PDB Short entry for 5GAG
HEADER    RIBOSOME                                26-NOV-15   5GAG              
TITLE     RNC IN COMPLEX WITH SRP-SR IN THE CLOSED STATE                        
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: SRP 4.5S RNA;                                              
COMPND   3 CHAIN: 1;                                                            
COMPND   4 ENGINEERED: YES;                                                     
COMPND   5 MOL_ID: 2;                                                           
COMPND   6 MOLECULE: TRNA CCAEND;                                               
COMPND   7 CHAIN: 2;                                                            
COMPND   8 MOL_ID: 3;                                                           
COMPND   9 MOLECULE: 23S RRNA;                                                  
COMPND  10 CHAIN: A;                                                            
COMPND  11 MOL_ID: 4;                                                           
COMPND  12 MOLECULE: 5S RRNA;                                                   
COMPND  13 CHAIN: B;                                                            
COMPND  14 MOL_ID: 5;                                                           
COMPND  15 MOLECULE: 50S RIBOSOMAL PROTEIN L2;                                  
COMPND  16 CHAIN: C;                                                            
COMPND  17 SYNONYM: RIBOSOMAL PROTEIN UL2;                                      
COMPND  18 MOL_ID: 6;                                                           
COMPND  19 MOLECULE: 50S RIBOSOMAL PROTEIN L3;                                  
COMPND  20 CHAIN: D;                                                            
COMPND  21 SYNONYM: RIBOSOMAL PROTEIN UL3;                                      
COMPND  22 MOL_ID: 7;                                                           
COMPND  23 MOLECULE: 50S RIBOSOMAL PROTEIN L4;                                  
COMPND  24 CHAIN: E;                                                            
COMPND  25 SYNONYM: RIBOSOMAL PROTEIN UL4;                                      
COMPND  26 MOL_ID: 8;                                                           
COMPND  27 MOLECULE: 50S RIBOSOMAL PROTEIN L5;                                  
COMPND  28 CHAIN: F;                                                            
COMPND  29 SYNONYM: RIBOSOMAL PROTEIN UL5;                                      
COMPND  30 MOL_ID: 9;                                                           
COMPND  31 MOLECULE: 50S RIBOSOMAL PROTEIN L6;                                  
COMPND  32 CHAIN: G;                                                            
COMPND  33 SYNONYM: RIBOSOMAL PROTEIN UL6;                                      
COMPND  34 MOL_ID: 10;                                                          
COMPND  35 MOLECULE: 50S RIBOSOMAL PROTEIN L9;                                  
COMPND  36 CHAIN: H;                                                            
COMPND  37 SYNONYM: RIBOSOMAL PROTEIN BL9;                                      
COMPND  38 MOL_ID: 11;                                                          
COMPND  39 MOLECULE: 50S RIBOSOMAL PROTEIN L10;                                 
COMPND  40 CHAIN: I;                                                            
COMPND  41 SYNONYM: 50S RIBOSOMAL PROTEIN L8, RIBOSOMAL PROTEIN UL10;           
COMPND  42 MOL_ID: 12;                                                          
COMPND  43 MOLECULE: 50S RIBOSOMAL PROTEIN L11;                                 
COMPND  44 CHAIN: J;                                                            
COMPND  45 SYNONYM: RIBOSOMAL PROTEIN UL11;                                     
COMPND  46 MOL_ID: 13;                                                          
COMPND  47 MOLECULE: 50S RIBOSOMAL PROTEIN L13;                                 
COMPND  48 CHAIN: K;                                                            
COMPND  49 SYNONYM: RIBOSOMAL PROTEIN UL13;                                     
COMPND  50 MOL_ID: 14;                                                          
COMPND  51 MOLECULE: 50S RIBOSOMAL PROTEIN L14;                                 
COMPND  52 CHAIN: L;                                                            
COMPND  53 SYNONYM: RIBOSOMAL PROTEIN UL14;                                     
COMPND  54 MOL_ID: 15;                                                          
COMPND  55 MOLECULE: 50S RIBOSOMAL PROTEIN L15;                                 
COMPND  56 CHAIN: M;                                                            
COMPND  57 SYNONYM: RIBOSOMAL PROTEIN UL15;                                     
COMPND  58 MOL_ID: 16;                                                          
COMPND  59 MOLECULE: 50S RIBOSOMAL PROTEIN L16;                                 
COMPND  60 CHAIN: N;                                                            
COMPND  61 SYNONYM: RIBOSOMAL PROTEIN UL16;                                     
COMPND  62 MOL_ID: 17;                                                          
COMPND  63 MOLECULE: 50S RIBOSOMAL PROTEIN L17;                                 
COMPND  64 CHAIN: O;                                                            
COMPND  65 SYNONYM: RIBOSOMAL PROTEIN UL17;                                     
COMPND  66 MOL_ID: 18;                                                          
COMPND  67 MOLECULE: 50S RIBOSOMAL PROTEIN L18;                                 
COMPND  68 CHAIN: P;                                                            
COMPND  69 SYNONYM: RIBOSOMAL PROTEIN UL18;                                     
COMPND  70 MOL_ID: 19;                                                          
COMPND  71 MOLECULE: 50S RIBOSOMAL PROTEIN L19;                                 
COMPND  72 CHAIN: Q;                                                            
COMPND  73 SYNONYM: RIBOSOMAL PROTEIN BL19;                                     
COMPND  74 MOL_ID: 20;                                                          
COMPND  75 MOLECULE: 50S RIBOSOMAL PROTEIN L20;                                 
COMPND  76 CHAIN: R;                                                            
COMPND  77 SYNONYM: RIBOSOMAL PROTEIN BL20;                                     
COMPND  78 MOL_ID: 21;                                                          
COMPND  79 MOLECULE: 50S RIBOSOMAL PROTEIN L21;                                 
COMPND  80 CHAIN: S;                                                            
COMPND  81 SYNONYM: RIBOSOMAL PROTEIN BL21;                                     
COMPND  82 MOL_ID: 22;                                                          
COMPND  83 MOLECULE: 50S RIBOSOMAL PROTEIN L22;                                 
COMPND  84 CHAIN: T;                                                            
COMPND  85 SYNONYM: RIBOSOMAL PROTEIN UL22;                                     
COMPND  86 MOL_ID: 23;                                                          
COMPND  87 MOLECULE: 50S RIBOSOMAL PROTEIN L23;                                 
COMPND  88 CHAIN: U;                                                            
COMPND  89 MOL_ID: 24;                                                          
COMPND  90 MOLECULE: 50S RIBOSOMAL PROTEIN L24;                                 
COMPND  91 CHAIN: V;                                                            
COMPND  92 SYNONYM: RIBOSOMAL PROTEIN UL24;                                     
COMPND  93 MOL_ID: 25;                                                          
COMPND  94 MOLECULE: 50S RIBOSOMAL PROTEIN L25;                                 
COMPND  95 CHAIN: W;                                                            
COMPND  96 SYNONYM: RIBOSOMAL PROTEIN BL25;                                     
COMPND  97 MOL_ID: 26;                                                          
COMPND  98 MOLECULE: 50S RIBOSOMAL PROTEIN L27;                                 
COMPND  99 CHAIN: X;                                                            
COMPND 100 SYNONYM: RIBOSOMAL PROTEIN BL27;                                     
COMPND 101 MOL_ID: 27;                                                          
COMPND 102 MOLECULE: 50S RIBOSOMAL PROTEIN L28;                                 
COMPND 103 CHAIN: Y;                                                            
COMPND 104 SYNONYM: RIBOSOMAL PROTEIN BL28;                                     
COMPND 105 MOL_ID: 28;                                                          
COMPND 106 MOLECULE: 50S RIBOSOMAL PROTEIN L29;                                 
COMPND 107 CHAIN: Z;                                                            
COMPND 108 SYNONYM: RIBOSOMAL PROTEIN UL29;                                     
COMPND 109 MOL_ID: 29;                                                          
COMPND 110 MOLECULE: 50S RIBOSOMAL PROTEIN L30;                                 
COMPND 111 CHAIN: a;                                                            
COMPND 112 SYNONYM: RIBOSOMAL PROTEIN UL30;                                     
COMPND 113 MOL_ID: 30;                                                          
COMPND 114 MOLECULE: 50S RIBOSOMAL PROTEIN L32;                                 
COMPND 115 CHAIN: b;                                                            
COMPND 116 SYNONYM: RIBOSOMAL PROTEIN BL32;                                     
COMPND 117 MOL_ID: 31;                                                          
COMPND 118 MOLECULE: 50S RIBOSOMAL PROTEIN L33;                                 
COMPND 119 CHAIN: c;                                                            
COMPND 120 SYNONYM: RIBOSOMAL PROTEIN BL33;                                     
COMPND 121 MOL_ID: 32;                                                          
COMPND 122 MOLECULE: 50S RIBOSOMAL PROTEIN L34;                                 
COMPND 123 CHAIN: d;                                                            
COMPND 124 SYNONYM: RIBOSOMAL PROTEIN BL34;                                     
COMPND 125 MOL_ID: 33;                                                          
COMPND 126 MOLECULE: 50S RIBOSOMAL PROTEIN L35;                                 
COMPND 127 CHAIN: e;                                                            
COMPND 128 SYNONYM: RIBOSOMAL PROTEIN A,RIBOSOMAL PROTEIN BL35;                 
COMPND 129 MOL_ID: 34;                                                          
COMPND 130 MOLECULE: 50S RIBOSOMAL PROTEIN L36;                                 
COMPND 131 CHAIN: f;                                                            
COMPND 132 SYNONYM: RIBOSOMAL PROTEIN B,RIBOSOMAL PROTEIN BL36;                 
COMPND 133 MOL_ID: 35;                                                          
COMPND 134 MOLECULE: SIGNAL RECOGNITION PARTICLE PROTEIN FFH;                   
COMPND 135 CHAIN: i;                                                            
COMPND 136 ENGINEERED: YES;                                                     
COMPND 137 OTHER_DETAILS: *****NOTES: LESS DEFINED REGIONS WERE REPLACED WITH   
COMPND 138 UNK RESIDUES. FULL SEQUENCE IS BELOW:                                
COMPND 139 MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLT
COMPND 140 PGQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSAD
COMPND 141 VYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQ
COMPND 142 VHASINPVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVG
COMPND 143 EKTEALEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDGFDLNDFLEQLRQMKNMG
COMPND 144 GMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVN
COMPND 145 RLLKQFDDMQRMMKKMKKGGMAKMMRSMKGMMPPGFPGR;                             
COMPND 146 MOL_ID: 36;                                                          
COMPND 147 MOLECULE: 1A9L SS;                                                   
COMPND 148 CHAIN: k;                                                            
COMPND 149 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE   3 ORGANISM_TAXID: 562;                                                 
SOURCE   4 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE   5 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE   6 MOL_ID: 2;                                                           
SOURCE   7 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE   8 ORGANISM_TAXID: 562;                                                 
SOURCE   9 MOL_ID: 3;                                                           
SOURCE  10 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  11 ORGANISM_TAXID: 562;                                                 
SOURCE  12 MOL_ID: 4;                                                           
SOURCE  13 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  14 ORGANISM_TAXID: 562;                                                 
SOURCE  15 MOL_ID: 5;                                                           
SOURCE  16 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  17 ORGANISM_TAXID: 562;                                                 
SOURCE  18 MOL_ID: 6;                                                           
SOURCE  19 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  20 ORGANISM_TAXID: 562;                                                 
SOURCE  21 MOL_ID: 7;                                                           
SOURCE  22 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  23 ORGANISM_TAXID: 562;                                                 
SOURCE  24 MOL_ID: 8;                                                           
SOURCE  25 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  26 ORGANISM_TAXID: 562;                                                 
SOURCE  27 MOL_ID: 9;                                                           
SOURCE  28 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  29 ORGANISM_TAXID: 562;                                                 
SOURCE  30 MOL_ID: 10;                                                          
SOURCE  31 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  32 ORGANISM_TAXID: 562;                                                 
SOURCE  33 MOL_ID: 11;                                                          
SOURCE  34 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  35 ORGANISM_TAXID: 562;                                                 
SOURCE  36 MOL_ID: 12;                                                          
SOURCE  37 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  38 ORGANISM_TAXID: 562;                                                 
SOURCE  39 MOL_ID: 13;                                                          
SOURCE  40 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  41 ORGANISM_TAXID: 562;                                                 
SOURCE  42 MOL_ID: 14;                                                          
SOURCE  43 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  44 ORGANISM_TAXID: 562;                                                 
SOURCE  45 MOL_ID: 15;                                                          
SOURCE  46 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  47 ORGANISM_TAXID: 562;                                                 
SOURCE  48 MOL_ID: 16;                                                          
SOURCE  49 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  50 ORGANISM_TAXID: 562;                                                 
SOURCE  51 MOL_ID: 17;                                                          
SOURCE  52 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  53 ORGANISM_TAXID: 562;                                                 
SOURCE  54 MOL_ID: 18;                                                          
SOURCE  55 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  56 ORGANISM_TAXID: 562;                                                 
SOURCE  57 MOL_ID: 19;                                                          
SOURCE  58 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  59 ORGANISM_TAXID: 562;                                                 
SOURCE  60 MOL_ID: 20;                                                          
SOURCE  61 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  62 ORGANISM_TAXID: 562;                                                 
SOURCE  63 MOL_ID: 21;                                                          
SOURCE  64 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  65 ORGANISM_TAXID: 562;                                                 
SOURCE  66 MOL_ID: 22;                                                          
SOURCE  67 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  68 ORGANISM_TAXID: 562;                                                 
SOURCE  69 MOL_ID: 23;                                                          
SOURCE  70 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI (STRAIN K12);                  
SOURCE  71 ORGANISM_TAXID: 83333;                                               
SOURCE  72 STRAIN: K12;                                                         
SOURCE  73 MOL_ID: 24;                                                          
SOURCE  74 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  75 ORGANISM_TAXID: 562;                                                 
SOURCE  76 MOL_ID: 25;                                                          
SOURCE  77 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  78 ORGANISM_TAXID: 562;                                                 
SOURCE  79 MOL_ID: 26;                                                          
SOURCE  80 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  81 ORGANISM_TAXID: 562;                                                 
SOURCE  82 MOL_ID: 27;                                                          
SOURCE  83 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  84 ORGANISM_TAXID: 562;                                                 
SOURCE  85 MOL_ID: 28;                                                          
SOURCE  86 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  87 ORGANISM_TAXID: 562;                                                 
SOURCE  88 MOL_ID: 29;                                                          
SOURCE  89 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  90 ORGANISM_TAXID: 562;                                                 
SOURCE  91 MOL_ID: 30;                                                          
SOURCE  92 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  93 ORGANISM_TAXID: 562;                                                 
SOURCE  94 MOL_ID: 31;                                                          
SOURCE  95 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  96 ORGANISM_TAXID: 562;                                                 
SOURCE  97 MOL_ID: 32;                                                          
SOURCE  98 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE  99 ORGANISM_TAXID: 562;                                                 
SOURCE 100 MOL_ID: 33;                                                          
SOURCE 101 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE 102 ORGANISM_TAXID: 562;                                                 
SOURCE 103 MOL_ID: 34;                                                          
SOURCE 104 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE 105 ORGANISM_TAXID: 562;                                                 
SOURCE 106 MOL_ID: 35;                                                          
SOURCE 107 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE 108 ORGANISM_TAXID: 562;                                                 
SOURCE 109 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE 110 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE 111 MOL_ID: 36;                                                          
SOURCE 112 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI;                               
SOURCE 113 ORGANISM_TAXID: 562;                                                 
SOURCE 114 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE 115 EXPRESSION_SYSTEM_TAXID: 562                                         
KEYWDS    RIBOSOME NASCENT CHAIN, SRP, SR, RIBOSOME                             
EXPDTA    ELECTRON MICROSCOPY                                                   
AUTHOR    A.JOMAA,D.BOEHRINGER,M.LEIBUNDGUT,N.BAN                               
REVDAT   4   02-AUG-17 5GAG    1                                                
REVDAT   3   12-OCT-16 5GAG    1                                                
REVDAT   2   03-FEB-16 5GAG    1       JRNL                                     
REVDAT   1   27-JAN-16 5GAG    0                                                
JRNL        AUTH   A.JOMAA,D.BOEHRINGER,M.LEIBUNDGUT,N.BAN                      
JRNL        TITL   STRUCTURES OF THE E. COLI TRANSLATING RIBOSOME WITH SRP AND  
JRNL        TITL 2 ITS RECEPTOR AND WITH THE TRANSLOCON.                        
JRNL        REF    NAT COMMUN                    V.   7 10471 2016              
JRNL        REFN                   ESSN 2041-1723                               
JRNL        PMID   26804923                                                     
JRNL        DOI    10.1038/NCOMMS10471                                          
REMARK   2                                                                      
REMARK   2 RESOLUTION.    3.80 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   SOFTWARE PACKAGES      : NULL                                      
REMARK   3   RECONSTRUCTION SCHEMA  : NULL                                      
REMARK   3                                                                      
REMARK   3 EM MAP-MODEL FITTING AND REFINEMENT                                  
REMARK   3   PDB ENTRY                    : NULL                                
REMARK   3   REFINEMENT SPACE             : RECIPROCAL                          
REMARK   3   REFINEMENT PROTOCOL          : RIGID BODY FIT                      
REMARK   3   REFINEMENT TARGET            : NULL                                
REMARK   3   OVERALL ANISOTROPIC B VALUE  : NULL                                
REMARK   3                                                                      
REMARK   3 FITTING PROCEDURE : NULL                                             
REMARK   3                                                                      
REMARK   3 EM IMAGE RECONSTRUCTION STATISTICS                                   
REMARK   3   NOMINAL PIXEL SIZE (ANGSTROMS)    : NULL                           
REMARK   3   ACTUAL PIXEL SIZE  (ANGSTROMS)    : NULL                           
REMARK   3   EFFECTIVE RESOLUTION (ANGSTROMS)  : 3.800                          
REMARK   3   NUMBER OF PARTICLES               : 75942                          
REMARK   3   CTF CORRECTION METHOD             : PHASE FLIPPING AND AMPLITUDE   
REMARK   3                                       CORRECTION                     
REMARK   3                                                                      
REMARK   3 EM RECONSTRUCTION MAGNIFICATION CALIBRATION: NULL                    
REMARK   3                                                                      
REMARK   3 OTHER DETAILS: NULL                                                  
REMARK   4                                                                      
REMARK   4 5GAG COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY PDBE ON 14-DEC-15.                  
REMARK 100 THE DEPOSITION ID IS D_1001300013.                                   
REMARK 245                                                                      
REMARK 245 EXPERIMENTAL DETAILS                                                 
REMARK 245   RECONSTRUCTION METHOD          : SINGLE PARTICLE                   
REMARK 245   SPECIMEN TYPE                  : NULL                              
REMARK 245                                                                      
REMARK 245 ELECTRON MICROSCOPE SAMPLE                                           
REMARK 245   SAMPLE TYPE                    : PARTICLE                          
REMARK 245   PARTICLE TYPE                  : POINT                             
REMARK 245   NAME OF SAMPLE                 : RIBOSOME NASCENT CHAIN COMPLEX    
REMARK 245                                    WITH SRP-SR IN THE CLOSED STATE   
REMARK 245   SAMPLE CONCENTRATION (MG ML-1) : 0.05                              
REMARK 245   SAMPLE SUPPORT DETAILS         : NULL                              
REMARK 245   SAMPLE VITRIFICATION DETAILS   : NULL                              
REMARK 245   SAMPLE BUFFER                  : NULL                              
REMARK 245   PH                             : 7.50                              
REMARK 245   SAMPLE DETAILS                 : NULL                              
REMARK 245                                                                      
REMARK 245 DATA ACQUISITION                                                     
REMARK 245   DATE OF EXPERIMENT                : NULL                           
REMARK 245   NUMBER OF MICROGRAPHS-IMAGES      : NULL                           
REMARK 245   TEMPERATURE (KELVIN)              : NULL                           
REMARK 245   MICROSCOPE MODEL                  : FEI TITAN KRIOS                
REMARK 245   DETECTOR TYPE                     : FEI FALCON II (4K X 4K)        
REMARK 245   MINIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MAXIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MINIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   MAXIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   NOMINAL CS                        : 2.70                           
REMARK 245   IMAGING MODE                      : BRIGHT FIELD                   
REMARK 245   ELECTRON DOSE (ELECTRONS NM**-2)  : 20.00                          
REMARK 245   ILLUMINATION MODE                 : FLOOD BEAM                     
REMARK 245   NOMINAL MAGNIFICATION             : NULL                           
REMARK 245   CALIBRATED MAGNIFICATION          : NULL                           
REMARK 245   SOURCE                            : FIELD EMISSION GUN             
REMARK 245   ACCELERATION VOLTAGE (KV)         : 300                            
REMARK 245   IMAGING DETAILS                   : NULL                           
REMARK 247                                                                      
REMARK 247 ELECTRON MICROSCOPY                                                  
REMARK 247  THE COORDINATES IN THIS ENTRY WERE GENERATED FROM ELECTRON          
REMARK 247  MICROSCOPY DATA. PROTEIN DATA BANK CONVENTIONS REQUIRE              
REMARK 247  THAT CRYST1 AND SCALE RECORDS BE INCLUDED, BUT THE VALUES           
REMARK 247  ON THESE RECORDS ARE MEANINGLESS EXCEPT FOR THE CALCULATION         
REMARK 247  OF THE STRUCTURE FACTORS.                                           
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: 36-MERIC                   
REMARK 350 SOFTWARE USED: PISA                                                  
REMARK 350 TOTAL BURIED SURFACE AREA: 209960 ANGSTROM**2                        
REMARK 350 SURFACE AREA OF THE COMPLEX: 495670 ANGSTROM**2                      
REMARK 350 CHANGE IN SOLVENT FREE ENERGY: -5025.0 KCAL/MOL                      
REMARK 350 APPLY THE FOLLOWING TO CHAINS: 1, 2, A, B, C, D, E, F, G, H,         
REMARK 350                    AND CHAINS: I, J, K, L, M, N, O, P, Q,            
REMARK 350                    AND CHAINS: R, S, T, U, V, W, X, Y, Z, a,         
REMARK 350                    AND CHAINS: b, c, d, e, f, i, k                   
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465       G 1     1                                                      
REMARK 465       G 1     2                                                      
REMARK 465       G 1     3                                                      
REMARK 465       G 1     4                                                      
REMARK 465       G 1     5                                                      
REMARK 465       C 1     6                                                      
REMARK 465       U 1     7                                                      
REMARK 465       C 1     8                                                      
REMARK 465       U 1     9                                                      
REMARK 465       G 1    10                                                      
REMARK 465       U 1    11                                                      
REMARK 465       U 1    12                                                      
REMARK 465       G 1    13                                                      
REMARK 465       G 1    14                                                      
REMARK 465       U 1    15                                                      
REMARK 465       U 1    16                                                      
REMARK 465       C 1    17                                                      
REMARK 465       U 1    18                                                      
REMARK 465       C 1    19                                                      
REMARK 465       C 1    20                                                      
REMARK 465       C 1    21                                                      
REMARK 465       G 1    22                                                      
REMARK 465       C 1    23                                                      
REMARK 465       A 1    24                                                      
REMARK 465       A 1    25                                                      
REMARK 465       C 1    26                                                      
REMARK 465       G 1    27                                                      
REMARK 465       C 1    28                                                      
REMARK 465       U 1    29                                                      
REMARK 465       A 1    30                                                      
REMARK 465       C 1    31                                                      
REMARK 465       U 1    75                                                      
REMARK 465       G 1    76                                                      
REMARK 465       A 1    77                                                      
REMARK 465       C 1    78                                                      
REMARK 465       G 1    79                                                      
REMARK 465       C 1    80                                                      
REMARK 465       G 1    81                                                      
REMARK 465       U 1    82                                                      
REMARK 465       G 1    83                                                      
REMARK 465       U 1    84                                                      
REMARK 465       G 1    85                                                      
REMARK 465       C 1    86                                                      
REMARK 465       C 1    87                                                      
REMARK 465       G 1    88                                                      
REMARK 465       G 1    89                                                      
REMARK 465       G 1    90                                                      
REMARK 465       A 1    91                                                      
REMARK 465       U 1    92                                                      
REMARK 465       G 1    93                                                      
REMARK 465       U 1    94                                                      
REMARK 465       A 1    95                                                      
REMARK 465       G 1    96                                                      
REMARK 465       C 1    97                                                      
REMARK 465       U 1    98                                                      
REMARK 465       G 1    99                                                      
REMARK 465       G 1   100                                                      
REMARK 465       C 1   101                                                      
REMARK 465       A 1   102                                                      
REMARK 465       G 1   103                                                      
REMARK 465       G 1   104                                                      
REMARK 465       G 1   105                                                      
REMARK 465       C 1   106                                                      
REMARK 465       C 1   107                                                      
REMARK 465       C 1   108                                                      
REMARK 465       C 1   109                                                      
REMARK 465       C 1   110                                                      
REMARK 465       A 1   111                                                      
REMARK 465       C 1   112                                                      
REMARK 465       C 1   113                                                      
REMARK 465       U A   546                                                      
REMARK 465       A A   547                                                      
REMARK 465       G A   883                                                      
REMARK 465       U A   884                                                      
REMARK 465       C A   885                                                      
REMARK 465       A A   886                                                      
REMARK 465       U A   887                                                      
REMARK 465       C A   888                                                      
REMARK 465       C A   889                                                      
REMARK 465       C A   890                                                      
REMARK 465       G A   891                                                      
REMARK 465       A A   892                                                      
REMARK 465       C A   893                                                      
REMARK 465       U A  1174                                                      
REMARK 465       A A  1175                                                      
REMARK 465       U A  1176                                                      
REMARK 465       A A  1913                                                      
REMARK 465       C A  1914                                                      
REMARK 465       U A  1915                                                      
REMARK 465       A A  1916                                                      
REMARK 465     MET C     1                                                      
REMARK 465     MET F     1                                                      
REMARK 465     MET G     1                                                      
REMARK 465     MET I     1                                                      
REMARK 465     ALA I   127                                                      
REMARK 465     THR I   128                                                      
REMARK 465     LEU I   129                                                      
REMARK 465     PRO I   130                                                      
REMARK 465     THR I   131                                                      
REMARK 465     TYR I   132                                                      
REMARK 465     GLU I   133                                                      
REMARK 465     GLU I   134                                                      
REMARK 465     ALA I   135                                                      
REMARK 465     ILE I   136                                                      
REMARK 465     ALA I   137                                                      
REMARK 465     ARG I   138                                                      
REMARK 465     LEU I   139                                                      
REMARK 465     MET I   140                                                      
REMARK 465     ALA I   141                                                      
REMARK 465     THR I   142                                                      
REMARK 465     MET I   143                                                      
REMARK 465     LYS I   144                                                      
REMARK 465     GLU I   145                                                      
REMARK 465     ALA I   146                                                      
REMARK 465     SER I   147                                                      
REMARK 465     ALA I   148                                                      
REMARK 465     GLY I   149                                                      
REMARK 465     LYS I   150                                                      
REMARK 465     LEU I   151                                                      
REMARK 465     VAL I   152                                                      
REMARK 465     ARG I   153                                                      
REMARK 465     THR I   154                                                      
REMARK 465     LEU I   155                                                      
REMARK 465     ALA I   156                                                      
REMARK 465     ALA I   157                                                      
REMARK 465     VAL I   158                                                      
REMARK 465     ARG I   159                                                      
REMARK 465     ASP I   160                                                      
REMARK 465     ALA I   161                                                      
REMARK 465     LYS I   162                                                      
REMARK 465     GLU I   163                                                      
REMARK 465     ALA I   164                                                      
REMARK 465     ALA I   165                                                      
REMARK 465     MET J     1                                                      
REMARK 465     ALA J     2                                                      
REMARK 465     LYS J     3                                                      
REMARK 465     LYS J     4                                                      
REMARK 465     VAL J     5                                                      
REMARK 465     GLN J     6                                                      
REMARK 465     ALA J     7                                                      
REMARK 465     ASP J   142                                                      
REMARK 465     ALA O   126                                                      
REMARK 465     GLU O   127                                                      
