A 227     221.196 304.837 191.029  1.00 82.56           C  
ATOM   5848  C4'   A A 227     220.600 305.530 189.827  1.00 82.63           C  
ATOM   5849  O4'   A A 227     220.584 304.611 188.703  1.00 81.82           O  
ATOM   5850  C3'   A A 227     219.156 306.004 189.982  1.00 77.63           C  
ATOM   5851  O3'   A A 227     218.961 307.080 189.073  1.00 83.91           O  
ATOM   5852  C2'   A A 227     218.385 304.818 189.441  1.00 75.93           C  
ATOM   5853  O2'   A A 227     217.053 305.088 189.063  1.00 78.21           O  
ATOM   5854  C1'   A A 227     219.253 304.469 188.247  1.00 80.45           C  
ATOM   5855  N9    A A 227     219.063 303.121 187.746  1.00 73.29           N  
ATOM   5856  C8    A A 227     219.062 301.942 188.430  1.00 74.68           C  
ATOM   5857  N7    A A 227     218.859 300.911 187.652  1.00 73.35           N  
ATOM   5858  C5    A A 227     218.721 301.467 186.394  1.00 69.53           C  
ATOM   5859  C6    A A 227     218.479 300.906 185.141  1.00 68.97           C  
ATOM   5860  N6    A A 227     218.343 299.597 184.952  1.00 67.88           N  
ATOM   5861  N1    A A 227     218.393 301.741 184.085  1.00 71.54           N  
ATOM   5862  C2    A A 227     218.540 303.056 184.293  1.00 73.17           C  
ATOM   5863  N3    A A 227     218.764 303.705 185.427  1.00 71.88           N  
ATOM   5864  C4    A A 227     218.842 302.832 186.439  1.00 69.67           C  
ATOM   5865  P     C A 228     218.405 308.489 189.581  1.00102.27           P  
ATOM   5866  OP1   C A 228     219.318 308.971 190.649  1.00104.12           O  
ATOM   5867  OP2   C A 228     216.945 308.365 189.814  1.00102.67           O1-
ATOM   5868  O5'   C A 228     218.596 309.432 188.324  1.00102.35           O  
ATOM   5869  C5'   C A 228     219.750 309.302 187.512  1.00103.31           C  
ATOM   5870  C4'   C A 228     219.491 309.778 186.107  1.00114.95           C  
ATOM   5871  O4'   C A 228     219.054 308.660 185.278  1.00105.48           O  
ATOM   5872  C3'   C A 228     218.409 310.859 185.968  1.00121.18           C  
ATOM   5873  O3'   C A 228     218.775 311.763 184.918  1.00121.19           O  
ATOM   5874  C2'   C A 228     217.195 310.043 185.524  1.00113.79           C  
ATOM   5875  O2'   C A 228     216.175 310.771 184.870  1.00112.81           O  
ATOM   5876  C1'   C A 228     217.864 309.025 184.608  1.00103.92           C  
ATOM   5877  N1    C A 228     217.066 307.831 184.316  1.00 94.30           N  
ATOM   5878  C2    C A 228     217.014 307.420 182.979  1.00 91.33           C  
ATOM   5879  O2    C A 228     217.652 308.055 182.122  1.00 89.10           O  
ATOM   5880  N3    C A 228     216.278 306.336 182.655  1.00 88.97           N  
ATOM   5881  C4    C A 228     215.611 305.686 183.610  1.00 86.37           C  
ATOM   5882  N4    C A 228     214.896 304.622 183.240  1.00 81.73           N  
ATOM   5883  C5    C A 228     215.641 306.094 184.979  1.00 87.18           C  
ATOM   5884  C6    C A 228     216.374 307.170 185.289  1.00 92.42           C  
ATOM   5885  P     C A 229     219.555 313.136 185.240  1.00123.28           P  
ATOM   5886  OP1   C A 229     218.618 314.023 185.980  1.00123.21           O  
ATOM   5887  OP2   C A 229     220.184 313.611 183.977  1.00119.27           O1-
ATOM   5888  O5'   C A 229     220.730 312.699 186.221  1.00114.74           O  
ATOM   5889  C5'   C A 229     221.961 312.217 185.706  1.00107.28           C  
ATOM   5890  C4'   C A 229     223.010 312.166 186.781  1.00106.17           C  
ATOM   5891  O4'   C A 229     222.629 311.206 187.802  1.00 99.78           O  
ATOM   5892  C3'   C A 229     224.388 311.702 186.347  1.00107.25           C  
ATOM   5893  O3'   C A 229     225.140 312.706 185.690  1.00109.67           O  
ATOM   5894  C2'   C A 229     225.001 311.240 187.661  1.00106.50           C  
ATOM   5895  O2'   C A 229     225.427 312.353 188.435  1.00103.94           O  
ATOM   5896  C1'   C A 229     223.788 310.605 188.345  1.00102.63           C  
ATOM   5897  N1    C A 229     223.736 309.145 188.099  1.00 98.12           N  
ATOM   5898  C2    C A 229     224.514 308.282 188.890  1.00 97.03           C  
ATOM   5899  O2    C A 229     225.229 308.741 189.801  1.00 93.63           O  
ATOM   5900  N3    C A 229     224.462 306.952 188.646  1.00 91.65           N  
ATOM   5901  C4    C A 229     223.690 306.479 187.662  1.00 87.97           C  
ATOM   5902  N4    C A 229     223.672 305.158 187.461  1.00 79.75           N  
ATOM   5903  C5    C A 229     222.899 307.335 186.843  1.00 86.27           C  
ATOM   5904  C6    C A 229     222.959 308.645 187.092  1.00 90.94           C  
ATOM   5905  P     G A 230     226.128 312.308 184.486  1.00124.35           P  
ATOM   5906  OP1   G A 230     226.502 313.576 183.805  1.00119.35           O  
ATOM   5907  OP2   G A 230     225.487 311.216 183.706  1.00117.02           O1-
ATOM   5908  O5'   G A 230     227.426 311.723 185.215  1.00110.78           O  
ATOM   5909  C5'   G A 230     228.055 310.514 184.791  1.00100.48           C  
ATOM   5910  C4'   G A 230     228.184 309.544 185.943  1.00 97.57           C  
ATOM   5911  O4'   G A 230     226.904 308.892 186.168  1.00 91.62           O  
ATOM   5912  C3'   G A 230     229.166 308.388 185.782  1.00 90.75           C  
ATOM   5913  O3'   G A 230     230.518 308.749 186.050  1.00 89.83           O  
ATOM   5914  C2'   G A 230     228.612 307.362 186.764  1.00 88.78           C  
ATOM   5915  O2'   G A 230     228.944 307.721 188.098  1.00 88.83           O  
ATOM   5916  C1'   G A 230     227.107 307.561 186.588  1.00 85.83           C  
ATOM   5917  N9    G A 230     226.560 306.667 185.555  1.00 78.46           N  
ATOM   5918  C8    G A 230     225.994 307.057 184.370  1.00 78.17           C  
ATOM   5919  N7    G A 230     225.604 306.052 183.638  1.00 75.81           N  
ATOM   5920  C5    G A 230     225.936 304.933 184.389  1.00 70.82           C  
ATOM   5921  C6    G A 230     225.755 303.559 184.109  1.00 67.66           C  
ATOM   5922  O6    G A 230     225.247 303.038 183.113  1.00 69.61           O  
ATOM   5923  N1    G A 230     226.226 302.753 185.126  1.00 64.99           N  
ATOM   5924  C2    G A 230     226.798 303.216 186.270  1.00 67.31           C  
ATOM   5925  N2    G A 230     227.193 302.286 187.143  1.00 70.24           N  
ATOM   5926  N3    G A 230     226.975 304.491 186.550  1.00 73.38           N  
ATOM   5927  C4    G A 230     226.522 305.294 185.572  1.00 72.16           C  
ATOM   5928  P     A A 231     231.736 308.130 185.192  1.00 78.70           P  
ATOM   5929  OP1   A A 231     232.976 308.870 185.534  1.00 81.12           O  
ATOM   5930  OP2   A A 231     231.292 308.029 183.778  1.00 87.06           O1-
ATOM   5931  O5'   A A 231     231.927 306.660 185.767  1.00 80.37           O  
ATOM   5932  C5'   A A 231     232.419 306.453 187.079  1.00 83.21           C  
ATOM   5933  C4'   A A 231     232.114 305.057 187.566  1.00 88.93           C  
ATOM   5934  O4'   A A 231     230.747 304.716 187.215  1.00 83.63           O  
ATOM   5935  C3'   A A 231     232.951 303.935 186.960  1.00 96.77           C  
ATOM   5936  O3'   A A 231     234.213 303.775 187.609  1.00101.18           O  
ATOM   5937  C2'   A A 231     232.034 302.717 187.094  1.00 87.65           C  
ATOM   5938  O2'   A A 231     232.094 302.173 188.405  1.00 88.00           O  
ATOM   5939  C1'   A A 231     230.650 303.341 186.912  1.00 78.59           C  
ATOM   5940  N9    A A 231     230.102 303.179 185.548  1.00 76.41           N  
ATOM   5941  C8    A A 231     229.752 304.149 184.642  1.00 76.84           C  
ATOM   5942  N7    A A 231     229.264 303.689 183.518  1.00 72.61           N  
ATOM   5943  C5    A A 231     229.283 302.319 183.699  1.00 68.56           C  
ATOM   5944  C6    A A 231     228.892 301.253 182.881  1.00 69.63           C  
ATOM   5945  N6    A A 231     228.378 301.396 181.661  1.00 70.20           N  
ATOM   5946  N1    A A 231     229.039 300.006 183.360  1.00 68.20           N  
ATOM   5947  C2    A A 231     229.544 299.859 184.587  1.00 69.58           C  
ATOM   5948  N3    A A 231     229.950 300.775 185.454  1.00 69.64           N  
ATOM   5949  C4    A A 231     229.787 301.997 184.941  1.00 70.32           C  
ATOM   5950  P     G A 232     235.610 304.022 186.834  1.00107.50           P  
ATOM   5951  OP1   G A 232     236.675 304.154 187.865  1.00 98.65           O  
ATOM   5952  OP2   G A 232     235.403 305.096 185.824  1.00 97.19           O1-
ATOM   5953  O5'   G A 232     235.875 302.662 186.044  1.00 95.20           O  
ATOM   5954  C5'   G A 232     235.740 301.402 186.689  1.00 92.53           C  
ATOM   5955  C4'   G A 232     235.168 300.356 185.761  1.00 93.74           C  
ATOM   5956  O4'   G A 232     233.987 300.889 185.093  1.00 89.57           O  
ATOM   5957  C3'   G A 232     236.106 299.872 184.652  1.00 99.05           C  
ATOM   5958  O3'   G A 232     235.905 298.474 184.448  1.00 95.93           O  
ATOM   5959  C2'   G A 232     235.626 300.653 183.428  1.00 91.70           C  
ATOM   5960  O2'   G A 232     235.902 300.036 182.185  1.00 86.42           O  
ATOM   5961  C1'   G A 232     234.126 300.749 183.691  1.00 85.11           C  
ATOM   5962  N9    G A 232     233.473 301.887 183.043  1.00 78.34           N  
ATOM   5963  C8    G A 232     233.700 303.222 183.268  1.00 81.04           C  
ATOM   5964  N7    G A 232     232.952 303.998 182.535  1.00 81.89           N  
ATOM   5965  C5    G A 232     232.181 303.119 181.785  1.00 79.31           C  
ATOM   5966  C6    G A 232     231.185 303.370 180.808  1.00 80.82           C  
ATOM   5967  O6    G A 232     230.775 304.463 180.404  1.00 82.67           O  
ATOM   5968  N1    G A 232     230.658 302.193 180.283  1.00 79.05           N  
ATOM   5969  C2    G A 232     231.043 300.928 180.653  1.00 82.40           C  
ATOM   5970  N2    G A 232     230.405 299.917 180.040  1.00 76.31           N  
ATOM   5971  N3    G A 232     231.966 300.680 181.573  1.00 82.81           N  
ATOM   5972  C4    G A 232     232.489 301.813 182.090  1.00 78.73           C  
ATOM   5973  P     A A 233     236.367 297.431 185.581  1.00105.26           P  
ATOM   5974  OP1   A A 233     235.280 297.306 186.598  1.00 87.92           O  
ATOM   5975  OP2   A A 233     237.742 297.840 185.980  1.00 91.48           O1-
ATOM   5976  O5'   A A 233     236.486 296.040 184.809  1.00 87.63           O  
ATOM   5977  C5'   A A 233     235.331 295.313 184.413  1.00 75.94           C  
ATOM   5978  C4'   A A 233     235.704 293.969 183.846  1.00 66.45           C  
ATOM   5979  O4'   A A 233     236.848 294.110 182.956  1.00 68.88           O  
ATOM   5980  C3'   A A 233     236.161 292.937 184.858  1.00 65.06           C  
ATOM   5981  O3'   A A 233     235.088 292.294 185.512  1.00 68.42           O  
ATOM   5982  C2'   A A 233     237.001 292.003 184.011  1.00 67.81           C  
ATOM   5983  O2'   A A 233     236.166 291.178 183.218  1.00 73.77           O  
ATOM   5984  C1'   A A 233     237.703 292.996 183.093  1.00 64.95           C  
ATOM   5985  N9    A A 233     238.965 293.463 183.688  1.00 72.58           N  
ATOM   5986  C8    A A 233     239.322 294.766 183.936  1.00 77.70           C  
ATOM   5987  N7    A A 233     240.507 294.887 184.491  1.00 79.20           N  
ATOM   5988  C5    A A 233     240.960 293.581 184.631  1.00 76.00           C  
ATOM   5989  C6    A A 233     242.156 293.038 185.155  1.00 73.49           C  
ATOM   5990  N6    A A 233     243.157 293.772 185.664  1.00 71.08           N  
ATOM   5991  N1    A A 233     242.292 291.690 185.144  1.00 73.04           N  
ATOM   5992  C2    A A 233     241.292 290.957 184.636  1.00 69.77           C  
ATOM   5993  N3    A A 233     240.129 291.348 184.118  1.00 71.41           N  
ATOM   5994  C4    A A 233     240.017 292.689 184.140  1.00 74.69           C  
ATOM   5995  P     U A 234     235.120 292.132 187.107  1.00 78.46           P  
ATOM   5996  OP1   U A 234     233.783 291.659 187.543  1.00 79.51           O  
ATOM   5997  OP2   U A 234     235.663 293.396 187.669  1.00 82.57           O1-
ATOM   5998  O5'   U A 234     236.158 290.950 187.358  1.00 70.13           O  
ATOM   5999  C5'   U A 234     235.961 289.688 186.740  1.00 71.76           C  
ATOM   6000  C4'   U A 234     237.184 288.812 186.827  1.00 73.80           C  
ATOM   6001  O4'   U A 234     238.333 289.485 186.250  1.00 73.61           O  
ATOM   6002  C3'   U A 234     237.638 288.448 188.224  1.00 64.86           C  
ATOM   6003  O3'   U A 234     236.899 287.388 188.771  1.00 64.12           O  
ATOM   6004  C2'   U A 234     239.102 288.106 188.023  1.00 65.61           C  
ATOM   6005  O2'   U A 234     239.239 286.790 187.507  1.00 64.06           O  
ATOM   6006  C1'   U A 234     239.503 289.119 186.950  1.00 70.79           C  
ATOM   6007  N1    U A 234     240.077 290.341 187.551  1.00 68.64           N  
ATOM   6008  C2    U A 234     241.336 290.269 188.122  1.00 68.13           C  
ATOM   6009  O2    U A 234     242.015 289.256 188.153  1.00 67.87           O  
ATOM   6010  N3    U A 234     241.780 291.443 188.667  1.00 70.60           N  
ATOM   6011  C4    U A 234     241.105 292.649 188.694  1.00 74.05           C  
ATOM   6012  O4    U A 234     241.639 293.625 189.221  1.00 76.56           O  
ATOM   6013  C5    U A 234     239.811 292.635 188.082  1.00 69.35           C  
ATOM   6014  C6    U A 234     239.351 291.507 187.545  1.00 67.65           C  
ATOM   6015  P     U A 235     236.542 287.442 190.322  1.00 73.15           P  
ATOM   6016  OP1   U A 235     235.706 286.263 190.668  1.00 76.81           O  
ATOM   6017  OP2   U A 235     236.054 288.824 190.588  1.00 70.23           O1-
