PDB Full entry for 5ONG
HEADER    DNA BINDING PROTEIN                     03-AUG-17   5ONG              
TITLE     X-RAY CRYSTAL STRUCTURE OF A NUCLEOSOME CORE PARTICLE WITH ITS DNA    
TITLE    2 SITE-SPECIFICALLY CROSSLINKED TO THE HISTONE OCTAMER                 
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: DNA (147-MER);                                             
COMPND   3 CHAIN: I;                                                            
COMPND   4 ENGINEERED: YES;                                                     
COMPND   5 MOL_ID: 2;                                                           
COMPND   6 MOLECULE: DNA (147-MER);                                             
COMPND   7 CHAIN: J;                                                            
COMPND   8 ENGINEERED: YES;                                                     
COMPND   9 MOL_ID: 3;                                                           
COMPND  10 MOLECULE: HISTONE H3.2;                                              
COMPND  11 CHAIN: A, E;                                                         
COMPND  12 ENGINEERED: YES;                                                     
COMPND  13 MUTATION: YES;                                                       
COMPND  14 MOL_ID: 4;                                                           
COMPND  15 MOLECULE: HISTONE H4;                                                
COMPND  16 CHAIN: B, F;                                                         
COMPND  17 ENGINEERED: YES;                                                     
COMPND  18 MOL_ID: 5;                                                           
COMPND  19 MOLECULE: HISTONE H2A;                                               
COMPND  20 CHAIN: C, G;                                                         
COMPND  21 ENGINEERED: YES;                                                     
COMPND  22 MOL_ID: 6;                                                           
COMPND  23 MOLECULE: HISTONE H2B 1.1;                                           
COMPND  24 CHAIN: D, H;                                                         
COMPND  25 SYNONYM: H2B1.1;                                                     
COMPND  26 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE   6 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE   7 EXPRESSION_SYSTEM_VARIANT: DH10B;                                    
SOURCE   8 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE   9 EXPRESSION_SYSTEM_VECTOR: PUC57;                                     
SOURCE  10 MOL_ID: 2;                                                           
SOURCE  11 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  12 ORGANISM_COMMON: HUMAN;                                              
SOURCE  13 ORGANISM_TAXID: 9606;                                                
SOURCE  14 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE  15 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE  16 EXPRESSION_SYSTEM_VARIANT: DH10B;                                    
SOURCE  17 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  18 EXPRESSION_SYSTEM_VECTOR: PUC57;                                     
SOURCE  19 MOL_ID: 3;                                                           
SOURCE  20 ORGANISM_SCIENTIFIC: XENOPUS LAEVIS;                                 
SOURCE  21 ORGANISM_COMMON: AFRICAN CLAWED FROG;                                
SOURCE  22 ORGANISM_TAXID: 8355;                                                
SOURCE  23 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  24 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  25 EXPRESSION_SYSTEM_VARIANT: PLYSS;                                    
SOURCE  26 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  27 EXPRESSION_SYSTEM_VECTOR: PET3A;                                     
SOURCE  28 MOL_ID: 4;                                                           
SOURCE  29 ORGANISM_SCIENTIFIC: XENOPUS LAEVIS;                                 
SOURCE  30 ORGANISM_COMMON: AFRICAN CLAWED FROG;                                
SOURCE  31 ORGANISM_TAXID: 8355;                                                
SOURCE  32 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  33 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  34 EXPRESSION_SYSTEM_VARIANT: PLYSS;                                    
SOURCE  35 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  36 EXPRESSION_SYSTEM_VECTOR: PET3A;                                     
SOURCE  37 MOL_ID: 5;                                                           
SOURCE  38 ORGANISM_SCIENTIFIC: XENOPUS LAEVIS;                                 
SOURCE  39 ORGANISM_COMMON: AFRICAN CLAWED FROG;                                
SOURCE  40 ORGANISM_TAXID: 8355;                                                
SOURCE  41 GENE: HIST1H2AJ, LOC494591;                                          
SOURCE  42 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  43 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  44 EXPRESSION_SYSTEM_VARIANT: PLYSS;                                    
SOURCE  45 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  46 EXPRESSION_SYSTEM_VECTOR: PET3A;                                     
SOURCE  47 MOL_ID: 6;                                                           
SOURCE  48 ORGANISM_SCIENTIFIC: XENOPUS LAEVIS;                                 
SOURCE  49 ORGANISM_COMMON: AFRICAN CLAWED FROG;                                
SOURCE  50 ORGANISM_TAXID: 8355;                                                
SOURCE  51 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  52 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  53 EXPRESSION_SYSTEM_VARIANT: PLYSS;                                    
SOURCE  54 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  55 EXPRESSION_SYSTEM_VECTOR: PET3A                                      
KEYWDS    NUCLEOSOME CORE PARTICLE, HISTONES, DISULFIDE, CONVERTIBLE            
KEYWDS   2 NUCLEOTIDE, DNA, DNA BINDING PROTEIN                                 
EXPDTA    X-RAY DIFFRACTION                                                     
AUTHOR    T.D.FROUWS,P.D.BARTH,T.J.RICHMOND                                     
REVDAT   2   27-DEC-17 5ONG    1       JRNL                                     
REVDAT   1   22-NOV-17 5ONG    0                                                
JRNL        AUTH   T.D.FROUWS,P.D.BARTH,T.J.RICHMOND                            
JRNL        TITL   SITE-SPECIFIC DISULFIDE CROSSLINKED NUCLEOSOMES WITH         
JRNL        TITL 2 ENHANCED STABILITY.                                          
JRNL        REF    J. MOL. BIOL.                 V. 430    45 2018              
JRNL        REFN                   ESSN 1089-8638                               
JRNL        PMID   29113904                                                     
JRNL        DOI    10.1016/J.JMB.2017.10.029                                    
REMARK   2                                                                      
REMARK   2 RESOLUTION.    2.80 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   PROGRAM     : PHENIX (DEV_2447: ???)                               
REMARK   3   AUTHORS     : PAUL ADAMS,PAVEL AFONINE,VINCENT CHEN,IAN            
REMARK   3               : DAVIS,KRESHNA GOPAL,RALF GROSSE-KUNSTLEVE,           
REMARK   3               : LI-WEI HUNG,ROBERT IMMORMINO,TOM IOERGER,            
REMARK   3               : AIRLIE MCCOY,ERIK MCKEE,NIGEL MORIARTY,              
REMARK   3               : REETAL PAI,RANDY READ,JANE RICHARDSON,               
REMARK   3               : DAVID RICHARDSON,TOD ROMO,JIM SACCHETTINI,           
REMARK   3               : NICHOLAS SAUTER,JACOB SMITH,LAURENT                  
REMARK   3               : STORONI,TOM TERWILLIGER,PETER ZWART                  
REMARK   3                                                                      
REMARK   3    REFINEMENT TARGET : NULL                                          
REMARK   3                                                                      
REMARK   3  DATA USED IN REFINEMENT.                                            
REMARK   3   RESOLUTION RANGE HIGH (ANGSTROMS) : 2.80                           
REMARK   3   RESOLUTION RANGE LOW  (ANGSTROMS) : 29.50                          
REMARK   3   MIN(FOBS/SIGMA_FOBS)              : 1.340                          
REMARK   3   COMPLETENESS FOR RANGE        (%) : 89.4                           
REMARK   3   NUMBER OF REFLECTIONS             : 47779                          
REMARK   3                                                                      
REMARK   3  FIT TO DATA USED IN REFINEMENT.                                     
REMARK   3   R VALUE     (WORKING + TEST SET) : 0.210                           
REMARK   3   R VALUE            (WORKING SET) : 0.206                           
REMARK   3   FREE R VALUE                     : 0.247                           
REMARK   3   FREE R VALUE TEST SET SIZE   (%) : 10.070                          
REMARK   3   FREE R VALUE TEST SET COUNT      : 4812                            
REMARK   3                                                                      
REMARK   3  FIT TO DATA USED IN REFINEMENT (IN BINS).                           
REMARK   3   BIN  RESOLUTION RANGE  COMPL.    NWORK NFREE   RWORK  RFREE        
REMARK   3     1 29.5008 -  8.6215    0.90     1585   165  0.1725 0.2045        
REMARK   3     2  8.6215 -  6.8716    0.92     1533   170  0.1700 0.2270        
REMARK   3     3  6.8716 -  6.0113    0.91     1497   171  0.2040 0.2500        
REMARK   3     4  6.0113 -  5.4655    0.93     1515   165  0.1943 0.2386        
REMARK   3     5  5.4655 -  5.0759    0.94     1508   188  0.1803 0.2157        
REMARK   3     6  5.0759 -  4.7779    0.94     1512   176  0.1722 0.2076        
REMARK   3     7  4.7779 -  4.5395    0.94     1522   166  0.1688 0.2018        
REMARK   3     8  4.5395 -  4.3426    0.92     1480   164  0.1756 0.2190        
REMARK   3     9  4.3426 -  4.1759    0.93     1529   150  0.1744 0.2223        
REMARK   3    10  4.1759 -  4.0321    0.94     1500   174  0.1820 0.2336        
REMARK   3    11  4.0321 -  3.9064    0.95     1492   184  0.1911 0.2204        
REMARK   3    12  3.9064 -  3.7949    0.96     1528   170  0.1960 0.2453        
REMARK   3    13  3.7949 -  3.6952    0.95     1525   194  0.2127 0.2452        
REMARK   3    14  3.6952 -  3.6052    0.95     1510   173  0.2231 0.2571        
REMARK   3    15  3.6052 -  3.5234    0.94     1478   156  0.2124 0.2854        
REMARK   3    16  3.5234 -  3.4485    0.94     1488   169  0.2464 0.2672        
REMARK   3    17  3.4485 -  3.3797    0.93     1464   186  0.2746 0.2998        
REMARK   3    18  3.3797 -  3.3160    0.95     1496   151  0.2726 0.3054        
REMARK   3    19  3.3160 -  3.2568    0.95     1528   164  0.2519 0.2828        
REMARK   3    20  3.2568 -  3.2017    0.96     1521   166  0.2703 0.2920        
REMARK   3    21  3.2017 -  3.1501    0.94     1518   143  0.2427 0.2714        
REMARK   3    22  3.1501 -  3.1017    0.91     1431   170  0.2406 0.2869        
REMARK   3    23  3.1017 -  3.0561    0.92     1446   163  0.2528 0.2910        
REMARK   3    24  3.0561 -  3.0131    0.92     1483   141  0.2430 0.3014        
REMARK   3    25  3.0131 -  2.9724    0.92     1450   164  0.2629 0.3088        
REMARK   3    26  2.9724 -  2.9339    0.82     1289   149  0.2772 0.3258        
REMARK   3    27  2.9339 -  2.8972    0.70     1096   130  0.2771 0.3339        
REMARK   3    28  2.8972 -  2.8623    0.72     1145   135  0.3028 0.3384        
REMARK   3    29  2.8623 -  2.8291    0.69     1076   118  0.3508 0.4231        
REMARK   3    30  2.8291 -  2.7973    0.52      822    97  0.3838 0.4036        
REMARK   3                                                                      
REMARK   3  BULK SOLVENT MODELLING.                                             
REMARK   3   METHOD USED        : NULL                                          
REMARK   3   SOLVENT RADIUS     : 1.11                                          
REMARK   3   SHRINKAGE RADIUS   : 0.90                                          
REMARK   3   K_SOL              : NULL                                          
REMARK   3   B_SOL              : NULL                                          
REMARK   3                                                                      
REMARK   3  ERROR ESTIMATES.                                                    
REMARK   3   COORDINATE ERROR (MAXIMUM-LIKELIHOOD BASED)     : 0.350            
REMARK   3   PHASE ERROR (DEGREES, MAXIMUM-LIKELIHOOD BASED) : 25.760           
REMARK   3                                                                      
REMARK   3  B VALUES.                                                           
REMARK   3   FROM WILSON PLOT           (A**2) : NULL                           
REMARK   3   MEAN B VALUE      (OVERALL, A**2) : NULL                           
REMARK   3   OVERALL ANISOTROPIC B VALUE.                                       
REMARK   3    B11 (A**2) : NULL                                                 
REMARK   3    B22 (A**2) : NULL                                                 
REMARK   3    B33 (A**2) : NULL                                                 
REMARK   3    B12 (A**2) : NULL                                                 
REMARK   3    B13 (A**2) : NULL                                                 
REMARK   3    B23 (A**2) : NULL                                                 
REMARK   3                                                                      
REMARK   3  TWINNING INFORMATION.                                               
REMARK   3   FRACTION: NULL                                                     
REMARK   3   OPERATOR: NULL                                                     
REMARK   3                                                                      
REMARK   3  DEVIATIONS FROM IDEAL VALUES.                                       
REMARK   3                 RMSD          COUNT                                  
REMARK   3   BOND      :  0.003          12813                                  
REMARK   3   ANGLE     :  0.597          18563                                  
REMARK   3   CHIRALITY :  0.036           2109                                  
REMARK   3   PLANARITY :  0.024           1473                                  
REMARK   3   DIHEDRAL  : 26.102           6679                                  
REMARK   3                                                                      
REMARK   3  TLS DETAILS                                                         
REMARK   3   NUMBER OF TLS GROUPS  : 58                                         
REMARK   3   TLS GROUP : 1                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID -73 THROUGH -54 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):   9.6346 111.8531  19.4256              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.7174 T22:   1.6236                                     
REMARK   3      T33:   1.6799 T12:   0.0718                                     
REMARK   3      T13:   0.4319 T23:  -0.0460                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.0744 L22:   2.1049                                     
REMARK   3      L33:   0.2138 L12:   0.1589                                     
REMARK   3      L13:   0.2685 L23:   0.7135                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   1.1736 S12:  -0.8087 S13:   0.8527                       
REMARK   3      S21:   2.5658 S22:  -1.3786 S23:   2.2344                       
REMARK   3      S31:  -0.1767 S32:  -0.7504 S33:  -0.0987                       
REMARK   3   TLS GROUP : 2                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID -53 THROUGH -44 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  14.3378  65.7429  19.4159              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.0233 T22:   1.0603                                     
REMARK   3      T33:   1.7645 T12:  -0.5449                                     
REMARK   3      T13:   0.1480 T23:   0.1066                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   4.0147 L22:   4.0769                                     
REMARK   3      L33:   1.8688 L12:  -3.9246                                     
REMARK   3      L13:  -0.0241 L23:  -0.6589                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.3548 S12:   0.5799 S13:  -1.5657                       
REMARK   3      S21:   0.8115 S22:   0.4420 S23:   1.5324                       
REMARK   3      S31:   0.2000 S32:  -1.1332 S33:   0.3414                       
REMARK   3   TLS GROUP : 3                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID -43 THROUGH -14 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  67.2307  71.4162  20.9835              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.7614 T22:   1.1192                                     
REMARK   3      T33:   1.1240 T12:   0.3555                                     
REMARK   3      T13:  -0.1825 T23:   0.3074                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.3558 L22:   0.9251                                     
REMARK   3      L33:   1.7551 L12:  -1.0474                                     
REMARK   3      L13:   0.0449 L23:  -0.5801                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.2891 S12:  -0.4906 S13:  -0.5862                       
REMARK   3      S21:   0.1569 S22:  -0.3297 S23:  -0.9212                       
REMARK   3      S31:   0.9059 S32:   1.1955 S33:  -2.1260                       
REMARK   3   TLS GROUP : 4                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID -13 THROUGH 16 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  44.8810 124.8368   1.7113              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.9237 T22:   0.4749                                     
REMARK   3      T33:   0.9163 T12:  -0.0887                                     
REMARK   3      T13:   0.1875 T23:   0.0475                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.2379 L22:   1.1750                                     
REMARK   3      L33:   1.9165 L12:   0.2645                                     
REMARK   3      L13:   1.4192 L23:   0.6977                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.1186 S12:  -0.1171 S13:   1.2973                       
REMARK   3      S21:  -0.4303 S22:  -0.1837 S23:  -0.1339                       
REMARK   3      S31:  -0.9526 S32:  -0.1328 S33:  -0.0453                       
REMARK   3   TLS GROUP : 5                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID 17 THROUGH 36 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  14.4384  74.6390  -5.5661              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.0445 T22:   1.0283                                     
REMARK   3      T33:   0.9463 T12:  -0.2830                                     
REMARK   3      T13:  -0.0035 T23:  -0.1348                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.0526 L22:   0.9116                                     
REMARK   3      L33:   0.1501 L12:   0.1051                                     
REMARK   3      L13:   0.1446 L23:   0.3826                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.1458 S12:   0.4312 S13:  -0.9420                       
REMARK   3      S21:  -0.0947 S22:  -0.5667 S23:   1.6580                       
REMARK   3      S31:   0.4609 S32:  -0.6133 S33:   0.1862                       
REMARK   3   TLS GROUP : 6                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID 37 THROUGH 46 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  52.4968  50.0233  -2.4507              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.5401 T22:   0.9031                                     
REMARK   3      T33:   1.5313 T12:   0.1462                                     
REMARK   3      T13:   0.2683 T23:  -0.1639                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.1309 L22:   0.0282                                     
REMARK   3      L33:   0.5091 L12:  -0.0068                                     
REMARK   3      L13:   0.4932 L23:  -0.0925                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.2547 S12:  -0.1860 S13:  -1.5428                       
REMARK   3      S21:  -1.3592 S22:   0.2786 S23:  -0.2679                       
REMARK   3      S31:   0.8323 S32:   0.1049 S33:   0.1119                       
REMARK   3   TLS GROUP : 7                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID 47 THROUGH 73 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  82.5550  92.2212  -8.8689              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.0514 T22:   1.2001                                     
REMARK   3      T33:   1.7370 T12:   0.2495                                     
REMARK   3      T13:   0.4443 T23:   0.0349                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.9973 L22:   0.6057                                     
REMARK   3      L33:   1.5365 L12:   0.0553                                     
REMARK   3      L13:  -0.1191 L23:  -1.0141                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.5659 S12:   0.1519 S13:  -0.3137                       
REMARK   3      S21:  -0.3167 S22:  -1.0556 S23:  -2.2272                       
REMARK   3      S31:  -0.0104 S32:   0.9782 S33:  -0.2702                       
REMARK   3   TLS GROUP : 8                                                      
REMARK   3    SELECTION: CHAIN 'J' AND (RESID -73 THROUGH -54 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  85.1536 102.8163 -11.9129              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.8440 T22:   1.4744                                     
REMARK   3      T33:   1.5302 T12:  -0.0371                                     
REMARK   3      T13:   0.4086 T23:   0.1775                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.3906 L22:   0.7935                                     
REMARK   3      L33:   1.5614 L12:  -0.8590                                     
REMARK   3      L13:  -0.2763 L23:  -0.2520                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.8389 S12:   0.1657 S13:   0.2923                       
REMARK   3      S21:  -1.0209 S22:  -1.4779 S23:  -1.5467                       
REMARK   3      S31:   0.0095 S32:   0.6523 S33:  -0.0656                       
REMARK   3   TLS GROUP : 9                                                      
REMARK   3    SELECTION: CHAIN 'J' AND (RESID -53 THROUGH -34 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  58.0826  54.3866  -3.2055              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.3489 T22:   0.7045                                     
REMARK   3      T33:   1.6208 T12:   0.1639                                     
REMARK   3      T13:   0.1445 T23:  -0.1214                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.1965 L22:   2.0941                                     
REMARK   3      L33:   0.8239 L12:   0.1867                                     
REMARK   3      L13:  -0.3998 L23:   0.1204                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.5337 S12:   0.0310 S13:  -1.5423                       
REMARK   3      S21:  -0.4362 S22:   0.0165 S23:  -0.0494                       
REMARK   3      S31:   0.8755 S32:   0.3189 S33:   0.1772                       
REMARK   3   TLS GROUP : 10                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID -33 THROUGH -14 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  11.0782  83.2297  -6.5520              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6192 T22:   1.2293                                     
REMARK   3      T33:   1.0295 T12:  -0.0845                                     
REMARK   3      T13:  -0.0990 T23:  -0.3091                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.3359 L22:   0.0860                                     
REMARK   3      L33:   1.4198 L12:   0.2715                                     
REMARK   3      L13:   0.1892 L23:  -0.1956                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.2823 S12:   0.2528 S13:  -0.7325                       
REMARK   3      S21:  -0.0859 S22:  -0.9664 S23:   1.9412                       
REMARK   3      S31:   0.3839 S32:  -0.9915 S33:  -0.6209                       
REMARK   3   TLS GROUP : 11                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID -13 THROUGH 16 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  52.5542 124.2774   2.7742              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.9983 T22:   0.5460                                     
REMARK   3      T33:   0.8878 T12:  -0.2561                                     
REMARK   3      T13:   0.0688 T23:   0.0652                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.2004 L22:   1.7757                                     
REMARK   3      L33:   2.1627 L12:  -0.0006                                     
REMARK   3      L13:   1.0017 L23:  -0.3553                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1463 S12:   0.0760 S13:   0.8047                       
REMARK   3      S21:   0.0273 S22:  -0.1103 S23:  -0.6187                       
REMARK   3      S31:  -1.0569 S32:   0.3830 S33:  -0.2502                       
REMARK   3   TLS GROUP : 12                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID 17 THROUGH 26 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  85.0413  84.6061  18.2396              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.4731 T22:   2.1883                                     
REMARK   3      T33:   1.5688 T12:   0.4392                                     
REMARK   3      T13:  -0.2196 T23:   0.4227                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.0388 L22:   1.5208                                     
REMARK   3      L33:   1.3696 L12:  -0.0439                                     
REMARK   3      L13:   0.1575 L23:   0.8594                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.4998 S12:  -0.8288 S13:  -0.4236                       
REMARK   3      S21:   0.3496 S22:   0.0909 S23:  -1.4465                       
REMARK   3      S31:   0.6293 S32:   0.3281 S33:   4.5429                       
REMARK   3   TLS GROUP : 13                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID 27 THROUGH 46 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  49.4277  57.3249  22.1767              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.2142 T22:   0.6356                                     
REMARK   3      T33:   1.1222 T12:   0.1757                                     
REMARK   3      T13:   0.0637 T23:   0.1599                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.8091 L22:   1.3979                                     
REMARK   3      L33:   1.4480 L12:  -1.0505                                     
REMARK   3      L13:  -0.7814 L23:  -0.3511                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.6848 S12:   0.0425 S13:  -1.5578                       
REMARK   3      S21:   0.2888 S22:   0.5355 S23:   0.1457                       
REMARK   3      S31:   1.1088 S32:   0.0189 S33:  -0.0922                       
REMARK   3   TLS GROUP : 14                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID 47 THROUGH 56 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):   9.1927  74.1298  18.0998              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.6491 T22:   1.1902                                     
REMARK   3      T33:   2.6590 T12:  -0.2126                                     
REMARK   3      T13:   0.1353 T23:   0.4091                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.9071 L22:   0.5368                                     
REMARK   3      L33:   1.8951 L12:  -0.5147                                     
REMARK   3      L13:   0.2434 L23:  -0.0921                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.2234 S12:  -0.3015 S13:   0.1741                       
REMARK   3      S21:   0.8259 S22:   1.0462 S23:   3.9804                       
REMARK   3      S31:  -0.6157 S32:  -1.8657 S33:  -0.1292                       
REMARK   3   TLS GROUP : 15                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID 57 THROUGH 73 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  11.5047 116.1599  19.1574              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.5229 T22:   1.4448                                     
REMARK   3      T33:   1.5245 T12:   0.3154                                     
REMARK   3      T13:   0.3431 T23:   0.0451                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.4902 L22:   0.2120                                     
REMARK   3      L33:  -0.0080 L12:   0.3419                                     
REMARK   3      L13:   0.0498 L23:   0.0388                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0861 S12:  -1.1855 S13:   0.6149                       
REMARK   3      S21:   0.3630 S22:  -0.8421 S23:   1.1553                       
REMARK   3      S31:  -0.0528 S32:  -0.1033 S33:   0.3430                       
REMARK   3   TLS GROUP : 16                                                     
REMARK   3    SELECTION: CHAIN 'A' AND (RESID 39 THROUGH 56 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  72.6655 113.6031  -3.4580              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3838 T22:   0.8281                                     
REMARK   3      T33:   0.8929 T12:  -0.3424                                     
REMARK   3      T13:   0.4167 T23:  -0.0248                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.7788 L22:   0.6497                                     
REMARK   3      L33:   0.6201 L12:  -0.7060                                     
REMARK   3      L13:  -0.0492 L23:  -0.0031                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0696 S12:  -0.1256 S13:  -0.0862                       
REMARK   3      S21:  -0.0708 S22:  -0.3364 S23:  -0.4092                       
REMARK   3      S31:  -0.1665 S32:   0.4229 S33:  -1.2476                       
REMARK   3   TLS GROUP : 17                                                     
REMARK   3    SELECTION: CHAIN 'A' AND (RESID 57 THROUGH 77 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  70.3955  95.2141  15.7005              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2024 T22:   0.7875                                     
REMARK   3      T33:   0.6664 T12:  -0.1408                                     
REMARK   3      T13:  -0.0249 T23:   0.0187                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.5143 L22:   3.0498                                     
REMARK   3      L33:   1.7374 L12:   0.1244                                     
REMARK   3      L13:  -0.1685 L23:   0.5870                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0061 S12:  -1.0664 S13:  -0.0926                       
REMARK   3      S21:   0.5993 S22:  -0.2386 S23:  -0.9009                       
REMARK   3      S31:  -0.0068 S32:   0.4769 S33:   0.0019                       
REMARK   3   TLS GROUP : 18                                                     
REMARK   3    SELECTION: CHAIN 'A' AND (RESID 78 THROUGH 120 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  61.4884  99.5426   9.5716              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.1993 T22:   0.3750                                     
REMARK   3      T33:   0.5165 T12:  -0.1139                                     
REMARK   3      T13:  -0.0269 T23:   0.0229                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.4588 L22:   2.2821                                     
REMARK   3      L33:   1.8093 L12:  -0.6040                                     
REMARK   3      L13:   0.0980 L23:  -0.5325                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.3216 S12:  -0.0780 S13:   0.5184                       
REMARK   3      S21:   0.4989 S22:  -0.1586 S23:  -1.1876                       
REMARK   3      S31:  -0.4061 S32:   0.7872 S33:  -0.0072                       
REMARK   3   TLS GROUP : 19                                                     
REMARK   3    SELECTION: CHAIN 'A' AND (RESID 121 THROUGH 134 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  50.0350 106.5553  10.2840              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.4495 T22:   0.5133                                     
REMARK   3      T33:   0.5507 T12:  -0.0919                                     
REMARK   3      T13:   0.1386 T23:  -0.1168                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   4.8080 L22:   5.1982                                     
REMARK   3      L33:   4.1485 L12:   0.7423                                     
REMARK   3      L13:   1.2722 L23:   0.4976                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.4506 S12:  -1.1945 S13:  -0.0935                       
REMARK   3      S21:   0.8805 S22:  -0.7618 S23:   1.0566                       
REMARK   3      S31:  -0.5565 S32:  -0.4063 S33:  -0.0203                       
REMARK   3   TLS GROUP : 20                                                     
REMARK   3    SELECTION: CHAIN 'B' AND (RESID 25 THROUGH 49 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  67.3193 108.7102   9.0032              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6107 T22:   0.4870                                     
REMARK   3      T33:   0.7978 T12:  -0.2036                                     
REMARK   3      T13:  -0.0066 T23:  -0.0226                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.4955 L22:   1.0717                                     
REMARK   3      L33:   2.4880 L12:   0.2956                                     
REMARK   3      L13:   0.7685 L23:   0.2049                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0304 S12:  -0.2475 S13:   0.0610                       
REMARK   3      S21:   0.6098 S22:  -0.5493 S23:  -1.1474                       
REMARK   3      S31:  -0.5368 S32:   0.8307 S33:  -0.1388                       
REMARK   3   TLS GROUP : 21                                                     
REMARK   3    SELECTION: CHAIN 'B' AND (RESID 50 THROUGH 75 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  59.2601  94.5953  17.8604              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3074 T22:   0.5245                                     
REMARK   3      T33:   0.3832 T12:   0.0678                                     
REMARK   3      T13:  -0.0659 T23:  -0.0024                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.7205 L22:   6.1909                                     
REMARK   3      L33:   0.9874 L12:   1.7109                                     
REMARK   3      L13:  -0.0566 L23:  -0.7391                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0180 S12:  -0.4520 S13:   0.0071                       
REMARK   3      S21:   1.2143 S22:  -0.0650 S23:  -0.2736                       
REMARK   3      S31:  -0.0054 S32:   0.0307 S33:   0.0643                       
REMARK   3   TLS GROUP : 22                                                     
REMARK   3    SELECTION: CHAIN 'B' AND (RESID 76 THROUGH 102 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  60.1506  82.6925  11.8279              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2638 T22:   0.5897                                     
REMARK   3      T33:   0.4096 T12:   0.0874                                     
REMARK   3      T13:  -0.0230 T23:   0.1089                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.2835 L22:   3.4235                                     
REMARK   3      L33:   0.5764 L12:   0.0076                                     
REMARK   3      L13:   0.3224 L23:  -0.8198                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1590 S12:  -0.1817 S13:   0.0548                       
REMARK   3      S21:  -0.5915 S22:   0.2293 S23:  -0.4864                       
REMARK   3      S31:   0.4300 S32:   0.3161 S33:   0.1261                       
REMARK   3   TLS GROUP : 23                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 15 THROUGH 44 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  35.6843  68.4409  21.3428              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5358 T22:   0.3194                                     
REMARK   3      T33:   0.4058 T12:  -0.0251                                     
REMARK   3      T13:   0.0412 T23:   0.0269                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.8968 L22:   1.6075                                     
REMARK   3      L33:   2.5324 L12:  -1.0599                                     
REMARK   3      L13:   0.5060 L23:   0.7281                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1666 S12:   0.0808 S13:  -0.6830                       
REMARK   3      S21:  -0.3573 S22:   0.2407 S23:   0.3488                       
REMARK   3      S31:   0.4428 S32:   0.0151 S33:  -0.1605                       
REMARK   3   TLS GROUP : 24                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 45 THROUGH 72 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  32.9355  85.2080  26.3936              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3717 T22:   0.3766                                     
REMARK   3      T33:   0.2495 T12:   0.0054                                     
REMARK   3      T13:   0.1016 T23:   0.0735                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.1947 L22:   5.5645                                     
REMARK   3      L33:   0.7939 L12:  -3.3952                                     
REMARK   3      L13:   0.4820 L23:   0.6094                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.4340 S12:  -0.8270 S13:  -0.1648                       
REMARK   3      S21:   0.0259 S22:   0.7027 S23:   0.2206                       
REMARK   3      S31:  -0.2078 S32:   0.1686 S33:   0.0433                       
REMARK   3   TLS GROUP : 25                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 73 THROUGH 79 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  18.3580  96.8430  23.7279              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2703 T22:   0.8002                                     
REMARK   3      T33:   0.3186 T12:   0.0626                                     
REMARK   3      T13:  -0.0606 T23:   0.0207                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   4.6532 L22:   4.9455                                     
REMARK   3      L33:   2.2447 L12:  -1.0052                                     
REMARK   3      L13:  -2.5038 L23:  -1.5201                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.5635 S12:  -0.9157 S13:  -0.1688                       
REMARK   3      S21:   0.2940 S22:   0.7282 S23:  -0.2767                       
REMARK   3      S31:  -0.1703 S32:  -1.3193 S33:  -0.0052                       
REMARK   3   TLS GROUP : 26                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 80 THROUGH 89 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  29.3231  97.5309  18.9306              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2541 T22:   0.4772                                     
REMARK   3      T33:   0.1984 T12:  -0.0002                                     
REMARK   3      T13:   0.0487 T23:   0.0465                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.6068 L22:   1.2179                                     
REMARK   3      L33:   0.5622 L12:  -0.7601                                     
REMARK   3      L13:   0.9423 L23:  -0.3944                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.2845 S12:   0.2418 S13:  -0.0097                       
REMARK   3      S21:   0.1492 S22:   0.1991 S23:   0.1188                       
REMARK   3      S31:  -0.3184 S32:  -0.5476 S33:  -0.0480                       
REMARK   3   TLS GROUP : 27                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 90 THROUGH 96 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  40.4434  94.7753  20.7828              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.0172 T22:   0.3182                                     
REMARK   3      T33:   0.4609 T12:   0.0012                                     
REMARK   3      T13:   0.0248 T23:  -0.0676                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.9922 L22:   3.4427                                     
REMARK   3      L33:   4.3148 L12:   0.6083                                     
REMARK   3      L13:  -0.8689 L23:  -0.9444                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1513 S12:  -0.1437 S13:   0.1501                       
REMARK   3      S21:   0.0008 S22:  -0.2614 S23:  -0.5238                       
REMARK   3      S31:  -0.0936 S32:   0.9181 S33:  -1.4756                       
REMARK   3   TLS GROUP : 28                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 97 THROUGH 101 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  37.3980  92.8994  11.0128              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5009 T22:   0.3353                                     
REMARK   3      T33:   0.3040 T12:   0.0246                                     
REMARK   3      T13:  -0.0024 T23:  -0.0019                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.4505 L22:   6.5423                                     
REMARK   3      L33:   8.9277 L12:  -0.7409                                     
REMARK   3      L13:   3.5847 L23:  -2.4840                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.6904 S12:   0.5189 S13:   0.4384                       
REMARK   3      S21:  -0.5658 S22:  -0.0602 S23:  -1.0125                       
REMARK   3      S31:   0.6017 S32:   0.4569 S33:  -0.0325                       
REMARK   3   TLS GROUP : 29                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 102 THROUGH 111 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  29.4864 102.8808  13.6992              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2908 T22:   0.3195                                     
REMARK   3      T33:   0.1843 T12:   0.0288                                     
REMARK   3      T13:   0.0619 T23:   0.0657                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.4092 L22:   4.5557                                     
REMARK   3      L33:   0.5417 L12:  -0.4084                                     
REMARK   3      L13:   0.1462 L23:   0.2230                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0288 S12:   0.2258 S13:  -0.2106                       
REMARK   3      S21:  -0.3165 S22:   0.5739 S23:  -0.0451                       
REMARK   3      S31:  -0.2910 S32:  -0.0188 S33:   0.0341                       
REMARK   3   TLS GROUP : 30                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 112 THROUGH 120 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  35.2114 123.7005  14.6502              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.9312 T22:   0.8985                                     
REMARK   3      T33:   0.9549 T12:   0.1109                                     
REMARK   3      T13:  -0.0555 T23:  -0.2366                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.9324 L22:   0.4752                                     
REMARK   3      L33:   1.6598 L12:   0.8505                                     
REMARK   3      L13:  -0.2498 L23:  -0.4514                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0272 S12:  -0.3764 S13:   1.9649                       
REMARK   3      S21:   0.8797 S22:   0.1767 S23:  -0.1678                       
REMARK   3      S31:  -1.1065 S32:  -0.3065 S33:  -0.1638                       
REMARK   3   TLS GROUP : 31                                                     
REMARK   3    SELECTION: CHAIN 'D' AND (RESID 28 THROUGH 52 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  22.6424  80.6206  22.7109              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6137 T22:   0.4085                                     
REMARK   3      T33:   0.2967 T12:  -0.1682                                     
REMARK   3      T13:   0.0251 T23:   0.0695                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.1519 L22:   0.4277                                     
REMARK   3      L33:   1.6744 L12:   0.1407                                     
REMARK   3      L13:   0.2722 L23:  -0.6906                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1299 S12:  -0.0455 S13:  -0.2432                       
REMARK   3      S21:   0.3825 S22:  -0.1658 S23:   0.5013                       
REMARK   3      S31:   0.7047 S32:  -0.7070 S33:   0.0876                       
REMARK   3   TLS GROUP : 32                                                     
REMARK   3    SELECTION: CHAIN 'D' AND (RESID 53 THROUGH 81 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  38.4818  80.2396  14.6818              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3998 T22:   0.2552                                     
REMARK   3      T33:   0.2417 T12:  -0.0383                                     
REMARK   3      T13:   0.0227 T23:  -0.0107                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   6.2435 L22:   1.9767                                     
REMARK   3      L33:   2.2534 L12:  -2.1733                                     
REMARK   3      L13:  -0.0970 L23:   0.2368                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0371 S12:   0.6828 S13:  -0.0967                       
REMARK   3      S21:  -0.1260 S22:  -0.1759 S23:  -0.0858                       
REMARK   3      S31:   0.7491 S32:  -0.1372 S33:  -0.0640                       
REMARK   3   TLS GROUP : 33                                                     
REMARK   3    SELECTION: CHAIN 'D' AND (RESID 82 THROUGH 121 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  45.5591  76.7593  26.4415              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6176 T22:   0.4110                                     
REMARK   3      T33:   0.3783 T12:   0.2300                                     
REMARK   3      T13:   0.0794 T23:   0.1024                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.4887 L22:   0.8570                                     
REMARK   3      L33:   1.4152 L12:  -0.0184                                     
REMARK   3      L13:   0.8711 L23:  -0.8686                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.5377 S12:   0.0305 S13:  -0.0842                       
REMARK   3      S21:   0.4238 S22:   0.4211 S23:  -0.0727                       
REMARK   3      S31:   0.6129 S32:   0.3164 S33:   0.4663                       
REMARK   3   TLS GROUP : 34                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 39 THROUGH 56 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  23.8723 118.7440   9.7664              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6343 T22:   0.4380                                     
REMARK   3      T33:   0.4322 T12:   0.1673                                     
REMARK   3      T13:   0.0534 T23:  -0.1281                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.5227 L22:   5.7478                                     
REMARK   3      L33:   3.5905 L12:   1.2291                                     
REMARK   3      L13:  -0.7986 L23:  -0.4734                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1094 S12:  -0.1105 S13:   0.7131                       
REMARK   3      S21:  -0.0346 S22:   0.4047 S23:   0.9499                       
REMARK   3      S31:  -0.6243 S32:  -0.8444 S33:   0.1715                       
REMARK   3   TLS GROUP : 35                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 57 THROUGH 78 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  23.1304  96.4902  -5.8569              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3791 T22:   0.5365                                     
REMARK   3      T33:   0.2981 T12:  -0.0038                                     
REMARK   3      T13:  -0.0705 T23:  -0.0400                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.6128 L22:   3.6614                                     
REMARK   3      L33:   2.6700 L12:  -0.1381                                     
REMARK   3      L13:   1.1448 L23:   1.2318                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.1526 S12:   0.0593 S13:  -0.1451                       
REMARK   3      S21:  -1.0130 S22:  -0.1041 S23:   0.5094                       
REMARK   3      S31:  -0.4714 S32:  -0.0355 S33:  -0.0429                       
REMARK   3   TLS GROUP : 36                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 79 THROUGH 85 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  23.1323  83.4224 -11.3389              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5774 T22:   0.7442                                     
REMARK   3      T33:   0.4529 T12:  -0.0811                                     
REMARK   3      T13:  -0.1314 T23:  -0.1461                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.7089 L22:   2.8843                                     
REMARK   3      L33:   0.4189 L12:   0.2599                                     
REMARK   3      L13:  -0.3197 L23:  -0.9932                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.3863 S12:   1.0623 S13:  -0.6338                       
REMARK   3      S21:  -0.7662 S22:  -0.7980 S23:   1.1109                       
REMARK   3      S31:   0.6323 S32:  -0.7022 S33:  -0.3702                       
REMARK   3   TLS GROUP : 37                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 86 THROUGH 120 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  34.5082 105.5658   2.8024              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2705 T22:   0.1507                                     
REMARK   3      T33:   0.3440 T12:   0.1356                                     
REMARK   3      T13:   0.0648 T23:  -0.0331                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.3608 L22:   1.7015                                     
REMARK   3      L33:   1.5154 L12:   0.3165                                     
REMARK   3      L13:   0.4409 L23:   0.4521                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.3189 S12:   0.1339 S13:   0.2354                       
REMARK   3      S21:   0.0887 S22:  -0.1001 S23:   0.0140                       
REMARK   3      S31:  -0.0633 S32:  -0.4060 S33:   0.0857                       
REMARK   3   TLS GROUP : 38                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 121 THROUGH 130 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  44.4056 108.0556  -2.3793              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3844 T22:   0.1960                                     
REMARK   3      T33:   0.4055 T12:   0.1977                                     
REMARK   3      T13:   0.1607 T23:  -0.0274                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.3925 L22:   1.9050                                     
REMARK   3      L33:   1.5448 L12:  -1.4871                                     
REMARK   3      L13:   1.2006 L23:  -1.7073                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0447 S12:   0.1901 S13:  -0.0379                       
REMARK   3      S21:  -0.2884 S22:  -0.5725 S23:   0.0996                       
REMARK   3      S31:   0.0903 S32:  -0.1446 S33:  -1.2320                       
REMARK   3   TLS GROUP : 39                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 131 THROUGH 135 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  45.8173 100.6839  -2.4830              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.8899 T22:   0.4045                                     
REMARK   3      T33:   0.6848 T12:  -0.0271                                     
REMARK   3      T13:   0.2428 T23:   0.0224                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   8.4170 L22:   3.5193                                     
REMARK   3      L33:   4.6400 L12:  -0.3713                                     
REMARK   3      L13:   5.3455 L23:   1.4898                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0941 S12:   1.6713 S13:   0.2386                       
REMARK   3      S21:  -1.7656 S22:   0.0061 S23:  -1.8701                       
REMARK   3      S31:  -0.0210 S32:   0.7368 S33:  -0.0942                       
REMARK   3   TLS GROUP : 40                                                     
REMARK   3    SELECTION: CHAIN 'F' AND (RESID 19 THROUGH 24 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  19.8753  95.7554 -19.6522              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.7180 T22:   0.9284                                     
REMARK   3      T33:   0.3297 T12:   0.0478                                     
REMARK   3      T13:   0.0351 T23:  -0.0684                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   5.2534 L22:   8.2671                                     
REMARK   3      L33:   3.9294 L12:   3.0474                                     
REMARK   3      L13:  -0.8701 L23:  -2.9710                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.5575 S12:   0.0634 S13:  -0.3180                       
REMARK   3      S21:  -0.6619 S22:  -0.4300 S23:  -0.6717                       
REMARK   3      S31:  -0.0415 S32:  -0.3308 S33:  -0.0674                       
REMARK   3   TLS GROUP : 41                                                     
REMARK   3    SELECTION: CHAIN 'F' AND (RESID 25 THROUGH 49 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  27.9587 110.7331  -1.4715              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5058 T22:   0.2683                                     
REMARK   3      T33:   0.4099 T12:   0.1949                                     
REMARK   3      T13:   0.0398 T23:   0.0397                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.1581 L22:   0.1870                                     
REMARK   3      L33:   2.6944 L12:   0.0124                                     
REMARK   3      L13:   0.4822 L23:  -0.2620                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0492 S12:   0.2937 S13:   0.3982                       
REMARK   3      S21:  -0.5960 S22:  -0.3104 S23:   0.1734                       
REMARK   3      S31:  -0.1510 S32:  -0.4767 S33:  -0.1753                       
REMARK   3   TLS GROUP : 42                                                     
REMARK   3    SELECTION: CHAIN 'F' AND (RESID 50 THROUGH 82 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  31.9735  90.8442  -7.4967              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3102 T22:   0.3891                                     
REMARK   3      T33:   0.2206 T12:  -0.0192                                     
REMARK   3      T13:   0.0055 T23:  -0.0836                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.8315 L22:   3.8489                                     
REMARK   3      L33:   1.0015 L12:   0.2929                                     
REMARK   3      L13:   0.0292 L23:   0.9043                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.4867 S12:   0.3802 S13:  -0.1609                       
REMARK   3      S21:  -0.2090 S22:   0.7880 S23:  -0.5165                       
REMARK   3      S31:   0.0608 S32:  -0.2748 S33:   0.0795                       
REMARK   3   TLS GROUP : 43                                                     
REMARK   3    SELECTION: CHAIN 'F' AND (RESID 83 THROUGH 102 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  32.7693  86.1628   3.6712              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2943 T22:   0.2873                                     
REMARK   3      T33:   0.2934 T12:   0.0142                                     
REMARK   3      T13:   0.0093 T23:  -0.0529                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.7000 L22:   1.2985                                     
REMARK   3      L33:   3.5934 L12:  -0.3228                                     
REMARK   3      L13:   0.9639 L23:   1.1617                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.3701 S12:  -0.0630 S13:  -0.3029                       
REMARK   3      S21:   0.2822 S22:   0.0438 S23:   0.3122                       
REMARK   3      S31:   0.9118 S32:  -0.0093 S33:  -0.0048                       
REMARK   3   TLS GROUP : 44                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 14 THROUGH 26 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  57.6242  63.0571 -13.7248              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.9481 T22:   0.4517                                     
REMARK   3      T33:   0.8920 T12:   0.1605                                     
REMARK   3      T13:   0.4070 T23:  -0.2974                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.6838 L22:   2.5007                                     
REMARK   3      L33:   3.3317 L12:  -0.0151                                     
REMARK   3      L13:   2.5712 L23:   1.3182                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.3149 S12:   0.5831 S13:  -0.8711                       
REMARK   3      S21:   0.0572 S22:  -0.0064 S23:   0.2224                       
REMARK   3      S31:   0.9912 S32:   0.5204 S33:   1.3979                       
REMARK   3   TLS GROUP : 45                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 27 THROUGH 36 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  53.5158  64.8841  -1.2892              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.8415 T22:   0.3866                                     
REMARK   3      T33:   0.7184 T12:   0.1199                                     
REMARK   3      T13:   0.1075 T23:   0.0137                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   5.5663 L22:   0.5398                                     
REMARK   3      L33:   4.2442 L12:   0.3944                                     
REMARK   3      L13:  -3.7075 L23:  -0.4968                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0723 S12:  -0.4527 S13:  -1.0877                       
REMARK   3      S21:   0.3627 S22:  -0.4772 S23:  -0.8961                       
REMARK   3      S31:   0.0978 S32:   0.7302 S33:  -0.0100                       
REMARK   3   TLS GROUP : 46                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 37 THROUGH 46 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  44.5082  65.1070   0.5924              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6964 T22:   0.7515                                     
REMARK   3      T33:   0.4723 T12:   0.2591                                     
REMARK   3      T13:   0.1187 T23:  -0.1305                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.4293 L22:   3.7958                                     
REMARK   3      L33:   2.1084 L12:   1.5295                                     
REMARK   3      L13:   0.8524 L23:  -0.1664                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.3540 S12:  -0.1698 S13:   0.1349                       
REMARK   3      S21:   0.2304 S22:  -0.6919 S23:   0.4896                       
REMARK   3      S31:   0.3196 S32:  -0.3969 S33:  -0.0593                       
REMARK   3   TLS GROUP : 47                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 47 THROUGH 72 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  58.5252  79.9926 -13.7023              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.7286 T22:   0.6901                                     
REMARK   3      T33:   0.4571 T12:   0.1318                                     
REMARK   3      T13:   0.1977 T23:  -0.0588                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.0682 L22:   1.7004                                     
REMARK   3      L33:   0.7277 L12:   1.1102                                     
REMARK   3      L13:   1.2754 L23:   0.9632                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.6236 S12:   1.4804 S13:  -0.3494                       
REMARK   3      S21:  -1.1767 S22:   0.5617 S23:  -0.4066                       
REMARK   3      S31:  -0.0341 S32:   0.1621 S33:   0.0674                       
REMARK   3   TLS GROUP : 48                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 73 THROUGH 80 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  73.7419  88.6878 -12.0699              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.7449 T22:   0.7785                                     
REMARK   3      T33:   0.8064 T12:   0.3208                                     
REMARK   3      T13:   0.3367 T23:   0.1646                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.0056 L22:   0.9491                                     
REMARK   3      L33:   2.4772 L12:   0.2033                                     
REMARK   3      L13:   0.9123 L23:  -0.1884                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0175 S12:   0.3023 S13:   0.5773                       
REMARK   3      S21:  -0.3284 S22:  -0.5894 S23:  -0.4820                       
REMARK   3      S31:   0.0676 S32:   0.0072 S33:  -1.0287                       
REMARK   3   TLS GROUP : 49                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 81 THROUGH 89 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  63.4262  92.4151  -8.8487              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.4183 T22:   0.6297                                     
REMARK   3      T33:   0.5837 T12:   0.1343                                     
REMARK   3      T13:   0.1877 T23:  -0.0101                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.7010 L22:   2.5085                                     
REMARK   3      L33:   0.6284 L12:   1.3269                                     
REMARK   3      L13:   0.6627 L23:   1.2537                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.4460 S12:   0.4596 S13:  -0.3888                       
REMARK   3      S21:  -0.5671 S22:   0.0953 S23:   0.1608                       
REMARK   3      S31:   0.4026 S32:   0.8624 S33:  -0.5278                       
REMARK   3   TLS GROUP : 50                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 90 THROUGH 101 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  53.3624  90.7091  -6.3182              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5298 T22:   0.3338                                     
REMARK   3      T33:   0.4475 T12:   0.0273                                     
REMARK   3      T13:   0.1530 T23:   0.0676                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   4.1632 L22:   3.9034                                     
REMARK   3      L33:   5.9519 L12:   0.1219                                     
REMARK   3      L13:   0.6444 L23:  -0.3090                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0920 S12:   0.8046 S13:   0.4662                       
REMARK   3      S21:  -0.1242 S22:  -0.1962 S23:   0.9479                       
REMARK   3      S31:  -0.0984 S32:  -0.3505 S33:  -0.0118                       
REMARK   3   TLS GROUP : 51                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 102 THROUGH 111 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  64.4944  98.2274  -4.5290              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.4440 T22:   0.4813                                     
REMARK   3      T33:   0.5598 T12:  -0.1324                                     
REMARK   3      T13:   0.0519 T23:   0.0158                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.1690 L22:   3.8293                                     
REMARK   3      L33:   0.7442 L12:   0.7411                                     
REMARK   3      L13:   0.0140 L23:  -0.5898                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.2056 S12:   0.0837 S13:   0.2192                       
REMARK   3      S21:   0.1780 S22:   0.0646 S23:  -0.5961                       
REMARK   3      S31:  -1.0810 S32:   0.7053 S33:   0.0951                       
REMARK   3   TLS GROUP : 52                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 112 THROUGH 119 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  61.1728 117.7313  -8.5479              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.9118 T22:   0.7331                                     
REMARK   3      T33:   1.0727 T12:  -0.0643                                     
REMARK   3      T13:   0.1669 T23:   0.2252                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.2659 L22:   0.2288                                     
REMARK   3      L33:   2.0434 L12:  -0.3064                                     
REMARK   3      L13:  -0.8812 L23:   0.4152                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.2496 S12:   0.8638 S13:   0.8072                       
REMARK   3      S21:   0.0566 S22:  -0.5894 S23:  -0.6900                       
REMARK   3      S31:  -0.2212 S32:  -0.5060 S33:  -0.0268                       
REMARK   3   TLS GROUP : 53                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 29 THROUGH 34 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  65.1283  68.2014   1.8873              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.2247 T22:   0.5547                                     
REMARK   3      T33:   0.5649 T12:   0.0453                                     
REMARK   3      T13:   0.0021 T23:  -0.0281                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.4174 L22:   2.8610                                     
REMARK   3      L33:   8.4705 L12:  -3.0345                                     
REMARK   3      L13:   5.3244 L23:  -4.8996                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.2744 S12:  -0.5404 S13:   0.8392                       
REMARK   3      S21:  -0.3062 S22:  -0.3124 S23:   0.2085                       
REMARK   3      S31:   0.7005 S32:  -0.2139 S33:  -0.0002                       
REMARK   3   TLS GROUP : 54                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 35 THROUGH 52 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  68.3065  76.3388 -13.9303              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5616 T22:   0.8205                                     
REMARK   3      T33:   0.7498 T12:   0.3954                                     
REMARK   3      T13:   0.4591 T23:   0.0411                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.9763 L22:   1.1218                                     
REMARK   3      L33:   1.3011 L12:   0.4309                                     
REMARK   3      L13:   1.1308 L23:   0.4432                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.2344 S12:   0.5689 S13:   0.0267                       
REMARK   3      S21:  -0.4986 S22:   0.1849 S23:  -0.5605                       
REMARK   3      S31:  -0.1559 S32:   0.6618 S33:   1.9792                       
REMARK   3   TLS GROUP : 55                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 53 THROUGH 81 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  51.8775  77.5863  -1.1694              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.4860 T22:   0.4010                                     
REMARK   3      T33:   0.3911 T12:   0.1198                                     
REMARK   3      T13:   0.0900 T23:  -0.0580                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.7580 L22:   1.2539                                     
REMARK   3      L33:   1.4031 L12:   0.9330                                     
REMARK   3      L13:  -0.0722 L23:  -0.3542                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0835 S12:  -0.7253 S13:   0.0035                       
REMARK   3      S21:  -0.3242 S22:  -0.2289 S23:  -0.3059                       
REMARK   3      S31:   0.2024 S32:   0.2017 S33:  -0.0341                       
REMARK   3   TLS GROUP : 56                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 82 THROUGH 87 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  37.0605  66.6074  -1.5037              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6005 T22:   0.2998                                     
REMARK   3      T33:   0.5699 T12:   0.0931                                     
REMARK   3      T13:   0.0063 T23:  -0.1686                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   6.3441 L22:   0.1644                                     
REMARK   3      L33:   3.5558 L12:   0.7996                                     
REMARK   3      L13:  -4.6624 L23:  -0.5663                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.3553 S12:   0.5399 S13:  -0.6970                       
REMARK   3      S21:  -0.4898 S22:  -0.1729 S23:   0.0433                       
REMARK   3      S31:  -0.2132 S32:   0.1933 S33:   0.0616                       
REMARK   3   TLS GROUP : 57                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 88 THROUGH 100 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  42.1947  77.0195  -8.8871              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5120 T22:   0.2559                                     
REMARK   3      T33:   0.2027 T12:  -0.0933                                     
REMARK   3      T13:  -0.0631 T23:  -0.1096                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.7472 L22:   2.6616                                     
REMARK   3      L33:   0.5303 L12:  -2.3492                                     
REMARK   3      L13:  -1.1366 L23:   1.1696                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0307 S12:  -0.1226 S13:   0.4746                       
REMARK   3      S21:  -0.9739 S22:  -0.1708 S23:  -0.0027                       
REMARK   3      S31:  -0.1516 S32:  -0.5086 S33:  -0.1293                       
REMARK   3   TLS GROUP : 58                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 101 THROUGH 121 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  48.1280  72.3466 -17.8824              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.8271 T22:   0.4956                                     
REMARK   3      T33:   0.3862 T12:   0.0147                                     
REMARK   3      T13:   0.0730 T23:  -0.1478                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.8167 L22:   7.1874                                     
REMARK   3      L33:   1.1581 L12:  -0.1976                                     
REMARK   3      L13:   1.0604 L23:   1.8696                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.4196 S12:   1.0392 S13:  -0.0854                       
REMARK   3      S21:  -1.1874 S22:   0.3928 S23:  -0.6884                       
REMARK   3      S31:  -0.4380 S32:   0.1858 S33:   0.0889                       
REMARK   3                                                                      
REMARK   3  NCS DETAILS                                                         
REMARK   3   NUMBER OF NCS GROUPS : NULL                                        
REMARK   3                                                                      
REMARK   3  OTHER REFINEMENT REMARKS: NULL                                      
REMARK   4                                                                      
REMARK   4 5ONG COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY PDBE ON 03-AUG-17.                  
REMARK 100 THE DEPOSITION ID IS D_1200006072.                                   
REMARK 200                                                                      
REMARK 200 EXPERIMENTAL DETAILS                                                 
REMARK 200  EXPERIMENT TYPE                : X-RAY DIFFRACTION                  
REMARK 200  DATE OF DATA COLLECTION        : 11-SEP-14                          
REMARK 200  TEMPERATURE           (KELVIN) : 90                                 
REMARK 200  PH                             : 6                                  
REMARK 200  NUMBER OF CRYSTALS USED        : 1                                  
REMARK 200                                                                      
REMARK 200  SYNCHROTRON              (Y/N) : Y                                  
REMARK 200  RADIATION SOURCE               : SLS                                
REMARK 200  BEAMLINE                       : X06SA                              
REMARK 200  X-RAY GENERATOR MODEL          : NULL                               
REMARK 200  MONOCHROMATIC OR LAUE    (M/L) : M                                  
REMARK 200  WAVELENGTH OR RANGE        (A) : 1.0                                
REMARK 200  MONOCHROMATOR                  : NULL                               
REMARK 200  OPTICS                         : NULL                               
REMARK 200                                                                      
REMARK 200  DETECTOR TYPE                  : PIXEL                              
REMARK 200  DETECTOR MANUFACTURER          : DECTRIS PILATUS 6M-F               
REMARK 200  INTENSITY-INTEGRATION SOFTWARE : XDS                                
REMARK 200  DATA SCALING SOFTWARE          : SCALA                              
REMARK 200                                                                      
REMARK 200  NUMBER OF UNIQUE REFLECTIONS   : 47952                              
REMARK 200  RESOLUTION RANGE HIGH      (A) : 2.797                              
REMARK 200  RESOLUTION RANGE LOW       (A) : 29.540                             
REMARK 200  REJECTION CRITERIA  (SIGMA(I)) : NULL                               
REMARK 200                                                                      
REMARK 200 OVERALL.                                                             
REMARK 200  COMPLETENESS FOR RANGE     (%) : 90.3                               
REMARK 200  DATA REDUNDANCY                : 3.300                              
REMARK 200  R MERGE                    (I) : 0.08400                            
REMARK 200  R SYM                      (I) : NULL                               
REMARK 200  <I/SIGMA(I)> FOR THE DATA SET  : 12.7000                            
REMARK 200                                                                      
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.                                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 2.80                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE LOW  (A) : 2.95                     
REMARK 200  COMPLETENESS FOR SHELL     (%) : 68.0                               
REMARK 200  DATA REDUNDANCY IN SHELL       : NULL                               
REMARK 200  R MERGE FOR SHELL          (I) : 0.23100                            
REMARK 200  R SYM FOR SHELL            (I) : NULL                               
REMARK 200  <I/SIGMA(I)> FOR SHELL         : 2.500                              
REMARK 200                                                                      
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH                              
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: MOLECULAR REPLACEMENT        
REMARK 200 SOFTWARE USED: PHASER                                                
REMARK 200 STARTING MODEL: 1KX5                                                 
REMARK 200                                                                      
REMARK 200 REMARK: HOLLOW HEXAGONAL RODS                                        
REMARK 280                                                                      
REMARK 280 CRYSTAL                                                              