REMARK 465     MET Q     1                                                      
REMARK 465     MET R     1                                                      
REMARK 465     MET U     1                                                      
REMARK 465     GLY U    97                                                      
REMARK 465     GLY U    98                                                      
REMARK 465     ALA U    99                                                      
REMARK 465     GLU U   100                                                      
REMARK 465     MET V     1                                                      
REMARK 465     MET X     1                                                      
REMARK 465     ALA X     2                                                      
REMARK 465     HIS X     3                                                      
REMARK 465     LYS X     4                                                      
REMARK 465     LYS X     5                                                      
REMARK 465     ALA X     6                                                      
REMARK 465     GLY X     7                                                      
REMARK 465     GLY X     8                                                      
REMARK 465     SER X     9                                                      
REMARK 465     MET Y     1                                                      
REMARK 465     MET Z     1                                                      
REMARK 465     MET a     1                                                      
REMARK 465     MET b     1                                                      
REMARK 465     MET c     1                                                      
REMARK 465     ALA c     2                                                      
REMARK 465     LYS c     3                                                      
REMARK 465     LYS c    55                                                      
REMARK 465     MET e     1                                                      
REMARK 465     ASN i     4                                                      
REMARK 465     LEU i     5                                                      
REMARK 465     THR i     6                                                      
REMARK 465     ASP i     7                                                      
REMARK 465     ARG i     8                                                      
REMARK 465     LEU i     9                                                      
REMARK 465     SER i    10                                                      
REMARK 465     ARG i    11                                                      
REMARK 465     THR i    12                                                      
REMARK 465     LEU i    13                                                      
REMARK 465     ARG i    14                                                      
REMARK 465     ASN i    15                                                      
REMARK 465     ILE i    16                                                      
REMARK 465     SER i    17                                                      
REMARK 465     GLY i    18                                                      
REMARK 465     ARG i    19                                                      
REMARK 465     GLY i    20                                                      
REMARK 465     ARG i    21                                                      
REMARK 465     LEU i    22                                                      
REMARK 465     THR i    23                                                      
REMARK 465     GLU i    24                                                      
REMARK 465     ASP i    25                                                      
REMARK 465     ASN i    26                                                      
REMARK 465     VAL i    27                                                      
REMARK 465     LYS i    28                                                      
REMARK 465     ASP i    29                                                      
REMARK 465     THR i    30                                                      
REMARK 465     LEU i    31                                                      
REMARK 465     ARG i    32                                                      
REMARK 465     GLU i    33                                                      
REMARK 465     VAL i    34                                                      
REMARK 465     ARG i    35                                                      
REMARK 465     MET i    36                                                      
REMARK 465     ALA i    37                                                      
REMARK 465     LEU i    38                                                      
REMARK 465     LEU i    39                                                      
REMARK 465     GLU i    40                                                      
REMARK 465     ALA i    41                                                      
REMARK 465     ASP i    42                                                      
REMARK 465     VAL i    43                                                      
REMARK 465     ALA i    44                                                      
REMARK 465     LEU i    45                                                      
REMARK 465     PRO i    46                                                      
REMARK 465     VAL i    47                                                      
REMARK 465     VAL i    48                                                      
REMARK 465     ARG i    49                                                      
REMARK 465     GLU i    50                                                      
REMARK 465     PHE i    51                                                      
REMARK 465     ILE i    52                                                      
REMARK 465     ASN i    53                                                      
REMARK 465     ARG i    54                                                      
REMARK 465     VAL i    55                                                      
REMARK 465     LYS i    56                                                      
REMARK 465     GLU i    57                                                      
REMARK 465     LYS i    58                                                      
REMARK 465     ALA i    59                                                      
REMARK 465     VAL i    60                                                      
REMARK 465     GLY i    61                                                      
REMARK 465     HIS i    62                                                      
REMARK 465     GLU i    63                                                      
REMARK 465     VAL i    64                                                      
REMARK 465     ASN i    65                                                      
REMARK 465     LYS i    66                                                      
REMARK 465     SER i    67                                                      
REMARK 465     LEU i    68                                                      
REMARK 465     THR i    69                                                      
REMARK 465     PRO i    70                                                      
REMARK 465     GLY i    71                                                      
REMARK 465     GLN i    72                                                      
REMARK 465     GLU i    73                                                      
REMARK 465     PHE i    74                                                      
REMARK 465     VAL i    75                                                      
REMARK 465     LYS i    76                                                      
REMARK 465     ILE i    77                                                      
REMARK 465     VAL i    78                                                      
REMARK 465     ARG i    79                                                      
REMARK 465     ASN i    80                                                      
REMARK 465     GLU i    81                                                      
REMARK 465     LEU i    82                                                      
REMARK 465     VAL i    83                                                      
REMARK 465     ALA i    84                                                      
REMARK 465     ALA i    85                                                      
REMARK 465     MET i    86                                                      
REMARK 465     GLY i    87                                                      
REMARK 465     GLU i    88                                                      
REMARK 465     GLU i    89                                                      
REMARK 465     ASN i    90                                                      
REMARK 465     GLN i    91                                                      
REMARK 465     THR i    92                                                      
REMARK 465     LEU i    93                                                      
REMARK 465     ASN i    94                                                      
REMARK 465     LEU i    95                                                      
REMARK 465     ALA i    96                                                      
REMARK 465     ALA i    97                                                      
REMARK 465     GLN i    98                                                      
REMARK 465     PRO i    99                                                      
REMARK 465     PRO i   100                                                      
REMARK 465     ALA i   101                                                      
REMARK 465     VAL i   102                                                      
REMARK 465     VAL i   103                                                      
REMARK 465     LEU i   104                                                      
REMARK 465     MET i   105                                                      
REMARK 465     ALA i   106                                                      
REMARK 465     GLY i   107                                                      
REMARK 465     LEU i   108                                                      
REMARK 465     GLN i   109                                                      
REMARK 465     GLY i   110                                                      
REMARK 465     ALA i   111                                                      
REMARK 465     GLY i   112                                                      
REMARK 465     LYS i   113                                                      
REMARK 465     THR i   114                                                      
REMARK 465     THR i   115                                                      
REMARK 465     SER i   116                                                      
REMARK 465     VAL i   117                                                      
REMARK 465     GLY i   118                                                      
REMARK 465     LYS i   119                                                      
REMARK 465     LEU i   120                                                      
REMARK 465     GLY i   121                                                      
REMARK 465     LYS i   122                                                      
REMARK 465     PHE i   123                                                      
REMARK 465     LEU i   124                                                      
REMARK 465     ARG i   125                                                      
REMARK 465     GLU i   126                                                      
REMARK 465     LYS i   127                                                      
REMARK 465     HIS i   128                                                      
REMARK 465     LYS i   129                                                      
REMARK 465     LYS i   130                                                      
REMARK 465     LYS i   131                                                      
REMARK 465     VAL i   132                                                      
REMARK 465     LEU i   133                                                      
REMARK 465     VAL i   134                                                      
REMARK 465     VAL i   135                                                      
REMARK 465     SER i   136                                                      
REMARK 465     ALA i   137                                                      
REMARK 465     ASP i   138                                                      
REMARK 465     VAL i   139                                                      
REMARK 465     TYR i   140                                                      
REMARK 465     ARG i   141                                                      
REMARK 465     PRO i   142                                                      
REMARK 465     ALA i   143                                                      
REMARK 465     ALA i   144                                                      
REMARK 465     ILE i   145                                                      
REMARK 465     LYS i   146                                                      
REMARK 465     GLN i   147                                                      
REMARK 465     LEU i   148                                                      
REMARK 465     GLU i   149                                                      
REMARK 465     THR i   150                                                      
REMARK 465     LEU i   151                                                      
REMARK 465     ALA i   152                                                      
REMARK 465     GLU i   153                                                      
REMARK 465     GLN i   154                                                      
REMARK 465     VAL i   155                                                      
REMARK 465     GLY i   156                                                      
REMARK 465     VAL i   157                                                      
REMARK 465     ASP i   158                                                      
REMARK 465     PHE i   159                                                      
REMARK 465     PHE i   160                                                      
REMARK 465     PRO i   161                                                      
REMARK 465     SER i   162                                                      
REMARK 465     ASP i   163                                                      
REMARK 465     VAL i   164                                                      
REMARK 465     GLY i   165                                                      
REMARK 465     GLN i   166                                                      
REMARK 465     LYS i   167                                                      
REMARK 465     PRO i   168                                                      
REMARK 465     VAL i   169                                                      
REMARK 465     ASP i   170                                                      
REMARK 465     ILE i   171                                                      
REMARK 465     VAL i   172                                                      
REMARK 465     ASN i   173                                                      
REMARK 465     ALA i   174                                                      
REMARK 465     ALA i   175                                                      
REMARK 465     LEU i   176                                                      
REMARK 465     LYS i   177                                                      
REMARK 465     GLU i   178                                                      
REMARK 465     ALA i   179                                                      
REMARK 465     LYS i   180                                                      
REMARK 465     LEU i   181                                                      
REMARK 465     LYS i   182                                                      
REMARK 465     PHE i   183                                                      
REMARK 465     TYR i   184                                                      
REMARK 465     ASP i   185                                                      
REMARK 465     VAL i   186                                                      
REMARK 465     LEU i   187                                                      
REMARK 465     LEU i   188                                                      
REMARK 465     VAL i   189                                                      
REMARK 465     ASP i   190                                                      
REMARK 465     THR i   191                                                      
REMARK 465     ALA i   192                                                      
REMARK 465     GLY i   193                                                      
REMARK 465     ARG i   194                                                      
REMARK 465     LEU i   195                                                      
REMARK 465     HIS i   196                                                      
REMARK 465     VAL i   197                                                      
REMARK 465     ASP i   198                                                      
REMARK 465     GLU i   199                                                      
REMARK 465     ALA i   200                                                      
REMARK 465     MET i   201                                                      
REMARK 465     MET i   202                                                      
REMARK 465     ASP i   203                                                      
REMARK 465     GLU i   204                                                      
REMARK 465     ILE i   205                                                      
REMARK 465     LYS i   206                                                      
REMARK 465     GLN i   207                                                      
REMARK 465     VAL i   208                                                      
REMARK 465     HIS i   209                                                      
REMARK 465     ALA i   210                                                      
REMARK 465     SER i   211                                                      
REMARK 465     ILE i   212                                                      
REMARK 465     ASN i   213                                                      
REMARK 465     PRO i   214                                                      
REMARK 465     VAL i   215                                                      
REMARK 465     GLU i   216                                                      
REMARK 465     THR i   217                                                      
REMARK 465     LEU i   218                                                      
REMARK 465     PHE i   219                                                      
REMARK 465     VAL i   220                                                      
REMARK 465     VAL i   221                                                      
REMARK 465     ASP i   222                                                      
REMARK 465     ALA i   223                                                      
REMARK 465     MET i   224                                                      
REMARK 465     THR i   225                                                      
REMARK 465     GLY i   226                                                      
REMARK 465     GLN i   227                                                      
REMARK 465     ASP i   228                                                      
REMARK 465     ALA i   229                                                      
REMARK 465     ALA i   230                                                      
REMARK 465     ASN i   231                                                      
REMARK 465     THR i   232                                                      
REMARK 465     ALA i   233                                                      
REMARK 465     LYS i   234                                                      
REMARK 465     ALA i   235                                                      
REMARK 465     PHE i   236                                                      
REMARK 465     ASN i   237                                                      
REMARK 465     GLU i   238                                                      
REMARK 465     ALA i   239                                                      
REMARK 465     LEU i   240                                                      
REMARK 465     PRO i   241                                                      
REMARK 465     LEU i   242                                                      
REMARK 465     THR i   243                                                      
REMARK 465     GLY i   244                                                      
REMARK 465     VAL i   245                                                      
REMARK 465     VAL i   246                                                      
REMARK 465     LEU i   247                                                      
REMARK 465     THR i   248                                                      
REMARK 465     LYS i   249                                                      
REMARK 465     VAL i   250                                                      
REMARK 465     ASP i   251                                                      
REMARK 465     GLY i   252                                                      
REMARK 465     ASP i   253                                                      
REMARK 465     ALA i   254                                                      
REMARK 465     ARG i   255                                                      
REMARK 465     GLY i   256                                                      
REMARK 465     GLY i   257                                                      
REMARK 465     ALA i   258                                                      
REMARK 465     ALA i   259                                                      
REMARK 465     LEU i   260                                                      
REMARK 465     SER i   261                                                      
REMARK 465     ILE i   262                                                      
REMARK 465     ARG i   263                                                      
REMARK 465     HIS i   264                                                      
REMARK 465     ILE i   265                                                      
REMARK 465     THR i   266                                                      
REMARK 465     GLY i   267                                                      
REMARK 465     LYS i   268                                                      
REMARK 465     PRO i   269                                                      
REMARK 465     ILE i   270                                                      
REMARK 465     LYS i   271                                                      
REMARK 465     PHE i   272                                                      
REMARK 465     LEU i   273                                                      
REMARK 465     GLY i   274                                                      
REMARK 465     VAL i   275                                                      
REMARK 465     GLY i   276                                                      
REMARK 465     GLU i   277                                                      
REMARK 465     LYS i   278                                                      
REMARK 465     THR i   279                                                      
REMARK 465     GLU i   280                                                      
REMARK 465     ALA i   281                                                      
REMARK 465     LEU i   282                                                      
REMARK 465     GLU i   283                                                      
REMARK 465     PRO i   284                                                      
REMARK 465     PHE i   285                                                      
REMARK 465     HIS i   286                                                      
REMARK 465     PRO i   287                                                      
REMARK 465     ASP i   288                                                      
REMARK 465     ARG i   289                                                      
REMARK 465     ILE i   290                                                      
REMARK 465     ALA i   291                                                      
REMARK 465     SER i   292                                                      
REMARK 465     ARG i   293                                                      
REMARK 465     ILE i   294                                                      
REMARK 465     LEU i   295                                                      
REMARK 465     GLY i   296                                                      
REMARK 465     MET i   297                                                      
REMARK 465     UNK i   298                                                      
REMARK 465     UNK i   299                                                      
REMARK 465     UNK i   300                                                      
REMARK 465     UNK i   301                                                      
REMARK 465     UNK i   302                                                      
REMARK 465     UNK i   303                                                      
REMARK 465     UNK i   304                                                      
REMARK 465     UNK i   305                                                      
REMARK 465     UNK i   306                                                      
REMARK 465     UNK i   307                                                      
REMARK 465     UNK i   308                                                      
REMARK 465     UNK i   309                                                      
REMARK 465     UNK i   310                                                      
REMARK 465     UNK i   311                                                      
REMARK 465     UNK i   312                                                      
REMARK 465     UNK i   313                                                      
REMARK 465     UNK i   314                                                      
REMARK 465     UNK i   315                                                      
REMARK 465     UNK i   316                                                      
REMARK 465     UNK i   317                                                      
REMARK 465     UNK i   318                                                      
REMARK 465     UNK i   319                                                      
REMARK 465     UNK i   320                                                      
REMARK 465     UNK i   321                                                      
REMARK 465     UNK i   322                                                      
REMARK 465     UNK i   323                                                      
REMARK 465     UNK i   324                                                      
REMARK 465     UNK i   325                                                      
REMARK 465     UNK i   326                                                      
REMARK 465     UNK i   327                                                      
REMARK 470                                                                      
REMARK 470 MISSING ATOM                                                         
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 470 I=INSERTION CODE):                                                   
REMARK 470   M RES CSSEQI  ATOMS                                                
REMARK 470     LYS C 273    CA   C    O    CB   CG   CD   CE                    
REMARK 470     LYS C 273    NZ                                                  
REMARK 470     LYS F 179    CA   C    O    CB   CG   CD   CE                    
REMARK 470     LYS F 179    NZ                                                  
REMARK 470     LYS V 104    CA   C    O    CB   CG   CD   CE                    
REMARK 470     LYS V 104    NZ                                                  
REMARK 470     THR X  10    OG1  CG2                                            
REMARK 470     ILE c  54    CG1  CG2  CD1                                       
REMARK 470     LYS i 371    CG   CD   CE   NZ                                   
REMARK 470     LYS i 431    CG   CD   CE   NZ                                   
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   O2     U A   276     N6     A A   278              2.03            
REMARK 500   O2'    A A  1342     OP2    U A  1344              2.05            
REMARK 500   NZ   LYS c    25     O    GLU c    32              2.07            
REMARK 500   O2'    C 1    62     O    SER i   382              2.09            
REMARK 500   O2     C B    43     NH2  ARG F    92              2.09            
REMARK 500   O2'    U A  1534     O6     G A  1537              2.10            
REMARK 500   O2'    U A  2130     O2'    G A  2133              2.11            
REMARK 500   OP1    G A  1753     NH1  ARG Q    93              2.12            
REMARK 500   N3     U A   545     O6     G A   548              2.13            
REMARK 500   O    ALA D   196     OG   SER D   199              2.13            
REMARK 500   O2'    G A   370     OP1    G A   424              2.14            
REMARK 500   O2'    G A  1266     O6     G A  2012              2.15            
REMARK 500   OP1    G A   617     NH2  ARG E   102              2.15            
REMARK 500   OP1    C A  2420     OG1  THR e    34              2.17            
REMARK 500   OP1    U A  2122     N2     G A  2168              2.17            
REMARK 500   OE1  GLN W    51     OH   TYR W    57              2.17            
REMARK 500   N2     G A  1869     O2'    A A  1871              2.17            
REMARK 500   O    HIS N    13     NZ   LYS N    71              2.18            
REMARK 500   O2'    C A  2636     OH   TYR D    45              2.18            
REMARK 500   O2     C A  2793     N2     G A  2803              2.19            
REMARK 500   O2     U A   545     N1     G A   548              2.19            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND LENGTHS                                      
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,2(A3,1X,A1,I4,A1,1X,A4,3X),1X,F6.3)               
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   RES CSSEQI ATM2   DEVIATION                     
REMARK 500      A A1490   N9      A A1490   C4      0.038                       
REMARK 500      A A2117   N9      A A2117   C4      0.036                       
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500      A 1  42   O4' -  C1' -  N9  ANGL. DEV. =   4.9 DEGREES          
REMARK 500      A 1  42   C4  -  N9  -  C1' ANGL. DEV. =  12.1 DEGREES          
REMARK 500      C 1  62   C6  -  N1  -  C2  ANGL. DEV. =  -2.9 DEGREES          
REMARK 500      G A 141   N7  -  C8  -  N9  ANGL. DEV. =   3.2 DEGREES          
REMARK 500      C A 281   O3' -  P   -  OP2 ANGL. DEV. =   9.1 DEGREES          
REMARK 500      A A 479   O4' -  C1' -  N9  ANGL. DEV. =   4.4 DEGREES          
REMARK 500      C A 645   C2  -  N1  -  C1' ANGL. DEV. =   7.1 DEGREES          
REMARK 500      G A 748   O4' -  C1' -  N9  ANGL. DEV. =   4.3 DEGREES          
REMARK 500      C A 995   C6  -  N1  -  C2  ANGL. DEV. =   2.9 DEGREES          
REMARK 500      C A1052   C5  -  C6  -  N1  ANGL. DEV. =   3.6 DEGREES          
REMARK 500      U A1065   C6  -  N1  -  C2  ANGL. DEV. =  -3.7 DEGREES          
REMARK 500      U A1065   C5  -  C6  -  N1  ANGL. DEV. =   3.0 DEGREES          
REMARK 500      C A1072   C6  -  N1  -  C2  ANGL. DEV. =  -3.3 DEGREES          
REMARK 500      C A1072   C5  -  C6  -  N1  ANGL. DEV. =   3.1 DEGREES          
REMARK 500      C A1164   C6  -  N1  -  C2  ANGL. DEV. =  -2.5 DEGREES          
REMARK 500      A A1308   N1  -  C6  -  N6  ANGL. DEV. =  -3.6 DEGREES          
REMARK 500      A A1434   O4' -  C1' -  N9  ANGL. DEV. =   4.5 DEGREES          
REMARK 500      A A1490   N7  -  C8  -  N9  ANGL. DEV. =   3.9 DEGREES          
REMARK 500      A A1490   C8  -  N9  -  C4  ANGL. DEV. =  -4.2 DEGREES          
REMARK 500      C A1533   C6  -  N1  -  C2  ANGL. DEV. =  -2.6 DEGREES          
REMARK 500      C A1533   C5  -  C6  -  N1  ANGL. DEV. =   3.6 DEGREES          
REMARK 500      U A1584   N1  -  C2  -  O2  ANGL. DEV. =   4.5 DEGREES          
REMARK 500      U A1584   C2  -  N1  -  C1' ANGL. DEV. =   9.3 DEGREES          
REMARK 500      U A1917   C2  -  N1  -  C1' ANGL. DEV. =   8.4 DEGREES          
REMARK 500      A A1970   C8  -  N9  -  C4  ANGL. DEV. =  -2.9 DEGREES          
REMARK 500      C A2153   C6  -  N1  -  C2  ANGL. DEV. =  -2.8 DEGREES          
REMARK 500      C A2160   C6  -  N1  -  C2  ANGL. DEV. =  -3.4 DEGREES          
REMARK 500      C A2160   C5  -  C6  -  N1  ANGL. DEV. =   3.3 DEGREES          
REMARK 500      C A2177   C6  -  N1  -  C2  ANGL. DEV. =  -2.4 DEGREES          
REMARK 500      C A2422   O4' -  C1' -  N1  ANGL. DEV. =   6.6 DEGREES          
REMARK 500      C A2422   C6  -  N1  -  C2  ANGL. DEV. =  -2.9 DEGREES          
REMARK 500      U A2423   C6  -  N1  -  C2  ANGL. DEV. =  -4.9 DEGREES          
REMARK 500      C A2427   C6  -  N1  -  C2  ANGL. DEV. =  -3.4 DEGREES          
REMARK 500      U A2431   C5  -  C4  -  O4  ANGL. DEV. =   3.9 DEGREES          
REMARK 500      U A2796   C5  -  C6  -  N1  ANGL. DEV. =   3.1 DEGREES          
REMARK 500    PRO D 143   C   -  N   -  CA  ANGL. DEV. =  10.6 DEGREES          
REMARK 500    PRO K   8   C   -  N   -  CA  ANGL. DEV. =   9.1 DEGREES          
REMARK 500    PRO i 391   C   -  N   -  CA  ANGL. DEV. =  10.6 DEGREES          
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    SER C  10      139.20   -176.04                                   
REMARK 500    GLN C 153      -61.03   -128.10                                   
REMARK 500    PHE C 240      -78.36   -124.83                                   
REMARK 500    LYS C 253       71.64     53.05                                   
REMARK 500    GLN D 130     -168.33    -75.28                                   
REMARK 500    HIS D 140      -62.96   -133.11                                   
REMARK 500    GLN D 148      -79.40   -102.37                                   
REMARK 500    ASN D 149     -166.22   -172.98                                   
REMARK 500    LYS E   6      -75.34    -57.78                                   
REMARK 500    THR E  18      -63.10   -104.20                                   
REMARK 500    SER E  80       -1.14     67.12                                   
REMARK 500    GLU E 144      -75.69   -121.43                                   
REMARK 500    GLU F  11      -64.80   -104.08                                   
REMARK 500    GLU F  32      -70.59    -81.26                                   
REMARK 500    VAL F  40      -74.58    -94.51                                   
REMARK 500    LYS F  78       60.49     60.70                                   
REMARK 500    ASP G  47     -126.26     54.22                                   
REMARK 500    THR G  80      -69.80   -107.62                                   
REMARK 500    TYR G 157      -71.59    -99.32                                   
REMARK 500    ASN H  11       -1.83     69.23                                   
REMARK 500    PHE H  29      -66.75   -132.36                                   
REMARK 500    LYS H  42      -70.11    -45.86                                   
REMARK 500    LEU H  75        0.12    -63.55                                   
REMARK 500    GLU H  87       -3.18     73.72                                   
REMARK 500    PRO H 118     -170.79    -66.06                                   
REMARK 500    LEU H 122       65.82     61.38                                   
REMARK 500    THR I  67      150.98     69.83                                   
REMARK 500    PRO I  68       46.46    -91.28                                   
REMARK 500    GLU I  70       -7.98    -59.66                                   
REMARK 500    HIS I  88      148.34     78.94                                   
REMARK 500    ALA I  91      -14.79     67.29                                   
REMARK 500    PHE I 106     -144.37     41.55                                   
REMARK 500    GLU I 107      -68.71   -135.33                                   
REMARK 500    VAL I 108       72.85     62.93                                   
REMARK 500    LYS I 109      -71.20    -73.72                                   
REMARK 500    GLU I 114       -3.84     72.11                                   
REMARK 500    ARG J  65      -13.90     76.85                                   
REMARK 500    ASN J  94      -12.59     64.07                                   
REMARK 500    ARG K  95      -74.41    -76.13                                   
REMARK 500    GLN L   5       -2.38     83.77                                   
REMARK 500    ARG L  17      -73.52   -123.23                                   
REMARK 500    ASN L  90      -65.70   -102.67                                   
REMARK 500    LYS M  29     -113.09     52.61                                   
REMARK 500    LYS M  36     -143.91     50.96                                   
REMARK 500    GLN N   3      134.78    179.29                                   
REMARK 500    PHE N  28      -72.25   -131.02                                   
REMARK 500    PRO N  77     -174.31    -66.26                                   
REMARK 500    GLU O  32      -15.19     69.30                                   
REMARK 500    VAL O  47      -60.91   -101.06                                   
REMARK 500    GLU O  82      -61.56   -127.12                                   
REMARK 500                                                                      
REMARK 500 THIS ENTRY HAS      74 RAMACHANDRAN OUTLIERS.                        
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: NON-CIS, NON-TRANS                                         
REMARK 500                                                                      
REMARK 500 THE FOLLOWING PEPTIDE BONDS DEVIATE SIGNIFICANTLY FROM BOTH          
REMARK 500 CIS AND TRANS CONFORMATION.  CIS BONDS, IF ANY, ARE LISTED           
REMARK 500 ON CISPEP RECORDS.  TRANS IS DEFINED AS 180 +/- 30 AND               
REMARK 500 CIS IS DEFINED AS 0 +/- 30 DEGREES.                                  