ATOM   6018  O5'   U A 235     237.955 287.251 191.025  1.00 73.61           O  
ATOM   6019  C5'   U A 235     238.776 286.131 190.725  1.00 71.56           C  
ATOM   6020  C4'   U A 235     240.120 286.255 191.398  1.00 78.96           C  
ATOM   6021  O4'   U A 235     240.885 287.335 190.794  1.00 76.25           O  
ATOM   6022  C3'   U A 235     240.084 286.622 192.872  1.00 80.35           C  
ATOM   6023  O3'   U A 235     239.760 285.538 193.722  1.00 78.30           O  
ATOM   6024  C2'   U A 235     241.470 287.214 193.095  1.00 78.15           C  
ATOM   6025  O2'   U A 235     242.459 286.193 193.174  1.00 71.87           O  
ATOM   6026  C1'   U A 235     241.665 287.982 191.786  1.00 75.47           C  
ATOM   6027  N1    U A 235     241.208 289.386 191.906  1.00 68.41           N  
ATOM   6028  C2    U A 235     242.010 290.263 192.596  1.00 63.96           C  
ATOM   6029  O2    U A 235     243.070 289.928 193.088  1.00 68.35           O  
ATOM   6030  N3    U A 235     241.543 291.546 192.685  1.00 61.53           N  
ATOM   6031  C4    U A 235     240.369 292.028 192.163  1.00 60.99           C  
ATOM   6032  O4    U A 235     240.074 293.208 192.318  1.00 62.92           O  
ATOM   6033  C5    U A 235     239.587 291.065 191.468  1.00 66.58           C  
ATOM   6034  C6    U A 235     240.021 289.809 191.368  1.00 69.34           C  
ATOM   6035  P     C A 236     238.690 285.752 194.900  1.00 88.51           P  
ATOM   6036  OP1   C A 236     238.205 284.406 195.303  1.00 88.85           O  
ATOM   6037  OP2   C A 236     237.708 286.784 194.468  1.00 79.76           O1-
ATOM   6038  O5'   C A 236     239.560 286.369 196.088  1.00 83.19           O  
ATOM   6039  C5'   C A 236     240.686 285.666 196.600  1.00 83.63           C  
ATOM   6040  C4'   C A 236     241.681 286.580 197.273  1.00 72.85           C  
ATOM   6041  O4'   C A 236     242.160 287.570 196.322  1.00 70.32           O  
ATOM   6042  C3'   C A 236     241.148 287.422 198.419  1.00 71.28           C  
ATOM   6043  O3'   C A 236     240.981 286.719 199.636  1.00 72.80           O  
ATOM   6044  C2'   C A 236     242.157 288.553 198.470  1.00 69.29           C  
ATOM   6045  O2'   C A 236     243.392 288.089 198.999  1.00 64.95           O  
ATOM   6046  C1'   C A 236     242.356 288.806 196.980  1.00 69.50           C  
ATOM   6047  N1    C A 236     241.374 289.792 196.451  1.00 71.65           N  
ATOM   6048  C2    C A 236     241.615 291.155 196.675  1.00 71.52           C  
ATOM   6049  O2    C A 236     242.634 291.484 197.304  1.00 71.91           O  
ATOM   6050  N3    C A 236     240.747 292.085 196.210  1.00 66.20           N  
ATOM   6051  C4    C A 236     239.669 291.700 195.539  1.00 63.17           C  
ATOM   6052  N4    C A 236     238.851 292.659 195.108  1.00 63.51           N  
ATOM   6053  C5    C A 236     239.386 290.326 195.287  1.00 64.57           C  
ATOM   6054  C6    C A 236     240.251 289.418 195.754  1.00 68.14           C  
ATOM   6055  P     C A 237     239.731 287.083 200.581  1.00 81.46           P  
ATOM   6056  OP1   C A 237     239.533 285.967 201.543  1.00 76.17           O  
ATOM   6057  OP2   C A 237     238.604 287.501 199.708  1.00 78.60           O1-
ATOM   6058  O5'   C A 237     240.225 288.376 201.376  1.00 77.14           O  
ATOM   6059  C5'   C A 237     241.473 288.364 202.059  1.00 83.10           C  
ATOM   6060  C4'   C A 237     241.820 289.705 202.656  1.00 74.64           C  
ATOM   6061  O4'   C A 237     242.166 290.644 201.604  1.00 70.17           O  
ATOM   6062  C3'   C A 237     240.713 290.413 203.418  1.00 73.57           C  
ATOM   6063  O3'   C A 237     240.507 289.910 204.727  1.00 76.11           O  
ATOM   6064  C2'   C A 237     241.181 291.856 203.383  1.00 70.33           C  
ATOM   6065  O2'   C A 237     242.263 292.036 204.286  1.00 70.32           O  
ATOM   6066  C1'   C A 237     241.738 291.940 201.964  1.00 67.01           C  
ATOM   6067  N1    C A 237     240.730 292.403 200.974  1.00 65.69           N  
ATOM   6068  C2    C A 237     240.517 293.779 200.813  1.00 69.63           C  
ATOM   6069  O2    C A 237     241.168 294.561 201.513  1.00 74.74           O  
ATOM   6070  N3    C A 237     239.624 294.247 199.913  1.00 62.39           N  
ATOM   6071  C4    C A 237     238.958 293.374 199.175  1.00 62.28           C  
ATOM   6072  N4    C A 237     238.089 293.867 198.297  1.00 68.11           N  
ATOM   6073  C5    C A 237     239.142 291.966 199.301  1.00 63.49           C  
ATOM   6074  C6    C A 237     240.030 291.524 200.200  1.00 62.69           C  
ATOM   6075  P     C A 238     239.011 289.783 205.309  1.00 85.34           P  
ATOM   6076  OP1   C A 238     239.062 288.956 206.543  1.00 84.11           O  
ATOM   6077  OP2   C A 238     238.105 289.391 204.200  1.00 72.90           O1-
ATOM   6078  O5'   C A 238     238.645 291.266 205.747  1.00 71.24           O  
ATOM   6079  C5'   C A 238     239.427 291.933 206.722  1.00 66.81           C  
ATOM   6080  C4'   C A 238     239.065 293.388 206.798  1.00 63.92           C  
ATOM   6081  O4'   C A 238     239.271 294.011 205.504  1.00 60.48           O  
ATOM   6082  C3'   C A 238     237.612 293.698 207.126  1.00 65.89           C  
ATOM   6083  O3'   C A 238     237.315 293.585 208.520  1.00 66.44           O  
ATOM   6084  C2'   C A 238     237.455 295.111 206.578  1.00 64.91           C  
ATOM   6085  O2'   C A 238     238.015 296.047 207.486  1.00 62.48           O  
ATOM   6086  C1'   C A 238     238.349 295.065 205.329  1.00 58.74           C  
ATOM   6087  N1    C A 238     237.593 294.877 204.058  1.00 56.55           N  
ATOM   6088  C2    C A 238     236.792 295.916 203.565  1.00 54.68           C  
ATOM   6089  O2    C A 238     236.705 296.967 204.198  1.00 61.87           O  
ATOM   6090  N3    C A 238     236.101 295.794 202.420  1.00 52.12           N  
ATOM   6091  C4    C A 238     236.192 294.670 201.742  1.00 54.30           C  
ATOM   6092  N4    C A 238     235.489 294.593 200.617  1.00 58.15           N  
ATOM   6093  C5    C A 238     236.999 293.585 202.184  1.00 58.24           C  
ATOM   6094  C6    C A 238     237.678 293.727 203.330  1.00 59.04           C  
ATOM   6095  P     C A 239     235.798 293.392 209.054  1.00 60.53           P  
ATOM   6096  OP1   C A 239     235.802 293.216 210.524  1.00 56.73           O  
ATOM   6097  OP2   C A 239     235.139 292.358 208.216  1.00 58.70           O1-
ATOM   6098  O5'   C A 239     235.125 294.810 208.795  1.00 63.85           O  
ATOM   6099  C5'   C A 239     233.738 294.931 208.521  1.00 66.46           C  
ATOM   6100  C4'   C A 239     233.453 296.203 207.764  1.00 63.38           C  
ATOM   6101  O4'   C A 239     234.103 296.162 206.469  1.00 57.88           O  
ATOM   6102  C3'   C A 239     232.000 296.494 207.429  1.00 65.07           C  
ATOM   6103  O3'   C A 239     231.280 297.041 208.522  1.00 71.35           O  
ATOM   6104  C2'   C A 239     232.129 297.462 206.267  1.00 62.13           C  
ATOM   6105  O2'   C A 239     232.435 298.765 206.737  1.00 66.72           O  
ATOM   6106  C1'   C A 239     233.360 296.916 205.542  1.00 56.68           C  
ATOM   6107  N1    C A 239     232.993 296.060 204.401  1.00 58.27           N  
ATOM   6108  C2    C A 239     232.342 296.654 203.314  1.00 63.90           C  
ATOM   6109  O2    C A 239     232.091 297.871 203.330  1.00 63.76           O  
ATOM   6110  N3    C A 239     231.991 295.899 202.252  1.00 63.06           N  
ATOM   6111  C4    C A 239     232.270 294.600 202.247  1.00 61.32           C  
ATOM   6112  N4    C A 239     231.892 293.906 201.170  1.00 61.87           N  
ATOM   6113  C5    C A 239     232.935 293.972 203.342  1.00 62.66           C  
ATOM   6114  C6    C A 239     233.282 294.731 204.393  1.00 58.30           C  
ATOM   6115  P     C A 240     229.927 296.352 209.058  1.00 80.38           P  
ATOM   6116  OP1   C A 240     229.527 297.106 210.277  1.00 70.79           O  
ATOM   6117  OP2   C A 240     230.128 294.879 209.117  1.00 69.51           O1-
ATOM   6118  O5'   C A 240     228.845 296.620 207.921  1.00 66.69           O  
ATOM   6119  C5'   C A 240     228.522 297.936 207.512  1.00 64.46           C  
ATOM   6120  C4'   C A 240     228.097 297.947 206.072  1.00 61.08           C  
ATOM   6121  O4'   C A 240     229.104 297.302 205.260  1.00 61.30           O  
ATOM   6122  C3'   C A 240     226.832 297.175 205.770  1.00 60.40           C  
ATOM   6123  O3'   C A 240     225.683 297.950 206.030  1.00 68.93           O  
ATOM   6124  C2'   C A 240     226.982 296.819 204.296  1.00 59.79           C  
ATOM   6125  O2'   C A 240     226.547 297.892 203.476  1.00 65.23           O  
ATOM   6126  C1'   C A 240     228.499 296.682 204.150  1.00 57.92           C  
ATOM   6127  N1    C A 240     228.944 295.275 204.067  1.00 60.22           N  
ATOM   6128  C2    C A 240     228.817 294.618 202.842  1.00 60.82           C  
ATOM   6129  O2    C A 240     228.329 295.243 201.894  1.00 64.15           O  
ATOM   6130  N3    C A 240     229.221 293.332 202.712  1.00 60.35           N  
ATOM   6131  C4    C A 240     229.743 292.699 203.761  1.00 60.31           C  
ATOM   6132  N4    C A 240     230.129 291.430 203.605  1.00 56.33           N  
ATOM   6133  C5    C A 240     229.889 293.349 205.021  1.00 62.74           C  
ATOM   6134  C6    C A 240     229.486 294.628 205.134  1.00 65.34           C  
ATOM   6135  P     A A 241     224.385 297.261 206.654  1.00 80.35           P  
ATOM   6136  OP1   A A 241     223.711 296.473 205.590  1.00 71.60           O  
ATOM   6137  OP2   A A 241     223.623 298.309 207.376  1.00 80.90           O1-
ATOM   6138  O5'   A A 241     224.985 296.258 207.730  1.00 62.89           O  
ATOM   6139  C5'   A A 241     224.131 295.621 208.665  1.00 55.24           C  
ATOM   6140  C4'   A A 241     224.566 294.206 208.933  1.00 59.44           C  
ATOM   6141  O4'   A A 241     224.445 293.418 207.717  1.00 62.18           O  
ATOM   6142  C3'   A A 241     226.007 294.038 209.413  1.00 61.14           C  
ATOM   6143  O3'   A A 241     226.059 292.983 210.358  1.00 60.57           O  
ATOM   6144  C2'   A A 241     226.740 293.589 208.161  1.00 64.97           C  
ATOM   6145  O2'   A A 241     227.907 292.833 208.419  1.00 61.32           O  
ATOM   6146  C1'   A A 241     225.666 292.757 207.461  1.00 64.83           C  
ATOM   6147  N9    A A 241     225.855 292.658 206.011  1.00 64.66           N  
ATOM   6148  C8    A A 241     225.532 293.580 205.040  1.00 63.19           C  
ATOM   6149  N7    A A 241     225.847 293.199 203.825  1.00 60.01           N  
ATOM   6150  C5    A A 241     226.419 291.942 204.015  1.00 60.34           C  
ATOM   6151  C6    A A 241     226.966 290.998 203.128  1.00 61.79           C  
ATOM   6152  N6    A A 241     227.028 291.178 201.804  1.00 65.26           N  
ATOM   6153  N1    A A 241     227.453 289.848 203.647  1.00 56.80           N  
ATOM   6154  C2    A A 241     227.389 289.662 204.966  1.00 52.56           C  
ATOM   6155  N3    A A 241     226.900 290.469 205.901  1.00 56.61           N  
ATOM   6156  C4    A A 241     226.424 291.598 205.354  1.00 59.52           C  
ATOM   6157  P     G A 242     226.221 293.324 211.910  1.00 68.50           P  
ATOM   6158  OP1   G A 242     225.085 294.192 212.314  1.00 64.32           O  
ATOM   6159  OP2   G A 242     227.606 293.818 212.118  1.00 66.41           O1-
ATOM   6160  O5'   G A 242     226.061 291.905 212.615  1.00 64.14           O  
ATOM   6161  C5'   G A 242     224.775 291.394 212.941  1.00 55.10           C  
ATOM   6162  C4'   G A 242     224.099 290.792 211.744  1.00 48.58           C  
ATOM   6163  O4'   G A 242     224.999 289.840 211.106  1.00 48.75           O  
ATOM   6164  C3'   G A 242     222.814 290.014 212.039  1.00 47.89           C  
ATOM   6165  O3'   G A 242     221.980 290.117 210.874  1.00 55.72           O  
ATOM   6166  C2'   G A 242     223.348 288.596 212.143  1.00 44.60           C  
ATOM   6167  O2'   G A 242     222.386 287.576 212.023  1.00 54.20           O  
ATOM   6168  C1'   G A 242     224.316 288.614 210.978  1.00 47.11           C  
ATOM   6169  N9    G A 242     225.234 287.486 210.877  1.00 47.78           N  
ATOM   6170  C8    G A 242     225.724 286.691 211.867  1.00 51.83           C  
ATOM   6171  N7    G A 242     226.488 285.742 211.396  1.00 55.22           N  
ATOM   6172  C5    G A 242     226.476 285.907 210.020  1.00 51.30           C  
ATOM   6173  C6    G A 242     227.118 285.170 208.988  1.00 53.45           C  
ATOM   6174  O6    G A 242     227.857 284.181 209.088  1.00 58.12           O  
ATOM   6175  N1    G A 242     226.835 285.684 207.731  1.00 51.84           N  
ATOM   6176  C2    G A 242     226.029 286.767 207.501  1.00 53.47           C  
ATOM   6177  N2    G A 242     225.866 287.121 206.218  1.00 55.16           N  
ATOM   6178  N3    G A 242     225.427 287.457 208.456  1.00 53.87           N  
ATOM   6179  C4    G A 242     225.692 286.975 209.686  1.00 49.38           C  
ATOM   6180  P     U A 243     220.388 289.830 210.899  1.00 63.30           P  
ATOM   6181  OP1   U A 243     219.872 290.050 212.271  1.00 57.81           O  
ATOM   6182  OP2   U A 243     220.120 288.537 210.218  1.00 56.17           O1-
ATOM   6183  O5'   U A 243     219.781 290.947 209.930  1.00 60.62           O  
ATOM   6184  C5'   U A 243     219.409 292.235 210.411  1.00 64.39           C  
ATOM   6185  C4'   U A 243     219.611 293.296 209.358  1.00 59.45           C  
ATOM   6186  O4'   U A 243     221.002 293.313 208.959  1.00 60.81           O  
ATOM   6187  C3'   U A 243     218.853 293.078 208.062  1.00 60.42           C  