REMARK 280 SOLVENT CONTENT, VS   (%): 59.09                                     
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 3.01                     
REMARK 280                                                                      
REMARK 280 CRYSTALLIZATION CONDITIONS: SAMPLE WAS MIXED IN A 1:1 RATIO WITH     
REMARK 280  10 MM NA-CACODYLATE, PH 6.0, 130-180 MM MNCL2, 100-160 MM KCL       
REMARK 280  AND EQUILIBRATED AGAINST A 1:4 DILUTION OF THE SAME SOLUTION,       
REMARK 280  VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 295K                     
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY                                            
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 21 21 21                       
REMARK 290                                                                      
REMARK 290      SYMOP   SYMMETRY                                                
REMARK 290     NNNMMM   OPERATOR                                                
REMARK 290       1555   X,Y,Z                                                   
REMARK 290       2555   -X+1/2,-Y,Z+1/2                                         
REMARK 290       3555   -X,Y+1/2,-Z+1/2                                         
REMARK 290       4555   X+1/2,-Y+1/2,-Z                                         
REMARK 290                                                                      
REMARK 290     WHERE NNN -> OPERATOR NUMBER                                     
REMARK 290           MMM -> TRANSLATION VECTOR                                  
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS                            
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM             
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY                
REMARK 290 RELATED MOLECULES.                                                   
REMARK 290   SMTRY1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   2 -1.000000  0.000000  0.000000       53.12000            
REMARK 290   SMTRY2   2  0.000000 -1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   2  0.000000  0.000000  1.000000       54.74500            
REMARK 290   SMTRY1   3 -1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   3  0.000000  1.000000  0.000000       91.56500            
REMARK 290   SMTRY3   3  0.000000  0.000000 -1.000000       54.74500            
REMARK 290   SMTRY1   4  1.000000  0.000000  0.000000       53.12000            
REMARK 290   SMTRY2   4  0.000000 -1.000000  0.000000       91.56500            
REMARK 290   SMTRY3   4  0.000000  0.000000 -1.000000        0.00000            
REMARK 290                                                                      
REMARK 290 REMARK: NULL                                                         
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: DECAMERIC                         
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: DECAMERIC                  
REMARK 350 SOFTWARE USED: PISA                                                  
REMARK 350 TOTAL BURIED SURFACE AREA: 60470 ANGSTROM**2                         
REMARK 350 SURFACE AREA OF THE COMPLEX: 72040 ANGSTROM**2                       
REMARK 350 CHANGE IN SOLVENT FREE ENERGY: -518.0 KCAL/MOL                       
REMARK 350 APPLY THE FOLLOWING TO CHAINS: I, J, A, B, C, D, E, F, G, H          
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     ALA A     1                                                      
REMARK 465     ARG A     2                                                      
REMARK 465     THR A     3                                                      
REMARK 465     LYS A     4                                                      
REMARK 465     GLN A     5                                                      
REMARK 465     THR A     6                                                      
REMARK 465     ALA A     7                                                      
REMARK 465     ARG A     8                                                      
REMARK 465     LYS A     9                                                      
REMARK 465     SER A    10                                                      
REMARK 465     THR A    11                                                      
REMARK 465     GLY A    12                                                      
REMARK 465     GLY A    13                                                      
REMARK 465     LYS A    14                                                      
REMARK 465     ALA A    15                                                      
REMARK 465     PRO A    16                                                      
REMARK 465     ARG A    17                                                      
REMARK 465     LYS A    18                                                      
REMARK 465     GLN A    19                                                      
REMARK 465     LEU A    20                                                      
REMARK 465     ALA A    21                                                      
REMARK 465     THR A    22                                                      
REMARK 465     LYS A    23                                                      
REMARK 465     ALA A    24                                                      
REMARK 465     ALA A    25                                                      
REMARK 465     ARG A    26                                                      
REMARK 465     LYS A    27                                                      
REMARK 465     SER A    28                                                      
REMARK 465     ALA A    29                                                      
REMARK 465     PRO A    30                                                      
REMARK 465     ALA A    31                                                      
REMARK 465     THR A    32                                                      
REMARK 465     GLY A    33                                                      
REMARK 465     GLY A    34                                                      
REMARK 465     VAL A    35                                                      
REMARK 465     LYS A    36                                                      
REMARK 465     LYS A    37                                                      
REMARK 465     PRO A    38                                                      
REMARK 465     ALA A   135                                                      
REMARK 465     MET B     0                                                      
REMARK 465     SER B     1                                                      
REMARK 465     GLY B     2                                                      
REMARK 465     ARG B     3                                                      
REMARK 465     GLY B     4                                                      
REMARK 465     LYS B     5                                                      
REMARK 465     GLY B     6                                                      
REMARK 465     GLY B     7                                                      
REMARK 465     LYS B     8                                                      
REMARK 465     GLY B     9                                                      
REMARK 465     LEU B    10                                                      
REMARK 465     GLY B    11                                                      
REMARK 465     LYS B    12                                                      
REMARK 465     GLY B    13                                                      
REMARK 465     GLY B    14                                                      
REMARK 465     ALA B    15                                                      
REMARK 465     LYS B    16                                                      
REMARK 465     ARG B    17                                                      
REMARK 465     HIS B    18                                                      
REMARK 465     ARG B    19                                                      
REMARK 465     LYS B    20                                                      
REMARK 465     VAL B    21                                                      
REMARK 465     LEU B    22                                                      
REMARK 465     ARG B    23                                                      
REMARK 465     ASP B    24                                                      
REMARK 465     SER C     1                                                      
REMARK 465     GLY C     2                                                      
REMARK 465     ARG C     3                                                      
REMARK 465     GLY C     4                                                      
REMARK 465     LYS C     5                                                      
REMARK 465     GLN C     6                                                      
REMARK 465     GLY C     7                                                      
REMARK 465     GLY C     8                                                      
REMARK 465     LYS C     9                                                      
REMARK 465     THR C    10                                                      
REMARK 465     ARG C    11                                                      
REMARK 465     ALA C    12                                                      
REMARK 465     LYS C    13                                                      
REMARK 465     ALA C    14                                                      
REMARK 465     GLU C   121                                                      
REMARK 465     SER C   122                                                      
REMARK 465     SER C   123                                                      
REMARK 465     LYS C   124                                                      
REMARK 465     SER C   125                                                      
REMARK 465     ALA C   126                                                      
REMARK 465     LYS C   127                                                      
REMARK 465     SER C   128                                                      
REMARK 465     LYS C   129                                                      
REMARK 465     ALA D     1                                                      
REMARK 465     LYS D     2                                                      
REMARK 465     SER D     3                                                      
REMARK 465     ALA D     4                                                      
REMARK 465     PRO D     5                                                      
REMARK 465     ALA D     6                                                      
REMARK 465     PRO D     7                                                      
REMARK 465     LYS D     8                                                      
REMARK 465     LYS D     9                                                      
REMARK 465     GLY D    10                                                      
REMARK 465     SER D    11                                                      
REMARK 465     LYS D    12                                                      
REMARK 465     LYS D    13                                                      
REMARK 465     ALA D    14                                                      
REMARK 465     VAL D    15                                                      
REMARK 465     THR D    16                                                      
REMARK 465     LYS D    17                                                      
REMARK 465     THR D    18                                                      
REMARK 465     GLN D    19                                                      
REMARK 465     LYS D    20                                                      
REMARK 465     LYS D    21                                                      
REMARK 465     ASP D    22                                                      
REMARK 465     GLY D    23                                                      
REMARK 465     LYS D    24                                                      
REMARK 465     LYS D    25                                                      
REMARK 465     ARG D    26                                                      
REMARK 465     ARG D    27                                                      
REMARK 465     LYS D   122                                                      
REMARK 465     ALA E     1                                                      
REMARK 465     ARG E     2                                                      
REMARK 465     THR E     3                                                      
REMARK 465     LYS E     4                                                      
REMARK 465     GLN E     5                                                      
REMARK 465     THR E     6                                                      
REMARK 465     ALA E     7                                                      
REMARK 465     ARG E     8                                                      
REMARK 465     LYS E     9                                                      
REMARK 465     SER E    10                                                      
REMARK 465     THR E    11                                                      
REMARK 465     GLY E    12                                                      
REMARK 465     GLY E    13                                                      
REMARK 465     LYS E    14                                                      
REMARK 465     ALA E    15                                                      
REMARK 465     PRO E    16                                                      
REMARK 465     ARG E    17                                                      
REMARK 465     LYS E    18                                                      
REMARK 465     GLN E    19                                                      
REMARK 465     LEU E    20                                                      
REMARK 465     ALA E    21                                                      
REMARK 465     THR E    22                                                      
REMARK 465     LYS E    23                                                      
REMARK 465     ALA E    24                                                      
REMARK 465     ALA E    25                                                      
REMARK 465     ARG E    26                                                      
REMARK 465     LYS E    27                                                      
REMARK 465     SER E    28                                                      
REMARK 465     ALA E    29                                                      
REMARK 465     PRO E    30                                                      
REMARK 465     ALA E    31                                                      
REMARK 465     THR E    32                                                      
REMARK 465     GLY E    33                                                      
REMARK 465     GLY E    34                                                      
REMARK 465     VAL E    35                                                      
REMARK 465     LYS E    36                                                      
REMARK 465     LYS E    37                                                      
REMARK 465     PRO E    38                                                      
REMARK 465     MET F     0                                                      
REMARK 465     SER F     1                                                      
REMARK 465     GLY F     2                                                      
REMARK 465     ARG F     3                                                      
REMARK 465     GLY F     4                                                      
REMARK 465     LYS F     5                                                      
REMARK 465     GLY F     6                                                      
REMARK 465     GLY F     7                                                      
REMARK 465     LYS F     8                                                      
REMARK 465     GLY F     9                                                      
REMARK 465     LEU F    10                                                      
REMARK 465     GLY F    11                                                      
REMARK 465     LYS F    12                                                      
REMARK 465     GLY F    13                                                      
REMARK 465     GLY F    14                                                      
REMARK 465     ALA F    15                                                      
REMARK 465     LYS F    16                                                      
REMARK 465     ARG F    17                                                      
REMARK 465     HIS F    18                                                      
REMARK 465     SER G     1                                                      
REMARK 465     GLY G     2                                                      
REMARK 465     ARG G     3                                                      
REMARK 465     GLY G     4                                                      
REMARK 465     LYS G     5                                                      
REMARK 465     GLN G     6                                                      
REMARK 465     GLY G     7                                                      
REMARK 465     GLY G     8                                                      
REMARK 465     LYS G     9                                                      
REMARK 465     THR G    10                                                      
REMARK 465     ARG G    11                                                      
REMARK 465     ALA G    12                                                      
REMARK 465     LYS G    13                                                      
REMARK 465     THR G   120                                                      
REMARK 465     GLU G   121                                                      
REMARK 465     SER G   122                                                      
REMARK 465     SER G   123                                                      
REMARK 465     LYS G   124                                                      
REMARK 465     SER G   125                                                      
REMARK 465     ALA G   126                                                      
REMARK 465     LYS G   127                                                      
REMARK 465     SER G   128                                                      
REMARK 465     LYS G   129                                                      
REMARK 465     ALA H     1                                                      
REMARK 465     LYS H     2                                                      
REMARK 465     SER H     3                                                      
REMARK 465     ALA H     4                                                      
REMARK 465     PRO H     5                                                      
REMARK 465     ALA H     6                                                      
REMARK 465     PRO H     7                                                      
REMARK 465     LYS H     8                                                      
REMARK 465     LYS H     9                                                      
REMARK 465     GLY H    10                                                      
REMARK 465     SER H    11                                                      
REMARK 465     LYS H    12                                                      
REMARK 465     LYS H    13                                                      
REMARK 465     ALA H    14                                                      
REMARK 465     VAL H    15                                                      
REMARK 465     THR H    16                                                      
REMARK 465     LYS H    17                                                      
REMARK 465     THR H    18                                                      
REMARK 465     GLN H    19                                                      
REMARK 465     LYS H    20                                                      
REMARK 465     LYS H    21                                                      
REMARK 465     ASP H    22                                                      
REMARK 465     GLY H    23                                                      
REMARK 465     LYS H    24                                                      
REMARK 465     LYS H    25                                                      
REMARK 465     ARG H    26                                                      
REMARK 465     ARG H    27                                                      
REMARK 465     LYS H    28                                                      
REMARK 465     LYS H   122                                                      
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   O    ARG F    40     O    HOH F   201              1.95            
REMARK 500   N2    DG I    56     O2    DC J   -56              2.06            
REMARK 500   OP2   DC J   -27     O    HOH J   201              2.15            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500     DG I -34   O4' -  C1' -  N9  ANGL. DEV. =   2.0 DEGREES          
REMARK 500     DG I   5   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG I  14   O4' -  C1' -  N9  ANGL. DEV. =   1.9 DEGREES          
REMARK 500     DG I  25   O4' -  C1' -  N9  ANGL. DEV. =   2.1 DEGREES          
REMARK 500     DG I  27   O4' -  C1' -  N9  ANGL. DEV. =   2.3 DEGREES          
REMARK 500     DA J -46   O4' -  C1' -  N9  ANGL. DEV. =   1.8 DEGREES          
REMARK 500     DT J -40   O4' -  C1' -  N1  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG J -34   O4' -  C1' -  N9  ANGL. DEV. =   1.9 DEGREES          
REMARK 500     DT J -29   O4' -  C1' -  N1  ANGL. DEV. =   1.9 DEGREES          
REMARK 500     DG J  14   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG J  25   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG J  27   O4' -  C1' -  N9  ANGL. DEV. =   1.9 DEGREES          
REMARK 500     DC J  59   O4' -  C1' -  N1  ANGL. DEV. =   2.0 DEGREES          
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    CYS A  40      -62.60   -163.79                                   
REMARK 500    ASN C  38       60.82     28.10                                   
REMARK 500    LEU C  97       42.33    -97.77                                   
REMARK 500    ARG F  95       69.54   -113.41                                   
REMARK 500    LEU G  97       33.77    -97.22                                   
REMARK 500    SER H 120       36.61    -75.48                                   
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 525                                                                      
REMARK 525 SOLVENT                                                              
REMARK 525                                                                      
REMARK 525 THE SOLVENT MOLECULES HAVE CHAIN IDENTIFIERS THAT                    
REMARK 525 INDICATE THE POLYMER CHAIN WITH WHICH THEY ARE MOST                  
REMARK 525 CLOSELY ASSOCIATED. THE REMARK LISTS ALL THE SOLVENT                 
REMARK 525 MOLECULES WHICH ARE MORE THAN 5A AWAY FROM THE                       
REMARK 525 NEAREST POLYMER CHAIN (M = MODEL NUMBER;                             
REMARK 525 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE                  
REMARK 525 NUMBER; I=INSERTION CODE):                                           
REMARK 525                                                                      
REMARK 525  M RES CSSEQI                                                        
REMARK 525    HOH J 217        DISTANCE = 10.00 ANGSTROMS                       
REMARK 620                                                                      
REMARK 620 METAL COORDINATION                                                   
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):                             
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN I 110  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1  DG I -35   N7                                                     
REMARK 620 2  DG I -34   O6   81.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN I 107  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1  DG I  27   N7                                                     
REMARK 620 2 HOH J 208   O    97.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN I 103  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1  DG I  55   N7                                                     
REMARK 620 2  DG I  56   N7  106.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN J 103  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1  DG J -35   N7                                                     
REMARK 620 2  DG J -34   O6   91.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN J 104  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 G47 J  70   N7                                                     
REMARK 620 2  DG J  71   O6  106.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN E 201  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 ASP E  77   OD1                                                    
REMARK 620 2 HOH F 206   O   137.2                                              
REMARK 620 3 VAL D  45   O    41.2 105.1                                        
REMARK 620 4 HOH D 301   O    73.0  72.5  75.3                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN J 109  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HOH J 204   O                                                      
REMARK 620 2 HOH J 203   O    57.7                                              
REMARK 620 N                    1                                               
REMARK 800                                                                      
REMARK 800 SITE                                                                 
REMARK 800 SITE_IDENTIFIER: AC1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 101                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 102                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 103                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 105                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 106                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 107                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 108                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 109                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 110                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 101                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 102                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 103                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 104                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 106                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 107                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 108                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 109                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue CL A 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue CL D 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN E 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue CL E 202                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue CL G 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for Di-peptide CYS E 40 and G47 J     
REMARK 800  70                                                                  
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: 5OMX   RELATED DB: PDB                                   
REMARK 900 RELATED X-RAY STRUCTURE                                              
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 CONSTRUCTS WERE ALL SEQUENCED AND THE EXPRESSED PROTEIN MW WAS       
REMARK 999 CONFIRMED BY MASS SPEC: 30268543:42-452 EXPRESSION VECTOR PET3-H3    
REMARK 999 H3 GENE FOR XENOPUS LAEVIS-LIKE HISTONE H3                           
REMARK 999 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 
REMARK 999 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 
REMARK 999 30268542|EMB|CAD89678.1| XENOPUS LAEVIS-LIKE HISTONE H2B             
REMARK 999 [EXPRESSION VECTOR PET3-H2B]                                         
REMARK 999                                                                      
REMARK 999 MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVF 
DBREF  5ONG I  -73    73  PDB    5ONG     5ONG           -73     73             
DBREF  5ONG J  -73    73  PDB    5ONG     5ONG           -73     73             
DBREF  5ONG A    1   135  UNP    P84233   H32_XENLA        2    136             
DBREF  5ONG B    0   102  UNP    P62799   H4_XENLA         1    103             
DBREF  5ONG C    1   129  UNP    Q6AZJ8   Q6AZJ8_XENLA     2    130             
DBREF  5ONG D    1   122  UNP    P02281   H2B11_XENLA      5    126             
DBREF  5ONG E    1   135  UNP    P84233   H32_XENLA        2    136             
DBREF  5ONG F    0   102  UNP    P62799   H4_XENLA         1    103             
DBREF  5ONG G    1   129  UNP    Q6AZJ8   Q6AZJ8_XENLA     2    130             
DBREF  5ONG H    1   122  UNP    P02281   H2B11_XENLA      5    126             
SEQADV 5ONG CYS A   40  UNP  P84233    ARG    41 ENGINEERED MUTATION            
SEQADV 5ONG ALA A  102  UNP  P84233    GLY   103 CONFLICT                       
SEQADV 5ONG ALA A  110  UNP  P84233    CYS   111 ENGINEERED MUTATION            
SEQADV 5ONG THR D   29  UNP  P02281    SER    33 CONFLICT                       
SEQADV 5ONG CYS E   40  UNP  P84233    ARG    41 ENGINEERED MUTATION            
SEQADV 5ONG ALA E  102  UNP  P84233    GLY   103 CONFLICT                       
SEQADV 5ONG ALA E  110  UNP  P84233    CYS   111 ENGINEERED MUTATION            
SEQADV 5ONG THR H   29  UNP  P02281    SER    33 CONFLICT                       
SEQRES   1 I  147   DA  DT  DC  DC  DA  DT  DA  DT  DC  DC  DA  DC  DC          
SEQRES   2 I  147   DT  DG  DG  DT  DC  DC  DT  DA  DC  DT  DA  DC  DC          
SEQRES   3 I  147   DA  DA  DA  DA  DG  DT  DG  DT  DA  DT  DT  DT  DG          
SEQRES   4 I  147   DG  DA  DA  DA  DC  DT  DG  DC  DT  DC  DC  DA  DT          
SEQRES   5 I  147   DC  DA  DA  DA  DA  DG  DG  DC  DA  DT  DG  DT  DT          
SEQRES   6 I  147   DC  DA  DG  DC  DT  DG  DG  DA  DA  DT  DC  DC  DA          
SEQRES   7 I  147   DG  DC  DT  DG  DA  DA  DC  DA  DT  DG  DC  DC  DT          
SEQRES   8 I  147   DT  DT  DT  DG  DA  DT  DG  DG  DA  DG  DC  DA  DG          
SEQRES   9 I  147   DT  DT  DT  DC  DC  DA  DA  DA  DT  DA  DC  DA  DC          
SEQRES  10 I  147   DT  DT  DT  DT  DG  DG  DT  DA  DG  DT  DA  DG  DG          
SEQRES  11 I  147   DA  DC  DC  DA  DG  DG  DT  DG  DG  DA  DT  DA  DT          
SEQRES  12 I  147  G47  DG  DA  DT                                              
SEQRES   1 J  147   DA  DT  DC  DC  DA  DT  DA  DT  DC  DC  DA  DC  DC          
SEQRES   2 J  147   DT  DG  DG  DT  DC  DC  DT  DA  DC  DT  DA  DC  DC          
SEQRES   3 J  147   DA  DA  DA  DA  DG  DT  DG  DT  DA  DT  DT  DT  DG          
SEQRES   4 J  147   DG  DA  DA  DA  DC  DT  DG  DC  DT  DC  DC  DA  DT          
SEQRES   5 J  147   DC  DA  DA  DA  DA  DG  DG  DC  DA  DT  DG  DT  DT          
SEQRES   6 J  147   DC  DA  DG  DC  DT  DG  DG  DA  DT  DT  DC  DC  DA          
SEQRES   7 J  147   DG  DC  DT  DG  DA  DA  DC  DA  DT  DG  DC  DC  DT          
SEQRES   8 J  147   DT  DT  DT  DG  DA  DT  DG  DG  DA  DG  DC  DA  DG          
SEQRES   9 J  147   DT  DT  DT  DC  DC  DA  DA  DA  DT  DA  DC  DA  DC          
SEQRES  10 J  147   DT  DT  DT  DT  DG  DG  DT  DA  DG  DT  DA  DG  DG          
SEQRES  11 J  147   DA  DC  DC  DA  DG  DG  DT  DG  DG  DA  DT  DA  DT          
SEQRES  12 J  147  G47  DG  DA  DT                                              
SEQRES   1 A  135  ALA ARG THR LYS GLN THR ALA ARG LYS SER THR GLY GLY          
SEQRES   2 A  135  LYS ALA PRO ARG LYS GLN LEU ALA THR LYS ALA ALA ARG          
SEQRES   3 A  135  LYS SER ALA PRO ALA THR GLY GLY VAL LYS LYS PRO HIS          
SEQRES   4 A  135  CYS TYR ARG PRO GLY THR VAL ALA LEU ARG GLU ILE ARG          
SEQRES   5 A  135  ARG TYR GLN LYS SER THR GLU LEU LEU ILE ARG LYS LEU          
SEQRES   6 A  135  PRO PHE GLN ARG LEU VAL ARG GLU ILE ALA GLN ASP PHE          
SEQRES   7 A  135  LYS THR ASP LEU ARG PHE GLN SER SER ALA VAL MET ALA          
SEQRES   8 A  135  LEU GLN GLU ALA SER GLU ALA TYR LEU VAL ALA LEU PHE          
SEQRES   9 A  135  GLU ASP THR ASN LEU ALA ALA ILE HIS ALA LYS ARG VAL          
SEQRES  10 A  135  THR ILE MET PRO LYS ASP ILE GLN LEU ALA ARG ARG ILE          
SEQRES  11 A  135  ARG GLY GLU ARG ALA                                          
SEQRES   1 B  103  MET SER GLY ARG GLY LYS GLY GLY LYS GLY LEU GLY LYS          
SEQRES   2 B  103  GLY GLY ALA LYS ARG HIS ARG LYS VAL LEU ARG ASP ASN          
SEQRES   3 B  103  ILE GLN GLY ILE THR LYS PRO ALA ILE ARG ARG LEU ALA          
SEQRES   4 B  103  ARG ARG GLY GLY VAL LYS ARG ILE SER GLY LEU ILE TYR          
SEQRES   5 B  103  GLU GLU THR ARG GLY VAL LEU LYS VAL PHE LEU GLU ASN          
SEQRES   6 B  103  VAL ILE ARG ASP ALA VAL THR TYR THR GLU HIS ALA LYS          
SEQRES   7 B  103  ARG LYS THR VAL THR ALA MET ASP VAL VAL TYR ALA LEU          
SEQRES   8 B  103  LYS ARG GLN GLY ARG THR LEU TYR GLY PHE GLY GLY              
SEQRES   1 C  129  SER GLY ARG GLY LYS GLN GLY GLY LYS THR ARG ALA LYS          
SEQRES   2 C  129  ALA LYS THR ARG SER SER ARG ALA GLY LEU GLN PHE PRO          
SEQRES   3 C  129  VAL GLY ARG VAL HIS ARG LEU LEU ARG LYS GLY ASN TYR          
SEQRES   4 C  129  ALA GLU ARG VAL GLY ALA GLY ALA PRO VAL TYR LEU ALA          
SEQRES   5 C  129  ALA VAL LEU GLU TYR LEU THR ALA GLU ILE LEU GLU LEU          
SEQRES   6 C  129  ALA GLY ASN ALA ALA ARG ASP ASN LYS LYS THR ARG ILE          
SEQRES   7 C  129  ILE PRO ARG HIS LEU GLN LEU ALA VAL ARG ASN ASP GLU          
SEQRES   8 C  129  GLU LEU ASN LYS LEU LEU GLY ARG VAL THR ILE ALA GLN          
SEQRES   9 C  129  GLY GLY VAL LEU PRO ASN ILE GLN SER VAL LEU LEU PRO          
SEQRES  10 C  129  LYS LYS THR GLU SER SER LYS SER ALA LYS SER LYS              
SEQRES   1 D  122  ALA LYS SER ALA PRO ALA PRO LYS LYS GLY SER LYS LYS          
SEQRES   2 D  122  ALA VAL THR LYS THR GLN LYS LYS ASP GLY LYS LYS ARG          
SEQRES   3 D  122  ARG LYS THR ARG LYS GLU SER TYR ALA ILE TYR VAL TYR          
SEQRES   4 D  122  LYS VAL LEU LYS GLN VAL HIS PRO ASP THR GLY ILE SER          
SEQRES   5 D  122  SER LYS ALA MET SER ILE MET ASN SER PHE VAL ASN ASP          
SEQRES   6 D  122  VAL PHE GLU ARG ILE ALA GLY GLU ALA SER ARG LEU ALA          
SEQRES   7 D  122  HIS TYR ASN LYS ARG SER THR ILE THR SER ARG GLU ILE          
SEQRES   8 D  122  GLN THR ALA VAL ARG LEU LEU LEU PRO GLY GLU LEU ALA          
SEQRES   9 D  122  LYS HIS ALA VAL SER GLU GLY THR LYS ALA VAL THR LYS          
SEQRES  10 D  122  TYR THR SER ALA LYS                                          
SEQRES   1 E  135  ALA ARG THR LYS GLN THR ALA ARG LYS SER THR GLY GLY          
SEQRES   2 E  135  LYS ALA PRO ARG LYS GLN LEU ALA THR LYS ALA ALA ARG          
SEQRES   3 E  135  LYS SER ALA PRO ALA THR GLY GLY VAL LYS LYS PRO HIS          
SEQRES   4 E  135  CYS TYR ARG PRO GLY THR VAL ALA LEU ARG GLU ILE ARG          
SEQRES   5 E  135  ARG TYR GLN LYS SER THR GLU LEU LEU ILE ARG LYS LEU          
SEQRES   6 E  135  PRO PHE GLN ARG LEU VAL ARG GLU ILE ALA GLN ASP PHE          
SEQRES   7 E  135  LYS THR ASP LEU ARG PHE GLN SER SER ALA VAL MET ALA          
SEQRES   8 E  135  LEU GLN GLU ALA SER GLU ALA TYR LEU VAL ALA LEU PHE          
SEQRES   9 E  135  GLU ASP THR ASN LEU ALA ALA ILE HIS ALA LYS ARG VAL          
SEQRES  10 E  135  THR ILE MET PRO LYS ASP ILE GLN LEU ALA ARG ARG ILE          
SEQRES  11 E  135  ARG GLY GLU ARG ALA                                          
SEQRES   1 F  103  MET SER GLY ARG GLY LYS GLY GLY LYS GLY LEU GLY LYS          
SEQRES   2 F  103  GLY GLY ALA LYS ARG HIS ARG LYS VAL LEU ARG ASP ASN          
SEQRES   3 F  103  ILE GLN GLY ILE THR LYS PRO ALA ILE ARG ARG LEU ALA          
SEQRES   4 F  103  ARG ARG GLY GLY VAL LYS ARG ILE SER GLY LEU ILE TYR          
SEQRES   5 F  103  GLU GLU THR ARG GLY VAL LEU LYS VAL PHE LEU GLU ASN          
SEQRES   6 F  103  VAL ILE ARG ASP ALA VAL THR TYR THR GLU HIS ALA LYS          
SEQRES   7 F  103  ARG LYS THR VAL THR ALA MET ASP VAL VAL TYR ALA LEU          
SEQRES   8 F  103  LYS ARG GLN GLY ARG THR LEU TYR GLY PHE GLY GLY              
SEQRES   1 G  129  SER GLY ARG GLY LYS GLN GLY GLY LYS THR ARG ALA LYS          
SEQRES   2 G  129  ALA LYS THR ARG SER SER ARG ALA GLY LEU GLN PHE PRO          
SEQRES   3 G  129  VAL GLY ARG VAL HIS ARG LEU LEU ARG LYS GLY ASN TYR          
SEQRES   4 G  129  ALA GLU ARG VAL GLY ALA GLY ALA PRO VAL TYR LEU ALA          
SEQRES   5 G  129  ALA VAL LEU GLU TYR LEU THR ALA GLU ILE LEU GLU LEU          
SEQRES   6 G  129  ALA GLY ASN ALA ALA ARG ASP ASN LYS LYS THR ARG ILE          
SEQRES   7 G  129  ILE PRO ARG HIS LEU GLN LEU ALA VAL ARG ASN ASP GLU          
SEQRES   8 G  129  GLU LEU ASN LYS LEU LEU GLY ARG VAL THR ILE ALA GLN          
SEQRES   9 G  129  GLY GLY VAL LEU PRO ASN ILE GLN SER VAL LEU LEU PRO          
SEQRES  10 G  129  LYS LYS THR GLU SER SER LYS SER ALA LYS SER LYS              
SEQRES   1 H  122  ALA LYS SER ALA PRO ALA PRO LYS LYS GLY SER LYS LYS          
SEQRES   2 H  122  ALA VAL THR LYS THR GLN LYS LYS ASP GLY LYS LYS ARG          
SEQRES   3 H  122  ARG LYS THR ARG LYS GLU SER TYR ALA ILE TYR VAL TYR          
SEQRES   4 H  122  LYS VAL LEU LYS GLN VAL HIS PRO ASP THR GLY ILE SER          
SEQRES   5 H  122  SER LYS ALA MET SER ILE MET ASN SER PHE VAL ASN ASP          
SEQRES   6 H  122  VAL PHE GLU ARG ILE ALA GLY GLU ALA SER ARG LEU ALA          
SEQRES   7 H  122  HIS TYR ASN LYS ARG SER THR ILE THR SER ARG GLU ILE          
SEQRES   8 H  122  GLN THR ALA VAL ARG LEU LEU LEU PRO GLY GLU LEU ALA          
SEQRES   9 H  122  LYS HIS ALA VAL SER GLU GLY THR LYS ALA VAL THR LYS          
SEQRES  10 H  122  TYR THR SER ALA LYS                                          
HET    G47  I  70      25                                                       
HET    G47  J  70      25                                                       
HET     MN  I 101       1                                                       
HET     MN  I 102       1                                                       
HET     MN  I 103       1                                                       
HET     MN  I 104       1                                                       
HET     MN  I 105       1                                                       
HET     MN  I 106       1                                                       
HET     MN  I 107       1                                                       
HET     MN  I 108       1                                                       
HET     MN  I 109       1                                                       
HET     MN  I 110       1                                                       
HET     MN  J 101       1                                                       
HET     MN  J 102       1                                                       
HET     MN  J 103       1                                                       
HET     MN  J 104       1                                                       
HET     MN  J 105       1                                                       
HET     MN  J 106       1                                                       
HET     MN  J 107       1                                                       
HET     MN  J 108       1                                                       
HET     MN  J 109       1                                                       
HET     CL  A 201       1                                                       
HET     CL  D 201       1                                                       
HET     MN  E 201       1                                                       
HET     CL  E 202       1                                                       
HET     CL  G 201       1                                                       
HETNAM     G47 N2-ETHANETHIOL-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE               
HETNAM      MN MANGANESE (II) ION                                               
HETNAM      CL CHLORIDE ION                                                     
FORMUL   1  G47    2(C12 H18 N5 O7 P S)                                         
FORMUL  11   MN    20(MN 2+)                                                    
FORMUL  30   CL    4(CL 1-)                                                     
FORMUL  35  HOH   *87(H2 O)                                                     
HELIX    1 AA1 GLY A   44  SER A   57  1                                  14    
HELIX    2 AA2 ARG A   63  ASP A   77  1                                  15    
HELIX    3 AA3 GLN A   85  ALA A  114  1                                  30    
HELIX    4 AA4 MET A  120  ARG A  131  1                                  12    
HELIX    5 AA5 ASN B   25  ILE B   29  5                                   5    
HELIX    6 AA6 THR B   30  GLY B   41  1                                  12    
HELIX    7 AA7 LEU B   49  ALA B   76  1                                  28    
HELIX    8 AA8 THR B   82  GLN B   93  1                                  12    
HELIX    9 AA9 THR C   16  GLY C   22  1                                   7    
HELIX   10 AB1 PRO C   26  GLY C   37  1                                  12    
HELIX   11 AB2 ALA C   45  ASN C   73  1                                  29    
HELIX   12 AB3 ILE C   79  ASP C   90  1                                  12    
HELIX   13 AB4 ASP C   90  LEU C   97  1                                   8    
HELIX   14 AB5 GLN C  112  LEU C  116  5                                   5    
HELIX   15 AB6 TYR D   34  HIS D   46  1                                  13    
HELIX   16 AB7 SER D   52  ASN D   81  1                                  30    
HELIX   17 AB8 THR D   87  LEU D   99  1                                  13    
HELIX   18 AB9 PRO D  100  SER D  120  1                                  21    
HELIX   19 AC1 GLY E   44  SER E   57  1                                  14    
HELIX   20 AC2 ARG E   63  LYS E   79  1                                  17    
HELIX   21 AC3 GLN E   85  ALA E  114  1                                  30    
HELIX   22 AC4 MET E  120  ARG E  131  1                                  12    
HELIX   23 AC5 ASP F   24  ILE F   29  5                                   6    
HELIX   24 AC6 THR F   30  GLY F   41  1                                  12    
HELIX   25 AC7 LEU F   49  ALA F   76  1                                  28    
HELIX   26 AC8 THR F   82  GLN F   93  1                                  12    
HELIX   27 AC9 THR G   16  ALA G   21  1                                   6    
HELIX   28 AD1 PRO G   26  GLY G   37  1                                  12    
HELIX   29 AD2 GLY G   46  ASN G   73  1                                  28    
HELIX   30 AD3 ILE G   79  ASP G   90  1                                  12    
HELIX   31 AD4 ASP G   90  LEU G   97  1                                   8    
HELIX   32 AD5 GLN G  112  LEU G  116  5                                   5    
HELIX   33 AD6 TYR H   34  HIS H   46  1                                  13    
HELIX   34 AD7 SER H   52  ASN H   81  1                                  30    
HELIX   35 AD8 THR H   87  LEU H   99  1                                  13    
HELIX   36 AD9 PRO H  100  SER H  120  1                                  21    
SHEET    1 AA1 2 ARG A  83  PHE A  84  0                                        
SHEET    2 AA1 2 THR B  80  VAL B  81  1  O  VAL B  81   N  ARG A  83           
SHEET    1 AA2 2 THR A 118  ILE A 119  0                                        
SHEET    2 AA2 2 ARG B  45  ILE B  46  1  O  ARG B  45   N  ILE A 119           
SHEET    1 AA3 2 THR B  96  TYR B  98  0                                        
SHEET    2 AA3 2 VAL G 100  ILE G 102  1  O  THR G 101   N  TYR B  98           
SHEET    1 AA4 2 ARG C  42  VAL C  43  0                                        
SHEET    2 AA4 2 THR D  85  ILE D  86  1  O  ILE D  86   N  ARG C  42           
SHEET    1 AA5 2 ARG C  77  ILE C  78  0                                        
SHEET    2 AA5 2 GLY D  50  ILE D  51  1  O  GLY D  50   N  ILE C  78           
SHEET    1 AA6 2 VAL C 100  ILE C 102  0                                        
SHEET    2 AA6 2 THR F  96  TYR F  98  1  O  TYR F  98   N  THR C 101           
SHEET    1 AA7 2 ARG E  83  PHE E  84  0                                        
SHEET    2 AA7 2 THR F  80  VAL F  81  1  O  VAL F  81   N  ARG E  83           
SHEET    1 AA8 2 THR E 118  ILE E 119  0                                        
SHEET    2 AA8 2 ARG F  45  ILE F  46  1  O  ARG F  45   N  ILE E 119           
SHEET    1 AA9 2 ARG G  42  VAL G  43  0                                        
SHEET    2 AA9 2 THR H  85  ILE H  86  1  O  ILE H  86   N  ARG G  42           
SHEET    1 AB1 2 ARG G  77  ILE G  78  0                                        
SHEET    2 AB1 2 GLY H  50  ILE H  51  1  O  GLY H  50   N  ILE G  78           
LINK         O6   DG I -58                MN    MN I 102     1555   1555  2.28  
LINK         N7   DG I -35                MN    MN I 110     1555   1555  2.71  
LINK         O6   DG I -34                MN    MN I 110     1555   1555  2.77  
LINK         O6   DG I   5                MN    MN I 108     1555   1555  2.16  
LINK         N7   DG I  27                MN    MN I 107     1555   1555  2.69  
LINK         N7   DG I  48                MN    MN I 105     1555   1555  2.67  
LINK         N7   DG I  55                MN    MN I 103     1555   1555  2.56  
LINK         N7   DG I  56                MN    MN I 103     1555   1555  2.46  
LINK         O3'  DT I  69                 P   G47 I  70     1555   1555  1.61  
LINK         O3' G47 I  70                 P    DG I  71     1555   1555  1.61  
LINK         SG  G47 I  70                 SG  CYS A  40     1555   1555  2.09  
LINK         O6   DG I  71                MN    MN I 101     1555   1555  2.11  
LINK         N7   DG J -35                MN    MN J 103     1555   1555  2.48  
LINK         O6   DG J -34                MN    MN J 103     1555   1555  2.36  
LINK         N7   DG J  -3                MN    MN J 108     1555   1555  2.53  
LINK         N7   DG J  27                MN    MN J 107     1555   1555  2.35  
LINK         N7   DG J  61                MN    MN J 106     1555   1555  2.71  
LINK         O3'  DT J  69                 P   G47 J  70     1555   1555  1.61  
LINK         O3' G47 J  70                 P    DG J  71     1555   1555  1.61  
LINK         N7  G47 J  70                MN    MN J 104     1555   1555  2.53  
LINK         SG  G47 J  70                 SG  CYS E  40     1555   1555  2.08  
LINK         O6   DG J  71                MN    MN J 104     1555   1555  1.84  
LINK         OD1 ASP E  77                MN    MN E 201     1555   1555  2.34  
LINK        MN    MN I 107                 O   HOH J 208     1555   1555  2.51  
LINK        MN    MN J 109                 O   HOH J 204     1555   1555  2.59  
LINK        MN    MN J 109                 O   HOH J 203     1555   1555  2.67  
LINK        MN    MN E 201                 O   HOH F 206     1555   1555  1.98  
LINK         O   VAL D  45                MN    MN E 201     1555   2565  2.37  
LINK        MN    MN E 201                 O   HOH D 301     1555   2564  2.10  
SITE     1 AC1  2 G47 I  70   DG I  71                                          
SITE     1 AC2  2  DG I -59   DG I -58                                          
SITE     1 AC3  2  DG I  55   DG I  56                                          
SITE     1 AC4  2  DT I  47   DG I  48                                          
SITE     1 AC5  1  DG I  61                                                     
SITE     1 AC6  2  DG I  27  HOH J 208                                          
SITE     1 AC7  1  DG I   5                                                     
SITE     1 AC8  2  DG I  -3   DG I  -2                                          
SITE     1 AC9  2  DG I -35   DG I -34                                          
SITE     1 AD1  1  DG J -59                                                     
SITE     1 AD2  1  DG J -16                                                     
SITE     1 AD3  2  DG J -35   DG J -34                                          
SITE     1 AD4  2 G47 J  70   DG J  71                                          
SITE     1 AD5  1  DG J  61                                                     
SITE     1 AD6  1  DG J  27                                                     
SITE     1 AD7  1  DG J  -3                                                     
SITE     1 AD8  3  DG J  48  HOH J 203  HOH J 204                               
SITE     1 AD9  2 PRO A 121  LYS A 122                                          
SITE     1 AE1  3 GLY C  46  THR D  87  SER D  88                               
SITE     1 AE2  4 VAL D  45  HOH D 301  ASP E  77  HOH F 206                    
SITE     1 AE3  2 PRO E 121  LYS E 122                                          
SITE     1 AE4  4 GLY G  44  GLY G  46  THR H  87  SER H  88                    
SITE     1 AE5 23 HIS E  39  TYR E  41  PRO E  66  PHE E  67                    
SITE     2 AE5 23 GLN E  68  ARG E  69  VAL E  71  ARG E  72                    
SITE     3 AE5 23 GLU E  73  ILE E  74  ILE F  26  ILE F  29                    
SITE     4 AE5 23 LEU F  62   DA I -39   DG I -41   DT I -40                    
SITE     5 AE5 23  DA I -69   DC I -70   DT J  39   DC J  41                    
SITE     6 AE5 23  DT J  69   DG J  71   MN J 104                               
CRYST1  106.240  183.130  109.490  90.00  90.00  90.00 P 21 21 21    8          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.009413  0.000000  0.000000        0.00000                         
SCALE2      0.000000  0.005461  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.009133        0.00000                         
ATOM      1  O5'  DA I -73      23.245 140.311  29.043  1.00177.32           O  
ANISOU    1  O5'  DA I -73    28620  17023  21731    -47   6258  -3898       O  
ATOM      2  C5'  DA I -73      23.305 140.210  27.626  1.00174.19           C  
ANISOU    2  C5'  DA I -73    27597  16719  21868    507   5767  -3409       C  
ATOM      3  C4'  DA I -73      21.965 140.562  27.005  1.00179.28           C  
ANISOU    3  C4'  DA I -73    27493  17256  23368    845   6207  -3603       C  
ATOM      4  O4'  DA I -73      22.111 140.654  25.562  1.00176.76           O  
ANISOU    4  O4'  DA I -73    26545  17000  23617   1431   5691  -3114       O  
ATOM      5  C3'  DA I -73      20.862 139.540  27.232  1.00182.35           C  
ANISOU    5  C3'  DA I -73    27825  17823  23635    656   6607  -3770       C  
ATOM      6  O3'  DA I -73      19.594 140.189  27.190  1.00186.31           O  
ANISOU    6  O3'  DA I -73    27802  18111  24875    799   7244  -4200       O  
ATOM      7  C2'  DA I -73      21.056 138.611  26.043  1.00178.23           C  
ANISOU    7  C2'  DA I -73    26969  17591  23161   1012   5988  -3181       C  
ATOM      8  C1'  DA I -73      21.390 139.607  24.940  1.00177.17           C  
ANISOU    8  C1'  DA I -73    26270  17303  23742   1573   5634  -2919       C  
ATOM      9  N9   DA I -73      22.217 139.047  23.873  1.00174.35           N  
ANISOU    9  N9   DA I -73    25770  17185  23289   1899   4854  -2284       N  
ATOM     10  C8   DA I -73      23.311 138.238  24.012  1.00171.68           C  
ANISOU   10  C8   DA I -73    25946  17075  22209   1699   4315  -1933       C  
ATOM     11  N7   DA I -73      23.863 137.892  22.872  1.00166.76           N  
ANISOU   11  N7   DA I -73    25022  16636  21703   2087   3673  -1396       N  
ATOM     12  C5   DA I -73      23.079 138.520  21.919  1.00166.50           C  
ANISOU   12  C5   DA I -73    24239  16493  22529   2576   3794  -1383       C  
ATOM     13  C6   DA I -73      23.135 138.552  20.511  1.00162.68           C  
ANISOU   13  C6   DA I -73    23147  16116  22548   3135   3330   -936       C  
ATOM     14  N6   DA I -73      24.063 137.908  19.792  1.00157.08           N  
ANISOU   14  N6   DA I -73    22485  15663  21536   3297   2638   -407       N  
ATOM     15  N1   DA I -73      22.198 139.277  19.867  1.00164.18           N  
ANISOU   15  N1   DA I -73    22673  16139  23567   3523   3605  -1059       N  
ATOM     16  C2   DA I -73      21.271 139.921  20.585  1.00168.95           C  
ANISOU   16  C2   DA I -73    23214  16480  24498   3362   4299  -1604       C  
ATOM     17  N3   DA I -73      21.116 139.965  21.905  1.00173.11           N  
ANISOU   17  N3   DA I -73    24262  16890  24621   2847   4803  -2073       N  
ATOM     18  C4   DA I -73      22.060 139.237  22.520  1.00171.59           C  
ANISOU   18  C4   DA I -73    24739  16876  23581   2470   4511  -1926       C  
ATOM     19  P    DT I -72      18.235 139.369  27.449  1.00188.63           P  
ANISOU   19  P    DT I -72    27926  18513  25233    628   7808  -4490       P  
ATOM     20  OP1  DT I -72      17.467 140.110  28.474  1.00196.35           O  
ANISOU   20  OP1  DT I -72    29002  19228  26373    326   8614  -5164       O  
ATOM     21  OP2  DT I -72      18.555 137.942  27.678  1.00184.66           O  
ANISOU   21  OP2  DT I -72    27872  18345  23946    336   7534  -4213       O  
ATOM     22  O5'  DT I -72      17.458 139.486  26.057  1.00185.59           O  
ANISOU   22  O5'  DT I -72    26631  18123  25761   1243   7674  -4274       O  
ATOM     23  C5'  DT I -72      17.210 140.769  25.495  1.00185.39           C  
ANISOU   23  C5'  DT I -72    26054  17804  26580   1651   7764  -4383       C  
ATOM     24  C4'  DT I -72      16.244 140.678  24.326  1.00183.53           C  
ANISOU   24  C4'  DT I -72    24997  17591  27145   2157   7738  -4247       C  
ATOM     25  O4'  DT I -72      16.952 140.268  23.128  1.00178.96           O  
ANISOU   25  O4'  DT I -72    24186  17229  26581   2568   6958  -3597       O  
ATOM     26  C3'  DT I -72      15.094 139.695  24.505  1.00182.75           C  
ANISOU   26  C3'  DT I -72    24760  17641  27034   1998   8149  -4458       C  
ATOM     27  O3'  DT I -72      13.902 140.258  23.966  1.00178.82           O  
ANISOU   27  O3'  DT I -72    23530  16951  27463   2343   8522  -4712       O  
ATOM     28  C2'  DT I -72      15.560 138.459  23.727  1.00179.81           C  
ANISOU   28  C2'  DT I -72    24393  17640  26286   2141   7496  -3876       C  
ATOM     29  C1'  DT I -72      16.406 139.068  22.614  1.00177.60           C  
ANISOU   29  C1'  DT I -72    23801  17343  26335   2646   6829  -3391       C  
ATOM     30  N1   DT I -72      17.550 138.201  22.174  1.00174.39           N  
ANISOU   30  N1   DT I -72    23702  17247  25310   2668   6081  -2813       N  
ATOM     31  C2   DT I -72      17.836 138.086  20.829  1.00169.26           C  
ANISOU   31  C2   DT I -72    22568  16740  25001   3190   5477  -2302       C  
ATOM     32  O2   DT I -72      17.191 138.644  19.959  1.00167.31           O  
ANISOU   32  O2   DT I -72    21657  16385  25530   3645   5506  -2280       O  
ATOM     33  N3   DT I -72      18.912 137.283  20.537  1.00165.90           N  
ANISOU   33  N3   DT I -72    22471  16593  23969   3159   4828  -1819       N  
ATOM     34  C4   DT I -72      19.714 136.604  21.437  1.00165.46           C  
ANISOU   34  C4   DT I -72    23160  16672  23036   2674   4709  -1789       C  
ATOM     35  O4   DT I -72      20.658 135.907  21.079  1.00161.31           O  
ANISOU   35  O4   DT I -72    22863  16386  22043   2690   4099  -1344       O  
ATOM     36  C5   DT I -72      19.364 136.772  22.827  1.00169.34           C  
ANISOU   36  C5   DT I -72    24141  17002  23198   2144   5349  -2322       C  
ATOM     37  C7   DT I -72      20.163 136.078  23.889  1.00167.05           C  
ANISOU   37  C7   DT I -72    24684  16838  21949   1593   5265  -2327       C  
ATOM     38  C6   DT I -72      18.314 137.555  23.126  1.00175.25           C  
ANISOU   38  C6   DT I -72    24577  17489  24520   2164   6005  -2806       C  
ATOM     39  P    DC I -71      12.542 139.406  23.895  1.00191.90           P  
ANISOU   39  P    DC I -71    24830  18713  29372   2314   8947  -4935       P  
ATOM     40  OP1  DC I -71      11.419 140.362  24.012  1.00197.80           O  
ANISOU   40  OP1  DC I -71    25081  19130  30945   2435   9584  -5461       O  
ATOM     41  OP2  DC I -71      12.636 138.272  24.841  1.00189.07           O  
ANISOU   41  OP2  DC I -71    25109  18578  28148   1760   9119  -5017       O  
ATOM     42  O5'  DC I -71      12.551 138.832  22.407  1.00186.36           O  
ANISOU   42  O5'  DC I -71    23564  18236  29007   2863   8295  -4364       O  
ATOM     43  C5'  DC I -71      12.833 139.708  21.324  1.00184.33           C  
ANISOU   43  C5'  DC I -71    22796  17859  29383   3419   7881  -4071       C  
ATOM     44  C4'  DC I -71      12.588 139.031  19.988  1.00180.43           C  
ANISOU   44  C4'  DC I -71    21747  17603  29206   3900   7377  -3613       C  
ATOM     45  O4'  DC I -71      13.754 138.258  19.600  1.00172.69           O  
ANISOU   45  O4'  DC I -71    21110  16934  27572   3906   6669  -3051       O  
ATOM     46  C3'  DC I -71      11.415 138.064  19.949  1.00182.81           C  
ANISOU   46  C3'  DC I -71    21770  18040  29649   3846   7697  -3801       C  
ATOM     47  O3'  DC I -71      10.826 138.115  18.655  1.00183.43           O  
ANISOU   47  O3'  DC I -71    21082  18151  30462   4425   7425  -3573       O  
ATOM     48  C2'  DC I -71      12.089 136.715  20.223  1.00176.54           C  
ANISOU   48  C2'  DC I -71    21523  17604  27951   3524   7358  -3497       C  
ATOM     49  C1'  DC I -71      13.422 136.885  19.502  1.00169.06           C  
ANISOU   49  C1'  DC I -71    20692  16780  26761   3786   6577  -2924       C  
ATOM     50  N1   DC I -71      14.552 136.106  20.098  1.00163.47           N  
ANISOU   50  N1   DC I -71    20732  16296  25083   3386   6244  -2681       N  
ATOM     51  C2   DC I -71      15.567 135.614  19.266  1.00153.43           C  
ANISOU   51  C2   DC I -71    19498  15279  23518   3621   5466  -2088       C  
ATOM     52  O2   DC I -71      15.496 135.814  18.047  1.00147.97           O  
ANISOU   52  O2   DC I -71    18228  14640  23352   4153   5078  -1772       O  
ATOM     53  N3   DC I -71      16.597 134.926  19.820  1.00149.85           N  
ANISOU   53  N3   DC I -71    19715  15008  22212   3258   5156  -1881       N  
ATOM     54  C4   DC I -71      16.636 134.733  21.140  1.00152.00           C  
ANISOU   54  C4   DC I -71    20613  15220  21919   2687   5582  -2227       C  
ATOM     55  N4   DC I -71      17.670 134.050  21.642  1.00147.29           N  
ANISOU   55  N4   DC I -71    20667  14801  20493   2350   5232  -1999       N  
ATOM     56  C5   DC I -71      15.616 135.233  22.005  1.00161.87           C  
ANISOU   56  C5   DC I -71    21850  16225  23428   2436   6385  -2828       C  
ATOM     57  C6   DC I -71      14.606 135.910  21.447  1.00166.45           C  
ANISOU   57  C6   DC I -71    21751  16621  24873   2797   6693  -3041       C  
ATOM     58  P    DC I -70       9.301 137.668  18.413  1.00182.51           P  
ANISOU   58  P    DC I -70    20389  18019  30938   4545   7858  -3887       P  
ATOM     59  OP1  DC I -70       8.590 138.806  17.789  1.00184.74           O  
ANISOU   59  OP1  DC I -70    19991  18001  32200   4994   8017  -4056       O  
ATOM     60  OP2  DC I -70       8.787 137.066  19.663  1.00188.36           O  
ANISOU   60  OP2  DC I -70    21565  18761  31242   3959   8491  -4346       O  
ATOM     61  O5'  DC I -70       9.449 136.537  17.300  1.00175.02           O  
ANISOU   61  O5'  DC I -70    19178  17444  29877   4862   7210  -3351       O  
ATOM     62  C5'  DC I -70      10.682 135.867  17.190  1.00169.45           C  
ANISOU   62  C5'  DC I -70    18950  17023  28412   4759   6610  -2871       C  
ATOM     63  C4'  DC I -70      10.972 135.449  15.771  1.00165.48           C  
ANISOU   63  C4'  DC I -70    18003  16772  28102   5287   5886  -2313       C  
ATOM     64  O4'  DC I -70      12.288 134.850  15.743  1.00161.83           O  
ANISOU   64  O4'  DC I -70    18055  16569  26864   5152   5304  -1860       O  
ATOM     65  C3'  DC I -70      10.075 134.348  15.264  1.00165.55           C  
ANISOU   65  C3'  DC I -70    17622  16999  28280   5409   5876  -2296       C  
ATOM     66  O3'  DC I -70      10.247 134.192  13.860  1.00162.55           O  
ANISOU   66  O3'  DC I -70    16735  16810  28217   5971   5234  -1821       O  
ATOM     67  C2'  DC I -70      10.651 133.167  16.025  1.00164.18           C  
ANISOU   67  C2'  DC I -70    18113  17075  27192   4907   5803  -2210       C  
ATOM     68  C1'  DC I -70      12.154 133.449  15.911  1.00159.01           C  
ANISOU   68  C1'  DC I -70    17894  16504  26019   4912   5228  -1783       C  
ATOM     69  N1   DC I -70      12.945 133.021  17.115  1.00154.26           N  
ANISOU   69  N1   DC I -70    18129  15951  24532   4313   5325  -1850       N  
ATOM     70  C2   DC I -70      14.178 132.382  16.941  1.00143.53           C  
ANISOU   70  C2   DC I -70    17184  14848  22504   4243   4692  -1384       C  
ATOM     71  O2   DC I -70      14.599 132.186  15.795  1.00135.65           O  
ANISOU   71  O2   DC I -70    15851  14040  21652   4674   4078   -931       O  
ATOM     72  N3   DC I -70      14.880 131.999  18.038  1.00143.36           N  
ANISOU   72  N3   DC I -70    17920  14860  21691   3705   4765  -1448       N  
ATOM     73  C4   DC I -70      14.391 132.229  19.258  1.00148.38           C  
ANISOU   73  C4   DC I -70    18907  15300  22169   3247   5442  -1945       C  
ATOM     74  N4   DC I -70      15.119 131.833  20.308  1.00147.57           N  
ANISOU   74  N4   DC I -70    19566  15246  21259   2726   5474  -1981       N  
ATOM     75  C5   DC I -70      13.136 132.875  19.455  1.00155.03           C  
ANISOU   75  C5   DC I -70    19336  15889  23679   3303   6115  -2435       C  
ATOM     76  C6   DC I -70      12.452 133.247  18.368  1.00157.29           C  
ANISOU   76  C6   DC I -70    18864  16130  24767   3840   6026  -2370       C  
ATOM     77  P    DA I -69       9.146 133.406  12.991  1.00164.61           P  
ANISOU   77  P    DA I -69    16460  17347  28735   6164   5034  -1776       P  
ATOM     78  OP1  DA I -69       8.655 134.336  11.951  1.00164.85           O  
ANISOU   78  OP1  DA I -69    16152  17529  28953   6374   4550  -1633       O  
ATOM     79  OP2  DA I -69       8.186 132.786  13.931  1.00167.84           O  
ANISOU   79  OP2  DA I -69    16893  17612  29265   5851   5797  -2285       O  
ATOM     80  O5'  DA I -69       9.974 132.232  12.284  1.00157.34           O  
ANISOU   80  O5'  DA I -69    15611  16797  27374   6329   4374  -1247       O  
ATOM     81  C5'  DA I -69      10.655 132.476  11.054  1.00152.72           C  
ANISOU   81  C5'  DA I -69    14958  16552  26518   6579   3477   -749       C  
ATOM     82  C4'  DA I -69      11.570 131.315  10.686  1.00147.64           C  
ANISOU   82  C4'  DA I -69    14491  16209  25395   6635   2958   -317       C  
ATOM     83  O4'  DA I -69      12.471 131.028  11.791  1.00147.01           O  
ANISOU   83  O4'  DA I -69    15010  15989  24858   6312   3198   -305       O  
ATOM     84  C3'  DA I -69      10.870 129.994  10.388  1.00144.69           C  
ANISOU   84  C3'  DA I -69    13935  16121  24920   6594   2870   -333       C  
ATOM     85  O3'  DA I -69      11.669 129.235   9.472  1.00138.99           O  
ANISOU   85  O3'  DA I -69    13307  15821  23683   6676   2060     98       O  
ATOM     86  C2'  DA I -69      10.837 129.351  11.768  1.00145.12           C  
ANISOU   86  C2'  DA I -69    14368  15962  24808   6212   3542   -602       C  
ATOM     87  C1'  DA I -69      12.223 129.721  12.279  1.00143.05           C  
ANISOU   87  C1'  DA I -69    14757  15689  23905   5962   3290   -382       C  
ATOM     88  N9   DA I -69      12.324 129.751  13.732  1.00142.15           N  
ANISOU   88  N9   DA I -69    15292  15413  23307   5352   3811   -736       N  
ATOM     89  C8   DA I -69      11.476 130.384  14.586  1.00146.07           C  
ANISOU   89  C8   DA I -69    15802  15608  24092   5118   4547  -1264       C  
ATOM     90  N7   DA I -69      11.803 130.259  15.848  1.00147.60           N  
ANISOU   90  N7   DA I -69    16665  15726  23690   4553   4892  -1492       N  
ATOM     91  C5   DA I -69      12.953 129.498  15.822  1.00143.27           C  
ANISOU   91  C5   DA I -69    16576  15437  22422   4409   4329  -1077       C  
ATOM     92  C6   DA I -69      13.787 129.024  16.848  1.00140.48           C  
ANISOU   92  C6   DA I -69    17004  15145  21229   3878   4318  -1057       C  
ATOM     93  N6   DA I -69      13.562 129.270  18.139  1.00142.96           N  
ANISOU   93  N6   DA I -69    17794  15265  21261   3377   4925  -1480       N  
ATOM     94  N1   DA I -69      14.858 128.283  16.496  1.00136.50           N  
ANISOU   94  N1   DA I -69    16773  14908  20183   3881   3655   -592       N  
ATOM     95  C2   DA I -69      15.074 128.041  15.194  1.00134.22           C  
ANISOU   95  C2   DA I -69    16002  14824  20172   4383   3061   -182       C  
ATOM     96  N3   DA I -69      14.354 128.436  14.136  1.00134.59           N  
ANISOU   96  N3   DA I -69    15313  14853  20973   4910   3009   -151       N  
ATOM     97  C4   DA I -69      13.296 129.171  14.526  1.00139.61           C  
ANISOU   97  C4   DA I -69    15696  15208  22142   4895   3662   -613       C  
ATOM     98  P    DT I -68      11.111 127.886   8.794  1.00147.01           P  
ANISOU   98  P    DT I -68    14152  17232  24471   6652   1709    132       P  
ATOM     99  OP1  DT I -68      11.256 128.035   7.329  1.00144.89           O  
ANISOU   99  OP1  DT I -68    13869  17377  23807   6734    906    225       O  
ATOM    100  OP2  DT I -68       9.783 127.581   9.371  1.00153.06           O  
ANISOU  100  OP2  DT I -68    14661  17835  25661   6565   2371   -252       O  
ATOM    101  O5'  DT I -68      12.139 126.762   9.287  1.00134.65           O  
ANISOU  101  O5'  DT I -68    12879  15720  22562   6590   1598    479       O  
ATOM    102  C5'  DT I -68      12.440 126.653  10.666  1.00130.66           C  
ANISOU  102  C5'  DT I -68    12852  14971  21823   6248   2155    354       C  
ATOM    103  C4'  DT I -68      13.570 125.689  10.916  1.00123.10           C  
ANISOU  103  C4'  DT I -68    12452  14270  20049   5960   1697    680       C  
ATOM    104  O4'  DT I -68      14.065 125.882  12.268  1.00124.31           O  
ANISOU  104  O4'  DT I -68    13335  14256  19641   5391   2044    477       O  
ATOM    105  C3'  DT I -68      13.169 124.231  10.837  1.00119.59           C  
ANISOU  105  C3'  DT I -68    11953  14082  19405   5839   1593    713       C  
ATOM    106  O3'  DT I -68      14.285 123.447  10.470  1.00114.80           O  
ANISOU  106  O3'  DT I -68    11607  13765  18245   5833    928   1155       O  
ATOM    107  C2'  DT I -68      12.710 123.945  12.264  1.00122.97           C  
ANISOU  107  C2'  DT I -68    12871  14340  19513   5229   2253    296       C  
ATOM    108  C1'  DT I -68      13.667 124.801  13.091  1.00123.70           C  
ANISOU  108  C1'  DT I -68    13576  14251  19175   4935   2332    283       C  
ATOM    109  N1   DT I -68      13.045 125.352  14.345  1.00128.47           N  
ANISOU  109  N1   DT I -68    14481  14550  19780   4508   3121   -229       N  
ATOM    110  C2   DT I -68      13.628 125.084  15.565  1.00128.82           C  
ANISOU  110  C2   DT I -68    15288  14554  19104   3931   3308   -326       C  
ATOM    111  O2   DT I -68      14.642 124.421  15.691  1.00124.60           O  
ANISOU  111  O2   DT I -68    15201  14206  17933   3747   2849    -10       O  
ATOM    112  N3   DT I -68      12.978 125.630  16.643  1.00134.81           N  
ANISOU  112  N3   DT I -68    16266  15041  19913   3574   4051   -815       N  
ATOM    113  C4   DT I -68      11.829 126.397  16.628  1.00139.96           C  
ANISOU  113  C4   DT I -68    16451  15455  21273   3730   4620  -1220       C  
ATOM    114  O4   DT I -68      11.323 126.843  17.655  1.00145.61           O  
ANISOU  114  O4   DT I -68    17412  15938  21975   3372   5284  -1665       O  
ATOM    115  C5   DT I -68      11.268 126.638  15.319  1.00138.25           C  
ANISOU  115  C5   DT I -68    15434  15280  21813   4345   4373  -1090       C  
ATOM    116  C7   DT I -68      10.019 127.455  15.176  1.00141.49           C  
ANISOU  116  C7   DT I -68    15272  15432  23056   4572   4920  -1501       C  
ATOM    117  C6   DT I -68      11.894 126.109  14.254  1.00134.01           C  
ANISOU  117  C6   DT I -68    14689  15019  21209   4699   3643   -603       C  
ATOM    118  P    DA I -67      14.116 121.876  10.180  1.00116.04           P  
ANISOU  118  P    DA I -67    11688  14234  18167   5774    637   1298       P  
ATOM    119  OP1  DA I -67      14.811 121.587   8.905  1.00112.41           O  
ANISOU  119  OP1  DA I -67    10922  14063  17725   6220   -127   1760       O  
ATOM    120  OP2  DA I -67      12.687 121.516  10.326  1.00117.87           O  
ANISOU  120  OP2  DA I -67    11539  14388  18861   5751   1160    920       O  
ATOM    121  O5'  DA I -67      14.934 121.200  11.374  1.00117.98           O  
ANISOU  121  O5'  DA I -67    12767  14501  17560   5147    659   1318       O  
ATOM    122  C5'  DA I -67      16.226 121.693  11.690  1.00112.11           C  
ANISOU  122  C5'  DA I -67    12543  13728  16326   5005    366   1539       C  
ATOM    123  C4'  DA I -67      16.654 121.277  13.085  1.00106.82           C  
ANISOU  123  C4'  DA I -67    12661  12976  14951   4352    624   1396       C  
ATOM    124  O4'  DA I -67      15.838 121.947  14.081  1.00112.25           O  
ANISOU  124  O4'  DA I -67    13494  13362  15795   4059   1402    918       O  
ATOM    125  C3'  DA I -67      16.550 119.785  13.386  1.00105.87           C  
ANISOU  125  C3'  DA I -67    12744  13057  14425   4051    520   1454       C  
ATOM    126  O3'  DA I -67      17.709 119.386  14.095  1.00104.30           O  
ANISOU  126  O3'  DA I -67    13258  12909  13461   3650    240   1643       O  
ATOM    127  C2'  DA I -67      15.288 119.694  14.253  1.00114.31           C  
ANISOU  127  C2'  DA I -67    13817  13937  15678   3736   1309    974       C  
ATOM    128  C1'  DA I -67      15.377 121.000  15.019  1.00117.66           C  
ANISOU  128  C1'  DA I -67    14530  14058  16117   3570   1764    705       C  
ATOM    129  N9   DA I -67      14.109 121.489  15.559  1.00128.26           N  
ANISOU  129  N9   DA I -67    15673  15158  17901   3461   2547    211       N  
ATOM    130  C8   DA I -67      13.035 121.942  14.848  1.00131.01           C  
ANISOU  130  C8   DA I -67    15307  15428  19043   3870   2786     24       C  
ATOM    131  N7   DA I -67      12.040 122.360  15.594  1.00136.88           N  
ANISOU  131  N7   DA I -67    16025  15930  20054   3650   3528   -450       N  
ATOM    132  C5   DA I -67      12.495 122.175  16.888  1.00138.99           C  
ANISOU  132  C5   DA I -67    17056  16122  19631   3053   3804   -580       C  
ATOM    133  C6   DA I -67      11.905 122.422  18.143  1.00145.63           C  
ANISOU  133  C6   DA I -67    18261  16740  20331   2570   4562  -1041       C  
ATOM    134  N6   DA I -67      10.678 122.930  18.289  1.00150.53           N  
ANISOU  134  N6   DA I -67    18484  17155  21555   2622   5207  -1480       N  
ATOM    135  N1   DA I -67      12.627 122.125  19.245  1.00148.36           N  
ANISOU  135  N1   DA I -67    19397  17083  19891   2029   4628  -1039       N  
ATOM    136  C2   DA I -67      13.855 121.614  19.091  1.00144.49           C  
ANISOU  136  C2   DA I -67    19289  16787  18825   1983   3968   -607       C  
ATOM    137  N3   DA I -67      14.516 121.340  17.963  1.00137.88           N  
ANISOU  137  N3   DA I -67    18158  16162  18069   2403   3233   -162       N  
ATOM    138  C4   DA I -67      13.772 121.646  16.887  1.00135.13           C  
ANISOU  138  C4   DA I -67    17036  15824  18483   2931   3197   -173       C  
ATOM    139  P    DT I -66      17.985 117.838  14.415  1.00110.16           P  
ANISOU  139  P    DT I -66    14332  13869  13655   3316    -30   1807       P  
ATOM    140  OP1  DT I -66      19.448 117.633  14.347  1.00108.63           O  
ANISOU  140  OP1  DT I -66    14563  13806  12906   3253   -678   2191       O  
ATOM    141  OP2  DT I -66      17.085 117.022  13.571  1.00111.29           O  
ANISOU  141  OP2  DT I -66    13850  14188  14246   3612   -100   1822       O  
ATOM    142  O5'  DT I -66      17.532 117.692  15.937  1.00117.98           O  
ANISOU  142  O5'  DT I -66    15910  14657  14259   2681    648   1435       O  
ATOM    143  C5'  DT I -66      18.017 118.618  16.896  1.00124.26           C  
ANISOU  143  C5'  DT I -66    17249  15226  14738   2372    936   1270       C  
ATOM    144  C4'  DT I -66      17.597 118.224  18.298  1.00129.39           C  
ANISOU  144  C4'  DT I -66    18470  15744  14947   1750   1522    954       C  
ATOM    145  O4'  DT I -66      16.307 118.809  18.613  1.00133.82           O  
ANISOU  145  O4'  DT I -66    18735  16101  16011   1738   2283    497       O  
ATOM    146  C3'  DT I -66      17.449 116.724  18.541  1.00129.73           C  
ANISOU  146  C3'  DT I -66    18693  15968  14631   1465   1403   1066       C  
ATOM    147  O3'  DT I -66      17.936 116.431  19.835  1.00131.68           O  
ANISOU  147  O3'  DT I -66    19749  16138  14144    863   1579    998       O  
ATOM    148  C2'  DT I -66      15.934 116.517  18.448  1.00132.92           C  
ANISOU  148  C2'  DT I -66    18589  16315  15600   1533   1988    732       C  
ATOM    149  C1'  DT I -66      15.440 117.802  19.086  1.00137.20           C  
ANISOU  149  C1'  DT I -66    19191  16567  16369   1441   2650    322       C  
ATOM    150  N1   DT I -66      14.045 118.189  18.728  1.00138.83           N  
ANISOU  150  N1   DT I -66    18742  16658  17350   1694   3188    -25       N  
ATOM    151  C2   DT I -66      13.183 118.565  19.731  1.00143.46           C  
ANISOU  151  C2   DT I -66    19500  17018  17989   1340   3993   -493       C  
ATOM    152  O2   DT I -66      13.494 118.577  20.909  1.00145.06           O  
ANISOU  152  O2   DT I -66    20382  17123  17611    822   4293   -635       O  
ATOM    153  N3   DT I -66      11.934 118.929  19.309  1.00145.16           N  
ANISOU  153  N3   DT I -66    19062  17125  18966   1614   4436   -799       N  
ATOM    154  C4   DT I -66      11.468 118.958  18.008  1.00140.62           C  
ANISOU  154  C4   DT I -66    17702  16646  19083   2201   4145   -680       C  
ATOM    155  O4   DT I -66      10.322 119.301  17.731  1.00141.49           O  
ANISOU  155  O4   DT I -66    17261  16634  19864   2410   4576   -987       O  
ATOM    156  C5   DT I -66      12.424 118.558  16.999  1.00134.81           C  
ANISOU  156  C5   DT I -66    16839  16161  18222   2548   3296   -177       C  
ATOM    157  C7   DT I -66      12.034 118.550  15.551  1.00130.99           C  
ANISOU  157  C7   DT I -66    15542  15815  18413   3188   2911     -6       C  
ATOM    158  C6   DT I -66      13.655 118.201  17.403  1.00133.85           C  
ANISOU  158  C6   DT I -66    17345  16144  17368   2280   2871    119       C  