REMARK 500                                 MODEL     OMEGA                      
REMARK 500 HIS C  232     GLY C  233                  145.75                    
REMARK 500 UNK i  367     UNK i  368                  148.45                    
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 620                                                                      
REMARK 620 METAL COORDINATION                                                   
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):                             
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3134  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 163   OP2                                                    
REMARK 620 2   C A 164   OP2 107.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3095  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 192   OP1                                                    
REMARK 620 2   U A2243   OP1  78.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3098  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 197   OP1                                                    
REMARK 620 2   C A 198   OP2  91.4                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3377  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 284   O4                                                     
REMARK 620 2   G A 285   O6   78.3                                              
REMARK 620 3   U A 355   O4  174.0 107.5                                        
REMARK 620 4   G A 356   O6   69.0  82.1 109.9                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3066  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 370   OP2                                                    
REMARK 620 2   A A 422   OP2 160.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3133  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 375   OP1                                                    
REMARK 620 2   C A 393   OP1  92.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3067  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 411   OP1                                                    
REMARK 620 2   A A2407   OP1  86.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3007  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 450   O6                                                     
REMARK 620 2   A A 453   OP1  82.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3302  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 452   O4'                                                    
REMARK 620 2   A A 470   OP2  92.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3225  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 452   O3'                                                    
REMARK 620 2   A A 453   OP1  61.0                                              
REMARK 620 3   A A 471   OP1 140.9 148.9                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3147  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 505   OP2                                                    
REMARK 620 2   G A1235   OP1  64.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3101  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 510   OP1                                                    
REMARK 620 2   U A 511   OP2  74.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3008  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 526   OP1                                                    
REMARK 620 2   C A 527   OP1  77.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3085  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 570   O6                                                     
REMARK 620 2   A A2448   OP1 153.8                                              
REMARK 620 3   C A2499   OP1  75.0  79.0                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3012  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 574   OP1                                                    
REMARK 620 2   A A 574   OP2  56.4                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3082  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 576   OP1                                                    
REMARK 620 2   A A2503   OP1  78.5                                              
REMARK 620 3   A A2503   OP2 137.3  58.8                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3177  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 586   OP2                                                    
REMARK 620 2   U A1249   OP1 146.1                                              
REMARK 620 3   G A1250   OP1 131.7  72.7                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3257  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 594   O4                                                     
REMARK 620 2   G A 662   O6   89.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3142  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 597   O6                                                     
REMARK 620 2   U A 598   O4   78.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3016  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 622   OP1                                                    
REMARK 620 2 ASN M  99   OD1 130.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3331  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 638   O6                                                     
REMARK 620 2   G A 649   O6   64.4                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3341  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 695   O6                                                     
REMARK 620 2   U A 767   O4   97.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3334  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 711   O6                                                     
REMARK 620 2   G A 712   O6   86.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3087  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 740   OP2                                                    
REMARK 620 2   A A1783   OP1 161.8                                              
REMARK 620 3   A A1784   OP2 101.4  72.2                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3020  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 751   OP1                                                    
REMARK 620 2   A A1614   OP1 170.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3021  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 783   OP2                                                    
REMARK 620 2   G A 784   OP2  75.4                                              
REMARK 620 3   A A2589   OP1  73.8  83.2                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3022  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 784   OP1                                                    
REMARK 620 2   G A2588   OP1  71.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3174  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 787   OP1                                                    
REMARK 620 2   U A 790   OP2 150.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3070  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 818   OP2                                                    
REMARK 620 2   G A1187   O6   95.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3027  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 827   OP1                                                    
REMARK 620 2   G A2429   OP2 106.1                                              
REMARK 620 3   A A2430   OP2 155.1  80.9                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3213  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 827   OP2                                                    
REMARK 620 2   C A2427   OP1 131.3                                              
REMARK 620 3   G A2429   OP1 118.8  63.2                                        
REMARK 620 4   G A2429   OP2  85.6 116.6  53.4                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3236  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 869   O6                                                     
REMARK 620 2   U A 870   O4   93.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3028  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 945   OP2                                                    
REMARK 620 2   C A 946   OP2  80.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3030  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A 948   OP1                                                    
REMARK 620 2   G A 962   OP1  73.9                                              
REMARK 620 3   U A 963   OP2 147.8  75.3                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3211  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 949   O6                                                     
REMARK 620 2   G A 950   O6   68.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3228  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A 953   OP1                                                    
REMARK 620 2   G A 953   O5'  55.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3072  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A 990   OP2                                                    
REMARK 620 2   C A 991   OP2  93.0                                              
REMARK 620 3   G A1186   OP2 158.6  68.0                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3169  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A 999   OP2                                                    
REMARK 620 2   C A1153   OP2 132.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3103  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1009   OP2                                                    
REMARK 620 2   A A1010   OP2  76.4                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3224  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A1013   OP2                                                    
REMARK 620 2   A A1014   OP2  85.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3212  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A1023   OP2                                                    
REMARK 620 2   G A1025   O2'  81.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3097  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1265   OP2                                                    
REMARK 620 2   U A2615   OP1  67.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3033  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1268   OP1                                                    
REMARK 620 2   C A2006   OP1  80.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3034  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1269   OP2                                                    
REMARK 620 2   A A2005   OP1 104.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3035  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A1271   OP2                                                    
REMARK 620 2   A A1272   OP1  74.2                                              
REMARK 620 3   U A1647   OP1 168.1  94.1                                        
REMARK 620 4   U A1648   OP1  85.7 153.8 106.2                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3171  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A1298   OP2                                                    
REMARK 620 2   C A1639   OP2 151.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3140  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A1303   OP2                                                    
REMARK 620 2   C A1607   OP1 150.9                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3099  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A1314   OP1                                                    
REMARK 620 2   C A1315   OP2  77.7                                              
REMARK 620 3   G A1332   OP1  88.7 150.1                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3343  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A1318   O4                                                     
REMARK 620 2   G A1331   OP2 108.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3319  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A1326   O2                                                     
REMARK 620 2 GLY O 105   O   141.9                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3090  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1342   OP2                                                    
REMARK 620 2   U A1602   O4   90.9                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3074  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1359   OP1                                                    
REMARK 620 2   G A1360   OP2  77.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3138  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A1379   OP2                                                    
REMARK 620 2   G A1380   OP2  80.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3040  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A1394   OP1                                                    
REMARK 620 2   C A1604   OP1  79.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3041  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1395   OP1                                                    
REMARK 620 2   A A1603   OP1  80.7                                              
REMARK 620 3   C A1604   OP2 110.8  81.1                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3193  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1395   O5'                                                    
REMARK 620 2   A A1603   OP1 109.4                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3076  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1439   OP2                                                    
REMARK 620 2   U A1440   O4   73.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3336  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A1622   OP1                                                    
REMARK 620 2   G A1622   OP2  51.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3110  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1664   OP1                                                    
REMARK 620 2   A A1665   OP2  71.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3092  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1669   OP2                                                    
REMARK 620 2   C A1670   OP2  84.3                                              
REMARK 620 3   U A1671   O4   89.5 106.2                                        
REMARK 620 4   G A2550   OP1  87.6  84.3 168.8                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3045  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A1670   OP1                                                    
REMARK 620 2   U A1671   OP2  70.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3281  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A1673   OP1                                                    
REMARK 620 2   U A2552   OP2 118.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3086  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1780   OP1                                                    
REMARK 620 2   U A1782   OP1  85.1                                              
REMARK 620 3   A A1783   OP2 112.1  80.4                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3190  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A1968   OP1                                                    
REMARK 620 2   G A2592   OP1  78.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3245  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A1970   OP1                                                    
REMARK 620 2   U A1971   OP1  97.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3052  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A2056   OP2                                                    
REMARK 620 2   G A2057   OP2  68.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3053  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A2061   OP2                                                    
REMARK 620 2   G A2502   OP2  72.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3320  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2071   OP1                                                    
REMARK 620 2   U A2243   OP2 160.9                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3405  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   U A2202   O4                                                     
REMARK 620 2   G A2221   O6  100.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3056  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A2248   OP2                                                    
REMARK 620 2   U A2249   O4   74.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3214  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A2250   O2'                                                    
REMARK 620 2   G A2251   OP2  84.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3057  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2268   OP1                                                    
REMARK 620 2   G A2269   OP1  92.9                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3084  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2448   OP2                                                    
REMARK 620 2   A A2497   O3' 120.7                                              
REMARK 620 3   C A2498   OP2  70.4  52.8                                        
REMARK 620 4   C A2499   OP2  70.0  94.1  61.5                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3089  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A2507   OP1                                                    
REMARK 620 2   C A2573   OP1 109.5                                              
REMARK 620 3   G A2574   OP1 111.1  58.7                                        
REMARK 620 4   C A2575   OP2 173.4  64.7  63.5                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3129  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A2576   OP1                                                    
REMARK 620 2   A A2577   OP1  88.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3307  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A2579   OP1                                                    
REMARK 620 2   C A2611   OP2 165.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3296  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   G A2582   OP2                                                    
REMARK 620 2   G A2583   OP2  92.7                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3242  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   C A2646   OP1                                                    
REMARK 620 2   U A2647   OP2  72.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3064  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2711   OP2                                                    
REMARK 620 2   G A2714   OP2  74.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3206  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2748   OP2                                                    
REMARK 620 2   U A2754   O4   70.6                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3231  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2766   OP1                                                    
REMARK 620 2   C A2767   OP2  81.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3273  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2776   O2'                                                    
REMARK 620 2   A A2781   O2'  90.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG A3116  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A A2821   OP2                                                    
REMARK 620 2   G A2822   OP2  72.1                                              
REMARK 620 3 GLY D 115   O    73.4  76.5                                        
REMARK 620 N                    1     2                                         
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG B 208  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1   A B  57   OP2                                                    
REMARK 620 2   A B  58   OP2  71.2                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MG b 101  MG                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 ASP b  20   OD1                                                    
REMARK 620 2 ASP b  20   OD2  44.3                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              ZN f 101  ZN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 CYS f  11   SG                                                     
REMARK 620 2 CYS f  14   SG  103.2                                              
REMARK 620 3 CYS f  27   SG  109.6 110.0                                        
REMARK 620 4 HIS f  33   ND1 116.4 108.7 108.7                                  
REMARK 620 N                    1     2     3                                   
REMARK 800                                                                      
REMARK 800 SITE                                                                 
REMARK 800 SITE_IDENTIFIER: AC1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG 2 101                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3002                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3003                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3004                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3005                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3006                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3007                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3008                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3010                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3011                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3012                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3014                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3016                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3017                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3019                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3020                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3021                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3022                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3023                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3024                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3025                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3026                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3027                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3028                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3029                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3030                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3031                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3033                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3034                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3035                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3036                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3037                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3038                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3039                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3040                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AF9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3041                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3042                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3043                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3045                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3046                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3047                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3048                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3050                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3051                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AG9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3052                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3053                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3054                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3056                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3057                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3058                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3059                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3060                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3061                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AH9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3062                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3063                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3064                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3065                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3066                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3067                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3068                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3070                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3071                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AI9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3072                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3073                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3074                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3075                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3076                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3079                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3080                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3081                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3082                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AJ9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3083                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3084                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3085                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3086                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3087                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3088                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3089                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3090                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3091                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AK9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3092                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3093                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3094                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3095                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3096                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3097                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3098                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3099                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3100                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AL9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3101                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3102                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3103                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3104                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3105                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3106                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3107                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3108                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3110                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AM9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3111                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3112                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3114                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3115                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3116                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3118                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3119                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3120                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3122                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AN9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3124                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3128                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3129                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3130                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3131                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3132                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3133                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3134                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3137                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AO9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3138                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3139                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3140                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3141                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3142                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3143                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3144                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3146                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3147                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AP9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3148                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3149                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3150                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3151                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3152                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3153                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3154                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3155                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3156                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AQ9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3158                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3159                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3161                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3162                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3163                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3164                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3165                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3166                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3167                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AR9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3168                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3169                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3170                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3171                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3172                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3173                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3174                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3175                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3176                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AS9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3177                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3178                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3179                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3180                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3182                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3183                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3185                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3186                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3187                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AT9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3188                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3190                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3191                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3192                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3193                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3194                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3195                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3196                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3198                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AU9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3199                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3200                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3201                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3202                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3203                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3204                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3205                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3206                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3208                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AV9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3209                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3210                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3211                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3212                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3213                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3214                