ATOM   6188  O3'   U A 243     217.528 293.562 208.128  1.00 64.82           O  
ATOM   6189  C2'   U A 243     219.705 293.805 207.033  1.00 61.72           C  
ATOM   6190  O2'   U A 243     219.443 295.203 207.073  1.00 60.57           O  
ATOM   6191  C1'   U A 243     221.110 293.566 207.575  1.00 57.66           C  
ATOM   6192  N1    U A 243     221.817 292.420 206.961  1.00 49.93           N  
ATOM   6193  C2    U A 243     222.325 292.510 205.686  1.00 51.92           C  
ATOM   6194  O2    U A 243     222.179 293.482 204.977  1.00 62.10           O  
ATOM   6195  N3    U A 243     223.000 291.406 205.237  1.00 53.08           N  
ATOM   6196  C4    U A 243     223.239 290.251 205.939  1.00 54.44           C  
ATOM   6197  O4    U A 243     223.864 289.325 205.426  1.00 56.13           O  
ATOM   6198  C5    U A 243     222.697 290.247 207.254  1.00 53.68           C  
ATOM   6199  C6    U A 243     222.031 291.303 207.709  1.00 48.97           C  
ATOM   6200  P     A A 244     216.332 292.666 207.551  1.00 77.28           P  
ATOM   6201  OP1   A A 244     215.047 293.341 207.855  1.00 77.47           O  
ATOM   6202  OP2   A A 244     216.578 291.266 207.983  1.00 68.92           O1-
ATOM   6203  O5'   A A 244     216.540 292.714 205.977  1.00 64.32           O  
ATOM   6204  C5'   A A 244     216.426 293.930 205.262  1.00 63.13           C  
ATOM   6205  C4'   A A 244     216.452 293.660 203.785  1.00 63.63           C  
ATOM   6206  O4'   A A 244     217.799 293.313 203.378  1.00 62.97           O  
ATOM   6207  C3'   A A 244     215.613 292.479 203.344  1.00 64.48           C  
ATOM   6208  O3'   A A 244     214.252 292.822 203.187  1.00 73.65           O  
ATOM   6209  C2'   A A 244     216.299 292.038 202.058  1.00 64.60           C  
ATOM   6210  O2'   A A 244     215.935 292.885 200.977  1.00 70.67           O  
ATOM   6211  C1'   A A 244     217.764 292.297 202.401  1.00 60.59           C  
ATOM   6212  N9    A A 244     218.440 291.113 202.963  1.00 57.38           N  
ATOM   6213  C8    A A 244     218.656 290.828 204.286  1.00 53.97           C  
ATOM   6214  N7    A A 244     219.302 289.709 204.494  1.00 52.21           N  
ATOM   6215  C5    A A 244     219.529 289.234 203.216  1.00 49.82           C  
ATOM   6216  C6    A A 244     220.163 288.089 202.741  1.00 51.68           C  
ATOM   6217  N6    A A 244     220.708 287.175 203.535  1.00 54.57           N  
ATOM   6218  N1    A A 244     220.228 287.901 201.411  1.00 55.89           N  
ATOM   6219  C2    A A 244     219.670 288.808 200.615  1.00 55.70           C  
ATOM   6220  N3    A A 244     219.054 289.936 200.938  1.00 58.57           N  
ATOM   6221  C4    A A 244     219.014 290.085 202.267  1.00 56.72           C  
ATOM   6222  P     G A 245     213.117 291.755 203.562  1.00 87.09           P  
ATOM   6223  OP1   G A 245     211.813 292.471 203.544  1.00 83.01           O  
ATOM   6224  OP2   G A 245     213.538 291.055 204.809  1.00 72.82           O1-
ATOM   6225  O5'   G A 245     213.156 290.742 202.327  1.00 79.08           O  
ATOM   6226  C5'   G A 245     213.061 289.336 202.514  1.00 79.23           C  
ATOM   6227  C4'   G A 245     214.098 288.595 201.702  1.00 73.59           C  
ATOM   6228  O4'   G A 245     215.426 288.925 202.196  1.00 72.30           O  
ATOM   6229  C3'   G A 245     214.047 287.073 201.774  1.00 70.71           C  
ATOM   6230  O3'   G A 245     213.064 286.500 200.922  1.00 71.71           O  
ATOM   6231  C2'   G A 245     215.477 286.685 201.422  1.00 67.26           C  
ATOM   6232  O2'   G A 245     215.701 286.830 200.025  1.00 63.58           O  
ATOM   6233  C1'   G A 245     216.263 287.786 202.133  1.00 68.82           C  
ATOM   6234  N9    G A 245     216.662 287.412 203.512  1.00 60.84           N  
ATOM   6235  C8    G A 245     216.416 288.145 204.646  1.00 58.83           C  
ATOM   6236  N7    G A 245     216.877 287.603 205.732  1.00 54.99           N  
ATOM   6237  C5    G A 245     217.478 286.438 205.295  1.00 52.56           C  
ATOM   6238  C6    G A 245     218.155 285.433 206.026  1.00 54.44           C  
ATOM   6239  O6    G A 245     218.372 285.363 207.240  1.00 59.38           O  
ATOM   6240  N1    G A 245     218.618 284.416 205.217  1.00 52.97           N  
ATOM   6241  C2    G A 245     218.440 284.378 203.866  1.00 56.15           C  
ATOM   6242  N2    G A 245     218.951 283.316 203.234  1.00 59.47           N  
ATOM   6243  N3    G A 245     217.816 285.305 203.168  1.00 58.41           N  
ATOM   6244  C4    G A 245     217.362 286.307 203.936  1.00 54.09           C  
ATOM   6245  P     C A 246     211.938 285.504 201.506  1.00 66.85           P  
ATOM   6246  OP1   C A 246     210.781 285.553 200.576  1.00 68.39           O  
ATOM   6247  OP2   C A 246     211.728 285.765 202.952  1.00 64.48           O1-
ATOM   6248  O5'   C A 246     212.603 284.065 201.403  1.00 58.95           O  
ATOM   6249  C5'   C A 246     213.378 283.699 200.273  1.00 55.36           C  
ATOM   6250  C4'   C A 246     214.298 282.560 200.614  1.00 58.25           C  
ATOM   6251  O4'   C A 246     215.378 283.019 201.470  1.00 58.54           O  
ATOM   6252  C3'   C A 246     213.663 281.438 201.406  1.00 56.27           C  
ATOM   6253  O3'   C A 246     212.917 280.559 200.591  1.00 54.17           O  
ATOM   6254  C2'   C A 246     214.862 280.783 202.080  1.00 54.83           C  
ATOM   6255  O2'   C A 246     215.546 279.923 201.183  1.00 60.65           O  
ATOM   6256  C1'   C A 246     215.756 281.989 202.360  1.00 51.75           C  
ATOM   6257  N1    C A 246     215.604 282.471 203.744  1.00 49.93           N  
ATOM   6258  C2    C A 246     216.008 281.646 204.793  1.00 49.52           C  
ATOM   6259  O2    C A 246     216.487 280.534 204.552  1.00 53.66           O  
ATOM   6260  N3    C A 246     215.878 282.066 206.066  1.00 52.06           N  
ATOM   6261  C4    C A 246     215.365 283.269 206.296  1.00 55.49           C  
ATOM   6262  N4    C A 246     215.247 283.661 207.565  1.00 58.09           N  
ATOM   6263  C5    C A 246     214.944 284.133 205.243  1.00 60.04           C  
ATOM   6264  C6    C A 246     215.079 283.698 203.989  1.00 57.76           C  
ATOM   6265  P     G A 247     211.498 280.022 201.095  1.00 54.55           P  
ATOM   6266  OP1   G A 247     211.043 278.972 200.152  1.00 58.29           O  
ATOM   6267  OP2   G A 247     210.632 281.178 201.421  1.00 63.98           O1-
ATOM   6268  O5'   G A 247     211.841 279.271 202.444  1.00 52.24           O  
ATOM   6269  C5'   G A 247     212.650 278.119 202.394  1.00 53.20           C  
ATOM   6270  C4'   G A 247     213.034 277.652 203.765  1.00 51.94           C  
ATOM   6271  O4'   G A 247     213.790 278.666 204.460  1.00 50.47           O  
ATOM   6272  C3'   G A 247     211.895 277.348 204.716  1.00 53.56           C  
ATOM   6273  O3'   G A 247     211.290 276.095 204.427  1.00 58.33           O  
ATOM   6274  C2'   G A 247     212.596 277.384 206.069  1.00 48.49           C  
ATOM   6275  O2'   G A 247     213.289 276.169 206.305  1.00 51.22           O  
ATOM   6276  C1'   G A 247     213.636 278.488 205.851  1.00 49.91           C  
ATOM   6277  N9    G A 247     213.242 279.753 206.485  1.00 50.79           N  
ATOM   6278  C8    G A 247     212.559 280.788 205.915  1.00 58.75           C  
ATOM   6279  N7    G A 247     212.352 281.768 206.750  1.00 59.51           N  
ATOM   6280  C5    G A 247     212.923 281.346 207.939  1.00 55.59           C  
ATOM   6281  C6    G A 247     213.002 281.994 209.198  1.00 62.19           C  
ATOM   6282  O6    G A 247     212.574 283.105 209.529  1.00 65.26           O  
ATOM   6283  N1    G A 247     213.663 281.221 210.135  1.00 55.85           N  
ATOM   6284  C2    G A 247     214.181 279.985 209.881  1.00 51.15           C  
ATOM   6285  N2    G A 247     214.783 279.405 210.922  1.00 57.43           N  
ATOM   6286  N3    G A 247     214.121 279.365 208.717  1.00 47.58           N  
ATOM   6287  C4    G A 247     213.479 280.100 207.792  1.00 47.04           C  
ATOM   6288  P     G A 248     209.700 275.876 204.544  1.00 56.07           P  
ATOM   6289  OP1   G A 248     209.399 274.529 203.980  1.00 48.83           O  
ATOM   6290  OP2   G A 248     209.030 277.075 203.973  1.00 53.70           O1-
ATOM   6291  O5'   G A 248     209.457 275.799 206.118  1.00 55.19           O  
ATOM   6292  C5'   G A 248     210.169 274.861 206.913  1.00 53.32           C  
ATOM   6293  C4'   G A 248     209.338 273.638 207.168  1.00 49.95           C  
ATOM   6294  O4'   G A 248     210.131 272.574 207.735  1.00 51.47           O  
ATOM   6295  C3'   G A 248     208.225 273.790 208.173  1.00 48.64           C  
ATOM   6296  O3'   G A 248     207.129 274.518 207.686  1.00 56.81           O  
ATOM   6297  C2'   G A 248     207.889 272.350 208.488  1.00 50.75           C  
ATOM   6298  O2'   G A 248     207.121 271.786 207.438  1.00 56.47           O  
ATOM   6299  C1'   G A 248     209.277 271.713 208.458  1.00 52.02           C  
ATOM   6300  N9    G A 248     209.779 271.467 209.813  1.00 51.32           N  
ATOM   6301  C8    G A 248     209.801 272.313 210.883  1.00 49.93           C  
ATOM   6302  N7    G A 248     210.269 271.732 211.956  1.00 53.95           N  
ATOM   6303  C5    G A 248     210.542 270.425 211.562  1.00 52.79           C  
ATOM   6304  C6    G A 248     211.062 269.314 212.271  1.00 52.43           C  
ATOM   6305  O6    G A 248     211.410 269.238 213.450  1.00 58.43           O  
ATOM   6306  N1    G A 248     211.174 268.189 211.478  1.00 45.95           N  
ATOM   6307  C2    G A 248     210.829 268.132 210.163  1.00 45.13           C  
ATOM   6308  N2    G A 248     211.009 266.956 209.559  1.00 53.34           N  
ATOM   6309  N3    G A 248     210.344 269.144 209.482  1.00 47.60           N  
ATOM   6310  C4    G A 248     210.233 270.249 210.241  1.00 50.54           C  
ATOM   6311  P     C A 249     206.284 275.390 208.721  1.00 68.41           P  
ATOM   6312  OP1   C A 249     206.047 274.540 209.923  1.00 63.02           O  
ATOM   6313  OP2   C A 249     205.127 275.944 207.969  1.00 67.20           O1-
ATOM   6314  O5'   C A 249     207.278 276.576 209.122  1.00 55.69           O  
ATOM   6315  C5'   C A 249     207.678 277.559 208.167  1.00 52.25           C  
ATOM   6316  C4'   C A 249     208.725 278.495 208.723  1.00 51.35           C  
ATOM   6317  O4'   C A 249     209.400 279.180 207.630  1.00 51.52           O  
ATOM   6318  C3'   C A 249     208.219 279.598 209.652  1.00 53.82           C  
ATOM   6319  O3'   C A 249     209.266 279.897 210.569  1.00 54.04           O  
ATOM   6320  C2'   C A 249     208.076 280.777 208.701  1.00 51.12           C  
ATOM   6321  O2'   C A 249     208.074 282.046 209.322  1.00 51.27           O  
ATOM   6322  C1'   C A 249     209.307 280.577 207.831  1.00 48.77           C  
ATOM   6323  N1    C A 249     209.256 281.243 206.529  1.00 53.43           N  
ATOM   6324  C2    C A 249     209.506 282.612 206.512  1.00 55.99           C  
ATOM   6325  O2    C A 249     209.736 283.192 207.584  1.00 55.83           O  
ATOM   6326  N3    C A 249     209.485 283.262 205.331  1.00 58.89           N  
ATOM   6327  C4    C A 249     209.231 282.582 204.212  1.00 61.90           C  
ATOM   6328  N4    C A 249     209.218 283.279 203.079  1.00 67.75           N  
ATOM   6329  C5    C A 249     208.980 281.178 204.195  1.00 58.53           C  
ATOM   6330  C6    C A 249     209.008 280.551 205.376  1.00 57.58           C  
ATOM   6331  P     G A 250     208.936 280.370 212.063  1.00 55.14           P  
ATOM   6332  OP1   G A 250     207.460 280.355 212.224  1.00 54.04           O  
ATOM   6333  OP2   G A 250     209.686 281.630 212.314  1.00 54.15           O1-
ATOM   6334  O5'   G A 250     209.583 279.216 212.958  1.00 54.08           O  
ATOM   6335  C5'   G A 250     210.957 278.867 212.829  1.00 52.20           C  
ATOM   6336  C4'   G A 250     211.240 277.499 213.404  1.00 49.24           C  
ATOM   6337  O4'   G A 250     210.805 276.485 212.469  1.00 49.43           O  
ATOM   6338  C3'   G A 250     212.699 277.151 213.662  1.00 48.27           C  
ATOM   6339  O3'   G A 250     213.187 277.684 214.881  1.00 54.32           O  
ATOM   6340  C2'   G A 250     212.678 275.634 213.645  1.00 47.13           C  
ATOM   6341  O2'   G A 250     212.147 275.134 214.864  1.00 50.01           O  
ATOM   6342  C1'   G A 250     211.655 275.363 212.549  1.00 47.89           C  
ATOM   6343  N9    G A 250     212.273 275.148 211.228  1.00 48.70           N  
ATOM   6344  C8    G A 250     212.118 275.953 210.136  1.00 52.30           C  
ATOM   6345  N7    G A 250     212.754 275.522 209.083  1.00 51.79           N  
ATOM   6346  C5    G A 250     213.363 274.357 209.500  1.00 44.46           C  
ATOM   6347  C6    G A 250     214.182 273.462 208.786  1.00 41.41           C  
ATOM   6348  O6    G A 250     214.551 273.519 207.615  1.00 46.19           O  
ATOM   6349  N1    G A 250     214.596 272.416 209.572  1.00 41.05           N  
ATOM   6350  C2    G A 250     214.251 272.252 210.878  1.00 43.99           C  
ATOM   6351  N2    G A 250     214.743 271.166 211.482  1.00 47.58           N  
ATOM   6352  N3    G A 250     213.481 273.073 211.559  1.00 47.48           N  
ATOM   6353  C4    G A 250     213.073 274.108 210.814  1.00 46.32           C  
ATOM   6354  P     A A 251     214.663 278.315 214.968  1.00 53.31           P  
ATOM   6355  OP1   A A 251     214.847 278.807 216.351  1.00 60.76           O  
ATOM   6356  OP2   A A 251     214.873 279.259 213.844  1.00 57.14           O1-
ATOM   6357  O5'   A A 251     215.638 277.073 214.802  1.00 49.14           O  
ATOM   6358  C5'   A A 251     216.027 276.301 215.928  1.00 53.76           C  