ATOM    159  P    DC I -65      18.312 114.931  20.265  1.00135.46           P  
ANISOU  159  P    DC I -65    20664  16791  14014    480   1286   1224       P  
ATOM    160  OP1  DC I -65      19.780 114.874  20.447  1.00132.68           O  
ANISOU  160  OP1  DC I -65    20854  16504  13053    350    679   1552       O  
ATOM    161  OP2  DC I -65      17.648 113.988  19.338  1.00132.04           O  
ANISOU  161  OP2  DC I -65    19622  16547  14000    777   1095   1342       O  
ATOM    162  O5'  DC I -65      17.615 114.794  21.692  1.00141.68           O  
ANISOU  162  O5'  DC I -65    21967  17402  14462   -126   2057    841       O  
ATOM    163  C5'  DC I -65      17.352 115.964  22.454  1.00147.72           C  
ANISOU  163  C5'  DC I -65    22949  17922  15255   -295   2650    471       C  
ATOM    164  C4'  DC I -65      16.105 115.784  23.293  1.00157.47           C  
ANISOU  164  C4'  DC I -65    24231  19025  16575   -646   3484     44       C  
ATOM    165  O4'  DC I -65      14.950 116.285  22.577  1.00157.52           O  
ANISOU  165  O4'  DC I -65    23459  18961  17429   -241   3852   -208       O  
ATOM    166  C3'  DC I -65      15.790 114.334  23.662  1.00165.41           C  
ANISOU  166  C3'  DC I -65    25439  20160  17248   -987   3500    137       C  
ATOM    167  O3'  DC I -65      15.653 114.226  25.064  1.00181.23           O  
ANISOU  167  O3'  DC I -65    28137  22039  18683  -1608   4039   -106       O  
ATOM    168  C2'  DC I -65      14.473 114.035  22.928  1.00161.90           C  
ANISOU  168  C2'  DC I -65    24212  19741  17562   -675   3801    -34       C  
ATOM    169  C1'  DC I -65      13.864 115.420  22.795  1.00159.88           C  
ANISOU  169  C1'  DC I -65    23582  19282  17885   -420   4279   -392       C  
ATOM    170  N1   DC I -65      12.917 115.564  21.647  1.00151.74           N  
ANISOU  170  N1   DC I -65    21643  18276  17733    126   4315   -469       N  
ATOM    171  C2   DC I -65      11.637 116.086  21.868  1.00155.15           C  
ANISOU  171  C2   DC I -65    21715  18521  18715    133   5068   -932       C  
ATOM    172  O2   DC I -65      11.314 116.407  23.018  1.00159.50           O  
ANISOU  172  O2   DC I -65    22709  18896  18998   -322   5706  -1274       O  
ATOM    173  N3   DC I -65      10.791 116.221  20.815  1.00150.56           N  
ANISOU  173  N3   DC I -65    20307  17957  18942    640   5069  -1000       N  
ATOM    174  C4   DC I -65      11.186 115.861  19.592  1.00142.15           C  
ANISOU  174  C4   DC I -65    18798  17099  18114   1118   4366   -626       C  
ATOM    175  N4   DC I -65      10.321 116.011  18.582  1.00137.60           N  
ANISOU  175  N4   DC I -65    17419  16537  18324   1611   4380   -709       N  
ATOM    176  C5   DC I -65      12.488 115.331  19.349  1.00136.76           C  
ANISOU  176  C5   DC I -65    18474  16618  16873   1113   3612   -159       C  
ATOM    177  C6   DC I -65      13.312 115.203  20.394  1.00139.41           C  
ANISOU  177  C6   DC I -65    19611  16920  16437    614   3612    -99       C  
ATOM    178  P    DC I -64      15.711 112.791  25.780  1.00155.16           P  
ANISOU  178  P    DC I -64    25345  18844  14765  -2111   4001     47       P  
ATOM    179  OP1  DC I -64      16.664 112.892  26.909  1.00159.76           O  
ANISOU  179  OP1  DC I -64    26828  19369  14504  -2607   3947     97       O  
ATOM    180  OP2  DC I -64      15.916 111.764  24.733  1.00149.54           O  
ANISOU  180  OP2  DC I -64    24221  18355  14243  -1793   3346    431       O  
ATOM    181  O5'  DC I -64      14.236 112.622  26.363  1.00163.04           O  
ANISOU  181  O5'  DC I -64    26186  19721  16040  -2365   4899   -391       O  
ATOM    182  C5'  DC I -64      13.411 113.769  26.512  1.00169.70           C  
ANISOU  182  C5'  DC I -64    26742  20368  17369  -2264   5563   -839       C  
ATOM    183  C4'  DC I -64      12.038 113.383  27.019  1.00178.50           C  
ANISOU  183  C4'  DC I -64    27695  21393  18732  -2519   6357  -1216       C  
ATOM    184  O4'  DC I -64      11.034 113.763  26.038  1.00181.94           O  
ANISOU  184  O4'  DC I -64    27235  21792  20102  -2013   6543  -1404       O  
ATOM    185  C3'  DC I -64      11.836 111.891  27.253  1.00176.19           C  
ANISOU  185  C3'  DC I -64    27582  21235  18128  -2824   6282  -1026       C  
ATOM    186  O3'  DC I -64      10.890 111.708  28.291  1.00170.33           O  
ANISOU  186  O3'  DC I -64    27090  20365  17263  -3303   7117  -1402       O  
ATOM    187  C2'  DC I -64      11.276 111.442  25.912  1.00178.22           C  
ANISOU  187  C2'  DC I -64    26964  21613  19140  -2275   5973   -898       C  
ATOM    188  C1'  DC I -64      10.353 112.608  25.596  1.00184.80           C  
ANISOU  188  C1'  DC I -64    27221  22274  20719  -1959   6506  -1314       C  
ATOM    189  N1   DC I -64      10.050 112.751  24.149  1.00187.69           N  
ANISOU  189  N1   DC I -64    26713  22727  21875  -1285   6116  -1201       N  
ATOM    190  C2   DC I -64       8.814 113.271  23.748  1.00194.07           C  
ANISOU  190  C2   DC I -64    26839  23408  23491  -1007   6633  -1573       C  
ATOM    191  O2   DC I -64       7.993 113.609  24.609  1.00200.57           O  
ANISOU  191  O2   DC I -64    27789  24045  24371  -1332   7423  -2003       O  
ATOM    192  N3   DC I -64       8.553 113.391  22.422  1.00192.34           N  
ANISOU  192  N3   DC I -64    25837  23274  23970   -388   6249  -1457       N  
ATOM    193  C4   DC I -64       9.470 113.013  21.526  1.00186.38           C  
ANISOU  193  C4   DC I -64    24974  22730  23111    -61   5410   -998       C  
ATOM    194  N4   DC I -64       9.173 113.149  20.230  1.00183.46           N  
ANISOU  194  N4   DC I -64    23837  22451  23419    544   5059   -898       N  
ATOM    195  C5   DC I -64      10.731 112.478  21.919  1.00181.95           C  
ANISOU  195  C5   DC I -64    25088  22298  21748   -341   4890   -627       C  
ATOM    196  C6   DC I -64      10.976 112.364  23.227  1.00183.73           C  
ANISOU  196  C6   DC I -64    26079  22427  21303   -944   5257   -740       C  
ATOM    197  P    DA I -63      10.692 110.276  28.993  1.00184.53           P  
ANISOU  197  P    DA I -63    29319  22243  18549  -3816   7232  -1273       P  
ATOM    198  OP1  DA I -63      11.791 110.098  29.967  1.00182.90           O  
ANISOU  198  OP1  DA I -63    30045  22059  17391  -4291   7002  -1071       O  
ATOM    199  OP2  DA I -63      10.463 109.253  27.949  1.00177.88           O  
ANISOU  199  OP2  DA I -63    27903  21563  18118  -3481   6766   -992       O  
ATOM    200  O5'  DA I -63       9.320 110.459  29.785  1.00186.55           O  
ANISOU  200  O5'  DA I -63    29516  22325  19040  -4140   8277  -1802       O  
ATOM    201  C5'  DA I -63       8.637 111.709  29.722  1.00186.92           C  
ANISOU  201  C5'  DA I -63    29178  22197  19646  -3931   8822  -2245       C  
ATOM    202  C4'  DA I -63       7.163 111.508  29.421  1.00193.11           C  
ANISOU  202  C4'  DA I -63    29284  22905  21186  -3809   9424  -2585       C  
ATOM    203  O4'  DA I -63       6.905 111.745  28.012  1.00188.39           O  
ANISOU  203  O4'  DA I -63    27807  22357  21416  -3124   9022  -2499       O  
ATOM    204  C3'  DA I -63       6.627 110.116  29.726  1.00201.68           C  
ANISOU  204  C3'  DA I -63    30459  24066  22106  -4142   9588  -2497       C  
ATOM    205  O3'  DA I -63       5.332 110.221  30.289  1.00219.53           O  
ANISOU  205  O3'  DA I -63    32542  26168  24701  -4380  10510  -2981       O  
ATOM    206  C2'  DA I -63       6.603 109.435  28.356  1.00192.70           C  
ANISOU  206  C2'  DA I -63    28614  23088  21514  -3603   8924  -2176       C  
ATOM    207  C1'  DA I -63       6.330 110.600  27.413  1.00190.34           C  
ANISOU  207  C1'  DA I -63    27613  22719  21988  -3001   8874  -2355       C  
ATOM    208  N9   DA I -63       6.945 110.437  26.097  1.00186.94           N  
ANISOU  208  N9   DA I -63    26713  22463  21854  -2427   8003  -1958       N  
ATOM    209  C8   DA I -63       8.236 110.075  25.843  1.00181.89           C  
ANISOU  209  C8   DA I -63    26428  21991  20691  -2381   7202  -1485       C  
ATOM    210  N7   DA I -63       8.534 110.022  24.568  1.00175.64           N  
ANISOU  210  N7   DA I -63    25067  21341  20326  -1813   6541  -1215       N  
ATOM    211  C5   DA I -63       7.356 110.375  23.936  1.00177.06           C  
ANISOU  211  C5   DA I -63    24469  21441  21365  -1454   6917  -1524       C  
ATOM    212  C6   DA I -63       7.015 110.503  22.577  1.00172.23           C  
ANISOU  212  C6   DA I -63    23016  20912  21511   -810   6550  -1452       C  
ATOM    213  N6   DA I -63       7.879 110.277  21.583  1.00167.43           N  
ANISOU  213  N6   DA I -63    22217  20505  20894   -410   5707  -1029       N  
ATOM    214  N1   DA I -63       5.752 110.870  22.279  1.00173.93           N  
ANISOU  214  N1   DA I -63    22594  20999  22494   -595   7081  -1836       N  
ATOM    215  C2   DA I -63       4.891 111.094  23.281  1.00180.89           C  
ANISOU  215  C2   DA I -63    23661  21679  23390  -1004   7942  -2274       C  
ATOM    216  N3   DA I -63       5.095 111.006  24.599  1.00186.24           N  
ANISOU  216  N3   DA I -63    25110  22271  23384  -1627   8382  -2390       N  
ATOM    217  C4   DA I -63       6.362 110.640  24.861  1.00184.18           C  
ANISOU  217  C4   DA I -63    25479  22144  22357  -1822   7817  -1989       C  
ATOM    218  P    DC I -62       4.518 108.903  30.708  1.00201.66           P  
ANISOU  218  P    DC I -62    30317  23931  22373  -4760  10891  -2999       P  
ATOM    219  OP1  DC I -62       3.644 109.264  31.848  1.00210.59           O  
ANISOU  219  OP1  DC I -62    31724  24883  23408  -5242  11898  -3497       O  
ATOM    220  OP2  DC I -62       5.486 107.791  30.848  1.00200.55           O  
ANISOU  220  OP2  DC I -62    30707  23965  21528  -4989  10249  -2487       O  
ATOM    221  O5'  DC I -62       3.607 108.612  29.430  1.00200.53           O  
ANISOU  221  O5'  DC I -62    29143  23814  23236  -4195  10776  -3045       O  
ATOM    222  C5'  DC I -62       2.928 109.686  28.792  1.00201.38           C  
ANISOU  222  C5'  DC I -62    28557  23798  24162  -3736  11029  -3390       C  
ATOM    223  C4'  DC I -62       2.066 109.173  27.657  1.00198.50           C  
ANISOU  223  C4'  DC I -62    27282  23476  24664  -3265  10892  -3397       C  
ATOM    224  O4'  DC I -62       2.807 109.238  26.411  1.00193.32           O  
ANISOU  224  O4'  DC I -62    26234  22982  24239  -2679   9989  -3012       O  
ATOM    225  C3'  DC I -62       1.601 107.726  27.813  1.00196.11           C  
ANISOU  225  C3'  DC I -62    26990  23251  24271  -3541  10963  -3273       C  
ATOM    226  O3'  DC I -62       0.208 107.638  27.552  1.00192.87           O  
ANISOU  226  O3'  DC I -62    25898  22722  24661  -3415  11543  -3661       O  
ATOM    227  C2'  DC I -62       2.431 106.962  26.776  1.00192.34           C  
ANISOU  227  C2'  DC I -62    26318  23005  23756  -3168   9964  -2737       C  
ATOM    228  C1'  DC I -62       2.667 108.023  25.713  1.00190.45           C  
ANISOU  228  C1'  DC I -62    25524  22777  24059  -2521   9559  -2734       C  
ATOM    229  N1   DC I -62       3.907 107.799  24.915  1.00185.14           N  
ANISOU  229  N1   DC I -62    24909  22318  23119  -2198   8567  -2215       N  
ATOM    230  C2   DC I -62       3.852 107.847  23.516  1.00178.87           C  
ANISOU  230  C2   DC I -62    23346  21639  22976  -1538   8007  -2063       C  
ATOM    231  O2   DC I -62       2.769 108.074  22.964  1.00180.27           O  
ANISOU  231  O2   DC I -62    22810  21736  23949  -1228   8328  -2359       O  
ATOM    232  N3   DC I -62       4.994 107.643  22.809  1.00172.07           N  
ANISOU  232  N3   DC I -62    22548  20977  21854  -1261   7126  -1600       N  
ATOM    233  C4   DC I -62       6.141 107.402  23.449  1.00170.22           C  
ANISOU  233  C4   DC I -62    23088  20811  20778  -1612   6799  -1304       C  
ATOM    234  N4   DC I -62       7.242 107.206  22.716  1.00163.08           N  
ANISOU  234  N4   DC I -62    22203  20097  19664  -1324   5937   -866       N  
ATOM    235  C5   DC I -62       6.212 107.348  24.871  1.00176.94           C  
ANISOU  235  C5   DC I -62    24728  21541  20961  -2277   7338  -1447       C  
ATOM    236  C6   DC I -62       5.084 107.552  25.557  1.00185.57           C  
ANISOU  236  C6   DC I -62    25762  22451  22294  -2549   8214  -1899       C  
ATOM    237  P    DC I -61      -0.531 106.212  27.547  1.00220.76           P  
ANISOU  237  P    DC I -61    29231  26300  28346  -3611  11690  -3610       P  
ATOM    238  OP1  DC I -61      -1.952 106.445  27.885  1.00224.98           O  
ANISOU  238  OP1  DC I -61    29366  26633  29484  -3727  12611  -4157       O  
ATOM    239  OP2  DC I -61       0.269 105.270  28.361  1.00219.71           O  
ANISOU  239  OP2  DC I -61    29927  26272  27282  -4144  11491  -3258       O  
ATOM    240  O5'  DC I -61      -0.441 105.756  26.020  1.00209.57           O  
ANISOU  240  O5'  DC I -61    27045  25050  27532  -2945  10881  -3314       O  
ATOM    241  C5'  DC I -61      -0.739 106.689  24.988  1.00204.15           C  
ANISOU  241  C5'  DC I -61    25627  24334  27608  -2315  10711  -3462       C  
ATOM    242  C4'  DC I -61      -0.920 105.983  23.659  1.00196.60           C  
ANISOU  242  C4'  DC I -61    23929  23535  27235  -1777  10085  -3235       C  
ATOM    243  O4'  DC I -61       0.334 105.984  22.926  1.00188.41           O  
ANISOU  243  O4'  DC I -61    22996  22707  25884  -1452   9146  -2752       O  
ATOM    244  C3'  DC I -61      -1.342 104.522  23.762  1.00196.11           C  
ANISOU  244  C3'  DC I -61    23829  23542  27143  -2026  10107  -3123       C  
ATOM    245  O3'  DC I -61      -2.209 104.208  22.689  1.00196.20           O  
ANISOU  245  O3'  DC I -61    22934  23576  28036  -1540   9988  -3232       O  
ATOM    246  C2'  DC I -61      -0.012 103.786  23.638  1.00189.35           C  
ANISOU  246  C2'  DC I -61    23468  22907  25570  -2093   9278  -2558       C  
ATOM    247  C1'  DC I -61       0.706 104.656  22.622  1.00181.74           C  
ANISOU  247  C1'  DC I -61    22200  22049  24804  -1500   8616  -2377       C  
ATOM    248  N1   DC I -61       2.200 104.566  22.668  1.00170.02           N  
ANISOU  248  N1   DC I -61    21320  20728  22553  -1564   7898  -1907       N  
ATOM    249  C2   DC I -61       2.915 104.520  21.470  1.00157.99           C  
ANISOU  249  C2   DC I -61    19432  19405  21192  -1022   7030  -1556       C  
ATOM    250  O2   DC I -61       2.287 104.539  20.407  1.00152.93           O  
ANISOU  250  O2   DC I -61    17993  18810  21303   -507   6871  -1636       O  
ATOM    251  N3   DC I -61       4.269 104.452  21.511  1.00152.50           N  
ANISOU  251  N3   DC I -61    19269  18848  19826  -1080   6390  -1147       N  
ATOM    252  C4   DC I -61       4.900 104.434  22.687  1.00154.15           C  
ANISOU  252  C4   DC I -61    20339  18997  19233  -1642   6575  -1081       C  
ATOM    253  N4   DC I -61       6.237 104.366  22.679  1.00148.37           N  
ANISOU  253  N4   DC I -61    20096  18397  17883  -1673   5912   -682       N  
ATOM    254  C5   DC I -61       4.188 104.486  23.923  1.00162.52           C  
ANISOU  254  C5   DC I -61    21798  19862  20090  -2198   7450  -1429       C  
ATOM    255  C6   DC I -61       2.851 104.553  23.868  1.00169.70           C  
ANISOU  255  C6   DC I -61    22171  20638  21668  -2141   8096  -1835       C  
ATOM    256  P    DT I -60      -3.252 102.993  22.810  1.00186.39           P  
ANISOU  256  P    DT I -60    21388  22295  27138  -1752  10361  -3374       P  
ATOM    257  OP1  DT I -60      -4.613 103.573  22.834  1.00191.02           O  
ANISOU  257  OP1  DT I -60    21403  22661  28513  -1656  11127  -3926       O  
ATOM    258  OP2  DT I -60      -2.805 102.109  23.910  1.00188.17           O  
ANISOU  258  OP2  DT I -60    22426  22537  26533  -2417  10513  -3178       O  
ATOM    259  O5'  DT I -60      -3.054 102.205  21.436  1.00183.33           O  
ANISOU  259  O5'  DT I -60    20378  22127  27153  -1203   9498  -3044       O  
ATOM    260  C5'  DT I -60      -2.833 102.933  20.238  1.00181.24           C  
ANISOU  260  C5'  DT I -60    19542  21957  27363   -528   8949  -2974       C  
ATOM    261  C4'  DT I -60      -2.185 102.059  19.180  1.00177.81           C  
ANISOU  261  C4'  DT I -60    18841  21789  26930   -158   8016  -2530       C  
ATOM    262  O4'  DT I -60      -0.736 102.121  19.299  1.00173.62           O  
ANISOU  262  O4'  DT I -60    18945  21414  25609   -242   7403  -2092       O  
ATOM    263  C3'  DT I -60      -2.542 100.576  19.248  1.00180.31           C  
ANISOU  263  C3'  DT I -60    19089  22165  27256   -387   7978  -2429       C  
ATOM    264  O3'  DT I -60      -2.606 100.070  17.934  1.00178.29           O  
ANISOU  264  O3'  DT I -60    18127  22092  27525    176   7318  -2268       O  
ATOM    265  C2'  DT I -60      -1.351  99.992  20.003  1.00177.97           C  
ANISOU  265  C2'  DT I -60    19681  21966  25971   -858   7664  -2024       C  
ATOM    266  C1'  DT I -60      -0.225 100.808  19.397  1.00170.80           C  
ANISOU  266  C1'  DT I -60    18874  21203  24819   -482   6991  -1746       C  
ATOM    267  N1   DT I -60       1.025 100.847  20.211  1.00165.77           N  
ANISOU  267  N1   DT I -60    19152  20610  23221   -892   6766  -1435       N  
ATOM    268  C2   DT I -60       2.238 100.858  19.565  1.00158.16           C  
ANISOU  268  C2   DT I -60    18308  19852  21932   -613   5910  -1016       C  
ATOM    269  O2   DT I -60       2.350 100.822  18.353  1.00153.34           O  
ANISOU  269  O2   DT I -60    17100  19403  21761    -50   5329   -877       O  
ATOM    270  N3   DT I -60       3.326 100.908  20.393  1.00156.47           N  
ANISOU  270  N3   DT I -60    18943  19652  20855  -1019   5757   -769       N  
ATOM    271  C4   DT I -60       3.326 100.952  21.772  1.00160.59           C  
ANISOU  271  C4   DT I -60    20207  20016  20794  -1661   6351   -890       C  
ATOM    272  O4   DT I -60       4.362 100.996  22.427  1.00160.14           O  
ANISOU  272  O4   DT I -60    20890  19987  19969  -1981   6129   -647       O  
ATOM    273  C5   DT I -60       2.023 100.942  22.390  1.00166.29           C  
ANISOU  273  C5   DT I -60    20772  20539  21873  -1930   7251  -1329       C  
ATOM    274  C7   DT I -60       1.905 100.981  23.885  1.00171.28           C  
ANISOU  274  C7   DT I -60    22174  21003  21902  -2633   7965  -1497       C  
ATOM    275  C6   DT I -60       0.944 100.893  21.590  1.00168.40           C  
ANISOU  275  C6   DT I -60    20194  20780  23012  -1538   7419  -1582       C  
ATOM    276  P    DG I -59      -3.461  98.757  17.588  1.00180.47           P  
ANISOU  276  P    DG I -59    17898  22391  28282    184   7343  -2330       P  
ATOM    277  OP1  DG I -59      -4.884  99.152  17.487  1.00183.14           O  
ANISOU  277  OP1  DG I -59    17599  22530  29457    326   8018  -2841       O  
ATOM    278  OP2  DG I -59      -3.059  97.684  18.524  1.00180.87           O  
ANISOU  278  OP2  DG I -59    18619  22445  27656   -427   7416  -2113       O  
ATOM    279  O5'  DG I -59      -2.930  98.373  16.132  1.00176.45           O  
ANISOU  279  O5'  DG I -59    16844  22158  28039    818   6358  -2005       O  
ATOM    280  C5'  DG I -59      -2.458  99.406  15.266  1.00172.30           C  
ANISOU  280  C5'  DG I -59    16052  21736  27680   1359   5911  -1924       C  
ATOM    281  C4'  DG I -59      -1.234  98.955  14.486  1.00163.46           C  
ANISOU  281  C4'  DG I -59    15017  20907  26183   1630   4935  -1427       C  
ATOM    282  O4'  DG I -59      -0.042  99.083  15.309  1.00161.70           O  
ANISOU  282  O4'  DG I -59    15681  20707  25051   1219   4794  -1135       O  
ATOM    283  C3'  DG I -59      -1.273  97.513  14.013  1.00160.30           C  
ANISOU  283  C3'  DG I -59    14359  20665  25882   1663   4500  -1238       C  
ATOM    284  O3'  DG I -59      -0.696  97.410  12.723  1.00155.39           O  
ANISOU  284  O3'  DG I -59    13300  20307  25432   2241   3646   -967       O  
ATOM    285  C2'  DG I -59      -0.452  96.775  15.068  1.00160.22           C  
ANISOU  285  C2'  DG I -59    15215  20653  25010   1037   4482   -962       C  
ATOM    286  C1'  DG I -59       0.564  97.820  15.512  1.00158.47           C  
ANISOU  286  C1'  DG I -59    15615  20425  24170    935   4397   -808       C  
ATOM    287  N9   DG I -59       0.918  97.720  16.930  1.00158.08           N  
ANISOU  287  N9   DG I -59    16448  20233  23384    240   4842   -779       N  
ATOM    288  C8   DG I -59       0.045  97.626  17.985  1.00162.66           C  
ANISOU  288  C8   DG I -59    17251  20582  23970   -251   5699  -1099       C  
ATOM    289  N7   DG I -59       0.631  97.568  19.147  1.00164.27           N  
ANISOU  289  N7   DG I -59    18305  20712  23400   -826   5926   -986       N  
ATOM    290  C5   DG I -59       1.985  97.634  18.852  1.00159.53           C  
ANISOU  290  C5   DG I -59    18062  20292  22261   -708   5164   -570       C  
ATOM    291  C6   DG I -59       3.104  97.615  19.719  1.00158.07           C  
ANISOU  291  C6   DG I -59    18765  20118  21176  -1144   4997   -290       C  
ATOM    292  O6   DG I -59       3.113  97.533  20.955  1.00161.61           O  
ANISOU  292  O6   DG I -59    19892  20423  21089  -1739   5504   -351       O  
ATOM    293  N1   DG I -59       4.302  97.701  19.017  1.00150.97           N  
ANISOU  293  N1   DG I -59    17930  19423  20009   -829   4144     89       N  
ATOM    294  C2   DG I -59       4.407  97.794  17.647  1.00144.43           C  
ANISOU  294  C2   DG I -59    16405  18778  19696   -179   3540    192       C  
ATOM    295  N2   DG I -59       5.650  97.865  17.148  1.00137.18           N  
ANISOU  295  N2   DG I -59    15671  18044  18405     30   2769    566       N  
ATOM    296  N3   DG I -59       3.363  97.814  16.820  1.00146.77           N  
ANISOU  296  N3   DG I -59    15877  19076  20814    238   3681    -61       N  
ATOM    297  C4   DG I -59       2.186  97.731  17.491  1.00154.37           C  
ANISOU  297  C4   DG I -59    16756  19829  22070    -57   4499   -438       C  
ATOM    298  P    DG I -58      -1.059  96.166  11.774  1.00154.21           P  
ANISOU  298  P    DG I -58    12515  20336  25743   2540   3168   -893       P  
ATOM    299  OP1  DG I -58      -1.457  96.696  10.450  1.00152.33           O  
ANISOU  299  OP1  DG I -58    11459  20219  26200   3252   2828   -992       O  
ATOM    300  OP2  DG I -58      -1.986  95.285  12.520  1.00156.31           O  
ANISOU  300  OP2  DG I -58    12789  20424  26180   2102   3763  -1126       O  
ATOM    301  O5'  DG I -58       0.332  95.398  11.626  1.00147.04           O  
ANISOU  301  O5'  DG I -58    12055  19667  24147   2457   2369   -386       O  
ATOM    302  C5'  DG I -58       1.540  96.030  12.047  1.00141.56           C  
ANISOU  302  C5'  DG I -58    12043  19012  22730   2298   2138   -112       C  
ATOM    303  C4'  DG I -58       2.558  94.998  12.496  1.00133.12           C  
ANISOU  303  C4'  DG I -58    11571  18048  20960   1917   1705    269       C  
ATOM    304  O4'  DG I -58       2.610  94.959  13.951  1.00136.10           O  
ANISOU  304  O4'  DG I -58    12726  18211  20776   1228   2296    222       O  
ATOM    305  C3'  DG I -58       2.248  93.573  12.063  1.00129.04           C  
ANISOU  305  C3'  DG I -58    10688  17638  20705   1945   1401    342       C  
ATOM    306  O3'  DG I -58       3.461  92.850  11.884  1.00122.77           O  
ANISOU  306  O3'  DG I -58    10231  17040  19377   1893    660    769       O  
ATOM    307  C2'  DG I -58       1.457  93.052  13.256  1.00136.10           C  
ANISOU  307  C2'  DG I -58    11898  18278  21534   1342   2174    124       C  
ATOM    308  C1'  DG I -58       2.243  93.668  14.401  1.00139.51           C  
ANISOU  308  C1'  DG I -58    13241  18598  21170    858   2423    243       C  
ATOM    309  N9   DG I -58       1.478  93.810  15.637  1.00150.15           N  
ANISOU  309  N9   DG I -58    14960  19672  22417    314   3333    -45       N  
ATOM    310  C8   DG I -58       0.112  93.785  15.772  1.00157.33           C  
ANISOU  310  C8   DG I -58    15421  20409  23949    284   4020   -455       C  
ATOM    311  N7   DG I -58      -0.294  93.957  16.999  1.00164.41           N  
ANISOU  311  N7   DG I -58    16820  21080  24566   -269   4784   -649       N  
ATOM    312  C5   DG I -58       0.879  94.087  17.730  1.00160.96           C  
ANISOU  312  C5   DG I -58    17231  20674  23254   -629   4575   -343       C  
ATOM    313  C6   DG I -58       1.070  94.285  19.118  1.00164.61           C  
ANISOU  313  C6   DG I -58    18523  20967  23054  -1270   5125   -371       C  
ATOM    314  O6   DG I -58       0.211  94.387  20.005  1.00170.67           O  
ANISOU  314  O6   DG I -58    19447  21524  23874  -1665   5951   -683       O  
ATOM    315  N1   DG I -58       2.422  94.363  19.446  1.00160.71           N  
ANISOU  315  N1   DG I -58    18721  20573  21770  -1442   4625      4       N  
ATOM    316  C2   DG I -58       3.456  94.263  18.546  1.00153.65           C  
ANISOU  316  C2   DG I -58    17718  19906  20755  -1050   3725    357       C  
ATOM    317  N2   DG I -58       4.694  94.364  19.051  1.00151.24           N  
ANISOU  317  N2   DG I -58    18145  19653  19667  -1300   3357    676       N  
ATOM    318  N3   DG I -58       3.291  94.079  17.242  1.00150.06           N  
ANISOU  318  N3   DG I -58    16492  19619  20904   -455   3220    387       N  
ATOM    319  C4   DG I -58       1.980  94.000  16.907  1.00153.86           C  
ANISOU  319  C4   DG I -58    16303  20011  22146   -275   3681     29       C  
ATOM    320  P    DT I -57       4.130  92.739  10.427  1.00126.28           P  
ANISOU  320  P    DT I -57    10160  17804  20019   2534   -261   1013       P  
ATOM    321  OP1  DT I -57       4.402  94.114   9.952  1.00123.98           O  
ANISOU  321  OP1  DT I -57     9761  17553  19791   2917   -323    986       O  
ATOM    322  OP2  DT I -57       3.295  91.830   9.611  1.00128.07           O  
ANISOU  322  OP2  DT I -57     9632  18119  20911   2830   -410    880       O  
ATOM    323  O5'  DT I -57       5.526  92.007  10.696  1.00123.68           O  
ANISOU  323  O5'  DT I -57    10447  17606  18938   2264   -891   1458       O  
ATOM    324  C5'  DT I -57       6.736  92.749  10.629  1.00121.16           C  
ANISOU  324  C5'  DT I -57    10544  17389  18103   2343  -1304   1722       C  
ATOM    325  C4'  DT I -57       7.451  92.737  11.964  1.00121.92           C  
ANISOU  325  C4'  DT I -57    11586  17329  17410   1703  -1088   1876       C  
ATOM    326  O4'  DT I -57       6.510  93.035  13.016  1.00127.01           O  
ANISOU  326  O4'  DT I -57    12462  17699  18098   1289   -195   1561       O  
ATOM    327  C3'  DT I -57       8.034  91.398  12.371  1.00118.06           C  
ANISOU  327  C3'  DT I -57    11474  16878  16504   1328  -1447   2149       C  
ATOM    328  O3'  DT I -57       9.325  91.175  11.747  1.00113.22           O  
ANISOU  328  O3'  DT I -57    10965  16496  15559   1542  -2307   2519       O  
ATOM    329  C2'  DT I -57       8.134  91.537  13.885  1.00120.31           C  
ANISOU  329  C2'  DT I -57    12606  16919  16187    647   -874   2130       C  
ATOM    330  C1'  DT I -57       6.988  92.484  14.229  1.00126.24           C  
ANISOU  330  C1'  DT I -57    13165  17475  17324    643    -32   1713       C  
ATOM    331  N1   DT I -57       5.861  91.825  14.952  1.00132.94           N  
ANISOU  331  N1   DT I -57    13991  18129  18392    255    649   1463       N  
ATOM    332  C2   DT I -57       5.878  91.806  16.325  1.00135.32           C  
ANISOU  332  C2   DT I -57    15042  18225  18147   -388   1193   1437       C  
ATOM    333  O2   DT I -57       6.772  92.299  16.989  1.00133.77           O  
ANISOU  333  O2   DT I -57    15534  17999  17294   -655   1132   1602       O  
ATOM    334  N3   DT I -57       4.805  91.188  16.902  1.00137.78           N  
ANISOU  334  N3   DT I -57    15274  18368  18709   -714   1819   1205       N  
ATOM    335  C4   DT I -57       3.736  90.597  16.261  1.00138.92           C  
ANISOU  335  C4   DT I -57    14667  18516  19601   -465   1949    992       C  
ATOM    336  O4   DT I -57       2.816  90.067  16.877  1.00140.40           O  
ANISOU  336  O4   DT I -57    14842  18532  19971   -806   2545    788       O  
ATOM    337  C5   DT I -57       3.776  90.646  14.820  1.00138.79           C  
ANISOU  337  C5   DT I -57    13881  18719  20133    220   1338   1022       C  
ATOM    338  C7   DT I -57       2.671  90.027  14.018  1.00140.77           C  
ANISOU  338  C7   DT I -57    13275  18995  21214    549   1395    792       C  
ATOM    339  C6   DT I -57       4.827  91.252  14.238  1.00134.75           C  
ANISOU  339  C6   DT I -57    13452  18386  19361    543    726   1259       C  
ATOM    340  P    DC I -56      10.673  91.898  12.264  1.00116.12           P  
ANISOU  340  P    DC I -56    12080  16864  15177   1352  -2566   2784       P  
ATOM    341  OP1  DC I -56      10.417  93.335  12.507  1.00101.15           O  
ANISOU  341  OP1  DC I -56    10265  14847  13318   1430  -2075   2574       O  
ATOM    342  OP2  DC I -56      11.736  91.506  11.312  1.00111.47           O  
ANISOU  342  OP2  DC I -56    11325  16541  14488   1696  -3468   3104       O  
ATOM    343  O5'  DC I -56      11.022  91.185  13.655  1.00109.89           O  
ANISOU  343  O5'  DC I -56    12129  15894  13730    622  -2349   2914       O  
ATOM    344  C5'  DC I -56      11.393  91.977  14.784  1.00112.36           C  
ANISOU  344  C5'  DC I -56    13194  16026  13470    198  -1941   2900       C  
ATOM    345  C4'  DC I -56      11.456  91.128  16.039  1.00108.31           C  
ANISOU  345  C4'  DC I -56    13368  15345  12438   -481  -1681   2988       C  
ATOM    346  O4'  DC I -56      10.117  90.797  16.488  1.00113.16           O  
ANISOU  346  O4'  DC I -56    13776  15795  13425   -696   -948   2682       O  
ATOM    347  C3'  DC I -56      12.194  89.801  15.876  1.00117.22           C  
ANISOU  347  C3'  DC I -56    14616  16588  13333   -593  -2364   3329       C  
ATOM    348  O3'  DC I -56      13.177  89.693  16.874  1.00115.93           O  
ANISOU  348  O3'  DC I -56    15324  16339  12386  -1083  -2495   3573       O  
ATOM    349  C2'  DC I -56      11.097  88.743  16.038  1.00108.82           C  
ANISOU  349  C2'  DC I -56    13252  15436  12658   -775  -2004   3181       C  
ATOM    350  C1'  DC I -56      10.095  89.457  16.921  1.00114.35           C  
ANISOU  350  C1'  DC I -56    14129  15908  13412  -1067  -1048   2837       C  
ATOM    351  N1   DC I -56       8.707  88.942  16.769  1.00117.51           N  
ANISOU  351  N1   DC I -56    13961  16228  14461  -1033   -545   2545       N  
ATOM    352  C2   DC I -56       7.935  88.656  17.902  1.00123.24           C  
ANISOU  352  C2   DC I -56    15047  16721  15057  -1581    211   2375       C  
ATOM    353  O2   DC I -56       8.422  88.833  19.025  1.00125.64           O  
ANISOU  353  O2   DC I -56    16158  16899  14680  -2091    442   2475       O  
ATOM    354  N3   DC I -56       6.669  88.194  17.729  1.00126.12           N  
ANISOU  354  N3   DC I -56    14860  17007  16052  -1537    667   2099       N  
ATOM    355  C4   DC I -56       6.186  88.018  16.497  1.00123.47           C  
ANISOU  355  C4   DC I -56    13659  16815  16438   -971    375   1992       C  
ATOM    356  N4   DC I -56       4.937  87.560  16.367  1.00129.93           N  
ANISOU  356  N4   DC I -56    13945  17542  17880   -943    832   1709       N  
ATOM    357  C5   DC I -56       6.962  88.302  15.339  1.00121.97           C  
ANISOU  357  C5   DC I -56    13108  16873  16361   -410   -399   2167       C  
ATOM    358  C6   DC I -56       8.204  88.748  15.522  1.00119.03           C  
ANISOU  358  C6   DC I -56    13283  16575  15369   -468   -826   2442       C  
ATOM    359  P    DC I -55      14.181  88.442  16.905  1.00109.04           P  
ANISOU  359  P    DC I -55    14756  15549  11126  -1276  -3235   3966       P  
ATOM    360  OP1  DC I -55      15.532  89.025  16.927  1.00103.08           O  
ANISOU  360  OP1  DC I -55    14453  14867   9845  -1241  -3752   4211       O  
ATOM    361  OP2  DC I -55      13.842  87.475  15.837  1.00116.97           O  
ANISOU  361  OP2  DC I -55    15021  16715  12705   -907  -3656   3995       O  
ATOM    362  O5'  DC I -55      13.864  87.770  18.314  1.00112.30           O  
ANISOU  362  O5'  DC I -55    15848  15728  11095  -1994  -2732   3980       O  
ATOM    363  C5'  DC I -55      13.315  88.568  19.351  1.00115.17           C  
ANISOU  363  C5'  DC I -55    16645  15890  11223  -2355  -1922   3744       C  
ATOM    364  C4'  DC I -55      12.508  87.724  20.315  1.00118.60           C  
ANISOU  364  C4'  DC I -55    17355  16137  11571  -2894  -1354   3670       C  
ATOM    365  O4'  DC I -55      11.177  87.523  19.793  1.00121.78           O  
ANISOU  365  O4'  DC I -55    17013  16524  12732  -2662   -915   3367       O  
ATOM    366  C3'  DC I -55      13.085  86.336  20.586  1.00114.91           C  
ANISOU  366  C3'  DC I -55    17200  15670  10788  -3206  -1851   4014       C  
ATOM    367  O3'  DC I -55      13.403  86.223  21.964  1.00130.23           O  
ANISOU  367  O3'  DC I -55    20050  17432  11998  -3858  -1552   4127       O  
ATOM    368  C2'  DC I -55      11.970  85.361  20.163  1.00116.34           C  
ANISOU  368  C2'  DC I -55    16746  15837  11621  -3125  -1647   3877       C  
ATOM    369  C1'  DC I -55      10.729  86.242  20.146  1.00123.47           C  
ANISOU  369  C1'  DC I -55    17251  16657  13003  -2986   -832   3442       C  
ATOM    370  N1   DC I -55       9.706  85.826  19.139  1.00127.17           N  
ANISOU  370  N1   DC I -55    16781  17198  14339  -2558   -779   3227       N  
ATOM    371  C2   DC I -55       8.445  85.396  19.567  1.00131.47           C  
ANISOU  371  C2   DC I -55    17130  17579  15243  -2797    -71   2971       C  
ATOM    372  O2   DC I -55       8.208  85.355  20.779  1.00136.85           O  
ANISOU  372  O2   DC I -55    18435  18067  15496  -3370    509   2937       O  
ATOM    373  N3   DC I -55       7.524  85.033  18.636  1.00130.88           N  
ANISOU  373  N3   DC I -55    16188  17566  15976  -2394    -44   2764       N  
ATOM    374  C4   DC I -55       7.828  85.095  17.337  1.00127.33           C  
ANISOU  374  C4   DC I -55    15100  17341  15939  -1780   -688   2810       C  
ATOM    375  N4   DC I -55       6.892  84.728  16.454  1.00123.56           N  
ANISOU  375  N4   DC I -55    13780  16920  16246  -1395   -651   2592       N  
ATOM    376  C5   DC I -55       9.105  85.536  16.884  1.00126.34           C  
ANISOU  376  C5   DC I -55    15172  17392  15439  -1535  -1397   3075       C  
ATOM    377  C6   DC I -55      10.002  85.891  17.809  1.00126.38           C  
ANISOU  377  C6   DC I -55    16020  17323  14675  -1936  -1413   3273       C  
ATOM    378  P    DT I -54      14.162  84.926  22.532  1.00122.47           P  
ANISOU  378  P    DT I -54    19618  16405  10510  -4295  -2038   4521       P  
ATOM    379  OP1  DT I -54      15.222  85.401  23.451  1.00119.74           O  
ANISOU  379  OP1  DT I -54    20169  15995   9332  -4661  -2175   4714       O  
ATOM    380  OP2  DT I -54      14.520  84.046  21.397  1.00114.25           O  
ANISOU  380  OP2  DT I -54    17991  15538   9882  -3890  -2817   4710       O  
ATOM    381  O5'  DT I -54      13.024  84.194  23.380  1.00137.60           O  
ANISOU  381  O5'  DT I -54    21660  18126  12498  -4777  -1301   4388       O  
ATOM    382  C5'  DT I -54      11.915  84.949  23.852  1.00147.60           C  
ANISOU  382  C5'  DT I -54    22863  19269  13948  -4893   -373   4005       C  
ATOM    383  C4'  DT I -54      10.735  84.049  24.157  1.00159.22           C  
ANISOU  383  C4'  DT I -54    24107  20610  15779  -5152    175   3871       C  
ATOM    384  O4'  DT I -54       9.965  83.816  22.955  1.00157.63           O  
ANISOU  384  O4'  DT I -54    22917  20513  16462  -4615     89   3681       O  
ATOM    385  C3'  DT I -54      11.101  82.667  24.706  1.00170.03           C  
ANISOU  385  C3'  DT I -54    25901  21902  16800  -5597   -127   4217       C  
ATOM    386  O3'  DT I -54      10.510  82.494  25.984  1.00194.87           O  
ANISOU  386  O3'  DT I -54    29630  24841  19573  -6225    630   4147       O  
ATOM    387  C2'  DT I -54      10.529  81.684  23.672  1.00163.12           C  
ANISOU  387  C2'  DT I -54    24175  21104  16699  -5240   -416   4201       C  
ATOM    388  C1'  DT I -54       9.443  82.516  23.010  1.00162.14           C  
ANISOU  388  C1'  DT I -54    23308  21015  17283  -4812    104   3763       C  
ATOM    389  N1   DT I -54       9.094  82.080  21.620  1.00162.08           N  
ANISOU  389  N1   DT I -54    22332  21168  18083  -4211   -331   3691       N  
ATOM    390  C2   DT I -54       7.827  81.603  21.363  1.00166.38           C  
ANISOU  390  C2   DT I -54    22269  21640  19306  -4144    134   3428       C  
ATOM    391  O2   DT I -54       6.965  81.506  22.218  1.00169.44           O  
ANISOU  391  O2   DT I -54    22866  21835  19680  -4560    903   3253       O  
ATOM    392  N3   DT I -54       7.604  81.238  20.060  1.00167.18           N  
ANISOU  392  N3   DT I -54    21502  21907  20111  -3571   -332   3370       N  
ATOM    393  C4   DT I -54       8.500  81.304  19.009  1.00163.35           C  
ANISOU  393  C4   DT I -54    20709  21656  19701  -3074  -1185   3546       C  
ATOM    394  O4   DT I -54       8.204  80.951  17.870  1.00163.00           O  
ANISOU  394  O4   DT I -54    19878  21760  20296  -2578  -1547   3467       O  
ATOM    395  C5   DT I -54       9.810  81.815  19.345  1.00158.04           C  
ANISOU  395  C5   DT I -54    20702  21044  18303  -3180  -1617   3821       C  
ATOM    396  C7   DT I -54      10.867  81.933  18.287  1.00150.85           C  
ANISOU  396  C7   DT I -54    19527  20379  17409  -2683  -2522   4024       C  
ATOM    397  C6   DT I -54      10.040  82.176  20.619  1.00159.04           C  
ANISOU  397  C6   DT I -54    21674  21001  17752  -3734  -1181   3877       C  
ATOM    398  P    DA I -53      10.832  81.190  26.863  1.00169.63           P  
ANISOU  398  P    DA I -53    22579  20182  21692  -1342   5828   4144       P  
ATOM    399  OP1  DA I -53      10.799  81.600  28.286  1.00170.38           O  
ANISOU  399  OP1  DA I -53    23219  20050  21466   -947   6007   4288       O  
ATOM    400  OP2  DA I -53      12.048  80.553  26.310  1.00170.14           O  
ANISOU  400  OP2  DA I -53    22656  20016  21973  -1695   5612   3852       O  
ATOM    401  O5'  DA I -53       9.587  80.229  26.573  1.00178.12           O  
ANISOU  401  O5'  DA I -53    23097  21541  23040  -1510   5843   4373       O  
ATOM    402  C5'  DA I -53       8.272  80.769  26.574  1.00183.51           C  
ANISOU  402  C5'  DA I -53    23553  22535  23638  -1293   6003   4605       C  
ATOM    403  C4'  DA I -53       7.241  79.710  26.229  1.00186.61           C  
ANISOU  403  C4'  DA I -53    23404  23112  24388  -1524   5998   4783       C  
ATOM    404  O4'  DA I -53       7.056  79.643  24.790  1.00187.23           O  
ANISOU  404  O4'  DA I -53    22979  23475  24686  -1778   5848   4632       O  
ATOM    405  C3'  DA I -53       7.585  78.287  26.676  1.00185.46           C  
ANISOU  405  C3'  DA I -53    23227  22699  24539  -1783   5920   4816       C  
ATOM    406  O3'  DA I -53       6.420  77.671  27.198  1.00184.11           O  
ANISOU  406  O3'  DA I -53    22812  22589  24555  -1736   6075   5133       O  
ATOM    407  C2'  DA I -53       8.027  77.620  25.371  1.00185.37           C  
ANISOU  407  C2'  DA I -53    22789  22760  24883  -2213   5657   4559       C  
ATOM    408  C1'  DA I -53       7.088  78.294  24.390  1.00187.43           C  
ANISOU  408  C1'  DA I -53    22632  23439  25144  -2157   5692   4590       C  
ATOM    409  N9   DA I -53       7.513  78.234  22.993  1.00185.67           N  
ANISOU  409  N9   DA I -53    22055  23398  25091  -2397   5483   4324       N  
ATOM    410  C8   DA I -53       8.724  78.603  22.477  1.00182.50           C  
ANISOU  410  C8   DA I -53    21847  22910  24583  -2451   5355   4045       C  
ATOM    411  N7   DA I -53       8.810  78.455  21.174  1.00181.73           N  
ANISOU  411  N7   DA I -53    21318  23054  24677  -2623   5201   3867       N  
ATOM    412  C5   DA I -53       7.566  77.963  20.811  1.00185.25           C  
ANISOU  412  C5   DA I -53    21249  23760  25380  -2696   5207   4024       C  
ATOM    413  C6   DA I -53       7.012  77.595  19.566  1.00188.29           C  
ANISOU  413  C6   DA I -53    20996  24484  26062  -2845   5060   3944       C  
ATOM    414  N6   DA I -53       7.679  77.673  18.408  1.00187.12           N  
ANISOU  414  N6   DA I -53    20697  24514  25886  -2885   4782   3600       N  
ATOM    415  N1   DA I -53       5.741  77.140  19.557  1.00192.00           N  
ANISOU  415  N1   DA I -53    21041  25114  26799  -2889   5090   4133       N  
ATOM    416  C2   DA I -53       5.077  77.061  20.716  1.00193.30           C  
ANISOU  416  C2   DA I -53    21416  25107  26922  -2781   5291   4409       C  
ATOM    417  N3   DA I -53       5.490  77.377  21.942  1.00191.46           N  
ANISOU  417  N3   DA I -53    21771  24588  26388  -2603   5456   4525       N  
ATOM    418  C4   DA I -53       6.754  77.826  21.920  1.00187.41           C  
ANISOU  418  C4   DA I -53    21662  23924  25622  -2573   5387   4308       C  
ATOM    419  P    DC I -52       6.425  77.025  28.668  1.00204.36           P  
ANISOU  419  P    DC I -52    25719  24856  27071  -1546   6243   5380       P  
ATOM    420  OP1  DC I -52       5.594  77.882  29.543  1.00206.32           O  
ANISOU  420  OP1  DC I -52    26180  25208  27005  -1078   6518   5642       O  
ATOM    421  OP2  DC I -52       7.831  76.743  29.032  1.00197.85           O  
ANISOU  421  OP2  DC I -52    25337  23700  26136  -1611   6111   5162       O  
ATOM    422  O5'  DC I -52       5.689  75.622  28.456  1.00199.87           O  
ANISOU  422  O5'  DC I -52    24617  24269  27054  -1866   6214   5546       O  
ATOM    423  C5'  DC I -52       6.278  74.645  27.610  1.00193.46           C  
ANISOU  423  C5'  DC I -52    23509  23357  26640  -2325   5929   5304       C  
ATOM    424  C4'  DC I -52       5.224  73.916  26.797  1.00192.70           C  
ANISOU  424  C4'  DC I -52    22716  23433  27067  -2607   5856   5379       C  
ATOM    425  O4'  DC I -52       5.221  74.430  25.437  1.00190.24           O  
ANISOU  425  O4'  DC I -52    22070  23415  26797  -2765   5673   5124       O  
ATOM    426  C3'  DC I -52       5.443  72.409  26.697  1.00193.26           C  
ANISOU  426  C3'  DC I -52    22517  23244  27668  -2986   5656   5316       C  
ATOM    427  O3'  DC I -52       4.248  71.704  26.986  1.00202.18           O  
ANISOU  427  O3'  DC I -52    23249  24369  29200  -3011   5792   5623       O  
ATOM    428  C2'  DC I -52       5.899  72.182  25.258  1.00189.73           C  
ANISOU  428  C2'  DC I -52    21689  22915  27487  -3358   5291   4921       C  
ATOM    429  C1'  DC I -52       5.326  73.374  24.505  1.00187.88           C  
ANISOU  429  C1'  DC I -52    21281  23088  27019  -3189   5372   4913       C  
ATOM    430  N1   DC I -52       6.212  73.827  23.381  1.00179.30           N  
ANISOU  430  N1   DC I -52    20155  22140  25830  -3318   5134   4540       N  
ATOM    431  C2   DC I -52       5.878  73.535  22.042  1.00180.65           C  
ANISOU  431  C2   DC I -52    19720  22564  26356  -3558   4886   4338       C  
ATOM    432  O2   DC I -52       4.839  72.907  21.795  1.00186.17           O  
ANISOU  432  O2   DC I -52    19911  23351  27472  -3687   4839   4447       O  
ATOM    433  N3   DC I -52       6.713  73.958  21.053  1.00174.62           N  
ANISOU  433  N3   DC I -52    18925  21940  25483  -3617   4699   4027       N  
ATOM    434  C4   DC I -52       7.824  74.633  21.361  1.00167.02           C  
ANISOU  434  C4   DC I -52    18502  20836  24120  -3480   4761   3916       C  
ATOM    435  N4   DC I -52       8.620  75.030  20.363  1.00161.33           N  
ANISOU  435  N4   DC I -52    17797  20276  23226  -3474   4485   3528       N  
ATOM    436  C5   DC I -52       8.175  74.930  22.711  1.00167.22           C  
ANISOU  436  C5   DC I -52    19141  20580  23815  -3265   4978   4087       C  
ATOM    437  C6   DC I -52       7.352  74.513  23.675  1.00171.81           C  
ANISOU  437  C6   DC I -52    19749  21064  24469  -3177   5153   4395       C  
ATOM    438  P    DT I -51       4.296  70.109  27.174  1.00174.10           P  
ANISOU  438  P    DT I -51    19448  20485  26216  -3326   5647   5642       P  
ATOM    439  OP1  DT I -51       3.121  69.699  27.973  1.00181.07           O  
ANISOU  439  OP1  DT I -51    20137  21317  27345  -3159   5947   6088       O  
ATOM    440  OP2  DT I -51       5.659  69.761  27.634  1.00170.25           O  
ANISOU  440  OP2  DT I -51    19455  19700  25534  -3367   5525   5452       O  
ATOM    441  O5'  DT I -51       4.138  69.545  25.687  1.00180.15           O  
ANISOU  441  O5'  DT I -51    19578  21371  27498  -3767   5246   5301       O  
ATOM    442  C5'  DT I -51       3.024  69.934  24.896  1.00187.78           C  
ANISOU  442  C5'  DT I -51    20019  22665  28663  -3782   5251   5355       C  
ATOM    443  C4'  DT I -51       2.990  69.153  23.596  1.00192.56           C  
ANISOU  443  C4'  DT I -51    20035  23320  29811  -4192   4803   4988       C  
ATOM    444  O4'  DT I -51       3.832  69.805  22.606  1.00191.09           O  
ANISOU  444  O4'  DT I -51    19905  23346  29356  -4246   4568   4608       O  
ATOM    445  C3'  DT I -51       3.488  67.713  23.694  1.00194.19           C  
ANISOU  445  C3'  DT I -51    20167  23142  30474  -4507   4517   4810       C  
ATOM    446  O3'  DT I -51       2.673  66.877  22.879  1.00194.80           O  
ANISOU  446  O3'  DT I -51    19573  23245  31198  -4782   4224   4675       O  
ATOM    447  C2'  DT I -51       4.918  67.813  23.160  1.00192.46           C  
ANISOU  447  C2'  DT I -51    20248  22878  30001  -4633   4213   4372       C  
ATOM    448  C1'  DT I -51       4.758  68.874  22.085  1.00192.97           C  
ANISOU  448  C1'  DT I -51    20087  23371  29863  -4565   4149   4209       C  
ATOM    449  N1   DT I -51       6.019  69.602  21.755  1.00193.04           N  
ANISOU  449  N1   DT I -51    20491  23432  29423  -4506   4068   3944       N  
ATOM    450  C2   DT I -51       6.355  69.805  20.435  1.00194.98           C  
ANISOU  450  C2   DT I -51    20418  23924  29740  -4631   3743   3572       C  
ATOM    451  O2   DT I -51       5.675  69.411  19.503  1.00198.09           O  
ANISOU  451  O2   DT I -51    20224  24515  30528  -4780   3477   3415       O  
ATOM    452  N3   DT I -51       7.526  70.492  20.243  1.00192.06           N  
ANISOU  452  N3   DT I -51    20459  23572  28943  -4531   3711   3360       N  
ATOM    453  C4   DT I -51       8.375  70.985  21.215  1.00188.18           C  
ANISOU  453  C4   DT I -51    20628  22855  28017  -4355   3945   3464       C  
ATOM    454  O4   DT I -51       9.407  71.590  20.944  1.00183.37           O  
ANISOU  454  O4   DT I -51    20393  22285  26994  -4235   3810   3173       O  
ATOM    455  C5   DT I -51       7.965  70.741  22.574  1.00188.68           C  
ANISOU  455  C5   DT I -51    20978  22674  28038  -4233   4260   3849       C  
ATOM    456  C7   DT I -51       8.814  71.229  23.710  1.00185.52           C  
ANISOU  456  C7   DT I -51    21284  22028  27176  -3997   4484   3957       C  
ATOM    457  C6   DT I -51       6.821  70.067  22.778  1.00191.63           C  
ANISOU  457  C6   DT I -51    20975  23054  28783  -4298   4312   4073       C  
ATOM    458  P    DA I -50       2.792  65.276  22.954  1.00205.85           P  
ANISOU  458  P    DA I -50    20774  24244  33195  -5091   3925   4528       P  
ATOM    459  OP1  DA I -50       1.469  64.750  23.358  1.00211.19           O  
ANISOU  459  OP1  DA I -50    21035  24834  34373  -5085   4115   4896       O  
ATOM    460  OP2  DA I -50       3.991  64.916  23.743  1.00200.98           O  
ANISOU  460  OP2  DA I -50    20745  23313  32304  -5069   3961   4492       O  
ATOM    461  O5'  DA I -50       3.059  64.862  21.435  1.00202.16           O  
ANISOU  461  O5'  DA I -50    19873  23911  33026  -5390   3314   3933       O  
ATOM    462  C5'  DA I -50       3.744  65.761  20.574  1.00192.84           C  
ANISOU  462  C5'  DA I -50    18781  23039  31450  -5342   3148   3621       C  
ATOM    463  C4'  DA I -50       4.541  65.001  19.538  1.00188.61           C  
ANISOU  463  C4'  DA I -50    18101  22448  31113  -5594   2544   3024       C  
ATOM    464  O4'  DA I -50       5.628  65.828  19.051  1.00182.54           O  
ANISOU  464  O4'  DA I -50    17632  21860  29866  -5507   2466   2775       O  
ATOM    465  C3'  DA I -50       5.165  63.707  20.038  1.00188.38           C  
ANISOU  465  C3'  DA I -50    18295  21970  31311  -5774   2352   2893       C  
ATOM    466  O3'  DA I -50       4.982  62.697  19.057  1.00190.77           O  
ANISOU  466  O3'  DA I -50    18167  22237  32078  -5999   1798   2448       O  
ATOM    467  C2'  DA I -50       6.641  64.068  20.256  1.00182.19           C  
ANISOU  467  C2'  DA I -50    18105  21100  30020  -5714   2339   2719       C  
ATOM    468  C1'  DA I -50       6.873  65.193  19.254  1.00179.10           C  
ANISOU  468  C1'  DA I -50    17601  21119  29329  -5618   2244   2504       C  
ATOM    469  N9   DA I -50       7.818  66.213  19.714  1.00173.82           N  
ANISOU  469  N9   DA I -50    17475  20472  28096  -5430   2527   2608       N  
ATOM    470  C8   DA I -50       7.985  66.670  20.994  1.00172.43           C  
ANISOU  470  C8   DA I -50    17803  20127  27585  -5237   2992   3012       C  
ATOM    471  N7   DA I -50       8.897  67.609  21.107  1.00168.10           N  
ANISOU  471  N7   DA I -50    17684  19625  26562  -5080   3126   2972       N  
ATOM    472  C5   DA I -50       9.354  67.788  19.811  1.00165.56           C  
ANISOU  472  C5   DA I -50    17140  19546  26218  -5148   2738   2523       C  
ATOM    473  C6   DA I -50      10.328  68.645  19.252  1.00158.88           C  
ANISOU  473  C6   DA I -50    16629  18913  24827  -4952   2609   2213       C  
ATOM    474  N6   DA I -50      11.043  69.519  19.970  1.00152.27           N  
ANISOU  474  N6   DA I -50    16360  18000  23496  -4730   2878   2331       N  
ATOM    475  N1   DA I -50      10.539  68.569  17.920  1.00161.74           N  
ANISOU  475  N1   DA I -50    16706  19557  25192  -4968   2188   1778       N  
ATOM    476  C2   DA I -50       9.822  67.694  17.205  1.00167.03           C  
ANISOU  476  C2   DA I -50    16812  20290  26360  -5165   1866   1610       C  
ATOM    477  N3   DA I -50       8.884  66.841  17.615  1.00170.94           N  
ANISOU  477  N3   DA I -50    16927  20577  27445  -5396   1906   1831       N  
ATOM    478  C4   DA I -50       8.696  66.939  18.940  1.00170.08           C  
ANISOU  478  C4   DA I -50    17101  20191  27328  -5377   2377   2313       C  
ATOM    479  P    DC I -49       5.608  61.230  19.238  1.00204.40           P  
ANISOU  479  P    DC I -49    20045  23542  34076  -6192   1476   2193       P  
ATOM    480  OP1  DC I -49       4.624  60.271  18.688  1.00210.35           O  
ANISOU  480  OP1  DC I -49    20239  24225  35458  -6354   1165   2053       O  
ATOM    481  OP2  DC I -49       6.085  61.060  20.629  1.00204.96           O  
ANISOU  481  OP2  DC I -49    20624  23285  33965  -6115   1892   2580       O  
ATOM    482  O5'  DC I -49       6.865  61.272  18.261  1.00193.60           O  
ANISOU  482  O5'  DC I -49    18876  22297  32385  -6218   1000   1603       O  
ATOM    483  C5'  DC I -49       6.789  62.058  17.079  1.00185.04           C  
ANISOU  483  C5'  DC I -49    17509  21638  31159  -6146    755   1307       C  
ATOM    484  C4'  DC I -49       8.109  62.048  16.344  1.00173.35           C  
ANISOU  484  C4'  DC I -49    16301  20222  29340  -6123    366    808       C  
ATOM    485  O4'  DC I -49       8.910  63.180  16.758  1.00165.33           O  
ANISOU  485  O4'  DC I -49    15697  19288  27832  -5979    707    983       O  
ATOM    486  C3'  DC I -49       8.953  60.801  16.575  1.00169.35           C  
ANISOU  486  C3'  DC I -49    16111  19351  28883  -6238     93    559       C  
ATOM    487  O3'  DC I -49       9.350  60.271  15.327  1.00168.00           O  
ANISOU  487  O3'  DC I -49    15793  19324  28717  -6237   -500    -19       O  
ATOM    488  C2'  DC I -49      10.145  61.300  17.403  1.00163.60           C  
ANISOU  488  C2'  DC I -49    15999  18474  27687  -6159    376    702       C  
ATOM    489  C1'  DC I -49      10.231  62.769  17.011  1.00159.26           C  
ANISOU  489  C1'  DC I -49    15422  18279  26809  -6001    565    764       C  
ATOM    490  N1   DC I -49      10.780  63.652  18.085  1.00149.50           N  
ANISOU  490  N1   DC I -49    14678  16930  25194  -5882   1064   1140       N  
ATOM    491  C2   DC I -49      11.783  64.581  17.778  1.00141.69           C  
ANISOU  491  C2   DC I -49    13962  16070  23802  -5762   1083    986       C  
ATOM    492  O2   DC I -49      12.212  64.641  16.620  1.00140.39           O  
ANISOU  492  O2   DC I -49    13656  16154  23533  -5715    697    550       O  
ATOM    493  N3   DC I -49      12.257  65.385  18.766  1.00135.90           N  
ANISOU  493  N3   DC I -49    13728  15234  22674  -5604   1508   1292       N  
ATOM    494  C4   DC I -49      11.762  65.285  20.003  1.00134.89           C  
ANISOU  494  C4   DC I -49    13770  14872  22611  -5584   1910   1753       C  
ATOM    495  N4   DC I -49      12.257  66.093  20.946  1.00127.39           N  
ANISOU  495  N4   DC I -49    13326  13821  21257  -5390   2289   2010       N  
ATOM    496  C5   DC I -49      10.738  64.348  20.329  1.00140.15           C  
ANISOU  496  C5   DC I -49    14144  15425  23681  -5690   1922   1943       C  
ATOM    497  C6   DC I -49      10.279  63.564  19.350  1.00146.22           C  
ANISOU  497  C6   DC I -49    14441  16287  24829  -5854   1501   1627       C  
ATOM    498  P    DC I -48      10.043  58.828  15.234  1.00168.31           P  
ANISOU  498  P    DC I -48    16049  19054  28848  -6327   -880   -353       P  
ATOM    499  OP1  DC I -48       9.461  58.117  14.074  1.00171.24           O  
ANISOU  499  OP1  DC I -48    15990  19551  29521  -6338  -1401   -764       O  
ATOM    500  OP2  DC I -48      10.005  58.203  16.576  1.00167.46           O  
ANISOU  500  OP2  DC I -48    16185  18527  28915  -6437   -523     42       O  
ATOM    501  O5'  DC I -48      11.555  59.187  14.894  1.00161.19           O  
ANISOU  501  O5'  DC I -48    15608  18244  27392  -6197  -1033   -652       O  
ATOM    502  C5'  DC I -48      11.848  60.360  14.142  1.00156.33           C  
ANISOU  502  C5'  DC I -48    14928  18009  26461  -6035  -1071   -793       C  
ATOM    503  C4'  DC I -48      13.341  60.513  13.965  1.00152.59           C  
ANISOU  503  C4'  DC I -48    14918  17532  25527  -5922  -1193  -1041       C  
ATOM    504  O4'  DC I -48      13.843  61.511  14.894  1.00149.53           O  
ANISOU  504  O4'  DC I -48    14872  17063  24877  -5895   -724   -698       O  
ATOM    505  C3'  DC I -48      14.135  59.250  14.253  1.00153.65           C  
ANISOU  505  C3'  DC I -48    15403  17354  25625  -5982  -1396  -1209       C  
ATOM    506  O3'  DC I -48      15.306  59.228  13.449  1.00154.69           O  
ANISOU  506  O3'  DC I -48    15767  17628  25380  -5819  -1712  -1598       O  
ATOM    507  C2'  DC I -48      14.461  59.417  15.733  1.00150.01           C  
ANISOU  507  C2'  DC I -48    15338  16576  25083  -6059   -927   -783       C  
ATOM    508  C1'  DC I -48      14.753  60.909  15.793  1.00144.58           C  
ANISOU  508  C1'  DC I -48    14747  16093  24095  -5941   -649   -636       C  
ATOM    509  N1   DC I -48      14.554  61.517  17.143  1.00136.51           N  
ANISOU  509  N1   DC I -48    13961  14870  23037  -5961   -107   -129       N  
ATOM    510  C2   DC I -48      15.367  62.581  17.548  1.00130.72           C  
ANISOU  510  C2   DC I -48    13586  14145  21935  -5844    145    -25       C  
ATOM    511  O2   DC I -48      16.242  62.991  16.778  1.00133.79           O  
ANISOU  511  O2   DC I -48    14060  14700  22076  -5747    -69   -346       O  
ATOM    512  N3   DC I -48      15.171  63.129  18.774  1.00122.16           N  
ANISOU  512  N3   DC I -48    12754  12881  20779  -5808    628    426       N  
ATOM    513  C4   DC I -48      14.210  62.653  19.570  1.00119.19           C  
ANISOU  513  C4   DC I -48    12270  12346  20673  -5870    873    790       C  
ATOM    514  N4   DC I -48      14.050  63.221  20.770  1.00115.82           N  
ANISOU  514  N4   DC I -48    12129  11769  20109  -5763   1355   1240       N  
ATOM    515  C5   DC I -48      13.372  61.571  19.173  1.00126.33           C  
ANISOU  515  C5   DC I -48    12773  13228  21998  -6012    642    706       C  
ATOM    516  C6   DC I -48      13.576  61.039  17.964  1.00133.78           C  
ANISOU  516  C6   DC I -48    13483  14330  23016  -6060    146    232       C  
ATOM    517  P    DA I -47      15.300  58.482  12.025  1.00163.97           P  
ANISOU  517  P    DA I -47    16711  19011  26581  -5686  -2281  -2101       P  
ATOM    518  OP1  DA I -47      14.156  59.005  11.245  1.00169.42           O  
ANISOU  518  OP1  DA I -47    16866  20015  27491  -5632  -2402  -2170       O  
ATOM    519  OP2  DA I -47      15.424  57.029  12.274  1.00164.27           O  
ANISOU  519  OP2  DA I -47    16880  18736  26802  -5792  -2451  -2191       O  
ATOM    520  O5'  DA I -47      16.652  58.974  11.327  1.00153.07           O  
ANISOU  520  O5'  DA I -47    15621  17837  24702  -5444  -2441  -2380       O  
ATOM    521  C5'  DA I -47      16.768  60.316  10.870  1.00143.09           C  
ANISOU  521  C5'  DA I -47    14231  16894  23242  -5288  -2331  -2394       C  
ATOM    522  C4'  DA I -47      18.066  60.947  11.347  1.00136.07           C  
ANISOU  522  C4'  DA I -47    13788  15922  21991  -5226  -2103  -2311       C  
ATOM    523  O4'  DA I -47      17.969  61.256  12.763  1.00133.27           O  
ANISOU  523  O4'  DA I -47    13670  15264  21701  -5417  -1652  -1876       O  
ATOM    524  C3'  DA I -47      19.313  60.080  11.195  1.00135.65           C  
ANISOU  524  C3'  DA I -47    14134  15734  21672  -5135  -2337  -2525       C  
ATOM    525  O3'  DA I -47      20.425  60.912  10.923  1.00137.73           O  
ANISOU  525  O3'  DA I -47    14604  16127  21600  -4954  -2274  -2608       O  
ATOM    526  C2'  DA I -47      19.428  59.437  12.572  1.00132.35           C  
ANISOU  526  C2'  DA I -47    14044  14909  21335  -5357  -2089  -2226       C  
ATOM    527  C1'  DA I -47      18.995  60.587  13.467  1.00129.63           C  
ANISOU  527  C1'  DA I -47    13693  14513  21048  -5449  -1644  -1850       C  
ATOM    528  N9   DA I -47      18.461  60.151  14.753  1.00128.52           N  
ANISOU  528  N9   DA I -47    13668  14047  21118  -5646  -1358  -1501       N  
ATOM    529  C8   DA I -47      17.734  59.023  14.994  1.00130.61           C  
ANISOU  529  C8   DA I -47    13785  14134  21708  -5788  -1434  -1466       C  
ATOM    530  N7   DA I -47      17.379  58.879  16.247  1.00130.80           N  
ANISOU  530  N7   DA I -47    13943  13871  21885  -5915  -1092  -1100       N  
ATOM    531  C5   DA I -47      17.902  59.993  16.873  1.00125.89           C  
ANISOU  531  C5   DA I -47    13601  13241  20992  -5844   -789   -893       C  
ATOM    532  C6   DA I -47      17.866  60.428  18.210  1.00117.97           C  
ANISOU  532  C6   DA I -47    12868  11997  19956  -5867   -368   -492       C  
ATOM    533  N6   DA I -47      17.246  59.756  19.184  1.00113.95           N  
ANISOU  533  N6   DA I -47    12373  11216  19708  -5968   -152   -193       N  
ATOM    534  N1   DA I -47      18.496  61.580  18.509  1.00110.87           N  
ANISOU  534  N1   DA I -47    12228  11136  18763  -5750   -170   -402       N  
ATOM    535  C2   DA I -47      19.113  62.252  17.529  1.00111.16           C  
ANISOU  535  C2   DA I -47    12219  11428  18587  -5636   -353   -680       C  
ATOM    536  N3   DA I -47      19.213  61.944  16.234  1.00116.79           N  
ANISOU  536  N3   DA I -47    12674  12396  19304  -5591   -725  -1042       N  
ATOM    537  C4   DA I -47      18.576  60.791  15.969  1.00124.70           C  
ANISOU  537  C4   DA I -47    13455  13362  20566  -5693   -944  -1138       C  
ATOM    538  P    DA I -46      21.818  60.301  10.404  1.00135.10           P  
ANISOU  538  P    DA I -46    14597  15790  20945  -4762  -2528  -2866       P  
ATOM    539  OP1  DA I -46      21.768  60.264   8.926  1.00139.05           O  
ANISOU  539  OP1  DA I -46    14810  16658  21364  -4482  -2892  -3258       O  
ATOM    540  OP2  DA I -46      22.128  59.066  11.157  1.00138.47           O  
ANISOU  540  OP2  DA I -46    15331  15890  21391  -4911  -2547  -2783       O  
ATOM    541  O5'  DA I -46      22.872  61.406  10.858  1.00127.59           O  
ANISOU  541  O5'  DA I -46    13921  14807  19751  -4700  -2234  -2730       O  
ATOM    542  C5'  DA I -46      22.405  62.692  11.235  1.00125.43           C  
ANISOU  542  C5'  DA I -46    13498  14602  19556  -4763  -1872  -2536       C  
ATOM    543  C4'  DA I -46      22.931  63.083  12.603  1.00121.08           C  
ANISOU  543  C4'  DA I -46    13362  13717  18927  -4887  -1524  -2202       C  
ATOM    544  O4'  DA I -46      22.142  62.462  13.646  1.00123.33           O  
ANISOU  544  O4'  DA I -46    13718  13734  19407  -5098  -1414  -1931       O  
ATOM    545  C3'  DA I -46      24.385  62.701  12.871  1.00113.18           C  
ANISOU  545  C3'  DA I -46    12802  12544  17656  -4790  -1628  -2245       C  
ATOM    546  O3'  DA I -46      25.104  63.882  13.194  1.00105.61           O  
ANISOU  546  O3'  DA I -46    12004  11562  16561  -4720  -1351  -2149       O  
ATOM    547  C2'  DA I -46      24.306  61.707  14.050  1.00115.97           C  
ANISOU  547  C2'  DA I -46    13459  12568  18035  -4963  -1604  -2042       C  
ATOM    548  C1'  DA I -46      22.987  62.085  14.707  1.00120.15           C  
ANISOU  548  C1'  DA I -46    13786  13025  18841  -5134  -1339  -1781       C  
ATOM    549  N9   DA I -46      22.320  60.996  15.429  1.00121.78           N  
ANISOU  549  N9   DA I -46    14019  13017  19235  -5316  -1327  -1655       N  
ATOM    550  C8   DA I -46      21.784  59.867  14.883  1.00121.69           C  
ANISOU  550  C8   DA I -46    13789  13042  19406  -5377  -1569  -1829       C  
ATOM    551  N7   DA I -46      21.203  59.075  15.751  1.00122.65           N  
ANISOU  551  N7   DA I -46    13940  12911  19750  -5544  -1447  -1653       N  
ATOM    552  C5   DA I -46      21.368  59.727  16.960  1.00119.94           C  
ANISOU  552  C5   DA I -46    13872  12367  19332  -5577  -1106  -1341       C  
ATOM    553  C6   DA I -46      20.975  59.399  18.273  1.00115.66           C  
ANISOU  553  C6   DA I -46    13490  11513  18944  -5691   -827  -1028       C  
ATOM    554  N6   DA I -46      20.314  58.280  18.584  1.00112.40           N  
ANISOU  554  N6   DA I -46    12946  10920  18839  -5821   -830   -965       N  
ATOM    555  N1   DA I -46      21.291  60.266  19.258  1.00118.72           N  
ANISOU  555  N1   DA I -46    14169  11756  19184  -5638   -550   -769       N  
ATOM    556  C2   DA I -46      21.946  61.390  18.940  1.00120.22           C  
ANISOU  556  C2   DA I -46    14458  12087  19135  -5495   -560   -824       C  
ATOM    557  N3   DA I -46      22.373  61.805  17.743  1.00121.72           N  
ANISOU  557  N3   DA I -46    14494  12557  19198  -5392   -777  -1095       N  
ATOM    558  C4   DA I -46      22.046  60.920  16.784  1.00121.16           C  
ANISOU  558  C4   DA I -46    14154  12645  19236  -5437  -1046  -1343       C  
ATOM    559  P    DA I -45      26.673  63.847  13.525  1.00115.90           P  
ANISOU  559  P    DA I -45    13718  12697  17622  -4588  -1414  -2152       P  
ATOM    560  OP1  DA I -45      27.279  65.036  12.881  1.00111.73           O  
ANISOU  560  OP1  DA I -45    13079  12359  17013  -4464  -1233  -2258       O  
ATOM    561  OP2  DA I -45      27.205  62.500  13.223  1.00116.84           O  
ANISOU  561  OP2  DA I -45    13976  12793  17625  -4556  -1742  -2303       O  
ATOM    562  O5'  DA I -45      26.696  64.070  15.102  1.00113.13           O  
ANISOU  562  O5'  DA I -45    13707  11997  17281  -4669  -1202  -1830       O  
ATOM    563  C5'  DA I -45      25.538  64.591  15.741  1.00112.03           C  
ANISOU  563  C5'  DA I -45    13459  11807  17301  -4807   -895  -1616       C  
ATOM    564  C4'  DA I -45      25.777  64.810  17.219  1.00109.80           C  
ANISOU  564  C4'  DA I -45    13530  11195  16995  -4792   -709  -1371       C  
ATOM    565  O4'  DA I -45      25.062  63.815  17.992  1.00109.68           O  
ANISOU  565  O4'  DA I -45    13544  10975  17155  -4926   -748  -1213       O  
ATOM    566  C3'  DA I -45      27.218  64.703  17.667  1.00106.66           C  
ANISOU  566  C3'  DA I -45    13446  10617  16465  -4598   -883  -1438       C  
ATOM    567  O3'  DA I -45      27.379  65.510  18.805  1.00112.47           O  
ANISOU  567  O3'  DA I -45    14435  11162  17139  -4542   -612  -1287       O  
ATOM    568  C2'  DA I -45      27.345  63.213  17.999  1.00104.05           C  
ANISOU  568  C2'  DA I -45    13207  10138  16187  -4595  -1173  -1444       C  
ATOM    569  C1'  DA I -45      25.975  62.914  18.598  1.00103.31           C  
ANISOU  569  C1'  DA I -45    13015   9944  16295  -4820   -984  -1239       C  
ATOM    570  N9   DA I -45      25.476  61.564  18.348  1.00102.33           N  
ANISOU  570  N9   DA I -45    12872   9885  16123  -5017  -1109  -1295       N  
ATOM    571  C8   DA I -45      25.399  60.919  17.144  1.00104.18           C  
ANISOU  571  C8   DA I -45    12901  10369  16314  -5088  -1281  -1580       C  
ATOM    572  N7   DA I -45      24.866  59.721  17.216  1.00106.72           N  
ANISOU  572  N7   DA I -45    13145  10622  16780  -5245  -1309  -1653       N  
ATOM    573  C5   DA I -45      24.560  59.576  18.560  1.00106.18           C  
ANISOU  573  C5   DA I -45    13270  10267  16806  -5319  -1068  -1393       C  
ATOM    574  C6   DA I -45      23.966  58.529  19.294  1.00109.59           C  
ANISOU  574  C6   DA I -45    13709  10454  17478  -5484   -961  -1292       C  
ATOM    575  N6   DA I -45      23.565  57.378  18.745  1.00114.02           N  
ANISOU  575  N6   DA I -45    14055  11024  18244  -5582  -1127  -1450       N  
ATOM    576  N1   DA I -45      23.802  58.711  20.623  1.00109.42           N  
ANISOU  576  N1   DA I -45    13912  10150  17513  -5493   -707   -986       N  
ATOM    577  C2   DA I -45      24.198  59.865  21.168  1.00105.46           C  
ANISOU  577  C2   DA I -45    13603   9607  16859  -5328   -647   -798       C  
ATOM    578  N3   DA I -45      24.767  60.917  20.585  1.00103.51           N  
ANISOU  578  N3   DA I -45    13293   9514  16524  -5127   -807   -862       N  
ATOM    579  C4   DA I -45      24.926  60.705  19.269  1.00104.51           C  
ANISOU  579  C4   DA I -45    13255   9955  16499  -5174   -965  -1163       C  
ATOM    580  P    DA I -44      28.828  65.782  19.430  1.00116.31           P  
ANISOU  580  P    DA I -44    15199  11473  17522  -4315   -718  -1370       P  
ATOM    581  OP1  DA I -44      28.886  67.231  19.715  1.00119.61           O  
ANISOU  581  OP1  DA I -44    15755  11891  17799  -4293   -435  -1281       O  
ATOM    582  OP2  DA I -44      29.857  65.146  18.577  1.00117.85           O  
ANISOU  582  OP2  DA I -44    15306  11758  17715  -4182  -1061  -1562       O  
ATOM    583  O5'  DA I -44      28.757  65.006  20.817  1.00111.09           O  
ANISOU  583  O5'  DA I -44    14753  10515  16942  -4293   -693  -1297       O  
ATOM    584  C5'  DA I -44      27.528  64.966  21.521  1.00105.16           C  
ANISOU  584  C5'  DA I -44    14064   9662  16227  -4470   -423  -1061       C  
ATOM    585  C4'  DA I -44      27.617  64.014  22.691  1.00102.45           C  
ANISOU  585  C4'  DA I -44    13935   9032  15961  -4450   -422  -1002       C  
ATOM    586  O4'  DA I -44      27.051  62.730  22.326  1.00104.31           O  
ANISOU  586  O4'  DA I -44    13913   9238  16482  -4570   -569   -991       O  
ATOM    587  C3'  DA I -44      29.034  63.741  23.180  1.00 97.93           C  
ANISOU  587  C3'  DA I -44    13546   8346  15319  -4222   -603  -1219       C  
ATOM    588  O3'  DA I -44      29.053  63.803  24.592  1.00100.57           O  
ANISOU  588  O3'  DA I -44    14287   8418  15507  -4192   -435  -1095       O  
ATOM    589  C2'  DA I -44      29.334  62.333  22.652  1.00 97.63           C  
ANISOU  589  C2'  DA I -44    13255   8337  15503  -4186   -814  -1401       C  
ATOM    590  C1'  DA I -44      27.955  61.696  22.642  1.00101.29           C  
ANISOU  590  C1'  DA I -44    13579   8736  16171  -4414   -729  -1180       C  
ATOM    591  N9   DA I -44      27.795  60.647  21.639  1.00101.65           N  
ANISOU  591  N9   DA I -44    13279   8937  16406  -4393   -912  -1345       N  
ATOM    592  C8   DA I -44      28.118  60.720  20.312  1.00100.30           C  
ANISOU  592  C8   DA I -44    12883   9039  16188  -4294  -1149  -1533       C  
ATOM    593  N7   DA I -44      27.844  59.627  19.640  1.00103.78           N  
ANISOU  593  N7   DA I -44    13751   9887  15793  -4858   -901  -1705       N  
ATOM    594  C5   DA I -44      27.296  58.781  20.589  1.00103.88           C  
ANISOU  594  C5   DA I -44    13805   9623  16042  -4960   -743  -1616       C  
ATOM    595  C6   DA I -44      26.799  57.464  20.515  1.00104.08           C  
ANISOU  595  C6   DA I -44    13757   9536  16253  -5129   -866  -1610       C  
ATOM    596  N6   DA I -44      26.775  56.748  19.387  1.00106.54           N  
ANISOU  596  N6   DA I -44    13874  10021  16586  -5185  -1125  -1810       N  
ATOM    597  N1   DA I -44      26.323  56.911  21.651  1.00106.10           N  
ANISOU  597  N1   DA I -44    14136   9460  16718  -5224   -698  -1395       N  
ATOM    598  C2   DA I -44      26.345  57.631  22.778  1.00104.74           C  
ANISOU  598  C2   DA I -44    14158   9085  16554  -5128   -427  -1206       C  
ATOM    599  N3   DA I -44      26.788  58.873  22.971  1.00103.72           N  
ANISOU  599  N3   DA I -44    13581   8792  17037  -4608   -561  -1179       N  
ATOM    600  C4   DA I -44      27.258  59.395  21.827  1.00104.20           C  
ANISOU  600  C4   DA I -44    13489   9189  16915  -4527   -634  -1478       C  
ATOM    601  P    DG I -43      30.432  63.690  25.407  1.00 80.29           P  
ANISOU  601  P    DG I -43    13596   7002   9908  -1857   -247   1188       P  
ATOM    602  OP1  DG I -43      30.510  64.867  26.301  1.00 82.55           O  
ANISOU  602  OP1  DG I -43    13749   7745   9871  -1777   -406   1282       O  
ATOM    603  OP2  DG I -43      31.542  63.421  24.465  1.00 78.68           O  
ANISOU  603  OP2  DG I -43    13418   6596   9881  -1715   -214   1008       O  
ATOM    604  O5'  DG I -43      30.196  62.397  26.308  1.00 92.36           O  
ANISOU  604  O5'  DG I -43    15212   8263  11619  -1810   -130   1557       O  
ATOM    605  C5'  DG I -43      28.929  62.205  26.927  1.00 97.61           C  
ANISOU  605  C5'  DG I -43    15896   8962  12228  -2000    -91   1723       C  
ATOM    606  C4'  DG I -43      28.756  60.769  27.370  1.00106.29           C  
ANISOU  606  C4'  DG I -43    17110   9678  13598  -1987     59   2007       C  
ATOM    607  O4'  DG I -43      28.475  59.932  26.219  1.00112.38           O  
ANISOU  607  O4'  DG I -43    17911  10122  14668  -2101    174   1753       O  
ATOM    608  C3'  DG I -43      29.978  60.164  28.061  1.00111.01           C  
ANISOU  608  C3'  DG I -43    17714  10175  14290  -1664     79   2274       C  
ATOM    609  O3'  DG I -43      29.586  59.537  29.269  1.00111.60           O  
ANISOU  609  O3'  DG I -43    17803  10226  14374  -1611    140   2674       O  
ATOM    610  C2'  DG I -43      30.517  59.157  27.041  1.00116.89           C  
ANISOU  610  C2'  DG I -43    18595  10456  15362  -1641    197   2125       C  
ATOM    611  C1'  DG I -43      29.258  58.766  26.285  1.00118.97           C  
ANISOU  611  C1'  DG I -43    18829  10603  15773  -1921    276   1906       C  
ATOM    612  N9   DG I -43      29.513  58.304  24.921  1.00124.59           N  
ANISOU  612  N9   DG I -43    19549  11080  16709  -1937    327   1566       N  
ATOM    613  C8   DG I -43      30.127  59.005  23.909  1.00123.96           C  
ANISOU  613  C8   DG I -43    19463  11077  16559  -1900    265   1243       C  
ATOM    614  N7   DG I -43      30.214  58.335  22.792  1.00125.80           N  
ANISOU  614  N7   DG I -43    19683  11094  17021  -1894    329    995       N  
ATOM    615  C5   DG I -43      29.619  57.113  23.080  1.00128.91           C  
ANISOU  615  C5   DG I -43    20089  11230  17660  -1947    423   1157       C  
ATOM    616  C6   DG I -43      29.417  55.977  22.255  1.00132.46           C  
ANISOU  616  C6   DG I -43    20539  11378  18411  -1968    487   1021       C  
ATOM    617  O6   DG I -43      29.736  55.823  21.067  1.00130.56           O  
ANISOU  617  O6   DG I -43    20285  11053  18269  -1927    477    726       O  
ATOM    618  N1   DG I -43      28.772  54.950  22.942  1.00137.31           N  
ANISOU  618  N1   DG I -43    21168  11788  19215  -2039    554   1279       N  
ATOM    619  C2   DG I -43      28.373  55.013  24.257  1.00137.47           C  
ANISOU  619  C2   DG I -43    21185  11906  19142  -2068    576   1633       C  
ATOM    620  N2   DG I -43      27.764  53.928  24.755  1.00140.21           N  
ANISOU  620  N2   DG I -43    21529  12032  19713  -2133    647   1859       N  
ATOM    621  N3   DG I -43      28.556  56.071  25.037  1.00134.86           N  
ANISOU  621  N3   DG I -43    20847  11882  18511  -2027    518   1766       N  
ATOM    622  C4   DG I -43      29.182  57.079  24.386  1.00129.98           C  
ANISOU  622  C4   DG I -43    20232  11445  17710  -1976    433   1510       C  
ATOM    623  P    DT I -42      30.688  58.866  30.225  1.00116.37           P  
ANISOU  623  P    DT I -42    18410  10759  15046  -1268    168   3023       P  
ATOM    624  OP1  DT I -42      30.170  58.910  31.610  1.00116.94           O  
ANISOU  624  OP1  DT I -42    18428  11056  14948  -1210    157   3393       O  
ATOM    625  OP2  DT I -42      31.999  59.475  29.906  1.00117.96           O  
ANISOU  625  OP2  DT I -42    18534  11114  15171  -1041     60   2871       O  
ATOM    626  O5'  DT I -42      30.725  57.347  29.739  1.00114.98           O  
ANISOU  626  O5'  DT I -42    18403  10024  15262  -1294    355   3081       O  
ATOM    627  C5'  DT I -42      29.518  56.608  29.648  1.00114.92           C  
ANISOU  627  C5'  DT I -42    18348   9871  15447  -1514    470   3087       C  
ATOM    628  C4'  DT I -42      29.803  55.121  29.690  1.00120.23           C  
ANISOU  628  C4'  DT I -42    19068  10141  16474  -1414    607   3253       C  
ATOM    629  O4'  DT I -42      29.896  54.604  28.339  1.00125.66           O  
ANISOU  629  O4'  DT I -42    19804  10531  17410  -1509    643   2909       O  
ATOM    630  C3'  DT I -42      31.100  54.739  30.392  1.00120.70           C  
ANISOU  630  C3'  DT I -42    19183  10140  16539  -1070    612   3529       C  
ATOM    631  O3'  DT I -42      30.891  53.578  31.184  1.00122.50           O  
ANISOU  631  O3'  DT I -42    19402  10187  16957  -1012    694   3860       O  
ATOM    632  C2'  DT I -42      32.075  54.490  29.236  1.00123.98           C  
ANISOU  632  C2'  DT I -42    19688  10304  17114   -974    623   3249       C  
ATOM    633  C1'  DT I -42      31.157  54.005  28.121  1.00127.93           C  