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3215                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3216                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3217                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AW9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3219                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3220                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3221                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3222                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3223                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3224                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3225                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3227                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3228                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AX9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3229                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3230                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3231                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3232                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3233                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3234                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3235                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3236                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3237                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AY9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3238                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3239                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3240                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3242                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3243                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3244                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3245                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3247                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3248                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AZ9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3250                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3251                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3253                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3254                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3255                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3256                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3257                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3258                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3262                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BC9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3263                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3264                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3265                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3266                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3268                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3269                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3271                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3273                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3274                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BD9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3275                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3276                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3277                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3278                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3279                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3280                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3281                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3282                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3283                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BE9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3284                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3285                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3286                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3288                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3289                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3290                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3291                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3292                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3293                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BF9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3294                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3295                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3296                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3297                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3298                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3299                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3300                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3301                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3302                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BG9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3304                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3305                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3306                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3307                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3308                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3309                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3310                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3311                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3312                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BH9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3313                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3314                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3315                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3316                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3317                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3318                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3319                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3320                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3321                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BI9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3322                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3323                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3324                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3326                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3327                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3328                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3329                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3330                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3331                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BJ9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3332                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3333                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3334                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3335                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3336                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3337                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3338                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3339                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3340                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BK9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3341                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3343                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3344                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3345                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3346                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3347                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3348                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3349                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3350                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BL9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3351                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3352                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3353                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3354                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3355                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3356                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3357                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3358                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3360                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BM9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3361                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3362                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3363                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3364                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3365                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3366                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3367                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3369                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3370                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BN9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3371                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3372                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3374                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3375                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3376                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3377                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3378                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3379                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3380                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BO9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3381                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3382                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3383                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3384                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3385                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3386                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3387                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3389                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3391                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BP9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3392                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3394                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3395                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3396                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3397                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3398                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3399                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3400                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3401                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BQ9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3402                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3403                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3404                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3405                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3407                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3408                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3409                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3410                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG A 3411                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BR9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 202                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 203                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 205                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 206                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 207                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 208                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 209                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 211                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BS9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG B 212                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG C 301                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG C 302                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG O 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG R 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MG b 101                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: BT6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue ZN f 101                  
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: EMD-8003   RELATED DB: EMDB                              
DBREF1 5GAG 1    1   113  GB                   CP011938.1                       
DBREF2 5GAG 1     850013407                      444142      444254             
DBREF  5GAG 2   74    76  PDB    5GAG     5GAG            74     76             
DBREF1 5GAG A    1  2903  GB                   J01695.2                         
DBREF2 5GAG A     170787319                        3250        6152             
DBREF1 5GAG B    1   120  GB                   CP007594.1                       
DBREF2 5GAG B     817146391                     3810264     3810145             
DBREF  5GAG C    1   273  UNP    P60422   RL2_ECOLI        1    273             
DBREF  5GAG D    1   209  UNP    P60438   RL3_ECOLI        1    209             
DBREF  5GAG E    1   201  UNP    P60723   RL4_ECOLI        1    201             
DBREF  5GAG F    1   179  UNP    P62399   RL5_ECOLI        1    179             
DBREF  5GAG G    1   177  UNP    P0AG55   RL6_ECOLI        1    177             
DBREF  5GAG H    1   149  UNP    P0A7R1   RL9_ECOLI        1    149             
DBREF  5GAG I    1   165  UNP    P0A7J3   RL10_ECOLI       1    165             
DBREF  5GAG J    1   142  UNP    P0A7J7   RL11_ECOLI       1    142             
DBREF  5GAG K    1   142  UNP    P0AA10   RL13_ECOLI       1    142             
DBREF  5GAG L    1   123  UNP    P0ADY3   RL14_ECOLI       1    123             
DBREF  5GAG M    1   144  UNP    P02413   RL15_ECOLI       1    144             
DBREF  5GAG N    1   136  UNP    P0ADY7   RL16_ECOLI       1    136             
DBREF  5GAG O    1   127  UNP    P0AG44   RL17_ECOLI       1    127             
DBREF  5GAG P    1   117  UNP    P0C018   RL18_ECOLI       1    117             
DBREF  5GAG Q    1   115  UNP    P0A7K6   RL19_ECOLI       1    115             
DBREF  5GAG R    1   118  UNP    P0A7L3   RL20_ECOLI       1    118             
DBREF  5GAG S    1   103  UNP    P0AG48   RL21_ECOLI       1    103             
DBREF  5GAG T    1   110  UNP    P61175   RL22_ECOLI       1    110             
DBREF  5GAG U    1   100  UNP    P0ADZ0   RL23_ECOLI       1    100             
DBREF  5GAG V    1   104  UNP    P60624   RL24_ECOLI       1    104             
DBREF  5GAG W    1    94  UNP    P68919   RL25_ECOLI       1     94             
DBREF  5GAG X    1    85  UNP    P0A7L8   RL27_ECOLI       1     85             
DBREF  5GAG Y    1    78  UNP    P0A7M2   RL28_ECOLI       1     78             
DBREF  5GAG Z    1    63  UNP    P0A7M6   RL29_ECOLI       1     63             
DBREF  5GAG a    1    59  UNP    P0AG51   RL30_ECOLI       1     59             
DBREF  5GAG b    1    57  UNP    P0A7N4   RL32_ECOLI       1     57             
DBREF  5GAG c    1    55  UNP    P0A7N9   RL33_ECOLI       1     55             
DBREF  5GAG d    1    46  UNP    P0A7P5   RL34_ECOLI       1     46             
DBREF  5GAG e    1    65  UNP    P0A7Q1   RL35_ECOLI       1     65             
DBREF  5GAG f    1    38  UNP    P0A7Q6   RL36_ECOLI       1     38             
DBREF  5GAG i    4   453  PDB    5GAG     5GAG             4    453             
DBREF  5GAG k   27    44  PDB    5GAG     5GAG            27     44             
SEQADV 5GAG VAL I   85  UNP  P0A7J3    SER    85 CONFLICT                       
SEQADV 5GAG THR I   86  UNP  P0A7J3    MET    86 CONFLICT                       
SEQRES   1 1  113    G   G   G   G   G   C   U   C   U   G   U   U   G          
SEQRES   2 1  113    G   U   U   C   U   C   C   C   G   C   A   A   C          
SEQRES   3 1  113    G   C   U   A   C   U   C   U   G   U   U   U   A          
SEQRES   4 1  113    C   C   A   G   G   U   C   A   G   G   U   C   C          
SEQRES   5 1  113    G   G   A   A   G   G   A   A   G   C   A   G   C          
SEQRES   6 1  113    C   A   A   G   G   C   A   G   A   U   G   A   C          
SEQRES   7 1  113    G   C   G   U   G   U   G   C   C   G   G   G   A          
SEQRES   8 1  113    U   G   U   A   G   C   U   G   G   C   A   G   G          
SEQRES   9 1  113    G   C   C   C   C   C   A   C   C                          
SEQRES   1 2    3    C   C   A                                                  
SEQRES   1 A 2903    G   G   U   U   A   A   G   C   G   A   C   U   A          
SEQRES   2 A 2903    A   G   C   G   U   A   C   A   C   G   G   U   G          
SEQRES   3 A 2903    G   A   U   G   C   C   C   U   G   G   C   A   G          
SEQRES   4 A 2903    U   C   A   G   A   G   G   C   G   A   U   G   A          
SEQRES   5 A 2903    A   G   G   A   C   G   U   G   C   U   A   A   U          
SEQRES   6 A 2903    C   U   G   C   G   A   U   A   A   G   C   G   U          
SEQRES   7 A 2903    C   G   G   U   A   A   G   G   U   G   A   U   A          
SEQRES   8 A 2903    U   G   A   A   C   C   G   U   U   A   U   A   A          
SEQRES   9 A 2903    C   C   G   G   C   G   A   U   U   U   C   C   G          
SEQRES  10 A 2903    A   A   U   G   G   G   G   A   A   A   C   C   C          
SEQRES  11 A 2903    A   G   U   G   U   G   U   U   U   C   G   A   C          
SEQRES  12 A 2903    A   C   A   C   U   A   U   C   A   U   U   A   A          
SEQRES  13 A 2903    C   U   G   A   A   U   C   C   A   U   A   G   G          
SEQRES  14 A 2903    U   U   A   A   U   G   A   G   G   C   G   A   A          
SEQRES  15 A 2903    C   C   G   G   G   G   G   A   A   C   U   G   A          
SEQRES  16 A 2903    A   A   C   A   U   C   U   A   A   G   U   A   C          
SEQRES  17 A 2903    C   C   C   G   A   G   G   A   A   A   A   G   A          
SEQRES  18 A 2903    A   A   U   C   A   A   C   C   G   A   G   A   U          
SEQRES  19 A 2903    U   C   C   C   C   C   A   G   U   A   G   C   G          
SEQRES  20 A 2903    G   C   G   A   G   C   G   A   A   C   G   G   G          
SEQRES  21 A 2903    G   A   G   C   A   G   C   C   C   A   G   A   G          
SEQRES  22 A 2903    C   C   U   G   A   A   U   C   A   G   U   G   U          
SEQRES  23 A 2903    G   U   G   U   G   U   U   A   G   U   G   G   A          
SEQRES  24 A 2903    A   G   C   G   U   C   U   G   G   A   A   A   G          
SEQRES  25 A 2903    G   C   G   C   G   C   G   A   U   A   C   A   G          
SEQRES  26 A 2903    G   G   U   G   A   C   A   G   C   C   C   C   G          
SEQRES  27 A 2903    U   A   C   A   C   A   A   A   A   A   U   G   C          
SEQRES  28 A 2903    A   C   A   U   G   C   U   G   U   G   A   G   C          
SEQRES  29 A 2903    U   C   G   A   U   G   A   G   U   A   G   G   G          
SEQRES  30 A 2903    C   G   G   G   A   C   A   C   G   U   G   G   U          
SEQRES  31 A 2903    A   U   C   C   U   G   U   C   U   G   A   A   U          
SEQRES  32 A 2903    A   U   G   G   G   G   G   G   A   C   C   A   U          
SEQRES  33 A 2903    C   C   U   C   C   A   A   G   G   C   U   A   A          
SEQRES  34 A 2903    A   U   A   C   U   C   C   U   G   A   C   U   G          
SEQRES  35 A 2903    A   C   C   G   A   U   A   G   U   G   A   A   C          
SEQRES  36 A 2903    C   A   G   U   A   C   C   G   U   G   A   G   G          
SEQRES  37 A 2903    G   A   A   A   G   G   C   G   A   A   A   A   G          
SEQRES  38 A 2903    A   A   C   C   C   C   G   G   C   G   A   G   G          
SEQRES  39 A 2903    G   G   A   G   U   G   A   A   A   A   A   G   A          
SEQRES  40 A 2903    A   C   C   U   G   A   A   A   C   C   G   U   G          
SEQRES  41 A 2903    U   A   C   G   U   A   C   A   A   G   C   A   G          
SEQRES  42 A 2903    U   G   G   G   A   G   C   A   C   G   C   U   U          
SEQRES  43 A 2903    A   G   G   C   G   U   G   U   G   A   C   U   G          
SEQRES  44 A 2903    C   G   U   A   C   C   U   U   U   U   G   U   A          
SEQRES  45 A 2903    U   A   A   U   G   G   G   U   C   A   G   C   G          
SEQRES  46 A 2903    A   C   U   U   A   U   A   U   U   C   U   G   U          
SEQRES  47 A 2903    A   G   C   A   A   G   G   U   U   A   A   C   C          
SEQRES  48 A 2903    G   A   A   U   A   G   G   G   G   A   G   C   C          
SEQRES  49 A 2903    G   A   A   G   G   G   A   A   A   C   C   G   A          
SEQRES  50 A 2903    G   U   C   U   U   A   A   C   U   G   G   G   C          
SEQRES  51 A 2903    G   U   U   A   A   G   U   U   G   C   A   G   G          
SEQRES  52 A 2903    G   U   A   U   A   G   A   C   C   C   G   A   A          
SEQRES  53 A 2903    A   C   C   C   G   G   U   G   A   U   C   U   A          
SEQRES  54 A 2903    G   C   C   A   U   G   G   G   C   A   G   G   U          
SEQRES  55 A 2903    U   G   A   A   G   G   U   U   G   G   G   U   A          
SEQRES  56 A 2903    A   C   A   C   U   A   A   C   U   G   G   A   G          
SEQRES  57 A 2903    G   A   C   C   G   A   A   C   C   G   A   C   U          
SEQRES  58 A 2903    A   A   U   G   U   U   G   A   A   A   A   A   U          
SEQRES  59 A 2903    U   A   G   C   G   G   A   U   G   A   C   U   U          
SEQRES  60 A 2903    G   U   G   G   C   U   G   G   G   G   G   U   G          
SEQRES  61 A 2903    A   A   A   G   G   C   C   A   A   U   C   A   A          
SEQRES  62 A 2903    A   C   C   G   G   G   A   G   A   U   A   G   C          
SEQRES  63 A 2903    U   G   G   U   U   C   U   C   C   C   C   G   A          
SEQRES  64 A 2903    A   A   G   C   U   A   U   U   U   A   G   G   U          
SEQRES  65 A 2903    A   G   C   G   C   C   U   C   G   U   G   A   A          
SEQRES  66 A 2903    U   U   C   A   U   C   U   C   C   G   G   G   G          
SEQRES  67 A 2903    G   U   A   G   A   G   C   A   C   U   G   U   U          
SEQRES  68 A 2903    U   C   G   G   C   A   A   G   G   G   G   G   U          
SEQRES  69 A 2903    C   A   U   C   C   C   G   A   C   U   U   A   C          
SEQRES  70 A 2903    C   A   A   C   C   C   G   A   U   G   C   A   A          
SEQRES  71 A 2903    A   C   U   G   C   G   A   A   U   A   C   C   G          
SEQRES  72 A 2903    G   A   G   A   A   U   G   U   U   A   U   C   A          
SEQRES  73 A 2903    C   G   G   G   A   G   A   C   A   C   A   C   G          
SEQRES  74 A 2903    G   C   G   G   G   U   G   C   U   A   A   C   G          
SEQRES  75 A 2903    U   C   C   G   U   C   G   U   G   A   A   G   A          
SEQRES  76 A 2903    G   G   G   A   A   A   C   A   A   C   C   C   A          
SEQRES  77 A 2903    G   A   C   C   G   C   C   A   G   C   U   A   A          
SEQRES  78 A 2903    G   G   U   C   C   C   A   A   A   G   U   C   A          
SEQRES  79 A 2903    U   G   G   U   U   A   A   G   U   G   G   G   A          
SEQRES  80 A 2903    A   A   C   G   A   U   G   U   G   G   G   A   A          
SEQRES  81 A 2903    G   G   C   C   C   A   G   A   C   A   G   C   C          
SEQRES  82 A 2903    A   G   G   A   U   G   U   U   G   G   C   U   U          
SEQRES  83 A 2903    A   G   A   A   G   C   A   G   C   C   A   U   C          
SEQRES  84 A 2903    A   U   U   U   A   A   A   G   A   A   A   G   C          
SEQRES  85 A 2903    G   U   A   A   U   A   G   C   U   C   A   C   U          
SEQRES  86 A 2903    G   G   U   C   G   A   G   U   C   G   G   C   C          
SEQRES  87 A 2903    U   G   C   G   C   G   G   A   A   G   A   U   G          
SEQRES  88 A 2903    U   A   A   C   G   G   G   G   C   U   A   A   A          
SEQRES  89 A 2903    C   C   A   U   G   C   A   C   C   G   A   A   G          
SEQRES  90 A 2903    C   U   G   C   G   G   C   A   G   C   G   A   C          
SEQRES  91 A 2903    G   C   U   U   A   U   G   C   G   U   U   G   U          
SEQRES  92 A 2903    U   G   G   G   U   A   G   G   G   G   A   G   C          
SEQRES  93 A 2903    G   U   U   C   U   G   U   A   A   G   C   C   U          
SEQRES  94 A 2903    G   C   G   A   A   G   G   U   G   U   G   C   U          
SEQRES  95 A 2903    G   U   G   A   G   G   C   A   U   G   C   U   G          
SEQRES  96 A 2903    G   A   G   G   U   A   U   C   A   G   A   A   G          
SEQRES  97 A 2903    U   G   C   G   A   A   U   G   C   U   G   A   C          
SEQRES  98 A 2903    A   U   A   A   G   U   A   A   C   G   A   U   A          
SEQRES  99 A 2903    A   A   G   C   G   G   G   U   G   A   A   A   A          
SEQRES 100 A 2903    G   C   C   C   G   C   U   C   G   C   C   G   G          
SEQRES 101 A 2903    A   A   G   A   C   C   A   A   G   G   G   U   U          
SEQRES 102 A 2903    C   C   U   G   U   C   C   A   A   C   G   U   U          
SEQRES 103 A 2903    A   A   U   C   G   G   G   G   C   A   G   G   G          
SEQRES 104 A 2903    U   G   A   G   U   C   G   A   C   C   C   C   U          
SEQRES 105 A 2903    A   A   G   G   C   G   A   G   G   C   C   G   A          
SEQRES 106 A 2903    A   A   G   G   C   G   U   A   G   U   C   G   A          
SEQRES 107 A 2903    U   G   G   G   A   A   A   C   A   G   G   U   U          
SEQRES 108 A 2903    A   A   U   A   U   U   C   C   U   G   U   A   C          
SEQRES 109 A 2903    U   U   G   G   U   G   U   U   A   C   U   G   C          
SEQRES 110 A 2903    G   A   A   G   G   G   G   G   G   A   C   G   G          
SEQRES 111 A 2903    A   G   A   A   G   G   C   U   A   U   G   U   U          
SEQRES 112 A 2903    G   G   C   C   G   G   G   C   G   A   C   G   G          
SEQRES 113 A 2903    U   U   G   U   C   C   C   G   G   U   U   U   A          
SEQRES 114 A 2903    A   G   C   G   U   G   U   A   G   G   C   U   G          
SEQRES 115 A 2903    G   U   U   U   U   C   C   A   G   G   C   A   A          
SEQRES 116 A 2903    A   U   C   C   G   G   A   A   A   A   U   C   A          
SEQRES 117 A 2903    A   G   G   C   U   G   A   G   G   C   G   U   G          
SEQRES 118 A 2903    A   U   G   A   C   G   A   G   G   C   A   C   U          
SEQRES 119 A 2903    A   C   G   G   U   G   C   U   G   A   A   G   C          
SEQRES 120 A 2903    A   A   C   A   A   A   U   G   C   C   C   U   G          
SEQRES 121 A 2903    C   U   U   C   C   A   G   G   A   A   A   A   G          
SEQRES 122 A 2903    C   C   U   C   U   A   A   G   C   A   U   C   A          
SEQRES 123 A 2903    G   G   U   A   A   C   A   U   C   A   A   A   U          
SEQRES 124 A 2903    C   G   U   A   C   C   C   C   A   A   A   C   C          
SEQRES 125 A 2903    G   A   C   A   C   A   G   G   U   G   G   U   C          
SEQRES 126 A 2903    A   G   G   U   A   G   A   G   A   A   U   A   C          
SEQRES 127 A 2903    C   A   A   G   G   C   G   C   U   U   G   A   G          
SEQRES 128 A 2903    A   G   A   A   C   U   C   G   G   G   U   G   A          
SEQRES 129 A 2903    A   G   G   A   A   C   U   A   G   G   C   A   A          
SEQRES 130 A 2903    A   A   U   G   G   U   G   C   C   G   U   A   A          
SEQRES 131 A 2903    C   U   U   C   G   G   G   A   G   A   A   G   G          
SEQRES 132 A 2903    C   A   C   G   C   U   G   A   U   A   U   G   U          
SEQRES 133 A 2903    A   G   G   U   G   A   G   G   U   C   C   C   U          
SEQRES 134 A 2903    C   G   C   G   G   A   U   G   G   A   G   C   U          
SEQRES 135 A 2903    G   A   A   A   U   C   A   G   U   C   G   A   A          
SEQRES 136 A 2903    G   A   U   A   C   C   A   G   C   U   G   G   C          
SEQRES 137 A 2903    U   G   C   A   A   C   U   G   U   U   U   A   U          
SEQRES 138 A 2903    U   A   A   A   A   A   C   A   C   A   G   C   A          
SEQRES 139 A 2903    C   U   G   U   G   C   A   A   A   C   A   C   G          
SEQRES 140 A 2903    A   A   A   G   U   G   G   A   C   G   U   A   U          
SEQRES 141 A 2903    A   C   G   G   U   G   U   G   A   C   G   C   C          
SEQRES 142 A 2903    U   G   C   C   C   G   G   U   G   C   C   G   G          
SEQRES 143 A 2903    A   A   G   G   U   U   A   A   U   U   G   A   U          
SEQRES 144 A 2903    G   G   G   G   U   U   A   G   C   G   C   A   A          
SEQRES 145 A 2903    G   C   G   A   A   G   C   U   C   U   U   G   A          
SEQRES 146 A 2903    U   C   G   A   A   G   C   C   C   C   G   G   U          
SEQRES 147 A 2903    A   A   A   C   G   G   C   G   G   C   C   G   U          
SEQRES 148 A 2903    A   A   C   U   A   U   A   A   C   G   G   U   C          
SEQRES 149 A 2903    C   U   A   A   G   G   U   A   G   C   G   A   A          
SEQRES 150 A 2903    A   U   U   C   C   U   U   G   U   C   G   G   G          
SEQRES 151 A 2903    U   A   A   G   U   U   C   C   G   A   C   C   U          
SEQRES 152 A 2903    G   C   A   C   G   A   A   U   G   G   C   G   U          
SEQRES 153 A 2903    A   A   U   G   A   U   G   G   C   C   A   G   G          
SEQRES 154 A 2903    C   U   G   U   C   U   C   C   A   C   C   C   G          
SEQRES 155 A 2903    A   G   A   C   U   C   A   G   U   G   A   A   A          
SEQRES 156 A 2903    U   U   G   A   A   C   U   C   G   C   U   G   U          
SEQRES 157 A 2903    G   A   A   G   A   U   G   C   A   G   U   G   U          
SEQRES 158 A 2903    A   C   C   C   G   C   G   G   C   A   A   G   A          
SEQRES 159 A 2903    C   G   G   A   A   A   G   A   C   C   C   C   G          
SEQRES 160 A 2903    U   G   A   A   C   C   U   U   U   A   C   U   A          
SEQRES 161 A 2903    U   A   G   C   U   U   G   A   C   A   C   U   G          
SEQRES 162 A 2903    A   A   C   A   U   U   G   A   G   C   C   U   U          
SEQRES 163 A 2903    G   A   U   G   U   G   U   A   G   G   A   U   A          
SEQRES 164 A 2903    G   G   U   G   G   G   A   G   G   C   U   U   U          
SEQRES 165 A 2903    G   A   A   G   U   G   U   G   G   A   C   G   C          
SEQRES 166 A 2903    C   A   G   U   C   U   G   C   A   U   G   G   A          
SEQRES 167 A 2903    G   C   C   G   A   C   C   U   U   G   A   A   A          
SEQRES 168 A 2903    U   A   C   C   A   C   C   C   U   U   U   A   A          
SEQRES 169 A 2903    U   G   U   U   U   G   A   U   G   U   U   C   U          
SEQRES 170 A 2903    A   A   C   G   U   U   G   A   C   C   C   G   U          
SEQRES 171 A 2903    A   A   U   C   C   G   G   G   U   U   G   C   G          
SEQRES 172 A 2903    G   A   C   A   G   U   G   U   C   U   G   G   U          
SEQRES 173 A 2903    G   G   G   U   A   G   U   U   U   G   A   C   U          
SEQRES 174 A 2903    G   G   G   G   C   G   G   U   C   U   C   C   U          
SEQRES 175 A 2903    C   C   U   A   A   A   G   A   G   U   A   A   C          
SEQRES 176 A 2903    G   G   A   G   G   A   G   C   A   C   G   A   A          
SEQRES 177 A 2903    G   G   U   U   G   G   C   U   A   A   U   C   C          
SEQRES 178 A 2903    U   G   G   U   C   G   G   A   C   A   U   C   A          
SEQRES 179 A 2903    G   G   A   G   G   U   U   A   G   U   G   C   A          
SEQRES 180 A 2903    A   U   G   G   C   A   U   A   A   G   C   C   A          
SEQRES 181 A 2903    G   C   U   U   G   A   C   U   G   C   G   A   G          
SEQRES 182 A 2903    C   G   U   G   A   C   G   G   C   G   C   G   A          
SEQRES 183 A 2903    G   C   A   G   G   U   G   C   G   A   A   A   G          
SEQRES 184 A 2903    C   A   G   G   U   C   A   U   A   G   U   G   A          
SEQRES 185 A 2903    U   C   C   G   G   U   G   G   U   U   C   U   G          
SEQRES 186 A 2903    A   A   U   G   G   A   A   G   G   G   C   C   A          
SEQRES 187 A 2903    U   C   G   C   U   C   A   A   C   G   G   A   U          
SEQRES 188 A 2903    A   A   A   A   G   G   U   A   C   U   C   C   G          
SEQRES 189 A 2903    G   G   G   A   U   A   A   C   A   G   G   C   U          
SEQRES 190 A 2903    G   A   U   A   C   C   G   C   C   C   A   A   G          
SEQRES 191 A 2903    A   G   U   U   C   A   U   A   U   C   G   A   C          
SEQRES 192 A 2903    G   G   C   G   G   U   G   U   U   U   G   G   C          
SEQRES 193 A 2903    A   C   C   U   C   G   A   U   G   U   C   G   G          
SEQRES 194 A 2903    C   U   C   A   U   C   A   C   A   U   C   C   U          
SEQRES 195 A 2903    G   G   G   G   C   U   G   A   A   G   U   A   G          
SEQRES 196 A 2903    G   U   C   C   C   A   A   G   G   G   U   A   U          
SEQRES 197 A 2903    G   G   C   U   G   U   U   C   G   C   C   A   U          
SEQRES 198 A 2903    U   U   A   A   A   G   U   G   G   U   A   C   G          
SEQRES 199 A 2903    C   G   A   G   C   U   G   G   G   U   U   U   A          
SEQRES 200 A 2903    G   A   A   C   G   U   C   G   U   G   A   G   A          
SEQRES 201 A 2903    C   A   G   U   U   C   G   G   U   C   C   C   U          
SEQRES 202 A 2903    A   U   C   U   G   C   C   G   U   G   G   G   C          
SEQRES 203 A 2903    G   C   U   G   G   A   G   A   A   C   U   G   A          
SEQRES 204 A 2903    G   G   G   G   G   G   C   U   G   C   U   C   C          
SEQRES 205 A 2903    U   A   G   U   A   C   G   A   G   A   G   G   A          
SEQRES 206 A 2903    C   C   G   G   A   G   U   G   G   A   C   G   C          
SEQRES 207 A 2903    A   U   C   A   C   U   G   G   U   G   U   U   C          
SEQRES 208 A 2903    G   G   G   U   U   G   U   C   A   U   G   C   C          
SEQRES 209 A 2903    A   A   U   G   G   C   A   C   U   G   C   C   C          
SEQRES 210 A 2903    G   G   U   A   G   C   U   A   A   A   U   G   C          
SEQRES 211 A 2903    G   G   A   A   G   A   G   A   U   A   A   G   U          