ATOM   6359  C4'   A A 251     216.915 275.164 215.505  1.00 55.15           C  
ATOM   6360  O4'   A A 251     216.229 274.409 214.481  1.00 54.44           O  
ATOM   6361  C3'   A A 251     218.235 275.575 214.870  1.00 54.79           C  
ATOM   6362  O3'   A A 251     219.259 275.723 215.835  1.00 59.60           O  
ATOM   6363  C2'   A A 251     218.517 274.466 213.870  1.00 50.06           C  
ATOM   6364  O2'   A A 251     219.141 273.363 214.509  1.00 51.12           O  
ATOM   6365  C1'   A A 251     217.110 274.061 213.446  1.00 48.66           C  
ATOM   6366  N9    A A 251     216.670 274.784 212.254  1.00 43.95           N  
ATOM   6367  C8    A A 251     215.831 275.852 212.219  1.00 48.49           C  
ATOM   6368  N7    A A 251     215.614 276.293 211.012  1.00 51.46           N  
ATOM   6369  C5    A A 251     216.364 275.449 210.215  1.00 48.27           C  
ATOM   6370  C6    A A 251     216.571 275.397 208.835  1.00 47.42           C  
ATOM   6371  N6    A A 251     216.004 276.236 207.981  1.00 54.40           N  
ATOM   6372  N1    A A 251     217.367 274.440 208.345  1.00 45.65           N  
ATOM   6373  C2    A A 251     217.920 273.605 209.222  1.00 48.05           C  
ATOM   6374  N3    A A 251     217.812 273.553 210.545  1.00 45.31           N  
ATOM   6375  C4    A A 251     217.008 274.516 210.974  1.00 42.27           C  
ATOM   6376  P     G A 252     220.398 276.833 215.636  1.00 69.21           P  
ATOM   6377  OP1   G A 252     221.116 276.984 216.928  1.00 64.00           O  
ATOM   6378  OP2   G A 252     219.785 278.016 214.978  1.00 64.48           O1-
ATOM   6379  O5'   G A 252     221.372 276.188 214.557  1.00 67.64           O  
ATOM   6380  C5'   G A 252     221.916 276.979 213.511  1.00 66.98           C  
ATOM   6381  C4'   G A 252     221.521 276.445 212.160  1.00 60.42           C  
ATOM   6382  O4'   G A 252     220.075 276.478 212.034  1.00 56.20           O  
ATOM   6383  C3'   G A 252     222.020 277.237 210.962  1.00 62.06           C  
ATOM   6384  O3'   G A 252     223.360 276.920 210.609  1.00 64.86           O  
ATOM   6385  C2'   G A 252     221.004 276.881 209.886  1.00 61.47           C  
ATOM   6386  O2'   G A 252     221.295 275.614 209.309  1.00 59.00           O  
ATOM   6387  C1'   G A 252     219.714 276.773 210.705  1.00 57.13           C  
ATOM   6388  N9    G A 252     218.964 278.042 210.695  1.00 56.61           N  
ATOM   6389  C8    G A 252     218.638 278.868 211.747  1.00 57.67           C  
ATOM   6390  N7    G A 252     217.977 279.932 211.365  1.00 58.44           N  
ATOM   6391  C5    G A 252     217.870 279.794 209.981  1.00 56.18           C  
ATOM   6392  C6    G A 252     217.267 280.622 209.000  1.00 52.81           C  
ATOM   6393  O6    G A 252     216.674 281.690 209.143  1.00 57.19           O  
ATOM   6394  N1    G A 252     217.393 280.104 207.728  1.00 49.80           N  
ATOM   6395  C2    G A 252     218.027 278.928 207.437  1.00 50.63           C  
ATOM   6396  N2    G A 252     218.065 278.572 206.151  1.00 59.69           N  
ATOM   6397  N3    G A 252     218.590 278.141 208.322  1.00 49.85           N  
ATOM   6398  C4    G A 252     218.475 278.635 209.564  1.00 53.65           C  
ATOM   6399  P     C A 253     224.378 278.068 210.122  1.00 63.88           P  
ATOM   6400  OP1   C A 253     225.756 277.508 210.123  1.00 55.35           O  
ATOM   6401  OP2   C A 253     224.073 279.290 210.911  1.00 58.67           O1-
ATOM   6402  O5'   C A 253     223.942 278.355 208.615  1.00 63.48           O  
ATOM   6403  C5'   C A 253     223.704 277.293 207.699  1.00 62.67           C  
ATOM   6404  C4'   C A 253     223.114 277.791 206.399  1.00 63.04           C  
ATOM   6405  O4'   C A 253     221.702 278.100 206.567  1.00 58.25           O  
ATOM   6406  C3'   C A 253     223.698 279.081 205.839  1.00 65.89           C  
ATOM   6407  O3'   C A 253     224.951 278.930 205.192  1.00 64.12           O  
ATOM   6408  C2'   C A 253     222.585 279.569 204.928  1.00 59.43           C  
ATOM   6409  O2'   C A 253     222.553 278.813 203.723  1.00 56.60           O  
ATOM   6410  C1'   C A 253     221.357 279.216 205.763  1.00 59.12           C  
ATOM   6411  N1    C A 253     220.949 280.337 206.653  1.00 55.66           N  
ATOM   6412  C2    C A 253     220.530 281.571 206.125  1.00 53.14           C  
ATOM   6413  O2    C A 253     220.497 281.753 204.903  1.00 56.65           O  
ATOM   6414  N3    C A 253     220.158 282.563 206.959  1.00 52.35           N  
ATOM   6415  C4    C A 253     220.188 282.366 208.274  1.00 53.32           C  
ATOM   6416  N4    C A 253     219.818 283.370 209.067  1.00 59.24           N  
ATOM   6417  C5    C A 253     220.608 281.139 208.848  1.00 54.49           C  
ATOM   6418  C6    C A 253     220.972 280.169 208.010  1.00 56.83           C  
ATOM   6419  P     G A 254     226.087 280.047 205.405  1.00 65.77           P  
ATOM   6420  OP1   G A 254     227.238 279.727 204.515  1.00 60.29           O  
ATOM   6421  OP2   G A 254     226.298 280.185 206.868  1.00 62.97           O1-
ATOM   6422  O5'   G A 254     225.400 281.388 204.893  1.00 55.50           O  
ATOM   6423  C5'   G A 254     224.936 281.472 203.559  1.00 55.00           C  
ATOM   6424  C4'   G A 254     224.177 282.742 203.310  1.00 53.48           C  
ATOM   6425  O4'   G A 254     222.977 282.804 204.120  1.00 52.65           O  
ATOM   6426  C3'   G A 254     224.906 284.014 203.665  1.00 53.38           C  
ATOM   6427  O3'   G A 254     225.907 284.347 202.728  1.00 55.58           O  
ATOM   6428  C2'   G A 254     223.763 285.010 203.767  1.00 49.39           C  
ATOM   6429  O2'   G A 254     223.283 285.361 202.479  1.00 50.72           O  
ATOM   6430  C1'   G A 254     222.707 284.150 204.458  1.00 50.24           C  
ATOM   6431  N9    G A 254     222.838 284.279 205.911  1.00 53.68           N  
ATOM   6432  C8    G A 254     223.640 283.496 206.696  1.00 56.79           C  
ATOM   6433  N7    G A 254     223.601 283.852 207.946  1.00 59.79           N  
ATOM   6434  C5    G A 254     222.732 284.938 207.980  1.00 53.95           C  
ATOM   6435  C6    G A 254     222.306 285.729 209.073  1.00 49.93           C  
ATOM   6436  O6    G A 254     222.620 285.626 210.263  1.00 55.88           O  
ATOM   6437  N1    G A 254     221.429 286.718 208.680  1.00 44.47           N  
ATOM   6438  C2    G A 254     221.024 286.916 207.399  1.00 47.96           C  
ATOM   6439  N2    G A 254     220.169 287.933 207.226  1.00 59.85           N  
ATOM   6440  N3    G A 254     221.407 286.189 206.365  1.00 49.76           N  
ATOM   6441  C4    G A 254     222.260 285.220 206.725  1.00 50.50           C  
ATOM   6442  P     A A 255     227.097 285.330 203.152  1.00 55.47           P  
ATOM   6443  OP1   A A 255     228.244 284.993 202.274  1.00 54.86           O  
ATOM   6444  OP2   A A 255     227.284 285.285 204.628  1.00 54.16           O1-
ATOM   6445  O5'   A A 255     226.508 286.759 202.760  1.00 61.69           O  
ATOM   6446  C5'   A A 255     226.935 287.437 201.586  1.00 65.82           C  
ATOM   6447  C4'   A A 255     225.959 287.335 200.430  1.00 61.97           C  
ATOM   6448  O4'   A A 255     224.576 287.403 200.878  1.00 59.49           O  
ATOM   6449  C3'   A A 255     226.065 288.456 199.415  1.00 58.69           C  
ATOM   6450  O3'   A A 255     227.178 288.302 198.551  1.00 57.83           O  
ATOM   6451  C2'   A A 255     224.702 288.411 198.731  1.00 56.82           C  
ATOM   6452  O2'   A A 255     224.639 287.331 197.815  1.00 60.63           O  
ATOM   6453  C1'   A A 255     223.790 288.084 199.916  1.00 53.21           C  
ATOM   6454  N9    A A 255     223.234 289.293 200.552  1.00 51.44           N  
ATOM   6455  C8    A A 255     223.504 289.726 201.819  1.00 55.58           C  
ATOM   6456  N7    A A 255     222.890 290.825 202.176  1.00 55.59           N  
ATOM   6457  C5    A A 255     222.150 291.149 201.056  1.00 53.57           C  
ATOM   6458  C6    A A 255     221.277 292.219 200.794  1.00 53.52           C  
ATOM   6459  N6    A A 255     221.007 293.180 201.673  1.00 57.10           N  
ATOM   6460  N1    A A 255     220.680 292.283 199.595  1.00 52.81           N  
ATOM   6461  C2    A A 255     220.975 291.309 198.731  1.00 60.34           C  
ATOM   6462  N3    A A 255     221.779 290.248 198.853  1.00 59.05           N  
ATOM   6463  C4    A A 255     222.356 290.221 200.056  1.00 52.23           C  
ATOM   6464  P     A A 256     228.238 289.502 198.370  1.00 66.29           P  
ATOM   6465  OP1   A A 256     229.471 288.906 197.803  1.00 68.94           O  
ATOM   6466  OP2   A A 256     228.392 290.282 199.628  1.00 58.14           O1-
ATOM   6467  O5'   A A 256     227.545 290.424 197.259  1.00 70.92           O  
ATOM   6468  C5'   A A 256     227.003 289.865 196.060  1.00 67.33           C  
ATOM   6469  C4'   A A 256     225.896 290.713 195.468  1.00 62.22           C  
ATOM   6470  O4'   A A 256     224.750 290.714 196.361  1.00 59.10           O  
ATOM   6471  C3'   A A 256     226.218 292.191 195.255  1.00 68.92           C  
ATOM   6472  O3'   A A 256     226.893 292.443 194.027  1.00 69.50           O  
ATOM   6473  C2'   A A 256     224.852 292.862 195.356  1.00 63.82           C  
ATOM   6474  O2'   A A 256     224.131 292.735 194.138  1.00 63.20           O  
ATOM   6475  C1'   A A 256     224.166 291.999 196.407  1.00 60.42           C  
ATOM   6476  N9    A A 256     224.320 292.528 197.780  1.00 60.45           N  
ATOM   6477  C8    A A 256     225.002 291.933 198.814  1.00 61.39           C  
ATOM   6478  N7    A A 256     224.963 292.595 199.940  1.00 60.78           N  
ATOM   6479  C5    A A 256     224.193 293.706 199.636  1.00 58.87           C  
ATOM   6480  C6    A A 256     223.781 294.794 200.421  1.00 57.14           C  
ATOM   6481  N6    A A 256     224.100 294.956 201.711  1.00 57.69           N  
ATOM   6482  N1    A A 256     223.024 295.728 199.821  1.00 58.69           N  
ATOM   6483  C2    A A 256     222.711 295.565 198.530  1.00 60.86           C  
ATOM   6484  N3    A A 256     223.032 294.590 197.688  1.00 58.01           N  
ATOM   6485  C4    A A 256     223.786 293.677 198.312  1.00 58.07           C  
ATOM   6486  P     C A 257     227.971 293.640 193.895  1.00 80.68           P  
ATOM   6487  OP1   C A 257     228.498 293.654 192.507  1.00 76.71           O  
ATOM   6488  OP2   C A 257     228.932 293.548 195.032  1.00 72.93           O1-
ATOM   6489  O5'   C A 257     227.103 294.968 194.041  1.00 68.00           O  
ATOM   6490  C5'   C A 257     226.089 295.289 193.101  1.00 61.87           C  
ATOM   6491  C4'   C A 257     225.229 296.434 193.576  1.00 64.28           C  
ATOM   6492  O4'   C A 257     224.566 296.102 194.827  1.00 62.76           O  
ATOM   6493  C3'   C A 257     225.948 297.739 193.877  1.00 66.51           C  
ATOM   6494  O3'   C A 257     226.264 298.472 192.706  1.00 69.16           O  
ATOM   6495  C2'   C A 257     224.959 298.450 194.794  1.00 69.56           C  
ATOM   6496  O2'   C A 257     223.909 299.043 194.045  1.00 74.69           O  
ATOM   6497  C1'   C A 257     224.386 297.275 195.598  1.00 65.65           C  
ATOM   6498  N1    C A 257     225.084 297.116 196.895  1.00 63.97           N  
ATOM   6499  C2    C A 257     224.990 298.136 197.852  1.00 65.66           C  
ATOM   6500  O2    C A 257     224.318 299.153 197.631  1.00 68.66           O  
ATOM   6501  N3    C A 257     225.641 298.004 199.022  1.00 65.25           N  
ATOM   6502  C4    C A 257     226.360 296.912 199.258  1.00 65.53           C  
ATOM   6503  N4    C A 257     226.978 296.837 200.435  1.00 69.75           N  
ATOM   6504  C5    C A 257     226.476 295.852 198.315  1.00 62.17           C  
ATOM   6505  C6    C A 257     225.827 296.000 197.156  1.00 62.82           C  
ATOM   6506  P     G A 258     227.740 299.070 192.482  1.00 71.05           P  
ATOM   6507  OP1   G A 258     227.678 299.960 191.294  1.00 68.33           O  
ATOM   6508  OP2   G A 258     228.718 297.945 192.516  1.00 70.29           O1-
ATOM   6509  O5'   G A 258     227.972 300.010 193.746  1.00 68.74           O  
ATOM   6510  C5'   G A 258     227.230 301.208 193.928  1.00 68.33           C  
ATOM   6511  C4'   G A 258     227.433 301.763 195.316  1.00 73.36           C  
ATOM   6512  O4'   G A 258     226.923 300.808 196.289  1.00 72.53           O  
ATOM   6513  C3'   G A 258     228.880 301.981 195.743  1.00 72.64           C  
ATOM   6514  O3'   G A 258     229.460 303.178 195.253  1.00 74.00           O  
ATOM   6515  C2'   G A 258     228.789 301.899 197.259  1.00 69.85           C  
ATOM   6516  O2'   G A 258     228.226 303.090 197.791  1.00 68.23           O  
ATOM   6517  C1'   G A 258     227.777 300.765 197.418  1.00 71.35           C  
ATOM   6518  N9    G A 258     228.454 299.452 197.425  1.00 65.20           N  
ATOM   6519  C8    G A 258     228.576 298.597 196.357  1.00 66.08           C  
ATOM   6520  N7    G A 258     229.248 297.509 196.618  1.00 66.05           N  
ATOM   6521  C5    G A 258     229.599 297.653 197.946  1.00 61.45           C  
ATOM   6522  C6    G A 258     230.338 296.785 198.775  1.00 61.20           C  
ATOM   6523  O6    G A 258     230.834 295.688 198.487  1.00 60.10           O  
ATOM   6524  N1    G A 258     230.466 297.314 200.057  1.00 64.22           N  
ATOM   6525  C2    G A 258     229.951 298.521 200.473  1.00 62.46           C  
ATOM   6526  N2    G A 258     230.175 298.875 201.745  1.00 62.35           N  
ATOM   6527  N3    G A 258     229.263 299.337 199.704  1.00 62.29           N  
ATOM   6528  C4    G A 258     229.123 298.843 198.461  1.00 62.48           C  