ANISOU  633  C1'  DT I -42    20184  10584  17840  -1256    671   2939       C  
ATOM    634  N1   DT I -42      31.619  54.392  26.751  1.00126.50           N  
ANISOU  634  N1   DT I -42    20036  10344  17682  -1279    636   2520       N  
ATOM    635  C2   DT I -42      31.515  53.484  25.722  1.00131.55           C  
ANISOU  635  C2   DT I -42    20706  10674  18602  -1343    686   2296       C  
ATOM    636  O2   DT I -42      31.071  52.360  25.866  1.00138.70           O  
ANISOU  636  O2   DT I -42    21631  11326  19744  -1398    743   2418       O  
ATOM    637  N3   DT I -42      31.957  53.941  24.507  1.00130.60           N  
ANISOU  637  N3   DT I -42    20593  10564  18465  -1335    648   1923       N  
ATOM    638  C4   DT I -42      32.478  55.190  24.223  1.00127.94           C  
ANISOU  638  C4   DT I -42    20238  10493  17879  -1287    568   1759       C  
ATOM    639  O4   DT I -42      32.847  55.505  23.095  1.00129.54           O  
ANISOU  639  O4   DT I -42    20432  10696  18092  -1277    544   1432       O  
ATOM    640  C5   DT I -42      32.556  56.096  25.345  1.00123.34           C  
ANISOU  640  C5   DT I -42    19642  10204  17016  -1244    497   2007       C  
ATOM    641  C7   DT I -42      33.105  57.479  25.159  1.00118.23           C  
ANISOU  641  C7   DT I -42    18982   9854  16087  -1205    367   1863       C  
ATOM    642  C6   DT I -42      32.127  55.659  26.540  1.00123.25           C  
ANISOU  642  C6   DT I -42    19619  10206  17002  -1233    533   2369       C  
ATOM    643  P    DG I -41      32.113  52.883  31.960  1.00125.83           P  
ANISOU  643  P    DG I -41    19874  10521  17415   -663    703   4156       P  
ATOM    644  OP1  DG I -41      31.568  52.293  33.203  1.00129.36           O  
ANISOU  644  OP1  DG I -41    20296  11026  17828   -654    715   4520       O  
ATOM    645  OP2  DG I -41      33.240  53.840  32.039  1.00120.26           O  
ANISOU  645  OP2  DG I -41    19152  10059  16482   -410    623   4123       O  
ATOM    646  O5'  DG I -41      32.528  51.691  30.985  1.00128.00           O  
ANISOU  646  O5'  DG I -41    20267  10338  18030   -659    779   3985       O  
ATOM    647  C5'  DG I -41      31.514  50.898  30.381  1.00132.66           C  
ANISOU  647  C5'  DG I -41    20884  10657  18863   -938    823   3858       C  
ATOM    648  C4'  DG I -41      32.118  49.793  29.537  1.00139.50           C  
ANISOU  648  C4'  DG I -41    21876  11121  20006   -864    869   3710       C  
ATOM    649  O4'  DG I -41      32.392  50.292  28.200  1.00137.54           O  
ANISOU  649  O4'  DG I -41    21633  10836  19789   -912    849   3300       O  
ATOM    650  C3'  DG I -41      33.442  49.236  30.050  1.00146.08           C  
ANISOU  650  C3'  DG I -41    22787  11868  20847   -505    904   3915       C  
ATOM    651  O3'  DG I -41      33.507  47.844  29.762  1.00155.80           O  
ANISOU  651  O3'  DG I -41    24145  12706  22344   -495    964   3928       O  
ATOM    652  C2'  DG I -41      34.463  50.024  29.232  1.00141.66           C  
ANISOU  652  C2'  DG I -41    22219  11398  20210   -342    877   3663       C  
ATOM    653  C1'  DG I -41      33.752  50.073  27.893  1.00138.98           C  
ANISOU  653  C1'  DG I -41    21892  10910  20002   -618    868   3264       C  
ATOM    654  N9   DG I -41      34.203  51.139  27.004  1.00132.87           N  
ANISOU  654  N9   DG I -41    21089  10299  19098   -601    823   2950       N  
ATOM    655  C8   DG I -41      34.459  52.449  27.329  1.00128.54           C  
ANISOU  655  C8   DG I -41    20474  10099  18266   -551    758   2955       C  
ATOM    656  N7   DG I -41      34.840  53.171  26.309  1.00125.53           N  
ANISOU  656  N7   DG I -41    20098   9780  17820   -563    717   2626       N  
ATOM    657  C5   DG I -41      34.824  52.282  25.240  1.00127.48           C  
ANISOU  657  C5   DG I -41    20398   9718  18319   -610    766   2388       C  
ATOM    658  C6   DG I -41      35.139  52.485  23.874  1.00124.86           C  
ANISOU  658  C6   DG I -41    20078   9327  18035   -624    751   2000       C  
ATOM    659  O6   DG I -41      35.508  53.528  23.315  1.00119.41           O  
ANISOU  659  O6   DG I -41    19352   8839  17178   -609    696   1785       O  
ATOM    660  N1   DG I -41      34.991  51.314  23.132  1.00126.54           N  
ANISOU  660  N1   DG I -41    20353   9216  18510   -653    793   1870       N  
ATOM    661  C2   DG I -41      34.588  50.103  23.647  1.00129.52           C  
ANISOU  661  C2   DG I -41    20792   9336  19084   -683    837   2084       C  
ATOM    662  N2   DG I -41      34.500  49.081  22.788  1.00132.60           N  
ANISOU  662  N2   DG I -41    21260   9422  19701   -711    850   1910       N  
ATOM    663  N3   DG I -41      34.292  49.904  24.920  1.00132.24           N  
ANISOU  663  N3   DG I -41    21126   9726  19393   -681    856   2447       N  
ATOM    664  C4   DG I -41      34.432  51.031  25.655  1.00130.89           C  
ANISOU  664  C4   DG I -41    20877   9890  18964   -636    823   2581       C  
ATOM    665  P    DT I -40      34.196  46.824  30.795  1.00144.85           P  
ANISOU  665  P    DT I -40    22837  11202  20998   -225   1030   4284       P  
ATOM    666  OP1  DT I -40      33.212  45.757  31.089  1.00149.24           O  
ANISOU  666  OP1  DT I -40    23473  11511  21721   -431   1068   4413       O  
ATOM    667  OP2  DT I -40      34.774  47.617  31.903  1.00141.10           O  
ANISOU  667  OP2  DT I -40    22254  11104  20252      8   1001   4536       O  
ATOM    668  O5'  DT I -40      35.395  46.190  29.949  1.00147.94           O  
ANISOU  668  O5'  DT I -40    23330  11329  21550     12   1073   4124       O  
ATOM    669  C5'  DT I -40      35.951  46.920  28.866  1.00143.20           C  
ANISOU  669  C5'  DT I -40    22703  10783  20922     52   1040   3802       C  
ATOM    670  C4'  DT I -40      36.416  45.993  27.764  1.00143.57           C  
ANISOU  670  C4'  DT I -40    22879  10470  21201    109   1079   3573       C  
ATOM    671  O4'  DT I -40      36.420  46.713  26.506  1.00143.69           O  
ANISOU  671  O4'  DT I -40    22864  10529  21204      9   1035   3182       O  
ATOM    672  C3'  DT I -40      37.831  45.474  27.934  1.00141.36           C  
ANISOU  672  C3'  DT I -40    22651  10115  20944    494   1137   3699       C  
ATOM    673  O3'  DT I -40      37.978  44.228  27.272  1.00135.82           O  
ANISOU  673  O3'  DT I -40    22102   9022  20481    521   1188   3599       O  
ATOM    674  C2'  DT I -40      38.657  46.568  27.268  1.00143.11           C  
ANISOU  674  C2'  DT I -40    22791  10558  21028    631   1099   3488       C  
ATOM    675  C1'  DT I -40      37.750  47.001  26.116  1.00144.81           C  
ANISOU  675  C1'  DT I -40    23005  10726  21289    313   1052   3110       C  
ATOM    676  N1   DT I -40      37.850  48.459  25.806  1.00143.77           N  
ANISOU  676  N1   DT I -40    22758  10920  20947    276    990   2941       N  
ATOM    677  C2   DT I -40      38.060  48.863  24.506  1.00143.01           C  
ANISOU  677  C2   DT I -40    22666  10802  20868    239    970   2568       C  
ATOM    678  O2   DT I -40      38.169  48.085  23.575  1.00145.07           O  
ANISOU  678  O2   DT I -40    23013  10802  21305    244    996   2364       O  
ATOM    679  N3   DT I -40      38.143  50.221  24.335  1.00139.28           N  
ANISOU  679  N3   DT I -40    22098  10637  20185    203    912   2441       N  
ATOM    680  C4   DT I -40      38.039  51.194  25.313  1.00136.86           C  
ANISOU  680  C4   DT I -40    21703  10644  19652    202    862   2645       C  
ATOM    681  O4   DT I -40      38.126  52.391  25.060  1.00135.44           O  
ANISOU  681  O4   DT I -40    21465  10716  19281    164    797   2501       O  
ATOM    682  C5   DT I -40      37.820  50.702  26.653  1.00137.44           C  
ANISOU  682  C5   DT I -40    21765  10742  19715    256    881   3035       C  
ATOM    683  C7   DT I -40      37.692  51.661  27.799  1.00134.10           C  
ANISOU  683  C7   DT I -40    21240  10679  19032    284    815   3283       C  
ATOM    684  C6   DT I -40      37.739  49.375  26.832  1.00142.15           C  
ANISOU  684  C6   DT I -40    22448  11043  20521    289    947   3163       C  
ATOM    685  P    DA I -39      39.397  43.473  27.278  1.00152.96           P  
ANISOU  685  P    DA I -39    24348  11056  22715    914   1262   3700       P  
ATOM    686  OP1  DA I -39      39.128  42.020  27.225  1.00154.30           O  
ANISOU  686  OP1  DA I -39    24685  10828  23115    882   1317   3759       O  
ATOM    687  OP2  DA I -39      40.204  44.025  28.389  1.00151.71           O  
ANISOU  687  OP2  DA I -39    24069  11216  22358   1182   1267   3996       O  
ATOM    688  O5'  DA I -39      40.071  43.924  25.899  1.00148.63           O  
ANISOU  688  O5'  DA I -39    23799  10498  22175    995   1243   3333       O  
ATOM    689  C5'  DA I -39      39.364  43.738  24.679  1.00144.20           C  
ANISOU  689  C5'  DA I -39    23305   9738  21747    750   1208   2979       C  
ATOM    690  C4'  DA I -39      40.223  44.097  23.478  1.00139.39           C  
ANISOU  690  C4'  DA I -39    22693   9147  21123    907   1206   2675       C  
ATOM    691  O4'  DA I -39      40.156  45.524  23.225  1.00131.88           O  
ANISOU  691  O4'  DA I -39    21599   8529  19980    827   1148   2524       O  
ATOM    692  C3'  DA I -39      41.704  43.759  23.598  1.00142.52           C  
ANISOU  692  C3'  DA I -39    23108   9537  21504   1318   1275   2807       C  
ATOM    693  O3'  DA I -39      42.175  43.312  22.332  1.00147.55           O  
ANISOU  693  O3'  DA I -39    23832   9980  22249   1409   1292   2520       O  
ATOM    694  C2'  DA I -39      42.327  45.098  24.002  1.00136.70           C  
ANISOU  694  C2'  DA I -39    22201   9204  20536   1450   1243   2881       C  
ATOM    695  C1'  DA I -39      41.457  46.080  23.234  1.00130.64           C  
ANISOU  695  C1'  DA I -39    21375   8562  19701   1147   1169   2572       C  
ATOM    696  N9   DA I -39      41.358  47.403  23.843  1.00127.05           N  
ANISOU  696  N9   DA I -39    20774   8472  19026   1099   1112   2658       N  
ATOM    697  C8   DA I -39      41.031  47.693  25.138  1.00127.17           C  
ANISOU  697  C8   DA I -39    20721   8668  18928   1073   1090   2970       C  
ATOM    698  N7   DA I -39      40.986  48.978  25.399  1.00122.19           N  
ANISOU  698  N7   DA I -39    19972   8366  18091   1031   1023   2967       N  
ATOM    699  C5   DA I -39      41.294  49.573  24.188  1.00120.65           C  
ANISOU  699  C5   DA I -39    19766   8196  17878   1018   1004   2628       C  
ATOM    700  C6   DA I -39      41.410  50.919  23.796  1.00119.72           C  
ANISOU  700  C6   DA I -39    19559   8350  17579    973    937   2455       C  
ATOM    701  N6   DA I -39      41.219  51.947  24.629  1.00118.88           N  
ANISOU  701  N6   DA I -39    19362   8547  17260    933    864   2608       N  
ATOM    702  N1   DA I -39      41.732  51.169  22.510  1.00116.73           N  
ANISOU  702  N1   DA I -39    19192   7929  17230    978    940   2118       N  
ATOM    703  C2   DA I -39      41.924  50.138  21.679  1.00117.71           C  
ANISOU  703  C2   DA I -39    19408   7769  17546   1033   1000   1967       C  
ATOM    704  N3   DA I -39      41.841  48.834  21.931  1.00120.39           N  
ANISOU  704  N3   DA I -39    19851   7827  18065   1079   1057   2099       N  
ATOM    705  C4   DA I -39      41.519  48.617  23.216  1.00122.75           C  
ANISOU  705  C4   DA I -39    20139   8164  18337   1063   1059   2434       C  
ATOM    706  P    DT I -38      43.707  42.879  22.116  1.00144.09           P  
ANISOU  706  P    DT I -38    23423   9508  21818   1831   1367   2581       P  
ATOM    707  OP1  DT I -38      43.696  41.677  21.252  1.00144.54           O  
ANISOU  707  OP1  DT I -38    23654   9191  22074   1851   1398   2411       O  
ATOM    708  OP2  DT I -38      44.385  42.827  23.431  1.00145.47           O  
ANISOU  708  OP2  DT I -38    23533   9832  21907   2068   1408   2974       O  
ATOM    709  O5'  DT I -38      44.316  44.093  21.273  1.00139.94           O  
ANISOU  709  O5'  DT I -38    22769   9259  21143   1913   1334   2341       O  
ATOM    710  C5'  DT I -38      43.639  44.538  20.105  1.00137.10           C  
ANISOU  710  C5'  DT I -38    22411   8888  20794   1675   1278   1964       C  
ATOM    711  C4'  DT I -38      44.415  45.639  19.406  1.00134.09           C  
ANISOU  711  C4'  DT I -38    21907   8777  20263   1814   1263   1787       C  
ATOM    712  O4'  DT I -38      44.189  46.904  20.079  1.00132.03           O  
ANISOU  712  O4'  DT I -38    21502   8844  19822   1714   1210   1884       O  
ATOM    713  C3'  DT I -38      45.928  45.436  19.354  1.00134.27           C  
ANISOU  713  C3'  DT I -38    21905   8848  20263   2229   1332   1904       C  
ATOM    714  O3'  DT I -38      46.396  45.731  18.040  1.00133.04           O  
ANISOU  714  O3'  DT I -38    21733   8725  20091   2310   1334   1595       O  
ATOM    715  C2'  DT I -38      46.455  46.424  20.398  1.00133.15           C  
ANISOU  715  C2'  DT I -38    21596   9049  19946   2353   1308   2172       C  
ATOM    716  C1'  DT I -38      45.422  47.537  20.338  1.00130.60           C  
ANISOU  716  C1'  DT I -38    21204   8902  19515   2021   1224   2020       C  
ATOM    717  N1   DT I -38      45.282  48.308  21.614  1.00127.12           N  
ANISOU  717  N1   DT I -38    20650   8723  18927   1995   1175   2303       N  
ATOM    718  C2   DT I -38      45.283  49.684  21.574  1.00122.06           C  
ANISOU  718  C2   DT I -38    19882   8387  18109   1931   1104   2228       C  
ATOM    719  O2   DT I -38      45.406  50.323  20.544  1.00120.81           O  
ANISOU  719  O2   DT I -38    19693   8298  17910   1894   1086   1942       O  
ATOM    720  N3   DT I -38      45.135  50.293  22.794  1.00116.96           N  
ANISOU  720  N3   DT I -38    19144   7973  17324   1920   1047   2504       N  
ATOM    721  C4   DT I -38      44.987  49.676  24.023  1.00113.57           C  
ANISOU  721  C4   DT I -38    18723   7521  16909   1967   1059   2839       C  
ATOM    722  O4   DT I -38      44.860  50.312  25.066  1.00104.38           O  
ANISOU  722  O4   DT I -38    17458   6610  15592   1965    993   3068       O  
ATOM    723  C5   DT I -38      44.991  48.232  23.994  1.00123.58           C  
ANISOU  723  C5   DT I -38    20125   8458  18370   2027   1146   2900       C  
ATOM    724  C7   DT I -38      44.839  47.452  25.266  1.00127.84           C  
ANISOU  724  C7   DT I -38    20688   8948  18938   2084   1171   3254       C  
ATOM    725  C6   DT I -38      45.135  47.625  22.805  1.00128.29           C  
ANISOU  725  C6   DT I -38    20826   8808  19109   2035   1196   2632       C  
ATOM    726  P    DT I -37      47.966  45.788  17.699  1.00133.37           P  
ANISOU  726  P    DT I -37    21705   8886  20082   2725   1397   1649       P  
ATOM    727  OP1  DT I -37      48.128  45.205  16.348  1.00133.27           O  
ANISOU  727  OP1  DT I -37    21790   8688  20159   2778   1425   1351       O  
ATOM    728  OP2  DT I -37      48.751  45.223  18.820  1.00134.52           O  
ANISOU  728  OP2  DT I -37    21839   9036  20237   2990   1449   2025       O  
ATOM    729  O5'  DT I -37      48.255  47.355  17.601  1.00128.37           O  
ANISOU  729  O5'  DT I -37    20877   8636  19261   2719   1343   1589       O  
ATOM    730  C5'  DT I -37      47.337  48.185  16.903  1.00122.11           C  
ANISOU  730  C5'  DT I -37    20060   7927  18411   2415   1276   1292       C  
ATOM    731  C4'  DT I -37      47.776  49.636  16.930  1.00115.56           C  
ANISOU  731  C4'  DT I -37    19052   7453  17401   2458   1231   1281       C  
ATOM    732  O4'  DT I -37      47.512  50.209  18.236  1.00113.19           O  
ANISOU  732  O4'  DT I -37    18681   7318  17007   2389   1180   1557       O  
ATOM    733  C3'  DT I -37      49.255  49.875  16.646  1.00112.69           C  
ANISOU  733  C3'  DT I -37    18572   7254  16991   2838   1275   1357       C  
ATOM    734  O3'  DT I -37      49.389  51.014  15.814  1.00105.33           O  
ANISOU  734  O3'  DT I -37    17527   6545  15948   2799   1239   1126       O  
ATOM    735  C2'  DT I -37      49.846  50.109  18.040  1.00113.99           C  
ANISOU  735  C2'  DT I -37    18626   7599  17087   3014   1254   1753       C  
ATOM    736  C1'  DT I -37      48.688  50.790  18.755  1.00113.08           C  
ANISOU  736  C1'  DT I -37    18512   7560  16893   2689   1172   1782       C  
ATOM    737  N1   DT I -37      48.677  50.595  20.236  1.00117.00           N  
ANISOU  737  N1   DT I -37    18976   8121  17358   2741   1147   2158       N  
ATOM    738  C2   DT I -37      48.525  51.688  21.056  1.00116.74           C  
ANISOU  738  C2   DT I -37    18817   8377  17163   2679   1052   2305       C  
ATOM    739  O2   DT I -37      48.415  52.827  20.638  1.00115.07           O  
ANISOU  739  O2   DT I -37    18529   8358  16835   2581    987   2142       O  
ATOM    740  N3   DT I -37      48.509  51.402  22.395  1.00115.34           N  
ANISOU  740  N3   DT I -37    18605   8268  16951   2740   1026   2648       N  
ATOM    741  C4   DT I -37      48.622  50.159  22.986  1.00115.19           C  
ANISOU  741  C4   DT I -37    18667   8054  17046   2849   1093   2854       C  
ATOM    742  O4   DT I -37      48.597  50.008  24.204  1.00116.54           O  
ANISOU  742  O4   DT I -37    18788   8329  17161   2902   1062   3157       O  
ATOM    743  C5   DT I -37      48.773  49.053  22.072  1.00117.79           C  
ANISOU  743  C5   DT I -37    19145   8058  17551   2904   1195   2685       C  
ATOM    744  C7   DT I -37      48.908  47.655  22.600  1.00119.67           C  
ANISOU  744  C7   DT I -37    19500   8048  17922   3025   1273   2884       C  
ATOM    745  C6   DT I -37      48.786  49.319  20.755  1.00119.78           C  
ANISOU  745  C6   DT I -37    19429   8250  17834   2848   1212   2349       C  
ATOM    746  P    DT I -36      50.764  51.310  15.042  1.00108.41           P  
ANISOU  746  P    DT I -36    17787   7103  16303   3140   1287   1088       P  
ATOM    747  OP1  DT I -36      50.438  51.562  13.620  1.00104.31           O  
ANISOU  747  OP1  DT I -36    17288   6570  15774   3021   1291    705       O  
ATOM    748  OP2  DT I -36      51.735  50.251  15.399  1.00110.67           O  
ANISOU  748  OP2  DT I -36    18095   7279  16673   3462   1362   1323       O  
ATOM    749  O5'  DT I -36      51.258  52.674  15.702  1.00108.27           O  
ANISOU  749  O5'  DT I -36    17560   7445  16133   3210   1215   1257       O  
ATOM    750  C5'  DT I -36      50.311  53.540  16.319  1.00 98.51           C  
ANISOU  750  C5'  DT I -36    16319   6311  14801   2926   1124   1259       C  
ATOM    751  C4'  DT I -36      51.016  54.623  17.106  1.00 94.26           C  
ANISOU  751  C4'  DT I -36    15494   6214  14106   3013    999   1464       C  
ATOM    752  O4'  DT I -36      50.822  54.403  18.529  1.00 96.16           O  
ANISOU  752  O4'  DT I -36    15707   6513  14315   2989    935   1777       O  
ATOM    753  C3'  DT I -36      52.526  54.684  16.896  1.00 95.72           C  
ANISOU  753  C3'  DT I -36    15489   6586  14293   3391   1026   1596       C  
ATOM    754  O3'  DT I -36      52.947  56.031  16.936  1.00 95.38           O  
ANISOU  754  O3'  DT I -36    15130   7022  14090   3319    873   1562       O  
ATOM    755  C2'  DT I -36      53.055  53.903  18.098  1.00 96.17           C  
ANISOU  755  C2'  DT I -36    15550   6594  14396   3622   1045   1982       C  
ATOM    756  C1'  DT I -36      52.080  54.360  19.168  1.00 97.97           C  
ANISOU  756  C1'  DT I -36    15747   6957  14520   3316    912   2066       C  
ATOM    757  N1   DT I -36      51.981  53.447  20.342  1.00103.07           N  
ANISOU  757  N1   DT I -36    16503   7435  15224   3418    951   2393       N  
ATOM    758  C2   DT I -36      51.749  53.985  21.585  1.00102.62           C  
ANISOU  758  C2   DT I -36    16295   7668  15028   3313    806   2599       C  
ATOM    759  O2   DT I -36      51.625  55.180  21.782  1.00102.07           O  
ANISOU  759  O2   DT I -36    16012   7980  14790   3137    640   2521       O  
ATOM    760  N3   DT I -36      51.667  53.071  22.599  1.00103.72           N  
ANISOU  760  N3   DT I -36    16550   7631  15227   3433    864   2904       N  
ATOM    761  C4   DT I -36      51.789  51.697  22.496  1.00110.59           C  
ANISOU  761  C4   DT I -36    17609   8145  16267   3570   1010   2972       C  
ATOM    762  O4   DT I -36      51.699  50.958  23.470  1.00115.25           O  
ANISOU  762  O4   DT I -36    18236   8676  16879   3615   1023   3216       O  
ATOM    763  C5   DT I -36      52.030  51.196  21.163  1.00111.67           C  
ANISOU  763  C5   DT I -36    17848   8058  16523   3615   1113   2699       C  
ATOM    764  C7   DT I -36      52.184  49.723  20.927  1.00116.11           C  
ANISOU  764  C7   DT I -36    18579   8293  17244   3722   1232   2707       C  
ATOM    765  C6   DT I -36      52.113  52.086  20.162  1.00108.06           C  
ANISOU  765  C6   DT I -36    17332   7706  16021   3564   1094   2442       C  
ATOM    766  P    DG I -35      53.076  56.896  15.588  1.00 92.56           P  
ANISOU  766  P    DG I -35    14674   6809  13684   3255    874   1237       P  
ATOM    767  OP1  DG I -35      51.896  56.610  14.742  1.00 90.11           O  
ANISOU  767  OP1  DG I -35    14631   6184  13423   3018    949    924       O  
ATOM    768  OP2  DG I -35      54.438  56.683  15.050  1.00100.44           O  
ANISOU  768  OP2  DG I -35    15553   7873  14737   3631    959   1323       O  
ATOM    769  O5'  DG I -35      52.971  58.406  16.104  1.00 81.28           O  
ANISOU  769  O5'  DG I -35    12951   5866  12066   3019    662   1229       O  
ATOM    770  C5'  DG I -35      51.719  58.907  16.564  1.00 79.93           C  
ANISOU  770  C5'  DG I -35    12838   5734  11797   2655    559   1130       C  
ATOM    771  C4'  DG I -35      51.887  59.839  17.759  1.00 77.39           C  
ANISOU  771  C4'  DG I -35    12269   5818  11318   2569    358   1324       C  
ATOM    772  O4'  DG I -35      52.191  59.077  18.953  1.00 83.66           O  
ANISOU  772  O4'  DG I -35    13086   6553  12146   2736    354   1658       O  
ATOM    773  C3'  DG I -35      52.985  60.882  17.644  1.00 73.97           C  
ANISOU  773  C3'  DG I -35    11511   5793  10802   2678    245   1358       C  
ATOM    774  O3'  DG I -35      52.581  62.050  18.339  1.00 71.29           O  
ANISOU  774  O3'  DG I -35    11007   5792  10288   2435     43   1353       O  
ATOM    775  C2'  DG I -35      54.177  60.201  18.321  1.00 77.98           C  
ANISOU  775  C2'  DG I -35    11921   6328  11379   3032    269   1688       C  
ATOM    776  C1'  DG I -35      53.504  59.362  19.407  1.00 87.53           C  
ANISOU  776  C1'  DG I -35    13317   7333  12606   2998    281   1881       C  
ATOM    777  N9   DG I -35      54.157  58.080  19.658  1.00 96.55           N  
ANISOU  777  N9   DG I -35    14573   8222  13889   3325    422   2114       N  
ATOM    778  C8   DG I -35      54.748  57.262  18.729  1.00 99.32           C  
ANISOU  778  C8   DG I -35    15036   8315  14387   3577    602   2067       C  
ATOM    779  N7   DG I -35      55.221  56.158  19.233  1.00102.08           N  
ANISOU  779  N7   DG I -35    15491   8459  14837   3849    703   2316       N  
ATOM    780  C5   DG I -35      54.922  56.244  20.584  1.00102.17           C  
ANISOU  780  C5   DG I -35    15451   8605  14764   3771    586   2548       C  
ATOM    781  C6   DG I -35      55.193  55.338  21.634  1.00107.26           C  
ANISOU  781  C6   DG I -35    16162   9141  15452   3981    626   2876       C  
ATOM    782  O6   DG I -35      55.772  54.246  21.571  1.00111.93           O  
ANISOU  782  O6   DG I -35    16879   9478  16173   4281    778   3030       O  
ATOM    783  N1   DG I -35      54.720  55.807  22.857  1.00104.03           N  
ANISOU  783  N1   DG I -35    15665   8953  14907   3825    471   3030       N  
ATOM    784  C2   DG I -35      54.066  57.003  23.041  1.00100.53           C  
ANISOU  784  C2   DG I -35    15096   8796  14306   3509    296   2881       C  
ATOM    785  N2   DG I -35      53.682  57.290  24.293  1.00 97.70           N  
ANISOU  785  N2   DG I -35    14677   8626  13818   3421    163   3066       N  
ATOM    786  N3   DG I -35      53.804  57.863  22.062  1.00100.99           N  
ANISOU  786  N3   DG I -35    15096   8950  14327   3307    258   2572       N  
ATOM    787  C4   DG I -35      54.260  57.419  20.864  1.00 99.62           C  
ANISOU  787  C4   DG I -35    14997   8568  14285   3452    410   2424       C  
ATOM    788  P    DG I -34      53.364  63.436  18.138  1.00 74.48           P  
ANISOU  788  P    DG I -34    11085   6629  10585   2415   -111   1306       P  
ATOM    789  OP1  DG I -34      52.358  64.520  18.190  1.00 65.90           O  
ANISOU  789  OP1  DG I -34     9986   5711   9342   2068   -242   1110       O  
ATOM    790  OP2  DG I -34      54.251  63.299  16.960  1.00 83.20           O  
ANISOU  790  OP2  DG I -34    12124   7691  11797   2625     17   1220       O  
ATOM    791  O5'  DG I -34      54.279  63.533  19.442  1.00 77.10           O  
ANISOU  791  O5'  DG I -34    11203   7224  10868   2591   -257   1644       O  
ATOM    792  C5'  DG I -34      53.690  63.359  20.721  1.00 71.04           C  
ANISOU  792  C5'  DG I -34    10502   6476  10015   2508   -354   1815       C  
ATOM    793  C4'  DG I -34      54.730  62.959  21.747  1.00 73.69           C  
ANISOU  793  C4'  DG I -34    10692   6947  10361   2790   -414   2155       C  
ATOM    794  O4'  DG I -34      55.120  61.573  21.543  1.00 86.22           O  
ANISOU  794  O4'  DG I -34    12439   8204  12116   3065   -211   2289       O  
ATOM    795  C3'  DG I -34      56.038  63.766  21.709  1.00 77.81           C  
ANISOU  795  C3'  DG I -34    10878   7830  10857   2934   -541   2233       C  
ATOM    796  O3'  DG I -34      56.458  64.038  23.038  1.00 84.72           O  
ANISOU  796  O3'  DG I -34    11590   8974  11626   3002   -728   2482       O  
ATOM    797  C2'  DG I -34      56.999  62.794  21.030  1.00 80.12           C  
ANISOU  797  C2'  DG I -34    11184   7935  11323   3265   -349   2324       C  
ATOM    798  C1'  DG I -34      56.515  61.510  21.661  1.00 85.58           C  
ANISOU  798  C1'  DG I -34    12136   8304  12077   3369   -230   2486       C  
ATOM    799  N9   DG I -34      57.020  60.285  21.049  1.00 90.95           N  
ANISOU  799  N9   DG I -34    12963   8665  12930   3656     -5   2549       N  
ATOM    800  C8   DG I -34      57.291  60.051  19.722  1.00 91.94           C  
ANISOU  800  C8   DG I -34    13147   8622  13164   3744    153   2364       C  
ATOM    801  N7   DG I -34      57.743  58.845  19.492  1.00 96.07           N  
ANISOU  801  N7   DG I -34    13820   8859  13824   4035    335   2480       N  
ATOM    802  C5   DG I -34      57.777  58.251  20.750  1.00 97.47           C  
ANISOU  802  C5   DG I -34    14033   9016  13986   4140    298   2768       C  
ATOM    803  C6   DG I -34      58.178  56.950  21.142  1.00101.87           C  
ANISOU  803  C6   DG I -34    14740   9312  14652   4443    441   3008       C  
ATOM    804  O6   DG I -34      58.598  56.025  20.433  1.00104.42           O  
ANISOU  804  O6   DG I -34    15210   9356  15111   4689    631   3007       O  
ATOM    805  N1   DG I -34      58.052  56.767  22.519  1.00102.14           N  
ANISOU  805  N1   DG I -34    14754   9438  14617   4460    346   3272       N  
ATOM    806  C2   DG I -34      57.596  57.720  23.400  1.00 99.06           C  
ANISOU  806  C2   DG I -34    14221   9353  14064   4222    133   3292       C  
ATOM    807  N2   DG I -34      57.540  57.374  24.692  1.00102.03           N  
ANISOU  807  N2   DG I -34    14600   9786  14378   4299     69   3566       N  
ATOM    808  N3   DG I -34      57.221  58.934  23.043  1.00 96.24           N  
ANISOU  808  N3   DG I -34    13733   9231  13603   3941     -6   3063       N  
ATOM    809  C4   DG I -34      57.338  59.129  21.711  1.00 95.28           C  
ANISOU  809  C4   DG I -34    13623   9023  13555   3913     89   2813       C  
ATOM    810  P    DA I -33      56.465  65.540  23.607  1.00 83.58           P  
ANISOU  810  P    DA I -33    11210   9250  11298   2792  -1008   2431       P  
ATOM    811  OP1  DA I -33      55.077  66.053  23.537  1.00 79.15           O  
ANISOU  811  OP1  DA I -33    10819   8628  10625   2460  -1041   2208       O  
ATOM    812  OP2  DA I -33      57.559  66.273  22.929  1.00 86.20           O  
ANISOU  812  OP2  DA I -33    11265   9812  11674   2863  -1064   2386       O  
ATOM    813  O5'  DA I -33      56.867  65.357  25.146  1.00 86.69           O  
ANISOU  813  O5'  DA I -33    11509   9833  11597   2943  -1164   2744       O  
ATOM    814  C5'  DA I -33      55.974  64.698  26.040  1.00 90.60           C  
ANISOU  814  C5'  DA I -33    12220  10171  12032   2914  -1136   2860       C  
ATOM    815  C4'  DA I -33      56.725  63.875  27.079  1.00 94.59           C  
ANISOU  815  C4'  DA I -33    12676  10710  12553   3226  -1143   3205       C  
ATOM    816  O4'  DA I -33      57.176  62.627  26.495  1.00 97.43           O  
ANISOU  816  O4'  DA I -33    13157  10755  13107   3476   -899   3294       O  
ATOM    817  C3'  DA I -33      57.967  64.523  27.673  1.00 98.38           C  
ANISOU  817  C3'  DA I -33    12828  11584  12968   3386  -1352   3364       C  
ATOM    818  O3'  DA I -33      58.112  64.087  29.018  1.00103.42           O  
ANISOU  818  O3'  DA I -33    13459  12320  13516   3555  -1436   3647       O  
ATOM    819  C2'  DA I -33      59.081  63.973  26.783  1.00101.34           C  
ANISOU  819  C2'  DA I -33    13105  11873  13527   3639  -1198   3411       C  
ATOM    820  C1'  DA I -33      58.589  62.553  26.537  1.00104.00           C  
ANISOU  820  C1'  DA I -33    13749  11772  13993   3765   -930   3470       C  
ATOM    821  N9   DA I -33      59.036  61.970  25.276  1.00110.66           N  
ANISOU  821  N9   DA I -33    14649  12379  15016   3901   -714   3375       N  
ATOM    822  C8   DA I -33      58.896  62.503  24.026  1.00109.82           C  
ANISOU  822  C8   DA I -33    14533  12231  14960   3749   -658   3095       C  
ATOM    823  N7   DA I -33      59.372  61.741  23.069  1.00110.66           N  
ANISOU  823  N7   DA I -33    14714  12108  15224   3950   -449   3070       N  
ATOM    824  C5   DA I -33      59.842  60.624  23.736  1.00114.24           C  
ANISOU  824  C5   DA I -33    15238  12430  15737   4248   -360   3352       C  
ATOM    825  C6   DA I -33      60.462  59.443  23.286  1.00116.53           C  
ANISOU  825  C6   DA I -33    15638  12460  16179   4574   -143   3470       C  
ATOM    826  N6   DA I -33      60.721  59.190  21.999  1.00113.32           N  
ANISOU  826  N6   DA I -33    15290  11878  15889   4657     25   3306       N  
ATOM    827  N1   DA I -33      60.811  58.529  24.215  1.00123.23           N  
ANISOU  827  N1   DA I -33    16538  13238  17044   4828   -104   3768       N  
ATOM    828  C2   DA I -33      60.549  58.784  25.502  1.00124.12           C  
ANISOU  828  C2   DA I -33    16593  13537  17028   4762   -270   3935       C  
ATOM    829  N3   DA I -33      59.971  59.854  26.044  1.00122.50           N  
ANISOU  829  N3   DA I -33    16288  13587  16668   4473   -484   3844       N  
ATOM    830  C4   DA I -33      59.638  60.745  25.097  1.00116.90           C  
ANISOU  830  C4   DA I -33    15534  12934  15950   4222   -518   3546       C  
ATOM    831  P    DA I -32      59.069  64.871  30.040  1.00103.89           P  
ANISOU  831  P    DA I -32    13207  12829  13436   3664  -1723   3816       P  
ATOM    832  OP1  DA I -32      58.299  65.087  31.286  1.00102.17           O  
ANISOU  832  OP1  DA I -32    13070  12727  13021   3580  -1872   3903       O  
ATOM    833  OP2  DA I -32      59.656  66.027  29.328  1.00104.99           O  
ANISOU  833  OP2  DA I -32    13102  13207  13583   3532  -1860   3630       O  
ATOM    834  O5'  DA I -32      60.237  63.821  30.334  1.00106.47           O  
ANISOU  834  O5'  DA I -32    13447  13130  13875   4068  -1624   4119       O  
ATOM    835  C5'  DA I -32      59.908  62.469  30.625  1.00109.77           C  
ANISOU  835  C5'  DA I -32    14109  13231  14369   4255  -1409   4300       C  
ATOM    836  C4'  DA I -32      61.148  61.593  30.623  1.00117.04           C  
ANISOU  836  C4'  DA I -32    14926  14134  15409   4611  -1303   4516       C  
ATOM    837  O4'  DA I -32      61.372  61.046  29.296  1.00118.44           O  
ANISOU  837  O4'  DA I -32    15189  14029  15782   4703  -1067   4423       O  
ATOM    838  C3'  DA I -32      62.444  62.298  31.015  1.00120.07           C  
ANISOU  838  C3'  DA I -32    14955  14933  15733   4660  -1515   4535       C  
ATOM    839  O3'  DA I -32      63.211  61.434  31.828  1.00124.86           O  
ANISOU  839  O3'  DA I -32    15530  15570  16341   4876  -1477   4719       O  
ATOM    840  C2'  DA I -32      63.120  62.548  29.665  1.00120.90           C  
ANISOU  840  C2'  DA I -32    14922  15023  15989   4720  -1428   4437       C  
ATOM    841  C1'  DA I -32      62.699  61.309  28.892  1.00122.22           C  
ANISOU  841  C1'  DA I -32    15385  14733  16319   4870  -1110   4459       C  
ATOM    842  N9   DA I -32      62.702  61.470  27.439  1.00121.97           N  
ANISOU  842  N9   DA I -32    15379  14545  16420   4803   -969   4238       N  
ATOM    843  C8   DA I -32      62.128  62.481  26.721  1.00119.39           C  
ANISOU  843  C8   DA I -32    15032  14268  16061   4478  -1037   3939       C  
ATOM    844  N7   DA I -32      62.269  62.355  25.422  1.00121.03           N  
ANISOU  844  N7   DA I -32    15281  14307  16400   4485   -867   3769       N  
ATOM    845  C5   DA I -32      62.976  61.173  25.276  1.00120.37           C  
ANISOU  845  C5   DA I -32    15256  14040  16440   4841   -675   3964       C  
ATOM    846  C6   DA I -32      63.444  60.478  24.141  1.00115.12           C  
ANISOU  846  C6   DA I -32    14663  13145  15930   5043   -441   3919       C  
ATOM    847  N6   DA I -32      63.254  60.904  22.887  1.00110.92           N  
ANISOU  847  N6   DA I -32    14150  12538  15457   4905   -360   3652       N  
ATOM    848  N1   DA I -32      64.116  59.324  24.344  1.00120.06           N  
ANISOU  848  N1   DA I -32    15350  13627  16642   5409   -291   4162       N  
ATOM    849  C2   DA I -32      64.304  58.903  25.601  1.00125.90           C  
ANISOU  849  C2   DA I -32    16070  14466  17300   5468   -377   4361       C  
ATOM    850  N3   DA I -32      63.912  59.468  26.744  1.00128.58           N  
ANISOU  850  N3   DA I -32    16339  15020  17494   5319   -589   4437       N  
ATOM    851  C4   DA I -32      63.247  60.611  26.509  1.00124.13           C  
ANISOU  851  C4   DA I -32    15721  14582  16860   5038   -731   4256       C  
ATOM    852  P    DA I -31      64.266  62.023  32.885  1.00126.44           P  
ANISOU  852  P    DA I -31    15438  16190  16415   4899  -1730   4775       P  
ATOM    853  OP1  DA I -31      63.816  61.629  34.239  1.00125.67           O  
ANISOU  853  OP1  DA I -31    15458  16111  16180   4908  -1788   4890       O  
ATOM    854  OP2  DA I -31      64.487  63.451  32.567  1.00124.44           O  
ANISOU  854  OP2  DA I -31    14954  16221  16107   4687  -1958   4597       O  
ATOM    855  O5'  DA I -31      65.603  61.226  32.539  1.00123.60           O  
ANISOU  855  O5'  DA I -31    14948  15827  16188   5185  -1592   4904       O  
ATOM    856  C5'  DA I -31      65.521  59.876  32.109  1.00125.38           C  
ANISOU  856  C5'  DA I -31    15394  15700  16545   5395  -1304   5010       C  
ATOM    857  C4'  DA I -31      66.772  59.485  31.352  1.00131.00           C  
ANISOU  857  C4'  DA I -31    15949  16441  17385   5614  -1188   5054       C  
ATOM    858  O4'  DA I -31      66.537  59.593  29.926  1.00130.45           O  
ANISOU  858  O4'  DA I -31    15941  16173  17450   5583  -1042   4910       O  
ATOM    859  C3'  DA I -31      67.998  60.340  31.663  1.00132.87           C  
ANISOU  859  C3'  DA I -31    15818  17101  17567   5614  -1404   5062       C  
ATOM    860  O3'  DA I -31      69.104  59.495  31.935  1.00139.31           O  
ANISOU  860  O3'  DA I -31    16547  17965  18419   5884  -1313   5233       O  
ATOM    861  C2'  DA I -31      68.200  61.177  30.393  1.00130.39           C  
ANISOU  861  C2'  DA I -31    15357  16842  17343   5507  -1411   4897       C  
ATOM    862  C1'  DA I -31      67.595  60.292  29.313  1.00129.48           C  
ANISOU  862  C1'  DA I -31    15517  16311  17368   5605  -1117   4859       C  
ATOM    863  N9   DA I -31      67.040  61.036  28.183  1.00122.97           N  
ANISOU  863  N9   DA I -31    14705  15415  16605   5439  -1099   4665       N  
ATOM    864  C8   DA I -31      66.214  62.126  28.240  1.00119.63           C  
ANISOU  864  C8   DA I -31    14263  15094  16096   5165  -1272   4526       C  
ATOM    865  N7   DA I -31      65.854  62.581  27.062  1.00116.28           N  
ANISOU  865  N7   DA I -31    13857  14569  15753   5079  -1197   4368       N  
ATOM    866  C5   DA I -31      66.481  61.726  26.170  1.00119.89           C  
ANISOU  866  C5   DA I -31    14357  14838  16358   5311   -956   4393       C  
ATOM    867  C6   DA I -31      66.501  61.670  24.761  1.00118.35           C  
ANISOU  867  C6   DA I -31    14207  14467  16294   5363   -770   4260       C  
ATOM    868  N6   DA I -31      65.842  62.533  23.979  1.00113.97           N  
ANISOU  868  N6   DA I -31    13664  13897  15744   5134   -797   4040       N  
ATOM    869  N1   DA I -31      67.229  60.690  24.184  1.00120.71           N  
ANISOU  869  N1   DA I -31    14555  14610  16699   5617   -554   4314       N  
ATOM    870  C2   DA I -31      67.887  59.829  24.970  1.00123.40           C  
ANISOU  870  C2   DA I -31    14892  14972  17021   5806   -527   4501       C  
ATOM    871  N3   DA I -31      67.944  59.780  26.300  1.00124.12           N  
ANISOU  871  N3   DA I -31    14937  15221  17001   5788   -681   4646       N  
ATOM    872  C4   DA I -31      67.212  60.765  26.844  1.00122.79           C  
ANISOU  872  C4   DA I -31    14726  15202  16725   5532   -895   4577       C  
ATOM    873  P    DC I -30      70.545  60.109  32.290  1.00144.67           P  
ANISOU  873  P    DC I -30    16855  19052  19062   5936  -1496   5281       P  
ATOM    874  OP1  DC I -30      71.153  59.228  33.312  1.00148.42           O  
ANISOU  874  OP1  DC I -30    17331  19580  19482   6158  -1467   5483       O  
ATOM    875  OP2  DC I -30      70.394  61.556  32.570  1.00142.13           O  
ANISOU  875  OP2  DC I -30    16351  19005  18648   5652  -1783   5128       O  
ATOM    876  O5'  DC I -30      71.353  59.934  30.926  1.00140.23           O  
ANISOU  876  O5'  DC I -30    16182  18444  18657   6069  -1324   5258       O  
ATOM    877  C5'  DC I -30      71.176  58.749  30.162  1.00136.20           C  
ANISOU  877  C5'  DC I -30    15908  17581  18262   6271  -1024   5303       C  
ATOM    878  C4'  DC I -30      71.871  58.860  28.821  1.00134.04           C  
ANISOU  878  C4'  DC I -30    15510  17305  18115   6350   -898   5234       C  
ATOM    879  O4'  DC I -30      71.008  59.535  27.872  1.00130.18           O  
ANISOU  879  O4'  DC I -30    15099  16688  17677   6150   -885   5034       O  
ATOM    880  C3'  DC I -30      73.186  59.644  28.837  1.00136.26           C  
ANISOU  880  C3'  DC I -30    15400  17987  18384   6353  -1055   5266       C  
ATOM    881  O3'  DC I -30      74.191  58.894  28.177  1.00144.47           O  
ANISOU  881  O3'  DC I -30    16380  19001  19512   6616   -860   5362       O  
ATOM    882  C2'  DC I -30      72.847  60.930  28.076  1.00131.88           C  
ANISOU  882  C2'  DC I -30    14714  17537  17856   6089  -1177   5069       C  
ATOM    883  C1'  DC I -30      71.788  60.426  27.116  1.00129.50           C  
ANISOU  883  C1'  DC I -30    14723  16843  17636   6092   -955   4958       C  
ATOM    884  N1   DC I -30      70.899  61.489  26.563  1.00124.12           N  
ANISOU  884  N1   DC I -30    14049  16156  16955   5817  -1050   4758       N  
ATOM    885  C2   DC I -30      70.799  61.640  25.178  1.00120.18           C  
ANISOU  885  C2   DC I -30    13572  15524  16566   5817   -896   4625       C  
ATOM    886  O2   DC I -30      71.459  60.891  24.450  1.00123.24           O  
ANISOU  886  O2   DC I -30    13976  15804  17044   6044   -689   4668       O  
ATOM    887  N3   DC I -30      69.984  62.602  24.677  1.00114.83           N  
ANISOU  887  N3   DC I -30    12900  14845  15884   5575   -977   4447       N  
ATOM    888  C4   DC I -30      69.291  63.386  25.507  1.00113.18           C  
ANISOU  888  C4   DC I -30    12680  14762  15559   5336  -1205   4402       C  
ATOM    889  N4   DC I -30      68.499  64.322  24.971  1.00103.84           N  
ANISOU  889  N4   DC I -30    11504  13582  14367   5104  -1277   4228       N  
ATOM    890  C5   DC I -30      69.380  63.246  26.925  1.00118.46           C  
ANISOU  890  C5   DC I -30    13336  15565  16107   5329  -1368   4526       C  
ATOM    891  C6   DC I -30      70.186  62.292  27.405  1.00122.66           C  
ANISOU  891  C6   DC I -30    13859  16095  16652   5575  -1281   4702       C  
ATOM    892  P    DT I -29      75.728  59.349  28.263  1.00137.37           P  
ANISOU  892  P    DT I -29    15095  18489  18609   6694   -967   5458       P  
ATOM    893  OP1  DT I -29      76.563  58.137  28.101  1.00141.31           O  
ANISOU  893  OP1  DT I -29    15637  18909  19147   7025   -748   5624       O  
ATOM    894  OP2  DT I -29      75.881  60.199  29.464  1.00143.70           O  
ANISOU  894  OP2  DT I -29    15708  19594  19297   6520  -1267   5472       O  
ATOM    895  O5'  DT I -29      75.919  60.274  26.978  1.00136.24           O  
ANISOU  895  O5'  DT I -29    14781  18426  18558   6558   -963   5303       O  
ATOM    896  C5'  DT I -29      75.736  59.728  25.683  1.00136.82           C  
ANISOU  896  C5'  DT I -29    15012  18236  18736   6679   -702   5234       C  
ATOM    897  C4'  DT I -29      75.986  60.778  24.622  1.00132.85           C  
ANISOU  897  C4'  DT I -29    14298  17878  18301   6527   -737   5096       C  
ATOM    898  O4'  DT I -29      74.805  61.612  24.472  1.00129.26           O  
ANISOU  898  O4'  DT I -29    13939  17341  17833   6248   -844   4911       O  
ATOM    899  C3'  DT I -29      77.144  61.739  24.925  1.00130.51           C  
ANISOU  899  C3'  DT I -29    13595  18003  17989   6435   -943   5153       C  
ATOM    900  O3'  DT I -29      77.875  61.999  23.732  1.00122.37           O  
ANISOU  900  O3'  DT I -29    12393  17051  17050   6488   -825   5125       O  
ATOM    901  C2'  DT I -29      76.413  62.994  25.402  1.00130.02           C  
ANISOU  901  C2'  DT I -29    13466  18065  17872   6090  -1212   5009       C  
ATOM    902  C1'  DT I -29      75.216  62.955  24.474  1.00129.55           C  
ANISOU  902  C1'  DT I -29    13663  17699  17859   6016  -1067   4843       C  
ATOM    903  N1   DT I -29      74.072  63.831  24.867  1.00128.38           N  
ANISOU  903  N1   DT I -29    13594  17539  17644   5718  -1256   4695       N  
ATOM    904  C2   DT I -29      73.334  64.424  23.875  1.00124.42           C  
ANISOU  904  C2   DT I -29    13152  16928  17194   5564  -1208   4516       C  
ATOM    905  O2   DT I -29      73.564  64.267  22.689  1.00121.86           O  
ANISOU  905  O2   DT I -29    12824  16512  16967   5660  -1017   4466       O  
ATOM    906  N3   DT I -29      72.306  65.208  24.311  1.00124.74           N  
ANISOU  906  N3   DT I -29    13265  16975  17157   5298  -1387   4393       N  
ATOM    907  C4   DT I -29      71.942  65.462  25.616  1.00126.17           C  
ANISOU  907  C4   DT I -29    13473  17257  17210   5170  -1607   4420       C  
ATOM    908  O4   DT I -29      70.991  66.189  25.898  1.00124.05           O  
ANISOU  908  O4   DT I -29    13280  16990  16863   4929  -1755   4295       O  
ATOM    909  C5   DT I -29      72.759  64.812  26.619  1.00128.75           C  
ANISOU  909  C5   DT I -29    13737  17692  17489   5346  -1645   4603       C  
ATOM    910  C7   DT I -29      72.463  65.012  28.076  1.00130.49           C  
ANISOU  910  C7   DT I -29    13989  18028  17563   5242  -1870   4637       C  
ATOM    911  C6   DT I -29      73.777  64.036  26.201  1.00130.21           C  
ANISOU  911  C6   DT I -29    13842  17875  17755   5609  -1470   4734       C  
ATOM    912  P    DG I -28      79.136  61.092  23.315  1.00125.20           P  
ANISOU  912  P    DG I -28    12662  17462  17448   6814   -624   5297       P  
ATOM    913  OP1  DG I -28      78.754  59.672  23.475  1.00122.91           O  
ANISOU  913  OP1  DG I -28    12701  16856  17142   7068   -417   5369       O  
ATOM    914  OP2  DG I -28      80.327  61.609  24.026  1.00124.03           O  
ANISOU  914  OP2  DG I -28    12164  17692  17269   6794   -810   5431       O  
ATOM    915  O5'  DG I -28      79.317  61.404  21.755  1.00123.16           O  
ANISOU  915  O5'  DG I -28    12349  17163  17285   6820   -456   5185       O  
ATOM    916  C5'  DG I -28      78.352  60.926  20.823  1.00123.70           C  
ANISOU  916  C5'  DG I -28    12728  16876  17395   6862   -251   5037       C  
ATOM    917  C4'  DG I -28      78.228  61.839  19.604  1.00125.48           C  
ANISOU  917  C4'  DG I -28    12846  17143  17686   6710   -219   4871       C  
ATOM    918  O4'  DG I -28      77.202  62.841  19.820  1.00123.27           O  
ANISOU  918  O4'  DG I -28    12584  16862  17392   6396   -401   4713       O  
ATOM    919  C3'  DG I -28      79.463  62.628  19.212  1.00129.01           C  
ANISOU  919  C3'  DG I -28    12906  17943  18168   6674   -280   4941       C  
ATOM    920  O3'  DG I -28      79.375  62.905  17.822  1.00130.56           O  
ANISOU  920  O3'  DG I -28    13113  18067  18428   6669   -118   4811       O  
ATOM    921  C2'  DG I -28      79.290  63.902  20.040  1.00126.74           C  
ANISOU  921  C2'  DG I -28    12405  17899  17853   6345   -595   4898       C  
ATOM    922  C1'  DG I -28      77.792  64.133  19.884  1.00123.52           C  
ANISOU  922  C1'  DG I -28    12263  17237  17434   6172   -607   4703       C  
ATOM    923  N9   DG I -28      77.151  64.829  20.991  1.00123.53           N  
ANISOU  923  N9   DG I -28    12251  17322  17363   5919   -877   4659       N  
ATOM    924  C8   DG I -28      77.311  64.580  22.329  1.00125.94           C  
ANISOU  924  C8   DG I -28    12546  17719  17586   5933  -1036   4778       C  
ATOM    925  N7   DG I -28      76.564  65.331  23.088  1.00123.94           N  
ANISOU  925  N7   DG I -28    12312  17516  17262   5678  -1264   4687       N  
ATOM    926  C5   DG I -28      75.841  66.106  22.197  1.00119.77           C  
ANISOU  926  C5   DG I -28    11811  16920  16776   5483  -1253   4502       C  
ATOM    927  C6   DG I -28      74.867  67.101  22.438  1.00118.35           C  
ANISOU  927  C6   DG I -28    11667  16756  16545   5177  -1442   4339       C  
ATOM    928  O6   DG I -28      74.432  67.505  23.524  1.00115.77           O  
ANISOU  928  O6   DG I -28    11366  16506  16117   5011  -1666   4319       O  
ATOM    929  N1   DG I -28      74.385  67.646  21.252  1.00118.90           N  
ANISOU  929  N1   DG I -28    11750  16745  16681   5069  -1347   4183       N  
ATOM    930  C2   DG I -28      74.791  67.275  19.992  1.00119.56           C  
ANISOU  930  C2   DG I -28    11822  16741  16864   5240  -1098   4176       C  
ATOM    931  N2   DG I -28      74.212  67.913  18.966  1.00117.88           N  
ANISOU  931  N2   DG I -28    11629  16463  16697   5106  -1035   4006       N  
ATOM    932  N3   DG I -28      75.704  66.343  19.753  1.00120.97           N  
ANISOU  932  N3   DG I -28    11978  16901  17083   5526   -921   4320       N  
ATOM    933  C4   DG I -28      76.182  65.802  20.899  1.00120.80           C  
ANISOU  933  C4   DG I -28    11937  16960  17003   5631  -1012   4482       C  
ATOM    934  P    DC I -27      80.670  63.300  16.964  1.00136.81           P  
ANISOU  934  P    DC I -27    13595  19119  19268   6740    -43   4892       P  
ATOM    935  OP1  DC I -27      80.818  62.292  15.890  1.00139.03           O  
ANISOU  935  OP1  DC I -27    14076  19186  19564   7026    258   4879       O  
ATOM    936  OP2  DC I -27      81.789  63.551  17.900  1.00138.79           O  
ANISOU  936  OP2  DC I -27    13541  19695  19499   6738   -214   5088       O  
ATOM    937  O5'  DC I -27      80.251  64.688  16.293  1.00135.24           O  
ANISOU  937  O5'  DC I -27    13249  19020  19116   6430   -144   4718       O  
ATOM    938  C5'  DC I -27      78.895  64.906  15.893  1.00130.19           C  
ANISOU  938  C5'  DC I -27    12857  18132  18478   6288   -120   4502       C  
ATOM    939  C4'  DC I -27      78.582  66.392  15.816  1.00124.99           C  
ANISOU  939  C4'  DC I -27    11996  17653  17841   5939   -319   4381       C  
ATOM    940  O4'  DC I -27      78.121  66.868  17.116  1.00122.38           O  
ANISOU  940  O4'  DC I -27    11641  17401  17456   5728   -592   4384       O  
ATOM    941  C3'  DC I -27      79.771  67.284  15.464  1.00125.15           C  
ANISOU  941  C3'  DC I -27    11637  18004  17912   5848   -385   4462       C  
ATOM    942  O3'  DC I -27      79.309  68.455  14.803  1.00120.91           O  
ANISOU  942  O3'  DC I -27    11012  17518  17412   5581   -444   4297       O  
ATOM    943  C2'  DC I -27      80.292  67.630  16.847  1.00125.98           C  
ANISOU  943  C2'  DC I -27    11548  18337  17982   5733   -653   4587       C  
ATOM    944  C1'  DC I -27      78.970  67.916  17.533  1.00121.37           C  
ANISOU  944  C1'  DC I -27    11165  17607  17342   5531   -809   4443       C  
ATOM    945  N1   DC I -27      79.032  67.947  19.026  1.00118.70           N  
ANISOU  945  N1   DC I -27    10789  17380  16930   5455  -1052   4525       N  
ATOM    946  C2   DC I -27      78.079  68.687  19.732  1.00115.21           C  
ANISOU  946  C2   DC I -27    10417  16929  16430   5179  -1276   4394       C  
ATOM    947  O2   DC I -27      77.206  69.287  19.097  1.00108.88           O  
ANISOU  947  O2   DC I -27     9699  16029  15643   5006  -1265   4222       O  
ATOM    948  N3   DC I -27      78.137  68.717  21.087  1.00119.83           N  
ANISOU  948  N3   DC I -27    10982  17616  16932   5116  -1496   4457       N  
ATOM    949  C4   DC I -27      79.099  68.049  21.727  1.00124.37           C  
ANISOU  949  C4   DC I -27    11462  18303  17492   5317  -1494   4644       C  
ATOM    950  N4   DC I -27      79.120  68.105  23.065  1.00124.86           N  
ANISOU  950  N4   DC I -27    11514  18464  17464   5255  -1711   4690       N  
ATOM    951  C5   DC I -27      80.084  67.292  21.023  1.00126.92           C  
ANISOU  951  C5   DC I -27    11702  18643  17878   5598  -1266   4788       C  
ATOM    952  C6   DC I -27      80.015  67.272  19.686  1.00123.47           C  
ANISOU  952  C6   DC I -27    11296  18103  17516   5655  -1053   4721       C  
ATOM    953  P    DT I -26      79.269  68.545  13.200  1.00120.05           P  
ANISOU  953  P    DT I -26    10942  17321  17351   5652   -197   4188       P  
ATOM    954  OP1  DT I -26      78.508  67.375  12.705  1.00118.07           O  
ANISOU  954  OP1  DT I -26    11062  16727  17073   5890     34   4102       O  
ATOM    955  OP2  DT I -26      80.645  68.787  12.714  1.00121.39           O  
ANISOU  955  OP2  DT I -26    10818  17739  17566   5726   -141   4338       O  
ATOM    956  O5'  DT I -26      78.407  69.865  12.927  1.00112.43           O  
ANISOU  956  O5'  DT I -26     9932  16384  16402   5304   -333   3991       O  
ATOM    957  C5'  DT I -26      76.990  69.810  13.030  1.00107.59           C  
ANISOU  957  C5'  DT I -26     9595  15533  15750   5213   -349   3814       C  
ATOM    958  C4'  DT I -26      76.426  71.043  13.722  1.00104.85           C  
ANISOU  958  C4'  DT I -26     9138  15317  15383   4848   -633   3722       C  
ATOM    959  O4'  DT I -26      76.777  71.043  15.130  1.00108.48           O  
ANISOU  959  O4'  DT I -26     9507  15912  15798   4783   -868   3846       O  
ATOM    960  C3'  DT I -26      76.890  72.396  13.175  1.00102.86           C  
ANISOU  960  C3'  DT I -26     8606  15292  15184   4594   -720   3671       C  
ATOM    961  O3'  DT I -26      75.762  73.253  13.097  1.00 97.06           O  
ANISOU  961  O3'  DT I -26     7955  14499  14424   4325   -826   3475       O  
ATOM    962  C2'  DT I -26      77.882  72.875  14.244  1.00107.08           C  
ANISOU  962  C2'  DT I -26     8873  16091  15720   4473   -964   3817       C  
ATOM    963  C1'  DT I -26      77.206  72.338  15.489  1.00109.17           C  
ANISOU  963  C1'  DT I -26     9325  16256  15899   4482  -1107   3827       C  
ATOM    964  N1   DT I -26      78.071  72.221  16.706  1.00111.98           N  
ANISOU  964  N1   DT I -26     9527  16792  16226   4496  -1294   3987       N  
ATOM    965  C2   DT I -26      77.615  72.743  17.897  1.00111.85           C  
ANISOU  965  C2   DT I -26     9532  16834  16133   4275  -1570   3932       C  
ATOM    966  O2   DT I -26      76.556  73.334  18.005  1.00113.76           O  
ANISOU  966  O2   DT I -26     9901  16996  16326   4057  -1675   3766       O  
ATOM    967  N3   DT I -26      78.455  72.558  18.962  1.00112.28           N  
ANISOU  967  N3   DT I -26     9456  17048  16157   4322  -1719   4074       N  
ATOM    968  C4   DT I -26      79.673  71.908  18.962  1.00116.35           C  
ANISOU  968  C4   DT I -26     9817  17677  16715   4562  -1623   4272       C  
ATOM    969  O4   DT I -26      80.356  71.794  19.973  1.00118.28           O  
ANISOU  969  O4   DT I -26     9948  18069  16925   4590  -1773   4386       O  
ATOM    970  C5   DT I -26      80.089  71.374  17.690  1.00115.32           C  
ANISOU  970  C5   DT I -26     9675  17482  16660   4783  -1331   4329       C  
ATOM    971  C7   DT I -26      81.400  70.660  17.577  1.00119.48           C  
ANISOU  971  C7   DT I -26    10042  18133  17223   5052  -1205   4544       C  
ATOM    972  C6   DT I -26      79.275  71.546  16.633  1.00114.12           C  
ANISOU  972  C6   DT I -26     9662  17165  16535   4743  -1181   4180       C  
ATOM    973  P    DC I -25      75.725  74.487  12.072  1.00100.54           P  
ANISOU  973  P    DC I -25     8248  15038  14914   4098   -809   3342       P  
ATOM    974  OP1  DC I -25      74.435  74.417  11.347  1.00 91.84           O  
ANISOU  974  OP1  DC I -25     7397  13714  13786   4092   -677   3144       O  
ATOM    975  OP2  DC I -25      77.003  74.501  11.324  1.00107.66           O  
ANISOU  975  OP2  DC I -25     8933  16085  15888   4223   -672   3469       O  
ATOM    976  O5'  DC I -25      75.691  75.760  13.034  1.00 98.36           O  
ANISOU  976  O5'  DC I -25     7810  14950  14615   3718  -1145   3296       O  
ATOM    977  C5'  DC I -25      74.854  75.754  14.181  1.00 96.75           C  
ANISOU  977  C5'  DC I -25     7751  14689  14319   3591  -1354   3241       C  
ATOM    978  C4'  DC I -25      75.352  76.744  15.216  1.00 97.97           C  
ANISOU  978  C4'  DC I -25     7725  15053  14448   3313  -1661   3247       C  
ATOM    979  O4'  DC I -25      76.382  76.127  16.037  1.00103.75           O  
ANISOU  979  O4'  DC I -25     8343  15894  15183   3478  -1718   3440       O  
ATOM    980  C3'  DC I -25      75.985  78.020  14.643  1.00 94.71           C  
ANISOU  980  C3'  DC I -25     7077  14803  14105   3076  -1717   3193       C  
ATOM    981  O3'  DC I -25      75.632  79.133  15.455  1.00 88.57           O  
ANISOU  981  O3'  DC I -25     6293  14095  13264   2736  -1997   3056       O  
ATOM    982  C2'  DC I -25      77.476  77.720  14.772  1.00100.85           C  
ANISOU  982  C2'  DC I -25     7616  15747  14955   3233  -1691   3404       C  
ATOM    983  C1'  DC I -25      77.464  77.019  16.114  1.00105.66           C  
ANISOU  983  C1'  DC I -25     8307  16354  15484   3325  -1840   3486       C  
ATOM    984  N1   DC I -25      78.709  76.271  16.452  1.00112.87           N  
ANISOU  984  N1   DC I -25     9063  17386  16435   3566  -1796   3711       N  
ATOM    985  C2   DC I -25      79.025  76.066  17.796  1.00116.98           C  
ANISOU  985  C2   DC I -25     9563  17991  16892   3566  -2001   3784       C  
ATOM    986  O2   DC I -25      78.255  76.504  18.658  1.00118.52           O  
ANISOU  986  O2   DC I -25     9882  18153  16996   3371  -2209   3656       O  
ATOM    987  N3   DC I -25      80.156  75.389  18.113  1.00120.07           N  
ANISOU  987  N3   DC I -25     9807  18501  17313   3788  -1961   3990       N  
ATOM    988  C4   DC I -25      80.953  74.935  17.142  1.00118.00           C  
ANISOU  988  C4   DC I -25     9427  18273  17134   3998  -1728   4120       C  
ATOM    989  N4   DC I -25      82.059  74.273  17.500  1.00116.84           N  
ANISOU  989  N4   DC I -25     9137  18252  17004   4215  -1696   4324       N  
ATOM    990  C5   DC I -25      80.648  75.140  15.762  1.00117.34           C  
ANISOU  990  C5   DC I -25     9374  18100  17109   4004  -1515   4042       C  
ATOM    991  C6   DC I -25      79.527  75.809  15.465  1.00114.91           C  
ANISOU  991  C6   DC I -25     9206  17676  16776   3786  -1557   3838       C  
ATOM    992  P    DC I -24      74.238  79.908  15.251  1.00 86.71           P  
ANISOU  992  P    DC I -24     6248  13745  12953   2474  -2064   2812       P  
ATOM    993  OP1  DC I -24      73.148  78.914  15.137  1.00 85.37           O  
ANISOU  993  OP1  DC I -24     6326  13382  12727   2650  -1937   2790       O  
ATOM    994  OP2  DC I -24      74.431  80.909  14.179  1.00 94.23           O  
ANISOU  994  OP2  DC I -24     7078  14744  13980   2313  -1987   2724       O  
ATOM    995  O5'  DC I -24      74.051  80.689  16.634  1.00 87.19           O  
ANISOU  995  O5'  DC I -24     6351  13876  12903   2204  -2389   2710       O  
ATOM    996  C5'  DC I -24      73.682  79.970  17.805  1.00 87.75           C  
ANISOU  996  C5'  DC I -24     6569  13906  12868   2292  -2508   2753       C  
ATOM    997  C4'  DC I -24      74.461  80.451  19.020  1.00 88.58           C  
ANISOU  997  C4'  DC I -24     6566  14160  12932   2186  -2755   2773       C  
ATOM    998  O4'  DC I -24      75.722  79.739  19.120  1.00 94.36           O  
ANISOU  998  O4'  DC I -24     7099  15001  13752   2427  -2690   3001       O  
ATOM    999  C3'  DC I -24      74.814  81.942  19.037  1.00 90.49           C  
ANISOU  999  C3'  DC I -24     6696  14501  13188   1879  -2911   2622       C  
ATOM   1000  O3'  DC I -24      74.516  82.476  20.320  1.00 90.06           O  
ANISOU 1000  O3'  DC I -24     6754  14467  12998   1716  -3163   2493       O  
ATOM   1001  C2'  DC I -24      76.322  81.948  18.761  1.00 95.02           C  
ANISOU 1001  C2'  DC I -24     6969  15233  13902   1981  -2867   2802       C  
ATOM   1002  C1'  DC I -24      76.738  80.659  19.440  1.00 97.39           C  
ANISOU 1002  C1'  DC I -24     7264  15555  14184   2272  -2844   3000       C  
ATOM   1003  N1   DC I -24      78.042  80.107  18.973  1.00102.49           N  
ANISOU 1003  N1   DC I -24     7666  16319  14957   2495  -2705   3227       N  
ATOM   1004  C2   DC I -24      78.982  79.681  19.915  1.00111.04           C  
ANISOU 1004  C2   DC I -24     8622  17532  16035   2619  -2815   3377       C  
ATOM   1005  O2   DC I -24      78.710  79.784  21.117  1.00115.79           O  
ANISOU 1005  O2   DC I -24     9320  18146  16530   2546  -3028   3312       O  
ATOM   1006  N3   DC I -24      80.162  79.170  19.482  1.00112.72           N  
ANISOU 1006  N3   DC I -24     8616  17858  16353   2825  -2682   3586       N  
ATOM   1007  C4   DC I -24      80.408  79.079  18.174  1.00108.27           C  
ANISOU 1007  C4   DC I -24     7972  17277  15890   2912  -2443   3643       C  
ATOM   1008  N4   DC I -24      81.583  78.569  17.790  1.00110.74           N  
ANISOU 1008  N4   DC I -24     8079  17708  16288   3122  -2311   3851       N  
ATOM   1009  C5   DC I -24      79.461  79.509  17.200  1.00105.34           C  
ANISOU 1009  C5   DC I -24     7731  16769  15524   2794  -2326   3486       C  
ATOM   1010  C6   DC I -24      78.301  80.009  17.639  1.00102.72           C  
ANISOU 1010  C6   DC I -24     7605  16331  15095   2586  -2465   3284       C  
ATOM   1011  P    DA I -23      74.459  84.063  20.558  1.00 90.67           P  
ANISOU 1011  P    DA I -23     6837  14580  13032   1387  -3335   2262       P  
ATOM   1012  OP1  DA I -23      73.098  84.387  21.037  1.00 78.96           O  
ANISOU 1012  OP1  DA I -23     5651  12975  11375   1240  -3414   2045       O  
ATOM   1013  OP2  DA I -23      74.984  84.745  19.355  1.00 97.33           O  
ANISOU 1013  OP2  DA I -23     7505  15458  14018   1299  -3211   2268       O  
ATOM   1014  O5'  DA I -23      75.490  84.294  21.757  1.00 92.16           O  
ANISOU 1014  O5'  DA I -23     6889  14917  13211   1394  -3549   2314       O  
ATOM   1015  C5'  DA I -23      75.358  83.534  22.952  1.00 94.48           C  
ANISOU 1015  C5'  DA I -23     7284  15219  13393   1533  -3664   2367       C  
ATOM   1016  C4'  DA I -23      76.549  83.735  23.875  1.00 95.95           C  
ANISOU 1016  C4'  DA I -23     7280  15570  13607   1565  -3842   2442       C  
ATOM   1017  O4'  DA I -23      77.695  82.997  23.381  1.00 97.06           O  
ANISOU 1017  O4'  DA I -23     7166  15815  13898   1770  -3722   2699       O  
ATOM   1018  C3'  DA I -23      77.015  85.174  24.045  1.00 98.52           C  
ANISOU 1018  C3'  DA I -23     7509  15971  13953   1320  -3995   2279       C  
ATOM   1019  O3'  DA I -23      77.430  85.361  25.387  1.00104.69           O  
ANISOU 1019  O3'  DA I -23     8281  16845  14652   1329  -4223   2240       O  
ATOM   1020  C2'  DA I -23      78.187  85.274  23.063  1.00 98.69           C  
ANISOU 1020  C2'  DA I -23     7225  16097  14174   1348  -3881   2449       C  
ATOM   1021  C1'  DA I -23      78.780  83.874  23.146  1.00104.68           C  
ANISOU 1021  C1'  DA I -23     7878  16915  14980   1652  -3784   2713       C  
ATOM   1022  N9   DA I -23      79.441  83.427  21.922  1.00118.45           N  
ANISOU 1022  N9   DA I -23     9429  18696  16882   1784  -3554   2903       N  
ATOM   1023  C8   DA I -23      78.951  83.502  20.647  1.00119.24           C  
ANISOU 1023  C8   DA I -23     9565  18699  17041   1757  -3346   2878       C  
ATOM   1024  N7   DA I -23      79.750  82.989  19.741  1.00121.37           N  
ANISOU 1024  N7   DA I -23     9642  19031  17441   1929  -3150   3073       N  
ATOM   1025  C5   DA I -23      80.834  82.533  20.473  1.00124.97           C  
ANISOU 1025  C5   DA I -23     9920  19636  17926   2073  -3235   3245       C  
ATOM   1026  C6   DA I -23      82.028  81.886  20.096  1.00134.02           C  
ANISOU 1026  C6   DA I -23    10828  20913  19182   2293  -3108   3490       C  
ATOM   1027  N6   DA I -23      82.326  81.581  18.830  1.00135.89           N  
ANISOU 1027  N6   DA I -23    10971  21142  19519   2416  -2852   3603       N  
ATOM   1028  N1   DA I -23      82.904  81.565  21.073  1.00139.30           N  
ANISOU 1028  N1   DA I -23    11362  21723  19843   2391  -3249   3612       N  
ATOM   1029  C2   DA I -23      82.598  81.874  22.339  1.00137.18           C  
ANISOU 1029  C2   DA I -23    11197  21460  19463   2284  -3501   3488       C  
ATOM   1030  N3   DA I -23      81.508  82.481  22.815  1.00131.25           N  
ANISOU 1030  N3   DA I -23    10680  20592  18598   2087  -3635   3252       N  
ATOM   1031  C4   DA I -23      80.658  82.787  21.820  1.00124.82           C  
ANISOU 1031  C4   DA I -23     9991  19641  17794   1986  -3488   3143       C  
ATOM   1032  P    DT I -22      77.683  86.831  25.979  1.00104.00           P  
ANISOU 1032  P    DT I -22     8171  16816  14526   1097  -4426   2021       P  
ATOM   1033  OP1  DT I -22      76.933  86.932  27.252  1.00 98.72           O  
ANISOU 1033  OP1  DT I -22     7741  16111  13655   1097  -4587   1851       O  
ATOM   1034  OP2  DT I -22      77.441  87.818  24.903  1.00103.62           O  
ANISOU 1034  OP2  DT I -22     8114  16706  14549    888  -4320   1907       O  
ATOM   1035  O5'  DT I -22      79.245  86.820  26.304  1.00111.46           O  
ANISOU 1035  O5'  DT I -22     8792  17954  15604   1169  -4535   2192       O  
ATOM   1036  C5'  DT I -22      79.957  85.587  26.272  1.00118.40           C  
ANISOU 1036  C5'  DT I -22     9519  18912  16558   1419  -4460   2461       C  
ATOM   1037  C4'  DT I -22      81.450  85.832  26.238  1.00128.25           C  
ANISOU 1037  C4'  DT I -22    10428  20344  17955   1435  -4525   2610       C  
ATOM   1038  O4'  DT I -22      82.018  85.245  25.036  1.00130.98           O  
ANISOU 1038  O4'  DT I -22    10589  20720  18456   1550  -4292   2833       O  
ATOM   1039  C3'  DT I -22      81.855  87.304  26.234  1.00133.67           C  
ANISOU 1039  C3'  DT I -22    11012  21083  18693   1176  -4661   2448       C  
ATOM   1040  O3'  DT I -22      82.922  87.505  27.151  1.00144.06           O  
ANISOU 1040  O3'  DT I -22    12130  22569  20036   1203  -4870   2494       O  
ATOM   1041  C2'  DT I -22      82.282  87.550  24.784  1.00133.05           C  
ANISOU 1041  C2'  DT I -22    10755  21007  18789   1113  -4459   2560       C  
ATOM   1042  C1'  DT I -22      82.835  86.189  24.386  1.00135.87           C  
ANISOU 1042  C1'  DT I -22    10978  21426  19220   1391  -4292   2844       C  
ATOM   1043  N1   DT I -22      82.780  85.928  22.910  1.00140.44           N  
ANISOU 1043  N1   DT I -22    11499  21951  19911   1432  -4016   2956       N  
ATOM   1044  C2   DT I -22      83.804  85.227  22.302  1.00146.42           C  
ANISOU 1044  C2   DT I -22    12011  22824  20797   1624  -3865   3218       C  
ATOM   1045  O2   DT I -22      84.771  84.798  22.905  1.00151.72           O  
ANISOU 1045  O2   DT I -22    12501  23645  21499   1756  -3946   3372       O  
ATOM   1046  N3   DT I -22      83.649  85.047  20.947  1.00147.27           N  
ANISOU 1046  N3   DT I -22    12097  22869  20989   1667  -3608   3290       N  
ATOM   1047  C4   DT I -22      82.598  85.488  20.162  1.00145.18           C  
ANISOU 1047  C4   DT I -22    12019  22444  20697   1535  -3498   3129       C  
ATOM   1048  O4   DT I -22      82.545  85.278  18.953  1.00145.81           O  
ANISOU 1048  O4   DT I -22    12064  22483  20853   1601  -3266   3203       O  
ATOM   1049  C5   DT I -22      81.564  86.214  20.863  1.00140.33           C  
ANISOU 1049  C5   DT I -22    11651  21719  19949   1327  -3670   2864       C  
ATOM   1050  C7   DT I -22      80.376  86.740  20.115  1.00136.42           C  
ANISOU 1050  C7   DT I -22    11372  21055  19406   1173  -3569   2675       C  
ATOM   1051  C6   DT I -22      81.704  86.397  22.184  1.00139.48           C  
ANISOU 1051  C6   DT I -22    11575  21668  19753   1290  -3912   2790       C  
ATOM   1052  P    DC I -21      83.188  88.954  27.794  1.00140.97           P  
ANISOU 1052  P    DC I -21    11703  22233  19626    971  -5103   2274       P  
ATOM   1053  OP1  DC I -21      83.071  88.834  29.264  1.00142.36           O  
ANISOU 1053  OP1  DC I -21    11988  22455  19646   1053  -5329   2167       O  
ATOM   1054  OP2  DC I -21      82.364  89.941  27.061  1.00134.45           O  
ANISOU 1054  OP2  DC I -21    11029  21269  18786    747  -5014   2082       O  
ATOM   1055  O5'  DC I -21      84.713  89.230  27.428  1.00147.66           O  
ANISOU 1055  O5'  DC I -21    12167  23263  20675    948  -5135   2460       O  
ATOM   1056  C5'  DC I -21      85.193  88.815  26.172  1.00149.75           C  
ANISOU 1056  C5'  DC I -21    12253  23545  21098   1001  -4907   2677       C  
ATOM   1057  C4'  DC I -21      86.560  88.185  26.288  1.00156.07           C  
ANISOU 1057  C4'  DC I -21    12737  24544  22018   1167  -4925   2942       C  
ATOM   1058  O4'  DC I -21      86.750  87.267  25.186  1.00158.50           O  
ANISOU 1058  O4'  DC I -21    12959  24848  22418   1337  -4648   3175       O  
ATOM   1059  C3'  DC I -21      87.696  89.172  26.164  1.00156.48           C  
ANISOU 1059  C3'  DC I -21    12494  24741  22221   1003  -5037   2976       C  
ATOM   1060  O3'  DC I -21      88.877  88.638  26.737  1.00150.08           O  
ANISOU 1060  O3'  DC I -21    11425  24129  21469   1157  -5137   3168       O  
ATOM   1061  C2'  DC I -21      87.814  89.315  24.652  1.00160.06           C  
ANISOU 1061  C2'  DC I -21    12845  25153  22817    950  -4781   3096       C  
ATOM   1062  C1'  DC I -21      87.502  87.899  24.164  1.00161.64           C  
ANISOU 1062  C1'  DC I -21    13118  25310  22987   1223  -4549   3273       C  
ATOM   1063  N1   DC I -21      86.707  87.864  22.891  1.00161.13           N  
ANISOU 1063  N1   DC I -21    13188  25092  22945   1195  -4292   3255       N  
ATOM   1064  C2   DC I -21      87.280  87.333  21.730  1.00163.24           C  
ANISOU 1064  C2   DC I -21    13278  25409  23337   1331  -4044   3484       C  
ATOM   1065  O2   DC I -21      88.436  86.898  21.780  1.00167.25           O  
ANISOU 1065  O2   DC I -21    13524  26090  23933   1470  -4034   3706       O  
ATOM   1066  N3   DC I -21      86.547  87.312  20.587  1.00159.76           N  
ANISOU 1066  N3   DC I -21    12963  24830  22909   1318  -3817   3454       N  
ATOM   1067  C4   DC I -21      85.302  87.793  20.582  1.00155.21           C  
ANISOU 1067  C4   DC I -21    12666  24077  22230   1166  -3837   3214       C  
ATOM   1068  N4   DC I -21      84.615  87.754  19.435  1.00153.12           N  
ANISOU 1068  N4   DC I -21    12511  23688  21982   1162  -3615   3189       N  
ATOM   1069  C5   DC I -21      84.705  88.340  21.753  1.00153.98           C  
ANISOU 1069  C5   DC I -21    12694  23870  21943   1024  -4081   2985       C  
ATOM   1070  C6   DC I -21      85.435  88.355  22.871  1.00157.29           C  
ANISOU 1070  C6   DC I -21    12994  24423  22347   1049  -4299   3011       C  
ATOM   1071  P    DA I -20      90.083  89.622  27.135  1.00155.82           P  
ANISOU 1071  P    DA I -20    11852  25036  22316   1000  -5355   3172       P  
ATOM   1072  OP1  DA I -20      90.910  88.945  28.158  1.00157.26           O  
ANISOU 1072  OP1  DA I -20    11883  25395  22475   1187  -5516   3293       O  
ATOM   1073  OP2  DA I -20      89.492  90.947  27.423  1.00150.43           O  
ANISOU 1073  OP2  DA I -20    11318  24256  21583    731  -5505   2882       O  
ATOM   1074  O5'  DA I -20      90.924  89.752  25.783  1.00156.80           O  
ANISOU 1074  O5'  DA I -20    11699  25232  22647    965  -5148   3401       O  
ATOM   1075  C5'  DA I -20      91.229  88.589  25.025  1.00158.27           C  
ANISOU 1075  C5'  DA I -20    11795  25457  22881   1208  -4897   3664       C  
ATOM   1076  C4'  DA I -20      92.159  88.925  23.875  1.00162.13           C  
ANISOU 1076  C4'  DA I -20    11994  26044  23563   1156  -4741   3865       C  
ATOM   1077  O4'  DA I -20      91.445  88.847  22.614  1.00160.12           O  
ANISOU 1077  O4'  DA I -20    11874  25637  23327   1150  -4468   3871       O  
ATOM   1078  C3'  DA I -20      92.779  90.312  23.928  1.00166.14           C  
ANISOU 1078  C3'  DA I -20    12317  26619  24189    873  -4916   3788       C  
ATOM   1079  O3'  DA I -20      94.144  90.224  23.481  1.00173.64           O  
ANISOU 1079  O3'  DA I -20    12896  27773  25307    927  -4864   4060       O  
ATOM   1080  C2'  DA I -20      91.872  91.135  22.999  1.00162.06           C  
ANISOU 1080  C2'  DA I -20    11984  25907  23683    670  -4788   3632       C  
ATOM   1081  C1'  DA I -20      91.445  90.104  21.960  1.00161.26           C  
ANISOU 1081  C1'  DA I -20    11968  25732  23570    880  -4471   3779       C  
ATOM   1082  N9   DA I -20      90.101  90.312  21.417  1.00159.71           N  
ANISOU 1082  N9   DA I -20    12086  25312  23287    799  -4349   3588       N  
ATOM   1083  C8   DA I -20      89.015  90.825  22.067  1.00158.62           C  
ANISOU 1083  C8   DA I -20    12237  25023  23008    658  -4487   3304       C  
ATOM   1084  N7   DA I -20      87.923  90.857  21.336  1.00155.05           N  
ANISOU 1084  N7   DA I -20    12023  24391  22497    622  -4321   3193       N  
ATOM   1085  C5   DA I -20      88.320  90.323  20.122  1.00156.48           C  
ANISOU 1085  C5   DA I -20    12063  24603  22789    753  -4059   3412       C  
ATOM   1086  C6   DA I -20      87.629  90.084  18.912  1.00154.68           C  
ANISOU 1086  C6   DA I -20    11958  24248  22567    798  -3796   3423       C  
ATOM   1087  N6   DA I -20      86.334  90.368  18.729  1.00149.58           N  
ANISOU 1087  N6   DA I -20    11608  23412  21813    698  -3759   3202       N  
ATOM   1088  N1   DA I -20      88.327  89.538  17.893  1.00157.86           N  
ANISOU 1088  N1   DA I -20    12165  24733  23081    962  -3567   3667       N  
ATOM   1089  C2   DA I -20      89.621  89.254  18.078  1.00162.48           C  
ANISOU 1089  C2   DA I -20    12453  25516  23765   1066  -3598   3893       C  
ATOM   1090  N3   DA I -20      90.374  89.432  19.163  1.00163.47           N  
ANISOU 1090  N3   DA I -20    12427  25779  23903   1028  -3839   3914       N  
ATOM   1091  C4   DA I -20      89.658  89.975  20.157  1.00159.84           C  
ANISOU 1091  C4   DA I -20    12168  25231  23332    869  -4066   3660       C  
ATOM   1092  P    DA I -19      94.865  91.413  22.676  1.00175.47           P  
ANISOU 1092  P    DA I -19    12883  28058  25729    682  -4853   4119       P  
ATOM   1093  OP1  DA I -19      96.308  91.088  22.650  1.00179.71           O  
ANISOU 1093  OP1  DA I -19    13041  28841  26398    791  -4860   4402       O  
ATOM   1094  OP2  DA I -19      94.440  92.716  23.237  1.00173.28           O  
ANISOU 1094  OP2  DA I -19    12716  27690  25432    388  -5084   3840       O  
ATOM   1095  O5'  DA I -19      94.304  91.244  21.189  1.00177.65           O  
ANISOU 1095  O5'  DA I -19    13260  28199  26041    716  -4521   4191       O  
ATOM   1096  C5'  DA I -19      95.161  91.415  20.081  1.00183.85           C  
ANISOU 1096  C5'  DA I -19    13781  29081  26992    716  -4340   4428       C  
ATOM   1097  C4'  DA I -19      94.843  92.711  19.373  1.00184.69           C  
ANISOU 1097  C4'  DA I -19    13921  29069  27182    429  -4324   4308       C  
ATOM   1098  O4'  DA I -19      93.425  92.746  19.058  1.00177.00           O  
ANISOU 1098  O4'  DA I -19    13308  27861  26081    394  -4225   4089       O  
ATOM   1099  C3'  DA I -19      95.125  93.974  20.197  1.00191.64           C  
ANISOU 1099  C3'  DA I -19    14732  29972  28110    142  -4627   4142       C  
ATOM   1100  O3'  DA I -19      95.753  94.950  19.382  1.00203.40           O  
ANISOU 1100  O3'  DA I -19    16011  31495  29777    -50  -4581   4242       O  
ATOM   1101  C2'  DA I -19      93.731  94.421  20.635  1.00182.73           C  
ANISOU 1101  C2'  DA I -19    13985  28621  26822     15  -4710   3808       C  
ATOM   1102  C1'  DA I -19      92.918  94.001  19.428  1.00173.90           C  
ANISOU 1102  C1'  DA I -19    13043  27356  25674    104  -4405   3836       C  
ATOM   1103  N9   DA I -19      91.478  93.905  19.667  1.00163.83           N  
ANISOU 1103  N9   DA I -19    12151  25875  24221     92  -4395   3579       N  
ATOM   1104  C8   DA I -19      90.815  94.110  20.847  1.00161.40           C  
ANISOU 1104  C8   DA I -19    12058  25501  23765     28  -4616   3332       C  
ATOM   1105  N7   DA I -19      89.512  93.970  20.751  1.00158.25           N  
ANISOU 1105  N7   DA I -19    11990  24915  23221     33  -4537   3145       N  
ATOM   1106  C5   DA I -19      89.307  93.662  19.414  1.00156.11           C  
ANISOU 1106  C5   DA I -19    11719  24584  23013    100  -4255   3268       C  
ATOM   1107  C6   DA I -19      88.141  93.394  18.663  1.00147.71           C  
ANISOU 1107  C6   DA I -19    10917  23343  21863    138  -4055   3173       C  
ATOM   1108  N6   DA I -19      86.911  93.395  19.188  1.00141.10           N  