SEQRES 212 A 2903    G   C   U   G   A   A   A   G   C   A   U   C   U          
SEQRES 213 A 2903    A   A   G   C   A   C   G   A   A   A   C   U   U          
SEQRES 214 A 2903    G   C   C   C   C   G   A   G   A   U   G   A   G          
SEQRES 215 A 2903    U   U   C   U   C   C   C   U   G   A   C   C   C          
SEQRES 216 A 2903    U   U   U   A   A   G   G   G   U   C   C   U   G          
SEQRES 217 A 2903    A   A   G   G   A   A   C   G   U   U   G   A   A          
SEQRES 218 A 2903    G   A   C   G   A   C   G   A   C   G   U   U   G          
SEQRES 219 A 2903    A   U   A   G   G   C   C   G   G   G   U   G   U          
SEQRES 220 A 2903    G   U   A   A   G   C   G   C   A   G   C   G   A          
SEQRES 221 A 2903    U   G   C   G   U   U   G   A   G   C   U   A   A          
SEQRES 222 A 2903    C   C   G   G   U   A   C   U   A   A   U   G   A          
SEQRES 223 A 2903    A   C   C   G   U   G   A   G   G   C   U   U   A          
SEQRES 224 A 2903    A   C   C   U                                              
SEQRES   1 B  120    U   G   C   C   U   G   G   C   G   G   C   C   G          
SEQRES   2 B  120    U   A   G   C   G   C   G   G   U   G   G   U   C          
SEQRES   3 B  120    C   C   A   C   C   U   G   A   C   C   C   C   A          
SEQRES   4 B  120    U   G   C   C   G   A   A   C   U   C   A   G   A          
SEQRES   5 B  120    A   G   U   G   A   A   A   C   G   C   C   G   U          
SEQRES   6 B  120    A   G   C   G   C   C   G   A   U   G   G   U   A          
SEQRES   7 B  120    G   U   G   U   G   G   G   G   U   C   U   C   C          
SEQRES   8 B  120    C   C   A   U   G   C   G   A   G   A   G   U   A          
SEQRES   9 B  120    G   G   G   A   A   C   U   G   C   C   A   G   G          
SEQRES  10 B  120    C   A   U                                                  
SEQRES   1 C  273  MET ALA VAL VAL LYS CYS LYS PRO THR SER PRO GLY ARG          
SEQRES   2 C  273  ARG HIS VAL VAL LYS VAL VAL ASN PRO GLU LEU HIS LYS          
SEQRES   3 C  273  GLY LYS PRO PHE ALA PRO LEU LEU GLU LYS ASN SER LYS          
SEQRES   4 C  273  SER GLY GLY ARG ASN ASN ASN GLY ARG ILE THR THR ARG          
SEQRES   5 C  273  HIS ILE GLY GLY GLY HIS LYS GLN ALA TYR ARG ILE VAL          
SEQRES   6 C  273  ASP PHE LYS ARG ASN LYS ASP GLY ILE PRO ALA VAL VAL          
SEQRES   7 C  273  GLU ARG LEU GLU TYR ASP PRO ASN ARG SER ALA ASN ILE          
SEQRES   8 C  273  ALA LEU VAL LEU TYR LYS ASP GLY GLU ARG ARG TYR ILE          
SEQRES   9 C  273  LEU ALA PRO LYS GLY LEU LYS ALA GLY ASP GLN ILE GLN          
SEQRES  10 C  273  SER GLY VAL ASP ALA ALA ILE LYS PRO GLY ASN THR LEU          
SEQRES  11 C  273  PRO MET ARG ASN ILE PRO VAL GLY SER THR VAL HIS ASN          
SEQRES  12 C  273  VAL GLU MET LYS PRO GLY LYS GLY GLY GLN LEU ALA ARG          
SEQRES  13 C  273  SER ALA GLY THR TYR VAL GLN ILE VAL ALA ARG ASP GLY          
SEQRES  14 C  273  ALA TYR VAL THR LEU ARG LEU ARG SER GLY GLU MET ARG          
SEQRES  15 C  273  LYS VAL GLU ALA ASP CYS ARG ALA THR LEU GLY GLU VAL          
SEQRES  16 C  273  GLY ASN ALA GLU HIS MET LEU ARG VAL LEU GLY LYS ALA          
SEQRES  17 C  273  GLY ALA ALA ARG TRP ARG GLY VAL ARG PRO THR VAL ARG          
SEQRES  18 C  273  GLY THR ALA MET ASN PRO VAL ASP HIS PRO HIS GLY GLY          
SEQRES  19 C  273  GLY GLU GLY ARG ASN PHE GLY LYS HIS PRO VAL THR PRO          
SEQRES  20 C  273  TRP GLY VAL GLN THR LYS GLY LYS LYS THR ARG SER ASN          
SEQRES  21 C  273  LYS ARG THR ASP LYS PHE ILE VAL ARG ARG ARG SER LYS          
SEQRES   1 D  209  MET ILE GLY LEU VAL GLY LYS LYS VAL GLY MET THR ARG          
SEQRES   2 D  209  ILE PHE THR GLU ASP GLY VAL SER ILE PRO VAL THR VAL          
SEQRES   3 D  209  ILE GLU VAL GLU ALA ASN ARG VAL THR GLN VAL LYS ASP          
SEQRES   4 D  209  LEU ALA ASN ASP GLY TYR ARG ALA ILE GLN VAL THR THR          
SEQRES   5 D  209  GLY ALA LYS LYS ALA ASN ARG VAL THR LYS PRO GLU ALA          
SEQRES   6 D  209  GLY HIS PHE ALA LYS ALA GLY VAL GLU ALA GLY ARG GLY          
SEQRES   7 D  209  LEU TRP GLU PHE ARG LEU ALA GLU GLY GLU GLU PHE THR          
SEQRES   8 D  209  VAL GLY GLN SER ILE SER VAL GLU LEU PHE ALA ASP VAL          
SEQRES   9 D  209  LYS LYS VAL ASP VAL THR GLY THR SER LYS GLY LYS GLY          
SEQRES  10 D  209  PHE ALA GLY THR VAL LYS ARG TRP ASN PHE ARG THR GLN          
SEQRES  11 D  209  ASP ALA THR HIS GLY ASN SER LEU SER HIS ARG VAL PRO          
SEQRES  12 D  209  GLY SER ILE GLY GLN ASN GLN THR PRO GLY LYS VAL PHE          
SEQRES  13 D  209  LYS GLY LYS LYS MET ALA GLY GLN MET GLY ASN GLU ARG          
SEQRES  14 D  209  VAL THR VAL GLN SER LEU ASP VAL VAL ARG VAL ASP ALA          
SEQRES  15 D  209  GLU ARG ASN LEU LEU LEU VAL LYS GLY ALA VAL PRO GLY          
SEQRES  16 D  209  ALA THR GLY SER ASP LEU ILE VAL LYS PRO ALA VAL LYS          
SEQRES  17 D  209  ALA                                                          
SEQRES   1 E  201  MET GLU LEU VAL LEU LYS ASP ALA GLN SER ALA LEU THR          
SEQRES   2 E  201  VAL SER GLU THR THR PHE GLY ARG ASP PHE ASN GLU ALA          
SEQRES   3 E  201  LEU VAL HIS GLN VAL VAL VAL ALA TYR ALA ALA GLY ALA          
SEQRES   4 E  201  ARG GLN GLY THR ARG ALA GLN LYS THR ARG ALA GLU VAL          
SEQRES   5 E  201  THR GLY SER GLY LYS LYS PRO TRP ARG GLN LYS GLY THR          
SEQRES   6 E  201  GLY ARG ALA ARG SER GLY SER ILE LYS SER PRO ILE TRP          
SEQRES   7 E  201  ARG SER GLY GLY VAL THR PHE ALA ALA ARG PRO GLN ASP          
SEQRES   8 E  201  HIS SER GLN LYS VAL ASN LYS LYS MET TYR ARG GLY ALA          
SEQRES   9 E  201  LEU LYS SER ILE LEU SER GLU LEU VAL ARG GLN ASP ARG          
SEQRES  10 E  201  LEU ILE VAL VAL GLU LYS PHE SER VAL GLU ALA PRO LYS          
SEQRES  11 E  201  THR LYS LEU LEU ALA GLN LYS LEU LYS ASP MET ALA LEU          
SEQRES  12 E  201  GLU ASP VAL LEU ILE ILE THR GLY GLU LEU ASP GLU ASN          
SEQRES  13 E  201  LEU PHE LEU ALA ALA ARG ASN LEU HIS LYS VAL ASP VAL          
SEQRES  14 E  201  ARG ASP ALA THR GLY ILE ASP PRO VAL SER LEU ILE ALA          
SEQRES  15 E  201  PHE ASP LYS VAL VAL MET THR ALA ASP ALA VAL LYS GLN          
SEQRES  16 E  201  VAL GLU GLU MET LEU ALA                                      
SEQRES   1 F  179  MET ALA LYS LEU HIS ASP TYR TYR LYS ASP GLU VAL VAL          
SEQRES   2 F  179  LYS LYS LEU MET THR GLU PHE ASN TYR ASN SER VAL MET          
SEQRES   3 F  179  GLN VAL PRO ARG VAL GLU LYS ILE THR LEU ASN MET GLY          
SEQRES   4 F  179  VAL GLY GLU ALA ILE ALA ASP LYS LYS LEU LEU ASP ASN          
SEQRES   5 F  179  ALA ALA ALA ASP LEU ALA ALA ILE SER GLY GLN LYS PRO          
SEQRES   6 F  179  LEU ILE THR LYS ALA ARG LYS SER VAL ALA GLY PHE LYS          
SEQRES   7 F  179  ILE ARG GLN GLY TYR PRO ILE GLY CYS LYS VAL THR LEU          
SEQRES   8 F  179  ARG GLY GLU ARG MET TRP GLU PHE PHE GLU ARG LEU ILE          
SEQRES   9 F  179  THR ILE ALA VAL PRO ARG ILE ARG ASP PHE ARG GLY LEU          
SEQRES  10 F  179  SER ALA LYS SER PHE ASP GLY ARG GLY ASN TYR SER MET          
SEQRES  11 F  179  GLY VAL ARG GLU GLN ILE ILE PHE PRO GLU ILE ASP TYR          
SEQRES  12 F  179  ASP LYS VAL ASP ARG VAL ARG GLY LEU ASP ILE THR ILE          
SEQRES  13 F  179  THR THR THR ALA LYS SER ASP GLU GLU GLY ARG ALA LEU          
SEQRES  14 F  179  LEU ALA ALA PHE ASP PHE PRO PHE ARG LYS                      
SEQRES   1 G  177  MET SER ARG VAL ALA LYS ALA PRO VAL VAL VAL PRO ALA          
SEQRES   2 G  177  GLY VAL ASP VAL LYS ILE ASN GLY GLN VAL ILE THR ILE          
SEQRES   3 G  177  LYS GLY LYS ASN GLY GLU LEU THR ARG THR LEU ASN ASP          
SEQRES   4 G  177  ALA VAL GLU VAL LYS HIS ALA ASP ASN THR LEU THR PHE          
SEQRES   5 G  177  GLY PRO ARG ASP GLY TYR ALA ASP GLY TRP ALA GLN ALA          
SEQRES   6 G  177  GLY THR ALA ARG ALA LEU LEU ASN SER MET VAL ILE GLY          
SEQRES   7 G  177  VAL THR GLU GLY PHE THR LYS LYS LEU GLN LEU VAL GLY          
SEQRES   8 G  177  VAL GLY TYR ARG ALA ALA VAL LYS GLY ASN VAL ILE ASN          
SEQRES   9 G  177  LEU SER LEU GLY PHE SER HIS PRO VAL ASP HIS GLN LEU          
SEQRES  10 G  177  PRO ALA GLY ILE THR ALA GLU CYS PRO THR GLN THR GLU          
SEQRES  11 G  177  ILE VAL LEU LYS GLY ALA ASP LYS GLN VAL ILE GLY GLN          
SEQRES  12 G  177  VAL ALA ALA ASP LEU ARG ALA TYR ARG ARG PRO GLU PRO          
SEQRES  13 G  177  TYR LYS GLY LYS GLY VAL ARG TYR ALA ASP GLU VAL VAL          
SEQRES  14 G  177  ARG THR LYS GLU ALA LYS LYS LYS                              
SEQRES   1 H  149  MET GLN VAL ILE LEU LEU ASP LYS VAL ALA ASN LEU GLY          
SEQRES   2 H  149  SER LEU GLY ASP GLN VAL ASN VAL LYS ALA GLY TYR ALA          
SEQRES   3 H  149  ARG ASN PHE LEU VAL PRO GLN GLY LYS ALA VAL PRO ALA          
SEQRES   4 H  149  THR LYS LYS ASN ILE GLU PHE PHE GLU ALA ARG ARG ALA          
SEQRES   5 H  149  GLU LEU GLU ALA LYS LEU ALA GLU VAL LEU ALA ALA ALA          
SEQRES   6 H  149  ASN ALA ARG ALA GLU LYS ILE ASN ALA LEU GLU THR VAL          
SEQRES   7 H  149  THR ILE ALA SER LYS ALA GLY ASP GLU GLY LYS LEU PHE          
SEQRES   8 H  149  GLY SER ILE GLY THR ARG ASP ILE ALA ASP ALA VAL THR          
SEQRES   9 H  149  ALA ALA GLY VAL GLU VAL ALA LYS SER GLU VAL ARG LEU          
SEQRES  10 H  149  PRO ASN GLY VAL LEU ARG THR THR GLY GLU HIS GLU VAL          
SEQRES  11 H  149  SER PHE GLN VAL HIS SER GLU VAL PHE ALA LYS VAL ILE          
SEQRES  12 H  149  VAL ASN VAL VAL ALA GLU                                      
SEQRES   1 I  165  MET ALA LEU ASN LEU GLN ASP LYS GLN ALA ILE VAL ALA          
SEQRES   2 I  165  GLU VAL SER GLU VAL ALA LYS GLY ALA LEU SER ALA VAL          
SEQRES   3 I  165  VAL ALA ASP SER ARG GLY VAL THR VAL ASP LYS MET THR          
SEQRES   4 I  165  GLU LEU ARG LYS ALA GLY ARG GLU ALA GLY VAL TYR MET          
SEQRES   5 I  165  ARG VAL VAL ARG ASN THR LEU LEU ARG ARG ALA VAL GLU          
SEQRES   6 I  165  GLY THR PRO PHE GLU CYS LEU LYS ASP ALA PHE VAL GLY          
SEQRES   7 I  165  PRO THR LEU ILE ALA TYR VAL THR GLU HIS PRO GLY ALA          
SEQRES   8 I  165  ALA ALA ARG LEU PHE LYS GLU PHE ALA LYS ALA ASN ALA          
SEQRES   9 I  165  LYS PHE GLU VAL LYS ALA ALA ALA PHE GLU GLY GLU LEU          
SEQRES  10 I  165  ILE PRO ALA SER GLN ILE ASP ARG LEU ALA THR LEU PRO          
SEQRES  11 I  165  THR TYR GLU GLU ALA ILE ALA ARG LEU MET ALA THR MET          
SEQRES  12 I  165  LYS GLU ALA SER ALA GLY LYS LEU VAL ARG THR LEU ALA          
SEQRES  13 I  165  ALA VAL ARG ASP ALA LYS GLU ALA ALA                          
SEQRES   1 J  142  MET ALA LYS LYS VAL GLN ALA TYR VAL LYS LEU GLN VAL          
SEQRES   2 J  142  ALA ALA GLY MET ALA ASN PRO SER PRO PRO VAL GLY PRO          
SEQRES   3 J  142  ALA LEU GLY GLN GLN GLY VAL ASN ILE MET GLU PHE CYS          
SEQRES   4 J  142  LYS ALA PHE ASN ALA LYS THR ASP SER ILE GLU LYS GLY          
SEQRES   5 J  142  LEU PRO ILE PRO VAL VAL ILE THR VAL TYR ALA ASP ARG          
SEQRES   6 J  142  SER PHE THR PHE VAL THR LYS THR PRO PRO ALA ALA VAL          
SEQRES   7 J  142  LEU LEU LYS LYS ALA ALA GLY ILE LYS SER GLY SER GLY          
SEQRES   8 J  142  LYS PRO ASN LYS ASP LYS VAL GLY LYS ILE SER ARG ALA          
SEQRES   9 J  142  GLN LEU GLN GLU ILE ALA GLN THR LYS ALA ALA ASP MET          
SEQRES  10 J  142  THR GLY ALA ASP ILE GLU ALA MET THR ARG SER ILE GLU          
SEQRES  11 J  142  GLY THR ALA ARG SER MET GLY LEU VAL VAL GLU ASP              
SEQRES   1 K  142  MET LYS THR PHE THR ALA LYS PRO GLU THR VAL LYS ARG          
SEQRES   2 K  142  ASP TRP TYR VAL VAL ASP ALA THR GLY LYS THR LEU GLY          
SEQRES   3 K  142  ARG LEU ALA THR GLU LEU ALA ARG ARG LEU ARG GLY LYS          
SEQRES   4 K  142  HIS LYS ALA GLU TYR THR PRO HIS VAL ASP THR GLY ASP          
SEQRES   5 K  142  TYR ILE ILE VAL LEU ASN ALA ASP LYS VAL ALA VAL THR          
SEQRES   6 K  142  GLY ASN LYS ARG THR ASP LYS VAL TYR TYR HIS HIS THR          
SEQRES   7 K  142  GLY HIS ILE GLY GLY ILE LYS GLN ALA THR PHE GLU GLU          
SEQRES   8 K  142  MET ILE ALA ARG ARG PRO GLU ARG VAL ILE GLU ILE ALA          
SEQRES   9 K  142  VAL LYS GLY MET LEU PRO LYS GLY PRO LEU GLY ARG ALA          
SEQRES  10 K  142  MET PHE ARG LYS LEU LYS VAL TYR ALA GLY ASN GLU HIS          
SEQRES  11 K  142  ASN HIS ALA ALA GLN GLN PRO GLN VAL LEU ASP ILE              
SEQRES   1 L  123  MET ILE GLN GLU GLN THR MET LEU ASN VAL ALA ASP ASN          
SEQRES   2 L  123  SER GLY ALA ARG ARG VAL MET CYS ILE LYS VAL LEU GLY          
SEQRES   3 L  123  GLY SER HIS ARG ARG TYR ALA GLY VAL GLY ASP ILE ILE          
SEQRES   4 L  123  LYS ILE THR ILE LYS GLU ALA ILE PRO ARG GLY LYS VAL          
SEQRES   5 L  123  LYS LYS GLY ASP VAL LEU LYS ALA VAL VAL VAL ARG THR          
SEQRES   6 L  123  LYS LYS GLY VAL ARG ARG PRO ASP GLY SER VAL ILE ARG          
SEQRES   7 L  123  PHE ASP GLY ASN ALA CYS VAL LEU LEU ASN ASN ASN SER          
SEQRES   8 L  123  GLU GLN PRO ILE GLY THR ARG ILE PHE GLY PRO VAL THR          
SEQRES   9 L  123  ARG GLU LEU ARG SER GLU LYS PHE MET LYS ILE ILE SER          
SEQRES  10 L  123  LEU ALA PRO GLU VAL LEU                                      
SEQRES   1 M  144  MET ARG LEU ASN THR LEU SER PRO ALA GLU GLY SER LYS          
SEQRES   2 M  144  LYS ALA GLY LYS ARG LEU GLY ARG GLY ILE GLY SER GLY          
SEQRES   3 M  144  LEU GLY LYS THR GLY GLY ARG GLY HIS LYS GLY GLN LYS          
SEQRES   4 M  144  SER ARG SER GLY GLY GLY VAL ARG ARG GLY PHE GLU GLY          
SEQRES   5 M  144  GLY GLN MET PRO LEU TYR ARG ARG LEU PRO LYS PHE GLY          
SEQRES   6 M  144  PHE THR SER ARG LYS ALA ALA ILE THR ALA GLU ILE ARG          
SEQRES   7 M  144  LEU SER ASP LEU ALA LYS VAL GLU GLY GLY VAL VAL ASP          
SEQRES   8 M  144  LEU ASN THR LEU LYS ALA ALA ASN ILE ILE GLY ILE GLN          
SEQRES   9 M  144  ILE GLU PHE ALA LYS VAL ILE LEU ALA GLY GLU VAL THR          
SEQRES  10 M  144  THR PRO VAL THR VAL ARG GLY LEU ARG VAL THR LYS GLY          
SEQRES  11 M  144  ALA ARG ALA ALA ILE GLU ALA ALA GLY GLY LYS ILE GLU          
SEQRES  12 M  144  GLU                                                          
SEQRES   1 N  136  MET LEU GLN PRO LYS ARG THR LYS PHE ARG LYS MET HIS          
SEQRES   2 N  136  LYS GLY ARG ASN ARG GLY LEU ALA GLN GLY THR ASP VAL          
SEQRES   3 N  136  SER PHE GLY SER PHE GLY LEU LYS ALA VAL GLY ARG GLY          
SEQRES   4 N  136  ARG LEU THR ALA ARG GLN ILE GLU ALA ALA ARG ARG ALA          
SEQRES   5 N  136  MET THR ARG ALA VAL LYS ARG GLN GLY LYS ILE TRP ILE          
SEQRES   6 N  136  ARG VAL PHE PRO ASP LYS PRO ILE THR GLU LYS PRO LEU          
SEQRES   7 N  136  ALA VAL ARG MET GLY LYS GLY LYS GLY ASN VAL GLU TYR          
SEQRES   8 N  136  TRP VAL ALA LEU ILE GLN PRO GLY LYS VAL LEU TYR GLU          
SEQRES   9 N  136  MET ASP GLY VAL PRO GLU GLU LEU ALA ARG GLU ALA PHE          
SEQRES  10 N  136  LYS LEU ALA ALA ALA LYS LEU PRO ILE LYS THR THR PHE          
SEQRES  11 N  136  VAL THR LYS THR VAL MET                                      
SEQRES   1 O  127  MET ARG HIS ARG LYS SER GLY ARG GLN LEU ASN ARG ASN          
SEQRES   2 O  127  SER SER HIS ARG GLN ALA MET PHE ARG ASN MET ALA GLY          
SEQRES   3 O  127  SER LEU VAL ARG HIS GLU ILE ILE LYS THR THR LEU PRO          
SEQRES   4 O  127  LYS ALA LYS GLU LEU ARG ARG VAL VAL GLU PRO LEU ILE          
SEQRES   5 O  127  THR LEU ALA LYS THR ASP SER VAL ALA ASN ARG ARG LEU          
SEQRES   6 O  127  ALA PHE ALA ARG THR ARG ASP ASN GLU ILE VAL ALA LYS          
SEQRES   7 O  127  LEU PHE ASN GLU LEU GLY PRO ARG PHE ALA SER ARG ALA          
SEQRES   8 O  127  GLY GLY TYR THR ARG ILE LEU LYS CYS GLY PHE ARG ALA          
SEQRES   9 O  127  GLY ASP ASN ALA PRO MET ALA TYR ILE GLU LEU VAL ASP          
SEQRES  10 O  127  ARG SER GLU LYS ALA GLU ALA ALA ALA GLU                      
SEQRES   1 P  117  MET ASP LYS LYS SER ALA ARG ILE ARG ARG ALA THR ARG          
SEQRES   2 P  117  ALA ARG ARG LYS LEU GLN GLU LEU GLY ALA THR ARG LEU          
SEQRES   3 P  117  VAL VAL HIS ARG THR PRO ARG HIS ILE TYR ALA GLN VAL          
SEQRES   4 P  117  ILE ALA PRO ASN GLY SER GLU VAL LEU VAL ALA ALA SER          
SEQRES   5 P  117  THR VAL GLU LYS ALA ILE ALA GLU GLN LEU LYS TYR THR          
SEQRES   6 P  117  GLY ASN LYS ASP ALA ALA ALA ALA VAL GLY LYS ALA VAL          
SEQRES   7 P  117  ALA GLU ARG ALA LEU GLU LYS GLY ILE LYS ASP VAL SER          
SEQRES   8 P  117  PHE ASP ARG SER GLY PHE GLN TYR HIS GLY ARG VAL GLN          
SEQRES   9 P  117  ALA LEU ALA ASP ALA ALA ARG GLU ALA GLY LEU GLN PHE          
SEQRES   1 Q  115  MET SER ASN ILE ILE LYS GLN LEU GLU GLN GLU GLN MET          
SEQRES   2 Q  115  LYS GLN ASP VAL PRO SER PHE ARG PRO GLY ASP THR VAL          
SEQRES   3 Q  115  GLU VAL LYS VAL TRP VAL VAL GLU GLY SER LYS LYS ARG          
SEQRES   4 Q  115  LEU GLN ALA PHE GLU GLY VAL VAL ILE ALA ILE ARG ASN          
SEQRES   5 Q  115  ARG GLY LEU HIS SER ALA PHE THR VAL ARG LYS ILE SER          
SEQRES   6 Q  115  ASN GLY GLU GLY VAL GLU ARG VAL PHE GLN THR HIS SER          
SEQRES   7 Q  115  PRO VAL VAL ASP SER ILE SER VAL LYS ARG ARG GLY ALA          
SEQRES   8 Q  115  VAL ARG LYS ALA LYS LEU TYR TYR LEU ARG GLU ARG THR          
SEQRES   9 Q  115  GLY LYS ALA ALA ARG ILE LYS GLU ARG LEU ASN                  
SEQRES   1 R  118  MET ALA ARG VAL LYS ARG GLY VAL ILE ALA ARG ALA ARG          
SEQRES   2 R  118  HIS LYS LYS ILE LEU LYS GLN ALA LYS GLY TYR TYR GLY          
SEQRES   3 R  118  ALA ARG SER ARG VAL TYR ARG VAL ALA PHE GLN ALA VAL          
SEQRES   4 R  118  ILE LYS ALA GLY GLN TYR ALA TYR ARG ASP ARG ARG GLN          
SEQRES   5 R  118  ARG LYS ARG GLN PHE ARG GLN LEU TRP ILE ALA ARG ILE          
SEQRES   6 R  118  ASN ALA ALA ALA ARG GLN ASN GLY ILE SER TYR SER LYS          
SEQRES   7 R  118  PHE ILE ASN GLY LEU LYS LYS ALA SER VAL GLU ILE ASP          
SEQRES   8 R  118  ARG LYS ILE LEU ALA ASP ILE ALA VAL PHE ASP LYS VAL          
SEQRES   9 R  118  ALA PHE THR ALA LEU VAL GLU LYS ALA LYS ALA ALA LEU          
SEQRES  10 R  118  ALA                                                          
SEQRES   1 S  103  MET TYR ALA VAL PHE GLN SER GLY GLY LYS GLN HIS ARG          
SEQRES   2 S  103  VAL SER GLU GLY GLN THR VAL ARG LEU GLU LYS LEU ASP          
SEQRES   3 S  103  ILE ALA THR GLY GLU THR VAL GLU PHE ALA GLU VAL LEU          
SEQRES   4 S  103  MET ILE ALA ASN GLY GLU GLU VAL LYS ILE GLY VAL PRO          
SEQRES   5 S  103  PHE VAL ASP GLY GLY VAL ILE LYS ALA GLU VAL VAL ALA          
SEQRES   6 S  103  HIS GLY ARG GLY GLU LYS VAL LYS ILE VAL LYS PHE ARG          
SEQRES   7 S  103  ARG ARG LYS HIS TYR ARG LYS GLN GLN GLY HIS ARG GLN          
SEQRES   8 S  103  TRP PHE THR ASP VAL LYS ILE THR GLY ILE SER ALA              
SEQRES   1 T  110  MET GLU THR ILE ALA LYS HIS ARG HIS ALA ARG SER SER          
SEQRES   2 T  110  ALA GLN LYS VAL ARG LEU VAL ALA ASP LEU ILE ARG GLY          
SEQRES   3 T  110  LYS LYS VAL SER GLN ALA LEU ASP ILE LEU THR TYR THR          
SEQRES   4 T  110  ASN LYS LYS ALA ALA VAL LEU VAL LYS LYS VAL LEU GLU          
SEQRES   5 T  110  SER ALA ILE ALA ASN ALA GLU HIS ASN ASP GLY ALA ASP          
SEQRES   6 T  110  ILE ASP ASP LEU LYS VAL THR LYS ILE PHE VAL ASP GLU          
SEQRES   7 T  110  GLY PRO SER MET LYS ARG ILE MET PRO ARG ALA LYS GLY          
SEQRES   8 T  110  ARG ALA ASP ARG ILE LEU LYS ARG THR SER HIS ILE THR          
SEQRES   9 T  110  VAL VAL VAL SER ASP ARG                                      
SEQRES   1 U  100  MET ILE ARG GLU GLU ARG LEU LEU LYS VAL LEU ARG ALA          
SEQRES   2 U  100  PRO HIS VAL SER GLU LYS ALA SER THR ALA MET GLU LYS          
SEQRES   3 U  100  SER ASN THR ILE VAL LEU LYS VAL ALA LYS ASP ALA THR          
SEQRES   4 U  100  LYS ALA GLU ILE LYS ALA ALA VAL GLN LYS LEU PHE GLU          
SEQRES   5 U  100  VAL GLU VAL GLU VAL VAL ASN THR LEU VAL VAL LYS GLY          
SEQRES   6 U  100  LYS VAL LYS ARG HIS GLY GLN ARG ILE GLY ARG ARG SER          
SEQRES   7 U  100  ASP TRP LYS LYS ALA TYR VAL THR LEU LYS GLU GLY GLN          
SEQRES   8 U  100  ASN LEU ASP PHE VAL GLY GLY ALA GLU                          
SEQRES   1 V  104  MET ALA ALA LYS ILE ARG ARG ASP ASP GLU VAL ILE VAL          
SEQRES   2 V  104  LEU THR GLY LYS ASP LYS GLY LYS ARG GLY LYS VAL LYS          
SEQRES   3 V  104  ASN VAL LEU SER SER GLY LYS VAL ILE VAL GLU GLY ILE          
SEQRES   4 V  104  ASN LEU VAL LYS LYS HIS GLN LYS PRO VAL PRO ALA LEU          
SEQRES   5 V  104  ASN GLN PRO GLY GLY ILE VAL GLU LYS GLU ALA ALA ILE          
SEQRES   6 V  104  GLN VAL SER ASN VAL ALA ILE PHE ASN ALA ALA THR GLY          
SEQRES   7 V  104  LYS ALA ASP ARG VAL GLY PHE ARG PHE GLU ASP GLY LYS          
SEQRES   8 V  104  LYS VAL ARG PHE PHE LYS SER ASN SER GLU THR ILE LYS          
SEQRES   1 W   94  MET PHE THR ILE ASN ALA GLU VAL ARG LYS GLU GLN GLY          
SEQRES   2 W   94  LYS GLY ALA SER ARG ARG LEU ARG ALA ALA ASN LYS PHE          
SEQRES   3 W   94  PRO ALA ILE ILE TYR GLY GLY LYS GLU ALA PRO LEU ALA          
SEQRES   4 W   94  ILE GLU LEU ASP HIS ASP LYS VAL MET ASN MET GLN ALA          
SEQRES   5 W   94  LYS ALA GLU PHE TYR SER GLU VAL LEU THR ILE VAL VAL          
SEQRES   6 W   94  ASP GLY LYS GLU ILE LYS VAL LYS ALA GLN ASP VAL GLN          
SEQRES   7 W   94  ARG HIS PRO TYR LYS PRO LYS LEU GLN HIS ILE ASP PHE          
SEQRES   8 W   94  VAL ARG ALA                                                  
SEQRES   1 X   85  MET ALA HIS LYS LYS ALA GLY GLY SER THR ARG ASN GLY          
SEQRES   2 X   85  ARG ASP SER GLU ALA LYS ARG LEU GLY VAL LYS ARG PHE          
SEQRES   3 X   85  GLY GLY GLU SER VAL LEU ALA GLY SER ILE ILE VAL ARG          
SEQRES   4 X   85  GLN ARG GLY THR LYS PHE HIS ALA GLY ALA ASN VAL GLY          
SEQRES   5 X   85  CYS GLY ARG ASP HIS THR LEU PHE ALA LYS ALA ASP GLY          
SEQRES   6 X   85  LYS VAL LYS PHE GLU VAL LYS GLY PRO LYS ASN ARG LYS          
SEQRES   7 X   85  PHE ILE SER ILE GLU ALA GLU                                  
SEQRES   1 Y   78  MET SER ARG VAL CYS GLN VAL THR GLY LYS ARG PRO VAL          
SEQRES   2 Y   78  THR GLY ASN ASN ARG SER HIS ALA LEU ASN ALA THR LYS          
SEQRES   3 Y   78  ARG ARG PHE LEU PRO ASN LEU HIS SER HIS ARG PHE TRP          
SEQRES   4 Y   78  VAL GLU SER GLU LYS ARG PHE VAL THR LEU ARG VAL SER          
SEQRES   5 Y   78  ALA LYS GLY MET ARG VAL ILE ASP LYS LYS GLY ILE ASP          
SEQRES   6 Y   78  THR VAL LEU ALA GLU LEU ARG ALA ARG GLY GLU LYS TYR          
SEQRES   1 Z   63  MET LYS ALA LYS GLU LEU ARG GLU LYS SER VAL GLU GLU          
SEQRES   2 Z   63  LEU ASN THR GLU LEU LEU ASN LEU LEU ARG GLU GLN PHE          
SEQRES   3 Z   63  ASN LEU ARG MET GLN ALA ALA SER GLY GLN LEU GLN GLN          
SEQRES   4 Z   63  SER HIS LEU LEU LYS GLN VAL ARG ARG ASP VAL ALA ARG          
SEQRES   5 Z   63  VAL LYS THR LEU LEU ASN GLU LYS ALA GLY ALA                  
SEQRES   1 a   59  MET ALA LYS THR ILE LYS ILE THR GLN THR ARG SER ALA          
SEQRES   2 a   59  ILE GLY ARG LEU PRO LYS HIS LYS ALA THR LEU LEU GLY          
SEQRES   3 a   59  LEU GLY LEU ARG ARG ILE GLY HIS THR VAL GLU ARG GLU          
SEQRES   4 a   59  ASP THR PRO ALA ILE ARG GLY MET ILE ASN ALA VAL SER          
SEQRES   5 a   59  PHE MET VAL LYS VAL GLU GLU                                  
SEQRES   1 b   57  MET ALA VAL GLN GLN ASN LYS PRO THR ARG SER LYS ARG          
SEQRES   2 b   57  GLY MET ARG ARG SER HIS ASP ALA LEU THR ALA VAL THR          
SEQRES   3 b   57  SER LEU SER VAL ASP LYS THR SER GLY GLU LYS HIS LEU          
SEQRES   4 b   57  ARG HIS HIS ILE THR ALA ASP GLY TYR TYR ARG GLY ARG          
SEQRES   5 b   57  LYS VAL ILE ALA LYS                                          
SEQRES   1 c   55  MET ALA LYS GLY ILE ARG GLU LYS ILE LYS LEU VAL SER          
SEQRES   2 c   55  SER ALA GLY THR GLY HIS PHE TYR THR THR THR LYS ASN          
SEQRES   3 c   55  LYS ARG THR LYS PRO GLU LYS LEU GLU LEU LYS LYS PHE          
SEQRES   4 c   55  ASP PRO VAL VAL ARG GLN HIS VAL ILE TYR LYS GLU ALA          
SEQRES   5 c   55  LYS ILE LYS                                                  
SEQRES   1 d   46  MET LYS ARG THR PHE GLN PRO SER VAL LEU LYS ARG ASN          
SEQRES   2 d   46  ARG SER HIS GLY PHE ARG ALA ARG MET ALA THR LYS ASN          
SEQRES   3 d   46  GLY ARG GLN VAL LEU ALA ARG ARG ARG ALA LYS GLY ARG          
SEQRES   4 d   46  ALA ARG LEU THR VAL SER LYS                                  
SEQRES   1 e   65  MET PRO LYS ILE LYS THR VAL ARG GLY ALA ALA LYS ARG          
SEQRES   2 e   65  PHE LYS LYS THR GLY LYS GLY GLY PHE LYS HIS LYS HIS          
SEQRES   3 e   65  ALA ASN LEU ARG HIS ILE LEU THR LYS LYS ALA THR LYS          
SEQRES   4 e   65  ARG LYS ARG HIS LEU ARG PRO LYS ALA MET VAL SER LYS          
SEQRES   5 e   65  GLY ASP LEU GLY LEU VAL ILE ALA CYS LEU PRO TYR ALA          
SEQRES   1 f   38  MET LYS VAL ARG ALA SER VAL LYS LYS LEU CYS ARG ASN          
SEQRES   2 f   38  CYS LYS ILE VAL LYS ARG ASP GLY VAL ILE ARG VAL ILE          
SEQRES   3 f   38  CYS SER ALA GLU PRO LYS HIS LYS GLN ARG GLN GLY              
SEQRES   1 i  450  ASN LEU THR ASP ARG LEU SER ARG THR LEU ARG ASN ILE          
SEQRES   2 i  450  SER GLY ARG GLY ARG LEU THR GLU ASP ASN VAL LYS ASP          
SEQRES   3 i  450  THR LEU ARG GLU VAL ARG MET ALA LEU LEU GLU ALA ASP          
SEQRES   4 i  450  VAL ALA LEU PRO VAL VAL ARG GLU PHE ILE ASN ARG VAL          
SEQRES   5 i  450  LYS GLU LYS ALA VAL GLY HIS GLU VAL ASN LYS SER LEU          
SEQRES   6 i  450  THR PRO GLY GLN GLU PHE VAL LYS ILE VAL ARG ASN GLU          
SEQRES   7 i  450  LEU VAL ALA ALA MET GLY GLU GLU ASN GLN THR LEU ASN          
SEQRES   8 i  450  LEU ALA ALA GLN PRO PRO ALA VAL VAL LEU MET ALA GLY          
SEQRES   9 i  450  LEU GLN GLY ALA GLY LYS THR THR SER VAL GLY LYS LEU          
SEQRES  10 i  450  GLY LYS PHE LEU ARG GLU LYS HIS LYS LYS LYS VAL LEU          
SEQRES  11 i  450  VAL VAL SER ALA ASP VAL TYR ARG PRO ALA ALA ILE LYS          
SEQRES  12 i  450  GLN LEU GLU THR LEU ALA GLU GLN VAL GLY VAL ASP PHE          
SEQRES  13 i  450  PHE PRO SER ASP VAL GLY GLN LYS PRO VAL ASP ILE VAL          
SEQRES  14 i  450  ASN ALA ALA LEU LYS GLU ALA LYS LEU LYS PHE TYR ASP          
SEQRES  15 i  450  VAL LEU LEU VAL ASP THR ALA GLY ARG LEU HIS VAL ASP          
SEQRES  16 i  450  GLU ALA MET MET ASP GLU ILE LYS GLN VAL HIS ALA SER          
SEQRES  17 i  450  ILE ASN PRO VAL GLU THR LEU PHE VAL VAL ASP ALA MET          
SEQRES  18 i  450  THR GLY GLN ASP ALA ALA ASN THR ALA LYS ALA PHE ASN          
SEQRES  19 i  450  GLU ALA LEU PRO LEU THR GLY VAL VAL LEU THR LYS VAL          
SEQRES  20 i  450  ASP GLY ASP ALA ARG GLY GLY ALA ALA LEU SER ILE ARG          
SEQRES  21 i  450  HIS ILE THR GLY LYS PRO ILE LYS PHE LEU GLY VAL GLY          
SEQRES  22 i  450  GLU LYS THR GLU ALA LEU GLU PRO PHE HIS PRO ASP ARG          
SEQRES  23 i  450  ILE ALA SER ARG ILE LEU GLY MET UNK UNK UNK UNK UNK          
SEQRES  24 i  450  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  25 i  450  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK GLY          
SEQRES  26 i  450  PHE ASP LEU ASN ASP PHE LEU GLU GLN LEU ARG GLN MET          
SEQRES  27 i  450  LYS ASN MET GLY GLY UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  28 i  450  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  29 i  450  UNK ASP ASP LYS VAL LEU VAL ARG MET GLU ALA ILE ILE          
SEQRES  30 i  450  ASN SER MET THR MET LYS GLU ARG ALA LYS PRO GLU ILE          
SEQRES  31 i  450  ILE LYS GLY SER ARG LYS ARG ARG ILE ALA ALA GLY CYS          
SEQRES  32 i  450  GLY MET GLN VAL GLN ASP VAL ASN ARG LEU LEU LYS GLN          
SEQRES  33 i  450  PHE ASP ASP MET GLN ARG MET MET LYS LYS MET LYS LYS          
SEQRES  34 i  450  GLY GLY UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  35 i  450  UNK UNK UNK UNK UNK UNK UNK UNK                              
SEQRES   1 k   18  MET LYS GLN SER THR LEU ALA LEU LEU LEU LEU LEU LEU          
SEQRES   2 k   18  LEU LEU THR PRO VAL                                          
HET     MG  2 101       1                                                       
HET     MG  A3001       1                                                       
HET     MG  A3002       1                                                       
HET     MG  A3003       1                                                       
HET     MG  A3004       1                                                       
HET     MG  A3005       1                                                       
HET     MG  A3006       1                                                       
HET     MG  A3007       1                                                       
HET     MG  A3008       1                                                       
HET     MG  A3009       1                                                       
HET     MG  A3010       1                                                       
HET     MG  A3011       1                                                       
HET     MG  A3012       1                                                       
HET     MG  A3013       1                                                       
HET     MG  A3014       1                                                       
HET     MG  A3015       1                                                       
HET     MG  A3016       1                                                       
HET     MG  A3017       1                                                       
HET     MG  A3018       1                                                       
HET     MG  A3019       1                                                       
HET     MG  A3020       1                                                       
HET     MG  A3021       1                                                       
HET     MG  A3022       1                                                       
HET     MG  A3023       1                                                       
HET     MG  A3024       1                                                       
HET     MG  A3025       1                                                       
HET     MG  A3026       1                                                       
HET     MG  A3027       1                                                       
HET     MG  A3028       1                                                       
HET     MG  A3029       1                                                       
HET     MG  A3030       1                                                       
HET     MG  A3031       1                                                       
HET     MG  A3032       1                                                       
HET     MG  A3033       1                                                       
HET     MG  A3034       1                                                       
HET     MG  A3035       1                                                       
HET     MG  A3036       1                                                       
HET     MG  A3037       1                                                       
HET     MG  A3038       1                                                       
HET     MG  A3039       1                                                       
HET     MG  A3040       1                                                       
HET     MG  A3041       1                                                       
HET     MG  A3042       1                                                       
HET     MG  A3043       1                                                       
HET     MG  A3044       1                                                       
HET     MG  A3045       1                                                       
HET     MG  A3046       1                                                       
HET     MG  A3047       1                                                       
HET     MG  A3048       1                                                       
HET     MG  A3049       1                                                       
HET     MG  A3050       1                                                       
HET     MG  A3051       1                                                       
HET     MG  A3052       1                                                       
HET     MG  A3053       1                                                       
HET     MG  A3054       1                                                       
HET     MG  A3055       1                                                       
HET     MG  A3056       1                                                       
HET     MG  A3057       1                                                       
HET     MG  A3058       1                                                       
HET     MG  A3059       1                                                       
HET     MG  A3060       1                                                       
HET     MG  A3061       1                                                       
HET     MG  A3062       1                                                       
HET     MG  A3063       1                                                       
HET     MG  A3064       1                                                       
HET     MG  A3065       1                                                       
HET     MG  A3066       1                                                       
HET     MG  A3067       1                                                       
HET     MG  A3068       1                                                       
HET     MG  A3069       1                                                       
HET     MG  A3070       1                                                       
HET     MG  A3071       1                                                       
HET     MG  A3072       1                                                       
HET     MG  A3073       1                                                       
HET     MG  A3074       1                                                       
HET     MG  A3075       1                                                       
HET     MG  A3076       1                                                       
HET     MG  A3077       1                                                       
HET     MG  A3078       1                                                       
HET     MG  A3079       1                                                       
HET     MG  A3080       1                                                       
HET     MG  A3081       1                                                       
HET     MG  A3082       1                                                       
HET     MG  A3083       1                                                       
HET     MG  A3084       1                                                       
HET     MG  A3085       1                                                       
HET     MG  A3086       1                                                       
HET     MG  A3087       1                                                       
HET     MG  A3088       1                                                       
HET     MG  A3089       1                                                       
HET     MG  A3090       1                                                       
HET     MG  A3091       1                                                       
HET     MG  A3092       1                                                       
HET     MG  A3093       1                                                       
HET     MG  A3094       1                                                       
HET     MG  A3095       1                                                       
HET     MG  A3096       1                                                       
HET     MG  A3097       1                                                       
HET     MG  A3098       1                                                       
HET     MG  A3099       1                                                       
HET     MG  A3100       1                                                       
HET     MG  A3101       1                                                       