ATOM   6529  P     G A 259     231.030 303.213 194.890  1.00 80.05           P  
ATOM   6530  OP1   G A 259     231.319 304.461 194.136  1.00 78.44           O  
ATOM   6531  OP2   G A 259     231.429 301.903 194.316  1.00 72.30           O1-
ATOM   6532  O5'   G A 259     231.731 303.339 196.309  1.00 74.67           O  
ATOM   6533  C5'   G A 259     231.340 304.379 197.187  1.00 76.57           C  
ATOM   6534  C4'   G A 259     231.961 304.231 198.547  1.00 73.22           C  
ATOM   6535  O4'   G A 259     231.327 303.150 199.288  1.00 69.99           O  
ATOM   6536  C3'   G A 259     233.430 303.866 198.593  1.00 73.85           C  
ATOM   6537  O3'   G A 259     234.313 304.929 198.258  1.00 78.21           O  
ATOM   6538  C2'   G A 259     233.561 303.370 200.022  1.00 77.00           C  
ATOM   6539  O2'   G A 259     233.498 304.455 200.941  1.00 73.18           O  
ATOM   6540  C1'   G A 259     232.275 302.559 200.158  1.00 68.49           C  
ATOM   6541  N9    G A 259     232.518 301.176 199.725  1.00 65.75           N  
ATOM   6542  C8    G A 259     232.095 300.609 198.559  1.00 70.02           C  
ATOM   6543  N7    G A 259     232.489 299.373 198.421  1.00 73.05           N  
ATOM   6544  C5    G A 259     233.238 299.109 199.556  1.00 67.38           C  
ATOM   6545  C6    G A 259     233.920 297.923 199.953  1.00 64.36           C  
ATOM   6546  O6    G A 259     233.995 296.838 199.362  1.00 63.78           O  
ATOM   6547  N1    G A 259     234.558 298.083 201.178  1.00 61.52           N  
ATOM   6548  C2    G A 259     234.531 299.245 201.915  1.00 62.90           C  
ATOM   6549  N2    G A 259     235.200 299.229 203.076  1.00 62.47           N  
ATOM   6550  N3    G A 259     233.895 300.349 201.554  1.00 65.08           N  
ATOM   6551  C4    G A 259     233.270 300.219 200.370  1.00 64.86           C  
ATOM   6552  P     G A 260     235.662 304.625 197.425  1.00 84.35           P  
ATOM   6553  OP1   G A 260     236.168 305.873 196.796  1.00 77.66           O  
ATOM   6554  OP2   G A 260     235.358 303.449 196.567  1.00 76.58           O1-
ATOM   6555  O5'   G A 260     236.727 304.193 198.538  1.00 75.03           O  
ATOM   6556  C5'   G A 260     236.849 304.913 199.761  1.00 72.49           C  
ATOM   6557  C4'   G A 260     237.688 304.169 200.774  1.00 64.76           C  
ATOM   6558  O4'   G A 260     236.983 302.988 201.245  1.00 64.66           O  
ATOM   6559  C3'   G A 260     239.010 303.635 200.259  1.00 61.66           C  
ATOM   6560  O3'   G A 260     240.020 304.624 200.255  1.00 65.70           O  
ATOM   6561  C2'   G A 260     239.301 302.476 201.203  1.00 62.47           C  
ATOM   6562  O2'   G A 260     239.824 302.962 202.431  1.00 64.40           O  
ATOM   6563  C1'   G A 260     237.896 301.931 201.463  1.00 62.55           C  
ATOM   6564  N9    G A 260     237.529 300.801 200.571  1.00 65.62           N  
ATOM   6565  C8    G A 260     236.651 300.881 199.513  1.00 67.98           C  
ATOM   6566  N7    G A 260     236.458 299.763 198.872  1.00 62.04           N  
ATOM   6567  C5    G A 260     237.258 298.865 199.556  1.00 61.08           C  
ATOM   6568  C6    G A 260     237.461 297.487 199.317  1.00 63.89           C  
ATOM   6569  O6    G A 260     236.959 296.788 198.433  1.00 69.40           O  
ATOM   6570  N1    G A 260     238.344 296.915 200.220  1.00 61.13           N  
ATOM   6571  C2    G A 260     238.950 297.604 201.230  1.00 62.35           C  
ATOM   6572  N2    G A 260     239.766 296.890 202.007  1.00 66.23           N  
ATOM   6573  N3    G A 260     238.778 298.894 201.473  1.00 64.59           N  
ATOM   6574  C4    G A 260     237.921 299.472 200.606  1.00 64.04           C  
ATOM   6575  P     G A 261     241.274 304.472 199.272  1.00 72.62           P  
ATOM   6576  OP1   G A 261     242.123 305.681 199.455  1.00 72.20           O  
ATOM   6577  OP2   G A 261     240.762 304.117 197.919  1.00 66.48           O1-
ATOM   6578  O5'   G A 261     242.053 303.218 199.870  1.00 70.77           O  
ATOM   6579  C5'   G A 261     242.862 302.388 199.052  1.00 71.73           C  
ATOM   6580  C4'   G A 261     243.254 301.129 199.783  1.00 67.68           C  
ATOM   6581  O4'   G A 261     242.063 300.360 200.100  1.00 65.23           O  
ATOM   6582  C3'   G A 261     244.133 300.157 199.012  1.00 70.95           C  
ATOM   6583  O3'   G A 261     245.515 300.520 199.032  1.00 74.71           O  
ATOM   6584  C2'   G A 261     243.827 298.825 199.694  1.00 67.67           C  
ATOM   6585  O2'   G A 261     244.524 298.713 200.926  1.00 68.89           O  
ATOM   6586  C1'   G A 261     242.342 298.980 200.017  1.00 63.17           C  
ATOM   6587  N9    G A 261     241.480 298.388 198.981  1.00 61.69           N  
ATOM   6588  C8    G A 261     240.485 299.020 198.290  1.00 65.13           C  
ATOM   6589  N7    G A 261     239.884 298.250 197.428  1.00 63.99           N  
ATOM   6590  C5    G A 261     240.522 297.031 197.569  1.00 59.07           C  
ATOM   6591  C6    G A 261     240.307 295.804 196.903  1.00 59.95           C  
ATOM   6592  O6    G A 261     239.485 295.532 196.028  1.00 64.01           O  
ATOM   6593  N1    G A 261     241.168 294.816 197.341  1.00 63.52           N  
ATOM   6594  C2    G A 261     242.123 295.000 198.304  1.00 67.18           C  
ATOM   6595  N2    G A 261     242.875 293.932 198.609  1.00 74.72           N  
ATOM   6596  N3    G A 261     242.333 296.135 198.938  1.00 60.80           N  
ATOM   6597  C4    G A 261     241.502 297.100 198.524  1.00 57.95           C  
ATOM   6598  P     A A 262     246.326 300.871 197.677  1.00 77.53           P  
ATOM   6599  OP1   A A 262     247.344 301.898 198.011  1.00 73.95           O  
ATOM   6600  OP2   A A 262     245.339 301.156 196.596  1.00 75.36           O1-
ATOM   6601  O5'   A A 262     247.109 299.525 197.318  1.00 71.80           O  
ATOM   6602  C5'   A A 262     247.890 298.845 198.293  1.00 70.44           C  
ATOM   6603  C4'   A A 262     247.886 297.350 198.077  1.00 72.94           C  
ATOM   6604  O4'   A A 262     246.542 296.818 198.203  1.00 74.31           O  
ATOM   6605  C3'   A A 262     248.333 296.880 196.709  1.00 74.21           C  
ATOM   6606  O3'   A A 262     249.737 296.889 196.578  1.00 76.45           O  
ATOM   6607  C2'   A A 262     247.704 295.495 196.603  1.00 72.91           C  
ATOM   6608  O2'   A A 262     248.462 294.534 197.322  1.00 73.35           O  
ATOM   6609  C1'   A A 262     246.383 295.706 197.341  1.00 71.80           C  
ATOM   6610  N9    A A 262     245.250 295.952 196.424  1.00 69.27           N  
ATOM   6611  C8    A A 262     244.603 297.132 196.137  1.00 72.52           C  
ATOM   6612  N7    A A 262     243.620 297.020 195.282  1.00 68.11           N  
ATOM   6613  C5    A A 262     243.626 295.670 194.993  1.00 63.93           C  
ATOM   6614  C6    A A 262     242.828 294.904 194.150  1.00 67.21           C  
ATOM   6615  N6    A A 262     241.845 295.429 193.426  1.00 74.27           N  
ATOM   6616  N1    A A 262     243.068 293.584 194.073  1.00 65.28           N  
ATOM   6617  C2    A A 262     244.063 293.089 194.809  1.00 64.19           C  
ATOM   6618  N3    A A 262     244.892 293.702 195.640  1.00 61.96           N  
ATOM   6619  C4    A A 262     244.613 295.004 195.682  1.00 62.39           C  
ATOM   6620  P     G A 263     250.402 297.781 195.430  1.00 83.05           P  
ATOM   6621  OP1   G A 263     251.877 297.748 195.627  1.00 83.50           O  
ATOM   6622  OP2   G A 263     249.665 299.076 195.414  1.00 80.93           O1-
ATOM   6623  O5'   G A 263     250.070 296.970 194.099  1.00 78.39           O  
ATOM   6624  C5'   G A 263     250.466 295.611 193.959  1.00 80.69           C  
ATOM   6625  C4'   G A 263     249.663 294.911 192.893  1.00 80.92           C  
ATOM   6626  O4'   G A 263     248.279 294.807 193.326  1.00 78.31           O  
ATOM   6627  C3'   G A 263     249.573 295.632 191.553  1.00 87.13           C  
ATOM   6628  O3'   G A 263     250.705 295.447 190.716  1.00 87.51           O  
ATOM   6629  C2'   G A 263     248.288 295.077 190.970  1.00 83.75           C  
ATOM   6630  O2'   G A 263     248.509 293.766 190.471  1.00 80.89           O  
ATOM   6631  C1'   G A 263     247.415 294.987 192.220  1.00 79.32           C  
ATOM   6632  N9    G A 263     246.639 296.225 192.433  1.00 73.23           N  
ATOM   6633  C8    G A 263     246.912 297.184 193.374  1.00 74.49           C  
ATOM   6634  N7    G A 263     246.076 298.182 193.342  1.00 79.99           N  
ATOM   6635  C5    G A 263     245.199 297.863 192.317  1.00 79.37           C  
ATOM   6636  C6    G A 263     244.077 298.578 191.824  1.00 85.43           C  
ATOM   6637  O6    G A 263     243.630 299.666 192.212  1.00 86.97           O  
ATOM   6638  N1    G A 263     243.458 297.910 190.775  1.00 78.67           N  
ATOM   6639  C2    G A 263     243.870 296.708 190.273  1.00 74.14           C  
ATOM   6640  N2    G A 263     243.141 296.226 189.260  1.00 80.50           N  
ATOM   6641  N3    G A 263     244.913 296.028 190.721  1.00 70.42           N  
ATOM   6642  C4    G A 263     245.530 296.660 191.739  1.00 71.00           C  
ATOM   6643  P     C A 264     251.189 296.645 189.752  1.00 96.20           P  
ATOM   6644  OP1   C A 264     252.403 296.200 189.025  1.00 95.39           O  
ATOM   6645  OP2   C A 264     251.256 297.895 190.553  1.00 90.48           O1-
ATOM   6646  O5'   C A 264     250.001 296.806 188.702  1.00 86.42           O  
ATOM   6647  C5'   C A 264     249.672 295.749 187.814  1.00 82.83           C  
ATOM   6648  C4'   C A 264     248.362 295.993 187.107  1.00 84.60           C  
ATOM   6649  O4'   C A 264     247.328 296.365 188.057  1.00 83.46           O  
ATOM   6650  C3'   C A 264     248.333 297.122 186.092  1.00 90.88           C  
ATOM   6651  O3'   C A 264     248.961 296.783 184.862  1.00 92.27           O  
ATOM   6652  C2'   C A 264     246.835 297.414 185.972  1.00 90.35           C  
ATOM   6653  O2'   C A 264     246.200 296.474 185.113  1.00 82.48           O  
ATOM   6654  C1'   C A 264     246.353 297.162 187.410  1.00 87.67           C  
ATOM   6655  N1    C A 264     246.127 298.412 188.181  1.00 82.54           N  
ATOM   6656  C2    C A 264     244.884 299.068 188.066  1.00 78.82           C  
ATOM   6657  O2    C A 264     244.000 298.608 187.330  1.00 78.87           O  
ATOM   6658  N3    C A 264     244.662 300.201 188.756  1.00 77.32           N  
ATOM   6659  C4    C A 264     245.631 300.672 189.540  1.00 87.40           C  
ATOM   6660  N4    C A 264     245.371 301.793 190.212  1.00 95.58           N  
ATOM   6661  C5    C A 264     246.901 300.034 189.688  1.00 80.36           C  
ATOM   6662  C6    C A 264     247.106 298.912 188.994  1.00 78.49           C  
ATOM   6663  P     A A 265     249.342 297.930 183.794  1.00107.54           P  
ATOM   6664  OP1   A A 265     250.367 297.399 182.851  1.00 93.15           O  
ATOM   6665  OP2   A A 265     249.656 299.161 184.570  1.00 95.71           O1-
ATOM   6666  O5'   A A 265     247.979 298.157 182.988  1.00100.12           O  
ATOM   6667  C5'   A A 265     247.967 298.446 181.588  1.00 99.90           C  
ATOM   6668  C4'   A A 265     246.918 297.639 180.848  1.00 92.23           C  
ATOM   6669  O4'   A A 265     247.550 296.487 180.232  1.00 90.84           O  
ATOM   6670  C3'   A A 265     245.789 297.079 181.712  1.00 89.52           C  
ATOM   6671  O3'   A A 265     244.621 296.888 180.902  1.00 94.52           O  
ATOM   6672  C2'   A A 265     246.333 295.704 182.078  1.00 85.47           C  
ATOM   6673  O2'   A A 265     245.345 294.776 182.463  1.00 85.31           O  
ATOM   6674  C1'   A A 265     246.992 295.300 180.767  1.00 85.81           C  
ATOM   6675  N9    A A 265     248.067 294.326 180.894  1.00 78.56           N  
ATOM   6676  C8    A A 265     249.368 294.561 181.233  1.00 82.97           C  
ATOM   6677  N7    A A 265     250.111 293.486 181.225  1.00 80.20           N  
ATOM   6678  C5    A A 265     249.237 292.490 180.837  1.00 70.95           C  
ATOM   6679  C6    A A 265     249.416 291.121 180.641  1.00 70.29           C  
ATOM   6680  N6    A A 265     250.577 290.496 180.813  1.00 70.37           N  
ATOM   6681  N1    A A 265     248.344 290.414 180.258  1.00 74.29           N  
ATOM   6682  C2    A A 265     247.188 291.067 180.092  1.00 77.43           C  
ATOM   6683  N3    A A 265     246.886 292.348 180.245  1.00 70.09           N  
ATOM   6684  C4    A A 265     247.979 293.002 180.620  1.00 68.42           C  
ATOM   6685  P     G A 266     243.751 298.116 180.308  1.00106.88           P  
ATOM   6686  OP1   G A 266     244.559 299.346 180.122  1.00 98.34           O  
ATOM   6687  OP2   G A 266     242.504 298.197 181.097  1.00 95.13           O1-
ATOM   6688  O5'   G A 266     243.316 297.626 178.852  1.00100.91           O  
ATOM   6689  C5'   G A 266     244.043 298.012 177.691  1.00104.32           C  
ATOM   6690  C4'   G A 266     245.043 296.957 177.275  1.00 98.29           C  
ATOM   6691  O4'   G A 266     244.855 295.743 178.054  1.00 94.87           O  
ATOM   6692  C3'   G A 266     244.959 296.479 175.833  1.00 98.73           C  
ATOM   6693  O3'   G A 266     245.549 297.381 174.910  1.00102.62           O  
ATOM   6694  C2'   G A 266     245.639 295.113 175.899  1.00 93.86           C  
ATOM   6695  O2'   G A 266     247.054 295.254 175.955  1.00 91.39           O  
ATOM   6696  C1'   G A 266     245.156 294.608 177.261  1.00 93.61           C  
ATOM   6697  N9    G A 266     243.943 293.768 177.161  1.00 82.07           N  
ATOM   6698  C8    G A 266     242.646 294.189 177.332  1.00 77.27           C  
ATOM   6699  N7    G A 266     241.767 293.242 177.201  1.00 71.29           N  