ANISOU 1108  N6   DA I -19    10404  22352  20854    102  -4113   2931       N  
ATOM   1109  N1   DA I -19      88.293  93.121  17.346  1.00146.80           N  
ANISOU 1109  N1   DA I -19    10715  23222  21841    222  -3791   3338       N  
ATOM   1110  C2   DA I -19      89.529  93.122  16.832  1.00152.01           C  
ANISOU 1110  C2   DA I -19    11052  24043  22663    267  -3725   3588       C  
ATOM   1111  N3   DA I -19      90.691  93.358  17.434  1.00157.51           N  
ANISOU 1111  N3   DA I -19    11477  24914  23455    231  -3892   3710       N  
ATOM   1112  C4   DA I -19      90.509  93.623  18.735  1.00159.11           C  
ANISOU 1112  C4   DA I -19    11769  25117  23567    144  -4160   3534       C  
ATOM   1113  P    DA I -18      97.116  95.650  19.864  1.00207.02           P  
ANISOU 1113  P    DA I -18    16101  32158  30400   -193  -4798   4363       P  
ATOM   1114  OP1  DA I -18      98.131  94.585  20.025  1.00212.79           O  
ANISOU 1114  OP1  DA I -18    16573  33110  31165     60  -4756   4635       O  
ATOM   1115  OP2  DA I -18      96.792  96.538  21.003  1.00210.59           O  
ANISOU 1115  OP2  DA I -18    16669  32554  30792   -407  -5108   4080       O  
ATOM   1116  O5'  DA I -18      97.531  96.572  18.625  1.00207.94           O  
ANISOU 1116  O5'  DA I -18    16051  32258  30700   -371  -4650   4496       O  
ATOM   1117  C5'  DA I -18      96.539  97.313  17.926  1.00201.51           C  
ANISOU 1117  C5'  DA I -18    15480  31224  29860   -530  -4545   4326       C  
ATOM   1118  C4'  DA I -18      96.191  96.637  16.612  1.00197.66           C  
ANISOU 1118  C4'  DA I -18    15057  30678  29366   -347  -4197   4474       C  
ATOM   1119  O4'  DA I -18      94.905  95.969  16.732  1.00191.65           O  
ANISOU 1119  O4'  DA I -18    14655  29751  28412   -224  -4118   4282       O  
ATOM   1120  C3'  DA I -18      96.010  97.576  15.438  1.00195.31           C  
ANISOU 1120  C3'  DA I -18    14764  30275  29172   -516  -4043   4493       C  
ATOM   1121  O3'  DA I -18      96.139  96.829  14.239  1.00192.89           O  
ANISOU 1121  O3'  DA I -18    14400  30000  28890   -298  -3726   4714       O  
ATOM   1122  C2'  DA I -18      94.570  98.017  15.654  1.00189.23           C  
ANISOU 1122  C2'  DA I -18    14385  29264  28248   -637  -4084   4160       C  
ATOM   1123  C1'  DA I -18      93.941  96.667  15.954  1.00184.64           C  
ANISOU 1123  C1'  DA I -18    13994  28662  27500   -365  -3999   4126       C  
ATOM   1124  N9   DA I -18      92.691  96.704  16.712  1.00173.85           N  
ANISOU 1124  N9   DA I -18    12982  27125  25948   -415  -4114   3816       N  
ATOM   1125  C8   DA I -18      92.562  96.851  18.062  1.00170.94           C  
ANISOU 1125  C8   DA I -18    12693  26767  25488   -479  -4387   3636       C  
ATOM   1126  N7   DA I -18      91.323  96.798  18.487  1.00165.79           N  
ANISOU 1126  N7   DA I -18    12384  25950  24659   -490  -4419   3381       N  
ATOM   1127  C5   DA I -18      90.583  96.601  17.336  1.00160.37           C  
ANISOU 1127  C5   DA I -18    11847  25132  23952   -438  -4156   3390       C  
ATOM   1128  C6   DA I -18      89.199  96.463  17.113  1.00149.73           C  
ANISOU 1128  C6   DA I -18    10846  23591  22452   -426  -4055   3187       C  
ATOM   1129  N6   DA I -18      88.290  96.514  18.092  1.00143.26           N  
ANISOU 1129  N6   DA I -18    10297  22673  21463   -465  -4208   2936       N  
ATOM   1130  N1   DA I -18      88.783  96.280  15.844  1.00147.81           N  
ANISOU 1130  N1   DA I -18    10659  23266  22234   -366  -3788   3253       N  
ATOM   1131  C2   DA I -18      89.698  96.229  14.865  1.00151.34           C  
ANISOU 1131  C2   DA I -18    10842  23821  22841   -308  -3625   3508       C  
ATOM   1132  N3   DA I -18      91.027  96.345  14.952  1.00157.63           N  
ANISOU 1132  N3   DA I -18    11303  24803  23788   -311  -3688   3727       N  
ATOM   1133  C4   DA I -18      91.408  96.528  16.229  1.00163.92           C  
ANISOU 1133  C4   DA I -18    12044  25676  24564   -384  -3963   3653       C  
ATOM   1134  P    DA I -17      96.854  97.461  12.949  1.00205.82           P  
ANISOU 1134  P    DA I -17    15802  31692  30708   -365  -3539   4948       P  
ATOM   1135  OP1  DA I -17      97.426  96.345  12.163  1.00208.49           O  
ANISOU 1135  OP1  DA I -17    15993  32166  31059    -56  -3273   5232       O  
ATOM   1136  OP2  DA I -17      97.728  98.563  13.407  1.00208.94           O  
ANISOU 1136  OP2  DA I -17    15951  32175  31263   -625  -3767   4986       O  
ATOM   1137  O5'  DA I -17      95.646  98.106  12.129  1.00198.60           O  
ANISOU 1137  O5'  DA I -17    15184  30538  29736   -483  -3403   4752       O  
ATOM   1138  C5'  DA I -17      94.443  97.371  11.925  1.00190.97           C  
ANISOU 1138  C5'  DA I -17    14543  29422  28595   -330  -3263   4591       C  
ATOM   1139  C4'  DA I -17      93.624  98.016  10.826  1.00184.93           C  
ANISOU 1139  C4'  DA I -17    13957  28485  27823   -421  -3081   4498       C  
ATOM   1140  O4'  DA I -17      92.239  98.126  11.235  1.00176.93           O  
ANISOU 1140  O4'  DA I -17    13313  27270  26643   -491  -3143   4179       O  
ATOM   1141  C3'  DA I -17      94.061  99.423  10.468  1.00187.93           C  
ANISOU 1141  C3'  DA I -17    14199  28850  28357   -695  -3148   4526       C  
ATOM   1142  O3'  DA I -17      93.846  99.657   9.086  1.00190.65           O  
ANISOU 1142  O3'  DA I -17    14563  29133  28741   -659  -2882   4616       O  
ATOM   1143  C2'  DA I -17      93.179 100.308  11.358  1.00182.61           C  
ANISOU 1143  C2'  DA I -17    13777  28011  27598   -944  -3385   4194       C  
ATOM   1144  C1'  DA I -17      91.917  99.468  11.565  1.00172.78           C  
ANISOU 1144  C1'  DA I -17    12872  26634  26141   -794  -3319   3987       C  
ATOM   1145  N9   DA I -17      91.435  99.478  12.943  1.00161.71           N  
ANISOU 1145  N9   DA I -17    11641  25187  24617   -867  -3577   3751       N  
ATOM   1146  C8   DA I -17      92.199  99.486  14.071  1.00162.17           C  
ANISOU 1146  C8   DA I -17    11535  25374  24708   -909  -3823   3772       C  
ATOM   1147  N7   DA I -17      91.509  99.471  15.183  1.00160.56           N  
ANISOU 1147  N7   DA I -17    11553  25097  24355   -950  -4015   3526       N  
ATOM   1148  C5   DA I -17      90.195  99.452  14.758  1.00154.93           C  
ANISOU 1148  C5   DA I -17    11169  24192  23504   -942  -3885   3335       C  
ATOM   1149  C6   DA I -17      88.976  99.431  15.458  1.00146.25           C  
ANISOU 1149  C6   DA I -17    10413  22945  22210   -966  -3971   3048       C  
ATOM   1150  N6   DA I -17      88.898  99.430  16.792  1.00143.15           N  
ANISOU 1150  N6   DA I -17    10094  22577  21721   -996  -4215   2898       N  
ATOM   1151  N1   DA I -17      87.838  99.413  14.735  1.00141.15           N  
ANISOU 1151  N1   DA I -17    10030  22134  21467   -951  -3794   2922       N  
ATOM   1152  C2   DA I -17      87.922  99.416  13.398  1.00139.34           C  
ANISOU 1152  C2   DA I -17     9726  21889  21327   -907  -3550   3067       C  
ATOM   1153  N3   DA I -17      89.012  99.434  12.627  1.00144.22           N  
ANISOU 1153  N3   DA I -17    10039  22636  22121   -869  -3440   3337       N  
ATOM   1154  C4   DA I -17      90.126  99.451  13.377  1.00153.30           C  
ANISOU 1154  C4   DA I -17    10931  23949  23368   -892  -3619   3465       C  
ATOM   1155  P    DG I -16      94.113 101.107   8.452  1.00180.86           P  
ANISOU 1155  P    DG I -16    13223  27844  27653   -921  -2889   4651       P  
ATOM   1156  OP1  DG I -16      94.554 100.909   7.054  1.00181.64           O  
ANISOU 1156  OP1  DG I -16    13176  28007  27832   -769  -2593   4907       O  
ATOM   1157  OP2  DG I -16      94.964 101.885   9.381  1.00184.85           O  
ANISOU 1157  OP2  DG I -16    13517  28436  28284  -1143  -3172   4673       O  
ATOM   1158  O5'  DG I -16      92.660 101.759   8.437  1.00177.27           O  
ANISOU 1158  O5'  DG I -16    13147  27142  27065  -1069  -2909   4317       O  
ATOM   1159  C5'  DG I -16      91.536 100.942   8.146  1.00172.01           C  
ANISOU 1159  C5'  DG I -16    12770  26364  26221   -892  -2754   4170       C  
ATOM   1160  C4'  DG I -16      90.254 101.650   8.518  1.00165.10           C  
ANISOU 1160  C4'  DG I -16    12235  25280  25218  -1072  -2856   3834       C  
ATOM   1161  O4'  DG I -16      90.122 101.692   9.966  1.00163.71           O  
ANISOU 1161  O4'  DG I -16    12139  25097  24967  -1169  -3140   3656       O  
ATOM   1162  C3'  DG I -16      90.169 103.104   8.041  1.00162.35           C  
ANISOU 1162  C3'  DG I -16    11894  24832  24958  -1327  -2877   3780       C  
ATOM   1163  O3'  DG I -16      88.869 103.371   7.542  1.00151.91           O  
ANISOU 1163  O3'  DG I -16    10891  23325  23503  -1350  -2765   3559       O  
ATOM   1164  C2'  DG I -16      90.438 103.892   9.322  1.00164.43           C  
ANISOU 1164  C2'  DG I -16    12135  25093  25247  -1559  -3198   3648       C  
ATOM   1165  C1'  DG I -16      89.755 102.994  10.335  1.00161.06           C  
ANISOU 1165  C1'  DG I -16    11918  24642  24635  -1443  -3302   3461       C  
ATOM   1166  N9   DG I -16      90.138 103.244  11.724  1.00159.25           N  
ANISOU 1166  N9   DG I -16    11643  24466  24399  -1558  -3601   3366       N  
ATOM   1167  C8   DG I -16      91.373 103.617  12.197  1.00162.54           C  
ANISOU 1167  C8   DG I -16    11751  25033  24976  -1655  -3768   3521       C  
ATOM   1168  N7   DG I -16      91.405 103.776  13.493  1.00162.83           N  
ANISOU 1168  N7   DG I -16    11820  25088  24960  -1748  -4040   3399       N  
ATOM   1169  C5   DG I -16      90.107 103.494  13.904  1.00158.57           C  
ANISOU 1169  C5   DG I -16    11641  24402  24207  -1703  -4043   3140       C  
ATOM   1170  C6   DG I -16      89.534 103.499  15.200  1.00155.47           C  
ANISOU 1170  C6   DG I -16    11446  23964  23663  -1749  -4270   2926       C  
ATOM   1171  O6   DG I -16      90.079 103.763  16.282  1.00157.13           O  
ANISOU 1171  O6   DG I -16    11549  24258  23895  -1839  -4526   2911       O  
ATOM   1172  N1   DG I -16      88.184 103.154  15.168  1.00151.29           N  
ANISOU 1172  N1   DG I -16    11268  23279  22935  -1674  -4175   2714       N  
ATOM   1173  C2   DG I -16      87.480 102.843  14.028  1.00149.24           C  
ANISOU 1173  C2   DG I -16    11149  22923  22633  -1572  -3905   2700       C  
ATOM   1174  N2   DG I -16      86.188 102.533  14.184  1.00146.57           N  
ANISOU 1174  N2   DG I -16    11145  22445  22100  -1516  -3855   2482       N  
ATOM   1175  N3   DG I -16      88.006 102.834  12.813  1.00150.37           N  
ANISOU 1175  N3   DG I -16    11114  23109  22913  -1522  -3695   2887       N  
ATOM   1176  C4   DG I -16      89.317 103.169  12.826  1.00155.63           C  
ANISOU 1176  C4   DG I -16    11440  23923  23768  -1590  -3775   3106       C  
ATOM   1177  P    DG I -15      88.512 103.142   5.992  1.00158.87           P  
ANISOU 1177  P    DG I -15    11811  24170  24381  -1200  -2437   3657       P  
ATOM   1178  OP1  DG I -15      89.286 101.980   5.501  1.00158.36           O  
ANISOU 1178  OP1  DG I -15    11538  24269  24364   -929  -2266   3922       O  
ATOM   1179  OP2  DG I -15      88.637 104.445   5.301  1.00154.75           O  
ANISOU 1179  OP2  DG I -15    11240  23588  23970  -1395  -2404   3686       O  
ATOM   1180  O5'  DG I -15      86.963 102.749   6.033  1.00151.13           O  
ANISOU 1180  O5'  DG I -15    11216  23021  23183  -1140  -2379   3366       O  
ATOM   1181  C5'  DG I -15      86.548 101.621   6.796  1.00145.12           C  
ANISOU 1181  C5'  DG I -15    10577  22271  22292   -986  -2433   3277       C  
ATOM   1182  C4'  DG I -15      85.173 101.833   7.415  1.00137.81           C  
ANISOU 1182  C4'  DG I -15    10008  21172  21180  -1080  -2532   2945       C  
ATOM   1183  O4'  DG I -15      85.296 102.262   8.796  1.00137.59           O  
ANISOU 1183  O4'  DG I -15    10009  21143  21125  -1238  -2821   2817       O  
ATOM   1184  C3'  DG I -15      84.287 102.861   6.736  1.00134.68           C  
ANISOU 1184  C3'  DG I -15     9813  20620  20740  -1227  -2454   2777       C  
ATOM   1185  O3'  DG I -15      82.940 102.408   6.805  1.00127.80           O  
ANISOU 1185  O3'  DG I -15     9260  19621  19677  -1162  -2402   2543       O  
ATOM   1186  C2'  DG I -15      84.523 104.130   7.570  1.00136.79           C  
ANISOU 1186  C2'  DG I -15    10075  20849  21051  -1498  -2697   2672       C  
ATOM   1187  C1'  DG I -15      84.762 103.566   8.970  1.00136.76           C  
ANISOU 1187  C1'  DG I -15    10062  20908  20991  -1477  -2923   2619       C  
ATOM   1188  N9   DG I -15      85.737 104.313   9.763  1.00139.66           N  
ANISOU 1188  N9   DG I -15    10227  21354  21485  -1654  -3154   2698       N  
ATOM   1189  C8   DG I -15      86.995 104.677   9.365  1.00144.28           C  
ANISOU 1189  C8   DG I -15    10482  22064  22276  -1702  -3151   2948       C  
ATOM   1190  N7   DG I -15      87.674 105.299  10.282  1.00148.10           N  
ANISOU 1190  N7   DG I -15    10826  22600  22845  -1874  -3400   2982       N  
ATOM   1191  C5   DG I -15      86.825 105.336  11.374  1.00145.47           C  
ANISOU 1191  C5   DG I -15    10753  22175  22344  -1931  -3578   2741       C  
ATOM   1192  C6   DG I -15      87.030 105.888  12.655  1.00145.66           C  
ANISOU 1192  C6   DG I -15    10778  22207  22359  -2094  -3873   2657       C  
ATOM   1193  O6   DG I -15      88.036 106.465  13.084  1.00150.80           O  
ANISOU 1193  O6   DG I -15    11188  22949  23161  -2233  -4047   2777       O  
ATOM   1194  N1   DG I -15      85.920 105.725  13.474  1.00138.84           N  
ANISOU 1194  N1   DG I -15    10233  21235  21285  -2084  -3962   2408       N  
ATOM   1195  C2   DG I -15      84.753 105.100  13.104  1.00132.14           C  
ANISOU 1195  C2   DG I -15     9660  20283  20264  -1945  -3793   2261       C  
ATOM   1196  N2   DG I -15      83.791 105.043  14.042  1.00127.17           N  
ANISOU 1196  N2   DG I -15     9312  19564  19443  -1958  -3913   2040       N  
ATOM   1197  N3   DG I -15      84.542 104.572  11.895  1.00133.88           N  
ANISOU 1197  N3   DG I -15     9878  20492  20497  -1800  -3523   2329       N  
ATOM   1198  C4   DG I -15      85.624 104.727  11.083  1.00139.77           C  
ANISOU 1198  C4   DG I -15    10321  21344  21440  -1797  -3429   2569       C  
ATOM   1199  P    DC I -14      81.725 103.323   6.295  1.00124.03           P  
ANISOU 1199  P    DC I -14     9064  18968  19094  -1293  -2335   2305       P  
ATOM   1200  OP1  DC I -14      80.634 102.409   5.886  1.00123.90           O  
ANISOU 1200  OP1  DC I -14     9266  18882  18928  -1124  -2180   2187       O  
ATOM   1201  OP2  DC I -14      82.252 104.319   5.336  1.00123.75           O  
ANISOU 1201  OP2  DC I -14     8881  18940  19199  -1395  -2237   2431       O  
ATOM   1202  O5'  DC I -14      81.263 104.085   7.617  1.00120.10           O  
ANISOU 1202  O5'  DC I -14     8751  18384  18499  -1492  -2598   2067       O  
ATOM   1203  C5'  DC I -14      81.114 103.359   8.830  1.00116.90           C  
ANISOU 1203  C5'  DC I -14     8423  18002  17992  -1435  -2761   1979       C  
ATOM   1204  C4'  DC I -14      80.682 104.275   9.958  1.00115.08           C  
ANISOU 1204  C4'  DC I -14     8353  17688  17684  -1646  -3005   1827       C  
ATOM   1205  O4'  DC I -14      81.822 105.036  10.436  1.00119.16           O  
ANISOU 1205  O4'  DC I -14     8629  18287  18361  -1801  -3185   1971       O  
ATOM   1206  C3'  DC I -14      79.624 105.307   9.581  1.00110.66           C  
ANISOU 1206  C3'  DC I -14     8044  16965  17038  -1793  -2966   1661       C  
ATOM   1207  O3'  DC I -14      78.771 105.522  10.684  1.00111.13           O  
ANISOU 1207  O3'  DC I -14     8361  16934  16929  -1868  -3133   1461       O  
ATOM   1208  C2'  DC I -14      80.463 106.547   9.283  1.00114.30           C  
ANISOU 1208  C2'  DC I -14     8313  17439  17677  -1987  -3030   1798       C  
ATOM   1209  C1'  DC I -14      81.537 106.416  10.349  1.00121.38           C  
ANISOU 1209  C1'  DC I -14     8996  18458  18664  -2027  -3254   1906       C  
ATOM   1210  N1   DC I -14      82.801 107.136  10.039  1.00129.99           N  
ANISOU 1210  N1   DC I -14     9774  19636  19983  -2149  -3303   2125       N  
ATOM   1211  C2   DC I -14      83.562 107.646  11.089  1.00133.11           C  
ANISOU 1211  C2   DC I -14    10033  20086  20456  -2295  -3565   2165       C  
ATOM   1212  O2   DC I -14      83.152 107.490  12.244  1.00131.35           O  
ANISOU 1212  O2   DC I -14     9963  19841  20102  -2309  -3742   2015       O  
ATOM   1213  N3   DC I -14      84.719 108.294  10.811  1.00139.24           N  
ANISOU 1213  N3   DC I -14    10513  20944  21449  -2414  -3615   2369       N  
ATOM   1214  C4   DC I -14      85.115 108.435   9.544  1.00140.83           C  
ANISOU 1214  C4   DC I -14    10559  21171  21780  -2382  -3407   2538       C  
ATOM   1215  N4   DC I -14      86.264 109.082   9.315  1.00146.06           N  
ANISOU 1215  N4   DC I -14    10923  21915  22659  -2504  -3463   2750       N  
ATOM   1216  C5   DC I -14      84.350 107.918   8.455  1.00135.87           C  
ANISOU 1216  C5   DC I -14    10071  20489  21063  -2220  -3133   2499       C  
ATOM   1217  C6   DC I -14      83.211 107.279   8.747  1.00132.38           C  
ANISOU 1217  C6   DC I -14     9919  19967  20413  -2112  -3095   2286       C  
ATOM   1218  P    DA I -13      77.232 105.916  10.459  1.00 90.15           P  
ANISOU 1218  P    DA I -13     9416  11824  13012  -2965    -85  -2505       P  
ATOM   1219  OP1  DA I -13      76.473 104.664  10.240  1.00 84.59           O  
ANISOU 1219  OP1  DA I -13     8815  11153  12173  -2825   -329  -2446       O  
ATOM   1220  OP2  DA I -13      77.185 106.994   9.445  1.00 92.79           O  
ANISOU 1220  OP2  DA I -13     9663  12180  13412  -3103    280  -2493       O  
ATOM   1221  O5'  DA I -13      76.806 106.536  11.868  1.00 95.31           O  
ANISOU 1221  O5'  DA I -13    10246  12318  13650  -2996   -162  -2386       O  
ATOM   1222  C5'  DA I -13      77.083 105.817  13.060  1.00100.63           C  
ANISOU 1222  C5'  DA I -13    11002  12954  14280  -2915   -468  -2373       C  
ATOM   1223  C4'  DA I -13      77.545 106.747  14.169  1.00105.00           C  
ANISOU 1223  C4'  DA I -13    11569  13421  14905  -2996   -431  -2385       C  
ATOM   1224  O4'  DA I -13      78.845 107.305  13.844  1.00110.48           O  
ANISOU 1224  O4'  DA I -13    12058  14168  15750  -3072   -269  -2553       O  
ATOM   1225  C3'  DA I -13      76.633 107.937  14.446  1.00103.63           C  
ANISOU 1225  C3'  DA I -13    11500  13144  14730  -3078   -250  -2282       C  
ATOM   1226  O3'  DA I -13      76.577 108.159  15.844  1.00101.28           O  
ANISOU 1226  O3'  DA I -13    11303  12770  14410  -3079   -397  -2245       O  
ATOM   1227  C2'  DA I -13      77.332 109.085  13.716  1.00108.10           C  
ANISOU 1227  C2'  DA I -13    11917  13711  15445  -3203     63  -2369       C  
ATOM   1228  C1'  DA I -13      78.793 108.716  13.911  1.00113.69           C  
ANISOU 1228  C1'  DA I -13    12459  14495  16244  -3200    -18  -2533       C  
ATOM   1229  N9   DA I -13      79.695 109.241  12.888  1.00120.67           N  
ANISOU 1229  N9   DA I -13    13140  15453  17255  -3291    229  -2648       N  
ATOM   1230  C8   DA I -13      79.637 109.011  11.542  1.00120.73           C  
ANISOU 1230  C8   DA I -13    13046  15565  17260  -3301    384  -2669       C  
ATOM   1231  N7   DA I -13      80.601 109.589  10.864  1.00120.93           N  
ANISOU 1231  N7   DA I -13    12885  15660  17404  -3404    599  -2767       N  
ATOM   1232  C5   DA I -13      81.349 110.236  11.834  1.00124.86           C  
ANISOU 1232  C5   DA I -13    13360  16082  17999  -3462    574  -2822       C  
ATOM   1233  C6   DA I -13      82.510 111.033  11.765  1.00132.40           C  
ANISOU 1233  C6   DA I -13    14150  17055  19099  -3582    731  -2924       C  
ATOM   1234  N6   DA I -13      83.140 111.319  10.621  1.00135.56           N  
ANISOU 1234  N6   DA I -13    14371  17570  19566  -3674    960  -2977       N  
ATOM   1235  N1   DA I -13      83.000 111.525  12.923  1.00136.17           N  
ANISOU 1235  N1   DA I -13    14654  17441  19645  -3612    642  -2961       N  
ATOM   1236  C2   DA I -13      82.366 111.237  14.065  1.00134.96           C  
ANISOU 1236  C2   DA I -13    14676  17196  19404  -3529    421  -2895       C  
ATOM   1237  N3   DA I -13      81.271 110.502  14.254  1.00131.38           N  
ANISOU 1237  N3   DA I -13    14388  16725  18805  -3421    263  -2785       N  
ATOM   1238  C4   DA I -13      80.808 110.026  13.088  1.00125.17           C  
ANISOU 1238  C4   DA I -13    13575  16018  17967  -3391    348  -2755       C  
ATOM   1239  P    DT I -12      75.554 109.230  16.461  1.00110.01           P  
ANISOU 1239  P    DT I -12    12531  13775  15493  -3130   -287  -2158       P  
ATOM   1240  OP1  DT I -12      75.074 108.697  17.756  1.00108.80           O  
ANISOU 1240  OP1  DT I -12    12512  13594  15233  -3070   -547  -2085       O  
ATOM   1241  OP2  DT I -12      74.582 109.596  15.407  1.00116.78           O  
ANISOU 1241  OP2  DT I -12    13422  14622  16326  -3146    -87  -2083       O  
ATOM   1242  O5'  DT I -12      76.477 110.499  16.742  1.00113.87           O  
ANISOU 1242  O5'  DT I -12    12920  14211  16135  -3243   -108  -2264       O  
ATOM   1243  C5'  DT I -12      77.737 110.324  17.372  1.00116.85           C  
ANISOU 1243  C5'  DT I -12    13203  14614  16582  -3257   -219  -2375       C  
ATOM   1244  C4'  DT I -12      78.293 111.655  17.837  1.00116.05           C  
ANISOU 1244  C4'  DT I -12    13048  14435  16610  -3367    -65  -2449       C  
ATOM   1245  O4'  DT I -12      79.254 112.150  16.871  1.00115.25           O  
ANISOU 1245  O4'  DT I -12    12776  14359  16654  -3449    143  -2541       O  
ATOM   1246  C3'  DT I -12      77.262 112.762  18.005  1.00118.87           C  
ANISOU 1246  C3'  DT I -12    13510  14687  16967  -3413     83  -2376       C  
ATOM   1247  O3'  DT I -12      77.643 113.585  19.091  1.00125.42           O  
ANISOU 1247  O3'  DT I -12    14345  15449  17860  -3469     63  -2442       O  
ATOM   1248  C2'  DT I -12      77.342 113.503  16.668  1.00119.45           C  
ANISOU 1248  C2'  DT I -12    13510  14732  17145  -3492    364  -2365       C  
ATOM   1249  C1'  DT I -12      78.824 113.392  16.349  1.00118.82           C  
ANISOU 1249  C1'  DT I -12    13247  14716  17182  -3543    395  -2490       C  
ATOM   1250  N1   DT I -12      79.143 113.407  14.892  1.00121.17           N  
ANISOU 1250  N1   DT I -12    13430  15071  17538  -3592    598  -2490       N  
ATOM   1251  C2   DT I -12      80.276 114.055  14.471  1.00128.51           C  
ANISOU 1251  C2   DT I -12    14202  16010  18617  -3703    755  -2574       C  
ATOM   1252  O2   DT I -12      81.030 114.640  15.228  1.00135.98           O  
ANISOU 1252  O2   DT I -12    15099  16908  19658  -3763    734  -2653       O  
ATOM   1253  N3   DT I -12      80.501 114.002  13.125  1.00127.35           N  
ANISOU 1253  N3   DT I -12    13951  15938  18499  -3751    941  -2559       N  
ATOM   1254  C4   DT I -12      79.725 113.375  12.171  1.00125.40           C  
ANISOU 1254  C4   DT I -12    13742  15755  18149  -3694    983  -2477       C  
ATOM   1255  O4   DT I -12      80.018 113.387  10.979  1.00130.15           O  
ANISOU 1255  O4   DT I -12    14237  16441  18775  -3749   1163  -2468       O  
ATOM   1256  C5   DT I -12      78.549 112.705  12.675  1.00118.89           C  
ANISOU 1256  C5   DT I -12    13088  14906  17180  -3574    803  -2399       C  
ATOM   1257  C7   DT I -12      77.628 111.990  11.732  1.00113.17           C  
ANISOU 1257  C7   DT I -12    12417  14243  16338  -3509    822  -2311       C  
ATOM   1258  C6   DT I -12      78.318 112.749  14.000  1.00118.69           C  
ANISOU 1258  C6   DT I -12    13164  14810  17122  -3531    621  -2405       C  
ATOM   1259  P    DG I -11      76.643 114.695  19.679  1.00113.64           P  
ANISOU 1259  P    DG I -11    12964  13849  16364  -3504    149  -2409       P  
ATOM   1260  OP1  DG I -11      76.480 114.425  21.124  1.00112.64           O  
ANISOU 1260  OP1  DG I -11    12910  13738  16149  -3467    -62  -2431       O  
ATOM   1261  OP2  DG I -11      75.449 114.777  18.808  1.00115.01           O  
ANISOU 1261  OP2  DG I -11    13217  14001  16481  -3478    273  -2301       O  
ATOM   1262  O5'  DG I -11      77.475 116.045  19.516  1.00119.11           O  
ANISOU 1262  O5'  DG I -11    13565  14442  17251  -3628    341  -2493       O  
ATOM   1263  C5'  DG I -11      78.862 116.050  19.820  1.00124.63           C  
ANISOU 1263  C5'  DG I -11    14136  15167  18051  -3679    299  -2604       C  
ATOM   1264  C4'  DG I -11      79.523 117.303  19.286  1.00131.15           C  
ANISOU 1264  C4'  DG I -11    14872  15895  19065  -3809    516  -2646       C  
ATOM   1265  O4'  DG I -11      79.844 117.124  17.883  1.00134.30           O  
ANISOU 1265  O4'  DG I -11    15180  16336  19512  -3843    675  -2605       O  
ATOM   1266  C3'  DG I -11      78.671 118.565  19.372  1.00131.80           C  
ANISOU 1266  C3'  DG I -11    15052  15823  19203  -3863    647  -2601       C  
ATOM   1267  O3'  DG I -11      79.491 119.662  19.744  1.00130.48           O  
ANISOU 1267  O3'  DG I -11    14820  15555  19203  -3976    713  -2685       O  
ATOM   1268  C2'  DG I -11      78.122 118.712  17.951  1.00134.87           C  
ANISOU 1268  C2'  DG I -11    15459  16182  19604  -3880    837  -2479       C  
ATOM   1269  C1'  DG I -11      79.274 118.168  17.124  1.00138.72           C  
ANISOU 1269  C1'  DG I -11    15788  16773  20144  -3918    886  -2512       C  
ATOM   1270  N9   DG I -11      78.877 117.622  15.828  1.00143.50           N  
ANISOU 1270  N9   DG I -11    16388  17444  20692  -3892    993  -2414       N  
ATOM   1271  C8   DG I -11      77.789 116.828  15.551  1.00142.51           C  
ANISOU 1271  C8   DG I -11    16364  17368  20414  -3785    934  -2329       C  
ATOM   1272  N7   DG I -11      77.705 116.484  14.292  1.00142.36           N  
ANISOU 1272  N7   DG I -11    16307  17405  20376  -3790   1059  -2260       N  
ATOM   1273  C5   DG I -11      78.814 117.082  13.703  1.00144.55           C  
ANISOU 1273  C5   DG I -11    16444  17681  20797  -3912   1214  -2296       C  
ATOM   1274  C6   DG I -11      79.261 117.067  12.357  1.00145.23           C  
ANISOU 1274  C6   DG I -11    16425  17835  20919  -3981   1401  -2248       C  
ATOM   1275  O6   DG I -11      78.749 116.502  11.380  1.00142.56           O  
ANISOU 1275  O6   DG I -11    16100  17572  20493  -3941   1469  -2168       O  
ATOM   1276  N1   DG I -11      80.433 117.805  12.197  1.00149.48           N  
ANISOU 1276  N1   DG I -11    16827  18361  21607  -4117   1516  -2299       N  
ATOM   1277  C2   DG I -11      81.086 118.472  13.208  1.00151.69           C  
ANISOU 1277  C2   DG I -11    17078  18560  21997  -4176   1451  -2392       C  
ATOM   1278  N2   DG I -11      82.201 119.133  12.876  1.00156.29           N  
ANISOU 1278  N2   DG I -11    17518  19143  22721  -4319   1575  -2427       N  
ATOM   1279  N3   DG I -11      80.677 118.491  14.465  1.00149.44           N  
ANISOU 1279  N3   DG I -11    16893  18209  21679  -4106   1278  -2445       N  
ATOM   1280  C4   DG I -11      79.543 117.780  14.639  1.00146.32           C  
ANISOU 1280  C4   DG I -11    16628  17835  21130  -3977   1171  -2390       C  
ATOM   1281  P    DT I -10      78.860 121.123  19.952  1.00145.21           P  
ANISOU 1281  P    DT I -10    16770  17230  21174  -4049    827  -2672       P  
ATOM   1282  OP1  DT I -10      79.586 121.759  21.073  1.00147.16           O  
ANISOU 1282  OP1  DT I -10    16975  17424  21513  -4109    749  -2805       O  
ATOM   1283  OP2  DT I -10      77.387 120.991  20.015  1.00143.54           O  
ANISOU 1283  OP2  DT I -10    16702  17002  20836  -3960    813  -2600       O  
ATOM   1284  O5'  DT I -10      79.243 121.882  18.601  1.00143.68           O  
ANISOU 1284  O5'  DT I -10    16519  16941  21130  -4167   1051  -2584       O  
ATOM   1285  C5'  DT I -10      80.542 121.714  18.049  1.00144.10           C  
ANISOU 1285  C5'  DT I -10    16415  17064  21273  -4249   1107  -2617       C  
ATOM   1286  C4'  DT I -10      80.727 122.588  16.824  1.00145.36           C  
ANISOU 1286  C4'  DT I -10    16545  17122  21563  -4380   1326  -2502       C  
ATOM   1287  O4'  DT I -10      80.413 121.832  15.625  1.00141.72           O  
ANISOU 1287  O4'  DT I -10    16073  16765  21009  -4338   1417  -2392       O  
ATOM   1288  C3'  DT I -10      79.851 123.840  16.786  1.00145.35           C  
ANISOU 1288  C3'  DT I -10    16679  16902  21644  -4431   1411  -2415       C  
ATOM   1289  O3'  DT I -10      80.634 124.953  16.390  1.00147.18           O  
ANISOU 1289  O3'  DT I -10    16849  17005  22067  -4603   1530  -2382       O  
ATOM   1290  C2'  DT I -10      78.788 123.493  15.742  1.00141.31           C  
ANISOU 1290  C2'  DT I -10    16262  16398  21030  -4367   1506  -2255       C  
ATOM   1291  C1'  DT I -10      79.573 122.600  14.797  1.00139.54           C  
ANISOU 1291  C1'  DT I -10    15904  16351  20763  -4381   1568  -2229       C  
ATOM   1292  N1   DT I -10      78.725 121.667  13.993  1.00132.48           N  
ANISOU 1292  N1   DT I -10    15066  15558  19711  -4274   1593  -2130       N  
ATOM   1293  C2   DT I -10      79.012 121.479  12.659  1.00129.54           C  
ANISOU 1293  C2   DT I -10    14628  15256  19337  -4328   1750  -2022       C  
ATOM   1294  O2   DT I -10      79.926 122.045  12.088  1.00128.76           O  
ANISOU 1294  O2   DT I -10    14423  15147  19352  -4467   1877  -1992       O  
ATOM   1295  N3   DT I -10      78.183 120.600  12.012  1.00128.76           N  
ANISOU 1295  N3   DT I -10    14588  15249  19088  -4221   1756  -1945       N  
ATOM   1296  C4   DT I -10      77.119 119.902  12.555  1.00125.52           C  
ANISOU 1296  C4   DT I -10    14292  14863  18538  -4077   1617  -1958       C  
ATOM   1297  O4   DT I -10      76.432 119.133  11.890  1.00124.73           O  
ANISOU 1297  O4   DT I -10    14235  14844  18313  -3997   1627  -1883       O  
ATOM   1298  C5   DT I -10      76.874 120.143  13.959  1.00124.45           C  
ANISOU 1298  C5   DT I -10    14217  14663  18407  -4034   1458  -2064       C  
ATOM   1299  C7   DT I -10      75.746 119.444  14.659  1.00119.73           C  
ANISOU 1299  C7   DT I -10    13735  14107  17652  -3896   1303  -2075       C  
ATOM   1300  C6   DT I -10      77.680 121.003  14.602  1.00128.62           C  
ANISOU 1300  C6   DT I -10    14689  15105  19077  -4130   1456  -2148       C  
ATOM   1301  P    DT I  -9      80.066 126.449  16.531  1.00138.00           P  
ANISOU 1301  P    DT I  -9    15806  15575  21051  -4691   1585  -2326       P  
ATOM   1302  OP1  DT I  -9      81.050 127.225  17.318  1.00136.58           O  
ANISOU 1302  OP1  DT I  -9    15550  15316  21030  -4806   1535  -2447       O  
ATOM   1303  OP2  DT I  -9      78.658 126.382  16.982  1.00134.65           O  
ANISOU 1303  OP2  DT I  -9    15539  15097  20524  -4557   1523  -2326       O  
ATOM   1304  O5'  DT I  -9      80.077 126.983  15.028  1.00140.43           O  
ANISOU 1304  O5'  DT I  -9    16122  15803  21431  -4810   1780  -2112       O  
ATOM   1305  C5'  DT I  -9      81.156 126.640  14.169  1.00144.11           C  
ANISOU 1305  C5'  DT I  -9    16433  16403  21918  -4910   1881  -2064       C  
ATOM   1306  C4'  DT I  -9      80.903 127.143  12.762  1.00148.72           C  
ANISOU 1306  C4'  DT I  -9    17058  16916  22531  -5010   2063  -1829       C  
ATOM   1307  O4'  DT I  -9      80.238 126.114  11.984  1.00146.72           O  
ANISOU 1307  O4'  DT I  -9    16834  16812  22100  -4885   2109  -1748       O  
ATOM   1308  C3'  DT I  -9      80.026 128.386  12.676  1.00152.21           C  
ANISOU 1308  C3'  DT I  -9    17675  17080  23078  -5062   2094  -1703       C  
ATOM   1309  O3'  DT I  -9      80.553 129.272  11.702  1.00157.48           O  
ANISOU 1309  O3'  DT I  -9    18320  17647  23870  -5258   2232  -1518       O  
ATOM   1310  C2'  DT I  -9      78.658 127.831  12.271  1.00149.71           C  
ANISOU 1310  C2'  DT I  -9    17499  16777  22605  -4900   2105  -1615       C  
ATOM   1311  C1'  DT I  -9      79.036 126.614  11.438  1.00146.55           C  
ANISOU 1311  C1'  DT I  -9    16988  16636  22058  -4855   2171  -1578       C  
ATOM   1312  N1   DT I  -9      78.021 125.515  11.481  1.00139.87           N  
ANISOU 1312  N1   DT I  -9    16216  15907  21022  -4660   2108  -1599       N  
ATOM   1313  C2   DT I  -9      77.775 124.781  10.343  1.00135.72           C  
ANISOU 1313  C2   DT I  -9    15680  15515  20371  -4620   2208  -1472       C  
ATOM   1314  O2   DT I  -9      78.337 124.985   9.282  1.00133.50           O  
ANISOU 1314  O2   DT I  -9    15331  15276  20117  -4734   2355  -1338       O  
ATOM   1315  N3   DT I  -9      76.838 123.793  10.492  1.00134.24           N  
ANISOU 1315  N3   DT I  -9    15563  15422  20020  -4449   2128  -1502       N  
ATOM   1316  C4   DT I  -9      76.140 123.467  11.639  1.00131.31           C  
ANISOU 1316  C4   DT I  -9    15265  15038  19589  -4325   1964  -1633       C  
ATOM   1317  O4   DT I  -9      75.313 122.560  11.670  1.00127.95           O  
ANISOU 1317  O4   DT I  -9    14896  14708  19010  -4191   1897  -1636       O  
ATOM   1318  C5   DT I  -9      76.445 124.273  12.797  1.00132.98           C  
ANISOU 1318  C5   DT I  -9    15477  15125  19923  -4372   1876  -1762       C  
ATOM   1319  C7   DT I  -9      75.745 124.014  14.098  1.00130.82           C  
ANISOU 1319  C7   DT I  -9    15272  14854  19579  -4254   1707  -1904       C  
ATOM   1320  C6   DT I  -9      77.363 125.244  12.665  1.00136.95           C  
ANISOU 1320  C6   DT I  -9    15915  15522  20596  -4532   1950  -1745       C  
ATOM   1321  P    DC I  -8      79.945 130.748  11.527  1.00154.36           P  
ANISOU 1321  P    DC I  -8    18092  16926  23634  -5368   2255  -1369       P  
ATOM   1322  OP1  DC I  -8      81.080 131.684  11.359  1.00157.52           O  
ANISOU 1322  OP1  DC I  -8    18400  17235  24214  -5604   2297  -1315       O  
ATOM   1323  OP2  DC I  -8      78.958 130.978  12.606  1.00151.84           O  
ANISOU 1323  OP2  DC I  -8    17907  16466  23321  -5229   2121  -1510       O  
ATOM   1324  O5'  DC I  -8      79.156 130.652  10.145  1.00154.26           O  
ANISOU 1324  O5'  DC I  -8    18181  16906  23526  -5353   2391  -1107       O  
ATOM   1325  C5'  DC I  -8      79.745 129.963   9.050  1.00151.72           C  
ANISOU 1325  C5'  DC I  -8    17738  16808  23100  -5401   2524   -987       C  
ATOM   1326  C4'  DC I  -8      78.748 129.799   7.922  1.00147.60           C  
ANISOU 1326  C4'  DC I  -8    17346  16277  22459  -5338   2625   -761       C  
ATOM   1327  O4'  DC I  -8      77.979 128.582   8.118  1.00144.15           O  
ANISOU 1327  O4'  DC I  -8    16934  16000  21838  -5115   2575   -863       O  
ATOM   1328  C3'  DC I  -8      77.732 130.932   7.800  1.00145.44           C  
ANISOU 1328  C3'  DC I  -8    17290  15687  22283  -5360   2609   -611       C  
ATOM   1329  O3'  DC I  -8      77.555 131.267   6.438  1.00142.49           O  
ANISOU 1329  O3'  DC I  -8    16978  15285  21875  -5452   2746   -318       O  
ATOM   1330  C2'  DC I  -8      76.464 130.329   8.403  1.00143.63           C  
ANISOU 1330  C2'  DC I  -8    17178  15450  21943  -5125   2517   -730       C  
ATOM   1331  C1'  DC I  -8      76.606 128.871   8.000  1.00142.48           C  
ANISOU 1331  C1'  DC I  -8    16924  15620  21593  -5010   2558   -767       C  
ATOM   1332  N1   DC I  -8      75.847 127.928   8.872  1.00139.42           N  
ANISOU 1332  N1   DC I  -8    16565  15327  21082  -4802   2434   -955       N  
ATOM   1333  C2   DC I  -8      75.166 126.848   8.297  1.00137.12           C  
ANISOU 1333  C2   DC I  -8    16300  15201  20600  -4660   2462   -904       C  
ATOM   1334  O2   DC I  -8      75.207 126.701   7.070  1.00136.64           O  
ANISOU 1334  O2   DC I  -8    16237  15208  20471  -4699   2594   -712       O  
ATOM   1335  N3   DC I  -8      74.483 125.997   9.105  1.00132.96           N  
ANISOU 1335  N3   DC I  -8    15799  14760  19960  -4492   2337  -1060       N  
ATOM   1336  C4   DC I  -8      74.469 126.196  10.425  1.00130.46           C  
ANISOU 1336  C4   DC I  -8    15480  14385  19702  -4459   2199  -1256       C  
ATOM   1337  N4   DC I  -8      73.782 125.335  11.184  1.00127.55           N  
ANISOU 1337  N4   DC I  -8    15138  14123  19203  -4306   2077  -1385       N  
ATOM   1338  C5   DC I  -8      75.157 127.292  11.027  1.00132.25           C  
ANISOU 1338  C5   DC I  -8    15681  14451  20118  -4589   2177  -1321       C  
ATOM   1339  C6   DC I  -8      75.826 128.123  10.221  1.00136.46           C  
ANISOU 1339  C6   DC I  -8    16190  14884  20774  -4759   2292  -1169       C  
ATOM   1340  P    DA I  -7      77.026 132.724   6.019  1.00151.10           P  
ANISOU 1340  P    DA I  -7    18261  16029  23121  -5582   2747    -94       P  
ATOM   1341  OP1  DA I  -7      78.171 133.487   5.475  1.00155.29           O  
ANISOU 1341  OP1  DA I  -7    18697  16535  23769  -5848   2818     60       O  
ATOM   1342  OP2  DA I  -7      76.245 133.272   7.150  1.00149.39           O  
ANISOU 1342  OP2  DA I  -7    18177  15568  23018  -5484   2599   -265       O  
ATOM   1343  O5'  DA I  -7      76.009 132.410   4.831  1.00146.68           O  
ANISOU 1343  O5'  DA I  -7    17838  15491  22402  -5488   2841    147       O  
ATOM   1344  C5'  DA I  -7      76.181 131.232   4.054  1.00138.99           C  
ANISOU 1344  C5'  DA I  -7    16756  14834  21219  -5414   2950    194       C  
ATOM   1345  C4'  DA I  -7      74.841 130.620   3.701  1.00131.68           C  
ANISOU 1345  C4'  DA I  -7    15978  13920  20134  -5203   2950    248       C  
ATOM   1346  O4'  DA I  -7      74.400 129.739   4.774  1.00126.73           O  
ANISOU 1346  O4'  DA I  -7    15325  13381  19446  -5009   2838    -27       O  
ATOM   1347  C3'  DA I  -7      73.707 131.627   3.497  1.00131.41           C  
ANISOU 1347  C3'  DA I  -7    16187  13559  20183  -5185   2912    409       C  
ATOM   1348  O3'  DA I  -7      72.865 131.176   2.454  1.00129.46           O  
ANISOU 1348  O3'  DA I  -7    16045  13379  19765  -5080   2990    606       O  
ATOM   1349  C2'  DA I  -7      72.985 131.573   4.841  1.00129.25           C  
ANISOU 1349  C2'  DA I  -7    15971  13165  19972  -5029   2766    141       C  
ATOM   1350  C1'  DA I  -7      73.082 130.087   5.127  1.00126.09           C  
ANISOU 1350  C1'  DA I  -7    15435  13088  19385  -4879   2763    -32       C  
ATOM   1351  N9   DA I  -7      72.843 129.718   6.520  1.00127.04           N  
ANISOU 1351  N9   DA I  -7    15524  13220  19525  -4761   2625   -323       N  
ATOM   1352  C8   DA I  -7      73.266 130.384   7.635  1.00129.35           C  
ANISOU 1352  C8   DA I  -7    15785  13381  19980  -4822   2524   -504       C  
ATOM   1353  N7   DA I  -7      72.909 129.812   8.762  1.00126.84           N  
ANISOU 1353  N7   DA I  -7    15442  13137  19615  -4685   2410   -743       N  
ATOM   1354  C5   DA I  -7      72.197 128.695   8.357  1.00124.65           C  
ANISOU 1354  C5   DA I  -7    15182  13040  19138  -4533   2430   -713       C  
ATOM   1355  C6   DA I  -7      71.548 127.670   9.074  1.00124.16           C  
ANISOU 1355  C6   DA I  -7    15111  13130  18933  -4363   2336   -877       C  
ATOM   1356  N6   DA I  -7      71.516 127.613  10.410  1.00125.80           N  
ANISOU 1356  N6   DA I  -7    15285  13345  19166  -4314   2204  -1109       N  
ATOM   1357  N1   DA I  -7      70.930 126.703   8.364  1.00122.43           N  
ANISOU 1357  N1   DA I  -7    14920  13063  18535  -4254   2377   -784       N  
ATOM   1358  C2   DA I  -7      70.965 126.763   7.027  1.00121.80           C  
ANISOU 1358  C2   DA I  -7    14874  12990  18414  -4300   2512   -549       C  
ATOM   1359  N3   DA I  -7      71.542 127.673   6.243  1.00123.19           N  
ANISOU 1359  N3   DA I  -7    15060  13049  18697  -4454   2614   -371       N  
ATOM   1360  C4   DA I  -7      72.146 128.621   6.978  1.00125.13           C  
ANISOU 1360  C4   DA I  -7    15279  13135  19129  -4571   2563   -463       C  
ATOM   1361  P    DG I  -6      72.917 131.848   0.997  1.00130.14           P  
ANISOU 1361  P    DG I  -6    16219  13407  19822  -5225   3106    978       P  
ATOM   1362  OP1  DG I  -6      74.339 132.028   0.631  1.00132.80           O  
ANISOU 1362  OP1  DG I  -6    16370  13893  20196  -5449   3193   1041       O  
ATOM   1363  OP2  DG I  -6      72.008 133.016   1.007  1.00135.06           O  
ANISOU 1363  OP2  DG I  -6    17078  13654  20586  -5236   3026   1105       O  
ATOM   1364  O5'  DG I  -6      72.270 130.727   0.055  1.00121.84           O  
ANISOU 1364  O5'  DG I  -6    15188  12599  18508  -5057   3196   1083       O  
ATOM   1365  C5'  DG I  -6      72.784 129.397   0.089  1.00115.75           C  
ANISOU 1365  C5'  DG I  -6    14229  12173  17579  -4973   3242    925       C  
ATOM   1366  C4'  DG I  -6      71.672 128.357  -0.013  1.00111.02           C  
ANISOU 1366  C4'  DG I  -6    13709  11678  16797  -4731   3220    880       C  
ATOM   1367  O4'  DG I  -6      71.185 127.999   1.308  1.00110.54           O  
ANISOU 1367  O4'  DG I  -6    13654  11554  16791  -4598   3080    602       O  
ATOM   1368  C3'  DG I  -6      70.440 128.768  -0.798  1.00110.71           C  
ANISOU 1368  C3'  DG I  -6    13899  11472  16695  -4647   3235   1120       C  
ATOM   1369  O3'  DG I  -6      69.878 127.609  -1.387  1.00107.37           O  
ANISOU 1369  O3'  DG I  -6    13478  11275  16043  -4478   3276   1144       O  
ATOM   1370  C2'  DG I  -6      69.536 129.337   0.297  1.00111.86           C  
ANISOU 1370  C2'  DG I  -6    14181  11325  16994  -4560   3096    974       C  
ATOM   1371  C1'  DG I  -6      69.827 128.390   1.457  1.00113.12           C  
ANISOU 1371  C1'  DG I  -6    14189  11655  17138  -4473   3018    649       C  
ATOM   1372  N9   DG I  -6      69.707 128.999   2.779  1.00117.24           N  
ANISOU 1372  N9   DG I  -6    14729  11973  17843  -4476   2893    435       N  
ATOM   1373  C8   DG I  -6      70.285 130.170   3.188  1.00120.27           C  
ANISOU 1373  C8   DG I  -6    15117  12140  18438  -4637   2861    428       C  
ATOM   1374  N7   DG I  -6      70.052 130.463   4.432  1.00118.24           N  
ANISOU 1374  N7   DG I  -6    14869  11754  18303  -4593   2742    197       N  
ATOM   1375  C5   DG I  -6      69.286 129.409   4.895  1.00116.51           C  
ANISOU 1375  C5   DG I  -6    14643  11685  17941  -4401   2695     48       C  
ATOM   1376  C6   DG I  -6      68.742 129.187   6.177  1.00123.23           C  
ANISOU 1376  C6   DG I  -6    15491  12516  18816  -4289   2574   -211       C  
ATOM   1377  O6   DG I  -6      68.840 129.902   7.182  1.00127.75           O  
ANISOU 1377  O6   DG I  -6    16064  12932  19545  -4324   2487   -375       O  
ATOM   1378  N1   DG I  -6      68.020 128.001   6.234  1.00125.92           N  
ANISOU 1378  N1   DG I  -6    15826  13052  18967  -4126   2553   -270       N  
ATOM   1379  C2   DG I  -6      67.847 127.132   5.183  1.00125.96           C  
ANISOU 1379  C2   DG I  -6    15831  13237  18789  -4068   2634   -112       C  
ATOM   1380  N2   DG I  -6      67.114 126.035   5.438  1.00125.93           N  
ANISOU 1380  N2   DG I  -6    15826  13396  18624  -3917   2582   -200       N  
ATOM   1381  N3   DG I  -6      68.355 127.328   3.965  1.00121.71           N  
ANISOU 1381  N3   DG I  -6    15294  12728  18222  -4159   2755    120       N  
ATOM   1382  C4   DG I  -6      69.064 128.487   3.896  1.00116.36           C  
ANISOU 1382  C4   DG I  -6    14619  11872  17721  -4329   2780    192       C  
ATOM   1383  P    DC I  -5      68.840 127.717  -2.606  1.00113.66           P  
ANISOU 1383  P    DC I  -5    14468  12028  16691  -4387   3332   1436       P  
ATOM   1384  OP1  DC I  -5      69.434 127.046  -3.779  1.00120.13           O  
ANISOU 1384  OP1  DC I  -5    15179  13156  17308  -4418   3466   1579       O  
ATOM   1385  OP2  DC I  -5      68.386 129.121  -2.712  1.00113.44           O  
ANISOU 1385  OP2  DC I  -5    14627  11651  16825  -4473   3293   1611       O  
ATOM   1386  O5'  DC I  -5      67.620 126.816  -2.119  1.00109.38           O  
ANISOU 1386  O5'  DC I  -5    14007  11505  16048  -4141   3247   1293       O  
ATOM   1387  C5'  DC I  -5      67.768 125.980  -0.973  1.00110.64           C  
ANISOU 1387  C5'  DC I  -5    14042  11774  16223  -4069   3160    989       C  
ATOM   1388  C4'  DC I  -5      66.438 125.810  -0.267  1.00111.36           C  
ANISOU 1388  C4'  DC I  -5    14267  11728  16318  -3894   3053    887       C  
ATOM   1389  O4'  DC I  -5      66.402 126.659   0.916  1.00110.85           O  
ANISOU 1389  O4'  DC I  -5    14222  11426  16469  -3944   2959    721       O  
ATOM   1390  C3'  DC I  -5      65.227 126.235  -1.090  1.00115.22           C  
ANISOU 1390  C3'  DC I  -5    14975  12056  16748  -3792   3075   1120       C  
ATOM   1391  O3'  DC I  -5      64.081 125.550  -0.631  1.00113.52           O  
ANISOU 1391  O3'  DC I  -5    14828  11851  16454  -3606   3001   1015       O  
ATOM   1392  C2'  DC I  -5      65.138 127.703  -0.729  1.00116.98           C  
ANISOU 1392  C2'  DC I  -5    15307  11935  17205  -3893   3038   1162       C  
ATOM   1393  C1'  DC I  -5      65.352 127.593   0.768  1.00112.08           C  
ANISOU 1393  C1'  DC I  -5    14582  11291  16712  -3895   2938    843       C  
ATOM   1394  N1   DC I  -5      65.730 128.867   1.432  1.00111.20           N  
ANISOU 1394  N1   DC I  -5    14495  10908  16849  -4027   2888    785       N  
ATOM   1395  C2   DC I  -5      65.529 129.001   2.805  1.00104.94           C  
ANISOU 1395  C2   DC I  -5    13668  10025  16179  -3991   2780    510       C  
ATOM   1396  O2   DC I  -5      65.051 128.047   3.427  1.00100.48           O  
ANISOU 1396  O2   DC I  -5    13053   9616  15508  -3864   2729    335       O  
ATOM   1397  N3   DC I  -5      65.870 130.165   3.409  1.00106.32           N  
ANISOU 1397  N3   DC I  -5    13867   9951  16580  -4104   2727    445       N  
ATOM   1398  C4   DC I  -5      66.385 131.163   2.689  1.00114.28           C  
ANISOU 1398  C4   DC I  -5    14935  10790  17695  -4260   2769    656       C  
ATOM   1399  N4   DC I  -5      66.707 132.295   3.326  1.00119.36           N  
ANISOU 1399  N4   DC I  -5    15607  11176  18568  -4372   2697    583       N  
ATOM   1400  C5   DC I  -5      66.591 131.046   1.283  1.00116.47           C  
ANISOU 1400  C5   DC I  -5    15249  11164  17843  -4313   2879    954       C  
ATOM   1401  C6   DC I  -5      66.247 129.893   0.700  1.00114.15           C  
ANISOU 1401  C6   DC I  -5    14926  11129  17319  -4186   2939   1002       C  
ATOM   1402  P    DT I  -4      63.467 124.322  -1.462  1.00108.83           P  
ANISOU 1402  P    DT I  -4    14257  11494  15599  -3447   3030   1109       P  
ATOM   1403  OP1  DT I  -4      64.585 123.421  -1.825  1.00109.82           O  
ANISOU 1403  OP1  DT I  -4    14195  11921  15609  -3509   3086   1065       O  
ATOM   1404  OP2  DT I  -4      62.591 124.878  -2.517  1.00112.01           O  
ANISOU 1404  OP2  DT I  -4    14858  11759  15942  -3373   3073   1383       O  
ATOM   1405  O5'  DT I  -4      62.544 123.590  -0.384  1.00101.88           O  
ANISOU 1405  O5'  DT I  -4    13385  10629  14697  -3310   2912    890       O  
ATOM   1406  C5'  DT I  -4      63.105 123.198   0.863  1.00 96.89           C  
ANISOU 1406  C5'  DT I  -4    12602  10073  14138  -3362   2825    613       C  
ATOM   1407  C4'  DT I  -4      62.228 123.628   2.031  1.00 91.22           C  
ANISOU 1407  C4'  DT I  -4    11951   9171  13538  -3313   2727    448       C  
ATOM   1408  O4'  DT I  -4      62.548 124.983   2.439  1.00 94.62           O  
ANISOU 1408  O4'  DT I  -4    12415   9342  14195  -3420   2732    427       O  
ATOM   1409  C3'  DT I  -4      60.719 123.605   1.779  1.00 89.00           C  
ANISOU 1409  C3'  DT I  -4    11841   8785  13191  -3159   2718    538       C  
ATOM   1410  O3'  DT I  -4      60.096 122.955   2.869  1.00 83.40           O  
ANISOU 1410  O3'  DT I  -4    11091   8151  12447  -3100   2614    321       O  
ATOM   1411  C2'  DT I  -4      60.348 125.097   1.725  1.00 96.42           C  
ANISOU 1411  C2'  DT I  -4    12921   9382  14332  -3188   2744    622       C  
ATOM   1412  C1'  DT I  -4      61.346 125.668   2.713  1.00 97.11           C  
ANISOU 1412  C1'  DT I  -4    12886   9412  14599  -3334   2703    428       C  
ATOM   1413  N1   DT I  -4      61.610 127.139   2.588  1.00100.16           N  
ANISOU 1413  N1   DT I  -4    13357   9498  15203  -3433   2725    513       N  
ATOM   1414  C2   DT I  -4      61.620 127.917   3.728  1.00104.02           C  
ANISOU 1414  C2   DT I  -4    13831   9800  15891  -3478   2650    304       C  
ATOM   1415  O2   DT I  -4      61.391 127.475   4.840  1.00102.96           O  
ANISOU 1415  O2   DT I  -4    13618   9751  15753  -3438   2573     56       O  
ATOM   1416  N3   DT I  -4      61.900 129.241   3.516  1.00109.12           N  
ANISOU 1416  N3   DT I  -4    14563  10162  16737  -3575   2655    400       N  
ATOM   1417  C4   DT I  -4      62.175 129.853   2.309  1.00112.52           C  
ANISOU 1417  C4   DT I  -4    15090  10485  17177  -3647   2723    691       C  
ATOM   1418  O4   DT I  -4      62.417 131.051   2.221  1.00117.44           O  
ANISOU 1418  O4   DT I  -4    15794  10840  17987  -3749   2701    769       O  
ATOM   1419  C5   DT I  -4      62.159 128.987   1.158  1.00107.37           C  
ANISOU 1419  C5   DT I  -4    14440  10062  16293  -3599   2809    900       C  
ATOM   1420  C7   DT I  -4      62.435 129.554  -0.202  1.00113.35           C  
ANISOU 1420  C7   DT I  -4    15296  10756  17017  -3678   2883   1225       C  
ATOM   1421  C6   DT I  -4      61.885 127.684   1.347  1.00100.00           C  
ANISOU 1421  C6   DT I  -4    13422   9401  15172  -3489   2807    794       C  
ATOM   1422  P    DG I  -3      58.629 122.320   2.728  1.00 83.71           P  
ANISOU 1422  P    DG I  -3    11243   8221  12343  -2942   2587    364       P  
ATOM   1423  OP1  DG I  -3      58.770 120.847   2.787  1.00 81.24           O  
ANISOU 1423  OP1  DG I  -3    10828   8210  11828  -2913   2520    305       O  
ATOM   1424  OP2  DG I  -3      57.955 122.953   1.574  1.00 88.98           O  
ANISOU 1424  OP2  DG I  -3    12088   8716  13004  -2855   2673    626       O  
ATOM   1425  O5'  DG I  -3      57.904 122.800   4.065  1.00 85.52           O  
ANISOU 1425  O5'  DG I  -3    11481   8310  12703  -2943   2512    132       O  
ATOM   1426  C5'  DG I  -3      58.543 122.600   5.322  1.00 84.25           C  
ANISOU 1426  C5'  DG I  -3    11170   8251  12590  -3033   2416   -127       C  
ATOM   1427  C4'  DG I  -3      57.967 123.519   6.387  1.00 82.76           C  
ANISOU 1427  C4'  DG I  -3    11009   7864  12573  -3045   2379   -321       C  
ATOM   1428  O4'  DG I  -3      58.298 124.896   6.081  1.00 86.20           O  
ANISOU 1428  O4'  DG I  -3    11519   8008  13227  -3088   2443   -249       O  
ATOM   1429  C3'  DG I  -3      56.455 123.485   6.530  1.00 82.66           C  
ANISOU 1429  C3'  DG I  -3    11101   7783  12524  -2933   2373   -349       C  
ATOM   1430  O3'  DG I  -3      56.109 123.769   7.871  1.00 87.85           O  
ANISOU 1430  O3'  DG I  -3    11692   8441  13247  -2945   2281   -630       O  
ATOM   1431  C2'  DG I  -3      56.010 124.601   5.588  1.00 85.14           C  
ANISOU 1431  C2'  DG I  -3    11584   7793  12973  -2856   2457   -148       C  
ATOM   1432  C1'  DG I  -3      57.121 125.626   5.788  1.00 87.54           C  
ANISOU 1432  C1'  DG I  -3    11852   7922  13490  -2992   2479   -183       C  
ATOM   1433  N9   DG I  -3      57.393 126.454   4.616  1.00 92.96           N  
ANISOU 1433  N9   DG I  -3    12658   8405  14258  -2997   2557     83       N  
ATOM   1434  C8   DG I  -3      57.316 126.086   3.294  1.00 96.03           C  
ANISOU 1434  C8   DG I  -3    13128   8858  14501  -2941   2627    366       C  
ATOM   1435  N7   DG I  -3      57.641 127.046   2.470  1.00100.30           N  
ANISOU 1435  N7   DG I  -3    13768   9199  15144  -2980   2673    569       N  
ATOM   1436  C5   DG I  -3      57.963 128.112   3.300  1.00 99.81           C  
ANISOU 1436  C5   DG I  -3    13690   8908  15323  -3068   2627    411       C  
ATOM   1437  C6   DG I  -3      58.391 129.427   2.983  1.00104.13           C  
ANISOU 1437  C6   DG I  -3    14322   9170  16071  -3156   2625    520       C  
ATOM   1438  O6   DG I  -3      58.579 129.928   1.866  1.00106.48           O  
ANISOU 1438  O6   DG I  -3    14727   9365  16364  -3187   2667    795       O  
ATOM   1439  N1   DG I  -3      58.607 130.188   4.131  1.00109.93           N  
ANISOU 1439  N1   DG I  -3    15008   9739  17019  -3218   2551    274       N  
ATOM   1440  C2   DG I  -3      58.431 129.734   5.418  1.00111.69           C  
ANISOU 1440  C2   DG I  -3    15110  10081  17244  -3197   2493    -39       C  
ATOM   1441  N2   DG I  -3      58.683 130.603   6.405  1.00119.16           N  
ANISOU 1441  N2   DG I  -3    16022  10856  18398  -3254   2420   -255       N  
ATOM   1442  N3   DG I  -3      58.033 128.510   5.723  1.00102.51           N  
ANISOU 1442  N3   DG I  -3    13868   9196  15884  -3130   2493   -133       N  
ATOM   1443  C4   DG I  -3      57.819 127.758   4.622  1.00 98.30           C  
ANISOU 1443  C4   DG I  -3    13386   8805  15159  -3069   2559    104       C  
ATOM   1444  P    DG I  -2      54.703 123.282   8.474  1.00 91.68           P  
ANISOU 1444  P    DG I  -2    12172   9115  13548  -2764   2151   -744       P  
ATOM   1445  OP1  DG I  -2      54.985 122.369   9.603  1.00 93.61           O  
ANISOU 1445  OP1  DG I  -2    12272   9633  13664  -2859   2046   -950       O  
ATOM   1446  OP2  DG I  -2      53.848 122.837   7.350  1.00 94.74           O  
ANISOU 1446  OP2  DG I  -2    12662   9564  13771  -2584   2152   -502       O  
ATOM   1447  O5'  DG I  -2      54.078 124.625   9.059  1.00 91.05           O  
ANISOU 1447  O5'  DG I  -2    12140   8777  13679  -2704   2144   -908       O  
ATOM   1448  C5'  DG I  -2      54.929 125.584   9.658  1.00 88.92           C  
ANISOU 1448  C5'  DG I  -2    11840   8280  13667  -2858   2183  -1061       C  
ATOM   1449  C4'  DG I  -2      54.409 126.982   9.407  1.00 92.39           C  
ANISOU 1449  C4'  DG I  -2    12403   8360  14342  -2767   2205  -1055       C  
ATOM   1450  O4'  DG I  -2      54.915 127.479   8.138  1.00 93.78           O  
ANISOU 1450  O4'  DG I  -2    12705   8296  14631  -2810   2312   -761       O  
ATOM   1451  C3'  DG I  -2      52.882 127.098   9.323  1.00 94.22           C  
ANISOU 1451  C3'  DG I  -2    12698   8618  14483  -2514   2131  -1073       C  
ATOM   1452  O3'  DG I  -2      52.463 128.225  10.060  1.00 96.71           O  
ANISOU 1452  O3'  DG I  -2    13020   8716  15008  -2458   2082  -1308       O  
ATOM   1453  C2'  DG I  -2      52.639 127.298   7.827  1.00 94.86           C  
ANISOU 1453  C2'  DG I  -2    12942   8535  14565  -2418   2194   -733       C  
ATOM   1454  C1'  DG I  -2      53.857 128.123   7.478  1.00 96.95           C  
ANISOU 1454  C1'  DG I  -2    13255   8507  15074  -2614   2291   -639       C  
ATOM   1455  N9   DG I  -2      54.148 128.219   6.050  1.00101.01           N  
ANISOU 1455  N9   DG I  -2    13902   8898  15581  -2627   2386   -289       N  
ATOM   1456  C8   DG I  -2      54.054 127.228   5.102  1.00101.30           C  
ANISOU 1456  C8   DG I  -2    13958   9157  15374  -2571   2424    -57       C  
ATOM   1457  N7   DG I  -2      54.383 127.628   3.901  1.00104.49           N  
ANISOU 1457  N7   DG I  -2    14489   9394  15820  -2605   2517    233       N  
ATOM   1458  C5   DG I  -2      54.709 128.970   4.068  1.00107.67           C  
ANISOU 1458  C5   DG I  -2    14967   9422  16521  -2699   2534    206       C  
ATOM   1459  C6   DG I  -2      55.142 129.936   3.124  1.00115.31           C  
ANISOU 1459  C6   DG I  -2    16058  10154  17599  -2745   2554    458       C  
ATOM   1460  O6   DG I  -2      55.328 129.796   1.907  1.00119.16           O  
ANISOU 1460  O6   DG I  -2    16625  10693  17959  -2739   2605    757       O  
ATOM   1461  N1   DG I  -2      55.360 131.178   3.722  1.00119.17           N  
ANISOU 1461  N1   DG I  -2    16573  10348  18359  -2801   2483    328       N  
ATOM   1462  C2   DG I  -2      55.185 131.446   5.060  1.00118.73           C  
ANISOU 1462  C2   DG I  -2    16427  10235  18449  -2801   2416    -19       C  
ATOM   1463  N2   DG I  -2      55.443 132.697   5.466  1.00120.86           N  
ANISOU 1463  N2   DG I  -2    16738  10210  18975  -2846   2337   -111       N  
ATOM   1464  N3   DG I  -2      54.784 130.551   5.947  1.00113.65           N  
ANISOU 1464  N3   DG I  -2    15662   9822  17697  -2767   2413   -264       N  
ATOM   1465  C4   DG I  -2      54.569 129.341   5.384  1.00106.64           C  
ANISOU 1465  C4   DG I  -2    14746   9248  16525  -2705   2450   -123       C  
ATOM   1466  P    DA I  -1      50.990 128.290  10.695  1.00102.96           P  
ANISOU 1466  P    DA I  -1    13776   9639  15705  -2234   1978  -1520       P  
ATOM   1467  OP1  DA I  -1      50.985 127.450  11.912  1.00102.81           O  
ANISOU 1467  OP1  DA I  -1    13585   9983  15497  -2309   1922  -1765       O  
ATOM   1468  OP2  DA I  -1      50.011 128.030   9.617  1.00104.88           O  
ANISOU 1468  OP2  DA I  -1    14125   9900  15823  -2033   1971  -1282       O  
ATOM   1469  O5'  DA I  -1      50.851 129.822  11.116  1.00102.72           O  
ANISOU 1469  O5'  DA I  -1    13796   9233  15999  -2183   1943  -1719       O  
ATOM   1470  C5'  DA I  -1      52.023 130.605  11.306  1.00104.98           C  
ANISOU 1470  C5'  DA I  -1    14100   9239  16548  -2376   1984  -1758       C  
ATOM   1471  C4'  DA I  -1      51.908 131.931  10.579  1.00110.96           C  
ANISOU 1471  C4'  DA I  -1    15030   9528  17601  -2308   1978  -1641       C  
ATOM   1472  O4'  DA I  -1      52.399 131.798   9.219  1.00112.79           O  
ANISOU 1472  O4'  DA I  -1    15394   9641  17822  -2376   2071  -1245       O  
ATOM   1473  C3'  DA I  -1      50.487 132.483  10.469  1.00114.24           C  
ANISOU 1473  C3'  DA I  -1    15513   9846  18047  -2022   1879  -1719       C  
ATOM   1474  O3'  DA I  -1      50.491 133.857  10.801  1.00118.86           O  
ANISOU 1474  O3'  DA I  -1    16162  10035  18964  -1989   1807  -1890       O  
ATOM   1475  C2'  DA I  -1      50.126 132.254   8.997  1.00112.21           C  
ANISOU 1475  C2'  DA I  -1    15415   9519  17702  -1926   1920  -1326       C  
ATOM   1476  C1'  DA I  -1      51.483 132.392   8.327  1.00113.05           C  
ANISOU 1476  C1'  DA I  -1    15592   9447  17916  -2176   2030  -1073       C  
ATOM   1477  N9   DA I  -1      51.588 131.702   7.041  1.00110.09           N  
ANISOU 1477  N9   DA I  -1    15305   9166  17357  -2181   2114   -698       N  
ATOM   1478  C8   DA I  -1      51.439 130.364   6.814  1.00105.10           C  
ANISOU 1478  C8   DA I  -1    14595   8927  16411  -2158   2148   -608       C  
ATOM   1479  N7   DA I  -1      51.606 130.015   5.560  1.00102.48           N  
ANISOU 1479  N7   DA I  -1    14368   8597  15973  -2162   2220   -271       N  
ATOM   1480  C5   DA I  -1      51.889 131.209   4.917  1.00105.25           C  
ANISOU 1480  C5   DA I  -1    14880   8535  16574  -2206   2241   -109       C  
ATOM   1481  C6   DA I  -1      52.168 131.519   3.570  1.00105.21           C  
ANISOU 1481  C6   DA I  -1    15042   8345  16587  -2246   2313    258       C  
ATOM   1482  N6   DA I  -1      52.202 130.604   2.595  1.00103.93           N  
ANISOU 1482  N6   DA I  -1    14903   8413  16172  -2228   2385    514       N  
ATOM   1483  N1   DA I  -1      52.405 132.811   3.260  1.00110.99           N  
ANISOU 1483  N1   DA I  -1    15921   8647  17603  -2308   2299    352       N  
ATOM   1484  C2   DA I  -1      52.369 133.725   4.239  1.00114.45           C  
ANISOU 1484  C2   DA I  -1    16336   8847  18304  -2315   2212     77       C  
ATOM   1485  N3   DA I  -1      52.120 133.554   5.539  1.00113.92           N  
ANISOU 1485  N3   DA I  -1    16109   8929  18246  -2267   2144   -299       N  
ATOM   1486  C4   DA I  -1      51.888 132.260   5.815  1.00109.60           C  
ANISOU 1486  C4   DA I  -1    15422   8824  17399  -2220   2169   -366       C  
ATOM   1487  P    DA I   0      49.131 134.593  11.232  1.00109.43           P  
ANISOU 1487  P    DA I   0    14970   8748  17859  -1697   1669  -2155       P  
ATOM   1488  OP1  DA I   0      49.395 135.315  12.497  1.00110.89           O  
ANISOU 1488  OP1  DA I   0    15052   8845  18237  -1741   1603  -2555       O  
ATOM   1489  OP2  DA I   0      48.034 133.600  11.161  1.00104.99           O  
ANISOU 1489  OP2  DA I   0    14332   8582  16977  -1518   1660  -2149       O  
ATOM   1490  O5'  DA I   0      48.912 135.665  10.070  1.00110.54           O  
ANISOU 1490  O5'  DA I   0    15347   8398  18256  -1595   1622  -1900       O  
ATOM   1491  C5'  DA I   0      50.005 136.461   9.637  1.00113.46           C  
ANISOU 1491  C5'  DA I   0    15843   8373  18893  -1801   1654  -1728       C  
ATOM   1492  C4'  DA I   0      49.662 137.201   8.359  1.00119.87           C  
ANISOU 1492  C4'  DA I   0    16892   8800  19854  -1704   1611  -1403       C  
ATOM   1493  O4'  DA I   0      49.988 136.377   7.206  1.00120.76           O  
ANISOU 1493  O4'  DA I   0    17077   9063  19745  -1793   1738   -994       O  
ATOM   1494  C3'  DA I   0      48.192 137.579   8.204  1.00122.56           C  
ANISOU 1494  C3'  DA I   0    17289   9069  20209  -1361   1468  -1499       C  
ATOM   1495  O3'  DA I   0      48.104 138.873   7.627  1.00126.27           O  
ANISOU 1495  O3'  DA I   0    17968   9004  21006  -1302   1353  -1388       O  
ATOM   1496  C2'  DA I   0      47.662 136.498   7.260  1.00120.88           C  
ANISOU 1496  C2'  DA I   0    17102   9160  19667  -1273   1541  -1204       C  
ATOM   1497  C1'  DA I   0      48.865 136.293   6.356  1.00122.13           C  
ANISOU 1497  C1'  DA I   0    17363   9230  19811  -1543   1679   -822       C  
ATOM   1498  N9   DA I   0      48.901 134.998   5.679  1.00121.61           N  
ANISOU 1498  N9   DA I   0    17262   9542  19402  -1572   1795   -576       N  
ATOM   1499  C8   DA I   0      48.791 133.762   6.252  1.00120.29           C  
ANISOU 1499  C8   DA I   0    16909   9849  18948  -1577   1845   -709       C  
ATOM   1500  N7   DA I   0      48.876 132.771   5.394  1.00119.31           N  
ANISOU 1500  N7   DA I   0    16804   9962  18567  -1600   1929   -432       N  
ATOM   1501  C5   DA I   0      49.066 133.401   4.175  1.00120.57           C  
ANISOU 1501  C5   DA I   0    17170   9804  18836  -1615   1951    -94       C  
ATOM   1502  C6   DA I   0      49.233 132.908   2.863  1.00119.52           C  
ANISOU 1502  C6   DA I   0    17151   9728  18534  -1639   2033    291       C  
ATOM   1503  N6   DA I   0      49.234 131.605   2.560  1.00118.27           N  
ANISOU 1503  N6   DA I   0    16907   9966  18064  -1638   2101    384       N  
ATOM   1504  N1   DA I   0      49.400 133.809   1.872  1.00120.62           N  
ANISOU 1504  N1   DA I   0    17500   9498  18833  -1667   2031    574       N  
ATOM   1505  C2   DA I   0      49.398 135.112   2.179  1.00123.98           C  
ANISOU 1505  C2   DA I   0    18021   9501  19585  -1670   1938    482       C  
ATOM   1506  N3   DA I   0      49.252 135.693   3.369  1.00125.50           N  
ANISOU 1506  N3   DA I   0    18122   9583  19981  -1635   1846    115       N  
ATOM   1507  C4   DA I   0      49.089 134.774   4.333  1.00122.92           C  
ANISOU 1507  C4   DA I   0    17579   9657  19470  -1608   1866   -165       C  
ATOM   1508  P    DT I   1      46.768 139.751   7.774  1.00131.34           P  
ANISOU 1508  P    DT I   1    18666   9415  21822   -953   1144  -1614       P  
ATOM   1509  OP1  DT I   1      47.133 141.004   8.472  1.00123.83           O  
ANISOU 1509  OP1  DT I   1    17745   8052  21252   -988   1018  -1875       O  
ATOM   1510  OP2  DT I   1      45.702 138.885   8.326  1.00127.65           O  
ANISOU 1510  OP2  DT I   1    18010   9417  21073   -736   1140  -1855       O  
ATOM   1511  O5'  DT I   1      46.398 140.101   6.260  1.00137.90           O  
ANISOU 1511  O5'  DT I   1    19756   9946  22692   -862   1098  -1174       O  
ATOM   1512  C5'  DT I   1      46.759 139.194   5.228  1.00136.28           C  
ANISOU 1512  C5'  DT I   1    19611   9948  22222   -987   1251   -763       C  
ATOM   1513  C4'  DT I   1      46.502 139.790   3.862  1.00137.46           C  
ANISOU 1513  C4'  DT I   1    20029   9736  22462   -922   1185   -364       C  
ATOM   1514  O4'  DT I   1      46.819 138.804   2.849  1.00134.36           O  
ANISOU 1514  O4'  DT I   1    19676   9606  21767  -1031   1344     19       O  
ATOM   1515  C3'  DT I   1      45.059 140.168   3.600  1.00138.77           C  
ANISOU 1515  C3'  DT I   1    20267   9792  22665   -553    999   -443       C  
ATOM   1516  O3'  DT I   1      45.001 141.156   2.583  1.00143.86           O  
ANISOU 1516  O3'  DT I   1    21189   9942  23530   -525    880   -139       O  
ATOM   1517  C2'  DT I   1      44.468 138.844   3.132  1.00134.16           C  
ANISOU 1517  C2'  DT I   1    19598   9694  21682   -451   1099   -312       C  
ATOM   1518  C1'  DT I   1      45.624 138.246   2.331  1.00131.70           C  
ANISOU 1518  C1'  DT I   1    19351   9474  21214   -754   1291     79       C  
ATOM   1519  N1   DT I   1      45.716 136.757   2.431  1.00124.36           N  
ANISOU 1519  N1   DT I   1    18243   9097  19910   -807   1444     88       N  
ATOM   1520  C2   DT I   1      45.913 136.017   1.288  1.00121.67           C  
ANISOU 1520  C2   DT I   1    17988   8913  19330   -866   1549    467       C  
ATOM   1521  O2   DT I   1      46.020 136.513   0.181  1.00124.82           O  
ANISOU 1521  O2   DT I   1    18600   9041  19786   -885   1536    808       O  
ATOM   1522  N3   DT I   1      45.983 134.663   1.487  1.00113.62           N  
ANISOU 1522  N3   DT I   1    16795   8381  17993   -903   1659    432       N  
ATOM   1523  C4   DT I   1      45.877 133.989   2.690  1.00108.06           C  
ANISOU 1523  C4   DT I   1    15859   8017  17184   -905   1673     87       C  
ATOM   1524  O4   DT I   1      45.955 132.766   2.765  1.00102.85           O  
ANISOU 1524  O4   DT I   1    15071   7766  16242   -949   1754     99       O  
ATOM   1525  C5   DT I   1      45.671 134.824   3.850  1.00111.94           C  
ANISOU 1525  C5   DT I   1    16271   8345  17917   -853   1574   -290       C  
ATOM   1526  C7   DT I   1      45.540 134.207   5.211  1.00109.51           C  
ANISOU 1526  C7   DT I   1    15715   8398  17497   -863   1582   -676       C  
ATOM   1527  C6   DT I   1      45.601 136.152   3.667  1.00118.53           C  
ANISOU 1527  C6   DT I   1    17263   8702  19071   -799   1466   -283       C  
ATOM   1528  P    DC I   2      43.601 141.840   2.194  1.00153.83           P  
ANISOU 1528  P    DC I   2    22578  10949  24920   -144    639   -191       P  
ATOM   1529  OP1  DC I   2      43.866 143.272   1.928  1.00156.09           O  
ANISOU 1529  OP1  DC I   2    23091  10737  25479   -174    438   -103       O  
ATOM   1530  OP2  DC I   2      42.603 141.456   3.217  1.00153.19           O  
ANISOU 1530  OP2  DC I   2    22258  11198  24751    118    582   -652       O  
ATOM   1531  O5'  DC I   2      43.205 141.130   0.817  1.00147.57           O  
ANISOU 1531  O5'  DC I   2    21918  10312  23840    -84    699    248       O  
ATOM   1532  C5'  DC I   2      44.080 141.227  -0.299  1.00141.45           C  
ANISOU 1532  C5'  DC I   2    21347   9369  23029   -333    790    727       C  
ATOM   1533  C4'  DC I   2      43.588 140.379  -1.458  1.00131.91           C  
ANISOU 1533  C4'  DC I   2    20216   8401  21505   -239    856   1068       C  
ATOM   1534  O4'  DC I   2      43.813 138.975  -1.172  1.00124.13           O  
ANISOU 1534  O4'  DC I   2    19008   7983  20172   -317   1054   1005       O  
ATOM   1535  C3'  DC I   2      42.101 140.516  -1.782  1.00131.44           C  
ANISOU 1535  C3'  DC I   2    20210   8301  21429    152    660   1001       C  
ATOM   1536  O3'  DC I   2      41.932 140.567  -3.188  1.00134.54           O  
ANISOU 1536  O3'  DC I   2    20842   8555  21721    176    633   1453       O  
ATOM   1537  C2'  DC I   2      41.498 139.242  -1.188  1.00125.23           C  
ANISOU 1537  C2'  DC I   2    19153   8097  20333    281    754    748       C  
ATOM   1538  C1'  DC I   2      42.627 138.252  -1.413  1.00121.21           C  
ANISOU 1538  C1'  DC I   2    18576   7906  19571    -34   1003    960       C  
ATOM   1539  N1   DC I   2      42.607 137.074  -0.493  1.00117.16           N  
ANISOU 1539  N1   DC I   2    17779   7919  18817    -56   1124    682       N  
ATOM   1540  C2   DC I   2      42.799 135.791  -1.015  1.00111.14           C  
ANISOU 1540  C2   DC I   2    16953   7570  17706   -133   1273    878       C  
ATOM   1541  O2   DC I   2      42.967 135.663  -2.232  1.00113.83           O  
ANISOU 1541  O2   DC I   2    17464   7852  17935   -170   1312   1263       O  
ATOM   1542  N3   DC I   2      42.793 134.729  -0.170  1.00101.69           N  
ANISOU 1542  N3   DC I   2    15513   6825  16301   -165   1359    640       N  
ATOM   1543  C4   DC I   2      42.610 134.919   1.138  1.00 99.27           C  
ANISOU 1543  C4   DC I   2    15029   6585  16104   -134   1315    231       C  
ATOM   1544  N4   DC I   2      42.610 133.845   1.936  1.00 90.82           N  
ANISOU 1544  N4   DC I   2    13733   5966  14809   -185   1393     28       N  
ATOM   1545  C5   DC I   2      42.416 136.221   1.688  1.00109.94           C  
ANISOU 1545  C5   DC I   2    16430   7543  17800    -49   1176      8       C  
ATOM   1546  C6   DC I   2      42.424 137.259   0.845  1.00117.55           C  
ANISOU 1546  C6   DC I   2    17638   8040  18987     -9   1079    241       C  
ATOM   1547  P    DC I   3      40.680 141.336  -3.835  1.00138.41           P  
ANISOU 1547  P    DC I   3    21522   8752  22314    518    348   1507       P  
ATOM   1548  OP1  DC I   3      41.210 142.322  -4.804  1.00139.82           O  
ANISOU 1548  OP1  DC I   3    22000   8635  22491    356    207   1858       O  
ATOM   1549  OP2  DC I   3      39.801 141.784  -2.732  1.00140.02           O  
ANISOU 1549  OP2  DC I   3    21578   8863  22759    794    190   1019       O  
ATOM   1550  O5'  DC I   3      39.918 140.187  -4.640  1.00135.51           O  
ANISOU 1550  O5'  DC I   3    21127   8762  21596    687    422   1692       O  
ATOM   1551  C5'  DC I   3      40.659 139.302  -5.471  1.00132.04           C  
ANISOU 1551  C5'  DC I   3    20722   8592  20853    460    634   2053       C  
ATOM   1552  C4'  DC I   3      39.874 138.035  -5.749  1.00125.31           C  
ANISOU 1552  C4'  DC I   3    19735   8232  19643    640    690   2040       C  
ATOM   1553  O4'  DC I   3      40.142 137.047  -4.714  1.00119.15           O  
ANISOU 1553  O4'  DC I   3    18661   7902  18708    553    844   1736       O  
ATOM   1554  C3'  DC I   3      38.353 138.206  -5.775  1.00124.04           C  
ANISOU 1554  C3'  DC I   3    19569   8045  19516   1039    471   1867       C  
ATOM   1555  O3'  DC I   3      37.809 137.362  -6.774  1.00122.85           O  
ANISOU 1555  O3'  DC I   3    19464   8155  19057   1155    492   2117       O  
ATOM   1556  C2'  DC I   3      37.957 137.722  -4.382  1.00119.08           C  
ANISOU 1556  C2'  DC I   3    18628   7743  18876   1126    496   1373       C  
ATOM   1557  C1'  DC I   3      38.910 136.551  -4.251  1.00114.87           C  
ANISOU 1557  C1'  DC I   3    17954   7626  18065    846    750   1453       C  
ATOM   1558  N1   DC I   3      39.074 136.020  -2.863  1.00110.82           N  
ANISOU 1558  N1   DC I   3    17154   7429  17522    777    835   1048       N  
ATOM   1559  C2   DC I   3      39.261 134.646  -2.680  1.00105.70           C  
ANISOU 1559  C2   DC I   3    16325   7284  16553    680    991   1033       C  
ATOM   1560  O2   DC I   3      39.286 133.913  -3.675  1.00102.04           O  
ANISOU 1560  O2   DC I   3    15937   6988  15847    664   1054   1338       O  
ATOM   1561  N3   DC I   3      39.410 134.163  -1.421  1.00102.27           N  
ANISOU 1561  N3   DC I   3    15643   7135  16080    605   1055    685       N  
ATOM   1562  C4   DC I   3      39.375 134.997  -0.380  1.00 99.96           C  
ANISOU 1562  C4   DC I   3    15274   6661  16044    630    982    350       C  
ATOM   1563  N4   DC I   3      39.525 134.478   0.845  1.00 92.12           N  
ANISOU 1563  N4   DC I   3    14040   5979  14983    548   1048     18       N  
ATOM   1564  C5   DC I   3      39.183 136.402  -0.548  1.00106.77           C  
ANISOU 1564  C5   DC I   3    16310   7011  17246    743    822    337       C  
ATOM   1565  C6   DC I   3      39.035 136.865  -1.795  1.00111.04           C  
ANISOU 1565  C6   DC I   3    17105   7255  17832    811    748    697       C  
ATOM   1566  P    DA I   4      37.284 137.956  -8.171  1.00125.09           P  
ANISOU 1566  P    DA I   4    20056   8117  19356   1304    329   2506       P  
ATOM   1567  OP1  DA I   4      38.382 138.754  -8.761  1.00128.15           O  
ANISOU 1567  OP1  DA I   4    20579   8292  19822    985    290   2788       O  
ATOM   1568  OP2  DA I   4      35.965 138.582  -7.930  1.00124.47           O  
ANISOU 1568  OP2  DA I   4    19980   7847  19466   1673     67   2264       O  
ATOM   1569  O5'  DA I   4      37.052 136.648  -9.070  1.00118.92           O  
ANISOU 1569  O5'  DA I   4    19244   7785  18155   1332    444   2740       O  
ATOM   1570  C5'  DA I   4      38.172 135.885  -9.524  1.00110.99           C  
ANISOU 1570  C5'  DA I   4    18198   7075  16897   1018    655   2969       C  
ATOM   1571  C4'  DA I   4      37.876 134.384  -9.563  1.00102.45           C  
ANISOU 1571  C4'  DA I   4    16960   6492  15473   1085    796   2933       C  
ATOM   1572  O4'  DA I   4      37.869 133.831  -8.223  1.00102.40           O  
ANISOU 1572  O4'  DA I   4    16665   6765  15477   1062    859   2524       O  
ATOM   1573  C3'  DA I   4      36.543 133.966 -10.154  1.00102.08           C  
ANISOU 1573  C3'  DA I   4    16930   6584  15271   1410    648   2955       C  
ATOM   1574  O3'  DA I   4      36.672 132.633 -10.611  1.00101.01           O  
ANISOU 1574  O3'  DA I   4    16702   6894  14783   1360    781   3066       O  
ATOM   1575  C2'  DA I   4      35.636 134.029  -8.928  1.00102.20           C  
ANISOU 1575  C2'  DA I   4    16724   6680  15430   1616    538   2492       C  
ATOM   1576  C1'  DA I   4      36.553 133.419  -7.875  1.00104.49           C  
ANISOU 1576  C1'  DA I   4    16790   7234  15676   1360    731   2277       C  
ATOM   1577  N9   DA I   4      36.321 133.877  -6.511  1.00110.86           N  
ANISOU 1577  N9   DA I   4    17420   7996  16707   1405    679   1854       N  
ATOM   1578  C8   DA I   4      36.128 135.162  -6.099  1.00115.53           C  
ANISOU 1578  C8   DA I   4    18089   8169  17638   1495    534   1704       C  
ATOM   1579  N7   DA I   4      36.000 135.288  -4.801  1.00114.64           N  
ANISOU 1579  N7   DA I   4    17766   8140  17654   1512    527   1292       N  
ATOM   1580  C5   DA I   4      36.144 133.999  -4.324  1.00110.64           C  
ANISOU 1580  C5   DA I   4    17035   8134  16867   1408    679   1186       C  
ATOM   1581  C6   DA I   4      36.108 133.461  -3.025  1.00108.69           C  
ANISOU 1581  C6   DA I   4    16513   8212  16571   1357    743    812       C  
ATOM   1582  N6   DA I   4      35.915 134.202  -1.930  1.00106.99           N  
ANISOU 1582  N6   DA I   4    16186   7876  16589   1415    672    444       N  