HET     MG  A3102       1                                                       
HET     MG  A3103       1                                                       
HET     MG  A3104       1                                                       
HET     MG  A3105       1                                                       
HET     MG  A3106       1                                                       
HET     MG  A3107       1                                                       
HET     MG  A3108       1                                                       
HET     MG  A3109       1                                                       
HET     MG  A3110       1                                                       
HET     MG  A3111       1                                                       
HET     MG  A3112       1                                                       
HET     MG  A3113       1                                                       
HET     MG  A3114       1                                                       
HET     MG  A3115       1                                                       
HET     MG  A3116       1                                                       
HET     MG  A3117       1                                                       
HET     MG  A3118       1                                                       
HET     MG  A3119       1                                                       
HET     MG  A3120       1                                                       
HET     MG  A3121       1                                                       
HET     MG  A3122       1                                                       
HET     MG  A3123       1                                                       
HET     MG  A3124       1                                                       
HET     MG  A3125       1                                                       
HET     MG  A3126       1                                                       
HET     MG  A3127       1                                                       
HET     MG  A3128       1                                                       
HET     MG  A3129       1                                                       
HET     MG  A3130       1                                                       
HET     MG  A3131       1                                                       
HET     MG  A3132       1                                                       
HET     MG  A3133       1                                                       
HET     MG  A3134       1                                                       
HET     MG  A3135       1                                                       
HET     MG  A3136       1                                                       
HET     MG  A3137       1                                                       
HET     MG  A3138       1                                                       
HET     MG  A3139       1                                                       
HET     MG  A3140       1                                                       
HET     MG  A3141       1                                                       
HET     MG  A3142       1                                                       
HET     MG  A3143       1                                                       
HET     MG  A3144       1                                                       
HET     MG  A3145       1                                                       
HET     MG  A3146       1                                                       
HET     MG  A3147       1                                                       
HET     MG  A3148       1                                                       
HET     MG  A3149       1                                                       
HET     MG  A3150       1                                                       
HET     MG  A3151       1                                                       
HET     MG  A3152       1                                                       
HET     MG  A3153       1                                                       
HET     MG  A3154       1                                                       
HET     MG  A3155       1                                                       
HET     MG  A3156       1                                                       
HET     MG  A3157       1                                                       
HET     MG  A3158       1                                                       
HET     MG  A3159       1                                                       
HET     MG  A3160       1                                                       
HET     MG  A3161       1                                                       
HET     MG  A3162       1                                                       
HET     MG  A3163       1                                                       
HET     MG  A3164       1                                                       
HET     MG  A3165       1                                                       
HET     MG  A3166       1                                                       
HET     MG  A3167       1                                                       
HET     MG  A3168       1                                                       
HET     MG  A3169       1                                                       
HET     MG  A3170       1                                                       
HET     MG  A3171       1                                                       
HET     MG  A3172       1                                                       
HET     MG  A3173       1                                                       
HET     MG  A3174       1                                                       
HET     MG  A3175       1                                                       
HET     MG  A3176       1                                                       
HET     MG  A3177       1                                                       
HET     MG  A3178       1                                                       
HET     MG  A3179       1                                                       
HET     MG  A3180       1                                                       
HET     MG  A3181       1                                                       
HET     MG  A3182       1                                                       
HET     MG  A3183       1                                                       
HET     MG  A3184       1                                                       
HET     MG  A3185       1                                                       
HET     MG  A3186       1                                                       
HET     MG  A3187       1                                                       
HET     MG  A3188       1                                                       
HET     MG  A3189       1                                                       
HET     MG  A3190       1                                                       
HET     MG  A3191       1                                                       
HET     MG  A3192       1                                                       
HET     MG  A3193       1                                                       
HET     MG  A3194       1                                                       
HET     MG  A3195       1                                                       
HET     MG  A3196       1                                                       
HET     MG  A3197       1                                                       
HET     MG  A3198       1                                                       
HET     MG  A3199       1                                                       
HET     MG  A3200       1                                                       
HET     MG  A3201       1                                                       
HET     MG  A3202       1                                                       
HET     MG  A3203       1                                                       
HET     MG  A3204       1                                                       
HET     MG  A3205       1                                                       
HET     MG  A3206       1                                                       
HET     MG  A3207       1                                                       
HET     MG  A3208       1                                                       
HET     MG  A3209       1                                                       
HET     MG  A3210       1                                                       
HET     MG  A3211       1                                                       
HET     MG  A3212       1                                                       
HET     MG  A3213       1                                                       
HET     MG  A3214       1                                                       
HET     MG  A3215       1                                                       
HET     MG  A3216       1                                                       
HET     MG  A3217       1                                                       
HET     MG  A3218       1                                                       
HET     MG  A3219       1                                                       
HET     MG  A3220       1                                                       
HET     MG  A3221       1                                                       
HET     MG  A3222       1                                                       
HET     MG  A3223       1                                                       
HET     MG  A3224       1                                                       
HET     MG  A3225       1                                                       
HET     MG  A3226       1                                                       
HET     MG  A3227       1                                                       
HET     MG  A3228       1                                                       
HET     MG  A3229       1                                                       
HET     MG  A3230       1                                                       
HET     MG  A3231       1                                                       
HET     MG  A3232       1                                                       
HET     MG  A3233       1                                                       
HET     MG  A3234       1                                                       
HET     MG  A3235       1                                                       
HET     MG  A3236       1                                                       
HET     MG  A3237       1                                                       
HET     MG  A3238       1                                                       
HET     MG  A3239       1                                                       
HET     MG  A3240       1                                                       
HET     MG  A3241       1                                                       
HET     MG  A3242       1                                                       
HET     MG  A3243       1                                                       
HET     MG  A3244       1                                                       
HET     MG  A3245       1                                                       
HET     MG  A3246       1                                                       
HET     MG  A3247       1                                                       
HET     MG  A3248       1                                                       
HET     MG  A3249       1                                                       
HET     MG  A3250       1                                                       
HET     MG  A3251       1                                                       
HET     MG  A3252       1                                                       
HET     MG  A3253       1                                                       
HET     MG  A3254       1                                                       
HET     MG  A3255       1                                                       
HET     MG  A3256       1                                                       
HET     MG  A3257       1                                                       
HET     MG  A3258       1                                                       
HET     MG  A3259       1                                                       
HET     MG  A3260       1                                                       
HET     MG  A3261       1                                                       
HET     MG  A3262       1                                                       
HET     MG  A3263       1                                                       
HET     MG  A3264       1                                                       
HET     MG  A3265       1                                                       
HET     MG  A3266       1                                                       
HET     MG  A3267       1                                                       
HET     MG  A3268       1                                                       
HET     MG  A3269       1                                                       
HET     MG  A3270       1                                                       
HET     MG  A3271       1                                                       
HET     MG  A3272       1                                                       
HET     MG  A3273       1                                                       
HET     MG  A3274       1                                                       
HET     MG  A3275       1                                                       
HET     MG  A3276       1                                                       
HET     MG  A3277       1                                                       
HET     MG  A3278       1                                                       
HET     MG  A3279       1                                                       
HET     MG  A3280       1                                                       
HET     MG  A3281       1                                                       
HET     MG  A3282       1                                                       
HET     MG  A3283       1                                                       
HET     MG  A3284       1                                                       
HET     MG  A3285       1                                                       
HET     MG  A3286       1                                                       
HET     MG  A3287       1                                                       
HET     MG  A3288       1                                                       
HET     MG  A3289       1                                                       
HET     MG  A3290       1                                                       
HET     MG  A3291       1                                                       
HET     MG  A3292       1                                                       
HET     MG  A3293       1                                                       
HET     MG  A3294       1                                                       
HET     MG  A3295       1                                                       
HET     MG  A3296       1                                                       
HET     MG  A3297       1                                                       
HET     MG  A3298       1                                                       
HET     MG  A3299       1                                                       
HET     MG  A3300       1                                                       
HET     MG  A3301       1                                                       
HET     MG  A3302       1                                                       
HET     MG  A3303       1                                                       
HET     MG  A3304       1                                                       
HET     MG  A3305       1                                                       
HET     MG  A3306       1                                                       
HET     MG  A3307       1                                                       
HET     MG  A3308       1                                                       
HET     MG  A3309       1                                                       
HET     MG  A3310       1                                                       
HET     MG  A3311       1                                                       
HET     MG  A3312       1                                                       
HET     MG  A3313       1                                                       
HET     MG  A3314       1                                                       
HET     MG  A3315       1                                                       
HET     MG  A3316       1                                                       
HET     MG  A3317       1                                                       
HET     MG  A3318       1                                                       
HET     MG  A3319       1                                                       
HET     MG  A3320       1                                                       
HET     MG  A3321       1                                                       
HET     MG  A3322       1                                                       
HET     MG  A3323       1                                                       
HET     MG  A3324       1                                                       
HET     MG  A3325       1                                                       
HET     MG  A3326       1                                                       
HET     MG  A3327       1                                                       
HET     MG  A3328       1                                                       
HET     MG  A3329       1                                                       
HET     MG  A3330       1                                                       
HET     MG  A3331       1                                                       
HET     MG  A3332       1                                                       
HET     MG  A3333       1                                                       
HET     MG  A3334       1                                                       
HET     MG  A3335       1                                                       
HET     MG  A3336       1                                                       
HET     MG  A3337       1                                                       
HET     MG  A3338       1                                                       
HET     MG  A3339       1                                                       
HET     MG  A3340       1                                                       
HET     MG  A3341       1                                                       
HET     MG  A3342       1                                                       
HET     MG  A3343       1                                                       
HET     MG  A3344       1                                                       
HET     MG  A3345       1                                                       
HET     MG  A3346       1                                                       
HET     MG  A3347       1                                                       
HET     MG  A3348       1                                                       
HET     MG  A3349       1                                                       
HET     MG  A3350       1                                                       
HET     MG  A3351       1                                                       
HET     MG  A3352       1                                                       
HET     MG  A3353       1                                                       
HET     MG  A3354       1                                                       
HET     MG  A3355       1                                                       
HET     MG  A3356       1                                                       
HET     MG  A3357       1                                                       
HET     MG  A3358       1                                                       
HET     MG  A3359       1                                                       
HET     MG  A3360       1                                                       
HET     MG  A3361       1                                                       
HET     MG  A3362       1                                                       
HET     MG  A3363       1                                                       
HET     MG  A3364       1                                                       
HET     MG  A3365       1                                                       
HET     MG  A3366       1                                                       
HET     MG  A3367       1                                                       
HET     MG  A3368       1                                                       
HET     MG  A3369       1                                                       
HET     MG  A3370       1                                                       
HET     MG  A3371       1                                                       
HET     MG  A3372       1                                                       
HET     MG  A3373       1                                                       
HET     MG  A3374       1                                                       
HET     MG  A3375       1                                                       
HET     MG  A3376       1                                                       
HET     MG  A3377       1                                                       
HET     MG  A3378       1                                                       
HET     MG  A3379       1                                                       
HET     MG  A3380       1                                                       
HET     MG  A3381       1                                                       
HET     MG  A3382       1                                                       
HET     MG  A3383       1                                                       
HET     MG  A3384       1                                                       
HET     MG  A3385       1                                                       
HET     MG  A3386       1                                                       
HET     MG  A3387       1                                                       
HET     MG  A3388       1                                                       
HET     MG  A3389       1                                                       
HET     MG  A3390       1                                                       
HET     MG  A3391       1                                                       
HET     MG  A3392       1                                                       
HET     MG  A3393       1                                                       
HET     MG  A3394       1                                                       
HET     MG  A3395       1                                                       
HET     MG  A3396       1                                                       
HET     MG  A3397       1                                                       
HET     MG  A3398       1                                                       
HET     MG  A3399       1                                                       
HET     MG  A3400       1                                                       
HET     MG  A3401       1                                                       
HET     MG  A3402       1                                                       
HET     MG  A3403       1                                                       
HET     MG  A3404       1                                                       
HET     MG  A3405       1                                                       
HET     MG  A3406       1                                                       
HET     MG  A3407       1                                                       
HET     MG  A3408       1                                                       
HET     MG  A3409       1                                                       
HET     MG  A3410       1                                                       
HET     MG  A3411       1                                                       
HET     MG  B 201       1                                                       
HET     MG  B 202       1                                                       
HET     MG  B 203       1                                                       
HET     MG  B 204       1                                                       
HET     MG  B 205       1                                                       
HET     MG  B 206       1                                                       
HET     MG  B 207       1                                                       
HET     MG  B 208       1                                                       
HET     MG  B 209       1                                                       
HET     MG  B 210       1                                                       
HET     MG  B 211       1                                                       
HET     MG  B 212       1                                                       
HET     MG  C 301       1                                                       
HET     MG  C 302       1                                                       
HET     MG  D 301       1                                                       
HET     MG  O 201       1                                                       
HET     MG  R 201       1                                                       
HET     MG  Y 101       1                                                       
HET     MG  b 101       1                                                       
HET     ZN  f 101       1                                                       
HETNAM      MG MAGNESIUM ION                                                    
HETNAM      ZN ZINC ION                                                         
FORMUL  37   MG    431(MG 2+)                                                   
FORMUL  68   ZN    ZN 2+                                                        
HELIX    1 AA1 GLY C   12  HIS C   15  5                                   4    
HELIX    2 AA2 LYS C  207  ARG C  214  1                                   8    
HELIX    3 AA3 ARG C  221  MET C  225  5                                   5    
HELIX    4 AA4 THR C  263  LYS C  265  5                                   3    
HELIX    5 AA5 LYS D   56  VAL D   60  5                                   5    
HELIX    6 AA6 THR D   61  GLY D   72  1                                  12    
HELIX    7 AA7 SER D   97  ALA D  102  5                                   6    
HELIX    8 AA8 GLY D  120  TRP D  125  1                                   6    
HELIX    9 AA9 ASN E   24  ALA E   39  1                                  16    
HELIX   10 AB1 ASN E   97  GLN E  115  1                                  19    
HELIX   11 AB2 LYS E  130  ALA E  142  1                                  13    
HELIX   12 AB3 ASP E  154  ALA E  161  1                                   8    
HELIX   13 AB4 ARG E  162  LEU E  164  5                                   3    
HELIX   14 AB5 THR E  173  ILE E  175  5                                   3    
HELIX   15 AB6 ASP E  176  ALA E  182  1                                   7    
HELIX   16 AB7 ALA E  190  ALA E  201  1                                  12    
HELIX   17 AB8 LYS F    3  GLU F   11  1                                   9    
HELIX   18 AB9 GLU F   11  PHE F   20  1                                  10    
HELIX   19 AC1 SER F   24  VAL F   28  5                                   5    
HELIX   20 AC2 LYS F   47  GLY F   62  1                                  16    
HELIX   21 AC3 GLY F   93  ILE F  106  1                                  14    
HELIX   22 AC4 ALA F  107  ILE F  111  5                                   5    
HELIX   23 AC5 ASP F  142  VAL F  146  5                                   5    
HELIX   24 AC6 SER F  162  PHE F  173  1                                  12    
HELIX   25 AC7 ASP G   60  VAL G   79  1                                  20    
HELIX   26 AC8 ASP G  137  ALA G  150  1                                  14    
HELIX   27 AC9 LYS H   22  PHE H   29  1                                   8    
HELIX   28 AD1 THR H   40  ASN H   73  1                                  34    
HELIX   29 AD2 GLY H   85  LYS H   89  5                                   5    
HELIX   30 AD3 GLY H   95  THR H  104  1                                  10    
HELIX   31 AD4 ASN I    4  LYS I   20  1                                  17    
HELIX   32 AD5 THR I   34  GLU I   47  1                                  14    
HELIX   33 AD6 ARG I   56  GLU I   65  1                                  10    
HELIX   34 AD7 ARG I   94  ASN I  103  1                                  10    
HELIX   35 AD8 VAL J   24  GLN J   30  1                                   7    
HELIX   36 AD9 ASN J   34  THR J   46  1                                  13    
HELIX   37 AE1 ASP J   47  ILE J   49  5                                   3    
HELIX   38 AE2 PRO J   75  ALA J   84  1                                  10    
HELIX   39 AE3 SER J  102  MET J  117  1                                  16    
HELIX   40 AE4 ASP J  121  MET J  136  1                                  16    
HELIX   41 AE5 THR K   24  GLY K   38  1                                  15    
HELIX   42 AE6 ASN K   58  VAL K   62  5                                   5    
HELIX   43 AE7 ASN K   67  LYS K   72  1                                   6    
HELIX   44 AE8 PHE K   89  ARG K   96  1                                   8    
HELIX   45 AE9 PRO K   97  GLY K  107  1                                  11    
HELIX   46 AF1 GLY K  112  ARG K  120  1                                   9    
HELIX   47 AF2 HIS K  132  GLN K  136  5                                   5    
HELIX   48 AF3 THR L  104  ARG L  108  5                                   5    
HELIX   49 AF4 PHE L  112  LEU L  118  1                                   7    
HELIX   50 AF5 PRO M   56  LEU M   61  1                                   6    
HELIX   51 AF6 SER M   68  ALA M   72  5                                   5    
HELIX   52 AF7 SER M   80  LYS M   84  5                                   5    
HELIX   53 AF8 ASP M   91  ALA M   98  1                                   8    
HELIX   54 AF9 THR M  128  GLU M  136  1                                   9    
HELIX   55 AG1 ALA N   43  VAL N   57  1                                  15    
HELIX   56 AG2 PRO N  109  ALA N  122  1                                  14    
HELIX   57 AG3 ASN O   13  HIS O   31  1                                  19    
HELIX   58 AG4 LEU O   38  LYS O   56  1                                  19    
HELIX   59 AG5 SER O   59  ARG O   71  1                                  13    
HELIX   60 AG6 ASP O   72  GLU O   82  1                                  11    
HELIX   61 AG7 GLU O   82  PHE O   87  1                                   6    
HELIX   62 AG8 ASP O  117  ALA O  125  1                                   9    
HELIX   63 AG9 ASP P    2  GLY P   22  1                                  21    
HELIX   64 AH1 GLU P   55  GLU P   60  1                                   6    
HELIX   65 AH2 ASN P   67  GLU P   84  1                                  18    
HELIX   66 AH3 HIS P  100  ALA P  113  1                                  14    
HELIX   67 AH4 ASN Q    3  GLN Q   10  1                                   8    
HELIX   68 AH5 ARG Q   53  HIS Q   56  5                                   4    
HELIX   69 AH6 LEU Q   97  GLU Q  102  5                                   6    
HELIX   70 AH7 THR Q  104  ARG Q  109  5                                   6    
HELIX   71 AH8 ARG R    6  ALA R   21  1                                  16    
HELIX   72 AH9 TYR R   25  ARG R   30  5                                   6    
HELIX   73 AI1 VAL R   31  ASN R   72  1                                  42    
HELIX   74 AI2 SER R   75  ALA R   86  1                                  12    
HELIX   75 AI3 ASP R   91  ASP R  102  1                                  12    
HELIX   76 AI4 ASP R  102  LEU R  117  1                                  16    
HELIX   77 AI5 SER T   13  ASP T   22  1                                  10    
HELIX   78 AI6 LYS T   28  THR T   39  1                                  12    
HELIX   79 AI7 LYS T   41  GLY T   63  1                                  23    
HELIX   80 AI8 ASP T   65  LEU T   69  5                                   5    
HELIX   81 AI9 ALA T   89  GLY T   91  5                                   3    
HELIX   82 AJ1 ARG U    3  LEU U    8  1                                   6    
HELIX   83 AJ2 SER U   17  ASN U   28  1                                  12    
HELIX   84 AJ3 THR U   39  PHE U   51  1                                  13    
HELIX   85 AJ4 GLY W   13  ALA W   23  1                                  11    
HELIX   86 AJ5 HIS W   44  GLN W   51  1                                   8    
HELIX   87 AJ6 ALA W   54  GLU W   59  1                                   6    
HELIX   88 AJ7 ALA Y   53  GLY Y   63  1                                  11    
HELIX   89 AJ8 GLY Y   63  GLY Y   75  1                                  13    
HELIX   90 AJ9 SER Z   10  GLY Z   35  1                                  26    
HELIX   91 AK1 SER Z   40  ALA Z   63  1                                  24    
HELIX   92 AK2 LEU a   17  GLY a   28  1                                  12    
HELIX   93 AK3 THR a   41  SER a   52  1                                  12    
HELIX   94 AK4 THR b    9  ARG b   17  1                                   9    
HELIX   95 AK5 SER b   18  ALA b   21  5                                   4    
HELIX   96 AK6 SER d    8  GLY d   17  1                                  10    
HELIX   97 AK7 GLY d   17  MET d   22  1                                   6    
HELIX   98 AK8 THR d   24  LYS d   37  1                                  14    
HELIX   99 AK9 VAL e    7  PHE e   14  1                                   8    
HELIX  100 AL1 ALA e   37  ARG e   45  1                                   9    
HELIX  101 AL2 ASP e   54  LEU e   62  1                                   9    
HELIX  102 AL3 GLU f   30  HIS f   33  5                                   4    
HELIX  103 AL4 ASN i  332  GLY i  345  1                                  14    
HELIX  104 AL5 GLY i  346  UNK i  351  1                                   6    
HELIX  105 AL6 UNK i  368  SER i  382  1                                  15    
HELIX  106 AL7 THR i  384  ALA i  389  1                                   6    
HELIX  107 AL8 LYS i  395  CYS i  406  1                                  12    
HELIX  108 AL9 GLN i  409  GLY i  433  1                                  25    
HELIX  109 AM1 GLY i  434  UNK i  441  1                                   8    
HELIX  110 AM2 LYS k   28  THR k   42  1                                  15    
SHEET    1 AA1 2 VAL C   3  LYS C   5  0                                        
SHEET    2 AA1 2 VAL C  17  VAL C  19 -1  O  LYS C  18   N  VAL C   4           
SHEET    1 AA2 2 LEU C  34  GLU C  35  0                                        
SHEET    2 AA2 2 TYR C  62  ARG C  63 -1  O  TYR C  62   N  GLU C  35           
SHEET    1 AA3 4 ARG C 101  LEU C 105  0                                        