ATOM   6700  C5    G A 266     242.532 292.123 176.933  1.00 70.29           C  
ATOM   6701  C6    G A 266     242.123 290.796 176.696  1.00 74.05           C  
ATOM   6702  O6    G A 266     240.976 290.352 176.676  1.00 78.38           O  
ATOM   6703  N1    G A 266     243.191 289.945 176.461  1.00 72.44           N  
ATOM   6704  C2    G A 266     244.499 290.333 176.452  1.00 72.67           C  
ATOM   6705  N2    G A 266     245.372 289.348 176.203  1.00 71.65           N  
ATOM   6706  N3    G A 266     244.902 291.579 176.668  1.00 73.69           N  
ATOM   6707  C4    G A 266     243.872 292.418 176.902  1.00 73.69           C  
ATOM   6708  P     C A 267     244.961 297.508 173.416  1.00112.84           P  
ATOM   6709  OP1   C A 267     245.693 298.589 172.701  1.00102.35           O  
ATOM   6710  OP2   C A 267     243.483 297.584 173.534  1.00100.03           O1-
ATOM   6711  O5'   C A 267     245.367 296.125 172.732  1.00100.40           O  
ATOM   6712  C5'   C A 267     244.423 295.335 172.021  1.00 92.90           C  
ATOM   6713  C4'   C A 267     244.924 293.920 171.861  1.00 90.02           C  
ATOM   6714  O4'   C A 267     244.606 293.151 173.054  1.00 83.05           O  
ATOM   6715  C3'   C A 267     244.321 293.101 170.724  1.00 97.15           C  
ATOM   6716  O3'   C A 267     244.883 293.385 169.445  1.00 99.93           O  
ATOM   6717  C2'   C A 267     244.562 291.672 171.196  1.00 92.57           C  
ATOM   6718  O2'   C A 267     245.916 291.292 170.990  1.00 87.53           O  
ATOM   6719  C1'   C A 267     244.316 291.812 172.699  1.00 87.22           C  
ATOM   6720  N1    C A 267     242.902 291.521 173.046  1.00 83.40           N  
ATOM   6721  C2    C A 267     242.413 290.203 172.944  1.00 80.61           C  
ATOM   6722  O2    C A 267     243.161 289.284 172.574  1.00 80.50           O  
ATOM   6723  N3    C A 267     241.125 289.946 173.255  1.00 78.99           N  
ATOM   6724  C4    C A 267     240.338 290.947 173.652  1.00 83.57           C  
ATOM   6725  N4    C A 267     239.071 290.660 173.954  1.00 84.54           N  
ATOM   6726  C5    C A 267     240.800 292.293 173.765  1.00 80.77           C  
ATOM   6727  C6    C A 267     242.077 292.536 173.455  1.00 79.75           C  
ATOM   6728  P     C A 268     244.032 293.154 168.089  1.00104.92           P  
ATOM   6729  OP1   C A 268     244.795 293.722 166.947  1.00 93.63           O  
ATOM   6730  OP2   C A 268     242.637 293.622 168.323  1.00 92.15           O1-
ATOM   6731  O5'   C A 268     244.008 291.569 167.901  1.00 95.50           O  
ATOM   6732  C5'   C A 268     245.203 290.833 167.670  1.00 90.17           C  
ATOM   6733  C4'   C A 268     244.947 289.342 167.637  1.00 88.68           C  
ATOM   6734  O4'   C A 268     244.435 288.894 168.922  1.00 85.55           O  
ATOM   6735  C3'   C A 268     243.909 288.857 166.636  1.00 85.50           C  
ATOM   6736  O3'   C A 268     244.421 288.744 165.317  1.00 94.22           O  
ATOM   6737  C2'   C A 268     243.468 287.532 167.240  1.00 80.61           C  
ATOM   6738  O2'   C A 268     244.433 286.520 166.996  1.00 84.06           O  
ATOM   6739  C1'   C A 268     243.484 287.868 168.731  1.00 80.68           C  
ATOM   6740  N1    C A 268     242.168 288.380 169.171  1.00 85.76           N  
ATOM   6741  C2    C A 268     241.109 287.486 169.309  1.00 83.79           C  
ATOM   6742  O2    C A 268     241.313 286.285 169.091  1.00 82.64           O  
ATOM   6743  N3    C A 268     239.899 287.954 169.695  1.00 83.86           N  
ATOM   6744  C4    C A 268     239.725 289.257 169.927  1.00 84.94           C  
ATOM   6745  N4    C A 268     238.515 289.671 170.301  1.00 85.83           N  
ATOM   6746  C5    C A 268     240.780 290.198 169.786  1.00 84.31           C  
ATOM   6747  C6    C A 268     241.970 289.715 169.408  1.00 89.28           C  
ATOM   6748  P     C A 269     243.570 289.263 164.049  1.00106.87           P  
ATOM   6749  OP1   C A 269     244.525 289.594 162.960  1.00100.66           O  
ATOM   6750  OP2   C A 269     242.619 290.314 164.493  1.00 95.28           O1-
ATOM   6751  O5'   C A 269     242.737 287.975 163.601  1.00105.57           O  
ATOM   6752  C5'   C A 269     243.392 286.740 163.329  1.00106.58           C  
ATOM   6753  C4'   C A 269     242.440 285.564 163.337  1.00102.75           C  
ATOM   6754  O4'   C A 269     241.878 285.368 164.665  1.00 97.59           O  
ATOM   6755  C3'   C A 269     241.216 285.664 162.438  1.00 99.88           C  
ATOM   6756  O3'   C A 269     241.501 285.403 161.071  1.00 97.65           O  
ATOM   6757  C2'   C A 269     240.272 284.644 163.064  1.00100.92           C  
ATOM   6758  O2'   C A 269     240.657 283.331 162.684  1.00 99.47           O  
ATOM   6759  C1'   C A 269     240.576 284.821 164.557  1.00 97.46           C  
ATOM   6760  N1    C A 269     239.598 285.705 165.257  1.00 92.34           N  
ATOM   6761  C2    C A 269     238.385 285.173 165.738  1.00 88.59           C  
ATOM   6762  O2    C A 269     238.132 283.968 165.567  1.00 88.46           O  
ATOM   6763  N3    C A 269     237.497 285.973 166.383  1.00 83.73           N  
ATOM   6764  C4    C A 269     237.774 287.263 166.569  1.00 83.43           C  
ATOM   6765  N4    C A 269     236.879 288.018 167.208  1.00 83.21           N  
ATOM   6766  C5    C A 269     238.988 287.837 166.101  1.00 87.02           C  
ATOM   6767  C6    C A 269     239.854 287.035 165.464  1.00 90.53           C  
ATOM   6768  P     A A 270     240.566 286.019 159.913  1.00104.07           P  
ATOM   6769  OP1   A A 270     241.034 285.511 158.600  1.00107.73           O  
ATOM   6770  OP2   A A 270     240.488 287.492 160.122  1.00 98.28           O1-
ATOM   6771  O5'   A A 270     239.130 285.371 160.188  1.00105.62           O  
ATOM   6772  C5'   A A 270     238.827 284.022 159.833  1.00101.34           C  
ATOM   6773  C4'   A A 270     237.421 283.629 160.247  1.00102.52           C  
ATOM   6774  O4'   A A 270     237.253 283.834 161.675  1.00 98.57           O  
ATOM   6775  C3'   A A 270     236.275 284.421 159.626  1.00105.74           C  
ATOM   6776  O3'   A A 270     235.934 283.991 158.318  1.00106.64           O  
ATOM   6777  C2'   A A 270     235.147 284.241 160.636  1.00 96.02           C  
ATOM   6778  O2'   A A 270     234.510 282.986 160.452  1.00 95.26           O  
ATOM   6779  C1'   A A 270     235.915 284.202 161.960  1.00 93.81           C  
ATOM   6780  N9    A A 270     235.907 285.498 162.678  1.00 87.06           N  
ATOM   6781  C8    A A 270     236.981 286.320 162.916  1.00 85.18           C  
ATOM   6782  N7    A A 270     236.691 287.403 163.596  1.00 84.99           N  
ATOM   6783  C5    A A 270     235.329 287.292 163.838  1.00 85.14           C  
ATOM   6784  C6    A A 270     234.411 288.123 164.512  1.00 82.42           C  
ATOM   6785  N6    A A 270     234.739 289.274 165.089  1.00 83.56           N  
ATOM   6786  N1    A A 270     233.124 287.741 164.583  1.00 81.29           N  
ATOM   6787  C2    A A 270     232.800 286.581 164.003  1.00 91.17           C  
ATOM   6788  N3    A A 270     233.561 285.709 163.338  1.00 90.38           N  
ATOM   6789  C4    A A 270     234.837 286.123 163.285  1.00 87.12           C  
ATOM   6790  P     G A 271     235.265 285.024 157.280  1.00113.93           P  
ATOM   6791  OP1   G A 271     234.004 285.533 157.878  1.00109.15           O  
ATOM   6792  OP2   G A 271     235.242 284.399 155.935  1.00114.79           O1-
ATOM   6793  O5'   G A 271     236.291 286.240 157.234  1.00116.13           O  
ATOM   6794  C5'   G A 271     237.649 286.029 156.871  1.00119.86           C  
ATOM   6795  C4'   G A 271     237.984 286.751 155.599  1.00125.23           C  
ATOM   6796  O4'   G A 271     237.964 288.187 155.844  1.00122.24           O  
ATOM   6797  C3'   G A 271     239.362 286.443 155.007  1.00137.20           C  
ATOM   6798  O3'   G A 271     239.236 286.535 153.582  1.00145.17           O  
ATOM   6799  C2'   G A 271     240.200 287.598 155.551  1.00133.20           C  
ATOM   6800  O2'   G A 271     241.407 287.874 154.867  1.00140.92           O  
ATOM   6801  C1'   G A 271     239.204 288.738 155.443  1.00125.46           C  
ATOM   6802  N9    G A 271     239.524 289.897 156.263  1.00117.25           N  
ATOM   6803  C8    G A 271     240.006 289.938 157.546  1.00108.40           C  
ATOM   6804  N7    G A 271     240.189 291.170 157.938  1.00113.38           N  
ATOM   6805  C5    G A 271     239.818 291.966 156.852  1.00118.32           C  
ATOM   6806  C6    G A 271     239.795 293.377 156.677  1.00116.54           C  
ATOM   6807  O6    G A 271     240.120 294.253 157.482  1.00117.78           O  
ATOM   6808  N1    G A 271     239.339 293.745 155.416  1.00113.81           N  
ATOM   6809  C2    G A 271     238.951 292.858 154.444  1.00115.38           C  
ATOM   6810  N2    G A 271     238.542 293.390 153.288  1.00122.86           N  
ATOM   6811  N3    G A 271     238.963 291.545 154.585  1.00113.41           N  
ATOM   6812  C4    G A 271     239.410 291.181 155.805  1.00116.68           C  
ATOM   6813  P     A A 272     240.485 286.374 152.575  1.00163.14           P  
ATOM   6814  OP1   A A 272     239.964 285.684 151.363  1.00147.70           O  
ATOM   6815  OP2   A A 272     241.644 285.792 153.309  1.00149.62           O1-
ATOM   6816  O5'   A A 272     240.822 287.885 152.178  1.00142.76           O  
ATOM   6817  C5'   A A 272     241.800 288.206 151.200  1.00139.74           C  
ATOM   6818  C4'   A A 272     241.469 289.516 150.529  1.00137.22           C  
ATOM   6819  O4'   A A 272     240.609 290.309 151.392  1.00128.10           O  
ATOM   6820  C3'   A A 272     242.642 290.441 150.241  1.00140.94           C  
ATOM   6821  O3'   A A 272     243.392 290.080 149.095  1.00142.95           O  
ATOM   6822  C2'   A A 272     241.963 291.798 150.132  1.00136.77           C  
ATOM   6823  O2'   A A 272     241.300 291.930 148.882  1.00133.07           O  
ATOM   6824  C1'   A A 272     240.905 291.683 151.231  1.00131.74           C  
ATOM   6825  N9    A A 272     241.402 292.214 152.517  1.00130.59           N  
ATOM   6826  C8    A A 272     241.716 291.500 153.648  1.00120.35           C  
ATOM   6827  N7    A A 272     242.139 292.248 154.639  1.00121.24           N  
ATOM   6828  C5    A A 272     242.123 293.539 154.127  1.00125.62           C  
ATOM   6829  C6    A A 272     242.461 294.791 154.676  1.00122.99           C  
ATOM   6830  N6    A A 272     242.908 294.946 155.920  1.00122.35           N  
ATOM   6831  N1    A A 272     242.330 295.891 153.903  1.00124.67           N  
ATOM   6832  C2    A A 272     241.884 295.749 152.652  1.00127.38           C  
ATOM   6833  N3    A A 272     241.534 294.627 152.023  1.00135.07           N  
ATOM   6834  C4    A A 272     241.672 293.540 152.819  1.00134.64           C  
ATOM   6835  P     G A 273     244.964 290.422 149.021  1.00155.36           P  
ATOM   6836  OP1   G A 273     245.475 289.869 147.740  1.00157.39           O  
ATOM   6837  OP2   G A 273     245.600 290.004 150.297  1.00144.62           O1-
ATOM   6838  O5'   G A 273     245.020 292.017 148.942  1.00147.41           O  
ATOM   6839  C5'   G A 273     244.621 292.707 147.767  1.00143.34           C  
ATOM   6840  C4'   G A 273     244.511 294.198 147.993  1.00148.90           C  
ATOM   6841  O4'   G A 273     243.733 294.473 149.192  1.00144.66           O  
ATOM   6842  C3'   G A 273     245.806 294.965 148.231  1.00158.85           C  
ATOM   6843  O3'   G A 273     246.578 295.196 147.060  1.00158.70           O  
ATOM   6844  C2'   G A 273     245.296 296.239 148.895  1.00156.86           C  
ATOM   6845  O2'   G A 273     244.698 297.104 147.939  1.00150.99           O  
ATOM   6846  C1'   G A 273     244.195 295.672 149.795  1.00149.19           C  
ATOM   6847  N9    G A 273     244.724 295.372 151.143  1.00142.18           N  
ATOM   6848  C8    G A 273     244.980 294.138 151.698  1.00134.89           C  
ATOM   6849  N7    G A 273     245.467 294.218 152.908  1.00130.49           N  
ATOM   6850  C5    G A 273     245.548 295.585 153.165  1.00137.88           C  
ATOM   6851  C6    G A 273     246.002 296.289 154.316  1.00136.46           C  
ATOM   6852  O6    G A 273     246.437 295.816 155.373  1.00135.01           O  
ATOM   6853  N1    G A 273     245.920 297.671 154.159  1.00133.50           N  
ATOM   6854  C2    G A 273     245.457 298.307 153.034  1.00135.98           C  
ATOM   6855  N2    G A 273     245.458 299.649 153.084  1.00133.59           N  
ATOM   6856  N3    G A 273     245.028 297.664 151.953  1.00138.25           N  
ATOM   6857  C4    G A 273     245.099 296.314 152.084  1.00140.63           C  
ATOM   6858  P     C A 274     248.187 295.288 147.151  1.00166.26           P  
ATOM   6859  OP1   C A 274     248.716 295.497 145.778  1.00159.92           O  
ATOM   6860  OP2   C A 274     248.691 294.156 147.976  1.00153.23           O1-
ATOM   6861  O5'   C A 274     248.464 296.619 147.980  1.00156.54           O  
ATOM   6862  C5'   C A 274     248.106 297.898 147.475  1.00152.60           C  
ATOM   6863  C4'   C A 274     248.375 298.986 148.486  1.00157.96           C  
ATOM   6864  O4'   C A 274     247.694 298.692 149.740  1.00152.73           O  
ATOM   6865  C3'   C A 274     249.828 299.173 148.904  1.00167.93           C  
ATOM   6866  O3'   C A 274     250.612 299.870 147.945  1.00173.57           O  
ATOM   6867  C2'   C A 274     249.690 299.886 150.248  1.00164.64           C  
ATOM   6868  O2'   C A 274     249.378 301.262 150.063  1.00159.06           O  
ATOM   6869  C1'   C A 274     248.458 299.183 150.831  1.00159.25           C  
ATOM   6870  N1    C A 274     248.831 298.054 151.732  1.00153.34           N  