ATOM   1583  N1   DA I   4      36.281 132.129  -2.893  1.00110.42           N  
ANISOU 1583  N1   DA I   4    16579   8889  16488   1243    873    828       N  
ATOM   1584  C2   DA I   4      36.477 131.393  -3.994  1.00108.95           C  
ANISOU 1584  C2   DA I   4    16500   8824  16073   1199    934   1173       C  
ATOM   1585  N3   DA I   4      36.526 131.786  -5.267  1.00107.78           N  
ANISOU 1585  N3   DA I   4    16597   8424  15930   1246    896   1529       N  
ATOM   1586  C4   DA I   4      36.352 133.114  -5.364  1.00109.71           C  
ANISOU 1586  C4   DA I   4    16998   8216  16471   1344    768   1526       C  
ATOM   1587  P    DG I   5      35.907 132.119 -11.923  1.00 92.07           P  
ANISOU 1587  P    DG I   5    15638   5959  13385   1526    669   3305       P  
ATOM   1588  OP1  DG I   5      36.846 132.228 -13.064  1.00 94.44           O  
ANISOU 1588  OP1  DG I   5    16006   6332  13546   1261    698   3623       O  
ATOM   1589  OP2  DG I   5      34.584 132.781 -11.978  1.00 96.96           O  
ANISOU 1589  OP2  DG I   5    16316   6364  14159   1854    428   3203       O  
ATOM   1590  O5'  DG I   5      35.673 130.572 -11.608  1.00 92.62           O  
ANISOU 1590  O5'  DG I   5    15523   6501  13169   1576    793   3185       O  
ATOM   1591  C5'  DG I   5      36.410 129.953 -10.559  1.00 91.82           C  
ANISOU 1591  C5'  DG I   5    15197   6643  13046   1369    945   2953       C  
ATOM   1592  C4'  DG I   5      35.475 129.280  -9.573  1.00 90.03           C  
ANISOU 1592  C4'  DG I   5    14716   6713  12777   1526    879   2589       C  
ATOM   1593  O4'  DG I   5      35.190 130.173  -8.457  1.00 91.24           O  
ANISOU 1593  O4'  DG I   5    14785   6662  13219   1578    805   2274       O  
ATOM   1594  C3'  DG I   5      34.107 128.879 -10.147  1.00 91.87           C  
ANISOU 1594  C3'  DG I   5    14951   7081  12873   1829    722   2604       C  
ATOM   1595  O3'  DG I   5      33.745 127.598  -9.653  1.00 87.90           O  
ANISOU 1595  O3'  DG I   5    14218   7026  12154   1837    753   2428       O  
ATOM   1596  C2'  DG I   5      33.189 129.956  -9.576  1.00 95.25           C  
ANISOU 1596  C2'  DG I   5    15372   7237  13581   2049    549   2369       C  
ATOM   1597  C1'  DG I   5      33.812 130.094  -8.204  1.00 96.69           C  
ANISOU 1597  C1'  DG I   5    15372   7455  13909   1867    646   2064       C  
ATOM   1598  N9   DG I   5      33.367 131.251  -7.430  1.00113.10           N  
ANISOU 1598  N9   DG I   5    17431   9241  16302   1993    525   1797       N  
ATOM   1599  C8   DG I   5      32.965 132.475  -7.903  1.00121.63           C  
ANISOU 1599  C8   DG I   5    18710   9882  17623   2162    361   1876       C  
ATOM   1600  N7   DG I   5      32.615 133.307  -6.958  1.00125.49           N  
ANISOU 1600  N7   DG I   5    19113  10191  18377   2261    265   1550       N  
ATOM   1601  C5   DG I   5      32.782 132.578  -5.785  1.00124.44           C  
ANISOU 1601  C5   DG I   5    18703  10424  18154   2143    384   1242       C  
ATOM   1602  C6   DG I   5      32.559 132.948  -4.434  1.00142.86           C  
ANISOU 1602  C6   DG I   5    20829  12799  20654   2173    361    812       C  
ATOM   1603  O6   DG I   5      32.153 134.031  -3.987  1.00172.53           O  
ANISOU 1603  O6   DG I   5    24599  16262  24693   2328    222    590       O  
ATOM   1604  N1   DG I   5      32.857 131.904  -3.559  1.00132.09           N  
ANISOU 1604  N1   DG I   5    19224  11871  19091   2002    508    632       N  
ATOM   1605  C2   DG I   5      33.310 130.663  -3.943  1.00122.80           C  
ANISOU 1605  C2   DG I   5    18015  11025  17618   1835    642    835       C  
ATOM   1606  N2   DG I   5      33.547 129.778  -2.967  1.00122.25           N  
ANISOU 1606  N2   DG I   5    17714  11335  17399   1681    746    627       N  
ATOM   1607  N3   DG I   5      33.524 130.310  -5.200  1.00115.25           N  
ANISOU 1607  N3   DG I   5    17242  10032  16516   1821    662   1213       N  
ATOM   1608  C4   DG I   5      33.240 131.312  -6.063  1.00116.80           C  
ANISOU 1608  C4   DG I   5    17670   9828  16880   1975    537   1400       C  
ATOM   1609  P    DC I   6      33.951 126.278 -10.545  1.00 96.32           P  
ANISOU 1609  P    DC I   6    15291   8426  12880   1790    818   2653       P  
ATOM   1610  OP1  DC I   6      35.240 126.408 -11.260  1.00 95.75           O  
ANISOU 1610  OP1  DC I   6    15378   8240  12764   1568    962   2938       O  
ATOM   1611  OP2  DC I   6      32.707 126.052 -11.314  1.00 93.70           O  
ANISOU 1611  OP2  DC I   6    15009   8159  12436   2071    658   2728       O  
ATOM   1612  O5'  DC I   6      34.074 125.113  -9.456  1.00 88.63           O  
ANISOU 1612  O5'  DC I   6    14040   7855  11780   1666    886   2386       O  
ATOM   1613  C5'  DC I   6      35.149 125.129  -8.525  1.00 82.74           C  
ANISOU 1613  C5'  DC I   6    13195   7122  11120   1409   1021   2251       C  
ATOM   1614  C4'  DC I   6      34.669 124.844  -7.111  1.00 75.51           C  
ANISOU 1614  C4'  DC I   6    12031   6409  10249   1406    992   1880       C  
ATOM   1615  O4'  DC I   6      34.068 126.035  -6.531  1.00 76.88           O  
ANISOU 1615  O4'  DC I   6    12202   6323  10684   1541    906   1682       O  
ATOM   1616  C3'  DC I   6      33.617 123.748  -6.980  1.00 74.21           C  
ANISOU 1616  C3'  DC I   6    11707   6614   9875   1536    900   1774       C  
ATOM   1617  O3'  DC I   6      33.854 123.042  -5.784  1.00 76.28           O  
ANISOU 1617  O3'  DC I   6    11750   7153  10081   1374    948   1532       O  
ATOM   1618  C2'  DC I   6      32.321 124.550  -6.891  1.00 79.13           C  
ANISOU 1618  C2'  DC I   6    12322   7104  10639   1809    753   1634       C  
ATOM   1619  C1'  DC I   6      32.787 125.709  -6.032  1.00 79.44           C  
ANISOU 1619  C1'  DC I   6    12359   6867  10959   1736    789   1450       C  
ATOM   1620  N1   DC I   6      31.941 126.926  -6.117  1.00 82.15           N  
ANISOU 1620  N1   DC I   6    12778   6904  11533   1979    653   1364       N  
ATOM   1621  C2   DC I   6      31.461 127.527  -4.944  1.00 88.58           C  
ANISOU 1621  C2   DC I   6    13429   7700  12526   2046    606   1000       C  
ATOM   1622  O2   DC I   6      31.721 127.013  -3.847  1.00 95.53           O  
ANISOU 1622  O2   DC I   6    14105   8840  13351   1891    684    767       O  
ATOM   1623  N3   DC I   6      30.711 128.652  -5.047  1.00 86.65           N  
ANISOU 1623  N3   DC I   6    13255   7160  12509   2285    463    905       N  
ATOM   1624  C4   DC I   6      30.454 129.174  -6.246  1.00 87.77           C  
ANISOU 1624  C4   DC I   6    13631   7019  12700   2442    365   1177       C  
ATOM   1625  N4   DC I   6      29.713 130.283  -6.302  1.00 90.66           N  
ANISOU 1625  N4   DC I   6    14064   7078  13303   2684    200   1069       N  
ATOM   1626  C5   DC I   6      30.936 128.579  -7.444  1.00 89.09           C  
ANISOU 1626  C5   DC I   6    13972   7211  12669   2362    421   1564       C  
ATOM   1627  C6   DC I   6      31.675 127.474  -7.334  1.00 85.92           C  
ANISOU 1627  C6   DC I   6    13486   7113  12046   2136    568   1634       C  
ATOM   1628  P    DT I   7      33.703 121.446  -5.730  1.00 69.36           P  
ANISOU 1628  P    DT I   7    10735   6699   8918   1306    931   1537       P  
ATOM   1629  OP1  DT I   7      35.009 120.912  -5.280  1.00 59.68           O  
ANISOU 1629  OP1  DT I   7     9465   5560   7650   1032   1051   1539       O  
ATOM   1630  OP2  DT I   7      33.112 120.988  -7.008  1.00 64.63           O  
ANISOU 1630  OP2  DT I   7    10250   6145   8161   1479    851   1772       O  
ATOM   1631  O5'  DT I   7      32.635 121.223  -4.564  1.00 68.33           O  
ANISOU 1631  O5'  DT I   7    10371   6811   8780   1368    849   1218       O  
ATOM   1632  C5'  DT I   7      32.918 121.704  -3.262  1.00 66.05           C  
ANISOU 1632  C5'  DT I   7     9949   6517   8631   1247    900    945       C  
ATOM   1633  C4'  DT I   7      31.673 122.270  -2.606  1.00 66.60           C  
ANISOU 1633  C4'  DT I   7     9883   6629   8791   1434    808    678       C  
ATOM   1634  O4'  DT I   7      31.195 123.403  -3.354  1.00 72.54           O  
ANISOU 1634  O4'  DT I   7    10793   7043   9725   1666    743    750       O  
ATOM   1635  C3'  DT I   7      30.493 121.305  -2.500  1.00 64.84           C  
ANISOU 1635  C3'  DT I   7     9497   6777   8364   1528    709    603       C  
ATOM   1636  O3'  DT I   7      30.338 120.910  -1.135  1.00 58.28           O  
ANISOU 1636  O3'  DT I   7     8431   6238   7475   1387    728    323       O  
ATOM   1637  C2'  DT I   7      29.284 122.111  -3.023  1.00 73.07           C  
ANISOU 1637  C2'  DT I   7    10573   7675   9514   1840    593    564       C  
ATOM   1638  C1'  DT I   7      29.820 123.534  -3.120  1.00 79.98           C  
ANISOU 1638  C1'  DT I   7    11606   8113  10671   1891    624    560       C  
ATOM   1639  N1   DT I   7      29.232 124.331  -4.241  1.00 85.34           N  
ANISOU 1639  N1   DT I   7    12473   8491  11462   2154    519    722       N  
ATOM   1640  C2   DT I   7      28.662 125.554  -3.970  1.00 87.63           C  
ANISOU 1640  C2   DT I   7    12769   8531  11997   2347    436    535       C  
ATOM   1641  O2   DT I   7      28.598 126.028  -2.851  1.00 93.91           O  
ANISOU 1641  O2   DT I   7    13412   9352  12919   2320    452    226       O  
ATOM   1642  N3   DT I   7      28.167 126.209  -5.067  1.00 88.51           N  
ANISOU 1642  N3   DT I   7    13073   8357  12199   2579    321    718       N  
ATOM   1643  C4   DT I   7      28.184 125.776  -6.378  1.00 90.91           C  
ANISOU 1643  C4   DT I   7    13560   8621  12360   2631    292   1063       C  
ATOM   1644  O4   DT I   7      27.710 126.441  -7.294  1.00 93.62           O  
ANISOU 1644  O4   DT I   7    14078   8702  12792   2842    176   1213       O  
ATOM   1645  C5   DT I   7      28.798 124.487  -6.594  1.00 86.80           C  
ANISOU 1645  C5   DT I   7    13013   8389  11580   2426    394   1227       C  
ATOM   1646  C7   DT I   7      28.874 123.910  -7.976  1.00 90.42           C  
ANISOU 1646  C7   DT I   7    13649   8851  11856   2471    371   1576       C  
ATOM   1647  C6   DT I   7      29.286 123.835  -5.527  1.00 83.50           C  
ANISOU 1647  C6   DT I   7    12408   8231  11087   2203    494   1050       C  
ATOM   1648  P    DG I   8      29.101 120.005  -0.650  1.00 57.40           P  
ANISOU 1648  P    DG I   8     8093   6553   7165   1429    637    176       P  
ATOM   1649  OP1  DG I   8      29.647 119.037   0.326  1.00 69.28           O  
ANISOU 1649  OP1  DG I   8     9457   8354   8513   1147    682     97       O  
ATOM   1650  OP2  DG I   8      28.339 119.505  -1.816  1.00 61.18           O  
ANISOU 1650  OP2  DG I   8     8646   7071   7528   1607    536    383       O  
ATOM   1651  O5'  DG I   8      28.190 121.039   0.154  1.00 60.03           O  
ANISOU 1651  O5'  DG I   8     8276   6877   7656   1591    606   -157       O  
ATOM   1652  C5'  DG I   8      28.791 121.891   1.127  1.00 61.27           C  
ANISOU 1652  C5'  DG I   8     8390   6903   7986   1502    684   -381       C  
ATOM   1653  C4'  DG I   8      27.751 122.715   1.869  1.00 63.81           C  
ANISOU 1653  C4'  DG I   8     8536   7286   8424   1685    632   -728       C  
ATOM   1654  O4'  DG I   8      27.241 123.760   1.009  1.00 75.09           O  
ANISOU 1654  O4'  DG I   8    10107   8367  10058   1977    548   -684       O  
ATOM   1655  C3'  DG I   8      26.529 121.954   2.353  1.00 63.46           C  
ANISOU 1655  C3'  DG I   8     8240   7696   8177   1722    572   -892       C  
ATOM   1656  O3'  DG I   8      26.033 122.572   3.527  1.00 66.58           O  
ANISOU 1656  O3'  DG I   8     8419   8237   8643   1756    584  -1278       O  
ATOM   1657  C2'  DG I   8      25.555 122.098   1.184  1.00 64.44           C  
ANISOU 1657  C2'  DG I   8     8445   7717   8322   2010    455   -755       C  
ATOM   1658  C1'  DG I   8      25.902 123.483   0.638  1.00 73.08           C  
ANISOU 1658  C1'  DG I   8     9747   8309   9713   2193    437   -726       C  
ATOM   1659  N9   DG I   8      25.822 123.585  -0.816  1.00 73.34           N  
ANISOU 1659  N9   DG I   8    10017   8074   9775   2358    365   -406       N  
ATOM   1660  C8   DG I   8      26.310 122.694  -1.740  1.00 70.49           C  
ANISOU 1660  C8   DG I   8     9804   7731   9249   2260    382    -66       C  
ATOM   1661  N7   DG I   8      26.115 123.066  -2.976  1.00 70.39           N  
ANISOU 1661  N7   DG I   8     9997   7454   9295   2451    307    167       N  
ATOM   1662  C5   DG I   8      25.459 124.285  -2.862  1.00 76.07           C  
ANISOU 1662  C5   DG I   8    10713   7945  10247   2691    224    -22       C  
ATOM   1663  C6   DG I   8      24.984 125.166  -3.863  1.00 81.83           C  
ANISOU 1663  C6   DG I   8    11627   8330  11134   2964    101     99       C  
ATOM   1664  O6   DG I   8      25.053 125.041  -5.094  1.00 82.90           O  
ANISOU 1664  O6   DG I   8    11973   8307  11217   3041     54    416       O  
ATOM   1665  N1   DG I   8      24.375 126.291  -3.311  1.00 88.77           N  
ANISOU 1665  N1   DG I   8    12429   9050  12250   3163     19   -198       N  
ATOM   1666  C2   DG I   8      24.245 126.533  -1.963  1.00 88.66           C  
ANISOU 1666  C2   DG I   8    12177   9210  12299   3105     64   -576       C  
ATOM   1667  N2   DG I   8      23.632 127.670  -1.610  1.00 95.26           N  
ANISOU 1667  N2   DG I   8    12962   9856  13378   3339    -39   -852       N  
ATOM   1668  N3   DG I   8      24.686 125.716  -1.020  1.00 79.11           N  
ANISOU 1668  N3   DG I   8    10794   8340  10923   2840    190   -684       N  
ATOM   1669  C4   DG I   8      25.278 124.618  -1.538  1.00 74.72           C  
ANISOU 1669  C4   DG I   8    10320   7921  10149   2644    258   -387       C  
ATOM   1670  P    DA I   9      24.771 121.959   4.307  1.00 65.72           P  
ANISOU 1670  P    DA I   9     7995   8645   8330   1767    545  -1527       P  
ATOM   1671  OP1  DA I   9      25.003 122.201   5.748  1.00 70.24           O  
ANISOU 1671  OP1  DA I   9     8374   9422   8893   1609    623  -1854       O  
ATOM   1672  OP2  DA I   9      24.544 120.581   3.819  1.00 72.16           O  
ANISOU 1672  OP2  DA I   9     8802   9729   8886   1646    510  -1276       O  
ATOM   1673  O5'  DA I   9      23.554 122.877   3.829  1.00 75.60           O  
ANISOU 1673  O5'  DA I   9     9203   9779   9745   2141    436  -1684       O  
ATOM   1674  C5'  DA I   9      23.640 124.289   3.982  1.00 84.26           C  
ANISOU 1674  C5'  DA I   9    10354  10526  11135   2332    417  -1889       C  
ATOM   1675  C4'  DA I   9      22.334 124.970   3.605  1.00 86.55           C  
ANISOU 1675  C4'  DA I   9    10560  10783  11544   2690    285  -2065       C  
ATOM   1676  O4'  DA I   9      22.297 125.220   2.177  1.00 83.32           O  
ANISOU 1676  O4'  DA I   9    10414  10003  11239   2881    190  -1750       O  
ATOM   1677  C3'  DA I   9      21.066 124.191   3.927  1.00 83.63           C  
ANISOU 1677  C3'  DA I   9     9899  10927  10949   2729    247  -2219       C  
ATOM   1678  O3'  DA I   9      20.049 125.107   4.296  1.00 86.58           O  
ANISOU 1678  O3'  DA I   9    10090  11335  11473   3012    168  -2590       O  
ATOM   1679  C2'  DA I   9      20.751 123.501   2.598  1.00 81.93           C  
ANISOU 1679  C2'  DA I   9     9840  10655  10636   2808    166  -1853       C  
ATOM   1680  C1'  DA I   9      21.186 124.563   1.598  1.00 83.28           C  
ANISOU 1680  C1'  DA I   9    10314  10247  11081   3021     99  -1686       C  
ATOM   1681  N9   DA I   9      21.618 124.037   0.307  1.00 86.97           N  
ANISOU 1681  N9   DA I   9    11045  10517  11482   3001     74  -1252       N  
ATOM   1682  C8   DA I   9      22.431 122.961   0.082  1.00 86.85           C  
ANISOU 1682  C8   DA I   9    11120  10611  11269   2731    155   -973       C  
ATOM   1683  N7   DA I   9      22.675 122.738  -1.189  1.00 84.95           N  
ANISOU 1683  N7   DA I   9    11119  10152  11008   2794    110   -626       N  
ATOM   1684  C5   DA I   9      21.985 123.747  -1.840  1.00 85.27           C  
ANISOU 1684  C5   DA I   9    11245   9908  11244   3116    -12   -660       C  
ATOM   1685  C6   DA I   9      21.839 124.073  -3.203  1.00 78.60           C  
ANISOU 1685  C6   DA I   9    10646   8751  10467   3321   -115   -384       C  
ATOM   1686  N6   DA I   9      22.409 123.377  -4.193  1.00 69.87           N  
ANISOU 1686  N6   DA I   9     9740   7587   9221   3227    -96    -17       N  
ATOM   1687  N1   DA I   9      21.081 125.145  -3.512  1.00 83.43           N  
ANISOU 1687  N1   DA I   9    11291   9118  11292   3631   -250   -506       N  
ATOM   1688  C2   DA I   9      20.509 125.838  -2.521  1.00 90.12           C  
ANISOU 1688  C2   DA I   9    11925  10035  12281   3741   -276   -901       C  
ATOM   1689  N3   DA I   9      20.574 125.631  -1.208  1.00 92.61           N  
ANISOU 1689  N3   DA I   9    11989  10655  12542   3574   -174  -1202       N  
ATOM   1690  C4   DA I   9      21.334 124.560  -0.932  1.00 88.53           C  
ANISOU 1690  C4   DA I   9    11459  10373  11806   3253    -43  -1048       C  
ATOM   1691  P    DA I  10      18.668 124.597   4.937  1.00 91.54           P  
ANISOU 1691  P    DA I  10    10340  12535  11905   3068    144  -2884       P  
ATOM   1692  OP1  DA I  10      18.401 125.438   6.126  1.00 85.05           O  
ANISOU 1692  OP1  DA I  10     9285  11843  11186   3137    174  -3358       O  
ATOM   1693  OP2  DA I  10      18.728 123.125   5.073  1.00 90.24           O  
ANISOU 1693  OP2  DA I  10    10096  12779  11412   2762    209  -2678       O  
ATOM   1694  O5'  DA I  10      17.591 124.957   3.815  1.00 95.06           O  
ANISOU 1694  O5'  DA I  10    10829  12826  12465   3437    -24  -2833       O  
ATOM   1695  C5'  DA I  10      17.557 126.270   3.275  1.00 95.72           C  
ANISOU 1695  C5'  DA I  10    11081  12414  12875   3753   -138  -2900       C  
ATOM   1696  C4'  DA I  10      16.567 126.361   2.130  1.00 93.76           C  
ANISOU 1696  C4'  DA I  10    10888  12057  12680   4063   -306  -2784       C  
ATOM   1697  O4'  DA I  10      17.195 125.919   0.898  1.00 88.16           O  
ANISOU 1697  O4'  DA I  10    10507  11058  11933   4003   -325  -2299       O  
ATOM   1698  C3'  DA I  10      15.305 125.519   2.293  1.00 95.04           C  
ANISOU 1698  C3'  DA I  10    10738  12760  12615   4099   -336  -2917       C  
ATOM   1699  O3'  DA I  10      14.190 126.265   1.836  1.00103.49           O  
ANISOU 1699  O3'  DA I  10    11731  13734  13857   4491   -508  -3110       O  
ATOM   1700  C2'  DA I  10      15.582 124.305   1.403  1.00 88.22           C  
ANISOU 1700  C2'  DA I  10    10036  11955  11530   3918   -323  -2467       C  
ATOM   1701  C1'  DA I  10      16.395 124.934   0.284  1.00 87.45           C  
ANISOU 1701  C1'  DA I  10    10339  11257  11632   4027   -382  -2143       C  
ATOM   1702  N9   DA I  10      17.281 124.000  -0.405  1.00 88.23           N  
ANISOU 1702  N9   DA I  10    10667  11292  11566   3788   -318  -1711       N  
ATOM   1703  C8   DA I  10      18.113 123.077   0.166  1.00 87.87           C  
ANISOU 1703  C8   DA I  10    10597  11465  11323   3427   -175  -1606       C  
ATOM   1704  N7   DA I  10      18.807 122.381  -0.705  1.00 86.23           N  
ANISOU 1704  N7   DA I  10    10622  11130  11011   3300   -160  -1217       N  
ATOM   1705  C5   DA I  10      18.407 122.888  -1.930  1.00 85.58           C  
ANISOU 1705  C5   DA I  10    10733  10733  11052   3586   -292  -1047       C  
ATOM   1706  C6   DA I  10      18.774 122.574  -3.255  1.00 85.36           C  
ANISOU 1706  C6   DA I  10    10986  10466  10982   3623   -342   -653       C  
ATOM   1707  N6   DA I  10      19.668 121.630  -3.569  1.00 84.16           N  
ANISOU 1707  N6   DA I  10    10961  10360  10656   3371   -261   -368       N  
ATOM   1708  N1   DA I  10      18.182 123.269  -4.249  1.00 88.90           N  
ANISOU 1708  N1   DA I  10    11576  10633  11569   3936   -489   -572       N  
ATOM   1709  C2   DA I  10      17.289 124.214  -3.931  1.00 91.13           C  
ANISOU 1709  C2   DA I  10    11727  10860  12039   4204   -591   -875       C  
ATOM   1710  N3   DA I  10      16.867 124.598  -2.729  1.00 90.80           N  
ANISOU 1710  N3   DA I  10    11410  11025  12063   4214   -558  -1277       N  
ATOM   1711  C4   DA I  10      17.471 123.890  -1.762  1.00 88.95           C  
ANISOU 1711  C4   DA I  10    11041  11085  11669   3887   -398  -1339       C  
ATOM   1712  P    DC I  11      12.688 125.761   2.097  1.00107.38           P  
ANISOU 1712  P    DC I  11    11842  14766  14191   4616   -565  -3373       P  
ATOM   1713  OP1  DC I  11      12.009 126.804   2.897  1.00109.47           O  
ANISOU 1713  OP1  DC I  11    11855  15099  14640   4865   -616  -3884       O  
ATOM   1714  OP2  DC I  11      12.718 124.367   2.592  1.00104.78           O  
ANISOU 1714  OP2  DC I  11    11343  14953  13515   4253   -433  -3264       O  
ATOM   1715  O5'  DC I  11      12.058 125.749   0.632  1.00112.12           O  
ANISOU 1715  O5'  DC I  11    12621  15122  14857   4894   -751  -3108       O  
ATOM   1716  C5'  DC I  11      12.589 126.614  -0.369  1.00111.67           C  
ANISOU 1716  C5'  DC I  11    12936  14442  15050   5092   -864  -2877       C  
ATOM   1717  C4'  DC I  11      12.197 126.131  -1.750  1.00105.10           C  
ANISOU 1717  C4'  DC I  11    12289  13491  14154   5218   -992  -2518       C  
ATOM   1718  O4'  DC I  11      13.268 125.326  -2.313  1.00102.88           O  
ANISOU 1718  O4'  DC I  11    12276  13098  13715   4932   -891  -2071       O  
ATOM   1719  C3'  DC I  11      10.942 125.258  -1.779  1.00 98.64           C  
ANISOU 1719  C3'  DC I  11    11169  13179  13131   5269  -1045  -2621       C  
ATOM   1720  O3'  DC I  11      10.078 125.688  -2.812  1.00 97.02           O  
ANISOU 1720  O3'  DC I  11    11038  12771  13054   5632  -1258  -2578       O  
ATOM   1721  C2'  DC I  11      11.487 123.854  -2.043  1.00 97.73           C  
ANISOU 1721  C2'  DC I  11    11132  13282  12720   4920   -935  -2257       C  
ATOM   1722  C1'  DC I  11      12.724 124.154  -2.871  1.00 95.92           C  
ANISOU 1722  C1'  DC I  11    11332  12526  12589   4867   -919  -1875       C  
ATOM   1723  N1   DC I  11      13.760 123.076  -2.817  1.00 84.54           N  
ANISOU 1723  N1   DC I  11    10002  11194  10923   4483   -768  -1577       N  
ATOM   1724  C2   DC I  11      14.283 122.556  -4.008  1.00 84.50           C  
ANISOU 1724  C2   DC I  11    10294  10973  10838   4444   -801  -1148       C  
ATOM   1725  O2   DC I  11      13.875 123.003  -5.085  1.00 91.97           O  
ANISOU 1725  O2   DC I  11    11412  11644  11887   4717   -950  -1007       O  
ATOM   1726  N3   DC I  11      15.223 121.578  -3.942  1.00 76.48           N  
ANISOU 1726  N3   DC I  11     9366  10061   9631   4113   -676   -908       N  
ATOM   1727  C4   DC I  11      15.632 121.126  -2.754  1.00 74.85           C  
ANISOU 1727  C4   DC I  11     8977  10144   9318   3825   -535  -1065       C  
ATOM   1728  N4   DC I  11      16.559 120.161  -2.733  1.00 71.65           N  
ANISOU 1728  N4   DC I  11     8668   9817   8737   3517   -439   -825       N  
ATOM   1729  C5   DC I  11      15.108 121.642  -1.532  1.00 77.70           C  
ANISOU 1729  C5   DC I  11     9044  10736   9742   3847   -494  -1483       C  
ATOM   1730  C6   DC I  11      14.185 122.606  -1.610  1.00 80.18           C  
ANISOU 1730  C6   DC I  11     9261  10960  10244   4181   -608  -1735       C  
ATOM   1731  P    DA I  12       8.488 125.544  -2.642  1.00101.17           P  
ANISOU 1731  P    DA I  12    11181  13720  13539   5869  -1376  -2911       P  
ATOM   1732  OP1  DA I  12       7.945 126.862  -2.243  1.00 99.41           O  
ANISOU 1732  OP1  DA I  12    10838  13326  13605   6210  -1494  -3325       O  
ATOM   1733  OP2  DA I  12       8.237 124.358  -1.795  1.00 99.47           O  
ANISOU 1733  OP2  DA I  12    10651  14123  13021   5548  -1222  -2998       O  
ATOM   1734  O5'  DA I  12       7.989 125.194  -4.117  1.00106.88           O  
ANISOU 1734  O5'  DA I  12    12101  14276  14232   6060  -1556  -2576       O  
ATOM   1735  C5'  DA I  12       8.802 125.530  -5.232  1.00105.98           C  
ANISOU 1735  C5'  DA I  12    12429  13621  14216   6113  -1622  -2173       C  
ATOM   1736  C4'  DA I  12       8.612 124.528  -6.354  1.00101.17           C  
ANISOU 1736  C4'  DA I  12    11956  13080  13406   6077  -1685  -1796       C  
ATOM   1737  O4'  DA I  12       9.715 123.584  -6.366  1.00 93.96           O  
ANISOU 1737  O4'  DA I  12    11198  12220  12282   5695  -1511  -1475       O  
ATOM   1738  C3'  DA I  12       7.336 123.698  -6.269  1.00106.10           C  
ANISOU 1738  C3'  DA I  12    12236  14217  13860   6125  -1749  -1956       C  
ATOM   1739  O3'  DA I  12       6.771 123.572  -7.567  1.00116.88           O  
ANISOU 1739  O3'  DA I  12    13760  15426  15223   6361  -1943  -1726       O  
ATOM   1740  C2'  DA I  12       7.825 122.356  -5.714  1.00 98.95           C  
ANISOU 1740  C2'  DA I  12    11223  13716  12657   5692  -1559  -1827       C  
ATOM   1741  C1'  DA I  12       9.227 122.260  -6.296  1.00 93.57           C  
ANISOU 1741  C1'  DA I  12    10947  12647  11960   5512  -1478  -1422       C  
ATOM   1742  N9   DA I  12      10.156 121.492  -5.470  1.00 90.15           N  
ANISOU 1742  N9   DA I  12    10475  12423  11354   5103  -1271  -1362       N  
ATOM   1743  C8   DA I  12      10.307 121.573  -4.116  1.00 89.83           C  
ANISOU 1743  C8   DA I  12    10191  12641  11299   4918  -1128  -1660       C  
ATOM   1744  N7   DA I  12      11.234 120.780  -3.636  1.00 83.16           N  
ANISOU 1744  N7   DA I  12     9385  11925  10285   4552   -972  -1511       N  
ATOM   1745  C5   DA I  12      11.731 120.136  -4.756  1.00 83.49           C  
ANISOU 1745  C5   DA I  12     9709  11781  10231   4501  -1015  -1100       C  
ATOM   1746  C6   DA I  12      12.737 119.164  -4.921  1.00 82.84           C  
ANISOU 1746  C6   DA I  12     9790  11713   9973   4192   -921   -795       C  
ATOM   1747  N6   DA I  12      13.444 118.663  -3.904  1.00 77.85           N  
ANISOU 1747  N6   DA I  12     9065  11283   9232   3860   -769   -848       N  
ATOM   1748  N1   DA I  12      12.988 118.728  -6.174  1.00 81.30           N  
ANISOU 1748  N1   DA I  12     9855  11321   9716   4246  -1002   -445       N  
ATOM   1749  C2   DA I  12      12.277 119.238  -7.188  1.00 82.06           C  
ANISOU 1749  C2   DA I  12    10050  11216   9912   4577  -1164   -387       C  
ATOM   1750  N3   DA I  12      11.307 120.153  -7.154  1.00 86.58           N  
ANISOU 1750  N3   DA I  12    10498  11739  10658   4885  -1276   -639       N  
ATOM   1751  C4   DA I  12      11.082 120.565  -5.897  1.00 86.05           C  
ANISOU 1751  C4   DA I  12    10164  11873  10659   4833  -1192  -1000       C  
ATOM   1752  P    DT I  13       5.489 122.641  -7.832  1.00118.27           P  
ANISOU 1752  P    DT I  13    13654  16062  15223   6427  -2047  -1793       P  
ATOM   1753  OP1  DT I  13       4.650 123.346  -8.827  1.00120.39           O  
ANISOU 1753  OP1  DT I  13    14047  16053  15643   6695  -2252  -1767       O  
ATOM   1754  OP2  DT I  13       4.889 122.238  -6.540  1.00121.17           O  
ANISOU 1754  OP2  DT I  13    13571  16979  15487   6270  -1932  -2170       O  
ATOM   1755  O5'  DT I  13       6.121 121.354  -8.535  1.00116.48           O  
ANISOU 1755  O5'  DT I  13    13630  15896  14734   6143  -1987  -1349       O  
ATOM   1756  C5'  DT I  13       7.086 121.530  -9.563  1.00112.67           C  
ANISOU 1756  C5'  DT I  13    13582  14952  14276   6150  -2008   -952       C  
ATOM   1757  C4'  DT I  13       7.562 120.196 -10.104  1.00106.44           C  
ANISOU 1757  C4'  DT I  13    12910  14314  13219   5884  -1954   -605       C  
ATOM   1758  O4'  DT I  13       8.542 119.618  -9.204  1.00103.72           O  
ANISOU 1758  O4'  DT I  13    12531  14124  12754   5496  -1736   -580       O  
ATOM   1759  C3'  DT I  13       6.473 119.144 -10.289  1.00103.10           C  
ANISOU 1759  C3'  DT I  13    12237  14322  12615   5883  -2052   -643       C  
ATOM   1760  O3'  DT I  13       6.652 118.505 -11.542  1.00 96.54           O  
ANISOU 1760  O3'  DT I  13    11672  13351  11659   5842  -2126   -278       O  
ATOM   1761  C2'  DT I  13       6.703 118.183  -9.117  1.00100.84           C  
ANISOU 1761  C2'  DT I  13    11693  14478  12145   5491  -1875   -752       C  
ATOM   1762  C1'  DT I  13       8.211 118.274  -8.939  1.00 98.04           C  
ANISOU 1762  C1'  DT I  13    11609  13853  11790   5256  -1708   -551       C  
ATOM   1763  N1   DT I  13       8.692 117.947  -7.559  1.00 91.06           N  
ANISOU 1763  N1   DT I  13    10521  13246  10830   4924  -1515   -727       N  
ATOM   1764  C2   DT I  13       9.704 117.027  -7.398  1.00 84.40           C  
ANISOU 1764  C2   DT I  13     9793  12459   9818   4579  -1396   -499       C  
ATOM   1765  O2   DT I  13      10.225 116.437  -8.327  1.00 83.42           O  
ANISOU 1765  O2   DT I  13     9915  12184   9599   4534  -1435   -173       O  
ATOM   1766  N3   DT I  13      10.084 116.814  -6.098  1.00 79.80           N  
ANISOU 1766  N3   DT I  13     9019  12125   9175   4295  -1238   -678       N  
ATOM   1767  C4   DT I  13       9.570 117.422  -4.968  1.00 86.01           C  
ANISOU 1767  C4   DT I  13     9514  13125  10040   4316  -1176  -1060       C  
ATOM   1768  O4   DT I  13       9.980 117.163  -3.840  1.00 86.66           O  
ANISOU 1768  O4   DT I  13     9446  13439  10041   4039  -1033  -1192       O  
ATOM   1769  C5   DT I  13       8.519 118.381  -5.206  1.00 91.96           C  
ANISOU 1769  C5   DT I  13    10150  13817  10974   4693  -1300  -1302       C  
ATOM   1770  C7   DT I  13       7.882 119.103  -4.055  1.00 96.24           C  
ANISOU 1770  C7   DT I  13    10360  14594  11612   4767  -1251  -1754       C  
ATOM   1771  C6   DT I  13       8.138 118.598  -6.475  1.00 93.32           C  
ANISOU 1771  C6   DT I  13    10513  13725  11219   4978  -1468  -1123       C  
ATOM   1772  P    DG I  14       5.426 117.762 -12.265  1.00 92.76           P  
ANISOU 1772  P    DG I  14    11079  13095  11072   5823  -2251   -262       P  
ATOM   1773  OP1  DG I  14       5.341 118.266 -13.653  1.00 88.58           O  
ANISOU 1773  OP1  DG I  14    10867  12164  10627   5890  -2332    -40       O  
ATOM   1774  OP2  DG I  14       4.245 117.846 -11.377  1.00 95.38           O  
ANISOU 1774  OP2  DG I  14    10989  13813  11439   5941  -2300   -651       O  
ATOM   1775  O5'  DG I  14       5.907 116.243 -12.313  1.00 91.05           O  
ANISOU 1775  O5'  DG I  14    10866  13138  10591   5513  -2191    -37       O  
ATOM   1776  C5'  DG I  14       7.253 115.947 -12.655  1.00 91.49           C  
ANISOU 1776  C5'  DG I  14    11221  12968  10572   5328  -2088    261       C  
ATOM   1777  C4'  DG I  14       7.670 114.610 -12.083  1.00 83.29           C  
ANISOU 1777  C4'  DG I  14    10060  12278   9310   5043  -2027    337       C  
ATOM   1778  O4'  DG I  14       8.021 114.768 -10.682  1.00 82.38           O  
ANISOU 1778  O4'  DG I  14     9736  12354   9212   4882  -1882    121       O  
ATOM   1779  C3'  DG I  14       6.581 113.529 -12.115  1.00 81.79           C  
ANISOU 1779  C3'  DG I  14     9628  12464   8983   4917  -2113    271       C  
ATOM   1780  O3'  DG I  14       7.176 112.259 -12.357  1.00 77.09           O  
ANISOU 1780  O3'  DG I  14     9136  11939   8214   4588  -2070    494       O  
ATOM   1781  C2'  DG I  14       6.029 113.604 -10.698  1.00 81.90           C  
ANISOU 1781  C2'  DG I  14     9229  12903   8988   4923  -2089    -55       C  
ATOM   1782  C1'  DG I  14       7.335 113.783  -9.955  1.00 84.48           C  
ANISOU 1782  C1'  DG I  14     9678  13095   9325   4671  -1886    -16       C  
ATOM   1783  N9   DG I  14       7.203 114.187  -8.558  1.00 86.32           N  
ANISOU 1783  N9   DG I  14     9633  13556   9607   4541  -1749   -334       N  
ATOM   1784  C8   DG I  14       6.290 115.057  -8.014  1.00 89.15           C  
ANISOU 1784  C8   DG I  14     9737  14032  10103   4745  -1766   -678       C  
ATOM   1785  N7   DG I  14       6.428 115.213  -6.724  1.00 88.84           N  
ANISOU 1785  N7   DG I  14     9477  14221  10058   4551  -1615   -922       N  
ATOM   1786  C5   DG I  14       7.497 114.387  -6.397  1.00 85.40           C  
ANISOU 1786  C5   DG I  14     9166  13809   9474   4191  -1499   -713       C  
ATOM   1787  C6   DG I  14       8.111 114.135  -5.146  1.00 82.00           C  
ANISOU 1787  C6   DG I  14     8611  13583   8961   3859  -1328   -819       C  
ATOM   1788  O6   DG I  14       7.822 114.607  -4.039  1.00 89.73           O  
ANISOU 1788  O6   DG I  14     9334  14787   9973   3809  -1231  -1132       O  
ATOM   1789  N1   DG I  14       9.162 113.228  -5.263  1.00 81.86           N  
ANISOU 1789  N1   DG I  14     8795  13499   8808   3571  -1281   -529       N  
ATOM   1790  C2   DG I  14       9.569 112.644  -6.440  1.00 82.85           C  
ANISOU 1790  C2   DG I  14     9197  13402   8881   3606  -1378   -197       C  
ATOM   1791  N2   DG I  14      10.601 111.793  -6.367  1.00 78.90           N  
ANISOU 1791  N2   DG I  14     8849  12874   8256   3318  -1324     23       N  
ATOM   1792  N3   DG I  14       9.003 112.873  -7.612  1.00 81.30           N  
ANISOU 1792  N3   DG I  14     9116  13030   8744   3911  -1527    -98       N  
ATOM   1793  C4   DG I  14       7.978 113.749  -7.515  1.00 84.45           C  
ANISOU 1793  C4   DG I  14     9331  13476   9278   4187  -1583   -360       C  
ATOM   1794  P    DC I  15       7.414 111.734 -13.858  1.00 71.91           P  
ANISOU 1794  P    DC I  15     8790  10983   7549   4452  -2080    759       P  
ATOM   1795  OP1  DC I  15       7.805 112.882 -14.706  1.00 69.18           O  
ANISOU 1795  OP1  DC I  15     8711  10224   7350   4639  -2066    851       O  
ATOM   1796  OP2  DC I  15       6.231 110.928 -14.233  1.00 72.06           O  
ANISOU 1796  OP2  DC I  15     8651  11207   7521   4391  -2185    705       O  
ATOM   1797  O5'  DC I  15       8.660 110.736 -13.717  1.00 68.16           O  
ANISOU 1797  O5'  DC I  15     8445  10500   6952   4111  -1973    947       O  
ATOM   1798  C5'  DC I  15       9.820 111.128 -12.963  1.00 74.80           C  
ANISOU 1798  C5'  DC I  15     9355  11285   7782   4084  -1863    980       C  
ATOM   1799  C4'  DC I  15      10.490 109.933 -12.289  1.00 77.48           C  
ANISOU 1799  C4'  DC I  15     9634  11833   7972   3741  -1808   1042       C  
ATOM   1800  O4'  DC I  15      10.270 110.002 -10.855  1.00 82.03           O  
ANISOU 1800  O4'  DC I  15     9917  12782   8470   3748  -1811    861       O  
ATOM   1801  C3'  DC I  15       9.949 108.568 -12.675  1.00 83.40           C  
ANISOU 1801  C3'  DC I  15    10318  12715   8654   3476  -1872   1081       C  
ATOM   1802  O3'  DC I  15      10.884 107.566 -12.282  1.00 85.33           O  
ANISOU 1802  O3'  DC I  15    10610  12990   8824   3139  -1810   1175       O  
ATOM   1803  C2'  DC I  15       8.731 108.504 -11.774  1.00 88.11           C  
ANISOU 1803  C2'  DC I  15    10568  13712   9196   3541  -1953    870       C  
ATOM   1804  C1'  DC I  15       9.366 108.973 -10.475  1.00 83.86           C  
ANISOU 1804  C1'  DC I  15     9899  13364   8598   3547  -1881    776       C  
ATOM   1805  N1   DC I  15       8.413 109.537  -9.493  1.00 82.92           N  
ANISOU 1805  N1   DC I  15     9430  13578   8497   3664  -1896    488       N  
ATOM   1806  C2   DC I  15       8.662 109.380  -8.128  1.00 84.33           C  
ANISOU 1806  C2   DC I  15     9410  14001   8632   3365  -1756    329       C  
ATOM   1807  O2   DC I  15       9.666 108.754  -7.772  1.00 86.11           O  
ANISOU 1807  O2   DC I  15     9743  14204   8769   3086  -1685    464       O  
ATOM   1808  N3   DC I  15       7.793 109.915  -7.238  1.00 87.67           N  
ANISOU 1808  N3   DC I  15     9520  14689   9103   3394  -1708     22       N  
ATOM   1809  C4   DC I  15       6.725 110.585  -7.670  1.00 85.18           C  
ANISOU 1809  C4   DC I  15     9087  14385   8892   3715  -1800   -132       C  
ATOM   1810  N4   DC I  15       5.894 111.097  -6.758  1.00 88.36           N  
ANISOU 1810  N4   DC I  15     9161  15073   9340   3744  -1749   -461       N  
ATOM   1811  C5   DC I  15       6.454 110.748  -9.054  1.00 87.34           C  
ANISOU 1811  C5   DC I  15     9569  14393   9223   4025  -1957     34       C  
ATOM   1812  C6   DC I  15       7.322 110.225  -9.924  1.00 87.66           C  
ANISOU 1812  C6   DC I  15     9924  14183   9201   3984  -1994    345       C  
ATOM   1813  P    DC I  16      12.123 107.146 -13.215  1.00 87.30           P  
ANISOU 1813  P    DC I  16    11146  12902   9123   2955  -1737   1358       P  
ATOM   1814  OP1  DC I  16      13.007 108.320 -13.390  1.00 85.79           O  
ANISOU 1814  OP1  DC I  16    11135  12476   8985   3135  -1636   1420       O  
ATOM   1815  OP2  DC I  16      11.576 106.448 -14.399  1.00 89.33           O  
ANISOU 1815  OP2  DC I  16    11458  13052   9430   2882  -1817   1408       O  
ATOM   1816  O5'  DC I  16      12.899 106.069 -12.320  1.00 82.65           O  
ANISOU 1816  O5'  DC I  16    10508  12435   8459   2606  -1702   1375       O  
ATOM   1817  C5'  DC I  16      13.390 106.440 -11.029  1.00 77.14           C  
ANISOU 1817  C5'  DC I  16     9710  11921   7678   2588  -1635   1320       C  
ATOM   1818  C4'  DC I  16      12.953 105.451  -9.956  1.00 71.11           C  
ANISOU 1818  C4'  DC I  16     8720  11482   6817   2315  -1683   1237       C  
ATOM   1819  O4'  DC I  16      11.666 105.851  -9.400  1.00 72.53           O  
ANISOU 1819  O4'  DC I  16     8624  11995   6940   2470  -1745   1078       O  
ATOM   1820  C3'  DC I  16      12.761 104.007 -10.421  1.00 68.47           C  
ANISOU 1820  C3'  DC I  16     8430  11061   6524   2022  -1767   1287       C  
ATOM   1821  O3'  DC I  16      13.120 103.122  -9.364  1.00 69.73           O  
ANISOU 1821  O3'  DC I  16     8511  11357   6625   1704  -1763   1263       O  
ATOM   1822  C2'  DC I  16      11.257 103.965 -10.662  1.00 69.60           C  
ANISOU 1822  C2'  DC I  16     8401  11381   6662   2144  -1868   1205       C  
ATOM   1823  C1'  DC I  16      10.800 104.737  -9.443  1.00 68.07           C  
ANISOU 1823  C1'  DC I  16     7943  11556   6362   2256  -1834   1057       C  
ATOM   1824  N1   DC I  16       9.388 105.217  -9.498  1.00 68.71           N  
ANISOU 1824  N1   DC I  16     7804  11865   6439   2484  -1909    915       N  
ATOM   1825  C2   DC I  16       8.758 105.626  -8.318  1.00 80.15           C  
ANISOU 1825  C2   DC I  16     8926  13736   7794   2506  -1900    719       C  
ATOM   1826  O2   DC I  16       9.390 105.583  -7.257  1.00 87.65           O  
ANISOU 1826  O2   DC I  16     9787  14864   8653   2319  -1826    682       O  
ATOM   1827  N3   DC I  16       7.475 106.063  -8.376  1.00 82.85           N  
ANISOU 1827  N3   DC I  16     9041  14285   8153   2716  -1969    553       N  
ATOM   1828  C4   DC I  16       6.834 106.096  -9.545  1.00 77.65           C  
ANISOU 1828  C4   DC I  16     8498  13414   7593   2897  -2050    601       C  
ATOM   1829  N4   DC I  16       5.571 106.534  -9.556  1.00 82.02           N  
ANISOU 1829  N4   DC I  16     8820  14173   8173   3101  -2119    420       N  
ATOM   1830  C5   DC I  16       7.456 105.669 -10.754  1.00 69.05           C  
ANISOU 1830  C5   DC I  16     7746  11908   6583   2855  -2059    814       C  
ATOM   1831  C6   DC I  16       8.723 105.246 -10.686  1.00 65.79           C  
ANISOU 1831  C6   DC I  16     7530  11308   6161   2648  -1985    953       C  
ATOM   1832  P    DT I  17      14.589 102.477  -9.279  1.00 66.59           P  
ANISOU 1832  P    DT I  17     7595  11770   5938    571  -2812    811       P  
ATOM   1833  OP1  DT I  17      15.585 103.527  -9.593  1.00 63.51           O  
ANISOU 1833  OP1  DT I  17     7504  11121   5507    706  -2743   1000       O  
ATOM   1834  OP2  DT I  17      14.567 101.223 -10.066  1.00 68.30           O  
ANISOU 1834  OP2  DT I  17     7925  12011   6015    524  -2955    685       O  
ATOM   1835  O5'  DT I  17      14.736 102.097  -7.733  1.00 64.14           O  
ANISOU 1835  O5'  DT I  17     7338  11319   5714    370  -2316    789       O  
ATOM   1836  C5'  DT I  17      14.971 103.126  -6.775  1.00 63.55           C  
ANISOU 1836  C5'  DT I  17     7215  11219   5711    389  -2093    911       C  
ATOM   1837  C4'  DT I  17      14.053 102.982  -5.572  1.00 59.62           C  
ANISOU 1837  C4'  DT I  17     6465  10579   5608    179  -1771    714       C  
ATOM   1838  O4'  DT I  17      12.685 103.280  -5.952  1.00 64.34           O  
ANISOU 1838  O4'  DT I  17     6666  11134   6645    162  -1976    486       O  
ATOM   1839  C3'  DT I  17      14.031 101.593  -4.927  1.00 58.01           C  
ANISOU 1839  C3'  DT I  17     6380  10277   5386    -45  -1478    603       C  
ATOM   1840  O3'  DT I  17      14.167 101.724  -3.525  1.00 56.86           O  
ANISOU 1840  O3'  DT I  17     6238  10061   5305   -181  -1062    630       O  
ATOM   1841  C2'  DT I  17      12.656 101.040  -5.310  1.00 68.66           C  
ANISOU 1841  C2'  DT I  17     7411  11548   7129   -155  -1616    307       C  
ATOM   1842  C1'  DT I  17      11.825 102.309  -5.403  1.00 73.94           C  
ANISOU 1842  C1'  DT I  17     7732  12226   8134    -64  -1779    243       C  
ATOM   1843  N1   DT I  17      10.625 102.196  -6.291  1.00 83.73           N  
ANISOU 1843  N1   DT I  17     8664  13450   9698    -55  -2102     12       N  
ATOM   1844  C2   DT I  17       9.405 102.652  -5.839  1.00 89.93           C  
ANISOU 1844  C2   DT I  17     9057  14146  10965   -140  -2058   -195       C  
ATOM   1845  O2   DT I  17       9.239 103.132  -4.731  1.00 95.86           O  
ANISOU 1845  O2   DT I  17     9695  14836  11893   -229  -1758   -209       O  
ATOM   1846  N3   DT I  17       8.377 102.518  -6.736  1.00 89.00           N  
ANISOU 1846  N3   DT I  17     8678  14021  11119   -117  -2382   -398       N  
ATOM   1847  C4   DT I  17       8.442 101.992  -8.012  1.00 86.82           C  
ANISOU 1847  C4   DT I  17     8490  13827  10672    -20  -2738   -416       C  
ATOM   1848  O4   DT I  17       7.458 101.915  -8.742  1.00 88.63           O  
ANISOU 1848  O4   DT I  17     8458  14048  11170     -6  -3018   -612       O  
ATOM   1849  C5   DT I  17       9.749 101.537  -8.425  1.00 81.25           C  
ANISOU 1849  C5   DT I  17     8198  13220   9451     64  -2759   -198       C  
ATOM   1850  C7   DT I  17       9.941 100.940  -9.787  1.00 75.56           C  
ANISOU 1850  C7   DT I  17     7602  12610   8499    170  -3125   -213       C  
ATOM   1851  C6   DT I  17      10.766 101.666  -7.558  1.00 84.42           C  
ANISOU 1851  C6   DT I  17     8860  13621   9596     44  -2445      5       C  
ATOM   1852  P    DT I  18      14.619 100.476  -2.621  1.00 63.14           P  
ANISOU 1852  P    DT I  18     7262  10775   5954   -387   -686    638       P  
ATOM   1853  OP1  DT I  18      15.856 100.861  -1.904  1.00 52.75           O  
ANISOU 1853  OP1  DT I  18     6233   9509   4301   -338   -454    887       O  
ATOM   1854  OP2  DT I  18      14.608  99.266  -3.472  1.00 65.72           O  
ANISOU 1854  OP2  DT I  18     7707  11083   6180   -421   -855    559       O  
ATOM   1855  O5'  DT I  18      13.425 100.332  -1.569  1.00 71.39           O  
ANISOU 1855  O5'  DT I  18     7982  11699   7444   -611   -406    412       O  
ATOM   1856  C5'  DT I  18      12.746 101.492  -1.117  1.00 58.82           C  
ANISOU 1856  C5'  DT I  18     6083  10108   6158   -587   -376    340       C  
ATOM   1857  C4'  DT I  18      11.346 101.147  -0.649  1.00 61.81           C  
ANISOU 1857  C4'  DT I  18     6102  10374   7009   -783   -257     55       C  
ATOM   1858  O4'  DT I  18      10.426 101.177  -1.769  1.00 67.03           O  
ANISOU 1858  O4'  DT I  18     6521  11026   7919   -714   -637   -119       O  
ATOM   1859  C3'  DT I  18      11.196  99.767  -0.006  1.00 69.19           C  
ANISOU 1859  C3'  DT I  18     7121  11208   7959  -1025     36    -29       C  
ATOM   1860  O3'  DT I  18      10.521  99.906   1.236  1.00 71.72           O  
ANISOU 1860  O3'  DT I  18     7221  11464   8566  -1211    388   -148       O  
ATOM   1861  C2'  DT I  18      10.367  98.975  -1.029  1.00 68.22           C  
ANISOU 1861  C2'  DT I  18     6855  11030   8035  -1051   -247   -231       C  
ATOM   1862  C1'  DT I  18       9.549 100.082  -1.669  1.00 70.18           C  
ANISOU 1862  C1'  DT I  18     6779  11315   8569   -911   -555   -344       C  
ATOM   1863  N1   DT I  18       9.028  99.771  -3.038  1.00 70.65           N  
ANISOU 1863  N1   DT I  18     6740  11391   8712   -817   -978   -469       N  
ATOM   1864  C2   DT I  18       7.695  99.990  -3.309  1.00 76.87           C  
ANISOU 1864  C2   DT I  18     7134  12121   9952   -855  -1132   -722       C  
ATOM   1865  O2   DT I  18       6.907 100.407  -2.480  1.00 82.55           O  
ANISOU 1865  O2   DT I  18     7576  12772  11017   -968   -932   -856       O  
ATOM   1866  N3   DT I  18       7.313  99.697  -4.591  1.00 77.59           N  
ANISOU 1866  N3   DT I  18     7161  12244  10076   -758  -1531   -823       N  
ATOM   1867  C4   DT I  18       8.113  99.220  -5.613  1.00 78.16           C  
ANISOU 1867  C4   DT I  18     7516  12408   9775   -631  -1782   -704       C  
ATOM   1868  O4   DT I  18       7.675  98.987  -6.735  1.00 85.22           O  
ANISOU 1868  O4   DT I  18     8318  13341  10721   -551  -2138   -819       O  
ATOM   1869  C5   DT I  18       9.502  99.018  -5.267  1.00 69.78           C  
ANISOU 1869  C5   DT I  18     6859  11400   8256   -598  -1596   -442       C  
ATOM   1870  C7   DT I  18      10.463  98.499  -6.297  1.00 67.82           C  
ANISOU 1870  C7   DT I  18     6932  11252   7582   -466  -1833   -308       C  
ATOM   1871  C6   DT I  18       9.891  99.304  -4.011  1.00 67.35           C  
ANISOU 1871  C6   DT I  18     6620  11054   7917   -690  -1211   -335       C  
ATOM   1872  P    DT I  19      10.350  98.653   2.224  1.00 72.09           P  
ANISOU 1872  P    DT I  19     7328  11409   8656  -1486    779   -207       P  
ATOM   1873  OP1  DT I  19      10.452  99.163   3.610  1.00 78.97           O  
ANISOU 1873  OP1  DT I  19     8157  12298   9550  -1592   1172   -161       O  
ATOM   1874  OP2  DT I  19      11.256  97.577   1.767  1.00 77.38           O  
ANISOU 1874  OP2  DT I  19     8357  12070   8974  -1479    735    -68       O  
ATOM   1875  O5'  DT I  19       8.847  98.186   1.965  1.00 71.17           O  
ANISOU 1875  O5'  DT I  19     6835  11182   9024  -1625    697   -518       O  
ATOM   1876  C5'  DT I  19       7.824  99.161   1.834  1.00 77.34           C  
ANISOU 1876  C5'  DT I  19     7233  11965  10186  -1578    560   -698       C  
ATOM   1877  C4'  DT I  19       6.475  98.501   1.641  1.00 87.93           C  
ANISOU 1877  C4'  DT I  19     8254  13190  11966  -1734    515   -991       C  
ATOM   1878  O4'  DT I  19       6.167  98.406   0.225  1.00 95.00           O  
ANISOU 1878  O4'  DT I  19     9090  14095  12912  -1588     62  -1075       O  
ATOM   1879  C3'  DT I  19       6.368  97.083   2.196  1.00 93.48           C  
ANISOU 1879  C3'  DT I  19     9050  13786  12681  -1975    797  -1039       C  
ATOM   1880  O3'  DT I  19       5.107  96.921   2.818  1.00100.03           O  
ANISOU 1880  O3'  DT I  19     9521  14519  13968  -2174    983  -1287       O  
ATOM   1881  C2'  DT I  19       6.500  96.211   0.945  1.00 98.34           C  
ANISOU 1881  C2'  DT I  19     9796  14376  13192  -1903    466  -1066       C  
ATOM   1882  C1'  DT I  19       5.809  97.079  -0.091  1.00 98.61           C  
ANISOU 1882  C1'  DT I  19     9567  14457  13445  -1725     52  -1202       C  
ATOM   1883  N1   DT I  19       6.227  96.810  -1.496  1.00 99.46           N  
ANISOU 1883  N1   DT I  19     9835  14624  13333  -1545   -364  -1159       N  
ATOM   1884  C2   DT I  19       5.290  96.898  -2.497  1.00109.11           C  
ANISOU 1884  C2   DT I  19    10788  15835  14832  -1478   -722  -1368       C  
ATOM   1885  O2   DT I  19       4.121  97.173  -2.293  1.00115.22           O  
ANISOU 1885  O2   DT I  19    11197  16541  16040  -1559   -718  -1591       O  
ATOM   1886  N3   DT I  19       5.766  96.646  -3.754  1.00105.57           N  
ANISOU 1886  N3   DT I  19    10512  15466  14135  -1312  -1090  -1315       N  
ATOM   1887  C4   DT I  19       7.063  96.325  -4.107  1.00 99.40           C  
ANISOU 1887  C4   DT I  19    10131  14767  12871  -1210  -1129  -1082       C  
ATOM   1888  O4   DT I  19       7.392  96.117  -5.271  1.00100.97           O  
ANISOU 1888  O4   DT I  19    10448  15045  12870  -1065  -1469  -1062       O  
ATOM   1889  C5   DT I  19       8.002  96.252  -3.009  1.00 91.80           C  
ANISOU 1889  C5   DT I  19     9432  13797  11652  -1286   -744   -871       C  
ATOM   1890  C7   DT I  19       9.440  95.910  -3.269  1.00 83.93           C  
ANISOU 1890  C7   DT I  19     8869  12877  10143  -1186   -750   -616       C  
ATOM   1891  C6   DT I  19       7.544  96.498  -1.769  1.00 92.72           C  
ANISOU 1891  C6   DT I  19     9387  13842  12001  -1447   -387   -916       C  
ATOM   1892  P    DT I  20       4.826  95.670   3.783  1.00101.84           P  
ANISOU 1892  P    DT I  20     9770  14633  14293  -2468   1384  -1340       P  
ATOM   1893  OP1  DT I  20       4.346  96.206   5.076  1.00108.17           O  
ANISOU 1893  OP1  DT I  20    10365  15441  15293  -2618   1755  -1399       O  
ATOM   1894  OP2  DT I  20       6.008  94.780   3.749  1.00 99.68           O  
ANISOU 1894  OP2  DT I  20     9918  14362  13593  -2470   1456  -1109       O  
ATOM   1895  O5'  DT I  20       3.622  94.917   3.058  1.00106.25           O  
ANISOU 1895  O5'  DT I  20    10048  15066  15255  -2557   1187  -1625       O  
ATOM   1896  C5'  DT I  20       2.718  95.655   2.249  1.00113.97           C  
ANISOU 1896  C5'  DT I  20    10704  16052  16547  -2437    849  -1827       C  
ATOM   1897  C4'  DT I  20       1.755  94.722   1.545  1.00123.44           C  
ANISOU 1897  C4'  DT I  20    11705  17132  18066  -2527    671  -2075       C  
ATOM   1898  O4'  DT I  20       2.101  94.626   0.139  1.00124.10           O  
ANISOU 1898  O4'  DT I  20    11913  17266  17975  -2322    221  -2054       O  
ATOM   1899  C3'  DT I  20       1.744  93.295   2.084  1.00126.49           C  
ANISOU 1899  C3'  DT I  20    12197  17393  18469  -2766    959  -2090       C  
ATOM   1900  O3'  DT I  20       0.408  92.819   2.144  1.00127.96           O  
ANISOU 1900  O3'  DT I  20    12021  17450  19148  -2938    994  -2383       O  
ATOM   1901  C2'  DT I  20       2.589  92.525   1.067  1.00126.48           C  
ANISOU 1901  C2'  DT I  20    12514  17405  18140  -2650    698  -1978       C  
ATOM   1902  C1'  DT I  20       2.291  93.275  -0.223  1.00124.94           C  
ANISOU 1902  C1'  DT I  20    12183  17290  17999  -2414    211  -2076       C  
ATOM   1903  N1   DT I  20       3.398  93.219  -1.223  1.00121.00           N  
ANISOU 1903  N1   DT I  20    12021  16896  17058  -2202    -85  -1891       N  
ATOM   1904  C2   DT I  20       3.092  93.281  -2.560  1.00118.88           C  
ANISOU 1904  C2   DT I  20    11666  16672  16832  -2042   -535  -2011       C  
ATOM   1905  O2   DT I  20       1.952  93.369  -2.980  1.00119.45           O  
ANISOU 1905  O2   DT I  20    11398  16695  17292  -2063   -714  -2263       O  
ATOM   1906  N3   DT I  20       4.171  93.233  -3.399  1.00117.46           N  
ANISOU 1906  N3   DT I  20    11809  16602  16218  -1858   -770  -1828       N  
ATOM   1907  C4   DT I  20       5.503  93.133  -3.044  1.00114.49           C  
ANISOU 1907  C4   DT I  20    11823  16285  15391  -1815   -607  -1546       C  
ATOM   1908  O4   DT I  20       6.402  93.097  -3.881  1.00110.07           O  
ANISOU 1908  O4   DT I  20    11528  15828  14467  -1645   -842  -1406       O  
ATOM   1909  C5   DT I  20       5.759  93.076  -1.623  1.00119.00           C  
ANISOU 1909  C5   DT I  20    12467  16799  15950  -1985   -140  -1432       C  
ATOM   1910  C7   DT I  20       7.166  92.969  -1.113  1.00119.42           C  
ANISOU 1910  C7   DT I  20    12928  16907  15538  -1954     66  -1131       C  
ATOM   1911  C6   DT I  20       4.705  93.123  -0.790  1.00120.87           C  
ANISOU 1911  C6   DT I  20    12390  16939  16596  -2169     96  -1606       C  
ATOM   1912  P    DG I  21       0.094  91.335   2.671  1.00122.33           P  
ANISOU 1912  P    DG I  21    11321  16576  18582  -3211   1280  -2453       P  
ATOM   1913  OP1  DG I  21      -1.206  91.387   3.376  1.00125.58           O  
ANISOU 1913  OP1  DG I  21    11331  16897  19487  -3411   1498  -2696       O  
ATOM   1914  OP2  DG I  21       1.289  90.822   3.378  1.00117.23           O  
ANISOU 1914  OP2  DG I  21    11067  15952  17522  -3269   1569  -2164       O  
ATOM   1915  O5'  DG I  21      -0.095  90.504   1.322  1.00124.38           O  
ANISOU 1915  O5'  DG I  21    11589  16772  18898  -3136    890  -2590       O  
ATOM   1916  C5'  DG I  21      -0.882  91.052   0.277  1.00128.68           C  
ANISOU 1916  C5'  DG I  21    11864  17342  19689  -2990    482  -2806       C  
ATOM   1917  C4'  DG I  21      -0.944  90.111  -0.911  1.00132.98           C  
ANISOU 1917  C4'  DG I  21    12456  17835  20237  -2940    154  -2923       C  
ATOM   1918  O4'  DG I  21       0.120  90.422  -1.844  1.00131.45           O  
ANISOU 1918  O4'  DG I  21    12564  17782  19598  -2693   -159  -2739       O  
ATOM   1919  C3'  DG I  21      -0.810  88.624  -0.577  1.00135.74           C  
ANISOU 1919  C3'  DG I  21    12935  18035  20604  -3149    384  -2929       C  
ATOM   1920  O3'  DG I  21      -1.855  87.909  -1.229  1.00138.81           O  
ANISOU 1920  O3'  DG I  21    13048  18303  21390  -3224    199  -3232       O  
ATOM   1921  C2'  DG I  21       0.579  88.256  -1.121  1.00132.35           C  
ANISOU 1921  C2'  DG I  21    12944  17685  19659  -3005    257  -2686       C  
ATOM   1922  C1'  DG I  21       0.724  89.229  -2.278  1.00131.07           C  
ANISOU 1922  C1'  DG I  21    12769  17682  19348  -2724   -197  -2695       C  
ATOM   1923  N9   DG I  21       2.107  89.533  -2.642  1.00128.03           N  
ANISOU 1923  N9   DG I  21    12776  17439  18430  -2533   -305  -2414       N  
ATOM   1924  C8   DG I  21       3.158  89.787  -1.792  1.00125.00           C  
ANISOU 1924  C8   DG I  21    12686  17107  17700  -2536    -20  -2126       C  
ATOM   1925  N7   DG I  21       4.277  90.048  -2.414  1.00121.60           N  
ANISOU 1925  N7   DG I  21    12566  16804  16831  -2338   -213  -1925       N  
ATOM   1926  C5   DG I  21       3.943  89.970  -3.761  1.00123.05           C  
ANISOU 1926  C5   DG I  21    12658  17033  17061  -2195   -652  -2085       C  
ATOM   1927  C6   DG I  21       4.744  90.157  -4.916  1.00120.90           C  
ANISOU 1927  C6   DG I  21    12606  16904  16426  -1964  -1013  -1985       C  
ATOM   1928  O6   DG I  21       5.949  90.438  -4.979  1.00117.85           O  
ANISOU 1928  O6   DG I  21    12550  16625  15601  -1835  -1013  -1728       O  
ATOM   1929  N1   DG I  21       4.007  89.985  -6.088  1.00124.14           N  
ANISOU 1929  N1   DG I  21    12811  17333  17022  -1886  -1403  -2222       N  
ATOM   1930  C2   DG I  21       2.668  89.673  -6.135  1.00128.88           C  
ANISOU 1930  C2   DG I  21    13038  17818  18112  -2012  -1443  -2523       C  
ATOM   1931  N2   DG I  21       2.121  89.546  -7.352  1.00131.16           N  
ANISOU 1931  N2   DG I  21    13171  18153  18512  -1906  -1853  -2727       N  
ATOM   1932  N3   DG I  21       1.911  89.496  -5.062  1.00130.58           N  
ANISOU 1932  N3   DG I  21    13043  17889  18684  -2229  -1104  -2620       N  
ATOM   1933  C4   DG I  21       2.611  89.659  -3.915  1.00127.34           C  
ANISOU 1933  C4   DG I  21    12829  17468  18085  -2311   -718  -2387       C  
ATOM   1934  P    DA I  22      -1.962  86.308  -1.137  1.00145.57           P  
ANISOU 1934  P    DA I  22    13956  18976  22378  -3432    351  -3313       P  
ATOM   1935  OP1  DA I  22      -3.401  85.989  -0.997  1.00144.41           O  
ANISOU 1935  OP1  DA I  22    13386  18685  22796  -3605    398  -3628       O  
ATOM   1936  OP2  DA I  22      -1.006  85.806  -0.125  1.00146.30           O  
ANISOU 1936  OP2  DA I  22    14366  19039  22182  -3556    745  -3036       O  
ATOM   1937  O5'  DA I  22      -1.480  85.834  -2.584  1.00139.59           O  
ANISOU 1937  O5'  DA I  22    13361  18268  21408  -3245    -93  -3357       O  
ATOM   1938  C5'  DA I  22      -1.684  86.697  -3.698  1.00135.92           C  
ANISOU 1938  C5'  DA I  22    12790  17945  20908  -3006   -540  -3451       C  
ATOM   1939  C4'  DA I  22      -1.304  86.019  -5.001  1.00133.58           C  
ANISOU 1939  C4'  DA I  22    12633  17684  20437  -2874   -917  -3523       C  
ATOM   1940  O4'  DA I  22      -0.019  86.515  -5.459  1.00131.53           O  
ANISOU 1940  O4'  DA I  22    12735  17602  19640  -2658  -1071  -3256       O  
ATOM   1941  C3'  DA I  22      -1.179  84.502  -4.937  1.00131.66           C  
ANISOU 1941  C3'  DA I  22    12487  17274  20262  -3047   -778  -3588       C  
ATOM   1942  O3'  DA I  22      -1.688  83.940  -6.136  1.00132.61           O  
ANISOU 1942  O3'  DA I  22    12465  17380  20542  -2984  -1153  -3854       O  
ATOM   1943  C2'  DA I  22       0.329  84.287  -4.802  1.00129.23           C  
ANISOU 1943  C2'  DA I  22    12639  17038  19423  -2975   -678  -3270       C  
ATOM   1944  C1'  DA I  22       0.885  85.443  -5.624  1.00127.80           C  
ANISOU 1944  C1'  DA I  22    12573  17086  18898  -2689  -1019  -3155       C  
ATOM   1945  N9   DA I  22       2.202  85.897  -5.187  1.00121.65           N  
ANISOU 1945  N9   DA I  22    12167  16417  17637  -2597   -870  -2811       N  
ATOM   1946  C8   DA I  22       2.610  86.130  -3.902  1.00119.62           C  
ANISOU 1946  C8   DA I  22    12028  16127  17295  -2712   -456  -2597       C  
ATOM   1947  N7   DA I  22       3.852  86.547  -3.807  1.00116.56           N  
ANISOU 1947  N7   DA I  22    11985  15862  16443  -2582   -424  -2310       N  
ATOM   1948  C5   DA I  22       4.285  86.602  -5.122  1.00115.99           C  
ANISOU 1948  C5   DA I  22    12028  15911  16133  -2369   -839  -2333       C  
ATOM   1949  C6   DA I  22       5.515  86.971  -5.702  1.00111.94           C  
ANISOU 1949  C6   DA I  22    11848  15559  15124  -2160  -1013  -2111       C  
ATOM   1950  N6   DA I  22       6.576  87.372  -4.992  1.00108.71           N  
ANISOU 1950  N6   DA I  22    11728  15207  14369  -2127   -783  -1814       N  
ATOM   1951  N1   DA I  22       5.614  86.913  -7.046  1.00110.52           N  
ANISOU 1951  N1   DA I  22    11691  15487  14816  -1986  -1433  -2209       N  
ATOM   1952  C2   DA I  22       4.552  86.511  -7.755  1.00112.15           C  
ANISOU 1952  C2   DA I  22    11602  15642  15366  -2016  -1669  -2515       C  
ATOM   1953  N3   DA I  22       3.347  86.140  -7.324  1.00114.37           N  
ANISOU 1953  N3   DA I  22    11553  15766  16135  -2201  -1547  -2750       N  
ATOM   1954  C4   DA I  22       3.279  86.209  -5.986  1.00117.58           C  
ANISOU 1954  C4   DA I  22    11947  16067  16660  -2375  -1120  -2640       C  
ATOM   1955  P    DT I  23      -1.898  82.354  -6.280  1.00129.82           P  
ANISOU 1955  P    DT I  23    12095  16830  20401  -3161  -1089  -4029       P  
ATOM   1956  OP1  DT I  23      -3.257  82.134  -6.823  1.00126.26           O  
ANISOU 1956  OP1  DT I  23    11233  16295  20446  -3213  -1295  -4398       O  
ATOM   1957  OP2  DT I  23      -1.509  81.708  -5.006  1.00130.29           O  
ANISOU 1957  OP2  DT I  23    12304  16740  20460  -3383   -603  -3846       O  
ATOM   1958  O5'  DT I  23      -0.831  81.946  -7.396  1.00129.64           O  
ANISOU 1958  O5'  DT I  23    12388  16924  19944  -2972  -1403  -3959       O  
ATOM   1959  C5'  DT I  23      -0.687  82.754  -8.558  1.00127.94           C  
ANISOU 1959  C5'  DT I  23    12181  16924  19506  -2711  -1846  -3991       C  
ATOM   1960  C4'  DT I  23       0.464  82.264  -9.414  1.00124.74           C  
ANISOU 1960  C4'  DT I  23    12117  16624  18653  -2566  -2054  -3889       C  
ATOM   1961  O4'  DT I  23       1.695  82.924  -9.011  1.00121.49           O  
ANISOU 1961  O4'  DT I  23    12057  16340  17762  -2457  -1924  -3531       O  
ATOM   1962  C3'  DT I  23       0.737  80.762  -9.322  1.00124.09           C  
ANISOU 1962  C3'  DT I  23    12145  16362  18640  -2726  -1907  -3962       C  
ATOM   1963  O3'  DT I  23       1.005  80.248 -10.613  1.00121.41           O  
ANISOU 1963  O3'  DT I  23    11870  16111  18149  -2590  -2286  -4116       O  
ATOM   1964  C2'  DT I  23       1.971  80.692  -8.425  1.00122.44           C  
ANISOU 1964  C2'  DT I  23    12314  16143  18066  -2764  -1568  -3606       C  
ATOM   1965  C1'  DT I  23       2.702  81.954  -8.845  1.00121.02           C  
ANISOU 1965  C1'  DT I  23    12316  16215  17451  -2513  -1767  -3395       C  
ATOM   1966  N1   DT I  23       3.681  82.446  -7.835  1.00119.14           N  
ANISOU 1966  N1   DT I  23    12364  16008  16894  -2520  -1442  -3041       N  
ATOM   1967  C2   DT I  23       4.930  82.850  -8.251  1.00115.17           C  
ANISOU 1967  C2   DT I  23    12204  15676  15878  -2329  -1562  -2804       C  
ATOM   1968  O2   DT I  23       5.286  82.830  -9.416  1.00113.14           O  
ANISOU 1968  O2   DT I  23    12032  15555  15399  -2154  -1918  -2864       O  
ATOM   1969  N3   DT I  23       5.754  83.285  -7.247  1.00113.25           N  
ANISOU 1969  N3   DT I  23    12199  15448  15384  -2350  -1246  -2496       N  
ATOM   1970  C4   DT I  23       5.462  83.354  -5.897  1.00113.37           C  
ANISOU 1970  C4   DT I  23    12144  15339  15590  -2540   -831  -2403       C  
ATOM   1971  O4   DT I  23       6.273  83.761  -5.070  1.00108.99           O  
ANISOU 1971  O4   DT I  23    11819  14822  14772  -2541   -575  -2127       O  
ATOM   1972  C5   DT I  23       4.136  82.913  -5.529  1.00117.32           C  
ANISOU 1972  C5   DT I  23    12283  15672  16622  -2739   -720  -2658       C  
ATOM   1973  C7   DT I  23       3.705  82.939  -4.093  1.00115.81           C  
ANISOU 1973  C7   DT I  23    11983  15353  16667  -2961   -271  -2586       C  
ATOM   1974  C6   DT I  23       3.320  82.485  -6.504  1.00120.74           C  
ANISOU 1974  C6   DT I  23    12479  16076  17320  -2719  -1027  -2961       C  
ATOM   1975  P    DG I  24       0.702  78.709 -10.954  1.00123.14           P  
ANISOU 1975  P    DG I  24    12009  16139  18639  -2737  -2302  -4379       P  
ATOM   1976  OP1  DG I  24      -0.636  78.639 -11.584  1.00126.68           O  
ANISOU 1976  OP1  DG I  24    12051  16554  19529  -2755  -2554  -4747       O  
ATOM   1977  OP2  DG I  24       0.992  77.909  -9.743  1.00120.09           O  
ANISOU 1977  OP2  DG I  24    11737  15528  18362  -2968  -1839  -4233       O  
ATOM   1978  O5'  DG I  24       1.811  78.351 -12.047  1.00122.40           O  
ANISOU 1978  O5'  DG I  24    12217  16202  18086  -2550  -2593  -4341       O  
ATOM   1979  C5'  DG I  24       2.133  79.295 -13.056  1.00120.19           C  
ANISOU 1979  C5'  DG I  24    12006  16200  17462  -2290  -2973  -4304       C  
ATOM   1980  C4'  DG I  24       3.601  79.212 -13.441  1.00115.29           C  
ANISOU 1980  C4'  DG I  24    11800  15720  16284  -2147  -3028  -4073       C  
ATOM   1981  O4'  DG I  24       4.429  79.795 -12.400  1.00113.15           O  
ANISOU 1981  O4'  DG I  24    11783  15451  15756  -2161  -2699  -3706       O  
ATOM   1982  C3'  DG I  24       4.147  77.809 -13.660  1.00113.46           C  
ANISOU 1982  C3'  DG I  24    11721  15362  16027  -2232  -2981  -4165       C  
ATOM   1983  O3'  DG I  24       5.118  77.861 -14.686  1.00109.12           O  
ANISOU 1983  O3'  DG I  24    11422  15027  15013  -2028  -3268  -4115       O  
ATOM   1984  C2'  DG I  24       4.778  77.482 -12.304  1.00113.43           C  
ANISOU 1984  C2'  DG I  24    11928  15179  15990  -2400  -2503  -3887       C  
ATOM   1985  C1'  DG I  24       5.360  78.835 -11.931  1.00113.66           C  
ANISOU 1985  C1'  DG I  24    12129  15391  15667  -2260  -2449  -3571       C  
ATOM   1986  N9   DG I  24       5.530  79.062 -10.497  1.00116.45           N  
ANISOU 1986  N9   DG I  24    12559  15618  16068  -2408  -2005  -3321       N  
ATOM   1987  C8   DG I  24       4.579  78.908  -9.520  1.00119.18           C  
ANISOU 1987  C8   DG I  24    12656  15774  16852  -2622  -1718  -3390       C  
ATOM   1988  N7   DG I  24       5.002  79.220  -8.327  1.00116.73           N  
ANISOU 1988  N7   DG I  24    12487  15413  16452  -2713  -1346  -3119       N  
ATOM   1989  C5   DG I  24       6.317  79.620  -8.525  1.00112.57           C  
ANISOU 1989  C5   DG I  24    12324  15044  15402  -2545  -1394  -2854       C  
ATOM   1990  C6   DG I  24       7.281  80.070  -7.592  1.00106.11           C  
ANISOU 1990  C6   DG I  24    11789  14257  14271  -2544  -1102  -2509       C  
ATOM   1991  O6   DG I  24       7.155  80.206  -6.368  1.00103.52           O  
ANISOU 1991  O6   DG I  24    11446  13830  14058  -2697   -733  -2366       O  
ATOM   1992  N1   DG I  24       8.493  80.375  -8.206  1.00103.77           N  
ANISOU 1992  N1   DG I  24    11814  14135  13479  -2341  -1275  -2332       N  
ATOM   1993  C2   DG I  24       8.742  80.262  -9.555  1.00106.75           C  
ANISOU 1993  C2   DG I  24    12236  14651  13673  -2164  -1675  -2467       C  
ATOM   1994  N2   DG I  24       9.973  80.604  -9.966  1.00105.71           N  
ANISOU 1994  N2   DG I  24    12431  14684  13050  -1986  -1778  -2257       N  
ATOM   1995  N3   DG I  24       7.845  79.841 -10.442  1.00111.02           N  
ANISOU 1995  N3   DG I  24    12515  15178  14489  -2163  -1954  -2791       N  
ATOM   1996  C4   DG I  24       6.657  79.539  -9.857  1.00113.90           C  
ANISOU 1996  C4   DG I  24    12564  15363  15352  -2357  -1795  -2971       C  
ATOM   1997  P    DG I  25       5.501  76.548 -15.522  1.00118.19           P  
ANISOU 1997  P    DG I  25    12648  16134  16124  -2035  -3430  -4335       P  
ATOM   1998  OP1  DG I  25       5.390  76.880 -16.960  1.00125.16           O  
ANISOU 1998  OP1  DG I  25    13464  17275  16815  -1825  -3909  -4524       O  
ATOM   1999  OP2  DG I  25       4.738  75.410 -14.962  1.00119.44           O  
ANISOU 1999  OP2  DG I  25    12596  15991  16795  -2281  -3216  -4545       O  
ATOM   2000  O5'  DG I  25       7.039  76.334 -15.169  1.00111.54           O  
ANISOU 2000  O5'  DG I  25    12244  15311  14825  -1998  -3236  -4019       O  
ATOM   2001  C5'  DG I  25       7.887  77.461 -15.024  1.00105.42           C  
ANISOU 2001  C5'  DG I  25    11716  14733  13606  -1839  -3221  -3691       C  
ATOM   2002  C4'  DG I  25       9.061  77.121 -14.137  1.00103.75           C  
ANISOU 2002  C4'  DG I  25    11850  14421  13151  -1904  -2876  -3389       C  
ATOM   2003  O4'  DG I  25       8.727  77.409 -12.749  1.00105.72           O  
ANISOU 2003  O4'  DG I  25    12045  14504  13621  -2070  -2483  -3212       O  
ATOM   2004  C3'  DG I  25       9.475  75.643 -14.172  1.00104.27           C  
ANISOU 2004  C3'  DG I  25    12015  14299  13304  -2027  -2783  -3506       C  
ATOM   2005  O3'  DG I  25      10.887  75.545 -14.194  1.00100.27           O  
ANISOU 2005  O3'  DG I  25    11890  13867  12343  -1936  -2726  -3268       O  
ATOM   2006  C2'  DG I  25       8.912  75.110 -12.857  1.00107.79           C  
ANISOU 2006  C2'  DG I  25    12339  14449  14168  -2288  -2375  -3466       C  
ATOM   2007  C1'  DG I  25       9.145  76.319 -11.974  1.00107.33           C  
ANISOU 2007  C1'  DG I  25    12379  14473  13928  -2254  -2167  -3146       C  
ATOM   2008  N9   DG I  25       8.430  76.295 -10.699  1.00112.58           N  
ANISOU 2008  N9   DG I  25    12881  14936  14958  -2469  -1800  -3086       N  
ATOM   2009  C8   DG I  25       7.173  75.802 -10.450  1.00116.74           C  
ANISOU 2009  C8   DG I  25    13064  15281  16011  -2648  -1735  -3334       C  
ATOM   2010  N7   DG I  25       6.812  75.912  -9.199  1.00116.23           N  
ANISOU 2010  N7   DG I  25    12932  15072  16160  -2825  -1364  -3198       N  
ATOM   2011  C5   DG I  25       7.905  76.509  -8.581  1.00112.82           C  
ANISOU 2011  C5   DG I  25    12821  14732  15314  -2757  -1177  -2842       C  
ATOM   2012  C6   DG I  25       8.106  76.880  -7.226  1.00111.72           C  
ANISOU 2012  C6   DG I  25    12769  14526  15153  -2877   -777  -2570       C  
ATOM   2013  O6   DG I  25       7.330  76.752  -6.269  1.00115.49           O  
ANISOU 2013  O6   DG I  25    13053  14851  15978  -3077   -491  -2584       O  
ATOM   2014  N1   DG I  25       9.360  77.457  -7.031  1.00106.87           N  
ANISOU 2014  N1   DG I  25    12503  14053  14049  -2742   -720  -2260       N  
ATOM   2015  C2   DG I  25      10.298  77.649  -8.018  1.00107.04           C  
ANISOU 2015  C2   DG I  25    12758  14253  13659  -2524  -1006  -2214       C  
ATOM   2016  N2   DG I  25      11.452  78.220  -7.651  1.00102.13           N  
ANISOU 2016  N2   DG I  25    12454  13744  12607  -2420   -897  -1902       N  
ATOM   2017  N3   DG I  25      10.120  77.307  -9.284  1.00111.75           N  
ANISOU 2017  N3   DG I  25    13276  14921  14261  -2414  -1374  -2462       N  
ATOM   2018  C4   DG I  25       8.908  76.746  -9.492  1.00112.55           C  
ANISOU 2018  C4   DG I  25    13041  14891  14832  -2539  -1442  -2770       C  
ATOM   2019  P    DA I  26      11.675  75.290 -15.570  1.00 99.59           P  
ANISOU 2019  P    DA I  26    11969  13991  11878  -1741  -3088  -3380       P  
ATOM   2020  OP1  DA I  26      11.041  76.127 -16.612  1.00100.62           O  
ANISOU 2020  OP1  DA I  26    11910  14370  11950  -1571  -3475  -3539       O  
ATOM   2021  OP2  DA I  26      11.786  73.828 -15.769  1.00100.80           O  
ANISOU 2021  OP2  DA I  26    12120  13955  12224  -1861  -3062  -3594       O  
ATOM   2022  O5'  DA I  26      13.139  75.862 -15.267  1.00 98.72           O  
ANISOU 2022  O5'  DA I  26    12267  14008  11236  -1617  -2964  -2999       O  
ATOM   2023  C5'  DA I  26      13.313  77.250 -14.995  1.00 99.72           C  
ANISOU 2023  C5'  DA I  26    12460  14308  11120  -1494  -2951  -2741       C  
ATOM   2024  C4'  DA I  26      14.340  77.492 -13.893  1.00 97.43           C  
ANISOU 2024  C4'  DA I  26    12473  13951  10593  -1529  -2597  -2370       C  
ATOM   2025  O4'  DA I  26      13.725  77.357 -12.583  1.00100.94           O  
ANISOU 2025  O4'  DA I  26    12791  14164  11398  -1741  -2233  -2300       O  
ATOM   2026  C3'  DA I  26      15.533  76.551 -13.865  1.00 94.78           C  
ANISOU 2026  C3'  DA I  26    12444  13540  10028  -1546  -2489  -2284       C  
ATOM   2027  O3'  DA I  26      16.617  77.243 -13.286  1.00 90.04           O  
ANISOU 2027  O3'  DA I  26    12146  13018   9047  -1466  -2314  -1928       O  
ATOM   2028  C2'  DA I  26      15.036  75.449 -12.936  1.00101.13           C  
ANISOU 2028  C2'  DA I  26    13136  14022  11269  -1804  -2186  -2360       C  
ATOM   2029  C1'  DA I  26      14.333  76.286 -11.876  1.00102.35           C  
ANISOU 2029  C1'  DA I  26    13144  14124  11619  -1894  -1948  -2214       C  
ATOM   2030  N9   DA I  26      13.272  75.600 -11.151  1.00107.77           N  
ANISOU 2030  N9   DA I  26    13567  14557  12825  -2131  -1738  -2361       N  
ATOM   2031  C8   DA I  26      12.189  74.976 -11.692  1.00113.41           C  
ANISOU 2031  C8   DA I  26    13971  15180  13938  -2210  -1901  -2706       C  
ATOM   2032  N7   DA I  26      11.363  74.482 -10.805  1.00116.97           N  
ANISOU 2032  N7   DA I  26    14222  15397  14825  -2433  -1638  -2762       N  
ATOM   2033  C5   DA I  26      11.930  74.823  -9.594  1.00112.16           C  
ANISOU 2033  C5   DA I  26    13805  14732  14081  -2505  -1280  -2428       C  
ATOM   2034  C6   DA I  26      11.531  74.586  -8.269  1.00110.31           C  
ANISOU 2034  C6   DA I  26    13499  14291  14122  -2727   -884  -2306       C  
ATOM   2035  N6   DA I  26      10.418  73.923  -7.953  1.00112.01           N  
ANISOU 2035  N6   DA I  26    13416  14304  14837  -2925   -780  -2512       N  
ATOM   2036  N1   DA I  26      12.324  75.051  -7.282  1.00108.57           N  
ANISOU 2036  N1   DA I  26    13522  14088  13642  -2739   -597  -1963       N  
ATOM   2037  C2   DA I  26      13.439  75.717  -7.610  1.00107.46           C  
ANISOU 2037  C2   DA I  26    13671  14145  13012  -2540   -703  -1762       C  
ATOM   2038  N3   DA I  26      13.918  76.001  -8.825  1.00107.96           N  
ANISOU 2038  N3   DA I  26    13830  14406  12784  -2324  -1060  -1843       N  
ATOM   2039  C4   DA I  26      13.105  75.522  -9.783  1.00109.04           C  
ANISOU 2039  C4   DA I  26    13722  14532  13176  -2319  -1338  -2182       C  
ATOM   2040  P    DG I  27      18.133  76.844 -13.619  1.00 87.29           P  
ANISOU 2040  P    DG I  27    12173  12736   8256  -1362  -2326  -1780       P  
ATOM   2041  OP1  DG I  27      18.806  78.106 -13.997  1.00 77.69           O  
ANISOU 2041  OP1  DG I  27    11126  11792   6602  -1145  -2464  -1565       O  
ATOM   2042  OP2  DG I  27      18.129  75.693 -14.551  1.00 94.33           O  
ANISOU 2042  OP2  DG I  27    13024  13591   9227  -1373  -2531  -2075       O  
ATOM   2043  O5'  DG I  27      18.701  76.353 -12.208  1.00 87.18           O  
ANISOU 2043  O5'  DG I  27    12342  12483   8299  -1533  -1887  -1532       O  
ATOM   2044  C5'  DG I  27      18.496  77.156 -11.053  1.00 82.92           C  
ANISOU 2044  C5'  DG I  27    11789  11905   7814  -1598  -1610  -1296       C  
ATOM   2045  C4'  DG I  27      18.487  76.311  -9.793  1.00 78.56           C  
ANISOU 2045  C4'  DG I  27    11266  11070   7512  -1832  -1219  -1196       C  
ATOM   2046  O4'  DG I  27      17.176  75.700  -9.610  1.00 82.95           O  
ANISOU 2046  O4'  DG I  27    11489  11447   8582  -2015  -1178  -1445       O  
ATOM   2047  C3'  DG I  27      19.487  75.146  -9.778  1.00 75.91           C  
ANISOU 2047  C3'  DG I  27    11178  10599   7066  -1878  -1133  -1154       C  
ATOM   2048  O3'  DG I  27      20.007  74.993  -8.465  1.00 77.56           O  
ANISOU 2048  O3'  DG I  27    11557  10656   7256  -2007   -752   -872       O  
ATOM   2049  C2'  DG I  27      18.591  73.966 -10.131  1.00 79.58           C  
ANISOU 2049  C2'  DG I  27    11393  10874   7971  -2027  -1205  -1480       C  
ATOM   2050  C1'  DG I  27      17.388  74.347  -9.296  1.00 85.84           C  
ANISOU 2050  C1'  DG I  27    11909  11572   9135  -2177  -1022  -1496       C  
ATOM   2051  N9   DG I  27      16.176  73.565  -9.544  1.00 96.40           N  
ANISOU 2051  N9   DG I  27    12917  12750  10961  -2321  -1088  -1816       N  
ATOM   2052  C8   DG I  27      15.686  73.137 -10.753  1.00103.06           C  
ANISOU 2052  C8   DG I  27    13588  13644  11927  -2257  -1426  -2152       C  
ATOM   2053  N7   DG I  27      14.577  72.453 -10.651  1.00108.11           N  
ANISOU 2053  N7   DG I  27    13929  14098  13048  -2425  -1396  -2394       N  
ATOM   2054  C5   DG I  27      14.324  72.416  -9.285  1.00104.81           C  
ANISOU 2054  C5   DG I  27    13490  13498  12834  -2615  -1007  -2198       C  
ATOM   2055  C6   DG I  27      13.261  71.813  -8.565  1.00111.20           C  
ANISOU 2055  C6   DG I  27    14033  14066  14151  -2851   -793  -2309       C  
ATOM   2056  O6   DG I  27      12.299  71.169  -9.008  1.00115.80           O  
ANISOU 2056  O6   DG I  27    14333  14535  15131  -2939   -913  -2618       O  
ATOM   2057  N1   DG I  27      13.387  72.018  -7.192  1.00113.22           N  
ANISOU 2057  N1   DG I  27    14371  14219  14427  -2991   -400  -2020       N  