SHEET    2 AA3 4 ILE C  91  TYR C  96 -1  N  VAL C  94   O  ARG C 102           
SHEET    3 AA3 4 ALA C  76  GLU C  82 -1  N  VAL C  77   O  LEU C  95           
SHEET    4 AA3 4 GLN C 115  ILE C 116 -1  O  ILE C 116   N  ALA C  76           
SHEET    1 AA4 7 THR C 129  PRO C 131  0                                        
SHEET    2 AA4 7 ARG C 189  LEU C 192 -1  O  ALA C 190   N  LEU C 130           
SHEET    3 AA4 7 THR C 140  HIS C 142 -1  N  HIS C 142   O  THR C 191           
SHEET    4 AA4 7 VAL C 162  ASP C 168 -1  O  VAL C 162   N  VAL C 141           
SHEET    5 AA4 7 TYR C 171  ARG C 175 -1  O  TYR C 171   N  ASP C 168           
SHEET    6 AA4 7 MET C 181  GLU C 185 -1  O  VAL C 184   N  VAL C 172           
SHEET    7 AA4 7 ILE C 267  ARG C 269 -1  O  VAL C 268   N  MET C 181           
SHEET    1 AA5 2 VAL C 144  GLU C 145  0                                        
SHEET    2 AA5 2 GLY C 152  LEU C 154 -1  O  GLN C 153   N  VAL C 144           
SHEET    1 AA6 7 LEU D   4  PHE D  15  0                                        
SHEET    2 AA6 7 SER D  21  GLU D  28 -1  O  ILE D  22   N  ILE D  14           
SHEET    3 AA6 7 LEU D 186  LYS D 190 -1  O  LEU D 187   N  ILE D  27           
SHEET    4 AA6 7 ARG D 169  ASP D 181 -1  N  ASP D 181   O  LEU D 186           
SHEET    5 AA6 7 LYS D 106  THR D 112 -1  N  VAL D 109   O  VAL D 172           
SHEET    6 AA6 7 ASP D 200  PRO D 205 -1  O  LYS D 204   N  ASP D 108           
SHEET    7 AA6 7 LEU D   4  PHE D  15 -1  N  LEU D   4   O  VAL D 203           
SHEET    1 AA7 4 TRP D  80  ARG D  83  0                                        
SHEET    2 AA7 4 ALA D  47  THR D  51 -1  N  VAL D  50   O  TRP D  80           
SHEET    3 AA7 4 ASN D  32  LYS D  38 -1  N  GLN D  36   O  GLN D  49           
SHEET    4 AA7 4 SER D  95  ILE D  96 -1  O  ILE D  96   N  ASN D  32           
SHEET    1 AA8 2 PHE D 118  ALA D 119  0                                        
SHEET    2 AA8 2 GLY D 163  GLN D 164 -1  O  GLY D 163   N  ALA D 119           
SHEET    1 AA9 2 GLU E   2  VAL E   4  0                                        
SHEET    2 AA9 2 ALA E  11  THR E  13 -1  O  LEU E  12   N  LEU E   3           
SHEET    1 AB1 4 LEU E 118  VAL E 121  0                                        
SHEET    2 AB1 4 LYS E 185  THR E 189  1  O  MET E 188   N  VAL E 121           
SHEET    3 AB1 4 VAL E 146  THR E 150  1  N  ILE E 149   O  VAL E 187           
SHEET    4 AB1 4 VAL E 167  ASP E 171  1  O  ARG E 170   N  ILE E 148           
SHEET    1 AB2 5 LEU F  66  LYS F  69  0                                        
SHEET    2 AB2 5 PRO F  84  ARG F  92 -1  O  LYS F  88   N  LEU F  66           
SHEET    3 AB2 5 VAL F  31  GLY F  39 -1  N  ILE F  34   O  LEU F  91           
SHEET    4 AB2 5 LEU F 152  THR F 158 -1  O  THR F 155   N  THR F  35           
SHEET    5 AB2 5 TYR F 128  VAL F 132 -1  N  MET F 130   O  ILE F 154           
SHEET    1 AB3 3 ASP G  16  ASN G  20  0                                        
SHEET    2 AB3 3 VAL G  23  GLY G  28 -1  O  VAL G  23   N  ASN G  20           
SHEET    3 AB3 3 GLY G  31  THR G  36 -1  O  LEU G  33   N  ILE G  26           
SHEET    1 AB4 2 VAL G  41  HIS G  45  0                                        
SHEET    2 AB4 2 LEU G  50  PRO G  54 -1  O  GLY G  53   N  GLU G  42           
SHEET    1 AB5 4 THR G 122  GLU G 124  0                                        
SHEET    2 AB5 4 GLU G 130  GLY G 135 -1  O  LYS G 134   N  THR G 122           
SHEET    3 AB5 4 PHE G  83  VAL G  90 -1  N  LEU G  87   O  ILE G 131           
SHEET    4 AB5 4 GLY G 161  TYR G 164 -1  O  GLY G 161   N  VAL G  90           
SHEET    1 AB6 3 ARG G  95  LYS G  99  0                                        
SHEET    2 AB6 3 VAL G 102  SER G 106 -1  O  VAL G 102   N  LYS G  99           
SHEET    3 AB6 3 VAL G 113  GLN G 116 -1  O  HIS G 115   N  ILE G 103           
SHEET    1 AB7 3 GLN H  18  ASN H  20  0                                        
SHEET    2 AB7 3 GLN H   2  ILE H   4 -1  N  VAL H   3   O  VAL H  19           
SHEET    3 AB7 3 VAL H  37  PRO H  38 -1  O  VAL H  37   N  ILE H   4           
SHEET    1 AB8 4 THR H  77  SER H  82  0                                        
SHEET    2 AB8 4 PHE H 139  ALA H 148  1  O  ASN H 145   N  VAL H  78           
SHEET    3 AB8 4 GLU H 127  GLN H 133 -1  N  HIS H 128   O  VAL H 144           
SHEET    4 AB8 4 VAL H 115  ARG H 116 -1  N  ARG H 116   O  SER H 131           
SHEET    1 AB9 5 VAL I  50  VAL I  54  0                                        
SHEET    2 AB9 5 LEU I  81  VAL I  85 -1  O  ILE I  82   N  ARG I  53           
SHEET    3 AB9 5 SER I  24  ALA I  28 -1  N  SER I  24   O  VAL I  85           
SHEET    4 AB9 5 ALA I 110  PHE I 113 -1  O  ALA I 112   N  ALA I  25           
SHEET    5 AB9 5 GLU I 116  ILE I 118 -1  O  ILE I 118   N  ALA I 111           
SHEET    1 AC1 3 VAL J   9  ALA J  14  0                                        
SHEET    2 AC1 3 PRO J  54  VAL J  61 -1  O  ILE J  55   N  VAL J  13           
SHEET    3 AC1 3 PHE J  67  THR J  71 -1  O  VAL J  70   N  VAL J  58           
SHEET    1 AC2 2 LYS J 100  ILE J 101  0                                        
SHEET    2 AC2 2 VAL J 139  VAL J 140  1  O  VAL J 139   N  ILE J 101           
SHEET    1 AC3 4 LEU K 122  VAL K 124  0                                        
SHEET    2 AC3 4 TYR K  53  LEU K  57  1  N  ILE K  54   O  LYS K 123           
SHEET    3 AC3 4 TRP K  15  ASP K  19  1  N  VAL K  18   O  ILE K  55           
SHEET    4 AC3 4 GLN K 138  VAL K 139  1  O  GLN K 138   N  TRP K  15           
SHEET    1 AC4 2 VAL K  73  HIS K  77  0                                        
SHEET    2 AC4 2 ILE K  84  THR K  88 -1  O  ALA K  87   N  TYR K  74           
SHEET    1 AC5 6 MET L   7  VAL L  10  0                                        
SHEET    2 AC5 6 ARG L  18  VAL L  24 -1  O  VAL L  19   N  LEU L   8           
SHEET    3 AC5 6 ILE L  38  ILE L  43 -1  O  THR L  42   N  MET L  20           
SHEET    4 AC5 6 VAL L  57  ARG L  64 -1  O  LEU L  58   N  ILE L  41           
SHEET    5 AC5 6 ALA L  83  LEU L  87 -1  O  VAL L  85   N  VAL L  61           
SHEET    6 AC5 6 MET L   7  VAL L  10  1  N  ASN L   9   O  CYS L  84           
SHEET    1 AC6 7 VAL L  69  ARG L  70  0                                        
SHEET    2 AC6 7 VAL L  76  PHE L  79 -1  O  ILE L  77   N  VAL L  69           
SHEET    3 AC6 7 GLU Q  68  GLN Q  75 -1  O  VAL Q  73   N  VAL L  76           
SHEET    4 AC6 7 ALA Q  58  SER Q  65 -1  N  PHE Q  59   O  PHE Q  74           
SHEET    5 AC6 7 LYS Q  37  ARG Q  51 -1  N  VAL Q  46   O  ARG Q  62           
SHEET    6 AC6 7 THR Q  25  GLU Q  34 -1  N  VAL Q  26   O  GLY Q  45           
SHEET    7 AC6 7 VAL Q  81  ARG Q  88 -1  O  SER Q  85   N  GLU Q  27           
SHEET    1 AC7 2 PRO L 102  VAL L 103  0                                        
SHEET    2 AC7 2 GLU L 121  VAL L 122  1  O  GLU L 121   N  VAL L 103           
SHEET    1 AC8 3 THR M  74  ARG M  78  0                                        
SHEET    2 AC8 3 PHE M 107  ILE M 111  1  O  LYS M 109   N  ILE M  77           
SHEET    3 AC8 3 ARG M 126  VAL M 127  1  O  ARG M 126   N  VAL M 110           
SHEET    1 AC9 3 VAL M  89  VAL M  90  0                                        
SHEET    2 AC9 3 THR M 121  ARG M 123  1  O  THR M 121   N  VAL M  90           
SHEET    3 AC9 3 LYS M 141  GLU M 143  1  O  GLU M 143   N  VAL M 122           
SHEET    1 AD1 4 LYS N  62  ILE N  65  0                                        
SHEET    2 AD1 4 VAL N 101  ASP N 106 -1  O  ASP N 106   N  LYS N  62           
SHEET    3 AD1 4 PHE N  31  ALA N  35 -1  N  PHE N  31   O  MET N 105           
SHEET    4 AD1 4 THR N 128  THR N 132 -1  O  THR N 129   N  LYS N  34           
SHEET    1 AD2 3 GLY N  39  THR N  42  0                                        
SHEET    2 AD2 3 ASN N  88  ILE N  96 -1  O  ALA N  94   N  LEU N  41           
SHEET    3 AD2 3 LYS N  71  GLU N  75 -1  N  LYS N  71   O  VAL N  93           
SHEET    1 AD3 3 ILE O  33  THR O  37  0                                        
SHEET    2 AD3 3 PRO O 109  LEU O 115 -1  O  ALA O 111   N  THR O  36           
SHEET    3 AD3 3 THR O  95  PHE O 102 -1  N  ARG O  96   O  GLU O 114           
SHEET    1 AD4 4 VAL P  47  SER P  52  0                                        
SHEET    2 AD4 4 ILE P  35  ILE P  40 -1  N  VAL P  39   O  VAL P  49           
SHEET    3 AD4 4 ARG P  25  ARG P  30 -1  N  VAL P  27   O  GLN P  38           
SHEET    4 AD4 4 SER P  91  ASP P  93  1  O  ASP P  93   N  LEU P  26           
SHEET    1 AD5 4 LYS S  10  VAL S  14  0                                        
SHEET    2 AD5 4 TYR S   2  SER S   7 -1  N  SER S   7   O  LYS S  10           
SHEET    3 AD5 4 VAL S  38  ASN S  43 -1  O  MET S  40   N  VAL S   4           
SHEET    4 AD5 4 GLU S  46  ILE S  49 -1  O  LYS S  48   N  ILE S  41           
SHEET    1 AD6 4 THR S  19  GLU S  23  0                                        
SHEET    2 AD6 4 TRP S  92  SER S 102 -1  O  VAL S  96   N  VAL S  20           
SHEET    3 AD6 4 VAL S  58  ARG S  68 -1  N  VAL S  58   O  SER S 102           
SHEET    4 AD6 4 THR S  32  PHE S  35 -1  N  PHE S  35   O  ILE S  59           
SHEET    1 AD7 2 VAL S  72  ARG S  78  0                                        
SHEET    2 AD7 2 TYR S  83  HIS S  89 -1  O  LYS S  85   N  LYS S  76           
SHEET    1 AD8 3 GLU T   2  ARG T  11  0                                        
SHEET    2 AD8 3 THR T 100  SER T 108 -1  O  VAL T 105   N  ALA T   5           
SHEET    3 AD8 3 LYS T  70  ASP T  77 -1  N  PHE T  75   O  THR T 104           
SHEET    1 AD9 2 MET T  82  PRO T  87  0                                        
SHEET    2 AD9 2 ALA T  93  LYS T  98 -1  O  ASP T  94   N  MET T  86           
SHEET    1 AE1 4 LEU U  11  PRO U  14  0                                        
SHEET    2 AE1 4 THR U  29  VAL U  34 -1  O  LYS U  33   N  ALA U  13           
SHEET    3 AE1 4 TRP U  80  LEU U  87 -1  O  LYS U  81   N  VAL U  34           
SHEET    4 AE1 4 VAL U  55  VAL U  63 -1  N  GLU U  56   O  THR U  86           
SHEET    1 AE2 2 VAL U  67  HIS U  70  0                                        
SHEET    2 AE2 2 ARG U  73  ARG U  76 -1  O  GLY U  75   N  LYS U  68           
SHEET    1 AE3 6 ILE V  65  GLN V  66  0                                        
SHEET    2 AE3 6 LYS V  33  VAL V  36 -1  N  VAL V  34   O  ILE V  65           
SHEET    3 AE3 6 ARG V  22  LEU V  29 -1  N  LEU V  29   O  LYS V  33           
SHEET    4 AE3 6 GLU V  10  VAL V  13 -1  N  VAL V  11   O  GLY V  23           
SHEET    5 AE3 6 VAL V  70  ASN V  74 -1  O  ALA V  71   N  ILE V  12           
SHEET    6 AE3 6 LYS V  79  ALA V  80 -1  O  LYS V  79   N  ASN V  74           
SHEET    1 AE4 2 LEU V  41  GLN V  46  0                                        
SHEET    2 AE4 2 GLY V  57  GLU V  62 -1  O  VAL V  59   N  LYS V  44           
SHEET    1 AE5 2 VAL V  83  GLU V  88  0                                        
SHEET    2 AE5 2 LYS V  91  PHE V  96 -1  O  LYS V  91   N  GLU V  88           
SHEET    1 AE6 7 THR W   3  VAL W   8  0                                        
SHEET    2 AE6 7 LEU W  38  ASP W  43 -1  O  GLU W  41   N  GLU W   7           
SHEET    3 AE6 7 LYS W  25  TYR W  31 -1  N  ILE W  30   O  LEU W  38           
SHEET    4 AE6 7 LEU W  86  ARG W  93  1  O  PHE W  91   N  TYR W  31           
SHEET    5 AE6 7 LYS W  68  ARG W  79 -1  N  ASP W  76   O  ASP W  90           
SHEET    6 AE6 7 VAL W  60  VAL W  65 -1  N  VAL W  65   O  LYS W  68           
SHEET    7 AE6 7 THR W   3  VAL W   8  1  N  ILE W   4   O  VAL W  64           
SHEET    1 AE7 4 GLY X  22  VAL X  23  0                                        
SHEET    2 AE7 4 ILE X  36  ARG X  39 -1  O  ARG X  39   N  GLY X  22           
SHEET    3 AE7 4 LEU X  59  ALA X  61 -1  O  LEU X  59   N  ILE X  37           
SHEET    4 AE7 4 VAL X  51  CYS X  53 -1  N  GLY X  52   O  PHE X  60           
SHEET    1 AE8 4 SER X  30  VAL X  31  0                                        
SHEET    2 AE8 4 GLY X  65  LYS X  72 -1  O  GLY X  65   N  VAL X  31           
SHEET    3 AE8 4 ARG X  77  GLU X  83 -1  O  PHE X  79   N  GLU X  70           
SHEET    4 AE8 4 HIS X  46  ALA X  47  1  N  HIS X  46   O  ILE X  80           
SHEET    1 AE9 2 VAL Y  13  ARG Y  18  0                                        
SHEET    2 AE9 2 ALA Y  24  PHE Y  29 -1  O  ARG Y  27   N  GLY Y  15           
SHEET    1 AF1 2 LEU Y  33  VAL Y  40  0                                        
SHEET    2 AF1 2 ARG Y  45  SER Y  52 -1  O  VAL Y  47   N  PHE Y  38           
SHEET    1 AF2 3 THR a  35  GLU a  39  0                                        
SHEET    2 AF2 3 THR a   4  GLN a   9 -1  N  ILE a   5   O  ARG a  38           
SHEET    3 AF2 3 VAL a  55  GLU a  58 -1  O  GLU a  58   N  LYS a   6           
SHEET    1 AF3 2 SER b  29  VAL b  30  0                                        
SHEET    2 AF3 2 LYS b  37  HIS b  38 -1  O  HIS b  38   N  SER b  29           
SHEET    1 AF4 2 TYR b  48  TYR b  49  0                                        
SHEET    2 AF4 2 ARG b  52  LYS b  53 -1  O  ARG b  52   N  TYR b  49           
SHEET    1 AF5 4 PHE c  20  LYS c  25  0                                        
SHEET    2 AF5 4 GLU c   7  SER c  13 -1  N  ILE c   9   O  THR c  23           
SHEET    3 AF5 4 GLN c  45  LYS c  53 -1  O  ALA c  52   N  LYS c  10           
SHEET    4 AF5 4 LEU c  36  ASP c  40 -1  N  LYS c  38   O  VAL c  47           
SHEET    1 AF6 3 LYS e  15  LYS e  16  0                                        
SHEET    2 AF6 3 PHE e  22  HIS e  24 -1  O  LYS e  23   N  LYS e  15           
SHEET    3 AF6 3 ALA e  48  MET e  49 -1  O  ALA e  48   N  HIS e  24           
SHEET    1 AF7 4 LYS f   2  ARG f   4  0                                        
SHEET    2 AF7 4 GLN f  35  GLN f  37  1  O  ARG f  36   N  LYS f   2           
SHEET    3 AF7 4 VAL f  22  CYS f  27 -1  N  ILE f  23   O  GLN f  37           
SHEET    4 AF7 4 CYS f  14  ARG f  19 -1  N  LYS f  15   O  ILE f  26           
LINK         OP1   A 2  76                MG    MG 2 101     1555   1555  2.46  
LINK         OP1   C A  31                MG    MG A3088     1555   1555  2.47  
LINK         OP2   A A  64                MG    MG A3344     1555   1555  2.55  
LINK         OP1   U A 120                MG    MG A3003     1555   1555  2.07  
LINK         OP2   U A 120                MG    MG A3002     1555   1555  1.97  
LINK         OP2   C A 163                MG    MG A3134     1555   1555  2.66  
LINK         OP2   C A 164                MG    MG A3134     1555   1555  2.76  
LINK         OP1   C A 192                MG    MG A3095     1555   1555  2.07  
LINK         OP2   C A 192                MG    MG A3271     1555   1555  2.51  
LINK         OP1   A A 197                MG    MG A3098     1555   1555  2.23  
LINK         OP2   C A 198                MG    MG A3098     1555   1555  2.40  
LINK         OP2   G A 214                MG    MG A3114     1555   1555  2.99  
LINK         OP2   A A 218                MG    MG A3004     1555   1555  2.86  
LINK         OP2   G A 248                MG    MG A3353     1555   1555  2.84  
LINK         O4    U A 284                MG    MG A3377     1555   1555  2.59  
LINK         O6    G A 285                MG    MG A3377     1555   1555  2.78  
LINK         O4    U A 290                MG    MG A3378     1555   1555  1.89  
LINK         OP2   G A 297                MG    MG A3202     1555   1555  2.42  
LINK         OP2   A A 299                MG    MG A3065     1555   1555  2.43  
LINK         O4    U A 355                MG    MG A3377     1555   1555  2.06  
LINK         O6    G A 356                MG    MG A3377     1555   1555  2.83  
LINK         OP2   G A 370                MG    MG A3066     1555   1555  1.84  
LINK         OP1   G A 375                MG    MG A3133     1555   1555  1.90  
LINK         OP1   C A 393                MG    MG A3133     1555   1555  2.76  
LINK         O4    U A 403                MG    MG A3321     1555   1555  2.62  
LINK         OP2   G A 410                MG    MG A3295     1555   1555  2.75  
LINK         OP1   G A 411                MG    MG A3067     1555   1555  2.08  
LINK         OP1   U A 419                MG    MG A3005     1555   1555  2.34  
LINK         OP2   A A 422                MG    MG A3066     1555   1555  1.80  
LINK         OP2   G A 446                MG    MG A3186     1555   1555  2.46  
LINK         OP2   G A 450                MG    MG A3006     1555   1555  2.10  
LINK         O6    G A 450                MG    MG A3007     1555   1555  2.17  
LINK         O4'   G A 452                MG    MG A3302     1555   1555  2.94  
LINK         O3'   G A 452                MG    MG A3225     1555   1555  2.78  
LINK         OP1   A A 453                MG    MG A3225     1555   1555  2.09  
LINK         OP1   A A 453                MG    MG A3007     1555   1555  2.59  
LINK         OP2   A A 470                MG    MG A3302     1555   1555  2.57  
LINK         OP1   A A 471                MG    MG A3225     1555   1555  3.00  
LINK         OP2   A A 505                MG    MG A3147     1555   1555  2.95  
LINK         OP1   C A 509                MG    MG A3400     1555   1555  2.28  
LINK         OP1   C A 510                MG    MG A3101     1555   1555  2.21  
LINK         OP2   U A 511                MG    MG A3101     1555   1555  2.65  
LINK         OP2   A A 514                MG    MG A3276     1555   1555  2.92  
LINK         OP1   A A 526                MG    MG A3008     1555   1555  2.02  
LINK         OP1   C A 527                MG    MG A3008     1555   1555  2.30  
LINK         O6    G A 530                MG    MG A3264     1555   1555  2.84  
LINK         OP2   G A 536                MG    MG A3345     1555   1555  2.88  
LINK         OP2   G A 543                MG    MG A3379     1555   1555  2.09  
LINK         O6    G A 551                MG    MG A3401     1555   1555  2.56  
LINK         O4    U A 558                MG    MG A3216     1555   1555  2.17  
LINK         OP1   U A 567                MG    MG A3010     1555   1555  2.28  
LINK         O6    G A 570                MG    MG A3085     1555   1555  2.01  
LINK         OP1   A A 572                MG    MG A3068     1555   1555  2.15  
LINK         OP1   A A 574                MG    MG A3012     1555   1555  2.81  
LINK         OP2   A A 574                MG    MG A3012     1555   1555  2.50  
LINK         OP1   U A 576                MG    MG A3082     1555   1555  2.06  
LINK         OP2   G A 578                MG    MG A3107     1555   1555  1.98  
LINK         OP2   A A 586                MG    MG A3177     1555   1555  2.92  
LINK         O4    U A 594                MG    MG A3257     1555   1555  2.85  
LINK         O6    G A 597                MG    MG A3142     1555   1555  2.66  
LINK         O4    U A 598                MG    MG A3142     1555   1555  2.96  
LINK         OP1   G A 622                MG    MG A3016     1555   1555  2.79  
LINK         O6    G A 638                MG    MG A3331     1555   1555  2.55  
LINK         O6    G A 649                MG    MG A3331     1555   1555  2.81  
LINK         O6    G A 656                MG    MG A3262     1555   1555  3.00  
LINK         O6    G A 662                MG    MG A3257     1555   1555  2.99  
LINK         OP1   A A 670                MG    MG A3188     1555   1555  2.93  
LINK         OP2   A A 670                MG    MG A3407     1555   1555  2.94  
LINK         OP2   U A 686                MG    MG A3091     1555   1555  2.74  
LINK         O6    G A 695                MG    MG A3341     1555   1555  2.54  
LINK         OP2   C A 698                MG    MG A3309     1555   1555  2.94  
LINK         O6    G A 711                MG    MG A3334     1555   1555  2.77  
LINK         O6    G A 712                MG    MG A3334     1555   1555  2.42  
LINK         OP1   C A 737                MG    MG A3337     1555   1555  2.49  
LINK         OP1   A A 739                MG    MG A3178     1555   1555  2.83  
LINK         OP2   C A 740                MG    MG A3087     1555   1555  1.99  
LINK         O4    U A 746                MG    MG A3019     1555   1555  1.92  
LINK         OP1   A A 751                MG    MG A3020     1555   1555  1.81  
LINK         OP1   G A 760                MG    MG A3203     1555   1555  2.65  
LINK         O4    U A 767                MG    MG A3341     1555   1555  2.63  
LINK         OP2   G A 776                MG    MG A3367     1555   1555  2.61  
LINK         OP2   A A 783                MG    MG A3021     1555   1555  2.57  
LINK         OP1   G A 784                MG    MG A3022     1555   1555  2.50  
LINK         OP2   G A 784                MG    MG A3021     1555   1555  2.29  
LINK         OP1   C A 787                MG    MG A3174     1555   1555  1.79  
LINK         OP2   U A 790                MG    MG A3174     1555   1555  1.84  
LINK         OP1   A A 800                MG    MG A3023     1555   1555  2.19  
LINK         OP1   A A 802                MG    MG A3024     1555   1555  2.12  
LINK         OP1   U A 810                MG    MG A3025     1555   1555  2.45  
LINK         OP2   G A 818                MG    MG A3070     1555   1555  2.55  
LINK         OP1   U A 827                MG    MG A3027     1555   1555  1.86  
LINK         OP2   U A 827                MG    MG A3213     1555   1555  2.77  
LINK         O2'   G A 830                MG    MG A3166     1555   1555  2.46  
LINK         O6    G A 834                MG    MG A3297     1555   1555  2.59  
LINK         OP2   C A 835                MG    MG A3409     1555   1555  2.80  
LINK         OP2   G A 862                MG    MG A3093     1555   1555  1.94  
LINK         O2'   C A 865                MG    MG A3237     1555   1555  2.93  
LINK         O6    G A 869                MG    MG A3236     1555   1555  2.27  
LINK         O4    U A 870                MG    MG A3236     1555   1555  2.65  
LINK         OP1   A A 911                MG    MG A3300     1555   1555  2.67  
LINK         OP2   A A 943                MG    MG A3105     1555   1555  2.10  
LINK         OP1   A A 945                MG    MG A3029     1555   1555  1.97  
LINK         OP2   A A 945                MG    MG A3028     1555   1555  2.41  
LINK         OP2   C A 946                MG    MG A3028     1555   1555  2.04  
LINK         OP1   C A 948                MG    MG A3030     1555   1555  1.97  
LINK         O6    G A 949                MG    MG A3211     1555   1555  2.69  
LINK         O6    G A 950                MG    MG A3211     1555   1555  2.93  
LINK         OP1   G A 953                MG    MG A3228     1555   1555  2.45  
LINK         O5'   G A 953                MG    MG A3228     1555   1555  2.80  
LINK         OP1   G A 962                MG    MG A3030     1555   1555  2.27  
LINK         OP1   U A 963                MG    MG A3108     1555   1555  2.08  
LINK         OP2   U A 963                MG    MG A3030     1555   1555  2.02  
LINK         O4    U A 963                MG    MG A3283     1555   1555  2.89  
LINK         OP2   A A 975                MG    MG A3168     1555   1555  2.47  
LINK         OP1   A A 980                MG    MG A3195     1555   1555  2.77  
LINK         OP1   A A 981                MG    MG A3071     1555   1555  2.03  
LINK         OP2   A A 990                MG    MG A3072     1555   1555  1.83  
LINK         OP2   C A 991                MG    MG A3072     1555   1555  2.59  
LINK         OP2   U A 999                MG    MG A3169     1555   1555  2.20  
LINK         OP2   A A1009                MG    MG A3103     1555   1555  2.26  
LINK         OP2   A A1010                MG    MG A3103     1555   1555  2.07  
LINK         OP2   C A1013                MG    MG A3224     1555   1555  1.92  
LINK         OP2   A A1014                MG    MG A3224     1555   1555  2.62  
LINK         OP2   U A1023                MG    MG A3212     1555   1555  1.79  
LINK         O2'   G A1025                MG    MG A3212     1555   1555  2.02  
LINK         OP2   G A1124                MG    MG A3137     1555   1555  2.74  
LINK         OP1   U A1132                MG    MG A3200     1555   1555  2.43  
LINK         OP2   C A1153                MG    MG A3169     1555   1555  2.22  
LINK         OP2   A A1156                MG    MG A3031     1555   1555  2.02  
LINK         OP2   G A1186                MG    MG A3072     1555   1555  2.30  
LINK         OP2   G A1187                MG    MG A3183     1555   1555  2.15  
LINK         O6    G A1187                MG    MG A3070     1555   1555  1.96  
LINK         OP2   A A1189                MG    MG A3173     1555   1555  1.92  
LINK         O4    U A1203                MG    MG A3360     1555   1555  2.65  
LINK         OP1   G A1235                MG    MG A3147     1555   1555  2.96  
LINK         O6    G A1235                MG    MG A3370     1555   1555  2.84  
LINK         OP1   A A1237                MG    MG A3199     1555   1555  2.45  
LINK         OP2   A A1237                MG    MG A3115     1555   1555  2.26  
LINK         OP1   U A1249                MG    MG A3177     1555   1555  2.29  
LINK         OP1   G A1250                MG    MG A3177     1555   1555  2.40  
LINK         O4    U A1263                MG    MG A3180     1555   1555  2.15  
LINK         OP2   A A1265                MG    MG A3097     1555   1555  2.45  
LINK         O2'   A A1265                MG    MG A3235     1555   1555  2.65  
LINK         OP1   A A1268                MG    MG A3033     1555   1555  2.47  
LINK         OP2   A A1269                MG    MG A3034     1555   1555  1.90  
LINK         OP2   G A1271                MG    MG A3035     1555   1555  2.40  
LINK         OP1   A A1272                MG    MG A3035     1555   1555  1.84  
LINK         OP2   C A1298                MG    MG A3171     1555   1555  2.00  
LINK         OP2   G A1303                MG    MG A3140     1555   1555  2.97  
LINK         OP1   U A1313                MG    MG A3036     1555   1555  2.29  
LINK         OP1   C A1314                MG    MG A3099     1555   1555  2.28  
LINK         OP2   C A1315                MG    MG A3099     1555   1555  2.01  
LINK         O4    U A1318                MG    MG A3343     1555   1555  2.58  
LINK         O2    U A1326                MG    MG A3319     1555   1555  2.92  
LINK         OP2   A A1327                MG    MG A3073     1555   1555  1.98  
LINK         OP1   A A1328                MG    MG A3132     1555   1555  2.01  
LINK         OP2   G A1331                MG    MG A3343     1555   1555  2.98  
LINK         OP1   G A1332                MG    MG A3099     1555   1555  1.88  
LINK         OP2   G A1333                MG    MG A3037     1555   1555  1.95  
LINK         OP2   A A1342                MG    MG A3090     1555   1555  2.12  
LINK         OP2   G A1346                MG    MG A3247     1555   1555  2.30  
LINK         O6    G A1355                MG    MG A3265     1555   1555  2.53  
LINK         OP1   A A1359                MG    MG A3074     1555   1555  2.41  
LINK         OP2   G A1360                MG    MG A3074     1555   1555  2.07  
LINK         OP1   C A1376                MG    MG A3128     1555   1555  2.02  
LINK         OP2   U A1379                MG    MG A3138     1555   1555  1.81  
LINK         OP2   G A1380                MG    MG A3138     1555   1555  2.75  
LINK         OP1   U A1394                MG    MG A3040     1555   1555  2.09  
LINK         OP1   A A1395                MG    MG A3041     1555   1555  1.96  
LINK         O5'   A A1395                MG    MG A3193     1555   1555  2.70  
LINK         OP1   C A1398                MG    MG A3119     1555   1555  2.40  
LINK         OP2   A A1439                MG    MG A3076     1555   1555  2.49  
LINK         O4    U A1440                MG    MG A3076     1555   1555  2.44  
LINK         O4    U A1602                MG    MG A3090     1555   1555  2.06  
LINK         OP1   A A1603                MG    MG A3193     1555   1555  2.77  
LINK         OP1   A A1603                MG    MG A3041     1555   1555  2.49  
LINK         OP1   C A1604                MG    MG A3040     1555   1555  2.64  
LINK         OP2   C A1604                MG    MG A3041     1555   1555  1.97  
LINK         OP1   C A1607                MG    MG A3140     1555   1555  2.94  
LINK         OP1   A A1614                MG    MG A3020     1555   1555  1.81  
LINK         OP1   G A1622                MG    MG A3336     1555   1555  2.94  
LINK         OP2   G A1622                MG    MG A3336     1555   1555  3.00  
LINK         OP2   U A1636                MG    MG A3079     1555   1555  2.10  
LINK         OP1   C A1639                MG    MG A3175     1555   1555  2.48  
LINK         OP2   C A1639                MG    MG A3171     1555   1555  2.75  
LINK         OP2   A A1641                MG    MG A3232     1555   1555  2.71  
LINK         OP1   U A1647                MG    MG A3035     1555   1555  2.18  
LINK         OP2   U A1647                MG    MG A3042     1555   1555  2.19  
LINK         OP1   U A1648                MG    MG A3035     1555   1555  1.94  
LINK         OP1   C A1658                MG    MG A3163     1555   1555  1.84  
LINK         OP2   U A1662                MG    MG A3294     1555   1555  2.40  
LINK         OP1   A A1664                MG    MG A3110     1555   1555  2.98  
LINK         OP2   A A1664                MG    MG A3043     1555   1555  2.10  
LINK         OP2   A A1665                MG    MG A3110     1555   1555  2.23  
LINK         OP2   A A1669                MG    MG A3092     1555   1555  2.21  
LINK         OP1   C A1670                MG    MG A3045     1555   1555  2.11  
LINK         OP2   C A1670                MG    MG A3092     1555   1555  2.14  
LINK         OP2   U A1671                MG    MG A3045     1555   1555  2.43  
LINK         O4    U A1671                MG    MG A3092     1555   1555  2.35  
LINK         OP1   G A1673                MG    MG A3281     1555   1555  2.64  
LINK         OP2   A A1676                MG    MG A3100     1555   1555  1.99  
LINK         OP2   A A1678                MG    MG A3046     1555   1555  2.22  
LINK         OP1   C A1774                MG    MG A3047     1555   1555  1.94  
LINK         OP2   G A1776                MG    MG A3048     1555   1555  2.24  
LINK         OP1   A A1780                MG    MG A3086     1555   1555  2.47  
LINK         OP1   U A1782                MG    MG A3086     1555   1555  2.21  
LINK         OP1   A A1783                MG    MG A3087     1555   1555  2.09  
LINK         OP2   A A1783                MG    MG A3086     1555   1555  2.01  
LINK         OP2   A A1784                MG    MG A3087     1555   1555  2.58  
LINK         OP2   G A1824                MG    MG A3411     1555   1555  2.27  
LINK         OP1   G A1828                MG    MG A3192     1555   1555  2.34  
LINK         OP2   G A1828                MG    MG A3096     1555   1555  1.94  
LINK         O4    U A1841                MG    MG A3329     1555   1555  2.88  
LINK         OP2   A A1938                MG    MG A3094     1555   1555  2.23  
LINK         OP1   U A1956                MG    MG A3278     1555   1555  2.58  
LINK         OP1   G A1968                MG    MG A3190     1555   1555  1.98  
LINK         OP1   A A1970                MG    MG A3245     1555   1555  2.50  
LINK         OP2   A A1970                MG    MG A3050     1555   1555  2.18  
LINK         OP1   U A1971                MG    MG A3245     1555   1555  2.53  
LINK         O4    U A1982                MG    MG A3219     1555   1555  2.95  
LINK         OP1   A A2005                MG    MG A3034     1555   1555  2.03  
LINK         OP1   C A2006                MG    MG A3033     1555   1555  1.94  
LINK         OP1   U A2022                MG    MG A3080     1555   1555  2.10  
LINK         O2    U A2022                MG    MG A3340     1555   1555  2.91  
LINK         OP2   C A2025                MG    MG A3051     1555   1555  2.14  
LINK         OP2   A A2031                MG    MG A3215     1555   1555  2.24  
LINK         OP1   A A2033                MG    MG A3185     1555   1555  2.40  
LINK         OP2   A A2051                MG    MG A3301     1555   1555  2.28  
LINK         OP2   G A2056                MG    MG A3052     1555   1555  2.88  
LINK         OP2   G A2057                MG    MG A3052     1555   1555  2.37  
LINK         OP2   G A2061                MG    MG A3053     1555   1555  2.31  
LINK         OP1   A A2062                MG    MG A3054     1555   1555  2.18  
LINK         OP1   A A2071                MG    MG A3320     1555   1555  2.23  
LINK         OP1   U A2074                MG    MG A3164     1555   1555  2.05  
LINK         O4    U A2202                MG    MG A3405     1555   1555  2.66  
LINK         O6    G A2221                MG    MG A3405     1555   1555  2.60  
LINK         OP2   A A2227                MG    MG A3131     1555   1555  2.67  
LINK         OP1   U A2243                MG    MG A3095     1555   1555  2.11  
LINK         OP2   U A2243                MG    MG A3320     1555   1555  1.85  
LINK         OP2   C A2248                MG    MG A3056     1555   1555  2.52  
LINK         O4    U A2249                MG    MG A3056     1555   1555  2.48  
LINK         O2'   G A2250                MG    MG A3214     1555   1555  2.67  
LINK         OP1   G A2251                MG    MG A3356     1555   1555  2.96  
LINK         OP2   G A2251                MG    MG A3214     1555   1555  2.54  
LINK         OP1   A A2268                MG    MG A3057     1555   1555  2.13  
LINK         OP1   G A2269                MG    MG A3057     1555   1555  1.96  
LINK         OP2   A A2270                MG    MG A3058     1555   1555  2.42  
LINK         OP2   A A2274                MG    MG A3251     1555   1555  2.53  
LINK         O6    G A2290                MG    MG A3330     1555   1555  2.77  
LINK         O6    G A2304                MG    MG A3059     1555   1555  2.97  
LINK         OP2   U A2305                MG    MG A3323     1555   1555  2.92  
LINK         OP2   G A2353                MG    MG A3363     1555   1555  2.73  
LINK         O6    G A2371                MG    MG A3346     1555   1555  2.23  
LINK         OP1   A A2377                MG    MG A3139     1555   1555  2.96  
LINK         OP1   C A2385                MG    MG A3118     1555   1555  1.87  
LINK         OP1   A A2406                MG    MG A3112     1555   1555  2.19  
LINK         OP1   A A2407                MG    MG A3067     1555   1555  2.12  
LINK         O4    U A2419                MG    MG A3081     1555   1555  2.25  
LINK         OP1   C A2427                MG    MG A3213     1555   1555  2.35  
LINK         OP1   G A2429                MG    MG A3213     1555   1555  2.82  
LINK         OP2   G A2429                MG    MG A3027     1555   1555  2.14  
LINK         OP2   G A2429                MG    MG A3213     1555   1555  2.83  
LINK         OP2   A A2430                MG    MG A3027     1555   1555  1.93  
LINK         OP1   A A2448                MG    MG A3085     1555   1555  2.00  
LINK         OP2   A A2448                MG    MG A3084     1555   1555  1.96  
LINK         O6    G A2494                MG    MG A3317     1555   1555  2.89  
LINK         O3'   A A2497                MG    MG A3084     1555   1555  2.98  
LINK         OP2   C A2498                MG    MG A3084     1555   1555  2.56  
LINK         OP1   C A2499                MG    MG A3085     1555   1555  2.30  
LINK         OP2   C A2499                MG    MG A3084     1555   1555  2.61  
LINK         O2    C A2499                MG    MG A3061     1555   1555  2.38  
LINK         OP2   G A2502                MG    MG A3053     1555   1555  2.10  
LINK         OP1   A A2503                MG    MG A3082     1555   1555  1.97  
LINK         OP2   A A2503                MG    MG A3082     1555   1555  2.95  