ATOM   6871  C2    C A 274     249.155 298.333 153.076  1.00144.89           C  
ATOM   6872  O2    C A 274     249.117 299.507 153.485  1.00141.25           O  
ATOM   6873  N3    C A 274     249.501 297.313 153.898  1.00139.15           N  
ATOM   6874  C4    C A 274     249.538 296.059 153.436  1.00141.16           C  
ATOM   6875  N4    C A 274     249.887 295.096 154.290  1.00141.14           N  
ATOM   6876  C5    C A 274     249.221 295.732 152.082  1.00141.45           C  
ATOM   6877  C6    C A 274     248.878 296.752 151.281  1.00149.41           C  
ATOM   6878  P     C A 275     252.221 299.744 147.950  1.00188.90           P  
ATOM   6879  OP1   C A 275     252.729 300.304 146.672  1.00186.81           O  
ATOM   6880  OP2   C A 275     252.609 298.357 148.329  1.00166.05           O1-
ATOM   6881  O5'   C A 275     252.668 300.733 149.117  1.00170.33           O  
ATOM   6882  C5'   C A 275     254.009 300.754 149.579  1.00170.02           C  
ATOM   6883  C4'   C A 275     254.075 300.875 151.081  1.00172.49           C  
ATOM   6884  O4'   C A 275     252.890 300.272 151.683  1.00161.05           O  
ATOM   6885  C3'   C A 275     255.228 300.143 151.753  1.00177.38           C  
ATOM   6886  O3'   C A 275     256.493 300.783 151.633  1.00180.53           O  
ATOM   6887  C2'   C A 275     254.707 299.972 153.174  1.00166.23           C  
ATOM   6888  O2'   C A 275     254.732 301.208 153.874  1.00158.79           O  
ATOM   6889  C1'   C A 275     253.247 299.613 152.888  1.00160.56           C  
ATOM   6890  N1    C A 275     253.078 298.145 152.693  1.00158.60           N  
ATOM   6891  C2    C A 275     253.081 297.298 153.813  1.00153.99           C  
ATOM   6892  O2    C A 275     253.213 297.803 154.939  1.00149.69           O  
ATOM   6893  N3    C A 275     252.939 295.952 153.643  1.00151.13           N  
ATOM   6894  C4    C A 275     252.799 295.423 152.420  1.00148.40           C  
ATOM   6895  N4    C A 275     252.662 294.097 152.303  1.00138.79           N  
ATOM   6896  C5    C A 275     252.798 296.251 151.260  1.00154.49           C  
ATOM   6897  C6    C A 275     252.937 297.578 151.443  1.00159.19           C  
ATOM   6898  P     U A 276     257.634 300.163 150.664  1.00195.35           P  
ATOM   6899  OP1   U A 276     258.676 301.208 150.476  1.00180.10           O  
ATOM   6900  OP2   U A 276     256.985 299.573 149.462  1.00173.67           O1-
ATOM   6901  O5'   U A 276     258.278 298.963 151.508  1.00182.42           O  
ATOM   6902  C5'   U A 276     257.799 297.620 151.409  1.00175.87           C  
ATOM   6903  C4'   U A 276     257.307 297.107 152.749  1.00172.79           C  
ATOM   6904  O4'   U A 276     256.351 296.030 152.583  1.00167.29           O  
ATOM   6905  C3'   U A 276     258.341 296.528 153.706  1.00168.80           C  
ATOM   6906  O3'   U A 276     259.080 297.538 154.383  1.00172.20           O  
ATOM   6907  C2'   U A 276     257.490 295.679 154.654  1.00159.40           C  
ATOM   6908  O2'   U A 276     256.969 296.477 155.704  1.00154.25           O  
ATOM   6909  C1'   U A 276     256.312 295.258 153.766  1.00160.82           C  
ATOM   6910  N1    U A 276     256.268 293.808 153.454  1.00157.12           N  
ATOM   6911  C2    U A 276     256.141 292.925 154.518  1.00152.18           C  
ATOM   6912  O2    U A 276     256.096 293.273 155.682  1.00144.36           O  
ATOM   6913  N3    U A 276     256.082 291.601 154.172  1.00152.82           N  
ATOM   6914  C4    U A 276     256.116 291.085 152.893  1.00154.61           C  
ATOM   6915  O4    U A 276     256.049 289.864 152.746  1.00146.43           O  
ATOM   6916  C5    U A 276     256.228 292.059 151.843  1.00151.01           C  
ATOM   6917  C6    U A 276     256.291 293.357 152.152  1.00153.30           C  
ATOM   6918  P     G A 277     260.489 297.201 155.085  1.00182.60           P  
ATOM   6919  OP1   G A 277     261.029 298.451 155.693  1.00161.58           O  
ATOM   6920  OP2   G A 277     261.296 296.449 154.087  1.00176.11           O1-
ATOM   6921  O5'   G A 277     260.104 296.213 156.274  1.00163.94           O  
ATOM   6922  C5'   G A 277     260.873 295.050 156.535  1.00165.41           C  
ATOM   6923  C4'   G A 277     260.111 294.078 157.397  1.00160.89           C  
ATOM   6924  O4'   G A 277     259.869 292.846 156.664  1.00160.51           O  
ATOM   6925  C3'   G A 277     260.795 293.622 158.681  1.00163.78           C  
ATOM   6926  O3'   G A 277     260.702 294.576 159.741  1.00153.52           O  
ATOM   6927  C2'   G A 277     260.089 292.303 158.977  1.00164.78           C  
ATOM   6928  O2'   G A 277     258.848 292.525 159.625  1.00155.19           O  
ATOM   6929  C1'   G A 277     259.815 291.759 157.566  1.00165.97           C  
ATOM   6930  N9    G A 277     260.785 290.704 157.179  1.00186.27           N  
ATOM   6931  C8    G A 277     260.538 289.346 157.289  1.00181.78           C  
ATOM   6932  N7    G A 277     261.550 288.600 156.921  1.00190.39           N  
ATOM   6933  C5    G A 277     262.550 289.504 156.550  1.00203.29           C  
ATOM   6934  C6    G A 277     263.883 289.274 156.059  1.00197.87           C  
ATOM   6935  O6    G A 277     264.461 288.192 155.848  1.00182.26           O  
ATOM   6936  N1    G A 277     264.555 290.476 155.806  1.00195.72           N  
ATOM   6937  C2    G A 277     264.030 291.739 155.995  1.00188.10           C  
ATOM   6938  N2    G A 277     264.841 292.770 155.694  1.00175.25           N  
ATOM   6939  N3    G A 277     262.795 291.962 156.450  1.00191.61           N  
ATOM   6940  C4    G A 277     262.099 290.815 156.712  1.00200.78           C  
ATOM   6941  P     A A 278     261.631 294.483 161.062  1.00145.12           P  
ATOM   6942  OP1   A A 278     263.010 294.890 160.690  1.00148.36           O  
ATOM   6943  OP2   A A 278     261.424 293.175 161.739  1.00136.13           O1-
ATOM   6944  O5'   A A 278     261.008 295.590 162.031  1.00152.00           O  
ATOM   6945  C5'   A A 278     261.344 296.971 161.914  1.00157.51           C  
ATOM   6946  C4'   A A 278     260.118 297.867 161.891  1.00158.91           C  
ATOM   6947  O4'   A A 278     259.614 297.941 160.535  1.00151.96           O  
ATOM   6948  C3'   A A 278     258.922 297.422 162.743  1.00158.52           C  
ATOM   6949  O3'   A A 278     258.971 297.919 164.080  1.00158.20           O  
ATOM   6950  C2'   A A 278     257.707 297.949 161.976  1.00148.21           C  
ATOM   6951  O2'   A A 278     257.388 299.278 162.373  1.00143.29           O  
ATOM   6952  C1'   A A 278     258.206 297.959 160.524  1.00151.58           C  
ATOM   6953  N9    A A 278     257.743 296.816 159.700  1.00154.16           N  
ATOM   6954  C8    A A 278     257.908 296.810 158.340  1.00153.50           C  
ATOM   6955  N7    A A 278     257.458 295.734 157.743  1.00154.80           N  
ATOM   6956  C5    A A 278     256.969 294.939 158.769  1.00159.16           C  
ATOM   6957  C6    A A 278     256.356 293.660 158.768  1.00153.95           C  
ATOM   6958  N6    A A 278     256.135 292.920 157.676  1.00145.15           N  
ATOM   6959  N1    A A 278     255.983 293.146 159.966  1.00148.55           N  
ATOM   6960  C2    A A 278     256.203 293.872 161.076  1.00148.10           C  
ATOM   6961  N3    A A 278     256.764 295.082 161.201  1.00151.76           N  
ATOM   6962  C4    A A 278     257.142 295.587 159.999  1.00158.44           C  
ATOM   6963  P     A A 279     260.049 297.379 165.152  1.00174.38           P  
ATOM   6964  OP1   A A 279     261.218 298.298 165.158  1.00161.32           O  
ATOM   6965  OP2   A A 279     260.244 295.918 164.947  1.00159.21           O1-
ATOM   6966  O5'   A A 279     259.337 297.573 166.564  1.00157.65           O  
ATOM   6967  C5'   A A 279     258.974 298.864 167.039  1.00150.57           C  
ATOM   6968  C4'   A A 279     257.606 298.827 167.673  1.00152.06           C  
ATOM   6969  O4'   A A 279     256.620 298.497 166.652  1.00152.24           O  
ATOM   6970  C3'   A A 279     257.404 297.737 168.720  1.00151.48           C  
ATOM   6971  O3'   A A 279     257.950 298.002 170.000  1.00150.29           O  
ATOM   6972  C2'   A A 279     255.898 297.530 168.693  1.00148.66           C  
ATOM   6973  O2'   A A 279     255.215 298.590 169.353  1.00140.60           O  
ATOM   6974  C1'   A A 279     255.637 297.630 167.193  1.00154.08           C  
ATOM   6975  N9    A A 279     255.753 296.301 166.549  1.00145.89           N  
ATOM   6976  C8    A A 279     256.694 295.805 165.668  1.00140.80           C  
ATOM   6977  N7    A A 279     256.482 294.558 165.309  1.00136.12           N  
ATOM   6978  C5    A A 279     255.328 294.205 166.005  1.00136.75           C  
ATOM   6979  C6    A A 279     254.563 293.017 166.072  1.00138.10           C  
ATOM   6980  N6    A A 279     254.833 291.882 165.407  1.00134.45           N  
ATOM   6981  N1    A A 279     253.473 293.035 166.876  1.00135.96           N  
ATOM   6982  C2    A A 279     253.163 294.148 167.559  1.00129.18           C  
ATOM   6983  N3    A A 279     253.800 295.311 167.578  1.00127.98           N  
ATOM   6984  C4    A A 279     254.878 295.270 166.773  1.00136.09           C  
ATOM   6985  P     U A 280     258.468 296.766 170.887  1.00160.99           P  
ATOM   6986  OP1   U A 280     258.559 297.205 172.304  1.00152.99           O  
ATOM   6987  OP2   U A 280     259.629 296.133 170.219  1.00147.66           O1-
ATOM   6988  O5'   U A 280     257.286 295.717 170.769  1.00147.44           O  
ATOM   6989  C5'   U A 280     256.318 295.608 171.788  1.00144.68           C  
ATOM   6990  C4'   U A 280     255.608 294.290 171.698  1.00140.49           C  
ATOM   6991  O4'   U A 280     255.207 294.036 170.322  1.00138.60           O  
ATOM   6992  C3'   U A 280     256.362 293.023 172.095  1.00140.68           C  
ATOM   6993  O3'   U A 280     256.486 292.889 173.515  1.00141.40           O  
ATOM   6994  C2'   U A 280     255.470 291.968 171.442  1.00138.81           C  
ATOM   6995  O2'   U A 280     254.235 291.878 172.145  1.00134.26           O  
ATOM   6996  C1'   U A 280     255.167 292.643 170.098  1.00140.39           C  
ATOM   6997  N1    U A 280     256.164 292.296 169.048  1.00139.58           N  
ATOM   6998  C2    U A 280     256.075 291.057 168.398  1.00134.02           C  
ATOM   6999  O2    U A 280     255.223 290.224 168.656  1.00124.96           O  
ATOM   7000  N3    U A 280     257.047 290.822 167.447  1.00135.30           N  
ATOM   7001  C4    U A 280     258.056 291.713 167.086  1.00137.74           C  
ATOM   7002  O4    U A 280     258.857 291.375 166.216  1.00139.00           O  
ATOM   7003  C5    U A 280     258.084 292.973 167.776  1.00131.55           C  
ATOM   7004  C6    U A 280     257.152 293.207 168.703  1.00135.73           C  
ATOM   7005  P     C A 281     257.731 292.211 174.314  1.00151.76           P  
ATOM   7006  OP1   C A 281     257.123 292.442 175.665  1.00149.19           O  
ATOM   7007  OP2   C A 281     259.136 292.721 174.078  1.00137.05           O1-
ATOM   7008  O5'   C A 281     257.651 290.651 173.969  1.00137.39           O  
ATOM   7009  C5'   C A 281     256.512 289.888 174.352  1.00131.64           C  
ATOM   7010  C4'   C A 281     256.444 288.579 173.620  1.00135.46           C  
ATOM   7011  O4'   C A 281     256.316 288.884 172.212  1.00137.50           O  
ATOM   7012  C3'   C A 281     257.694 287.707 173.722  1.00142.45           C  
ATOM   7013  O3'   C A 281     257.685 286.826 174.846  1.00147.64           O  
ATOM   7014  C2'   C A 281     257.729 286.979 172.384  1.00138.50           C  
ATOM   7015  O2'   C A 281     256.923 285.814 172.419  1.00132.30           O  
ATOM   7016  C1'   C A 281     257.082 287.997 171.440  1.00139.65           C  
ATOM   7017  N1    C A 281     258.078 288.791 170.694  1.00137.52           N  
ATOM   7018  C2    C A 281     258.666 288.285 169.531  1.00136.63           C  
ATOM   7019  O2    C A 281     258.356 287.156 169.107  1.00131.24           O  
ATOM   7020  N3    C A 281     259.576 289.061 168.891  1.00137.11           N  
ATOM   7021  C4    C A 281     259.898 290.271 169.362  1.00138.94           C  
ATOM   7022  N4    C A 281     260.800 290.993 168.693  1.00138.68           N  
ATOM   7023  C5    C A 281     259.305 290.796 170.541  1.00133.18           C  
ATOM   7024  C6    C A 281     258.415 290.025 171.159  1.00132.79           C  
ATOM   7025  P     A A 282     259.054 286.222 175.457  1.00160.80           P  
ATOM   7026  OP1   A A 282     258.695 285.544 176.742  1.00138.30           O  
ATOM   7027  OP2   A A 282     260.041 287.330 175.457  1.00151.15           O1-
ATOM   7028  O5'   A A 282     259.550 285.154 174.376  1.00150.22           O  
ATOM   7029  C5'   A A 282     258.843 283.938 174.189  1.00149.76           C  
ATOM   7030  C4'   A A 282     259.361 283.154 173.009  1.00149.86           C  
ATOM   7031  O4'   A A 282     259.174 283.915 171.786  1.00139.32           O  
ATOM   7032  C3'   A A 282     260.850 282.831 173.002  1.00155.27           C  
ATOM   7033  O3'   A A 282     261.221 281.759 173.861  1.00159.14           O  
ATOM   7034  C2'   A A 282     261.109 282.554 171.528  1.00148.68           C  
ATOM   7035  O2'   A A 282     260.646 281.258 171.177  1.00146.35           O  
ATOM   7036  C1'   A A 282     260.198 283.590 170.865  1.00137.70           C  
ATOM   7037  N9    A A 282     260.940 284.812 170.524  1.00132.05           N  
ATOM   7038  C8    A A 282     260.734 286.091 170.968  1.00134.45           C  
ATOM   7039  N7    A A 282     261.597 286.945 170.472  1.00139.26           N  
ATOM   7040  C5    A A 282     262.424 286.174 169.658  1.00140.58           C  