ATOM   2058  C2   DG I  27      14.410  72.715  -6.592  1.00109.11           C  
ANISOU 2058  C2   DG I  27    14150  13812  13496  -2910   -241  -1679       C  
ATOM   2059  N2   DG I  27      14.371  72.811  -5.255  1.00106.78           N  
ANISOU 2059  N2   DG I  27    13886  13406  13278  -3070    140  -1442       N  
ATOM   2060  N3   DG I  27      15.408  73.282  -7.256  1.00106.61           N  
ANISOU 2060  N3   DG I  27    14080  13707  12720  -2688   -440  -1577       N  
ATOM   2061  C4   DG I  27      15.301  73.093  -8.592  1.00102.33           C  
ANISOU 2061  C4   DG I  27    13464  13270  12145  -2553   -816  -1845       C  
ATOM   2062  P    DC I  28      21.537  75.348  -8.127  1.00 72.58           P  
ANISOU 2062  P    DC I  28    11321  10112   6144  -1891   -637   -543       P  
ATOM   2063  OP1  DC I  28      21.769  76.757  -8.515  1.00 72.46           O  
ANISOU 2063  OP1  DC I  28    11357  10370   5805  -1685   -795   -433       O  
ATOM   2064  OP2  DC I  28      22.388  74.278  -8.692  1.00 81.13           O  
ANISOU 2064  OP2  DC I  28    12588  11121   7116  -1871   -725   -609       O  
ATOM   2065  O5'  DC I  28      21.598  75.234  -6.534  1.00 75.87           O  
ANISOU 2065  O5'  DC I  28    11800  10347   6680  -2081   -201   -285       O  
ATOM   2066  C5'  DC I  28      20.750  76.051  -5.737  1.00 79.02           C  
ANISOU 2066  C5'  DC I  28    12011  10763   7249  -2155    -35   -223       C  
ATOM   2067  C4'  DC I  28      20.104  75.254  -4.613  1.00 78.11           C  
ANISOU 2067  C4'  DC I  28    11765  10392   7520  -2422    294   -206       C  
ATOM   2068  O4'  DC I  28      19.017  74.443  -5.129  1.00 79.81           O  
ANISOU 2068  O4'  DC I  28    11689  10473   8162  -2534    170   -525       O  
ATOM   2069  C3'  DC I  28      21.024  74.291  -3.866  1.00 82.96           C  
ANISOU 2069  C3'  DC I  28    12632  10824   8067  -2536    549     -4       C  
ATOM   2070  O3'  DC I  28      20.708  74.351  -2.482  1.00 91.84           O  
ANISOU 2070  O3'  DC I  28    13718  11837   9339  -2720    919    183       O  
ATOM   2071  C2'  DC I  28      20.655  72.930  -4.472  1.00 81.51           C  
ANISOU 2071  C2'  DC I  28    12330  10445   8196  -2637    433   -261       C  
ATOM   2072  C1'  DC I  28      19.163  73.116  -4.665  1.00 82.43           C  
ANISOU 2072  C1'  DC I  28    12065  10546   8709  -2718    355   -519       C  
ATOM   2073  N1   DC I  28      18.527  72.214  -5.669  1.00 87.92           N  
ANISOU 2073  N1   DC I  28    12557  11148   9700  -2744    106   -868       N  
ATOM   2074  C2   DC I  28      17.492  71.356  -5.274  1.00 94.67           C  
ANISOU 2074  C2   DC I  28    13150  11769  11054  -2967    238  -1030       C  
ATOM   2075  O2   DC I  28      17.153  71.325  -4.086  1.00 99.55           O  
ANISOU 2075  O2   DC I  28    13719  12261  11844  -3145    569   -867       O  
ATOM   2076  N3   DC I  28      16.902  70.568  -6.208  1.00 95.26           N  
ANISOU 2076  N3   DC I  28    13027  11762  11405  -2984      2  -1363       N  
ATOM   2077  C4   DC I  28      17.295  70.631  -7.479  1.00 93.95           C  
ANISOU 2077  C4   DC I  28    12917  11756  11023  -2790   -352  -1536       C  
ATOM   2078  N4   DC I  28      16.683  69.838  -8.365  1.00 97.97           N  
ANISOU 2078  N4   DC I  28    13219  12190  11816  -2814   -578  -1879       N  
ATOM   2079  C5   DC I  28      18.338  71.500  -7.898  1.00 91.44           C  
ANISOU 2079  C5   DC I  28    12868  11687  10188  -2566   -485  -1367       C  
ATOM   2080  C6   DC I  28      18.911  72.277  -6.973  1.00 90.18           C  
ANISOU 2080  C6   DC I  28    12899  11592   9775  -2550   -251  -1037       C  
ATOM   2081  P    DA I  29      21.682  73.699  -1.387  1.00 91.40           P  
ANISOU 2081  P    DA I  29    13938  11632   9157  -2837   1246    487       P  
ATOM   2082  OP1  DA I  29      21.600  74.540  -0.173  1.00 88.29           O  
ANISOU 2082  OP1  DA I  29    13557  11302   8686  -2899   1541    721       O  
ATOM   2083  OP2  DA I  29      22.992  73.451  -2.028  1.00 93.93           O  
ANISOU 2083  OP2  DA I  29    14563  12004   9120  -2675   1090    565       O  
ATOM   2084  O5'  DA I  29      21.000  72.287  -1.075  1.00 96.23           O  
ANISOU 2084  O5'  DA I  29    14384  11949  10228  -3082   1380    363       O  
ATOM   2085  C5'  DA I  29      19.660  72.242  -0.602  1.00 96.31           C  
ANISOU 2085  C5'  DA I  29    14071  11867  10654  -3261   1510    233       C  
ATOM   2086  C4'  DA I  29      19.163  70.812  -0.497  1.00 95.95           C  
ANISOU 2086  C4'  DA I  29    13893  11536  11029  -3471   1594    107       C  
ATOM   2087  O4'  DA I  29      18.770  70.328  -1.807  1.00 95.20           O  
ANISOU 2087  O4'  DA I  29    13648  11421  11102  -3395   1251   -231       O  
ATOM   2088  C3'  DA I  29      20.180  69.797   0.028  1.00 97.00           C  
ANISOU 2088  C3'  DA I  29    14291  11486  11079  -3554   1771    326       C  
ATOM   2089  O3'  DA I  29      19.501  68.833   0.812  1.00102.02           O  
ANISOU 2089  O3'  DA I  29    14769  11863  12129  -3816   2023    335       O  
ATOM   2090  C2'  DA I  29      20.711  69.176  -1.262  1.00 96.28           C  
ANISOU 2090  C2'  DA I  29    14278  11380  10924  -3415   1441    124       C  
ATOM   2091  C1'  DA I  29      19.422  69.103  -2.055  1.00 97.48           C  
ANISOU 2091  C1'  DA I  29    14075  11523  11439  -3438   1229   -242       C  
ATOM   2092  N9   DA I  29      19.589  68.947  -3.496  1.00 97.92           N  
ANISOU 2092  N9   DA I  29    14117  11669  11419  -3263    841   -515       N  
ATOM   2093  C8   DA I  29      20.585  69.451  -4.288  1.00 95.31           C  
ANISOU 2093  C8   DA I  29    14017  11543  10652  -3030    613   -483       C  
ATOM   2094  N7   DA I  29      20.449  69.150  -5.562  1.00 95.08           N  
ANISOU 2094  N7   DA I  29    13900  11571  10657  -2920    277   -781       N  
ATOM   2095  C5   DA I  29      19.281  68.402  -5.601  1.00 99.05           C  
ANISOU 2095  C5   DA I  29    14088  11885  11660  -3090    283  -1030       C  
ATOM   2096  C6   DA I  29      18.577  67.777  -6.655  1.00101.02           C  
ANISOU 2096  C6   DA I  29    14101  12089  12193  -3086      9  -1411       C  
ATOM   2097  N6   DA I  29      18.965  67.809  -7.936  1.00108.08           N  
ANISOU 2097  N6   DA I  29    15042  13146  12878  -2895   -339  -1613       N  
ATOM   2098  N1   DA I  29      17.446  67.115  -6.338  1.00103.23           N  
ANISOU 2098  N1   DA I  29    14086  12157  12981  -3288    110  -1580       N  
ATOM   2099  C2   DA I  29      17.053  67.081  -5.062  1.00104.87           C  
ANISOU 2099  C2   DA I  29    14243  12215  13387  -3483    464  -1376       C  
ATOM   2100  N3   DA I  29      17.623  67.623  -3.995  1.00103.02           N  
ANISOU 2100  N3   DA I  29    14213  12017  12912  -3510    744  -1020       N  
ATOM   2101  C4   DA I  29      18.743  68.274  -4.335  1.00101.16           C  
ANISOU 2101  C4   DA I  29    14266  11987  12184  -3303    631   -866       C  
ATOM   2102  P    DG I  30      20.165  68.246   2.150  1.00104.80           P  
ANISOU 2102  P    DG I  30    15330  12057  12433  -3986   2400    695       P  
ATOM   2103  OP1  DG I  30      19.961  69.237   3.230  1.00103.97           O  
ANISOU 2103  OP1  DG I  30    15222  12092  12189  -4033   2663    908       O  
ATOM   2104  OP2  DG I  30      21.532  67.793   1.810  1.00104.24           O  
ANISOU 2104  OP2  DG I  30    15583  11961  12062  -3866   2307    825       O  
ATOM   2105  O5'  DG I  30      19.282  66.952   2.463  1.00110.62           O  
ANISOU 2105  O5'  DG I  30    15834  12485  13713  -4247   2541    583       O  
ATOM   2106  C5'  DG I  30      17.862  67.048   2.479  1.00114.52           C  
ANISOU 2106  C5'  DG I  30    15966  12942  14604  -4371   2563    359       C  
ATOM   2107  C4'  DG I  30      17.227  65.760   1.986  1.00117.06           C  
ANISOU 2107  C4'  DG I  30    16078  12995  15402  -4507   2479    112       C  
ATOM   2108  O4'  DG I  30      17.223  65.741   0.534  1.00118.47           O  
ANISOU 2108  O4'  DG I  30    16198  13247  15567  -4322   2075   -210       O  
ATOM   2109  C3'  DG I  30      17.934  64.480   2.428  1.00119.03           C  
ANISOU 2109  C3'  DG I  30    16496  12979  15749  -4638   2634    291       C  
ATOM   2110  O3'  DG I  30      16.970  63.500   2.785  1.00125.70           O  
ANISOU 2110  O3'  DG I  30    17080  13556  17123  -4883   2782    192       O  
ATOM   2111  C2'  DG I  30      18.725  64.069   1.185  1.00118.29           C  
ANISOU 2111  C2'  DG I  30    16542  12893  15511  -4448   2292    120       C  
ATOM   2112  C1'  DG I  30      17.806  64.543   0.070  1.00118.68           C  
ANISOU 2112  C1'  DG I  30    16323  13073  15696  -4338   1981   -267       C  
ATOM   2113  N9   DG I  30      18.494  64.826  -1.189  1.00115.55           N  
ANISOU 2113  N9   DG I  30    16057  12849  14996  -4085   1618   -430       N  
ATOM   2114  C8   DG I  30      19.538  65.698  -1.386  1.00112.58           C  
ANISOU 2114  C8   DG I  30    15964  12711  14099  -3873   1529   -264       C  
ATOM   2115  N7   DG I  30      19.945  65.751  -2.626  1.00112.21           N  
ANISOU 2115  N7   DG I  30    15970  12787  13879  -3677   1189   -472       N  
ATOM   2116  C5   DG I  30      19.110  64.864  -3.296  1.00114.58           C  
ANISOU 2116  C5   DG I  30    16001  12923  14609  -3761   1037   -808       C  
ATOM   2117  C6   DG I  30      19.072  64.501  -4.665  1.00111.53           C  
ANISOU 2117  C6   DG I  30    15532  12582  14262  -3633    675  -1151       C  
ATOM   2118  O6   DG I  30      19.790  64.907  -5.590  1.00107.72           O  
ANISOU 2118  O6   DG I  30    15204  12304  13420  -3415    412  -1219       O  
ATOM   2119  N1   DG I  30      18.069  63.568  -4.923  1.00115.47           N  
ANISOU 2119  N1   DG I  30    15729  12866  15281  -3785    633  -1437       N  
ATOM   2120  C2   DG I  30      17.215  63.051  -3.976  1.00119.33           C  
ANISOU 2120  C2   DG I  30    16021  13118  16201  -4034    913  -1386       C  
ATOM   2121  N2   DG I  30      16.310  62.161  -4.403  1.00124.54           N  
ANISOU 2121  N2   DG I  30    16390  13583  17348  -4153    825  -1696       N  
ATOM   2122  N3   DG I  30      17.243  63.382  -2.692  1.00119.30           N  
ANISOU 2122  N3   DG I  30    16096  13078  16154  -4160   1258  -1057       N  
ATOM   2123  C4   DG I  30      18.211  64.290  -2.425  1.00117.43           C  
ANISOU 2123  C4   DG I  30    16153  13055  15411  -4011   1297   -787       C  
ATOM   2124  P    DT I  31      17.381  62.258   3.717  1.00120.41           P  
ANISOU 2124  P    DT I  31    16518  12586  16648  -5103   3072    455       P  
ATOM   2125  OP1  DT I  31      16.289  62.060   4.697  1.00121.69           O  
ANISOU 2125  OP1  DT I  31    16433  12624  17179  -5362   3379    511       O  
ATOM   2126  OP2  DT I  31      18.763  62.488   4.193  1.00117.64           O  
ANISOU 2126  OP2  DT I  31    16549  12319  15828  -5006   3163    798       O  
ATOM   2127  O5'  DT I  31      17.398  61.020   2.704  1.00123.65           O  
ANISOU 2127  O5'  DT I  31    16843  12758  17381  -5103   2829    181       O  
ATOM   2128  C5'  DT I  31      16.239  60.729   1.933  1.00129.85           C  
ANISOU 2128  C5'  DT I  31    17281  13468  18587  -5144   2648   -210       C  
ATOM   2129  C4'  DT I  31      16.539  59.707   0.847  1.00134.51           C  
ANISOU 2129  C4'  DT I  31    17852  13893  19361  -5082   2370   -471       C  
ATOM   2130  O4'  DT I  31      17.139  60.357  -0.300  1.00132.03           O  
ANISOU 2130  O4'  DT I  31    17667  13830  18669  -4804   2021   -642       O  
ATOM   2131  C3'  DT I  31      17.495  58.576   1.249  1.00137.00           C  
ANISOU 2131  C3'  DT I  31    18380  13953  19720  -5167   2495   -251       C  
ATOM   2132  O3'  DT I  31      16.875  57.322   0.997  1.00142.56           O  
ANISOU 2132  O3'  DT I  31    18846  14342  20976  -5330   2474   -462       O  
ATOM   2133  C2'  DT I  31      18.718  58.793   0.346  1.00134.47           C  
ANISOU 2133  C2'  DT I  31    18336  13789  18967  -4909   2218   -288       C  
ATOM   2134  C1'  DT I  31      18.094  59.489  -0.851  1.00134.25           C  
ANISOU 2134  C1'  DT I  31    18124  13985  18900  -4737   1881   -670       C  
ATOM   2135  N1   DT I  31      19.055  60.295  -1.669  1.00133.85           N  
ANISOU 2135  N1   DT I  31    18315  14222  18320  -4457   1622   -690       N  
ATOM   2136  C2   DT I  31      19.125  60.080  -3.029  1.00134.82           C  
ANISOU 2136  C2   DT I  31    18376  14410  18439  -4300   1258  -1040       C  
ATOM   2137  O2   DT I  31      18.445  59.253  -3.610  1.00136.48           O  
ANISOU 2137  O2   DT I  31    18341  14452  19064  -4375   1129  -1349       O  
ATOM   2138  N3   DT I  31      20.028  60.873  -3.689  1.00133.41           N  
ANISOU 2138  N3   DT I  31    18431  14508  17752  -4052   1051  -1017       N  
ATOM   2139  C4   DT I  31      20.849  61.841  -3.137  1.00130.55           C  
ANISOU 2139  C4   DT I  31    18346  14346  16910  -3946   1167   -691       C  
ATOM   2140  O4   DT I  31      21.630  62.504  -3.813  1.00128.54           O  
ANISOU 2140  O4   DT I  31    18282  14329  16228  -3724    966   -695       O  
ATOM   2141  C5   DT I  31      20.723  62.017  -1.709  1.00130.11           C  
ANISOU 2141  C5   DT I  31    18336  14207  16892  -4117   1546   -349       C  
ATOM   2142  C7   DT I  31      21.565  63.035  -1.000  1.00124.73           C  
ANISOU 2142  C7   DT I  31    17939  13730  15724  -4021   1699      4       C  
ATOM   2143  C6   DT I  31      19.842  61.246  -1.052  1.00133.20           C  
ANISOU 2143  C6   DT I  31    18506  14342  17764  -4362   1753   -362       C  
ATOM   2144  P    DT I  32      17.473  55.972   1.632  1.00144.06           P  
ANISOU 2144  P    DT I  32    19149  14182  21407  -5504   2672   -235       P  
ATOM   2145  OP1  DT I  32      16.339  55.226   2.222  1.00143.43           O  
ANISOU 2145  OP1  DT I  32    18766  13834  21898  -5776   2884   -271       O  
ATOM   2146  OP2  DT I  32      18.634  56.334   2.477  1.00139.68           O  
ANISOU 2146  OP2  DT I  32    18957  13714  20403  -5463   2863    197       O  
ATOM   2147  O5'  DT I  32      18.010  55.164   0.361  1.00146.10           O  
ANISOU 2147  O5'  DT I  32    19424  14335  21753  -5370   2331   -541       O  
ATOM   2148  C5'  DT I  32      17.110  54.816  -0.685  1.00148.22           C  
ANISOU 2148  C5'  DT I  32    19381  14554  22382  -5355   2072   -999       C  
ATOM   2149  C4'  DT I  32      17.858  54.352  -1.923  1.00146.80           C  
ANISOU 2149  C4'  DT I  32    19288  14382  22106  -5170   1730  -1264       C  
ATOM   2150  O4'  DT I  32      18.560  55.471  -2.524  1.00141.69           O  
ANISOU 2150  O4'  DT I  32    18859  14099  20876  -4907   1527  -1266       O  
ATOM   2151  C3'  DT I  32      18.908  53.261  -1.682  1.00148.35           C  
ANISOU 2151  C3'  DT I  32    19686  14315  22365  -5219   1802  -1088       C  
ATOM   2152  O3'  DT I  32      18.687  52.174  -2.580  1.00155.50           O  
ANISOU 2152  O3'  DT I  32    20398  15003  23683  -5238   1588  -1455       O  
ATOM   2153  C2'  DT I  32      20.237  53.969  -1.960  1.00143.68           C  
ANISOU 2153  C2'  DT I  32    19461  13982  21149  -4982   1687   -930       C  
ATOM   2154  C1'  DT I  32      19.824  55.038  -2.955  1.00142.75           C  
ANISOU 2154  C1'  DT I  32    19257  14211  20772  -4780   1403  -1221       C  
ATOM   2155  N1   DT I  32      20.744  56.218  -2.994  1.00142.87           N  
ANISOU 2155  N1   DT I  32    19577  14561  20146  -4565   1353  -1021       N  
ATOM   2156  C2   DT I  32      21.253  56.635  -4.204  1.00144.09           C  
ANISOU 2156  C2   DT I  32    19815  14952  19981  -4323   1017  -1256       C  
ATOM   2157  O2   DT I  32      20.996  56.086  -5.261  1.00147.82           O  
ANISOU 2157  O2   DT I  32    20125  15387  20652  -4271    752  -1631       O  
ATOM   2158  N3   DT I  32      22.080  57.726  -4.134  1.00139.86           N  
ANISOU 2158  N3   DT I  32    19556  14706  18879  -4143   1003  -1038       N  
ATOM   2159  C4   DT I  32      22.443  58.428  -3.000  1.00137.30           C  
ANISOU 2159  C4   DT I  32    19425  14457  18286  -4178   1281   -631       C  
ATOM   2160  O4   DT I  32      23.195  59.397  -3.040  1.00134.29           O  
ANISOU 2160  O4   DT I  32    19278  14335  17409  -4003   1241   -471       O  
ATOM   2161  C5   DT I  32      21.876  57.940  -1.764  1.00140.62           C  
ANISOU 2161  C5   DT I  32    19745  14633  19049  -4435   1624   -411       C  
ATOM   2162  C7   DT I  32      22.200  58.622  -0.468  1.00141.48           C  
ANISOU 2162  C7   DT I  32    20041  14818  18896  -4496   1944     21       C  
ATOM   2163  C6   DT I  32      21.063  56.872  -1.820  1.00142.66           C  
ANISOU 2163  C6   DT I  32    19737  14606  19861  -4616   1645   -606       C  
ATOM   2164  P    DT I  33      19.664  50.897  -2.592  1.00149.84           P  
ANISOU 2164  P    DT I  33    19821  13978  23133  -5280   1594  -1385       P  
ATOM   2165  OP1  DT I  33      18.809  49.703  -2.772  1.00152.98           O  
ANISOU 2165  OP1  DT I  33    19892  14032  24202  -5464   1586  -1642       O  
ATOM   2166  OP2  DT I  33      20.575  50.966  -1.426  1.00149.76           O  
ANISOU 2166  OP2  DT I  33    20119  13918  22867  -5338   1883   -878       O  
ATOM   2167  O5'  DT I  33      20.528  51.099  -3.923  1.00148.15           O  
ANISOU 2167  O5'  DT I  33    19750  13979  22560  -5005   1220  -1661       O  
ATOM   2168  C5'  DT I  33      19.862  51.347  -5.155  1.00149.40           C  
ANISOU 2168  C5'  DT I  33    19684  14308  22772  -4882    897  -2128       C  
ATOM   2169  C4'  DT I  33      20.842  51.425  -6.315  1.00149.37           C  
ANISOU 2169  C4'  DT I  33    19853  14493  22409  -4637    577  -2338       C  
ATOM   2170  O4'  DT I  33      21.575  52.676  -6.270  1.00148.49           O  
ANISOU 2170  O4'  DT I  33    20030  14734  21654  -4447    558  -2113       O  
ATOM   2171  C3'  DT I  33      21.890  50.320  -6.369  1.00148.56           C  
ANISOU 2171  C3'  DT I  33    19903  14136  22407  -4650    575  -2294       C  
ATOM   2172  O3'  DT I  33      22.076  49.933  -7.722  1.00144.81           O  
ANISOU 2172  O3'  DT I  33    19343  13728  21950  -4503    228  -2735       O  
ATOM   2173  C2'  DT I  33      23.138  50.997  -5.787  1.00148.19           C  
ANISOU 2173  C2'  DT I  33    20258  14249  21797  -4539    701  -1876       C  
ATOM   2174  C1'  DT I  33      22.967  52.425  -6.285  1.00148.14           C  
ANISOU 2174  C1'  DT I  33    20301  14677  21309  -4346    549  -1938       C  
ATOM   2175  N1   DT I  33      23.618  53.469  -5.434  1.00146.80           N  
ANISOU 2175  N1   DT I  33    20428  14706  20642  -4285    743  -1503       N  
ATOM   2176  C2   DT I  33      24.396  54.437  -6.033  1.00144.20           C  
ANISOU 2176  C2   DT I  33    20323  14720  19746  -4043    566  -1493       C  
ATOM   2177  O2   DT I  33      24.616  54.473  -7.231  1.00142.69           O  
ANISOU 2177  O2   DT I  33    20111  14686  19417  -3875    259  -1811       O  
ATOM   2178  N3   DT I  33      24.922  55.363  -5.168  1.00142.82           N  
ANISOU 2178  N3   DT I  33    20396  14702  19166  -4006    766  -1094       N  
ATOM   2179  C4   DT I  33      24.744  55.425  -3.799  1.00142.57           C  
ANISOU 2179  C4   DT I  33    20410  14539  19222  -4182   1115   -720       C  
ATOM   2180  O4   DT I  33      25.259  56.297  -3.107  1.00139.77           O  
ANISOU 2180  O4   DT I  33    20278  14352  18475  -4129   1268   -392       O  
ATOM   2181  C5   DT I  33      23.910  54.392  -3.238  1.00145.08           C  
ANISOU 2181  C5   DT I  33    20488  14511  20124  -4434   1287   -743       C  
ATOM   2182  C7   DT I  33      23.653  54.360  -1.762  1.00144.96           C  
ANISOU 2182  C7   DT I  33    20499  14345  20233  -4645   1671   -348       C  
ATOM   2183  C6   DT I  33      23.387  53.477  -4.072  1.00147.58           C  
ANISOU 2183  C6   DT I  33    20558  14655  20859  -4474   1096  -1127       C  
ATOM   2184  P    DC I  34      22.955  48.644  -8.096  1.00155.40           P  
ANISOU 2184  P    DC I  34    20744  14793  23509  -4510    147  -2852       P  
ATOM   2185  OP1  DC I  34      22.397  48.070  -9.341  1.00156.73           O  
ANISOU 2185  OP1  DC I  34    20629  14949  23974  -4463   -162  -3400       O  
ATOM   2186  OP2  DC I  34      23.078  47.802  -6.887  1.00156.27           O  
ANISOU 2186  OP2  DC I  34    20886  14515  23974  -4736    470  -2510       O  
ATOM   2187  O5'  DC I  34      24.388  49.262  -8.421  1.00149.41           O  
ANISOU 2187  O5'  DC I  34    20364  14298  22106  -4279     46  -2701       O  
ATOM   2188  C5'  DC I  34      24.482  50.451  -9.195  1.00146.40           C  
ANISOU 2188  C5'  DC I  34    20066  14350  21208  -4057   -169  -2819       C  
ATOM   2189  C4'  DC I  34      25.931  50.830  -9.412  1.00142.63           C  
ANISOU 2189  C4'  DC I  34    19951  14055  20188  -3867   -231  -2652       C  
ATOM   2190  O4'  DC I  34      26.346  51.781  -8.394  1.00138.86           O  
ANISOU 2190  O4'  DC I  34    19729  13707  19325  -3856      8  -2181       O  
ATOM   2191  C3'  DC I  34      26.914  49.665  -9.324  1.00142.17           C  
ANISOU 2191  C3'  DC I  34    20013  13699  20306  -3908   -194  -2615       C  
ATOM   2192  O3'  DC I  34      27.945  49.842 -10.272  1.00140.08           O  
ANISOU 2192  O3'  DC I  34    19934  13651  19638  -3689   -430  -2770       O  
ATOM   2193  C2'  DC I  34      27.444  49.785  -7.899  1.00139.57           C  
ANISOU 2193  C2'  DC I  34    19920  13226  19884  -4018    152  -2072       C  
ATOM   2194  C1'  DC I  34      27.499  51.295  -7.747  1.00135.68           C  
ANISOU 2194  C1'  DC I  34    19594  13126  18833  -3880    171  -1872       C  
ATOM   2195  N1   DC I  34      27.488  51.765  -6.332  1.00131.35           N  
ANISOU 2195  N1   DC I  34    19182  12527  18199  -4001    513  -1389       N  
ATOM   2196  C2   DC I  34      27.999  53.029  -6.028  1.00126.26           C  
ANISOU 2196  C2   DC I  34    18783  12196  16994  -3864    567  -1121       C  
ATOM   2197  O2   DC I  34      28.447  53.723  -6.946  1.00122.91           O  
ANISOU 2197  O2   DC I  34    18458  12075  16165  -3647    330  -1279       O  
ATOM   2198  N3   DC I  34      27.984  53.454  -4.740  1.00125.17           N  
ANISOU 2198  N3   DC I  34    18761  12024  16776  -3975    877   -699       N  
ATOM   2199  C4   DC I  34      27.488  52.665  -3.784  1.00124.43           C  
ANISOU 2199  C4   DC I  34    18550  11607  17119  -4214   1128   -532       C  
ATOM   2200  N4   DC I  34      27.493  53.123  -2.525  1.00119.80           N  
ANISOU 2200  N4   DC I  34    18083  11018  16417  -4318   1432   -118       N  
ATOM   2201  C5   DC I  34      26.963  51.370  -4.075  1.00128.45           C  
ANISOU 2201  C5   DC I  34    18812  11785  18211  -4360   1080   -783       C  
ATOM   2202  C6   DC I  34      26.983  50.964  -5.350  1.00131.66           C  
ANISOU 2202  C6   DC I  34    19101  12221  18705  -4245    770  -1213       C  
ATOM   2203  P    DC I  35      28.655  48.571 -10.949  1.00152.43           P  
ANISOU 2203  P    DC I  35    21478  14988  21451  -3675   -580  -3045       P  
ATOM   2204  OP1  DC I  35      27.835  48.161 -12.111  1.00155.93           O  
ANISOU 2204  OP1  DC I  35    21602  15473  22170  -3650   -859  -3584       O  
ATOM   2205  OP2  DC I  35      28.953  47.596  -9.876  1.00153.89           O  
ANISOU 2205  OP2  DC I  35    21707  14747  22018  -3869   -312  -2757       O  
ATOM   2206  O5'  DC I  35      30.038  49.166 -11.481  1.00146.87           O  
ANISOU 2206  O5'  DC I  35    21108  14572  20124  -3437   -710  -2979       O  
ATOM   2207  C5'  DC I  35      30.051  50.421 -12.151  1.00142.70           C  
ANISOU 2207  C5'  DC I  35    20664  14493  19064  -3238   -882  -3043       C  
ATOM   2208  C4'  DC I  35      31.273  51.238 -11.764  1.00135.76           C  
ANISOU 2208  C4'  DC I  35    20165  13806  17610  -3100   -791  -2670       C  
ATOM   2209  O4'  DC I  35      31.081  51.835 -10.448  1.00132.72           O  
ANISOU 2209  O4'  DC I  35    19891  13374  17164  -3205   -488  -2210       O  
ATOM   2210  C3'  DC I  35      32.577  50.451 -11.673  1.00132.98           C  
ANISOU 2210  C3'  DC I  35    20029  13264  17235  -3076   -755  -2581       C  
ATOM   2211  O3'  DC I  35      33.645  51.273 -12.103  1.00130.28           O  
ANISOU 2211  O3'  DC I  35    19970  13239  16292  -2861   -853  -2493       O  
ATOM   2212  C2'  DC I  35      32.672  50.172 -10.176  1.00130.76           C  
ANISOU 2212  C2'  DC I  35    19850  12679  17153  -3260   -407  -2120       C  
ATOM   2213  C1'  DC I  35      32.179  51.498  -9.628  1.00127.26           C  
ANISOU 2213  C1'  DC I  35    19467  12501  16383  -3235   -290  -1858       C  
ATOM   2214  N1   DC I  35      31.721  51.441  -8.206  1.00119.76           N  
ANISOU 2214  N1   DC I  35    18513  11327  15665  -3440     43  -1471       N  
ATOM   2215  C2   DC I  35      32.064  52.474  -7.318  1.00112.54           C  
ANISOU 2215  C2   DC I  35    17828  10579  14352  -3408    240  -1053       C  
ATOM   2216  O2   DC I  35      32.746  53.422  -7.727  1.00108.73           O  
ANISOU 2216  O2   DC I  35    17551  10415  13347  -3209    135  -1005       O  
ATOM   2217  N3   DC I  35      31.632  52.402  -6.032  1.00108.92           N  
ANISOU 2217  N3   DC I  35    17356   9932  14097  -3599    544   -715       N  
ATOM   2218  C4   DC I  35      30.896  51.362  -5.634  1.00107.57           C  
ANISOU 2218  C4   DC I  35    16957   9416  14498  -3815    654   -769       C  
ATOM   2219  N4   DC I  35      30.492  51.327  -4.361  1.00104.91           N  
ANISOU 2219  N4   DC I  35    16615   8916  14331  -4003    960   -420       N  
ATOM   2220  C5   DC I  35      30.545  50.305  -6.521  1.00112.73           C  
ANISOU 2220  C5   DC I  35    17374   9880  15579  -3849    456  -1185       C  
ATOM   2221  C6   DC I  35      30.970  50.386  -7.784  1.00117.91           C  
ANISOU 2221  C6   DC I  35    18041  10730  16027  -3658    154  -1531       C  
ATOM   2222  P    DA I  36      34.407  50.983 -13.486  1.00123.02           P  
ANISOU 2222  P    DA I  36    19081  12490  15169  -2677  -1159  -2883       P  
ATOM   2223  OP1  DA I  36      33.406  51.080 -14.573  1.00121.48           O  
ANISOU 2223  OP1  DA I  36    18601  12484  15071  -2633  -1419  -3330       O  
ATOM   2224  OP2  DA I  36      35.198  49.741 -13.327  1.00123.59           O  
ANISOU 2224  OP2  DA I  36    19205  12220  15536  -2746  -1108  -2909       O  
ATOM   2225  O5'  DA I  36      35.429  52.210 -13.611  1.00115.79           O  
ANISOU 2225  O5'  DA I  36    18499  11946  13550  -2465  -1183  -2644       O  
ATOM   2226  C5'  DA I  36      34.933  53.521 -13.858  1.00112.39           C  
ANISOU 2226  C5'  DA I  36    18072  11884  12746  -2356  -1255  -2597       C  
ATOM   2227  C4'  DA I  36      35.447  54.521 -12.829  1.00108.79           C  
ANISOU 2227  C4'  DA I  36    17889  11522  11923  -2328  -1024  -2098       C  
ATOM   2228  O4'  DA I  36      35.075  54.104 -11.488  1.00108.56           O  
ANISOU 2228  O4'  DA I  36    17836  11164  12247  -2538   -723  -1792       O  
ATOM   2229  C3'  DA I  36      36.955  54.720 -12.789  1.00104.76           C  
ANISOU 2229  C3'  DA I  36    17718  11091  10996  -2191   -996  -1893       C  
ATOM   2230  O3'  DA I  36      37.225  56.062 -12.413  1.00 98.97           O  
ANISOU 2230  O3'  DA I  36    17184  10636   9786  -2081   -919  -1581       O  
ATOM   2231  C2'  DA I  36      37.385  53.736 -11.701  1.00104.16           C  
ANISOU 2231  C2'  DA I  36    17719  10598  11260  -2359   -747  -1646       C  
ATOM   2232  C1'  DA I  36      36.240  53.883 -10.708  1.00107.41           C  
ANISOU 2232  C1'  DA I  36    17972  10868  11969  -2544   -538  -1454       C  
ATOM   2233  N9   DA I  36      35.991  52.703  -9.887  1.00116.32           N  
ANISOU 2233  N9   DA I  36    18999  11562  13635  -2764   -350  -1366       N  
ATOM   2234  C8   DA I  36      35.869  51.415 -10.319  1.00121.33           C  
ANISOU 2234  C8   DA I  36    19456  11917  14728  -2851   -440  -1660       C  
ATOM   2235  N7   DA I  36      35.609  50.557  -9.364  1.00122.99           N  
ANISOU 2235  N7   DA I  36    19597  11749  15386  -3057   -225  -1480       N  
ATOM   2236  C5   DA I  36      35.537  51.337  -8.225  1.00122.17           C  
ANISOU 2236  C5   DA I  36    19636  11694  15091  -3112     27  -1043       C  
ATOM   2237  C6   DA I  36      35.285  51.021  -6.877  1.00128.23           C  
ANISOU 2237  C6   DA I  36    20417  12192  16114  -3312    331   -673       C  
ATOM   2238  N6   DA I  36      35.053  49.777  -6.444  1.00134.99           N  
ANISOU 2238  N6   DA I  36    21136  12646  17509  -3501    433   -673       N  
ATOM   2239  N1   DA I  36      35.295  52.032  -5.985  1.00125.65           N  
ANISOU 2239  N1   DA I  36    20246  12027  15469  -3311    527   -300       N  
ATOM   2240  C2   DA I  36      35.534  53.275  -6.422  1.00120.98           C  
ANISOU 2240  C2   DA I  36    19783  11824  14361  -3121    422   -297       C  
ATOM   2241  N3   DA I  36      35.777  53.695  -7.665  1.00118.64           N  
ANISOU 2241  N3   DA I  36    19488  11801  13787  -2924    140   -608       N  
ATOM   2242  C4   DA I  36      35.764  52.665  -8.527  1.00119.21           C  
ANISOU 2242  C4   DA I  36    19409  11719  14165  -2932    -47   -976       C  
ATOM   2243  P    DA I  37      38.638  56.743 -12.753  1.00127.07           P  
ANISOU 2243  P    DA I  37    21972  12008  14299  -1631   -446  -3539       P  
ATOM   2244  OP1  DA I  37      38.353  58.063 -13.360  1.00127.34           O  
ANISOU 2244  OP1  DA I  37    22157  12279  13948  -1751   -562  -3639       O  
ATOM   2245  OP2  DA I  37      39.463  55.758 -13.486  1.00130.14           O  
ANISOU 2245  OP2  DA I  37    22583  12046  14818  -1580   -163  -3765       O  
ATOM   2246  O5'  DA I  37      39.288  56.979 -11.314  1.00120.10           O  
ANISOU 2246  O5'  DA I  37    20613  11381  13638  -1390   -372  -3245       O  
ATOM   2247  C5'  DA I  37      38.580  57.734 -10.342  1.00113.57           C  
ANISOU 2247  C5'  DA I  37    19483  10898  12772  -1390   -627  -2994       C  
ATOM   2248  C4'  DA I  37      39.115  57.470  -8.948  1.00107.12           C  
ANISOU 2248  C4'  DA I  37    18211  10238  12252  -1164   -549  -2711       C  
ATOM   2249  O4'  DA I  37      38.573  56.223  -8.432  1.00105.95           O  
ANISOU 2249  O4'  DA I  37    17955   9891  12410  -1175   -630  -2552       O  
ATOM   2250  C3'  DA I  37      40.639  57.340  -8.840  1.00107.22           C  
ANISOU 2250  C3'  DA I  37    18139  10209  12391   -945   -187  -2760       C  
ATOM   2251  O3'  DA I  37      41.076  58.025  -7.683  1.00106.79           O  
ANISOU 2251  O3'  DA I  37    17672  10509  12394   -768   -178  -2535       O  
ATOM   2252  C2'  DA I  37      40.835  55.833  -8.691  1.00107.85           C  
ANISOU 2252  C2'  DA I  37    18210   9945  12823   -888    -63  -2722       C  
ATOM   2253  C1'  DA I  37      39.624  55.497  -7.846  1.00108.20           C  
ANISOU 2253  C1'  DA I  37    18035  10078  13000   -964   -369  -2459       C  
ATOM   2254  N9   DA I  37      39.278  54.080  -7.823  1.00109.95           N  
ANISOU 2254  N9   DA I  37    18298   9954  13523  -1001   -380  -2411       N  
ATOM   2255  C8   DA I  37      39.199  53.228  -8.887  1.00113.12           C  
ANISOU 2255  C8   DA I  37    19069   9950  13962  -1115   -310  -2656       C  
ATOM   2256  N7   DA I  37      38.860  52.003  -8.558  1.00116.94           N  
ANISOU 2256  N7   DA I  37    19485  10175  14771  -1122   -351  -2540       N  
ATOM   2257  C5   DA I  37      38.709  52.058  -7.182  1.00113.01           C  
ANISOU 2257  C5   DA I  37    18540   9946  14453  -1007   -452  -2179       C  
ATOM   2258  C6   DA I  37      38.360  51.087  -6.223  1.00112.34           C  
ANISOU 2258  C6   DA I  37    18166   9794  14726   -959   -539  -1885       C  
ATOM   2259  N6   DA I  37      38.087  49.816  -6.533  1.00114.80           N  
ANISOU 2259  N6   DA I  37    18610   9702  15305  -1027   -542  -1915       N  
ATOM   2260  N1   DA I  37      38.297  51.475  -4.930  1.00107.86           N  
ANISOU 2260  N1   DA I  37    17156   9595  14232   -841   -628  -1556       N  
ATOM   2261  C2   DA I  37      38.566  52.748  -4.627  1.00102.07           C  
ANISOU 2261  C2   DA I  37    16286   9256  13242   -772   -632  -1543       C  
ATOM   2262  N3   DA I  37      38.911  53.747  -5.438  1.00102.34           N  
ANISOU 2262  N3   DA I  37    16562   9371  12951   -807   -560  -1800       N  
ATOM   2263  C4   DA I  37      38.963  53.331  -6.714  1.00108.62           C  
ANISOU 2263  C4   DA I  37    17793   9807  13671   -929   -470  -2105       C  
ATOM   2264  P    DA I  38      42.618  58.430  -7.488  1.00104.30           P  
ANISOU 2264  P    DA I  38    17223  10294  12112   -544    150  -2570       P  
ATOM   2265  OP1  DA I  38      42.857  59.671  -8.256  1.00105.30           O  
ANISOU 2265  OP1  DA I  38    17542  10569  11897   -610    162  -2758       O  
ATOM   2266  OP2  DA I  38      43.457  57.237  -7.740  1.00105.47           O  
ANISOU 2266  OP2  DA I  38    17460  10105  12509   -444    432  -2649       O  
ATOM   2267  O5'  DA I  38      42.706  58.758  -5.927  1.00 99.52           O  
ANISOU 2267  O5'  DA I  38    16093  10049  11671   -366     78  -2247       O  
ATOM   2268  C5'  DA I  38      41.510  59.004  -5.187  1.00 94.28           C  
ANISOU 2268  C5'  DA I  38    15216   9611  10993   -445   -252  -2043       C  
ATOM   2269  C4'  DA I  38      41.535  58.262  -3.862  1.00 89.25           C  
ANISOU 2269  C4'  DA I  38    14158   9073  10681   -294   -261  -1735       C  
ATOM   2270  O4'  DA I  38      41.037  56.906  -4.050  1.00 95.97           O  
ANISOU 2270  O4'  DA I  38    15132   9577  11755   -377   -288  -1699       O  
ATOM   2271  C3'  DA I  38      42.925  58.124  -3.240  1.00 90.51           C  
ANISOU 2271  C3'  DA I  38    14063   9296  11029    -41     46  -1659       C  
ATOM   2272  O3'  DA I  38      42.874  58.369  -1.841  1.00 94.72           O  
ANISOU 2272  O3'  DA I  38    14109  10193  11686    102    -46  -1365       O  
ATOM   2273  C2'  DA I  38      43.296  56.679  -3.540  1.00 96.31           C  
ANISOU 2273  C2'  DA I  38    14933   9616  12045    -16    233  -1684       C  
ATOM   2274  C1'  DA I  38      41.949  55.986  -3.493  1.00 98.91           C  
ANISOU 2274  C1'  DA I  38    15311   9820  12449   -191    -47  -1580       C  
ATOM   2275  N9   DA I  38      41.914  54.752  -4.280  1.00101.52           N  
ANISOU 2275  N9   DA I  38    15944   9681  12949   -273     47  -1714       N  
ATOM   2276  C8   DA I  38      42.131  54.631  -5.624  1.00 99.57           C  
ANISOU 2276  C8   DA I  38    16145   9130  12559   -380    166  -2043       C  
ATOM   2277  N7   DA I  38      42.044  53.400  -6.069  1.00100.90           N  
ANISOU 2277  N7   DA I  38    16494   8899  12944   -429    227  -2115       N  
ATOM   2278  C5   DA I  38      41.758  52.656  -4.936  1.00101.94           C  
ANISOU 2278  C5   DA I  38    16273   9065  13395   -351    141  -1795       C  
ATOM   2279  C6   DA I  38      41.539  51.278  -4.737  1.00107.39           C  
ANISOU 2279  C6   DA I  38    16929   9433  14439   -355    140  -1686       C  
ATOM   2280  N6   DA I  38      41.586  50.379  -5.724  1.00111.66           N  
ANISOU 2280  N6   DA I  38    17817   9532  15078   -439    232  -1922       N  
ATOM   2281  N1   DA I  38      41.271  50.859  -3.481  1.00108.32           N  
ANISOU 2281  N1   DA I  38    16634   9707  14815   -270     35  -1324       N  
ATOM   2282  C2   DA I  38      41.222  51.766  -2.496  1.00104.93           C  
ANISOU 2282  C2   DA I  38    15850   9739  14279   -181    -58  -1106       C  
ATOM   2283  N3   DA I  38      41.409  53.087  -2.561  1.00101.11           N  
ANISOU 2283  N3   DA I  38    15357   9584  13476   -163    -70  -1197       N  
ATOM   2284  C4   DA I  38      41.674  53.472  -3.822  1.00100.77           C  
ANISOU 2284  C4   DA I  38    15732   9361  13196   -254     33  -1542       C  
ATOM   2285  P    DT I  39      44.209  58.247  -0.951  1.00 97.14           P  
ANISOU 2285  P    DT I  39    14067  10638  12206    375    234  -1228       P  
ATOM   2286  OP1  DT I  39      44.215  59.365   0.014  1.00 93.32           O  
ANISOU 2286  OP1  DT I  39    13206  10635  11617    478    119  -1087       O  
ATOM   2287  OP2  DT I  39      45.368  58.061  -1.851  1.00116.00           O  
ANISOU 2287  OP2  DT I  39    16733  12752  14588    433    560  -1465       O  
ATOM   2288  O5'  DT I  39      44.007  56.887  -0.144  1.00 96.00           O  
ANISOU 2288  O5'  DT I  39    13687  10367  12424    438    232   -962       O  
ATOM   2289  C5'  DT I  39      42.883  56.734   0.705  1.00 97.62           C  
ANISOU 2289  C5'  DT I  39    13628  10774  12689    377    -62   -707       C  
ATOM   2290  C4'  DT I  39      42.913  55.386   1.397  1.00104.76           C  
ANISOU 2290  C4'  DT I  39    14318  11522  13964    451    -12   -456       C  
ATOM   2291  O4'  DT I  39      42.816  54.327   0.408  1.00108.01           O  
ANISOU 2291  O4'  DT I  39    15114  11426  14500    334     66   -614       O  
ATOM   2292  C3'  DT I  39      44.178  55.102   2.204  1.00111.75           C  
ANISOU 2292  C3'  DT I  39    14881  12501  15080    707    264   -308       C  
ATOM   2293  O3'  DT I  39      43.826  54.462   3.421  1.00121.95           O  
ANISOU 2293  O3'  DT I  39    15751  13965  16621    782    158     51       O  
ATOM   2294  C2'  DT I  39      44.980  54.179   1.283  1.00113.07           C  
ANISOU 2294  C2'  DT I  39    15378  12179  15407    722    543   -503       C  
ATOM   2295  C1'  DT I  39      43.868  53.405   0.593  1.00109.98           C  
ANISOU 2295  C1'  DT I  39    15285  11453  15051    498    351   -563       C  
ATOM   2296  N1   DT I  39      44.241  52.838  -0.749  1.00108.59           N  
ANISOU 2296  N1   DT I  39    15585  10799  14875    417    528   -883       N  
ATOM   2297  C2   DT I  39      44.129  51.481  -0.958  1.00113.01           C  
ANISOU 2297  C2   DT I  39    16246  10954  15737    385    571   -855       C  
ATOM   2298  O2   DT I  39      43.754  50.702  -0.100  1.00112.57           O  
ANISOU 2298  O2   DT I  39    15911  10900  15960    416    475   -564       O  
ATOM   2299  N3   DT I  39      44.477  51.065  -2.217  1.00115.24           N  
ANISOU 2299  N3   DT I  39    16964  10833  15989    314    729  -1183       N  
ATOM   2300  C4   DT I  39      44.912  51.848  -3.267  1.00112.69           C  
ANISOU 2300  C4   DT I  39    16973  10486  15358    269    847  -1513       C  
ATOM   2301  O4   DT I  39      45.203  51.380  -4.362  1.00118.84           O  
ANISOU 2301  O4   DT I  39    18122  10911  16123    208    987  -1796       O  
ATOM   2302  C5   DT I  39      45.005  53.257  -2.989  1.00105.41           C  
ANISOU 2302  C5   DT I  39    15925   9992  14136    298    792  -1503       C  
ATOM   2303  C7   DT I  39      45.474  54.193  -4.061  1.00101.88           C  
ANISOU 2303  C7   DT I  39    15803   9555  13353    248    906  -1824       C  
ATOM   2304  C6   DT I  39      44.665  53.686  -1.758  1.00104.18           C  
ANISOU 2304  C6   DT I  39    15347  10220  14016    372    634  -1200       C  
ATOM   2305  P    DA I  40      44.844  54.444   4.663  1.00117.69           P  
ANISOU 2305  P    DA I  40    14721  13722  16274   1048    341    300       P  
ATOM   2306  OP1  DA I  40      44.076  54.778   5.884  1.00119.93           O  
ANISOU 2306  OP1  DA I  40    14558  14465  16546   1071     87    599       O  
ATOM   2307  OP2  DA I  40      46.033  55.246   4.299  1.00114.77           O  
ANISOU 2307  OP2  DA I  40    14434  13411  15762   1174    596     83       O  
ATOM   2308  O5'  DA I  40      45.290  52.915   4.745  1.00119.59           O  
ANISOU 2308  O5'  DA I  40    14948  13579  16912   1112    518    434       O  
ATOM   2309  C5'  DA I  40      44.330  51.891   4.526  1.00120.76           C  
ANISOU 2309  C5'  DA I  40    15222  13432  17228    951    348    523       C  
ATOM   2310  C4'  DA I  40      45.010  50.545   4.402  1.00124.43           C  
ANISOU 2310  C4'  DA I  40    15734  13476  18068   1030    571    572       C  
ATOM   2311  O4'  DA I  40      45.163  50.197   2.997  1.00125.49           O  
ANISOU 2311  O4'  DA I  40    16389  13133  18159    916    686    217       O  
ATOM   2312  C3'  DA I  40      46.407  50.481   5.013  1.00126.49           C  
ANISOU 2312  C3'  DA I  40    15726  13840  18493   1287    876    662       C  
ATOM   2313  O3'  DA I  40      46.573  49.241   5.696  1.00130.81           O  
ANISOU 2313  O3'  DA I  40    16025  14232  19446   1373    931    952       O  
ATOM   2314  C2'  DA I  40      47.321  50.593   3.790  1.00126.49           C  
ANISOU 2314  C2'  DA I  40    16152  13509  18398   1301   1144    277       C  
ATOM   2315  C1'  DA I  40      46.507  49.857   2.737  1.00127.45           C  
ANISOU 2315  C1'  DA I  40    16696  13178  18552   1085   1029     97       C  
ATOM   2316  N9   DA I  40      46.828  50.247   1.363  1.00128.19           N  
ANISOU 2316  N9   DA I  40    17273  13024  18410    999   1153   -318       N  
ATOM   2317  C8   DA I  40      47.055  51.513   0.902  1.00127.02           C  
ANISOU 2317  C8   DA I  40    17264  13102  17897    982   1176   -533       C  
ATOM   2318  N7   DA I  40      47.315  51.572  -0.383  1.00127.59           N  
ANISOU 2318  N7   DA I  40    17781  12882  17817    894   1295   -884       N  
ATOM   2319  C5   DA I  40      47.255  50.252  -0.797  1.00132.10           C  
ANISOU 2319  C5   DA I  40    18519  13001  18671    856   1354   -921       C  
ATOM   2320  C6   DA I  40      47.439  49.643  -2.056  1.00138.88           C  
ANISOU 2320  C6   DA I  40    19816  13410  19540    769   1480  -1242       C  
ATOM   2321  N6   DA I  40      47.734  50.325  -3.168  1.00141.98           N  
ANISOU 2321  N6   DA I  40    20569  13753  19623    699   1575  -1585       N  
ATOM   2322  N1   DA I  40      47.309  48.303  -2.127  1.00142.91           N  
ANISOU 2322  N1   DA I  40    20372  13530  20397    756   1500  -1198       N  
ATOM   2323  C2   DA I  40      47.017  47.622  -1.011  1.00142.28           C  
ANISOU 2323  C2   DA I  40    19921  13506  20633    821   1401   -833       C  
ATOM   2324  N3   DA I  40      46.818  48.083   0.226  1.00137.53           N  
ANISOU 2324  N3   DA I  40    18886  13327  20042    902   1282   -496       N  
ATOM   2325  C4   DA I  40      46.954  49.419   0.265  1.00132.24           C  
ANISOU 2325  C4   DA I  40    18184  13041  19021    918   1266   -571       C  
ATOM   2326  P    DC I  41      47.747  49.047   6.777  1.00135.00           P  
ANISOU 2326  P    DC I  41    16113  14977  20205   1642   1166   1201       P  
ATOM   2327  OP1  DC I  41      47.125  48.582   8.036  1.00134.57           O  
ANISOU 2327  OP1  DC I  41    15594  15189  20349   1668    977   1634       O  
ATOM   2328  OP2  DC I  41      48.583  50.268   6.774  1.00132.08           O  
ANISOU 2328  OP2  DC I  41    15706  14915  19562   1765   1317   1033       O  
ATOM   2329  O5'  DC I  41      48.606  47.852   6.161  1.00137.15           O  
ANISOU 2329  O5'  DC I  41    16602  14706  20803   1708   1439   1095       O  
ATOM   2330  C5'  DC I  41      48.446  47.533   4.793  1.00140.28           C  
ANISOU 2330  C5'  DC I  41    17519  14634  21145   1560   1475    744       C  
ATOM   2331  C4'  DC I  41      49.312  46.368   4.389  1.00145.94           C  
ANISOU 2331  C4'  DC I  41    18365  14879  22208   1655   1734    672       C  
ATOM   2332  O4'  DC I  41      49.442  46.362   2.944  1.00147.13           O  
ANISOU 2332  O4'  DC I  41    19043  14648  22213   1546   1832    242       O  
ATOM   2333  C3'  DC I  41      50.734  46.409   4.919  1.00148.38           C  
ANISOU 2333  C3'  DC I  41    18428  15305  22644   1913   2047    739       C  
ATOM   2334  O3'  DC I  41      51.232  45.082   4.995  1.00154.92           O  
ANISOU 2334  O3'  DC I  41    19214  15747  23903   2001   2197    842       O  
ATOM   2335  C2'  DC I  41      51.445  47.224   3.844  1.00146.33           C  
ANISOU 2335  C2'  DC I  41    18537  14984  22077   1918   2241    322       C  
ATOM   2336  C1'  DC I  41      50.760  46.722   2.579  1.00146.52           C  
ANISOU 2336  C1'  DC I  41    19050  14555  22066   1708   2152     31       C  
ATOM   2337  N1   DC I  41      50.699  47.738   1.481  1.00141.94           N  
ANISOU 2337  N1   DC I  41    18861  14004  21067   1591   2157   -346       N  
ATOM   2338  C2   DC I  41      50.860  47.322   0.159  1.00144.07           C  
ANISOU 2338  C2   DC I  41    19595  13841  21302   1501   2270   -709       C  
ATOM   2339  O2   DC I  41      51.046  46.122  -0.063  1.00147.56           O  
ANISOU 2339  O2   DC I  41    20115  13879  22073   1524   2361   -723       O  
ATOM   2340  N3   DC I  41      50.812  48.245  -0.834  1.00142.22           N  
ANISOU 2340  N3   DC I  41    19703  13653  20683   1392   2275  -1033       N  
ATOM   2341  C4   DC I  41      50.611  49.531  -0.540  1.00136.80           C  
ANISOU 2341  C4   DC I  41    18908  13396  19674   1373   2166  -1000       C  
ATOM   2342  N4   DC I  41      50.570  50.407  -1.551  1.00136.79           N  
ANISOU 2342  N4   DC I  41    19246  13417  19310   1261   2169  -1310       N  
ATOM   2343  C5   DC I  41      50.444  49.977   0.806  1.00132.96           C  
ANISOU 2343  C5   DC I  41    17950  13343  19227   1470   2047   -650       C  
ATOM   2344  C6   DC I  41      50.496  49.055   1.775  1.00135.65           C  
ANISOU 2344  C6   DC I  41    17954  13656  19930   1576   2049   -333       C  
ATOM   2345  P    DA I  42      52.675  44.759   5.624  1.00140.28           P  
ANISOU 2345  P    DA I  42    17074  13931  22295   2275   2520    971       P  
ATOM   2346  OP1  DA I  42      52.452  43.830   6.755  1.00142.37           O  
ANISOU 2346  OP1  DA I  42    16919  14229  22944   2342   2435   1413       O  
ATOM   2347  OP2  DA I  42      53.418  46.018   5.855  1.00136.71           O  
ANISOU 2347  OP2  DA I  42    16509  13902  21532   2397   2652    889       O  
ATOM   2348  O5'  DA I  42      53.394  43.954   4.448  1.00145.12           O  
ANISOU 2348  O5'  DA I  42    18097  13971  23072   2291   2765    632       O  
ATOM   2349  C5'  DA I  42      52.593  43.277   3.485  1.00147.80           C  
ANISOU 2349  C5'  DA I  42    18818  13868  23472   2094   2633    432       C  
ATOM   2350  C4'  DA I  42      53.444  42.633   2.405  1.00151.47           C  
ANISOU 2350  C4'  DA I  42    19638  13849  24063   2143   2899     81       C  
ATOM   2351  O4'  DA I  42      53.375  43.415   1.187  1.00152.86           O  
ANISOU 2351  O4'  DA I  42    20256  13982  23843   2022   2924   -344       O  
ATOM   2352  C3'  DA I  42      54.920  42.501   2.729  1.00150.55           C  
ANISOU 2352  C3'  DA I  42    19345  13750  24106   2401   3239     99       C  
ATOM   2353  O3'  DA I  42      55.432  41.335   2.102  1.00148.84           O  
ANISOU 2353  O3'  DA I  42    19326  13006  24220   2448   3410    -66       O  
ATOM   2354  C2'  DA I  42      55.516  43.783   2.139  1.00151.41           C  
ANISOU 2354  C2'  DA I  42    19646  14112  23772   2425   3383   -200       C  
ATOM   2355  C1'  DA I  42      54.616  44.047   0.931  1.00154.16           C  
ANISOU 2355  C1'  DA I  42    20460  14270  23843   2182   3219   -533       C  
ATOM   2356  N9   DA I  42      54.347  45.465   0.688  1.00154.67           N  
ANISOU 2356  N9   DA I  42    20620  14713  23435   2097   3130   -663       N  
ATOM   2357  C8   DA I  42      53.991  46.405   1.614  1.00153.44           C  
ANISOU 2357  C8   DA I  42    20149  15053  23098   2109   2975   -418       C  
ATOM   2358  N7   DA I  42      53.789  47.599   1.107  1.00152.43           N  
ANISOU 2358  N7   DA I  42    20201  15159  22556   2016   2913   -619       N  
ATOM   2359  C5   DA I  42      54.023  47.430  -0.247  1.00153.63           C  
ANISOU 2359  C5   DA I  42    20818  14956  22597   1933   3038  -1011       C  
ATOM   2360  C6   DA I  42      53.976  48.322  -1.340  1.00153.08           C  
ANISOU 2360  C6   DA I  42    21119  14911  22134   1812   3047  -1354       C  
ATOM   2361  N6   DA I  42      53.663  49.618  -1.224  1.00149.23           N  
ANISOU 2361  N6   DA I  42    20591  14815  21295   1753   2919  -1354       N  
ATOM   2362  N1   DA I  42      54.265  47.828  -2.561  1.00155.65           N  
ANISOU 2362  N1   DA I  42    21851  14846  22444   1755   3190  -1697       N  
ATOM   2363  C2   DA I  42      54.579  46.531  -2.676  1.00157.79           C  
ANISOU 2363  C2   DA I  42    22156  14716  23082   1820   3312  -1711       C  
ATOM   2364  N3   DA I  42      54.656  45.600  -1.727  1.00158.37           N  
ANISOU 2364  N3   DA I  42    21909  14701  23562   1934   3313  -1407       N  
ATOM   2365  C4   DA I  42      54.362  46.118  -0.525  1.00155.75           C  
ANISOU 2365  C4   DA I  42    21176  14777  23224   1983   3172  -1053       C  
ATOM   2366  P    DC I  43      56.965  40.904   2.298  1.00162.16           P  
ANISOU 2366  P    DC I  43    20874  14586  26152   2713   3774    -75       P  
ATOM   2367  OP1  DC I  43      57.022  39.427   2.225  1.00163.76           O  
ANISOU 2367  OP1  DC I  43    21086  14287  26849   2743   3809    -20       O  
ATOM   2368  OP2  DC I  43      57.497  41.605   3.488  1.00158.69           O  
ANISOU 2368  OP2  DC I  43    19990  14654  25651   2878   3835    237       O  
ATOM   2369  O5'  DC I  43      57.679  41.502   1.004  1.00158.59           O  
ANISOU 2369  O5'  DC I  43    20853  14028  25376   2712   3997   -574       O  
ATOM   2370  C5'  DC I  43      57.071  41.339  -0.268  1.00158.06           C  
ANISOU 2370  C5'  DC I  43    21254  13633  25167   2519   3914   -942       C  
ATOM   2371  C4'  DC I  43      57.873  42.047  -1.337  1.00156.07           C  
ANISOU 2371  C4'  DC I  43    21335  13386  24576   2544   4144  -1363       C  
ATOM   2372  O4'  DC I  43      57.372  43.400  -1.514  1.00152.87           O  
ANISOU 2372  O4'  DC I  43    21018  13372  23694   2418   4006  -1431       O  
ATOM   2373  C3'  DC I  43      59.368  42.177  -1.035  1.00155.05           C  
ANISOU 2373  C3'  DC I  43    21032  13365  24516   2800   4485  -1362       C  
ATOM   2374  O3'  DC I  43      60.117  41.811  -2.186  1.00157.76           O  
ANISOU 2374  O3'  DC I  43    21724  13371  24848   2837   4726  -1767       O  
ATOM   2375  C2'  DC I  43      59.528  43.659  -0.694  1.00151.06           C  
ANISOU 2375  C2'  DC I  43    20405  13394  23595   2813   4476  -1311       C  
ATOM   2376  C1'  DC I  43      58.459  44.289  -1.564  1.00151.04           C  
ANISOU 2376  C1'  DC I  43    20751  13408  23230   2560   4247  -1537       C  
ATOM   2377  N1   DC I  43      58.008  45.628  -1.081  1.00147.47           N  
ANISOU 2377  N1   DC I  43    20154  13457  22421   2497   4081  -1408       N  
ATOM   2378  C2   DC I  43      57.920  46.691  -1.985  1.00144.64           C  
ANISOU 2378  C2   DC I  43    20099  13234  21623   2379   4071  -1701       C  
ATOM   2379  O2   DC I  43      58.217  46.493  -3.168  1.00148.58           O  
ANISOU 2379  O2   DC I  43    20978  13451  22023   2327   4203  -2057       O  
ATOM   2380  N3   DC I  43      57.510  47.904  -1.535  1.00137.87           N  
ANISOU 2380  N3   DC I  43    19100  12817  20466   2327   3911  -1585       N  
ATOM   2381  C4   DC I  43      57.200  48.068  -0.247  1.00134.20           C  
ANISOU 2381  C4   DC I  43    18210  12664  20115   2391   3771  -1210       C  
ATOM   2382  N4   DC I  43      56.798  49.280   0.155  1.00128.56           N  
ANISOU 2382  N4   DC I  43    17364  12379  19103   2342   3611  -1128       N  
ATOM   2383  C5   DC I  43      57.287  46.996   0.689  1.00137.58           C  
ANISOU 2383  C5   DC I  43    18319  12983  20971   2510   3784   -902       C  
ATOM   2384  C6   DC I  43      57.692  45.806   0.233  1.00143.88           C  
ANISOU 2384  C6   DC I  43    19262  13330  22074   2557   3939  -1006       C  
ATOM   2385  P    DT I  44      61.725  41.833  -2.184  1.00157.46           P  
ANISOU 2385  P    DT I  44    21601  13355  24870   3091   5110  -1864       P  
ATOM   2386  OP1  DT I  44      62.171  40.491  -2.615  1.00160.36           O  
ANISOU 2386  OP1  DT I  44    22079  13214  25634   3173   5260  -2007       O  
ATOM   2387  OP2  DT I  44      62.235  42.385  -0.908  1.00154.75           O  
ANISOU 2387  OP2  DT I  44    20806  13438  24554   3254   5161  -1499       O  
ATOM   2388  O5'  DT I  44      62.064  42.869  -3.348  1.00153.54           O  
ANISOU 2388  O5'  DT I  44    21474  12982  23884   3018   5226  -2272       O  
ATOM   2389  C5'  DT I  44      61.259  42.881  -4.521  1.00152.10           C  
ANISOU 2389  C5'  DT I  44    21717  12590  23484   2798   5089  -2595       C  
ATOM   2390  C4'  DT I  44      61.716  43.961  -5.480  1.00148.50           C  
ANISOU 2390  C4'  DT I  44    21543  12323  22559   2753   5219  -2923       C  
ATOM   2391  O4'  DT I  44      61.130  45.232  -5.100  1.00144.56           O  
ANISOU 2391  O4'  DT I  44    20951  12263  21712   2647   5027  -2776       O  
ATOM   2392  C3'  DT I  44      63.225  44.165  -5.540  1.00148.00           C  
ANISOU 2392  C3'  DT I  44    21411  12341  22479   2975   5577  -3026       C  
ATOM   2393  O3'  DT I  44      63.646  44.259  -6.898  1.00152.87           O  
ANISOU 2393  O3'  DT I  44    22429  12796  22859   2926   5740  -3465       O  
ATOM   2394  C2'  DT I  44      63.453  45.463  -4.762  1.00144.07           C  
ANISOU 2394  C2'  DT I  44    20649  12367  21725   3023   5559  -2801       C  
ATOM   2395  C1'  DT I  44      62.132  46.208  -4.917  1.00142.44           C  
ANISOU 2395  C1'  DT I  44    20562  12333  21224   2780   5228  -2778       C  
ATOM   2396  N1   DT I  44      61.762  47.028  -3.713  1.00140.44           N  
ANISOU 2396  N1   DT I  44    19937  12517  20907   2797   5056  -2413       N  
ATOM   2397  C2   DT I  44      61.387  48.344  -3.876  1.00137.36           C  
ANISOU 2397  C2   DT I  44    19607  12474  20109   2682   4927  -2453       C  
ATOM   2398  O2   DT I  44      61.344  48.898  -4.959  1.00138.87           O  
ANISOU 2398  O2   DT I  44    20142  12641  19981   2560   4947  -2756       O  
ATOM   2399  N3   DT I  44      61.062  48.994  -2.711  1.00132.19           N  
ANISOU 2399  N3   DT I  44    18582  12206  19438   2716   4770  -2122       N  
ATOM   2400  C4   DT I  44      61.074  48.474  -1.431  1.00129.77           C  
ANISOU 2400  C4   DT I  44    17857  11993  19457   2847   4732  -1756       C  
ATOM   2401  O4   DT I  44      60.767  49.140  -0.446  1.00122.28           O  
ANISOU 2401  O4   DT I  44    16585  11425  18451   2870   4586  -1488       O  
ATOM   2402  C5   DT I  44      61.473  47.092  -1.330  1.00135.50           C  
ANISOU 2402  C5   DT I  44    18541  12344  20601   2957   4872  -1712       C  
ATOM   2403  C7   DT I  44      61.525  46.423   0.010  1.00136.17           C  
ANISOU 2403  C7   DT I  44    18174  12499  21065   3100   4843  -1305       C  
ATOM   2404  C6   DT I  44      61.790  46.442  -2.462  1.00140.03           C  
ANISOU 2404  C6   DT I  44    19478  12516  21211   2928   5023  -2042       C  
ATOM   2405  P    DT I  45      65.136  44.728  -7.276  1.00150.84           P  
ANISOU 2405  P    DT I  45    22196  12670  22447   3106   6102  -3654       P  
ATOM   2406  OP1  DT I  45      65.477  44.093  -8.569  1.00152.60           O  
ANISOU 2406  OP1  DT I  45    22732  12661  22588   3034   6145  -4014       O  
ATOM   2407  OP2  DT I  45      66.031  44.520  -6.115  1.00152.25           O  
ANISOU 2407  OP2  DT I  45    21961  12972  22914   3348   6266  -3352       O  
ATOM   2408  O5'  DT I  45      64.965  46.294  -7.522  1.00146.35           O  
ANISOU 2408  O5'  DT I  45    21704  12536  21368   2989   6026  -3689       O  
ATOM   2409  C5'  DT I  45      63.798  46.766  -8.179  1.00144.53           C  
ANISOU 2409  C5'  DT I  45    21741  12325  20848   2734   5763  -3811       C  
ATOM   2410  C4'  DT I  45      63.900  48.247  -8.476  1.00140.94           C  
ANISOU 2410  C4'  DT I  45    21354  12265  19931   2658   5748  -3868       C  
ATOM   2411  O4'  DT I  45      63.451  49.014  -7.329  1.00140.77           O  
ANISOU 2411  O4'  DT I  45    21001  12603  19883   2658   5557  -3512       O  
ATOM   2412  C3'  DT I  45      65.300  48.747  -8.804  1.00140.23           C  
ANISOU 2412  C3'  DT I  45    21218  12399  19666   2779   5987  -3960       C  
ATOM   2413  O3'  DT I  45      65.210  49.716  -9.839  1.00139.35           O  
ANISOU 2413  O3'  DT I  45    21353  12498  19094   2602   5898  -4159       O  
ATOM   2414  C2'  DT I  45      65.768  49.350  -7.476  1.00139.40           C  
ANISOU 2414  C2'  DT I  45    20702  12605  19658   2953   6055  -3630       C  
ATOM   2415  C1'  DT I  45      64.471  49.893  -6.899  1.00139.28           C  
ANISOU 2415  C1'  DT I  45    20605  12745  19569   2809   5742  -3429       C  
ATOM   2416  N1   DT I  45      64.424  49.946  -5.398  1.00137.64           N  
ANISOU 2416  N1   DT I  45    19934  12771  19594   2934   5657  -3022       N  
ATOM   2417  C2   DT I  45      64.018  51.107  -4.781  1.00133.78           C  
ANISOU 2417  C2   DT I  45    19255  12686  18888   2884   5479  -2837       C  
ATOM   2418  O2   DT I  45      63.718  52.118  -5.391  1.00133.64           O  
ANISOU 2418  O2   DT I  45    19428  12838  18511   2744   5388  -2980       O  
ATOM   2419  N3   DT I  45      63.983  51.048  -3.413  1.00131.02           N  
ANISOU 2419  N3   DT I  45    18472  12545  18765   3006   5408  -2476       N  
ATOM   2420  C4   DT I  45      64.298  49.966  -2.614  1.00132.06           C  
ANISOU 2420  C4   DT I  45    18345  12524  19309   3164   5493  -2266       C  
ATOM   2421  O4   DT I  45      64.234  50.013  -1.390  1.00133.27           O  
ANISOU 2421  O4   DT I  45    18099  12911  19625   3263   5417  -1934       O  
ATOM   2422  C5   DT I  45      64.706  48.776  -3.319  1.00134.52           C  
ANISOU 2422  C5   DT I  45    18876  12388  19847   3206   5673  -2465       C  
ATOM   2423  C7   DT I  45      65.076  47.543  -2.550  1.00135.96           C  
ANISOU 2423  C7   DT I  45    18801  12357  20500   3375   5772  -2253       C  
ATOM   2424  C6   DT I  45      64.745  48.819  -4.663  1.00137.98           C  
ANISOU 2424  C6   DT I  45    19741  12618  20065   3092   5745  -2839       C  
ATOM   2425  P    DT I  46      66.510  50.479 -10.393  1.00139.96           P  
ANISOU 2425  P    DT I  46    21376  12921  18881   2633   5999  -4215       P  
ATOM   2426  OP1  DT I  46      66.402  50.493 -11.869  1.00138.84           O  
ANISOU 2426  OP1  DT I  46    21576  12722  18456   2463   5938  -4520       O  
ATOM   2427  OP2  DT I  46      67.728  49.919  -9.763  1.00143.45           O  
ANISOU 2427  OP2  DT I  46    21532  13389  19583   2848   6183  -4076       O  
ATOM   2428  O5'  DT I  46      66.293  51.967  -9.862  1.00131.48           O  
ANISOU 2428  O5'  DT I  46    20168  12243  17547   2592   5905  -4048       O  
ATOM   2429  C5'  DT I  46      64.966  52.455  -9.704  1.00127.20           C  
ANISOU 2429  C5'  DT I  46    19748  11682  16902   2455   5727  -4034       C  
ATOM   2430  C4'  DT I  46      64.960  53.892  -9.224  1.00123.34           C  
ANISOU 2430  C4'  DT I  46    19099  11598  16166   2437   5649  -3885       C  
ATOM   2431  O4'  DT I  46      64.885  53.933  -7.776  1.00122.06           O  
ANISOU 2431  O4'  DT I  46    18583  11538  16258   2607   5681  -3601       O  
ATOM   2432  C3'  DT I  46      66.179  54.714  -9.608  1.00124.98           C  
ANISOU 2432  C3'  DT I  46    19206  12133  16148   2463   5714  -3885       C  
ATOM   2433  O3'  DT I  46      65.767  56.043  -9.868  1.00123.82           O  
ANISOU 2433  O3'  DT I  46    19122  12258  15667   2323   5561  -3888       O  
ATOM   2434  C2'  DT I  46      67.062  54.614  -8.361  1.00124.48           C  
ANISOU 2434  C2'  DT I  46    18728  12229  16340   2687   5835  -3621       C  
ATOM   2435  C1'  DT I  46      66.033  54.561  -7.239  1.00122.78           C  
ANISOU 2435  C1'  DT I  46    18359  11974  16316   2736   5761  -3435       C  
ATOM   2436  N1   DT I  46      66.465  53.767  -6.041  1.00129.83           N  
ANISOU 2436  N1   DT I  46    18901  12825  17605   2954   5877  -3192       N  
ATOM   2437  C2   DT I  46      66.152  54.228  -4.780  1.00133.84           C  
ANISOU 2437  C2   DT I  46    19069  13562  18221   3057   5822  -2921       C  
ATOM   2438  O2   DT I  46      65.557  55.273  -4.579  1.00134.78           O  
ANISOU 2438  O2   DT I  46    19135  13961  18116   2950   5611  -2848       O  
ATOM   2439  N3   DT I  46      66.570  53.420  -3.755  1.00134.15           N  
ANISOU 2439  N3   DT I  46    18780  13567  18625   3247   5917  -2687       N  
ATOM   2440  C4   DT I  46      67.247  52.221  -3.857  1.00130.70           C  
ANISOU 2440  C4   DT I  46    18334  12868  18458   3341   6061  -2703       C  
ATOM   2441  O4   DT I  46      67.580  51.567  -2.872  1.00127.88           O  
ANISOU 2441  O4   DT I  46    17660  12508  18422   3503   6122  -2463       O  
ATOM   2442  C5   DT I  46      67.537  51.789  -5.202  1.00131.13           C  
ANISOU 2442  C5   DT I  46    18762  12675  18387   3233   6118  -3013       C  
ATOM   2443  C7   DT I  46      68.274  50.503  -5.430  1.00132.05           C  
ANISOU 2443  C7   DT I  46    18893  12505  18776   3328   6265  -3070       C  
ATOM   2444  C6   DT I  46      67.132  52.570  -6.220  1.00132.52           C  
ANISOU 2444  C6   DT I  46    19247  12907  18198   3047   6022  -3237       C  
ATOM   2445  P    DT I  47      66.777  57.133 -10.478  1.00130.22           P  
ANISOU 2445  P    DT I  47    18309  11589  19578   4794   2122  -4065       P  
ATOM   2446  OP1  DT I  47      66.200  57.591 -11.761  1.00128.28           O  
ANISOU 2446  OP1  DT I  47    18117  11702  18923   4640   2252  -4371       O  
ATOM   2447  OP2  DT I  47      68.161  56.609 -10.441  1.00138.00           O  
ANISOU 2447  OP2  DT I  47    18990  12399  21044   5211   1928  -4015       O  
ATOM   2448  O5'  DT I  47      66.660  58.329  -9.432  1.00123.17           O  
ANISOU 2448  O5'  DT I  47    17491  10834  18473   4717   2014  -3834       O  
ATOM   2449  C5'  DT I  47      65.541  58.377  -8.545  1.00116.72           C  
ANISOU 2449  C5'  DT I  47    16999  10123  17225   4514   1682  -3772       C  
ATOM   2450  C4'  DT I  47      65.842  59.258  -7.351  1.00109.28           C  
ANISOU 2450  C4'  DT I  47    15989   9276  16257   4555   1356  -3547       C  
ATOM   2451  O4'  DT I  47      66.166  58.432  -6.198  1.00109.18           O  
ANISOU 2451  O4'  DT I  47    15881   8967  16634   4700    954  -3347       O  
ATOM   2452  C3'  DT I  47      67.034  60.188  -7.538  1.00111.84           C  
ANISOU 2452  C3'  DT I  47    16015   9623  16858   4742   1608  -3427       C  
ATOM   2453  O3'  DT I  47      66.805  61.398  -6.842  1.00108.63           O  
ANISOU 2453  O3'  DT I  47    15628   9501  16146   4625   1347  -3368       O  
ATOM   2454  C2'  DT I  47      68.165  59.389  -6.901  1.00118.78           C  
ANISOU 2454  C2'  DT I  47    16666  10122  18344   5080   1546  -3140       C  
ATOM   2455  C1'  DT I  47      67.440  58.800  -5.707  1.00114.52           C  
ANISOU 2455  C1'  DT I  47    16184   9521  17808   4937    932  -3107       C  
ATOM   2456  N1   DT I  47      68.097  57.593  -5.124  1.00117.89           N  
ANISOU 2456  N1   DT I  47    16365   9575  18853   5105    752  -2893       N  
ATOM   2457  C2   DT I  47      68.078  57.412  -3.758  1.00119.91           C  
ANISOU 2457  C2   DT I  47    16353   9783  19426   4948    182  -2664       C  
ATOM   2458  O2   DT I  47      67.550  58.194  -2.987  1.00119.70           O  
ANISOU 2458  O2   DT I  47    16323  10102  19055   4617   -154  -2565       O  
ATOM   2459  N3   DT I  47      68.701  56.272  -3.323  1.00124.17           N  
ANISOU 2459  N3   DT I  47    16625   9987  20566   5062     81  -2425       N  
ATOM   2460  C4   DT I  47      69.328  55.316  -4.100  1.00129.26           C  
ANISOU 2460  C4   DT I  47    17289  10366  21459   5334    473  -2418       C  
ATOM   2461  O4   DT I  47      69.862  54.324  -3.617  1.00134.47           O  
ANISOU 2461  O4   DT I  47    17709  10764  22621   5408    349  -2177       O  
ATOM   2462  C5   DT I  47      69.315  55.567  -5.521  1.00128.16           C  
ANISOU 2462  C5   DT I  47    17500  10334  20862   5505   1018  -2672       C  
ATOM   2463  C7   DT I  47      69.971  54.599  -6.460  1.00133.54           C  
ANISOU 2463  C7   DT I  47    18292  10820  21627   5828   1347  -2705       C  
ATOM   2464  C6   DT I  47      68.707  56.681  -5.960  1.00122.51           C  
ANISOU 2464  C6   DT I  47    17000   9923  19624   5364   1155  -2868       C  
ATOM   2465  P    DG I  48      66.633  62.777  -7.646  1.00107.47           P  
ANISOU 2465  P    DG I  48    15493   9734  15608   4454   1619  -3490       P  
ATOM   2466  OP1  DG I  48      65.394  62.685  -8.450  1.00104.42           O  
ANISOU 2466  OP1  DG I  48    15349   9598  14729   4150   1683  -3710       O  
ATOM   2467  OP2  DG I  48      67.921  63.069  -8.311  1.00114.59           O  
ANISOU 2467  OP2  DG I  48    16044  10544  16950   4689   1952  -3461       O  
ATOM   2468  O5'  DG I  48      66.416  63.857  -6.489  1.00 96.31           O  
ANISOU 2468  O5'  DG I  48    14119   8532  13942   4366   1226  -3381       O  
ATOM   2469  C5'  DG I  48      65.453  63.613  -5.472  1.00 91.66           C  
ANISOU 2469  C5'  DG I  48    13724   8013  13089   4190    708  -3401       C  
ATOM   2470  C4'  DG I  48      66.077  63.712  -4.091  1.00 93.06           C  
ANISOU 2470  C4'  DG I  48    13563   8150  13646   4131    261  -3106       C  
ATOM   2471  O4'  DG I  48      66.882  62.533  -3.825  1.00100.99           O  
ANISOU 2471  O4'  DG I  48    14279   8813  15279   4282    224  -2901       O  
ATOM   2472  C3'  DG I  48      66.997  64.911  -3.874  1.00 90.49           C  
ANISOU 2472  C3'  DG I  48    12912   8008  13462   4069    356  -2887       C  
ATOM   2473  O3'  DG I  48      66.763  65.447  -2.586  1.00 85.34           O  
ANISOU 2473  O3'  DG I  48    12111   7611  12704   3699   -120  -2652       O  
ATOM   2474  C2'  DG I  48      68.395  64.301  -3.983  1.00 99.95           C  
ANISOU 2474  C2'  DG I  48    13695   8913  15371   4314    555  -2648       C  
ATOM   2475  C1'  DG I  48      68.164  62.925  -3.384  1.00105.04           C  
ANISOU 2475  C1'  DG I  48    14309   9320  16281   4295    253  -2557       C  
ATOM   2476  N9   DG I  48      69.121  61.915  -3.827  1.00113.82           N  
ANISOU 2476  N9   DG I  48    15206  10054  17986   4622    512  -2473       N  
ATOM   2477  C8   DG I  48      69.620  61.748  -5.095  1.00116.96           C  
ANISOU 2477  C8   DG I  48    15680  10250  18509   4999   1045  -2675       C  
ATOM   2478  N7   DG I  48      70.450  60.747  -5.199  1.00121.45           N  
ANISOU 2478  N7   DG I  48    16015  10481  19648   5246   1173  -2539       N  
ATOM   2479  C5   DG I  48      70.499  60.210  -3.920  1.00121.84           C  
ANISOU 2479  C5   DG I  48    15812  10507  19974   5013    689  -2217       C  
ATOM   2480  C6   DG I  48      71.232  59.107  -3.421  1.00127.89           C  
ANISOU 2480  C6   DG I  48    16254  10972  21365   5124    581  -1937       C  
ATOM   2481  O6   DG I  48      72.006  58.360  -4.036  1.00130.64           O  
ANISOU 2481  O6   DG I  48    16481  10995  22164   5469    909  -1928       O  
ATOM   2482  N1   DG I  48      70.999  58.903  -2.063  1.00129.69           N  
ANISOU 2482  N1   DG I  48    16290  11313  21674   4794     35  -1639       N  
ATOM   2483  C2   DG I  48      70.161  59.670  -1.286  1.00125.93           C  
ANISOU 2483  C2   DG I  48    15928  11197  20723   4411   -353  -1627       C  
ATOM   2484  N2   DG I  48      70.059  59.327   0.006  1.00127.59           N  
ANISOU 2484  N2   DG I  48    15911  11485  21082   4134   -857  -1317       N  
ATOM   2485  N3   DG I  48      69.468  60.706  -1.743  1.00120.72           N  
ANISOU 2485  N3   DG I  48    15578  10809  19479   4314   -250  -1896       N  
ATOM   2486  C4   DG I  48      69.686  60.917  -3.063  1.00118.50           C  
ANISOU 2486  C4   DG I  48    15481  10422  19122   4626    276  -2175       C  
ATOM   2487  P    DG I  49      67.173  66.961  -2.244  1.00100.47           P  
ANISOU 2487  P    DG I  49    13853   9827  14495   3511   -128  -2515       P  
ATOM   2488  OP1  DG I  49      65.937  67.696  -1.896  1.00 89.24           O  
ANISOU 2488  OP1  DG I  49    12761   8719  12426   3244   -369  -2675       O  
ATOM   2489  OP2  DG I  49      68.042  67.455  -3.333  1.00105.10           O  
ANISOU 2489  OP2  DG I  49    14352  10325  15258   3794    396  -2578       O  
ATOM   2490  O5'  DG I  49      68.066  66.812  -0.928  1.00105.80           O  
ANISOU 2490  O5'  DG I  49    14025  10505  15670   3308   -508  -2074       O  
ATOM   2491  C5'  DG I  49      67.594  66.022   0.158  1.00107.53           C  
ANISOU 2491  C5'  DG I  49    14192  10729  15935   3096   -994  -1921       C  
ATOM   2492  C4'  DG I  49      68.750  65.550   1.017  1.00107.57           C  
ANISOU 2492  C4'  DG I  49    13672  10618  16581   3054  -1190  -1504       C  
ATOM   2493  O4'  DG I  49      69.393  64.416   0.385  1.00108.87           O  
ANISOU 2493  O4'  DG I  49    13725  10408  17231   3390   -921  -1484       O  
ATOM   2494  C3'  DG I  49      69.841  66.597   1.252  1.00107.65           C  
ANISOU 2494  C3'  DG I  49    13314  10761  16827   2979  -1110  -1268       C  
ATOM   2495  O3'  DG I  49      70.075  66.748   2.644  1.00112.75           O  
ANISOU 2495  O3'  DG I  49    13644  11585  17611   2649  -1592   -936       O  
ATOM   2496  C2'  DG I  49      71.065  66.034   0.521  1.00109.56           C  
ANISOU 2496  C2'  DG I  49    13273  10695  17659   3329   -714  -1153       C  
ATOM   2497  C1'  DG I  49      70.787  64.541   0.505  1.00109.83           C  
ANISOU 2497  C1'  DG I  49    13376  10442  17913   3485   -788  -1176       C  
ATOM   2498  N9   DG I  49      71.406  63.842  -0.622  1.00111.49           N  
ANISOU 2498  N9   DG I  49    13580  10317  18464   3904   -312  -1281       N  
ATOM   2499  C8   DG I  49      71.273  64.143  -1.956  1.00109.94           C  
ANISOU 2499  C8   DG I  49    13672  10057  18044   4174    177  -1614       C  
ATOM   2500  N7   DG I  49      71.937  63.338  -2.740  1.00112.13           N  
ANISOU 2500  N7   DG I  49    13870  10017  18716   4535    534  -1642       N  
ATOM   2501  C5   DG I  49      72.548  62.444  -1.871  1.00116.99           C  
ANISOU 2501  C5   DG I  49    14121  10465  19866   4506    268  -1299       C  
ATOM   2502  C6   DG I  49      73.397  61.344  -2.142  1.00124.09           C  
ANISOU 2502  C6   DG I  49    14786  11005  21357   4814    462  -1161       C  
ATOM   2503  O6   DG I  49      73.790  60.930  -3.242  1.00129.80           O  
ANISOU 2503  O6   DG I  49    15589  11483  22246   5188    923  -1336       O  
ATOM   2504  N1   DG I  49      73.797  60.702  -0.972  1.00127.48           N  
ANISOU 2504  N1   DG I  49    14853  11379  22205   4659     63   -777       N  
ATOM   2505  C2   DG I  49      73.423  61.075   0.298  1.00124.64           C  
ANISOU 2505  C2   DG I  49    14372  11291  21695   4252   -460   -560       C  
ATOM   2506  N2   DG I  49      73.906  60.339   1.308  1.00127.32           N  
ANISOU 2506  N2   DG I  49    14340  11547  22490   4156   -791   -181       N  
ATOM   2507  N3   DG I  49      72.628  62.103   0.564  1.00119.99           N  
ANISOU 2507  N3   DG I  49    14010  11039  20543   3964   -643   -702       N  
ATOM   2508  C4   DG I  49      72.230  62.739  -0.563  1.00116.69           C  
ANISOU 2508  C4   DG I  49    13945  10665  19728   4115   -257  -1068       C  
ATOM   2509  P    DT I  50      71.163  67.801   3.182  1.00111.28           P  
ANISOU 2509  P    DT I  50    13041  11571  17668   2479  -1636   -644       P  
ATOM   2510  OP1  DT I  50      70.619  68.403   4.418  1.00114.79           O  
ANISOU 2510  OP1  DT I  50    13473  12335  17806   2068  -2132   -538       O  
ATOM   2511  OP2  DT I  50      71.576  68.679   2.065  1.00110.64           O  
ANISOU 2511  OP2  DT I  50    13043  11476  17519   2675  -1147   -813       O  
ATOM   2512  O5'  DT I  50      72.400  66.881   3.588  1.00118.75           O  
ANISOU 2512  O5'  DT I  50    13474  12296  19348   2590  -1680   -255       O  
ATOM   2513  C5'  DT I  50      72.199  65.800   4.485  1.00124.06           C  
ANISOU 2513  C5'  DT I  50    14015  12900  20222   2490  -2068    -58       C  
ATOM   2514  C4'  DT I  50      73.489  65.040   4.715  1.00134.69           C  
ANISOU 2514  C4'  DT I  50    14858  14030  22289   2638  -2029    317       C  
ATOM   2515  O4'  DT I  50      73.841  64.295   3.519  1.00140.95           O  
ANISOU 2515  O4'  DT I  50    15733  14473  23350   3067  -1554    169       O  
ATOM   2516  C3'  DT I  50      74.702  65.908   5.049  1.00137.60           C  
ANISOU 2516  C3'  DT I  50    14780  14534  22967   2534  -1999    621       C  
ATOM   2517  O3'  DT I  50      75.449  65.283   6.084  1.00141.31           O  
ANISOU 2517  O3'  DT I  50    14772  14990  23928   2417  -2321   1057       O  
ATOM   2518  C2'  DT I  50      75.474  65.947   3.727  1.00140.48           C  
ANISOU 2518  C2'  DT I  50    15121  14666  23588   2927  -1410    519       C  
ATOM   2519  C1'  DT I  50      75.181  64.563   3.174  1.00144.06           C  
ANISOU 2519  C1'  DT I  50    15738  14782  24217   3239  -1259    392       C  
ATOM   2520  N1   DT I  50      75.317  64.451   1.689  1.00145.37           N  
ANISOU 2520  N1   DT I  50    16130  14718  24385   3645   -681     99       N  
ATOM   2521  C2   DT I  50      76.095  63.445   1.162  1.00149.73           C  
ANISOU 2521  C2   DT I  50    16491  14937  25464   3999   -400    200       C  
ATOM   2522  O2   DT I  50      76.697  62.637   1.848  1.00152.93           O  
ANISOU 2522  O2   DT I  50    16539  15214  26353   4003   -596    533       O  
ATOM   2523  N3   DT I  50      76.147  63.418  -0.206  1.00149.18           N  
ANISOU 2523  N3   DT I  50    16660  14690  25332   4359    129   -100       N  
ATOM   2524  C4   DT I  50      75.513  64.274  -1.085  1.00142.51           C  
ANISOU 2524  C4   DT I  50    16207  13977  23965   4394    395   -469       C  
ATOM   2525  O4   DT I  50      75.624  64.167  -2.303  1.00139.84           O  
ANISOU 2525  O4   DT I  50    16050  13479  23604   4730    872   -714       O  
ATOM   2526  C5   DT I  50      74.710  65.304  -0.471  1.00139.69           C  
ANISOU 2526  C5   DT I  50    16028  13962  23085   4014     80   -543       C  
ATOM   2527  C7   DT I  50      73.978  66.292  -1.329  1.00135.36           C  
ANISOU 2527  C7   DT I  50    15894  13579  21956   4024    336   -914       C  
ATOM   2528  C6   DT I  50      74.648  65.342   0.872  1.00141.35           C  
ANISOU 2528  C6   DT I  50    16020  14340  23347   3664   -435   -267       C  
ATOM   2529  P    DA I  51      76.597  66.081   6.875  1.00143.47           P  
ANISOU 2529  P    DA I  51    14529  15476  24509   2182  -2484   1453       P  
ATOM   2530  OP1  DA I  51      76.189  66.156   8.295  1.00142.97           O  
ANISOU 2530  OP1  DA I  51    14346  15685  24292   1773  -3068   1649       O  
ATOM   2531  OP2  DA I  51      76.913  67.326   6.141  1.00141.50           O  
ANISOU 2531  OP2  DA I  51    14359  15324  24079   2210  -2151   1296       O  
ATOM   2532  O5'  DA I  51      77.855  65.105   6.759  1.00150.52           O  