LINK         OP1   C A2507                MG    MG A3089     1555   1555  2.89  
LINK         OP2   A A2518                MG    MG A3062     1555   1555  2.43  
LINK         O6    G A2526                MG    MG A3310     1555   1555  2.98  
LINK         OP1   A A2531                MG    MG A3364     1555   1555  2.34  
LINK         OP1   G A2550                MG    MG A3092     1555   1555  1.98  
LINK         OP2   U A2552                MG    MG A3281     1555   1555  2.56  
LINK         OP1   C A2573                MG    MG A3089     1555   1555  2.80  
LINK         OP1   G A2574                MG    MG A3089     1555   1555  2.88  
LINK         OP2   C A2575                MG    MG A3089     1555   1555  2.71  
LINK         OP1   G A2576                MG    MG A3129     1555   1555  2.05  
LINK         OP1   A A2577                MG    MG A3129     1555   1555  2.34  
LINK         OP1   C A2579                MG    MG A3307     1555   1555  2.02  
LINK         OP2   G A2582                MG    MG A3296     1555   1555  2.44  
LINK         OP2   G A2583                MG    MG A3296     1555   1555  2.06  
LINK         OP1   G A2588                MG    MG A3022     1555   1555  2.08  
LINK         OP2   G A2588                MG    MG A3063     1555   1555  2.23  
LINK         OP1   A A2589                MG    MG A3021     1555   1555  2.23  
LINK         OP1   G A2592                MG    MG A3190     1555   1555  2.34  
LINK         O4    U A2593                MG    MG A3172     1555   1555  2.36  
LINK         OP2   C A2611                MG    MG A3307     1555   1555  1.90  
LINK         OP1   U A2615                MG    MG A3097     1555   1555  2.57  
LINK         OP1   C A2646                MG    MG A3242     1555   1555  2.78  
LINK         OP2   U A2647                MG    MG A3242     1555   1555  2.56  
LINK         OP2   A A2682                MG    MG A3204     1555   1555  2.17  
LINK         OP2   G A2686                MG    MG A3167     1555   1555  2.03  
LINK         O6    G A2686                MG    MG A3182     1555   1555  2.96  
LINK         O6    G A2697                MG    MG A3369     1555   1555  2.42  
LINK         OP2   A A2705                MG    MG A3083     1555   1555  2.09  
LINK         OP2   A A2711                MG    MG A3064     1555   1555  1.92  
LINK         OP2   G A2714                MG    MG A3064     1555   1555  2.54  
LINK         O6    G A2719                MG    MG A3179     1555   1555  1.93  
LINK         OP2   A A2748                MG    MG A3206     1555   1555  2.07  
LINK         O4    U A2754                MG    MG A3206     1555   1555  2.74  
LINK         OP1   A A2766                MG    MG A3231     1555   1555  1.95  
LINK         OP2   C A2767                MG    MG A3231     1555   1555  2.83  
LINK         O2'   A A2776                MG    MG A3273     1555   1555  2.97  
LINK         O2'   A A2781                MG    MG A3273     1555   1555  2.81  
LINK         OP2   A A2821                MG    MG A3116     1555   1555  2.51  
LINK         OP2   G A2822                MG    MG A3116     1555   1555  2.17  
LINK         O4    U A2847                MG    MG A3338     1555   1555  2.81  
LINK         OP2   A A2850                MG    MG A3165     1555   1555  2.81  
LINK         OP2   A B  57                MG    MG B 208     1555   1555  2.32  
LINK         OP2   A B  58                MG    MG B 208     1555   1555  2.13  
LINK         O4    U B  95                MG    MG B 202     1555   1555  1.91  
LINK         OP2   G B 100                MG    MG B 203     1555   1555  2.66  
LINK         OP2   G B 106                MG    MG B 206     1555   1555  2.70  
LINK         O   GLY D 115                MG    MG A3116     1555   1555  2.29  
LINK         OD1 ASN M  99                MG    MG A3016     1555   1555  2.15  
LINK         O   GLY O 105                MG    MG A3319     1555   1555  2.75  
LINK         OD1 ASP b  20                MG    MG b 101     1555   1555  2.95  
LINK         OD2 ASP b  20                MG    MG b 101     1555   1555  2.85  
LINK         SG  CYS f  11                ZN    ZN f 101     1555   1555  2.34  
LINK         SG  CYS f  14                ZN    ZN f 101     1555   1555  2.38  
LINK         SG  CYS f  27                ZN    ZN f 101     1555   1555  2.31  
LINK         ND1 HIS f  33                ZN    ZN f 101     1555   1555  2.29  
CISPEP   1 THR D  151    PRO D  152          0         1.54                     
CISPEP   2 THR I   67    PRO I   68          0       -16.67                     
CISPEP   3 VAL S   51    PRO S   52          0        -2.15                     
SITE     1 AC1  3   C 2  75    A 2  76    A A2602                               
SITE     1 AC2  1   U A 120                                                     
SITE     1 AC3  2   U A 120    G A 123                                          
SITE     1 AC4  2   A A 218    A A 219                                          
SITE     1 AC5  1   U A 419                                                     
SITE     1 AC6  2   G A 450    G A 452                                          
SITE     1 AC7  4   A A 449    G A 450    A A 453   MG A3225                    
SITE     1 AC8  3   A A 526    C A 527    A A 528                               
SITE     1 AC9  1   U A 567                                                     
SITE     1 AD1  1   G A 831                                                     
SITE     1 AD2  1   A A 574                                                     
SITE     1 AD3  1   A A 582                                                     
SITE     1 AD4  3   A A 621    G A 622  ASN M  99                               
SITE     1 AD5  2   G A 733    A A 761                                          
SITE     1 AD6  1   U A 746                                                     
SITE     1 AD7  2   A A 751    A A1614                                          
SITE     1 AD8  3   A A 783    G A 784    A A2589                               
SITE     1 AD9  2   G A 784    G A2588                                          
SITE     1 AE1  2   C A 192    A A 800                                          
SITE     1 AE2  3   A A 675    A A 802    U A 803                               
SITE     1 AE3  2   U A 810    A A1253                                          
SITE     1 AE4  1   G A 822                                                     
SITE     1 AE5  5   U A 826    U A 827    G A2429    A A2430                    
SITE     2 AE5  5  MG A3213                                                     
SITE     1 AE6  3   C A 944    A A 945    C A 946                               
SITE     1 AE7  1   A A 945                                                     
SITE     1 AE8  4   A A 947    C A 948    G A 962    U A 963                    
SITE     1 AE9  1   A A1156                                                     
SITE     1 AF1  4   U A1267    A A1268    C A2006    G A2048                    
SITE     1 AF2  2   A A1269    A A2005                                          
SITE     1 AF3  4   G A1271    A A1272    U A1647    U A1648                    
SITE     1 AF4  3   U A1313    G A1333    G A1334                               
SITE     1 AF5  1   G A1333                                                     
SITE     1 AF6  1   C A1376                                                     
SITE     1 AF7  2   G A1358    G A1371                                          
SITE     1 AF8  3   A A1393    U A1394    C A1604                               
SITE     1 AF9  3   A A1395    A A1603    C A1604                               
SITE     1 AG1  1   U A1647                                                     
SITE     1 AG2  3   A A1664    A A1665    G A1992                               
SITE     1 AG3  2   C A1670    U A1671                                          
SITE     1 AG4  1   A A1678                                                     
SITE     1 AG5  1   C A1774                                                     
SITE     1 AG6  1   G A1776                                                     
SITE     1 AG7  2   A A1900    A A1970                                          
SITE     1 AG8  1   C A2025                                                     
SITE     1 AG9  2   G A2056    G A2057                                          
SITE     1 AH1  2   G A2061    G A2502                                          
SITE     1 AH2  2   A A2062    C A2443                                          
SITE     1 AH3  3   C A2066    C A2248    U A2249                               
SITE     1 AH4  2   A A2268    G A2269                                          
SITE     1 AH5  2   A A2267    A A2270                                          
SITE     1 AH6  2   G A2304    C A2310                                          
SITE     1 AH7  1   A A2453                                                     
SITE     1 AH8  1   C A2499                                                     
SITE     1 AH9  3   A A2518    U A2519    A A2541                               
SITE     1 AI1  2   G A2588  GLU C 236                                          
SITE     1 AI2  2   A A2711    G A2714                                          
SITE     1 AI3  2   A A 299    G A 338                                          
SITE     1 AI4  2   G A 370    A A 422                                          
SITE     1 AI5  3   G A 411    A A 412    A A2407                               
SITE     1 AI6  1   A A 572                                                     
SITE     1 AI7  2   G A 818    G A1187                                          
SITE     1 AI8  1   A A 981                                                     
SITE     1 AI9  3   A A 990    C A 991    G A1186                               
SITE     1 AJ1  1   A A1327                                                     
SITE     1 AJ2  2   A A1359    G A1360                                          
SITE     1 AJ3  1   G A1425                                                     
SITE     1 AJ4  2   A A1439    U A1440                                          
SITE     1 AJ5  1   U A1636                                                     
SITE     1 AJ6  1   U A2022                                                     
SITE     1 AJ7  1   U A2419                                                     
SITE     1 AJ8  2   U A 576    A A2503                                          
SITE     1 AJ9  1   A A2705                                                     
SITE     1 AK1  4   A A2448    A A2497    C A2498    C A2499                    
SITE     1 AK2  3   G A 570    A A2448    C A2499                               
SITE     1 AK3  3   A A1780    U A1782    A A1783                               
SITE     1 AK4  3   C A 740    A A1783    A A1784                               
SITE     1 AK5  2   C A  31    G A1239                                          
SITE     1 AK6  4   C A2507    C A2573    G A2574    C A2575                    
SITE     1 AK7  3   A A1342    U A1602  THR U  60                               
SITE     1 AK8  3   U A 686    C A 687    U A 688                               
SITE     1 AK9  4   A A1669    C A1670    U A1671    G A2550                    
SITE     1 AL1  3   A A 861    G A 862    A A 910                               
SITE     1 AL2  3   A A1938    C A1957    C A1958                               
SITE     1 AL3  3   C A 192    A A 199    U A2243                               
SITE     1 AL4  2   G A1828  ARG C 221                                          
SITE     1 AL5  2   A A1265    U A2615                                          
SITE     1 AL6  4   G A 194    A A 195    A A 197    C A 198                    
SITE     1 AL7  3   C A1314    C A1315    G A1332                               
SITE     1 AL8  1   A A1676                                                     
SITE     1 AL9  4   C A 509    C A 510    U A 511    G A 512                    
SITE     1 AM1  1   A A 973                                                     
SITE     1 AM2  3   A A1008    A A1009    A A1010                               
SITE     1 AM3  2   A A2741    G A2742                                          
SITE     1 AM4  1   A A 943                                                     
SITE     1 AM5  1   G A2843                                                     
SITE     1 AM6  2   G A 578    U A2017                                          
SITE     1 AM7  1   U A 963                                                     
SITE     1 AM8  2   A A1664    A A1665                                          
SITE     1 AM9  1   G A1989                                                     
SITE     1 AN1  2   A A2406    U A2408                                          
SITE     1 AN2  1   G A 214                                                     
SITE     1 AN3  1   A A1237                                                     
SITE     1 AN4  5   A A2820    A A2821    G A2822  GLY D 115                    
SITE     2 AN4  5 HIS O   3                                                     
SITE     1 AN5  4   G A2289    G A2325    U A2384    C A2385                    
SITE     1 AN6  1   C A1398                                                     
SITE     1 AN7  1   A A2335                                                     
SITE     1 AN8  1   U A 665                                                     
SITE     1 AN9  1   U A1240                                                     
SITE     1 AO1  1   C A1376                                                     
SITE     1 AO2  4   G A2053    G A2576    A A2577   MG A3392                    
SITE     1 AO3  1  MG A3257                                                     
SITE     1 AO4  3   C A2226    A A2227    G A2228                               
SITE     1 AO5  3   A A1284    A A1285    A A1328                               
SITE     1 AO6  3   A A 374    G A 375    C A 393                               
SITE     1 AO7  2   C A 163    C A 164                                          
SITE     1 AO8  2   G A1124    G A1125                                          
SITE     1 AO9  3   A A1378    U A1379    G A1380                               
SITE     1 AP1  1   A A2377                                                     
SITE     1 AP2  3   G A1303    C A1607   MG A3210                               
SITE     1 AP3  1   C A1167                                                     
SITE     1 AP4  3   G A 597    U A 598    G A 659                               
SITE     1 AP5  1   A A 515                                                     
SITE     1 AP6  2   U A1995  THR D 129                                          
SITE     1 AP7  1   G A2640                                                     
SITE     1 AP8  4   A A 505    G A1235    G A1236   MG A3387                    
SITE     1 AP9  4   G A1529    G A1530    C A1541    U A1542                    
SITE     1 AQ1  2   U A2076    G A2238                                          
SITE     1 AQ2  1   U A2865                                                     
SITE     1 AQ3  1   G A2524                                                     
SITE     1 AQ4  1   G A2775                                                     
SITE     1 AQ5  1   G A  55                                                     
SITE     1 AQ6  1   G A 500                                                     
SITE     1 AQ7  1   G A2414                                                     
SITE     1 AQ8  1   G A2396                                                     
SITE     1 AQ9  1   U A2236                                                     
SITE     1 AR1  1   G A2545                                                     
SITE     1 AR2  1   G A 261                                                     
SITE     1 AR3  2   G A1429    U A1563                                          
SITE     1 AR4  2   C A1658  HIS D 140                                          
SITE     1 AR5  3   U A2074    G A2239    U A2240                               
SITE     1 AR6  3   A A2850    A A2851    G A2852                               
SITE     1 AR7  3   G A 805    G A 830    U A2068                               
SITE     1 AR8  1   G A2686                                                     
SITE     1 AR9  2   A A 975    G A 976                                          
SITE     1 AS1  2   U A 999    C A1153                                          
SITE     1 AS2  4   C A2681    U A2684    G A2685    U A2724                    
SITE     1 AS3  2   C A1298    C A1639                                          
SITE     1 AS4  1   U A2593                                                     
SITE     1 AS5  2   A A1189    G A1190                                          
SITE     1 AS6  2   C A 787    U A 790                                          
SITE     1 AS7  3   C A1297    C A1639    G A2709                               
SITE     1 AS8  4   G A2061    G A2447    C A2501    U A2504                    
SITE     1 AS9  3   A A 586    U A1249    G A1250                               
SITE     1 AT1  2   A A 739    U A1779                                          
SITE     1 AT2  1   G A2719                                                     
SITE     1 AT3  2   U A1263    A A2015                                          
SITE     1 AT4  4   G A2686    U A2687    G A2688    G A2722                    
SITE     1 AT5  2   C A 816    G A1187                                          
SITE     1 AT6  2   U A2028    A A2033                                          
SITE     1 AT7  1   G A 446                                                     
SITE     1 AT8  1  MG A3362                                                     
SITE     1 AT9  2   A A 670    A A 804                                          
SITE     1 AU1  2   G A1968    G A2592                                          
SITE     1 AU2  2   C A2055  GLN b   5                                          
SITE     1 AU3  2   G A1828    G A1973                                          
SITE     1 AU4  5   U A1394    A A1395    U A1397    U A1602                    
SITE     2 AU4  5   A A1603                                                     
SITE     1 AU5  1   G A2595                                                     
SITE     1 AU6  1   A A 980                                                     
SITE     1 AU7  2   G A 463    G A 465                                          
SITE     1 AU8  1   U A2571                                                     
SITE     1 AU9  1   A A1237                                                     
SITE     1 AV1  1   U A1132                                                     
SITE     1 AV2  2   A A 861   MG A3300                                          
SITE     1 AV3  2   G A 297    G A 338                                          
SITE     1 AV4  2   C A 731    G A 760                                          
SITE     1 AV5  2   A A2682    G A2722                                          
SITE     1 AV6  2   G A2693    U A2707                                          
SITE     1 AV7  2   A A2748    U A2754                                          
SITE     1 AV8  2   G A2337    C A2385                                          
SITE     1 AV9  1   A A2386                                                     
SITE     1 AW1  4   G A1303    A A1304    C A1606   MG A3140                    
SITE     1 AW2  2   G A 949    G A 950                                          
SITE     1 AW3  4   G A1022    U A1023    G A1025    C A1135                    
SITE     1 AW4  5   U A 827    A A2426    C A2427    G A2429                    
SITE     2 AW4  5  MG A3027                                                     
SITE     1 AW5  3   G A2250    G A2251    A A2497                               
SITE     1 AW6  2   A A 574    A A2031                                          
SITE     1 AW7  4   G A 533    U A 534    G A 535    U A 558                    
SITE     1 AW8  1   G A2846                                                     
SITE     1 AW9  3   U A1769    G A1980    U A1982                               
SITE     1 AX1  4   A A 374    G A 375    G A 376   MG A3288                    
SITE     1 AX2  1  MG A3301                                                     
SITE     1 AX3  1   G A1631                                                     
SITE     1 AX4  1   C A 961                                                     
SITE     1 AX5  2   C A1013    A A1014                                          
SITE     1 AX6  5   G A 452    A A 453    A A 471   MG A3007                    
SITE     2 AX6  5 SER E  80                                                     
SITE     1 AX7  2   G A2864    U A2866                                          
SITE     1 AX8  1   G A 953                                                     
SITE     1 AX9  1   G A 974                                                     
SITE     1 AY1  2   G A2446    G A2502                                          
SITE     1 AY2  2   A A2766    C A2767                                          
SITE     1 AY3  2   A A1641    G A1642                                          
SITE     1 AY4  1   G A 759                                                     
SITE     1 AY5  2   A A 743    G A2581                                          
SITE     1 AY6  2   A A1265  ARG b  17                                          
SITE     1 AY7  4   U A 868    G A 869    U A 870   MG A3237                    
SITE     1 AY8  4   C A 865    U A 868    G A 869   MG A3236                    
SITE     1 AY9  1   A A2432                                                     
SITE     1 AZ1  3   C A1838    G A1839    G A1897                               
SITE     1 AZ2  1   G A  58                                                     
SITE     1 AZ3  2   C A2646    U A2647                                          
SITE     1 AZ4  1   G A 628                                                     
SITE     1 AZ5  4   G A1215    U A1234    G A1235   MG A3348                    
SITE     1 AZ6  2   A A1970    U A1971                                          
SITE     1 AZ7  2   C A1345    G A1346                                          
SITE     1 AZ8  1   G A1163                                                     
SITE     1 AZ9  1   C A 671                                                     
SITE     1 BC1  1   A A2274                                                     
SITE     1 BC2  1   G A 189                                                     
SITE     1 BC3  1   U A2779                                                     
SITE     1 BC4  1   C A1967                                                     
SITE     1 BC5  1  MG A3257                                                     
SITE     1 BC6  7   U A 593    U A 594    G A 662    G A 663                    
SITE     2 BC6  7   G A 664   MG A3130   MG A3256                               
SITE     1 BC7  4   U A 839    G A 938    G A 939    G A 940                    
SITE     1 BC8  4   A A 599    G A 600    G A 656    U A 657                    
SITE     1 BC9  2   G A2791    A A2792                                          
SITE     1 BD1  3   G A 530    G A2038    U A2039                               
SITE     1 BD2  1   G A1355                                                     
SITE     1 BD3  1   G A1271                                                     
SITE     1 BD4  2   G A1807    A A1809                                          
SITE     1 BD5  1   A A1001                                                     
SITE     1 BD6  2   C A 192    U A 193                                          
SITE     1 BD7  4   C A2628    A A2776    A A2781    G A2782                    
SITE     1 BD8  1   A A 513                                                     
SITE     1 BD9  2   G A  26   MG A3400                                          
SITE     1 BE1  3   G A  24    U A  25    A A 514                               
SITE     1 BE2  1   G A2290                                                     
SITE     1 BE3  1   U A1956                                                     
SITE     1 BE4  2   C A2710   MG A3369                                          
SITE     1 BE5  3   U A 448    A A 472   MG A3313                               
SITE     1 BE6  5   A A1672    G A1673    U A2552    G A2553                    
SITE     2 BE6  5   U A2554                                                     
SITE     1 BE7  2   A A 181    A A 182                                          
SITE     1 BE8  4   G A 953    G A 954    G A 962    U A 963                    
SITE     1 BE9  1   G A 561                                                     
SITE     1 BF1  1   G A  58                                                     
SITE     1 BF2  2   C A1607    G A1622                                          
SITE     1 BF3  2   G A 375   MG A3220                                          
SITE     1 BF4  2   A A2810    G A2811                                          
SITE     1 BF5  1   A A 945                                                     
SITE     1 BF6  2   G A 185    G A 186                                          
SITE     1 BF7  1   G A 189                                                     
SITE     1 BF8  2   A A 793    C A2072                                          
SITE     1 BF9  1   U A1662                                                     
SITE     1 BG1  1   G A 410                                                     
SITE     1 BG2  2   G A2582    G A2583                                          
SITE     1 BG3  6   A A 833    G A 834    C A 835    A A 943                    
SITE     2 BG3  6   C A 944   MG A3408                                          
SITE     1 BG4  1   G A 707                                                     
SITE     1 BG5  4   G A 775    G A 776    A A 793    A A 794                    
SITE     1 BG6  3   A A 910    A A 911   MG A3201                               
SITE     1 BG7  2   A A2051   MG A3221                                          
SITE     1 BG8  3   G A 452    A A 470  THR E  53                               
SITE     1 BG9  1   G A 379                                                     
SITE     1 BH1  1   G A2549                                                     
SITE     1 BH2  1   A A 863                                                     
SITE     1 BH3  2   C A2579    C A2611                                          
SITE     1 BH4  1   U A 554                                                     
SITE     1 BH5  1   C A 698                                                     
SITE     1 BH6  5   G A2525    G A2526    C A2527    G A2536                    
SITE     2 BH6  5   U A2537                                                     
SITE     1 BH7  2   U A 562    C A 982                                          
SITE     1 BH8  1   A A 800                                                     
SITE     1 BH9  2   A A 472   MG A3280                                          
SITE     1 BI1  1   C A1135                                                     
SITE     1 BI2  2   G A1449    G A1450                                          
SITE     1 BI3  3   U A 827    G A2067    U A2068                               
SITE     1 BI4  1   G A2494                                                     
SITE     1 BI5  2   C A1348    G A1377                                          
SITE     1 BI6  5   A A1287    G A1288    U A1326    A A1327                    
SITE     2 BI6  5 GLY O 105                                                     
SITE     1 BI7  2   A A2071    U A2243                                          
SITE     1 BI8  2   A A 371    U A 403                                          
SITE     1 BI9  2   G A 830    U A2449                                          
SITE     1 BJ1  2   G A2304    U A2305                                          
SITE     1 BJ2  1   G A1311                                                     
SITE     1 BJ3  1   G A2458                                                     
SITE     1 BJ4  1   G A2490                                                     
SITE     1 BJ5  1   G A1356                                                     
SITE     1 BJ6  4   C A1838    U A1841    G A1842    U A1898                    
SITE     1 BJ7  2   G A2289    G A2290                                          
SITE     1 BJ8  6   G A 638    U A 639    U A 646    G A 648                    
SITE     2 BJ8  6   G A 649    C A 650                                          
SITE     1 BJ9  4   G A1041    G A1042    C A1043    G A1112                    
SITE     1 BK1  2   U A1476    G A1478                                          
SITE     1 BK2  3   G A 711    G A 712    C A 719                               
SITE     1 BK3  1   A A2518                                                     
SITE     1 BK4  1   G A1622                                                     
SITE     1 BK5  2   C A 737    U A1621                                          
SITE     1 BK6  3   G A2846    U A2847    G A2848                               
SITE     1 BK7  1   G A2375                                                     
SITE     1 BK8  2   U A2022    C A2616                                          
SITE     1 BK9  4   G A 695    G A 696    U A 766    U A 767                    
SITE     1 BL1  2   U A1318    G A1331                                          
SITE     1 BL2  3   U A  62    A A  63    A A  64                               
SITE     1 BL3  1   G A 536                                                     
SITE     1 BL4  3   G A2345    G A2370    G A2371                               
SITE     1 BL5  3   C A1658    G A1659    G A1660                               
SITE     1 BL6  1  MG A3244                                                     
SITE     1 BL7  1   U A2818                                                     
SITE     1 BL8  2   U A2259   MG A3375                                          
SITE     1 BL9  3   G A 695    G A1380    C A1428                               
SITE     1 BM1  1   G A2315                                                     
SITE     1 BM2  1   G A 248                                                     
SITE     1 BM3  2   G A 248    C A 249                                          
SITE     1 BM4  1   A A1810                                                     
SITE     1 BM5  1   G A2251                                                     
SITE     1 BM6  3   U A1716    A A1717    G A1718                               
SITE     1 BM7  2   U A1720    G A1721                                          
SITE     1 BM8  1   U A1203                                                     
SITE     1 BM9  2   G A2857    G A2859                                          
SITE     1 BN1  3   G A1281    A A1286   MG A3187                               
SITE     1 BN2  2   A A2352    G A2353                                          
SITE     1 BN3  2   A A2531    U A2533                                          
SITE     1 BN4  2   U A1856    G A1857                                          
SITE     1 BN5  2   U A 779  ASP C 229                                          
SITE     1 BN6  2   C A 680    G A 776                                          
SITE     1 BN7  4   U A2696    G A2697    U A2698   MG A3279                    
SITE     1 BN8  1   G A1235                                                     
SITE     1 BN9  2   G A1715    U A1742                                          
SITE     1 BO1  2   A A1711    U A1714                                          
SITE     1 BO2  2   A A 654    A A 655                                          
SITE     1 BO3  3   A A 825    G A2428   MG A3350                               
SITE     1 BO4  1   A A1978                                                     
SITE     1 BO5  5   U A 284    G A 285    A A 354    U A 355                    
SITE     2 BO5  5   G A 356                                                     
SITE     1 BO6  4   G A 289    U A 290    G A 291    G A 350                    
SITE     1 BO7  1   G A 543                                                     
SITE     1 BO8  1   G A1823                                                     
SITE     1 BO9  1   G A2223                                                     
SITE     1 BP1  1   G A1753                                                     
SITE     1 BP2  1   G A1756                                                     
SITE     1 BP3  1   G A2255                                                     
SITE     1 BP4  2   U A1209    A A1213                                          
SITE     1 BP5  2   A A1213    A A1214                                          
SITE     1 BP6  3   G A1235    G A1236   MG A3147                               
SITE     1 BP7  2   C A1771    C A1974                                          
SITE     1 BP8  2   A A1773    U A1976                                          
SITE     1 BP9  3   G A2053    A A2577   MG A3129                               
SITE     1 BQ1  3   U A2746    U A2754    C A2755                               
SITE     1 BQ2  1   G A2029                                                     
SITE     1 BQ3  2   G A1814    C A1816                                          
SITE     1 BQ4  1   G A1814                                                     
SITE     1 BQ5  2   G A2839    U A2878                                          
SITE     1 BQ6  1   G A2877                                                     
SITE     1 BQ7  3   G A  27    C A 509   MG A3275                               
SITE     1 BQ8  3   C A 542    C A 550    G A 551                               
SITE     1 BQ9  1   U A 769                                                     
SITE     1 BR1  3   C A 249    U A2431    A A2432                               
SITE     1 BR2  3   U A2584    U A2585    G A2608                               
SITE     1 BR3  4   G A2201    U A2202    U A2220    G A2221                    
SITE     1 BR4  1   A A 670                                                     
SITE     1 BR5  4   C A 835    G A 942    A A 943   MG A3297                    
SITE     1 BR6  2   C A 835    G A 836                                          
SITE     1 BR7  1   G A2828                                                     
SITE     1 BR8  3   G A1823    G A1824  HIS C  53                               
SITE     1 BR9  2   C B  97    G B  98                                          
SITE     1 BS1  2   U B  80    U B  95                                          
SITE     1 BS2  3   A B  73    G B 100    G B 102                               
SITE     1 BS3  1   G B  76                                                     
SITE     1 BS4  2   G B 106    G B 107                                          
SITE     1 BS5  2   G B  72    G B 102                                          
SITE     1 BS6  3   G B  56    A B  57    A B  58                               
SITE     1 BS7  1   G B  84                                                     
SITE     1 BS8  3   G B  64    A B 108    A B 109                               
SITE     1 BS9  1   G B   7                                                     
SITE     1 BT1  4   A A2590  GLY C 234  GLY C 235  GLY C 237                    
SITE     1 BT2  1 GLN C  60                                                     
SITE     1 BT3  1 ASN O  11                                                     
SITE     1 BT4  2 LYS R  41  TYR R  45                                          
SITE     1 BT5  2   C A2047  ASP b  20                                          
SITE     1 BT6  4 CYS f  11  CYS f  14  CYS f  27  HIS f  33                    
CRYST1    1.000    1.000    1.000  90.00  90.00  90.00 P 1           1          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.001000  0.000000  0.000000        0.00000                         
SCALE2      0.000000  0.001000  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.001000        0.00000