ATOM   7041  C6    A A 282     263.539 286.498 168.848  1.00141.24           C  
ATOM   7042  N6    A A 282     264.052 287.732 168.706  1.00131.01           N  
ATOM   7043  N1    A A 282     264.122 285.475 168.170  1.00142.46           N  
ATOM   7044  C2    A A 282     263.625 284.230 168.290  1.00138.20           C  
ATOM   7045  N3    A A 282     262.591 283.811 169.020  1.00132.48           N  
ATOM   7046  C4    A A 282     262.026 284.846 169.685  1.00134.80           C  
ATOM   7047  P     G A 283     262.608 281.807 174.688  1.00171.60           P  
ATOM   7048  OP1   G A 283     262.475 280.812 175.786  1.00154.73           O  
ATOM   7049  OP2   G A 283     262.952 283.229 174.988  1.00159.94           O1-
ATOM   7050  O5'   G A 283     263.701 281.257 173.666  1.00155.31           O  
ATOM   7051  C5'   G A 283     263.459 280.072 172.924  1.00149.55           C  
ATOM   7052  C4'   G A 283     264.332 279.989 171.696  1.00152.15           C  
ATOM   7053  O4'   G A 283     264.032 281.079 170.781  1.00146.80           O  
ATOM   7054  C3'   G A 283     265.832 280.114 171.918  1.00153.01           C  
ATOM   7055  O3'   G A 283     266.433 278.936 172.430  1.00147.75           O  
ATOM   7056  C2'   G A 283     266.331 280.509 170.532  1.00149.71           C  
ATOM   7057  O2'   G A 283     266.407 279.386 169.665  1.00141.01           O  
ATOM   7058  C1'   G A 283     265.199 281.426 170.058  1.00145.94           C  
ATOM   7059  N9    G A 283     265.539 282.839 170.304  1.00144.46           N  
ATOM   7060  C8    G A 283     265.093 283.716 171.272  1.00139.53           C  
ATOM   7061  N7    G A 283     265.659 284.893 171.169  1.00138.78           N  
ATOM   7062  C5    G A 283     266.535 284.780 170.080  1.00144.18           C  
ATOM   7063  C6    G A 283     267.436 285.710 169.462  1.00141.55           C  
ATOM   7064  O6    G A 283     267.665 286.897 169.754  1.00137.50           O  
ATOM   7065  N1    G A 283     268.118 285.137 168.378  1.00142.54           N  
ATOM   7066  C2    G A 283     267.971 283.837 167.929  1.00144.18           C  
ATOM   7067  N2    G A 283     268.713 283.456 166.874  1.00139.71           N  
ATOM   7068  N3    G A 283     267.141 282.972 168.490  1.00142.55           N  
ATOM   7069  C4    G A 283     266.471 283.506 169.545  1.00146.07           C  
ATOM   7070  P     U A 284     267.611 279.037 173.521  1.00141.44           P  
ATOM   7071  OP1   U A 284     268.020 277.649 173.851  1.00129.94           O  
ATOM   7072  OP2   U A 284     267.183 279.973 174.595  1.00140.28           O1-
ATOM   7073  O5'   U A 284     268.812 279.731 172.738  1.00142.64           O  
ATOM   7074  C5'   U A 284     269.455 279.077 171.656  1.00141.93           C  
ATOM   7075  C4'   U A 284     270.406 280.002 170.930  1.00148.09           C  
ATOM   7076  O4'   U A 284     269.739 281.237 170.567  1.00149.62           O  
ATOM   7077  C3'   U A 284     271.635 280.468 171.699  1.00149.36           C  
ATOM   7078  O3'   U A 284     272.656 279.482 171.749  1.00147.10           O  
ATOM   7079  C2'   U A 284     272.046 281.736 170.943  1.00151.75           C  
ATOM   7080  O2'   U A 284     272.848 281.420 169.810  1.00147.36           O  
ATOM   7081  C1'   U A 284     270.696 282.275 170.448  1.00152.93           C  
ATOM   7082  N1    U A 284     270.241 283.499 171.161  1.00146.62           N  
ATOM   7083  C2    U A 284     270.707 284.695 170.630  1.00138.74           C  
ATOM   7084  O2    U A 284     271.446 284.728 169.658  1.00132.39           O  
ATOM   7085  N3    U A 284     270.274 285.830 171.275  1.00138.83           N  
ATOM   7086  C4    U A 284     269.440 285.893 172.375  1.00145.28           C  
ATOM   7087  O4    U A 284     269.146 287.000 172.840  1.00143.75           O  
ATOM   7088  C5    U A 284     268.998 284.616 172.865  1.00143.18           C  
ATOM   7089  C6    U A 284     269.400 283.489 172.257  1.00141.42           C  
ATOM   7090  P     G A 285     273.798 279.528 172.883  1.00158.68           P  
ATOM   7091  OP1   G A 285     274.858 278.552 172.518  1.00149.99           O  
ATOM   7092  OP2   G A 285     273.141 279.427 174.210  1.00150.37           O1-
ATOM   7093  O5'   G A 285     274.424 280.986 172.746  1.00150.23           O  
ATOM   7094  C5'   G A 285     275.829 281.173 172.732  1.00145.06           C  
ATOM   7095  C4'   G A 285     276.240 282.275 171.790  1.00150.32           C  
ATOM   7096  O4'   G A 285     275.076 282.911 171.190  1.00148.72           O  
ATOM   7097  C3'   G A 285     276.993 283.430 172.420  1.00157.45           C  
ATOM   7098  O3'   G A 285     278.347 283.116 172.704  1.00161.51           O  
ATOM   7099  C2'   G A 285     276.795 284.546 171.397  1.00152.67           C  
ATOM   7100  O2'   G A 285     277.665 284.379 170.285  1.00147.54           O  
ATOM   7101  C1'   G A 285     275.353 284.278 170.943  1.00148.55           C  
ATOM   7102  N9    G A 285     274.376 285.109 171.682  1.00143.73           N  
ATOM   7103  C8    G A 285     273.371 284.675 172.515  1.00139.14           C  
ATOM   7104  N7    G A 285     272.675 285.655 173.032  1.00140.60           N  
ATOM   7105  C5    G A 285     273.242 286.817 172.518  1.00145.54           C  
ATOM   7106  C6    G A 285     272.912 288.198 172.720  1.00144.96           C  
ATOM   7107  O6    G A 285     272.020 288.718 173.413  1.00141.05           O  
ATOM   7108  N1    G A 285     273.761 289.028 171.995  1.00144.26           N  
ATOM   7109  C2    G A 285     274.788 288.613 171.184  1.00147.60           C  
ATOM   7110  N2    G A 285     275.477 289.595 170.580  1.00146.81           N  
ATOM   7111  N3    G A 285     275.106 287.336 170.988  1.00147.54           N  
ATOM   7112  C4    G A 285     274.297 286.491 171.679  1.00146.75           C  
ATOM   7113  P     U A 286     278.934 283.326 174.190  1.00176.68           P  
ATOM   7114  OP1   U A 286     280.009 282.327 174.429  1.00167.85           O  
ATOM   7115  OP2   U A 286     277.796 283.422 175.144  1.00160.67           O1-
ATOM   7116  O5'   U A 286     279.630 284.750 174.100  1.00161.62           O  
ATOM   7117  C5'   U A 286     280.066 285.257 172.847  1.00156.68           C  
ATOM   7118  C4'   U A 286     279.945 286.755 172.809  1.00158.71           C  
ATOM   7119  O4'   U A 286     278.603 287.151 172.404  1.00153.95           O  
ATOM   7120  C3'   U A 286     280.125 287.451 174.143  1.00163.60           C  
ATOM   7121  O3'   U A 286     281.471 287.512 174.589  1.00167.60           O  
ATOM   7122  C2'   U A 286     279.460 288.799 173.889  1.00160.97           C  
ATOM   7123  O2'   U A 286     280.287 289.627 173.082  1.00155.66           O  
ATOM   7124  C1'   U A 286     278.249 288.361 173.058  1.00156.96           C  
ATOM   7125  N1    U A 286     277.040 288.140 173.904  1.00149.46           N  
ATOM   7126  C2    U A 286     276.259 289.251 174.187  1.00145.37           C  
ATOM   7127  O2    U A 286     276.517 290.372 173.767  1.00141.30           O  
ATOM   7128  N3    U A 286     275.157 288.993 174.974  1.00142.81           N  
ATOM   7129  C4    U A 286     274.741 287.795 175.516  1.00135.68           C  
ATOM   7130  O4    U A 286     273.717 287.762 176.205  1.00128.04           O  
ATOM   7131  C5    U A 286     275.598 286.696 175.188  1.00139.97           C  
ATOM   7132  C6    U A 286     276.682 286.903 174.418  1.00145.22           C  
ATOM   7133  P     G A 287     281.797 287.393 176.161  1.00180.37           P  
ATOM   7134  OP1   G A 287     283.194 286.904 176.313  1.00175.66           O  
ATOM   7135  OP2   G A 287     280.683 286.653 176.820  1.00158.47           O1-
ATOM   7136  O5'   G A 287     281.754 288.910 176.651  1.00171.13           O  
ATOM   7137  C5'   G A 287     282.286 289.950 175.838  1.00169.62           C  
ATOM   7138  C4'   G A 287     281.664 291.282 176.176  1.00165.64           C  
ATOM   7139  O4'   G A 287     280.335 291.380 175.589  1.00156.36           O  
ATOM   7140  C3'   G A 287     281.426 291.533 177.655  1.00169.75           C  
ATOM   7141  O3'   G A 287     282.594 291.906 178.371  1.00176.70           O  
ATOM   7142  C2'   G A 287     280.326 292.585 177.626  1.00162.85           C  
ATOM   7143  O2'   G A 287     280.851 293.851 177.244  1.00159.39           O  
ATOM   7144  C1'   G A 287     279.466 292.056 176.481  1.00153.45           C  
ATOM   7145  N9    G A 287     278.461 291.084 176.967  1.00150.43           N  
ATOM   7146  C8    G A 287     278.575 289.713 176.930  1.00151.33           C  
ATOM   7147  N7    G A 287     277.549 289.082 177.426  1.00150.20           N  
ATOM   7148  C5    G A 287     276.692 290.094 177.836  1.00150.17           C  
ATOM   7149  C6    G A 287     275.411 290.012 178.449  1.00144.73           C  
ATOM   7150  O6    G A 287     274.772 289.002 178.766  1.00140.77           O  
ATOM   7151  N1    G A 287     274.884 291.275 178.705  1.00142.08           N  
ATOM   7152  C2    G A 287     275.505 292.462 178.403  1.00144.93           C  
ATOM   7153  N2    G A 287     274.835 293.577 178.724  1.00141.05           N  
ATOM   7154  N3    G A 287     276.697 292.552 177.823  1.00151.48           N  
ATOM   7155  C4    G A 287     277.238 291.337 177.565  1.00151.51           C  
ATOM   7156  P     U A 288     282.902 291.257 179.816  1.00192.79           P  
ATOM   7157  OP1   U A 288     284.378 291.157 179.977  1.00182.38           O  
ATOM   7158  OP2   U A 288     282.072 290.031 179.984  1.00166.22           O1-
ATOM   7159  O5'   U A 288     282.357 292.352 180.841  1.00174.24           O  
ATOM   7160  C5'   U A 288     282.588 293.738 180.622  1.00168.75           C  
ATOM   7161  C4'   U A 288     281.434 294.585 181.103  1.00159.04           C  
ATOM   7162  O4'   U A 288     280.277 294.412 180.231  1.00152.72           O  
ATOM   7163  C3'   U A 288     280.874 294.254 182.476  1.00160.00           C  
ATOM   7164  O3'   U A 288     281.681 294.638 183.577  1.00162.70           O  
ATOM   7165  C2'   U A 288     279.506 294.916 182.411  1.00151.66           C  
ATOM   7166  O2'   U A 288     279.631 296.332 182.469  1.00154.00           O  
ATOM   7167  C1'   U A 288     279.086 294.528 180.994  1.00148.11           C  
ATOM   7168  N1    U A 288     278.365 293.224 181.013  1.00147.81           N  
ATOM   7169  C2    U A 288     276.997 293.268 181.229  1.00140.72           C  
ATOM   7170  O2    U A 288     276.386 294.315 181.357  1.00137.81           O  
ATOM   7171  N3    U A 288     276.361 292.045 181.276  1.00137.65           N  
ATOM   7172  C4    U A 288     276.944 290.798 181.141  1.00137.08           C  
ATOM   7173  O4    U A 288     276.247 289.785 181.208  1.00136.84           O  
ATOM   7174  C5    U A 288     278.358 290.820 180.940  1.00140.38           C  
ATOM   7175  C6    U A 288     278.994 291.997 180.892  1.00149.41           C  
ATOM   7176  P     G A 289     281.684 293.722 184.904  1.00164.50           P  
ATOM   7177  OP1   G A 289     282.790 294.179 185.785  1.00165.57           O  
ATOM   7178  OP2   G A 289     281.629 292.293 184.490  1.00154.72           O1-
ATOM   7179  O5'   G A 289     280.295 294.069 185.607  1.00155.73           O  
ATOM   7180  C5'   G A 289     279.924 295.418 185.850  1.00156.69           C  
ATOM   7181  C4'   G A 289     278.488 295.537 186.302  1.00153.63           C  
ATOM   7182  O4'   G A 289     277.578 295.272 185.197  1.00147.10           O  
ATOM   7183  C3'   G A 289     278.034 294.557 187.370  1.00154.15           C  
ATOM   7184  O3'   G A 289     278.501 294.851 188.674  1.00157.51           O  
ATOM   7185  C2'   G A 289     276.522 294.606 187.211  1.00145.78           C  
ATOM   7186  O2'   G A 289     276.003 295.828 187.720  1.00140.24           O  
ATOM   7187  C1'   G A 289     276.411 294.630 185.688  1.00146.14           C  
ATOM   7188  N9    G A 289     276.367 293.252 185.150  1.00147.53           N  
ATOM   7189  C8    G A 289     277.321 292.613 184.387  1.00148.99           C  
ATOM   7190  N7    G A 289     277.001 291.382 184.076  1.00143.71           N  
ATOM   7191  C5    G A 289     275.764 291.180 184.673  1.00140.40           C  
ATOM   7192  C6    G A 289     274.923 290.033 184.678  1.00131.68           C  
ATOM   7193  O6    G A 289     275.114 288.936 184.137  1.00127.88           O  
ATOM   7194  N1    G A 289     273.758 290.265 185.408  1.00132.57           N  
ATOM   7195  C2    G A 289     273.443 291.445 186.049  1.00136.29           C  
ATOM   7196  N2    G A 289     272.272 291.472 186.704  1.00131.57           N  
ATOM   7197  N3    G A 289     274.219 292.519 186.050  1.00138.65           N  
ATOM   7198  C4    G A 289     275.359 292.323 185.345  1.00143.78           C  
ATOM   7199  P     U A 290     279.081 293.667 189.597  1.00156.43           P  
ATOM   7200  OP1   U A 290     279.934 294.281 190.649  1.00161.13           O  
ATOM   7201  OP2   U A 290     279.648 292.617 188.708  1.00144.55           O1-
ATOM   7202  O5'   U A 290     277.784 293.061 190.295  1.00145.94           O  
ATOM   7203  C5'   U A 290     276.766 293.915 190.797  1.00146.94           C  
ATOM   7204  C4'   U A 290     275.425 293.225 190.798  1.00146.31           C  
ATOM   7205  O4'   U A 290     275.073 292.828 189.446  1.00139.29           O  
ATOM   7206  C3'   U A 290     275.353 291.929 191.591  1.00148.38           C  
ATOM   7207  O3'   U A 290     275.204 292.128 192.988  1.00153.36           O  
ATOM   7208  C2'   U A 290     274.184 291.201 190.933  1.00137.70           C  
ATOM   7209  O2'   U A 290     272.937 291.707 191.385  1.00134.44           O  
ATOM   7210  C1'   U A 290     274.369 291.602 189.471  1.00134.34           C  
ATOM   7211  N1    U A 290     275.156 290.590 18