ANISOU 2532  O5'  DA I  51    14951  16093  26146   2454  -2316   1806       O  
ATOM   2533  C5'  DA I  51      77.957  64.221   5.649  1.00155.54           C  
ANISOU 2533  C5'  DA I  51    15729  16369  27001   2891  -1886   1642       C  
ATOM   2534  C4'  DA I  51      79.396  64.095   5.202  1.00162.34           C  
ANISOU 2534  C4'  DA I  51    16150  17066  28466   3152  -1548   1921       C  
ATOM   2535  O4'  DA I  51      79.445  63.804   3.779  1.00164.37           O  
ANISOU 2535  O4'  DA I  51    16655  17046  28753   3585   -992   1627       O  
ATOM   2536  C3'  DA I  51      80.232  65.352   5.404  1.00162.53           C  
ANISOU 2536  C3'  DA I  51    15874  17341  28537   2963  -1526   2113       C  
ATOM   2537  O3'  DA I  51      81.544  64.985   5.794  1.00164.73           O  
ANISOU 2537  O3'  DA I  51    15575  17561  29453   3023  -1531   2578       O  
ATOM   2538  C2'  DA I  51      80.205  66.005   4.021  1.00162.89           C  
ANISOU 2538  C2'  DA I  51    16212  17313  28368   3227   -989   1772       C  
ATOM   2539  C1'  DA I  51      80.213  64.785   3.113  1.00165.91           C  
ANISOU 2539  C1'  DA I  51    16722  17320  28997   3674   -638   1635       C  
ATOM   2540  N9   DA I  51      79.612  65.021   1.801  1.00165.46           N  
ANISOU 2540  N9   DA I  51    17135  17160  28570   3934   -199   1177       N  
ATOM   2541  C8   DA I  51      78.576  65.865   1.509  1.00161.59           C  
ANISOU 2541  C8   DA I  51    17094  16855  27446   3783   -204    813       C  
ATOM   2542  N7   DA I  51      78.236  65.868   0.241  1.00161.68           N  
ANISOU 2542  N7   DA I  51    17456  16732  27244   4086    245    455       N  
ATOM   2543  C5   DA I  51      79.106  64.959  -0.340  1.00164.86           C  
ANISOU 2543  C5   DA I  51    17635  16834  28172   4465    568    575       C  
ATOM   2544  C6   DA I  51      79.261  64.508  -1.667  1.00163.97           C  
ANISOU 2544  C6   DA I  51    17701  16470  28132   4904   1099    331       C  
ATOM   2545  N6   DA I  51      78.505  64.937  -2.682  1.00160.73           N  
ANISOU 2545  N6   DA I  51    17747  16086  27236   5025   1397    -94       N  
ATOM   2546  N1   DA I  51      80.225  63.595  -1.910  1.00166.96           N  
ANISOU 2546  N1   DA I  51    17765  16575  29097   5220   1316    545       N  
ATOM   2547  C2   DA I  51      80.980  63.167  -0.890  1.00169.86           C  
ANISOU 2547  C2   DA I  51    17661  16928  29950   5099   1016    990       C  
ATOM   2548  N3   DA I  51      80.928  63.517   0.397  1.00169.84           N  
ANISOU 2548  N3   DA I  51    17439  17160  29932   4687    507   1263       N  
ATOM   2549  C4   DA I  51      79.960  64.425   0.607  1.00167.40           C  
ANISOU 2549  C4   DA I  51    17462  17115  29027   4383    304   1024       C  
ATOM   2550  P    DG I  52      82.491  66.027   6.565  1.00170.69           P  
ANISOU 2550  P    DG I  52    15871  18615  30368   2702  -1731   2941       P  
ATOM   2551  OP1  DG I  52      82.829  65.445   7.883  1.00172.37           O  
ANISOU 2551  OP1  DG I  52    15676  18927  30889   2461  -2212   3363       O  
ATOM   2552  OP2  DG I  52      81.862  67.365   6.488  1.00164.27           O  
ANISOU 2552  OP2  DG I  52    15373  18057  28985   2445  -1770   2660       O  
ATOM   2553  O5'  DG I  52      83.805  66.047   5.662  1.00176.02           O  
ANISOU 2553  O5'  DG I  52    16215  19118  31546   3049  -1233   3122       O  
ATOM   2554  C5'  DG I  52      83.690  65.772   4.279  1.00178.37           C  
ANISOU 2554  C5'  DG I  52    16805  19156  31813   3479   -697   2807       C  
ATOM   2555  C4'  DG I  52      84.765  64.813   3.821  1.00187.43           C  
ANISOU 2555  C4'  DG I  52    17590  20020  33604   3875   -384   3071       C  
ATOM   2556  O4'  DG I  52      84.397  64.276   2.532  1.00187.20           O  
ANISOU 2556  O4'  DG I  52    17934  19702  33492   4306     91   2700       O  
ATOM   2557  C3'  DG I  52      86.105  65.462   3.580  1.00195.65           C  
ANISOU 2557  C3'  DG I  52    18173  21141  35025   3937   -141   3386       C  
ATOM   2558  O3'  DG I  52      87.123  64.478   3.554  1.00207.73           O  
ANISOU 2558  O3'  DG I  52    19273  22455  37199   4225      5   3743       O  
ATOM   2559  C2'  DG I  52      85.892  66.087   2.206  1.00191.60           C  
ANISOU 2559  C2'  DG I  52    18016  20565  34218   4195    374   2996       C  
ATOM   2560  C1'  DG I  52      85.004  65.048   1.510  1.00186.94           C  
ANISOU 2560  C1'  DG I  52    17874  19683  33470   4510    561   2620       C  
ATOM   2561  N9   DG I  52      83.945  65.632   0.685  1.00178.42           N  
ANISOU 2561  N9   DG I  52    17369  18642  31779   4537    755   2109       N  
ATOM   2562  C8   DG I  52      82.919  66.444   1.107  1.00172.65           C  
ANISOU 2562  C8   DG I  52    16972  18155  30472   4182    462   1879       C  
ATOM   2563  N7   DG I  52      82.113  66.807   0.149  1.00169.22           N  
ANISOU 2563  N7   DG I  52    17020  17703  29573   4312    743   1440       N  
ATOM   2564  C5   DG I  52      82.632  66.193  -0.983  1.00172.72           C  
ANISOU 2564  C5   DG I  52    17455  17878  30292   4779   1251   1361       C  
ATOM   2565  C6   DG I  52      82.179  66.223  -2.323  1.00167.98           C  
ANISOU 2565  C6   DG I  52    17260  17158  29407   5099   1722    949       C  
ATOM   2566  O6   DG I  52      81.196  66.818  -2.789  1.00159.29           O  
ANISOU 2566  O6   DG I  52    16611  16169  27741   5028   1783    574       O  
ATOM   2567  N1   DG I  52      82.994  65.464  -3.159  1.00171.48           N  
ANISOU 2567  N1   DG I  52    17536  17333  30285   5544   2157   1006       N  
ATOM   2568  C2   DG I  52      84.106  64.766  -2.751  1.00175.10           C  
ANISOU 2568  C2   DG I  52    17511  17665  31353   5655   2137   1416       C  
ATOM   2569  N2   DG I  52      84.766  64.092  -3.704  1.00176.22           N  
ANISOU 2569  N2   DG I  52    17723  17705  31528   5932   2520   1351       N  
ATOM   2570  N3   DG I  52      84.542  64.729  -1.498  1.00179.43           N  
ANISOU 2570  N3   DG I  52    17649  18312  32213   5374   1703   1827       N  
ATOM   2571  C4   DG I  52      83.759  65.463  -0.671  1.00177.79           C  
ANISOU 2571  C4   DG I  52    17603  18373  31578   4930   1270   1766       C  
ATOM   2572  P    DT I  53      88.666  64.919   3.623  1.00196.65           P  
ANISOU 2572  P    DT I  53    17250  21151  36317   4253    149   4221       P  
ATOM   2573  OP1  DT I  53      89.448  63.756   4.097  1.00202.78           O  
ANISOU 2573  OP1  DT I  53    17757  21824  37465   4292     86   4555       O  
ATOM   2574  OP2  DT I  53      88.729  66.199   4.363  1.00195.63           O  
ANISOU 2574  OP2  DT I  53    17000  21389  35942   3777   -172   4333       O  
ATOM   2575  O5'  DT I  53      89.043  65.217   2.098  1.00200.14           O  
ANISOU 2575  O5'  DT I  53    17885  21462  36695   4638    801   3967       O  
ATOM   2576  C5'  DT I  53      88.837  64.216   1.109  1.00201.70           C  
ANISOU 2576  C5'  DT I  53    18443  21380  36814   5015   1184   3668       C  
ATOM   2577  C4'  DT I  53      89.136  64.757  -0.278  1.00200.96           C  
ANISOU 2577  C4'  DT I  53    18551  21265  36542   5290   1744   3414       C  
ATOM   2578  O4'  DT I  53      87.923  65.285  -0.874  1.00195.61           O  
ANISOU 2578  O4'  DT I  53    18365  20574  35383   5335   1841   2935       O  
ATOM   2579  C3'  DT I  53      90.169  65.887  -0.325  1.00200.92           C  
ANISOU 2579  C3'  DT I  53    18155  21483  36704   5177   1860   3706       C  
ATOM   2580  O3'  DT I  53      91.183  65.570  -1.276  1.00202.69           O  
ANISOU 2580  O3'  DT I  53    18310  21630  37074   5463   2321   3763       O  
ATOM   2581  C2'  DT I  53      89.351  67.116  -0.741  1.00196.05           C  
ANISOU 2581  C2'  DT I  53    17808  20988  35694   5106   1930   3390       C  
ATOM   2582  C1'  DT I  53      88.223  66.487  -1.539  1.00194.82           C  
ANISOU 2582  C1'  DT I  53    18252  20632  35140   5346   2123   2872       C  
ATOM   2583  N1   DT I  53      86.987  67.322  -1.583  1.00192.19           N  
ANISOU 2583  N1   DT I  53    18355  20424  34245   5150   2000   2493       N  
ATOM   2584  C2   DT I  53      86.295  67.441  -2.765  1.00191.39           C  
ANISOU 2584  C2   DT I  53    18729  20235  33755   5404   2388   2036       C  
ATOM   2585  O2   DT I  53      86.639  66.895  -3.798  1.00193.52           O  
ANISOU 2585  O2   DT I  53    19146  20378  34006   5719   2795   1892       O  
ATOM   2586  N3   DT I  53      85.174  68.227  -2.695  1.00186.80           N  
ANISOU 2586  N3   DT I  53    18583  19833  32559   5132   2217   1705       N  
ATOM   2587  C4   DT I  53      84.688  68.893  -1.585  1.00182.70           C  
ANISOU 2587  C4   DT I  53    18079  19559  31779   4651   1712   1773       C  
ATOM   2588  O4   DT I  53      83.670  69.577  -1.622  1.00176.91           O  
ANISOU 2588  O4   DT I  53    17757  18972  30490   4452   1607   1459       O  
ATOM   2589  C5   DT I  53      85.463  68.726  -0.378  1.00185.29           C  
ANISOU 2589  C5   DT I  53    17904  19969  32530   4402   1322   2244       C  
ATOM   2590  C7   DT I  53      85.035  69.399   0.892  1.00181.82           C  
ANISOU 2590  C7   DT I  53    17437  19804  31844   3880    763   2346       C  
ATOM   2591  C6   DT I  53      86.564  67.961  -0.437  1.00190.18           C  
ANISOU 2591  C6   DT I  53    18083  20422  33753   4657   1481   2584       C  
ATOM   2592  P    DA I  54      92.246  66.678  -1.752  1.00224.19           P  
ANISOU 2592  P    DA I  54    20735  24542  39905   5445   2591   3977       P  
ATOM   2593  OP1  DA I  54      93.452  65.954  -2.208  1.00229.20           O  
ANISOU 2593  OP1  DA I  54    21149  25088  40849   5673   2878   4210       O  
ATOM   2594  OP2  DA I  54      92.374  67.709  -0.696  1.00223.46           O  
ANISOU 2594  OP2  DA I  54    20282  24692  39930   5048   2198   4277       O  
ATOM   2595  O5'  DA I  54      91.550  67.341  -3.028  1.00214.87           O  
ANISOU 2595  O5'  DA I  54    20035  23359  38245   5633   2983   3489       O  
ATOM   2596  C5'  DA I  54      91.055  66.509  -4.071  1.00208.23           C  
ANISOU 2596  C5'  DA I  54    19666  22331  37123   5952   3297   3078       C  
ATOM   2597  C4'  DA I  54      90.666  67.332  -5.284  1.00199.67           C  
ANISOU 2597  C4'  DA I  54    18949  21327  35592   6079   3670   2704       C  
ATOM   2598  O4'  DA I  54      89.330  67.875  -5.102  1.00189.82           O  
ANISOU 2598  O4'  DA I  54    18056  20118  33949   5935   3497   2375       O  
ATOM   2599  C3'  DA I  54      91.575  68.528  -5.578  1.00199.85           C  
ANISOU 2599  C3'  DA I  54    18666  21551  35718   6007   3860   2941       C  
ATOM   2600  O3'  DA I  54      91.788  68.628  -6.977  1.00203.99           O  
ANISOU 2600  O3'  DA I  54    19453  22083  35972   6267   4321   2693       O  
ATOM   2601  C2'  DA I  54      90.762  69.707  -5.050  1.00191.39           C  
ANISOU 2601  C2'  DA I  54    17648  20630  34442   5730   3630   2858       C  
ATOM   2602  C1'  DA I  54      89.351  69.257  -5.373  1.00185.29           C  
ANISOU 2602  C1'  DA I  54    17449  19740  33211   5816   3612   2359       C  
ATOM   2603  N9   DA I  54      88.333  69.908  -4.556  1.00178.01           N  
ANISOU 2603  N9   DA I  54    16614  18889  32133   5558   3266   2266       N  
ATOM   2604  C8   DA I  54      88.360  70.103  -3.203  1.00177.04           C  
ANISOU 2604  C8   DA I  54    16194  18872  32199   5197   2759   2557       C  
ATOM   2605  N7   DA I  54      87.302  70.723  -2.737  1.00173.12           N  
ANISOU 2605  N7   DA I  54    16059  18535  31185   4851   2442   2309       N  
ATOM   2606  C5   DA I  54      86.527  70.949  -3.863  1.00169.09           C  
ANISOU 2606  C5   DA I  54    16032  17975  30240   5072   2804   1861       C  
ATOM   2607  C6   DA I  54      85.274  71.567  -4.045  1.00157.64           C  
ANISOU 2607  C6   DA I  54    15108  16637  28152   4906   2730   1451       C  
ATOM   2608  N6   DA I  54      84.560  72.090  -3.044  1.00151.28           N  
ANISOU 2608  N6   DA I  54    14437  16016  27025   4470   2251   1418       N  
ATOM   2609  N1   DA I  54      84.783  71.627  -5.300  1.00154.28           N  
ANISOU 2609  N1   DA I  54    15059  16138  27422   5212   3173   1080       N  
ATOM   2610  C2   DA I  54      85.500  71.100  -6.300  1.00157.82           C  
ANISOU 2610  C2   DA I  54    15383  16419  28163   5644   3649   1102       C  
ATOM   2611  N3   DA I  54      86.687  70.497  -6.252  1.00167.66           N  
ANISOU 2611  N3   DA I  54    16248  17607  29846   5745   3707   1434       N  
ATOM   2612  C4   DA I  54      87.149  70.453  -4.993  1.00172.63           C  
ANISOU 2612  C4   DA I  54    16403  18239  30950   5547   3333   1841       C  
ATOM   2613  P    DG I  55      92.904  69.618  -7.576  1.00191.14           P  
ANISOU 2613  P    DG I  55    17536  20629  34459   6281   4614   2934       P  
ATOM   2614  OP1  DG I  55      93.981  68.775  -8.138  1.00196.04           O  
ANISOU 2614  OP1  DG I  55    17993  21163  35330   6536   4868   3100       O  
ATOM   2615  OP2  DG I  55      93.240  70.648  -6.567  1.00191.12           O  
ANISOU 2615  OP2  DG I  55    17111  20788  34718   5956   4341   3297       O  
ATOM   2616  O5'  DG I  55      92.137  70.350  -8.772  1.00187.17           O  
ANISOU 2616  O5'  DG I  55    17521  20215  33381   6371   4910   2477       O  
ATOM   2617  C5'  DG I  55      91.170  69.634  -9.531  1.00187.12           C  
ANISOU 2617  C5'  DG I  55    18056  20105  32936   6553   5016   1995       C  
ATOM   2618  C4'  DG I  55      90.201  70.587 -10.208  1.00185.96           C  
ANISOU 2618  C4'  DG I  55    18328  20097  32233   6492   5128   1616       C  
ATOM   2619  O4'  DG I  55      89.168  70.988  -9.273  1.00181.82           O  
ANISOU 2619  O4'  DG I  55    17909  19581  31593   6255   4802   1527       O  
ATOM   2620  C3'  DG I  55      90.830  71.876 -10.740  1.00189.51           C  
ANISOU 2620  C3'  DG I  55    18610  20744  32652   6436   5358   1757       C  
ATOM   2621  O3'  DG I  55      90.547  72.011 -12.128  1.00192.34           O  
ANISOU 2621  O3'  DG I  55    19359  21179  32542   6603   5669   1407       O  
ATOM   2622  C2'  DG I  55      90.179  72.989  -9.906  1.00184.67           C  
ANISOU 2622  C2'  DG I  55    17958  20236  31973   6141   5120   1787       C  
ATOM   2623  C1'  DG I  55      88.873  72.349  -9.462  1.00178.98           C  
ANISOU 2623  C1'  DG I  55    17613  19402  30989   6103   4872   1463       C  
ATOM   2624  N9   DG I  55      88.362  72.883  -8.199  1.00173.36           N  
ANISOU 2624  N9   DG I  55    16740  18712  30415   5828   4504   1590       N  
ATOM   2625  C8   DG I  55      88.933  72.741  -6.958  1.00174.35           C  
ANISOU 2625  C8   DG I  55    16371  18811  31064   5659   4173   2006       C  
ATOM   2626  N7   DG I  55      88.258  73.317  -6.004  1.00170.79           N  
ANISOU 2626  N7   DG I  55    15901  18429  30563   5374   3816   2015       N  
ATOM   2627  C5   DG I  55      87.165  73.880  -6.650  1.00166.78           C  
ANISOU 2627  C5   DG I  55    15922  17982  29464   5369   3948   1573       C  
ATOM   2628  C6   DG I  55      86.085  74.630  -6.124  1.00160.61           C  
ANISOU 2628  C6   DG I  55    15502  17364  28159   4992   3615   1342       C  
ATOM   2629  O6   DG I  55      85.884  74.954  -4.946  1.00157.70           O  
ANISOU 2629  O6   DG I  55    15058  17120  27738   4578   3122   1473       O  
ATOM   2630  N1   DG I  55      85.185  75.013  -7.117  1.00158.19           N  
ANISOU 2630  N1   DG I  55    15681  17078  27346   5141   3911    920       N  
ATOM   2631  C2   DG I  55      85.312  74.707  -8.452  1.00160.14           C  
ANISOU 2631  C2   DG I  55    16083  17238  27524   5545   4421    729       C  
ATOM   2632  N2   DG I  55      84.344  75.166  -9.265  1.00156.48           N  
ANISOU 2632  N2   DG I  55    16136  16876  26444   5555   4575    325       N  
ATOM   2633  N3   DG I  55      86.322  74.002  -8.961  1.00164.90           N  
ANISOU 2633  N3   DG I  55    16493  17785  28377   5734   4598    896       N  
ATOM   2634  C4   DG I  55      87.208  73.621  -8.003  1.00167.81           C  
ANISOU 2634  C4   DG I  55    16342  18079  29341   5673   4388   1322       C  
ATOM   2635  P    DG I  56      90.997  73.328 -12.931  1.00182.17           P  
ANISOU 2635  P    DG I  56    18017  20101  31099   6566   5935   1464       P  
ATOM   2636  OP1  DG I  56      91.138  72.953 -14.355  1.00184.65           O  
ANISOU 2636  OP1  DG I  56    18594  20452  31114   6809   6241   1216       O  
ATOM   2637  OP2  DG I  56      92.140  73.941 -12.218  1.00185.10           O  
ANISOU 2637  OP2  DG I  56    17819  20520  31992   6441   5897   1974       O  
ATOM   2638  O5'  DG I  56      89.737  74.299 -12.788  1.00178.72           O  
ANISOU 2638  O5'  DG I  56    17918  19773  30213   6357   5815   1182       O  
ATOM   2639  C5'  DG I  56      88.432  73.789 -13.021  1.00177.28           C  
ANISOU 2639  C5'  DG I  56    18246  19553  29560   6376   5714    737       C  
ATOM   2640  C4'  DG I  56      87.391  74.889 -12.938  1.00173.30           C  
ANISOU 2640  C4'  DG I  56    18020  19186  28640   6170   5636    523       C  
ATOM   2641  O4'  DG I  56      87.108  75.199 -11.549  1.00173.27           O  
ANISOU 2641  O4'  DG I  56    17810  19129  28897   5956   5336    701       O  
ATOM   2642  C3'  DG I  56      87.785  76.212 -13.588  1.00170.23           C  
ANISOU 2642  C3'  DG I  56    17566  18989  28125   6105   5862    602       C  
ATOM   2643  O3'  DG I  56      86.637  76.788 -14.179  1.00158.20           O  
ANISOU 2643  O3'  DG I  56    16514  17597  25999   6025   5873    224       O  
ATOM   2644  C2'  DG I  56      88.267  77.037 -12.395  1.00172.80           C  
ANISOU 2644  C2'  DG I  56    17444  19319  28895   5892   5707    986       C  
ATOM   2645  C1'  DG I  56      87.280  76.584 -11.334  1.00172.12           C  
ANISOU 2645  C1'  DG I  56    17490  19124  28783   5773   5370    858       C  
ATOM   2646  N9   DG I  56      87.725  76.777  -9.958  1.00173.21           N  
ANISOU 2646  N9   DG I  56    17145  19211  29458   5589   5090   1235       N  
ATOM   2647  C8   DG I  56      88.902  76.348  -9.392  1.00177.19           C  
ANISOU 2647  C8   DG I  56    17123  19655  30544   5597   5007   1665       C  
ATOM   2648  N7   DG I  56      89.006  76.646  -8.125  1.00176.82           N  
ANISOU 2648  N7   DG I  56    16702  19612  30868   5363   4667   1945       N  
ATOM   2649  C5   DG I  56      87.817  77.303  -7.831  1.00171.33           C  
ANISOU 2649  C5   DG I  56    16426  19015  29658   5095   4442   1639       C  
ATOM   2650  C6   DG I  56      87.354  77.857  -6.613  1.00167.45           C  
ANISOU 2650  C6   DG I  56    15979  18658  28986   4601   3902   1681       C  
ATOM   2651  O6   DG I  56      87.928  77.885  -5.514  1.00168.92           O  
ANISOU 2651  O6   DG I  56    15805  18903  29474   4304   3516   2014       O  
ATOM   2652  N1   DG I  56      86.092  78.434  -6.755  1.00161.60           N  
ANISOU 2652  N1   DG I  56    15762  18001  27639   4460   3834   1288       N  
ATOM   2653  C2   DG I  56      85.372  78.462  -7.925  1.00158.36           C  
ANISOU 2653  C2   DG I  56    15767  17558  26846   4750   4229    914       C  
ATOM   2654  N2   DG I  56      84.177  79.057  -7.871  1.00149.95           N  
ANISOU 2654  N2   DG I  56    15163  16596  25213   4557   4092    588       N  
ATOM   2655  N3   DG I  56      85.793  77.944  -9.068  1.00161.95           N  
ANISOU 2655  N3   DG I  56    16185  17895  27454   5201   4727    865       N  
ATOM   2656  C4   DG I  56      87.019  77.385  -8.948  1.00168.68           C  
ANISOU 2656  C4   DG I  56    16539  18655  28895   5353   4808   1234       C  
ATOM   2657  P    DA I  57      86.746  77.627 -15.543  1.00167.91           P  
ANISOU 2657  P    DA I  57    17912  19027  26858   6062   6149    102       P  
ATOM   2658  OP1  DA I  57      86.070  76.849 -16.606  1.00166.36           O  
ANISOU 2658  OP1  DA I  57    18128  18869  26213   6195   6184   -289       O  
ATOM   2659  OP2  DA I  57      88.156  78.040 -15.714  1.00171.05           O  
ANISOU 2659  OP2  DA I  57    17860  19444  27686   6127   6359    491       O  
ATOM   2660  O5'  DA I  57      85.875  78.929 -15.236  1.00159.12           O  
ANISOU 2660  O5'  DA I  57    16985  18046  25427   5816   6062      0       O  
ATOM   2661  C5'  DA I  57      84.753  78.834 -14.359  1.00149.80           C  
ANISOU 2661  C5'  DA I  57    16033  16818  24065   5671   5793   -183       C  
ATOM   2662  C4'  DA I  57      84.321  80.207 -13.878  1.00142.44           C  
ANISOU 2662  C4'  DA I  57    15121  15989  23009   5442   5750   -151       C  
ATOM   2663  O4'  DA I  57      84.633  80.356 -12.466  1.00142.43           O  
ANISOU 2663  O4'  DA I  57    14743  15870  23505   5318   5566    132       O  
ATOM   2664  C3'  DA I  57      85.013  81.375 -14.564  1.00143.29           C  
ANISOU 2664  C3'  DA I  57    15075  16238  23132   5412   5997     17       C  
ATOM   2665  O3'  DA I  57      84.172  82.511 -14.503  1.00140.14           O  
ANISOU 2665  O3'  DA I  57    14921  15961  22365   5218   5960   -129       O  
ATOM   2666  C2'  DA I  57      86.229  81.565 -13.663  1.00146.52           C  
ANISOU 2666  C2'  DA I  57    14889  16551  24231   5378   5996    480       C  
ATOM   2667  C1'  DA I  57      85.566  81.409 -12.303  1.00146.79           C  
ANISOU 2667  C1'  DA I  57    14888  16482  24404   5225   5688    470       C  
ATOM   2668  N9   DA I  57      86.475  81.052 -11.220  1.00157.12           N  
ANISOU 2668  N9   DA I  57    15638  17672  26388   5185   5523    868       N  
ATOM   2669  C8   DA I  57      87.594  80.273 -11.303  1.00162.93           C  
ANISOU 2669  C8   DA I  57    16025  18335  27546   5329   5576   1143       C  
ATOM   2670  N7   DA I  57      88.209  80.108 -10.155  1.00164.59           N  
ANISOU 2670  N7   DA I  57    15744  18476  28316   5213   5335   1500       N  
ATOM   2671  C5   DA I  57      87.436  80.824  -9.257  1.00160.93           C  
ANISOU 2671  C5   DA I  57    15461  18109  27575   4807   4935   1409       C  
ATOM   2672  C6   DA I  57      87.554  81.046  -7.870  1.00161.08           C  
ANISOU 2672  C6   DA I  57    15293  18194  27717   4362   4389   1622       C  
ATOM   2673  N6   DA I  57      88.545  80.543  -7.131  1.00165.95           N  
ANISOU 2673  N6   DA I  57    15426  18776  28853   4288   4185   2012       N  
ATOM   2674  N1   DA I  57      86.614  81.809  -7.274  1.00156.56           N  
ANISOU 2674  N1   DA I  57    15045  17735  26705   3998   4064   1423       N  
ATOM   2675  C2   DA I  57      85.622  82.310  -8.021  1.00152.65           C  
ANISOU 2675  C2   DA I  57    15024  17283  25694   4079   4274   1051       C  
ATOM   2676  N3   DA I  57      85.409  82.173  -9.332  1.00152.14           N  
ANISOU 2676  N3   DA I  57    15167  17174  25463   4473   4775    834       N  
ATOM   2677  C4   DA I  57      86.361  81.410  -9.894  1.00156.92           C  
ANISOU 2677  C4   DA I  57    15448  17669  26507   4825   5086   1024       C  
ATOM   2678  P    DC I  58      83.016  82.771 -15.590  1.00138.13           P  
ANISOU 2678  P    DC I  58    15212  15888  21385   5183   5960   -532       P  
ATOM   2679  OP1  DC I  58      82.427  81.473 -15.989  1.00135.38           O  
ANISOU 2679  OP1  DC I  58    15129  15506  20802   5303   5843   -808       O  
ATOM   2680  OP2  DC I  58      83.576  83.663 -16.628  1.00141.54           O  
ANISOU 2680  OP2  DC I  58    15582  16460  21738   5201   6202   -438       O  
ATOM   2681  O5'  DC I  58      81.915  83.603 -14.770  1.00136.03           O  
ANISOU 2681  O5'  DC I  58    15181  15665  20838   4946   5772   -670       O  
ATOM   2682  C5'  DC I  58      81.201  82.975 -13.701  1.00134.33           C  
ANISOU 2682  C5'  DC I  58    15069  15335  20636   4888   5519   -778       C  
ATOM   2683  C4'  DC I  58      80.624  83.989 -12.712  1.00130.50           C  
ANISOU 2683  C4'  DC I  58    14627  14859  20098   4668   5406   -774       C  
ATOM   2684  O4'  DC I  58      81.559  84.230 -11.637  1.00132.47           O  
ANISOU 2684  O4'  DC I  58    14364  14985  20982   4590   5354   -417       O  
ATOM   2685  C3'  DC I  58      80.288  85.363 -13.260  1.00128.66           C  
ANISOU 2685  C3'  DC I  58    14578  14802  19504   4526   5517   -837       C  
ATOM   2686  O3'  DC I  58      79.222  85.917 -12.487  1.00124.80           O  
ANISOU 2686  O3'  DC I  58    14363  14340  18714   4331   5336  -1012       O  
ATOM   2687  C2'  DC I  58      81.595  86.132 -13.061  1.00131.70           C  
ANISOU 2687  C2'  DC I  58    14455  15138  20448   4522   5727   -451       C  
ATOM   2688  C1'  DC I  58      82.173  85.500 -11.792  1.00133.19           C  
ANISOU 2688  C1'  DC I  58    14256  15174  21177   4447   5478   -212       C  
ATOM   2689  N1   DC I  58      83.636  85.271 -11.856  1.00138.77           N  
ANISOU 2689  N1   DC I  58    14417  15813  22497   4562   5621    172       N  
ATOM   2690  C2   DC I  58      84.392  85.260 -10.678  1.00142.32           C  
ANISOU 2690  C2   DC I  58    14484  16242  23350   4258   5220    499       C  
ATOM   2691  O2   DC I  58      83.827  85.470  -9.599  1.00143.29           O  
ANISOU 2691  O2   DC I  58    14737  16406  23303   3894   4752    451       O  
ATOM   2692  N3   DC I  58      85.726  85.026 -10.760  1.00145.41           N  
ANISOU 2692  N3   DC I  58    14366  16584  24300   4373   5360    866       N  
ATOM   2693  C4   DC I  58      86.292  84.801 -11.946  1.00148.76           C  
ANISOU 2693  C4   DC I  58    14665  16977  24879   4782   5877    904       C  
ATOM   2694  N4   DC I  58      87.610  84.577 -11.984  1.00154.37           N  
ANISOU 2694  N4   DC I  58    14887  17659  26107   4864   5972   1279       N  
ATOM   2695  C5   DC I  58      85.536  84.812 -13.152  1.00147.35           C  
ANISOU 2695  C5   DC I  58    15024  16891  24072   4899   6050    541       C  
ATOM   2696  C6   DC I  58      84.224  85.037 -13.059  1.00142.68           C  
ANISOU 2696  C6   DC I  58    14893  16344  22975   4802   5931    197       C  
ATOM   2697  P    DC I  59      78.798  87.461 -12.635  1.00125.56           P  
ANISOU 2697  P    DC I  59    14631  14578  18497   4136   5404  -1052       P  
ATOM   2698  OP1  DC I  59      77.386  87.557 -12.202  1.00122.41           O  
ANISOU 2698  OP1  DC I  59    14687  14257  17567   3974   5148  -1351       O  
ATOM   2699  OP2  DC I  59      79.185  87.934 -13.983  1.00128.47           O  
ANISOU 2699  OP2  DC I  59    15012  15090  18711   4195   5595  -1013       O  
ATOM   2700  O5'  DC I  59      79.702  88.214 -11.551  1.00124.03           O  
ANISOU 2700  O5'  DC I  59    14024  14330  18773   3862   5232   -717       O  
ATOM   2701  C5'  DC I  59      79.558  87.905 -10.164  1.00120.10           C  
ANISOU 2701  C5'  DC I  59    13475  13810  18347   3530   4684   -655       C  
ATOM   2702  C4'  DC I  59      80.444  88.792  -9.304  1.00118.39           C  
ANISOU 2702  C4'  DC I  59    12901  13613  18468   3170   4430   -333       C  
ATOM   2703  O4'  DC I  59      81.829  88.353  -9.401  1.00123.10           O  
ANISOU 2703  O4'  DC I  59    12983  14127  19661   3293   4554     10       O  
ATOM   2704  C3'  DC I  59      80.463  90.273  -9.686  1.00117.74           C  
ANISOU 2704  C3'  DC I  59    12882  13612  18242   3038   4605   -309       C  
ATOM   2705  O3'  DC I  59      80.677  91.050  -8.519  1.00118.15           O  
ANISOU 2705  O3'  DC I  59    12811  13693  18387   2592   4182   -157       O  
ATOM   2706  C2'  DC I  59      81.685  90.335 -10.590  1.00122.68           C  
ANISOU 2706  C2'  DC I  59    13118  14196  19300   3292   5032    -48       C  
ATOM   2707  C1'  DC I  59      82.621  89.457  -9.782  1.00127.60           C  
ANISOU 2707  C1'  DC I  59    13317  14736  20429   3226   4768    228       C  
ATOM   2708  N1   DC I  59      83.817  88.972 -10.523  1.00136.75           N  
ANISOU 2708  N1   DC I  59    14063  15832  22065   3539   5133    486       N  
ATOM   2709  C2   DC I  59      85.034  88.840  -9.844  1.00141.66           C  
ANISOU 2709  C2   DC I  59    14171  16418  23236   3390   4949    876       C  
ATOM   2710  O2   DC I  59      85.083  89.131  -8.643  1.00141.97           O  
ANISOU 2710  O2   DC I  59    14117  16481  23345   2989   4480    988       O  
ATOM   2711  N3   DC I  59      86.120  88.396 -10.524  1.00144.94           N  
ANISOU 2711  N3   DC I  59    14203  16785  24084   3690   5291   1123       N  
ATOM   2712  C4   DC I  59      86.016  88.093 -11.819  1.00145.29           C  
ANISOU 2712  C4   DC I  59    14371  16815  24017   4121   5797    978       C  
ATOM   2713  N4   DC I  59      87.111  87.660 -12.452  1.00149.91           N  
ANISOU 2713  N4   DC I  59    14566  17360  25033   4419   6131   1230       N  
ATOM   2714  C5   DC I  59      84.784  88.228 -12.527  1.00142.23           C  
ANISOU 2714  C5   DC I  59    14509  16470  23064   4268   5985    572       C  
ATOM   2715  C6   DC I  59      83.721  88.666 -11.846  1.00138.31           C  
ANISOU 2715  C6   DC I  59    14378  16022  22153   3968   5643    347       C  
ATOM   2716  P    DA I  60      79.502  91.942  -7.884  1.00121.55           P  
ANISOU 2716  P    DA I  60    13664  14213  18304   2275   3890   -398       P  
ATOM   2717  OP1  DA I  60      78.408  91.025  -7.492  1.00122.99           O  
ANISOU 2717  OP1  DA I  60    14176  14419  18134   2312   3658   -665       O  
ATOM   2718  OP2  DA I  60      79.226  93.065  -8.809  1.00117.76           O  
ANISOU 2718  OP2  DA I  60    13381  13780  17582   2354   4256   -488       O  
ATOM   2719  O5'  DA I  60      80.173  92.545  -6.559  1.00116.58           O  
ANISOU 2719  O5'  DA I  60    12744  13589  17963   1810   3430   -146       O  
ATOM   2720  C5'  DA I  60      80.546  91.673  -5.494  1.00112.40           C  
ANISOU 2720  C5'  DA I  60    11970  13040  17697   1652   3021      0       C  
ATOM   2721  C4'  DA I  60      81.850  92.110  -4.833  1.00115.65           C  
ANISOU 2721  C4'  DA I  60    11884  13435  18624   1379   2838    381       C  
ATOM   2722  O4'  DA I  60      82.983  91.734  -5.659  1.00119.04           O  
ANISOU 2722  O4'  DA I  60    11922  13795  19511   1665   3210    638       O  
ATOM   2723  C3'  DA I  60      82.002  93.601  -4.578  1.00117.76           C  
ANISOU 2723  C3'  DA I  60    12165  13737  18841   1052   2771    436       C  
ATOM   2724  O3'  DA I  60      82.774  93.793  -3.401  1.00121.60           O  
ANISOU 2724  O3'  DA I  60    12307  14241  19655    666   2349    697       O  
ATOM   2725  C2'  DA I  60      82.749  94.073  -5.825  1.00118.95           C  
ANISOU 2725  C2'  DA I  60    12133  13843  19219   1310   3295    583       C  
ATOM   2726  C1'  DA I  60      83.675  92.891  -6.100  1.00123.31           C  
ANISOU 2726  C1'  DA I  60    12288  14341  20221   1580   3430    813       C  
ATOM   2727  N9   DA I  60      83.993  92.695  -7.515  1.00131.87           N  
ANISOU 2727  N9   DA I  60    13324  15392  21390   2019   3996    826       N  
ATOM   2728  C8   DA I  60      83.129  92.785  -8.569  1.00132.47           C  
ANISOU 2728  C8   DA I  60    13788  15486  21059   2311   4364    535       C  
ATOM   2729  N7   DA I  60      83.683  92.535  -9.732  1.00135.84           N  
ANISOU 2729  N7   DA I  60    14059  15890  21664   2685   4845    620       N  
ATOM   2730  C5   DA I  60      84.997  92.239  -9.420  1.00138.38           C  
ANISOU 2730  C5   DA I  60    13853  16170  22555   2648   4794    996       C  
ATOM   2731  C6   DA I  60      86.104  91.886 -10.219  1.00135.98           C  
ANISOU 2731  C6   DA I  60    13154  15836  22675   2948   5172   1259       C  
ATOM   2732  N6   DA I  60      86.043  91.761 -11.549  1.00136.11           N  
ANISOU 2732  N6   DA I  60    13264  15861  22589   3361   5694   1160       N  
ATOM   2733  N1   DA I  60      87.280  91.664  -9.596  1.00137.21           N  
ANISOU 2733  N1   DA I  60    12807  15968  23358   2810   4994   1636       N  
ATOM   2734  C2   DA I  60      87.337  91.791  -8.264  1.00139.28           C  
ANISOU 2734  C2   DA I  60    12973  16241  23706   2390   4467   1734       C  
ATOM   2735  N3   DA I  60      86.366  92.116  -7.408  1.00140.99           N  
ANISOU 2735  N3   DA I  60    13534  16488  23549   2077   4075   1501       N  
ATOM   2736  C4   DA I  60      85.209  92.330  -8.057  1.00139.06           C  
ANISOU 2736  C4   DA I  60    13784  16260  22792   2234   4270   1134       C  
ATOM   2737  P    DG I  61      82.684  95.165  -2.572  1.00109.89           P  
ANISOU 2737  P    DG I  61    10904  12801  18048    193   2045    694       P  
ATOM   2738  OP1  DG I  61      82.517  94.808  -1.145  1.00106.81           O  
ANISOU 2738  OP1  DG I  61    10471  12478  17634   -148   1479    709       O  
ATOM   2739  OP2  DG I  61      81.691  96.044  -3.228  1.00102.93           O  
ANISOU 2739  OP2  DG I  61    10489  11925  16696    265   2281    398       O  
ATOM   2740  O5'  DG I  61      84.133  95.807  -2.769  1.00118.86           O  
ANISOU 2740  O5'  DG I  61    11550  13895  19718     84   2180   1078       O  
ATOM   2741  C5'  DG I  61      85.284  95.033  -2.469  1.00126.25           C  
ANISOU 2741  C5'  DG I  61    11972  14822  21175     96   2093   1424       C  
ATOM   2742  C4'  DG I  61      86.498  95.550  -3.218  1.00133.94           C  
ANISOU 2742  C4'  DG I  61    12551  15754  22585    178   2434   1743       C  
ATOM   2743  O4'  DG I  61      86.475  95.078  -4.590  1.00135.91           O  
ANISOU 2743  O4'  DG I  61    12850  15959  22830    678   2973   1688       O  
ATOM   2744  C3'  DG I  61      86.620  97.076  -3.295  1.00136.00           C  
ANISOU 2744  C3'  DG I  61    12878  16004  22793    -96   2475   1762       C  
ATOM   2745  O3'  DG I  61      87.933  97.454  -2.920  1.00139.40           O  
ANISOU 2745  O3'  DG I  61    12802  16436  23728   -339   2366   2159       O  
ATOM   2746  C2'  DG I  61      86.347  97.380  -4.772  1.00136.03           C  
ANISOU 2746  C2'  DG I  61    13075  15968  22643    298   3053   1644       C  
ATOM   2747  C1'  DG I  61      86.894  96.126  -5.425  1.00138.20           C  
ANISOU 2747  C1'  DG I  61    13083  16230  23196    714   3324   1784       C  
ATOM   2748  N9   DG I  61      86.400  95.880  -6.778  1.00137.99           N  
ANISOU 2748  N9   DG I  61    13297  16187  22945   1178   3839   1593       N  
ATOM   2749  C8   DG I  61      85.096  95.909  -7.211  1.00134.72           C  
ANISOU 2749  C8   DG I  61    13409  15789  21991   1332   3957   1203       C  
ATOM   2750  N7   DG I  61      84.965  95.635  -8.481  1.00135.40           N  
ANISOU 2750  N7   DG I  61    13587  15872  21988   1757   4448   1118       N  
ATOM   2751  C5   DG I  61      86.266  95.411  -8.916  1.00138.44           C  
ANISOU 2751  C5   DG I  61    13477  16235  22888   1902   4676   1471       C  
ATOM   2752  C6   DG I  61      86.758  95.076 -10.201  1.00138.05           C  
ANISOU 2752  C6   DG I  61    13278  16184  22991   2340   5206   1558       C  
ATOM   2753  O6   DG I  61      86.120  94.902 -11.249  1.00137.01           O  
ANISOU 2753  O6   DG I  61    13432  16072  22552   2688   5588   1324       O  
ATOM   2754  N1   DG I  61      88.145  94.941 -10.201  1.00140.14           N  
ANISOU 2754  N1   DG I  61    12990  16436  23819   2351   5275   1968       N  
ATOM   2755  C2   DG I  61      88.952  95.109  -9.100  1.00142.72           C  
ANISOU 2755  C2   DG I  61    12954  16757  24515   1974   4873   2262       C  
ATOM   2756  N2   DG I  61      90.268  94.941  -9.284  1.00149.85           N  
ANISOU 2756  N2   DG I  61    13327  17663  25945   2046   5010   2661       N  
ATOM   2757  N3   DG I  61      88.502  95.422  -7.895  1.00140.86           N  
ANISOU 2757  N3   DG I  61    12858  16527  24135   1554   4370   2175       N  
ATOM   2758  C4   DG I  61      87.157  95.557  -7.877  1.00139.81           C  
ANISOU 2758  C4   DG I  61    13264  16401  23456   1549   4304   1773       C  
ATOM   2759  P    DG I  62      88.277  98.977  -2.543  1.00138.81           P  
ANISOU 2759  P    DG I  62    12692  16344  23705   -774   2227   2251       P  
ATOM   2760  OP1  DG I  62      88.785  98.982  -1.153  1.00142.10           O  
ANISOU 2760  OP1  DG I  62    12849  16815  24326  -1229   1684   2426       O  
ATOM   2761  OP2  DG I  62      87.122  99.827  -2.908  1.00132.35           O  
ANISOU 2761  OP2  DG I  62    12414  15493  22381   -768   2350   1889       O  
ATOM   2762  O5'  DG I  62      89.482  99.333  -3.527  1.00139.06           O  
ANISOU 2762  O5'  DG I  62    12306  16341  24188   -607   2648   2604       O  
ATOM   2763  C5'  DG I  62      90.507  98.376  -3.758  1.00139.91           C  
ANISOU 2763  C5'  DG I  62    11934  16473  24752   -387   2770   2930       C  
ATOM   2764  C4'  DG I  62      91.333  98.761  -4.968  1.00141.08           C  
ANISOU 2764  C4'  DG I  62    11819  16597  25188   -127   3278   3171       C  
ATOM   2765  O4'  DG I  62      90.731  98.212  -6.167  1.00139.21           O  
ANISOU 2765  O4'  DG I  62    11838  16342  24714    388   3748   2955       O  
ATOM   2766  C3'  DG I  62      91.468 100.266  -5.194  1.00140.25           C  
ANISOU 2766  C3'  DG I  62    11774  16454  25061   -384   3360   3213       C  
ATOM   2767  O3'  DG I  62      92.839 100.605  -5.339  1.00144.82           O  
ANISOU 2767  O3'  DG I  62    11814  17047  26165   -482   3448   3660       O  
ATOM   2768  C2'  DG I  62      90.665 100.529  -6.474  1.00137.60           C  
ANISOU 2768  C2'  DG I  62    11824  16088  24371      1   3855   2949       C  
ATOM   2769  C1'  DG I  62      90.719  99.185  -7.183  1.00139.62           C  
ANISOU 2769  C1'  DG I  62    11991  16372  24686    501   4150   2944       C  
ATOM   2770  N9   DG I  62      89.562  98.927  -8.039  1.00139.07           N  
ANISOU 2770  N9   DG I  62    12402  16297  24140    863   4458   2564       N  
ATOM   2771  C8   DG I  62      88.241  98.915  -7.661  1.00135.76           C  
ANISOU 2771  C8   DG I  62    12499  15876  23208    798   4264   2164       C  
ATOM   2772  N7   DG I  62      87.422  98.643  -8.639  1.00134.11           N  
ANISOU 2772  N7   DG I  62    12629  15678  22649   1175   4624   1898       N  
ATOM   2773  C5   DG I  62      88.253  98.455  -9.736  1.00137.21           C  
ANISOU 2773  C5   DG I  62    12717  16080  23335   1517   5090   2123       C  
ATOM   2774  C6   DG I  62      87.932  98.136 -11.078  1.00138.46           C  
ANISOU 2774  C6   DG I  62    13028  16267  23314   1993   5611   1990       C  
ATOM   2775  O6   DG I  62      86.813  97.949 -11.576  1.00138.04           O  
ANISOU 2775  O6   DG I  62    13421  16235  22792   2202   5761   1641       O  
ATOM   2776  N1   DG I  62      89.073  98.038 -11.871  1.00140.03           N  
ANISOU 2776  N1   DG I  62    12793  16484  23930   2228   5976   2317       N  
ATOM   2777  C2   DG I  62      90.361  98.225 -11.424  1.00140.76           C  
ANISOU 2777  C2   DG I  62    12360  16568  24552   2026   5849   2735       C  
ATOM   2778  N2   DG I  62      91.337  98.091 -12.331  1.00140.45           N  
ANISOU 2778  N2   DG I  62    11944  16563  24856   2315   6258   3022       N  
ATOM   2779  N3   DG I  62      90.673  98.525 -10.169  1.00143.12           N  
ANISOU 2779  N3   DG I  62    12510  16843  25027   1568   5355   2868       N  
ATOM   2780  C4   DG I  62      89.574  98.624  -9.384  1.00140.23           C  
ANISOU 2780  C4   DG I  62    12569  16457  24253   1337   4998   2539       C  
ATOM   2781  P    DT I  63      93.279 102.114  -5.664  1.00141.97           P  
ANISOU 2781  P    DT I  63    11389  16639  25915   -736   3571   3809       P  
ATOM   2782  OP1  DT I  63      94.587 102.347  -5.014  1.00145.10           O  
ANISOU 2782  OP1  DT I  63    11235  17069  26826  -1077   3326   4247       O  
ATOM   2783  OP2  DT I  63      92.146 103.020  -5.367  1.00138.56           O  
ANISOU 2783  OP2  DT I  63    11491  16143  25011   -961   3422   3436       O  
ATOM   2784  O5'  DT I  63      93.498 102.094  -7.242  1.00142.73           O  
ANISOU 2784  O5'  DT I  63    11425  16736  26068   -238   4218   3887       O  
ATOM   2785  C5'  DT I  63      94.304 101.080  -7.828  1.00146.62           C  
ANISOU 2785  C5'  DT I  63    11525  17286  26897    138   4491   4144       C  
ATOM   2786  C4'  DT I  63      94.702 101.470  -9.234  1.00149.57           C  
ANISOU 2786  C4'  DT I  63    11784  17673  27372    487   5071   4285       C  
ATOM   2787  O4'  DT I  63      93.674 101.039 -10.166  1.00147.47           O  
ANISOU 2787  O4'  DT I  63    11947  17406  26678    926   5429   3924       O  
ATOM   2788  C3'  DT I  63      94.868 102.971  -9.448  1.00150.93           C  
ANISOU 2788  C3'  DT I  63    11980  17802  27563    206   5137   4380       C  
ATOM   2789  O3'  DT I  63      95.949 103.220 -10.340  1.00155.40           O  
ANISOU 2789  O3'  DT I  63    12111  18415  28520    387   5524   4768       O  
ATOM   2790  C2'  DT I  63      93.524 103.378 -10.049  1.00147.83           C  
ANISOU 2790  C2'  DT I  63    12187  17370  26612    376   5345   3944       C  
ATOM   2791  C1'  DT I  63      93.171 102.150 -10.877  1.00147.24           C  
ANISOU 2791  C1'  DT I  63    12201  17352  26391    928   5688   3793       C  
ATOM   2792  N1   DT I  63      91.702 101.969 -11.063  1.00143.51           N  
ANISOU 2792  N1   DT I  63    12330  16864  25333   1087   5723   3307       N  
ATOM   2793  C2   DT I  63      91.217 101.604 -12.298  1.00143.27           C  
ANISOU 2793  C2   DT I  63    12499  16878  25059   1569   6209   3139       C  
ATOM   2794  O2   DT I  63      91.930 101.409 -13.266  1.00147.34           O  
ANISOU 2794  O2   DT I  63    12727  17447  25811   1890   6626   3360       O  
ATOM   2795  N3   DT I  63      89.855 101.471 -12.359  1.00139.43           N  
ANISOU 2795  N3   DT I  63    12560  16387  24031   1663   6190   2704       N  
ATOM   2796  C4   DT I  63      88.949 101.666 -11.333  1.00138.45           C  
ANISOU 2796  C4   DT I  63    12794  16220  23592   1342   5750   2432       C  
ATOM   2797  O4   DT I  63      87.740 101.521 -11.487  1.00138.17           O  
ANISOU 2797  O4   DT I  63    13232  16196  23070   1463   5774   2062       O  
ATOM   2798  C5   DT I  63      89.524 102.050 -10.067  1.00138.61           C  
ANISOU 2798  C5   DT I  63    12584  16194  23885    853   5261   2619       C  
ATOM   2799  C7   DT I  63      88.639 102.288  -8.880  1.00136.65           C  
ANISOU 2799  C7   DT I  63    12686  15913  23322    482   4765   2349       C  
ATOM   2800  C6   DT I  63      90.856 102.183  -9.994  1.00141.23           C  
ANISOU 2800  C6   DT I  63    12383  16530  24746    744   5267   3040       C  
ATOM   2801  P    DG I  64      96.631 104.675 -10.408  1.00155.70           P  
ANISOU 2801  P    DG I  64    11943  18416  28800     32   5536   5053       P  
ATOM   2802  OP1  DG I  64      98.080 104.507 -10.159  1.00162.82           O  
ANISOU 2802  OP1  DG I  64    12201  19382  30280    -91   5465   5560       O  
ATOM   2803  OP2  DG I  64      95.839 105.590  -9.556  1.00148.81           O  
ANISOU 2803  OP2  DG I  64    11466  17442  27633   -417   5153   4784       O  
ATOM   2804  O5'  DG I  64      96.427 105.104 -11.934  1.00159.28           O  
ANISOU 2804  O5'  DG I  64    12515  18892  29113    446   6152   5027       O  
ATOM   2805  C5'  DG I  64      95.363 104.532 -12.675  1.00157.63           C  
ANISOU 2805  C5'  DG I  64    12732  18703  28457    874   6444   4648       C  
ATOM   2806  C4'  DG I  64      95.532 104.768 -14.156  1.00160.24           C  
ANISOU 2806  C4'  DG I  64    13004  19102  28779   1295   7052   4745       C  
ATOM   2807  O4'  DG I  64      94.309 104.397 -14.825  1.00156.85           O  
ANISOU 2807  O4'  DG I  64    13076  18690  27831   1648   7298   4320       O  
ATOM   2808  C3'  DG I  64      95.735 106.213 -14.541  1.00161.97           C  
ANISOU 2808  C3'  DG I  64    13202  19282  29058   1079   7188   4904       C  
ATOM   2809  O3'  DG I  64      96.273 106.283 -15.850  1.00161.94           O  
ANISOU 2809  O3'  DG I  64    12960  19377  29194   1466   7738   5132       O  
ATOM   2810  C2'  DG I  64      94.307 106.748 -14.487  1.00158.97           C  
ANISOU 2810  C2'  DG I  64    13454  18827  28121   1013   7127   4446       C  
ATOM   2811  C1'  DG I  64      93.482 105.541 -14.953  1.00154.20           C  
ANISOU 2811  C1'  DG I  64    13136  18294  27160   1471   7313   4114       C  
ATOM   2812  N9   DG I  64      92.261 105.317 -14.175  1.00146.23           N  
ANISOU 2812  N9   DG I  64    12628  17225  25709   1328   6969   3682       N  
ATOM   2813  C8   DG I  64      92.112 105.407 -12.810  1.00144.70           C  
ANISOU 2813  C8   DG I  64    12504  16953  25524    885   6413   3607       C  
ATOM   2814  N7   DG I  64      90.900 105.143 -12.400  1.00140.00           N  
ANISOU 2814  N7   DG I  64    12391  16335  24467    874   6223   3198       N  
ATOM   2815  C5   DG I  64      90.203 104.856 -13.566  1.00137.63           C  
ANISOU 2815  C5   DG I  64    12358  16101  23835   1330   6675   2990       C  
ATOM   2816  C6   DG I  64      88.845 104.497 -13.755  1.00129.42           C  
ANISOU 2816  C6   DG I  64    11844  15083  22246   1522   6716   2558       C  
ATOM   2817  O6   DG I  64      87.959 104.358 -12.899  1.00124.49           O  
ANISOU 2817  O6   DG I  64    11564  14423  21313   1329   6352   2268       O  
ATOM   2818  N1   DG I  64      88.550 104.296 -15.102  1.00129.87           N  
ANISOU 2818  N1   DG I  64    12008  15228  22109   1984   7243   2481       N  
ATOM   2819  C2   DG I  64      89.453 104.424 -16.133  1.00134.22           C  
ANISOU 2819  C2   DG I  64    12201  15841  22954   2239   7681   2783       C  
ATOM   2820  N2   DG I  64      88.994 104.190 -17.369  1.00131.66           N  
ANISOU 2820  N2   DG I  64    12046  15618  22360   2679   8159   2647       N  
ATOM   2821  N3   DG I  64      90.723 104.757 -15.967  1.00139.97           N  
ANISOU 2821  N3   DG I  64    12431  16551  24200   2073   7653   3196       N  
ATOM   2822  C4   DG I  64      91.028 104.957 -14.665  1.00141.70           C  
ANISOU 2822  C4   DG I  64    12540  16680  24618   1614   7137   3278       C  
ATOM   2823  P    DG I  65      96.734 107.692 -16.465  1.00169.87           P  
ANISOU 2823  P    DG I  65    13817  20366  30358   1317   7973   5406       P  
ATOM   2824  OP1  DG I  65      97.846 107.428 -17.406  1.00172.48           O  
ANISOU 2824  OP1  DG I  65    13790  20806  30940   1626   8259   5745       O  
ATOM   2825  OP2  DG I  65      96.926 108.639 -15.345  1.00169.61           O  
ANISOU 2825  OP2  DG I  65    13765  20199  30479    714   7496   5489       O  
ATOM   2826  O5'  DG I  65      95.457 108.169 -17.295  1.00163.09           O  
ANISOU 2826  O5'  DG I  65    13511  19501  28955   1543   8278   5029       O  
ATOM   2827  C5'  DG I  65      94.838 107.275 -18.201  1.00158.25           C  
ANISOU 2827  C5'  DG I  65    13203  18982  27941   2053   8548   4744       C  
ATOM   2828  C4'  DG I  65      93.454 107.762 -18.572  1.00151.03           C  
ANISOU 2828  C4'  DG I  65    12867  18045  26472   2124   8662   4339       C  
ATOM   2829  O4'  DG I  65      92.504 107.390 -17.536  1.00144.93           O  
ANISOU 2829  O4'  DG I  65    12412  17197  25456   1935   8318   3996       O  
ATOM   2830  C3'  DG I  65      93.319 109.284 -18.732  1.00150.20           C  
ANISOU 2830  C3'  DG I  65    12832  17866  26370   1860   8749   4441       C  
ATOM   2831  O3'  DG I  65      92.505 109.560 -19.859  1.00147.56           O  
ANISOU 2831  O3'  DG I  65    12986  17583  25496   2156   8951   4176       O  
ATOM   2832  C2'  DG I  65      92.616 109.689 -17.439  1.00145.90           C  
ANISOU 2832  C2'  DG I  65    12584  17169  25682   1406   8264   4202       C  
ATOM   2833  C1'  DG I  65      91.690 108.504 -17.286  1.00141.25           C  
ANISOU 2833  C1'  DG I  65    12330  16633  24706   1660   8192   3808       C  
ATOM   2834  N9   DG I  65      91.055 108.377 -15.979  1.00138.45           N  
ANISOU 2834  N9   DG I  65    12255  16173  24174   1311   7654   3543       N  
ATOM   2835  C8   DG I  65      91.618 108.565 -14.739  1.00139.78           C  
ANISOU 2835  C8   DG I  65    12228  16246  24636    850   7164   3680       C  
ATOM   2836  N7   DG I  65      90.777 108.375 -13.756  1.00136.13           N  
ANISOU 2836  N7   DG I  65    12115  15724  23885    633   6757   3362       N  
ATOM   2837  C5   DG I  65      89.585 108.050 -14.391  1.00132.56           C  
ANISOU 2837  C5   DG I  65    12115  15327  22923    969   6992   3000       C  
ATOM   2838  C6   DG I  65      88.311 107.738 -13.855  1.00129.30           C  
ANISOU 2838  C6   DG I  65    12201  14901  22026    941   6757   2576       C  
ATOM   2839  O6   DG I  65      87.966 107.684 -12.667  1.00129.18           O  
ANISOU 2839  O6   DG I  65    12335  14822  21925    611   6280   2424       O  
ATOM   2840  N1   DG I  65      87.383 107.469 -14.862  1.00126.12           N  
ANISOU 2840  N1   DG I  65    12134  14586  21198   1351   7137   2324       N  
ATOM   2841  C2   DG I  65      87.655 107.497 -16.209  1.00125.78           C  
ANISOU 2841  C2   DG I  65    11965  14639  21188   1738   7675   2456       C  
ATOM   2842  N2   DG I  65      86.644 107.212 -17.039  1.00122.29           N  
ANISOU 2842  N2   DG I  65    11890  14291  20284   2090   7977   2171       N  
ATOM   2843  N3   DG I  65      88.837 107.784 -16.716  1.00130.52           N  
ANISOU 2843  N3   DG I  65    12101  15256  22233   1776   7903   2848       N  
ATOM   2844  C4   DG I  65      89.748 108.046 -15.755  1.00133.76           C  
ANISOU 2844  C4   DG I  65    12178  15576  23068   1381   7540   3105       C  
ATOM   2845  P    DA I  66      92.543 110.997 -20.575  1.00153.74           P  
ANISOU 2845  P    DA I  66    13852  18331  26232   2064   9120   4316       P  
ATOM   2846  OP1  DA I  66      93.686 110.999 -21.516  1.00152.95           O  
ANISOU 2846  OP1  DA I  66    13453  18316  26343   2254   9261   4640       O  
ATOM   2847  OP2  DA I  66      92.442 112.044 -19.533  1.00153.90           O  
ANISOU 2847  OP2  DA I  66    13763  18193  26520   1570   9004   4422       O  
ATOM   2848  O5'  DA I  66      91.181 111.023 -21.411  1.00145.17           O  
ANISOU 2848  O5'  DA I  66    13407  17302  24449   2332   9208   3884       O  
ATOM   2849  C5'  DA I  66      90.659 109.813 -21.947  1.00138.96           C  
ANISOU 2849  C5'  DA I  66    12911  16634  23255   2677   9173   3581       C  
ATOM   2850  C4'  DA I  66      89.146 109.777 -21.826  1.00134.09           C  
ANISOU 2850  C4'  DA I  66    12856  16014  22077   2697   9074   3135       C  
ATOM   2851  O4'  DA I  66      88.768 109.447 -20.463  1.00138.37           O  
ANISOU 2851  O4'  DA I  66    13368  16464  22744   2477   8916   3016       O  
ATOM   2852  C3'  DA I  66      88.440 111.089 -22.158  1.00132.81           C  
ANISOU 2852  C3'  DA I  66    12988  15806  21668   2580   9144   3070       C  
ATOM   2853  O3'  DA I  66      87.272 110.825 -22.918  1.00129.58           O  
ANISOU 2853  O3'  DA I  66    13103  15503  20629   2784   9069   2704       O  
ATOM   2854  C2'  DA I  66      88.104 111.667 -20.783  1.00134.00           C  
ANISOU 2854  C2'  DA I  66    13102  15796  22016   2205   9064   3051       C  
ATOM   2855  C1'  DA I  66      87.854 110.405 -19.972  1.00135.03           C  
ANISOU 2855  C1'  DA I  66    13232  15947  22126   2243   8895   2855       C  
ATOM   2856  N9   DA I  66      88.090 110.561 -18.537  1.00132.45           N  
ANISOU 2856  N9   DA I  66    12705  15481  22137   1829   8628   2926       N  
ATOM   2857  C8   DA I  66      89.288 110.792 -17.921  1.00134.41           C  
ANISOU 2857  C8   DA I  66    12510  15647  22911   1524   8403   3269       C  
ATOM   2858  N7   DA I  66      89.206 110.876 -16.613  1.00133.02           N  
ANISOU 2858  N7   DA I  66    12413  15345  22782   1111   7882   3175       N  
ATOM   2859  C5   DA I  66      87.861 110.674 -16.351  1.00127.73           C  
ANISOU 2859  C5   DA I  66    12273  14674  21586   1158   7761   2744       C  
ATOM   2860  C6   DA I  66      87.122 110.633 -15.150  1.00124.77           C  
ANISOU 2860  C6   DA I  66    12221  14211  20976    852   7278   2458       C  
ATOM   2861  N6   DA I  66      87.666 110.807 -13.940  1.00126.13           N  
ANISOU 2861  N6   DA I  66    12225  14275  21426    413   6807   2558       N  
ATOM   2862  N1   DA I  66      85.795 110.408 -15.243  1.00120.61           N  
ANISOU 2862  N1   DA I  66    12192  13727  19909   1012   7298   2069       N  
ATOM   2863  C2   DA I  66      85.251 110.233 -16.454  1.00119.38           C  
ANISOU 2863  C2   DA I  66    12199  13693  19465   1438   7762   1971       C  
ATOM   2864  N3   DA I  66      85.842 110.246 -17.647  1.00121.73           N  
ANISOU 2864  N3   DA I  66    12236  14087  19928   1753   8238   2202       N  
ATOM   2865  C4   DA I  66      87.159 110.473 -17.525  1.00126.34           C  
ANISOU 2865  C4   DA I  66    12326  14625  21054   1595   8213   2590       C  
ATOM   2866  P    DT I  67      86.607 111.987 -23.804  1.00130.94           P  
ANISOU 2866  P    DT I  67    13588  15697  20466   2790   9135   2650       P  
ATOM   2867  OP1  DT I  67      86.074 111.360 -25.035  1.00127.81           O  
ANISOU 2867  OP1  DT I  67    13476  15491  19595   3062   9063   2435       O  
ATOM   2868  OP2  DT I  67      87.584 113.094 -23.906  1.00132.60           O  
ANISOU 2868  OP2  DT I  67    13439  15817  21125   2648   9333   3046       O  
ATOM   2869  O5'  DT I  67      85.382 112.489 -22.906  1.00134.45           O  
ANISOU 2869  O5'  DT I  67    14405  16040  20642   2583   9004   2375       O  
ATOM   2870  C5'  DT I  67      84.399 111.556 -22.473  1.00128.40           C  
ANISOU 2870  C5'  DT I  67    13964  15328  19495   2637   8780   2010       C  
ATOM   2871  C4'  DT I  67      83.425 112.189 -21.494  1.00125.90           C  
ANISOU 2871  C4'  DT I  67    13938  14891  19006   2403   8688   1811       C  
ATOM   2872  O4'  DT I  67      83.954 112.112 -20.140  1.00127.32           O  
ANISOU 2872  O4'  DT I  67    13820  14927  19630   2153   8720   1922       O  
ATOM   2873  C3'  DT I  67      83.117 113.676 -21.720  1.00127.27           C  
ANISOU 2873  C3'  DT I  67    14249  14972  19135   2260   8799   1891       C  
ATOM   2874  O3'  DT I  67      81.778 113.919 -21.344  1.00132.24           O  
ANISOU 2874  O3'  DT I  67    15348  15589  19308   2189   8621   1567       O  
ATOM   2875  C2'  DT I  67      84.054 114.335 -20.718  1.00125.73           C  
ANISOU 2875  C2'  DT I  67    13645  14584  19542   1946   8962   2186       C  
ATOM   2876  C1'  DT I  67      83.823 113.388 -19.563  1.00125.56           C  
ANISOU 2876  C1'  DT I  67    13615  14541  19550   1848   8814   2004       C  
ATOM   2877  N1   DT I  67      84.761 113.530 -18.421  1.00127.81           N  
ANISOU 2877  N1   DT I  67    13533  14673  20356   1460   8585   2219       N  
ATOM   2878  C2   DT I  67      84.248 113.507 -17.147  1.00124.17           C  
ANISOU 2878  C2   DT I  67    13323  14096  19762   1128   8087   1982       C  
ATOM   2879  O2   DT I  67      83.061 113.373 -16.911  1.00123.45           O  
ANISOU 2879  O2   DT I  67    13678  14027  19201   1173   7986   1637       O  
ATOM   2880  N3   DT I  67      85.172 113.641 -16.152  1.00124.45           N  
ANISOU 2880  N3   DT I  67    13059  14002  20224    739   7705   2171       N  
ATOM   2881  C4   DT I  67      86.536 113.797 -16.298  1.00130.52           C  
ANISOU 2881  C4   DT I  67    13308  14746  21538    645   7769   2576       C  
ATOM   2882  O4   DT I  67      87.286 113.909 -15.333  1.00133.38           O  
ANISOU 2882  O4   DT I  67    13427  15003  22249    271   7392   2726       O  
ATOM   2883  C5   DT I  67      87.014 113.816 -17.664  1.00127.79           C  
ANISOU 2883  C5   DT I  67    12717  14525  21313   1016   8307   2818       C  
ATOM   2884  C7   DT I  67      88.477 113.982 -17.949  1.00132.57           C  
ANISOU 2884  C7   DT I  67    12745  15131  22493    960   8429   3281       C  
ATOM   2885  C6   DT I  67      86.112 113.684 -18.650  1.00125.40           C  
ANISOU 2885  C6   DT I  67    12709  14350  20585   1403   8687   2625       C  
ATOM   2886  P    DA I  68      80.675 114.381 -22.414  1.00117.96           P  
ANISOU 2886  P    DA I  68    13951  13908  16962   2320   8482   1389       P  
ATOM   2887  OP1  DA I  68      80.774 113.491 -23.592  1.00118.18           O  
ANISOU 2887  OP1  DA I  68    13947  14152  16806   2577   8399   1358       O  
ATOM   2888  OP2  DA I  68      80.799 115.846 -22.584  1.00116.83           O  
ANISOU 2888  OP2  DA I  68    13795  13629  16966   2193   8672   1576       O  
ATOM   2889  O5'  DA I  68      79.301 114.096 -21.646  1.00122.66           O  
ANISOU 2889  O5'  DA I  68    14976  14516  17111   2234   8187   1019       O  
ATOM   2890  C5'  DA I  68      79.192 112.954 -20.798  1.00128.89           C  
ANISOU 2890  C5'  DA I  68    15772  15326  17875   2225   8037    847       C  
ATOM   2891  C4'  DA I  68      78.616 113.328 -19.440  1.00132.87           C  
ANISOU 2891  C4'  DA I  68    16475  15676  18333   1979   7978    684       C  
ATOM   2892  O4'  DA I  68      79.687 113.641 -18.509  1.00138.56           O  
ANISOU 2892  O4'  DA I  68    16819  16207  19619   1761   8243    906       O  
ATOM   2893  C3'  DA I  68      77.686 114.538 -19.435  1.00131.67           C  
ANISOU 2893  C3'  DA I  68    16669  15459  17902   1858   7926    587       C  
ATOM   2894  O3'  DA I  68      76.587 114.279 -18.570  1.00125.31           O  
ANISOU 2894  O3'  DA I  68    16220  14660  16731   1756   7650    279       O  
ATOM   2895  C2'  DA I  68      78.582 115.659 -18.902  1.00135.76           C  
ANISOU 2895  C2'  DA I  68    16937  15738  18908   1620   8272    845       C  
ATOM   2896  C1'  DA I  68      79.449 114.900 -17.913  1.00138.35           C  
ANISOU 2896  C1'  DA I  68    16914  16001  19653   1484   8360    923       C  
ATOM   2897  N9   DA I  68      80.746 115.520 -17.644  1.00142.88           N  
ANISOU 2897  N9   DA I  68    17062  16418  20809   1214   8327   1270       N  
ATOM   2898  C8   DA I  68      81.703 115.850 -18.561  1.00146.51           C  
ANISOU 2898  C8   DA I  68    17141  16902  21622   1342   8688   1620       C  
ATOM   2899  N7   DA I  68      82.787 116.368 -18.035  1.00149.87           N  
ANISOU 2899  N7   DA I  68    17226  17170  22546   1013   8500   1894       N  
ATOM   2900  C5   DA I  68      82.528 116.372 -16.675  1.00148.73           C  
ANISOU 2900  C5   DA I  68    17255  16889  22365    642   7978   1702       C  
ATOM   2901  C6   DA I  68      83.286 116.797 -15.567  1.00151.68           C  
ANISOU 2901  C6   DA I  68    17436  17077  23116    177   7559   1827       C  
ATOM   2902  N6   DA I  68      84.510 117.323 -15.675  1.00156.57           N  
ANISOU 2902  N6   DA I  68    17626  17609  24254     -2   7603   2200       N  
ATOM   2903  N1   DA I  68      82.737 116.662 -14.342  1.00149.99           N  
ANISOU 2903  N1   DA I  68    17484  16786  22719   -103   7088   1559       N  
ATOM   2904  C2   DA I  68      81.508 116.138 -14.241  1.00145.67           C  
ANISOU 2904  C2   DA I  68    17357  16338  21653     76   7044   1202       C  
ATOM   2905  N3   DA I  68      80.702 115.698 -15.208  1.00143.00           N  
ANISOU 2905  N3   DA I  68    17233  16172  20930    499   7404   1058       N  
ATOM   2906  C4   DA I  68      81.276 115.846 -16.413  1.00144.58           C  
ANISOU 2906  C4   DA I  68    17171  16446  21318    766   7867   1320       C  
ATOM   2907  P    DT I  69      75.510 115.424 -18.240  1.00130.61           P  
ANISOU 2907  P    DT I  69    17282  15247  17097   1601   7538    134       P  
ATOM   2908  OP1  DT I  69      74.243 114.747 -17.883  1.00122.20           O  
ANISOU 2908  OP1  DT I  69    16540  14333  15558   1615   7105   -167       O  
ATOM   2909  OP2  DT I  69      75.534 116.411 -19.343  1.00133.47           O  
ANISOU 2909  OP2  DT I  69    17625  15618  17470   1682   7659    311       O  
ATOM   2910  O5'  DT I  69      76.098 116.127 -16.931  1.00130.42           O  
ANISOU 2910  O5'  DT I  69    17189  14944  17420   1280   7818    174       O  
ATOM   2911  C5'  DT I  69      76.556 115.328 -15.844  1.00128.16           C  
ANISOU 2911  C5'  DT I  69    16755  14610  17330   1105   7647    111       C  
ATOM   2912  C4'  DT I  69      76.365 116.049 -14.523  1.00124.54           C  
ANISOU 2912  C4'  DT I  69    16476  13953  16889    664   7190     -1       C  
ATOM   2913  O4'  DT I  69      77.615 116.647 -14.095  1.00127.33           O  
ANISOU 2913  O4'  DT I  69    16463  14119  17798    340   7046    278       O  
ATOM   2914  C3'  DT I  69      75.349 117.177 -14.544  1.00120.17           C  
ANISOU 2914  C3'  DT I  69    16344  13322  15992    615   7264   -149       C  
ATOM   2915  O3'  DT I  69      74.710 117.249 -13.284  1.00118.05           O  
ANISOU 2915  O3'  DT I  69    16368  12977  15510    335   6809   -405       O  
ATOM   2916  C2'  DT I  69      76.211 118.413 -14.818  1.00122.04           C  
ANISOU 2916  C2'  DT I  69    16358  13359  16651    430   7419    146       C  
ATOM   2917  C1'  DT I  69      77.529 118.062 -14.131  1.00127.21           C  
ANISOU 2917  C1'  DT I  69    16578  13921  17837    153   7126    347       C  
ATOM   2918  N1   DT I  69      78.741 118.569 -14.847  1.00132.17           N  
ANISOU 2918  N1   DT I  69    16775  14480  18966    147   7400    735       N  
ATOM   2919  C2   DT I  69      79.818 119.019 -14.114  1.00138.00           C  
ANISOU 2919  C2   DT I  69    17211  15033  20191   -245   7124    941       C  
ATOM   2920  O2   DT I  69      79.831 119.044 -12.896  1.00142.28           O  
ANISOU 2920  O2   DT I  69    17826  15465  20770   -595   6663    814       O  
ATOM   2921  N3   DT I  69      80.888 119.444 -14.860  1.00139.13           N  
ANISOU 2921  N3   DT I  69    16953  15138  20772   -219   7405   1312       N  
ATOM   2922  C4   DT I  69      80.983 119.460 -16.241  1.00139.29           C  
ANISOU 2922  C4   DT I  69    16846  15292  20784    162   7930   1491       C  
ATOM   2923  O4   DT I  69      81.985 119.861 -16.825  1.00140.89           O  
ANISOU 2923  O4   DT I  69    16673  15463  21398    158   8152   1838       O  
ATOM   2924  C5   DT I  69      79.822 118.969 -16.948  1.00137.97           C  
ANISOU 2924  C5   DT I  69    17016  15321  20084    561   8196   1247       C  
ATOM   2925  C7   DT I  69      79.812 118.940 -18.447  1.00143.22           C  
ANISOU 2925  C7   DT I  69    17579  16164  20673    988   8763   1404       C  
ATOM   2926  C6   DT I  69      78.772 118.550 -16.226  1.00131.37           C  
ANISOU 2926  C6   DT I  69    16573  14518  18825    531   7919    887       C  
HETATM 2927  P   G47 I  70      73.349 118.082 -13.097  1.00123.16           P  
ANISOU 2927  P   G47 I  70    17540  13592  15663    324   6809   -660       P  
HETATM 2928  O1P G47 I  70      72.274 117.129 -12.726  1.00117.90           O  
ANISOU 2928  O1P G47 I  70    17173  13114  14510    461   6632   -964       O  
HETATM 2929  O2P G47 I  70      73.160 118.968 -14.272  1.00120.37           O  
ANISOU 2929  O2P G47 I  70    17242  13231  15261    542   7297   -520       O  
HETATM 2930  O5' G47 I  70      73.648 118.981 -11.818  1.00118.69           O  
ANISOU 2930  O5' G47 I  70    17025  12767  15306   -161   6387   -689       O  
HETATM 2931  C5' G47 I  70      74.312 118.411 -10.692  1.00113.45           C  
ANISOU 2931  C5' G47 I  70    16159  12058  14891   -464   5924   -698       C  
HETATM 2932  C4' G47 I  70      74.955 119.493  -9.857  1.00109.52           C  
ANISOU 2932  C4' G47 I  70    15592  11293  14729   -911   5661   -613       C  
HETATM 2933  O4' G47 I  70      76.207 119.900 -10.460  1.00113.76           O  
ANISOU 2933  O4' G47 I  70    15704  11724  15793   -962   5873   -258       O  
HETATM 2934  C3' G47 I  70      74.117 120.763  -9.711  1.00104.28           C  
ANISOU 2934  C3' G47 I  70    15338  10469  13814  -1010   5706   -761       C  
HETATM 2935  O3' G47 I  70      74.219 121.241  -8.369  1.00101.27           O  
ANISOU 2935  O3' G47 I  70    15058   9914  13506  -1446   5236   -889       O  
HETATM 2936  C2' G47 I  70      74.769 121.734 -10.677  1.00109.08           C  
ANISOU 2936  C2' G47 I  70    15757  10934  14755   -967   6099   -470       C  
HETATM 2937  C1' G47 I  70      76.224 121.307 -10.639  1.00114.95           C  
ANISOU 2937  C1' G47 I  70    15970  11655  16053  -1113   6014   -178       C  
HETATM 2938  N9  G47 I  70      76.952 121.588 -11.845  1.00117.72           N  
ANISOU 2938  N9  G47 I  70    16012  12008  16707   -917   6456    145       N  
HETATM 2939  C8  G47 I  70      76.503 121.447 -13.137  1.00116.28           C  
ANISOU 2939  C8  G47 I  70    15880  11988  16315   -485   6944    199       C  
HETATM 2940  N7  G47 I  70      77.395 121.780 -14.030  1.00118.85           N  
ANISOU 2940  N7  G47 I  70    15860  12290  17009   -399   7270    529       N  
HETATM 2941  C5  G47 I  70      78.499 122.162 -13.283  1.00122.22           C  
ANISOU 2941  C5  G47 I  70    15989  12522  17926   -802   6978    709       C  
HETATM 2942  C6  G47 I  70      79.801 122.632 -13.688  1.00124.23           C  
ANISOU 2942  C6  G47 I  70    15793  12672  18736   -928   7113   1096       C  
HETATM 2943  O6  G47 I  70      80.235 122.807 -14.835  1.00125.32           O  
ANISOU 2943  O6  G47 I  70    15700  12875  19040   -684   7543   1362       O  
HETATM 2944  N1  G47 I  70      80.611 122.906 -12.594  1.00127.67           N  
ANISOU 2944  N1  G47 I  70    16046  12925  19536  -1390   6684   1164       N  
HETATM 2945  C2  G47 I  70      80.245 122.753 -11.283  1.00130.81           C  
ANISOU 2945  C2  G47 I  70    16661  13255  19786  -1692   6193    895       C  
HETATM 2946  N2  G47 I  70      81.173 123.073 -10.368  1.00140.81           N  
ANISOU 2946  N2  G47 I  70    17692  14359  21452  -2136   5825   1015       N  
HETATM 2947  N3  G47 I  70      79.060 122.324 -10.888  1.00127.59           N  
ANISOU 2947  N3  G47 I  70    16663  12945  18870  -1575   6065    541       N  
HETATM 2948  C4  G47 I  70      78.246 122.050 -11.930  1.00122.92           C  
ANISOU 2948  C4  G47 I  70    16258  12524  17923  -1131   6471    472       C  
HETATM 2949  C6A G47 I  70      81.298 124.299  -9.748  1.00149.76           C  
ANISOU 2949  C6A G47 I  70    18952  15212  22737  -2535   5633   1004       C  
HETATM 2950  C7A G47 I  70      80.587 124.335  -8.484  1.00154.40           C  
ANISOU 2950  C7A G47 I  70    19898  15733  23032  -2799   5184    650       C  
HETATM 2951  SG  G47 I  70      81.441 123.778  -6.939  1.00165.44           S  
ANISOU 2951  SG  G47 I  70    21037  17123  24698  -3288   4535    637       S  
ATOM   2952  P    DG I  71      73.460 122.583  -7.923  1.00 98.55           P  
ANISOU 2952  P    DG I  71    15138   9355  12952  -1631   5184  -1068       P  
ATOM   2953  OP1  DG I  71      73.259 122.495  -6.458  1.00 97.09           O  
ANISOU 2953  OP1  DG I  71    15109   9123  12658  -1980   4650  -1302       O  
ATOM   2954  OP2  DG I  71      72.304 122.766  -8.830  1.00 96.52           O  
ANISOU 2954  OP2  DG I  71    15214   9209  12250  -1246   5574  -1173       O  
ATOM   2955  O5'  DG I  71      74.520 123.739  -8.231  1.00102.84           O  
ANISOU 2955  O5'  DG I  71    15432   9624  14019  -1858   5326   -779       O  
ATOM   2956  C5'  DG I  71      75.870 123.585  -7.818  1.00106.04           C  
ANISOU 2956  C5'  DG I  71    15394   9946  14949  -2154   5105   -552       C  
ATOM   2957  C4'  DG I  71      76.692 124.813  -8.167  1.00109.55           C  
ANISOU 2957  C4'  DG I  71    15669  10123  15833  -2358   5266   -294       C  
ATOM   2958  O4'  DG I  71      77.218 124.695  -9.517  1.00112.67           O  
ANISOU 2958  O4'  DG I  71    15762  10603  16443  -2048   5740     15       O  
ATOM   2959  C3'  DG I  71      75.933 126.144  -8.127  1.00110.55           C  
ANISOU 2959  C3'  DG I  71    16210  10017  15777  -2437   5364   -434       C  
ATOM   2960  O3'  DG I  71      76.766 127.136  -7.552  1.00119.73           O  
ANISOU 2960  O3'  DG I  71    17254  10882  17358  -2875   5164   -319       O  
ATOM   2961  C2'  DG I  71      75.682 126.430  -9.606  1.00111.96           C  
ANISOU 2961  C2'  DG I  71    16379  10258  15903  -2030   5942   -253       C  
ATOM   2962  C1'  DG I  71      76.973 125.902 -10.198  1.00119.56           C  
ANISOU 2962  C1'  DG I  71    16791  11299  17336  -1996   6070    102       C  
ATOM   2963  N9   DG I  71      76.923 125.638 -11.633  1.00132.24           N  
ANISOU 2963  N9   DG I  71    18263  13083  18900  -1553   6593    296       N  
ATOM   2964  C8   DG I  71      75.850 125.196 -12.368  1.00131.90           C  
ANISOU 2964  C8   DG I  71    18480  13259  18378  -1130   6886    148       C  
ATOM   2965  N7   DG I  71      76.118 125.048 -13.638  1.00132.80           N  
ANISOU 2965  N7   DG I  71    18377  13509  18573   -801   7338    385       N  
ATOM   2966  C5   DG I  71      77.456 125.413 -13.747  1.00141.61           C  
ANISOU 2966  C5   DG I  71    19058  14486  20262  -1012   7348    718       C  
ATOM   2967  C6   DG I  71      78.306 125.456 -14.880  1.00168.13           C  
ANISOU 2967  C6   DG I  71    22021  17911  23948   -822   7743   1082       C  
ATOM   2968  O6   DG I  71      78.038 125.171 -16.056  1.00211.82           O  
ANISOU 2968  O6   DG I  71    27517  23648  29318   -415   8179   1174       O  
ATOM   2969  N1   DG I  71      79.589 125.886 -14.544  1.00157.04           N  
ANISOU 2969  N1   DG I  71    20233  16325  23108  -1162   7589   1360       N  
ATOM   2970  C2   DG I  71      79.996 126.228 -13.275  1.00148.51           C  
ANISOU 2970  C2   DG I  71    19157  15027  22243  -1636   7109   1285       C  
ATOM   2971  N2   DG I  71      81.268 126.619 -13.133  1.00149.48           N  
ANISOU 2971  N2   DG I  71    18873  15007  22916  -1928   7018   1595       N  
ATOM   2972  N3   DG I  71      79.210 126.190 -12.212  1.00142.94           N  
ANISOU 2972  N3   DG I  71    18824  14261  21225  -1816   6739    933       N  
ATOM   2973  C4   DG I  71      77.961 125.776 -12.521  1.00138.92           C  
ANISOU 2973  C4   DG I  71    18685  13926  20173  -1480   6888    669       C  
ATOM   2974  P    DA I  72      76.136 128.418  -6.818  1.00122.54           P  
ANISOU 2974  P    DA I  72    18048  10940  17572  -3153   5002   -552       P  
ATOM   2975  OP1  DA I  72      75.725 128.009  -5.456  1.00123.13           O  
ANISOU 2975  OP1  DA I  72    18332  11055  17396  -3399   4498   -871       O  
ATOM   2976  OP2  DA I  72      75.145 129.024  -7.734  1.00121.02           O  
ANISOU 2976  OP2  DA I  72    18182  10729  17072  -2809   5438   -598       O  
ATOM   2977  O5'  DA I  72      77.373 129.427  -6.714  1.00126.98           O  
ANISOU 2977  O5'  DA I  72    18323  11192  18732  -3550   4946   -281       O  
ATOM   2978  C5'  DA I  72      78.680 128.924  -6.453  1.00130.77           C  
ANISOU 2978  C5'  DA I  72    18305  11710  19670  -3786   4738    -34       C  
ATOM   2979  C4'  DA I  72      79.732 129.721  -7.206  1.00136.85           C  
ANISOU 2979  C4'  DA I  72    18733  12294  20969  -3886   4996    356       C  
ATOM   2980  O4'  DA I  72      79.833 129.236  -8.573  1.00138.44           O  
ANISOU 2980  O4'  DA I  72    18706  12700  21193  -3433   5481    605       O  
ATOM   2981  C3'  DA I  72      79.459 131.220  -7.311  1.00140.17           C  
ANISOU 2981  C3'  DA I  72    19434  12369  21456  -4041   5129    336       C  
ATOM   2982  O3'  DA I  72      80.678 131.942  -7.198  1.00145.11           O  
ANISOU 2982  O3'  DA I  72    19729  12759  22647  -4422   5038    621       O  
ATOM   2983  C2'  DA I  72      78.855 131.358  -8.705  1.00141.04           C  
ANISOU 2983  C2'  DA I  72    19629  12575  21383  -3549   5700    453       C  
ATOM   2984  C1'  DA I  72      79.636 130.306  -9.475  1.00143.24           C  
ANISOU 2984  C1'  DA I  72    19423  13137  21864  -3307   5886    746       C  
ATOM   2985  N9   DA I  72      78.924 129.794 -10.640  1.00146.02           N  
ANISOU 2985  N9   DA I  72    19848  13740  21891  -2769   6341    765       N  
ATOM   2986  C8   DA I  72      77.693 129.205 -10.652  1.00142.83           C  
ANISOU 2986  C8   DA I  72    19808  13534  20927  -2467   6384    462       C  
ATOM   2987  N7   DA I  72      77.296 128.833 -11.844  1.00141.31           N  
ANISOU 2987  N7   DA I  72    19592  13557  20542  -2013   6829    559       N  
ATOM   2988  C5   DA I  72      78.340 129.203 -12.673  1.00144.53           C  
ANISOU 2988  C5   DA I  72    19591  13910  21412  -2006   7105    955       C  
ATOM   2989  C6   DA I  72      78.532 129.081 -14.060  1.00147.99           C  
ANISOU 2989  C6   DA I  72    19805  14514  21908  -1627   7609   1229       C  
ATOM   2990  N6   DA I  72      77.632 128.528 -14.877  1.00147.13           N  
ANISOU 2990  N6   DA I  72    19872  14667  21365  -1176   7928   1127       N  
ATOM   2991  N1   DA I  72      79.687 129.551 -14.577  1.00152.56           N  
ANISOU 2991  N1   DA I  72    19968  14994  23003  -1735   7770   1616       N  
ATOM   2992  C2   DA I  72      80.585 130.104 -13.752  1.00156.09           C  
ANISOU 2992  C2   DA I  72    20238  15186  23882  -2204   7438   1721       C  
ATOM   2993  N3   DA I  72      80.515 130.274 -12.430  1.00155.38           N  
ANISOU 2993  N3   DA I  72    20334  14919  23784  -2602   6949   1479       N  
ATOM   2994  C4   DA I  72      79.355 129.796 -11.949  1.00148.96           C  
ANISOU 2994  C4   DA I  72    19934  14216  22448  -2470   6809   1095       C  
ATOM   2995  P    DT I  73      80.663 133.498  -6.797  1.00156.72           P  
ANISOU 2995  P    DT I  73    21459  13798  24290  -4789   4963    565       P  
ATOM   2996  OP1  DT I  73      81.495 133.656  -5.583  1.00158.93           O  
ANISOU 2996  OP1  DT I  73    21593  13928  24866  -5342   4446    532       O  
ATOM   2997  OP2  DT I  73      79.252 133.943  -6.782  1.00152.01           O  
ANISOU 2997  OP2  DT I  73    21430  13137  23192  -4579   5089    231       O  
ATOM   2998  O5'  DT I  73      81.392 134.221  -8.026  1.00156.22           O  
ANISOU 2998  O5'  DT I  73    21090  13609  24658  -4693   5408   1001       O  
ATOM   2999  C5'  DT I  73      80.749 134.289  -9.296  1.00149.49           C  
ANISOU 2999  C5'  DT I  73    20331  12868  23601  -4203   5941   1101       C  
ATOM   3000  C4'  DT I  73      81.769 134.340 -10.419  1.00148.84           C  
ANISOU 3000  C4'  DT I  73    19751  12842  23960  -4081   6295   1580       C  
ATOM   3001  O4'  DT I  73      81.398 133.388 -11.448  1.00144.34           O  
ANISOU 3001  O4'  DT I  73    19079  12633  23132  -3550   6668   1655       O  
ATOM   3002  C3'  DT I  73      81.879 135.682 -11.126  1.00152.18           C  
ANISOU 3002  C3'  DT I  73    20213  12972  24635  -4117   6618   1805       C  
ATOM   3003  O3'  DT I  73      83.190 135.854 -11.646  1.00156.33           O  
ANISOU 3003  O3'  DT I  73    20212  13469  25716  -4251   6726   2253       O  
ATOM   3004  C2'  DT I  73      80.850 135.548 -12.242  1.00149.38           C  
ANISOU 3004  C2'  DT I  73    20073  12809  23875  -3565   7110   1779       C  
ATOM   3005  C1'  DT I  73      80.977 134.072 -12.614  1.00146.86           C  
ANISOU 3005  C1'  DT I  73    19489  12916  23396  -3242   7170   1814       C  
ATOM   3006  N1   DT I  73      79.694 133.474 -13.070  1.00143.45           N  
ANISOU 3006  N1   DT I  73    19392  12738  22373  -2778   7397   1566       N  
ATOM   3007  C2   DT I  73      79.510 133.209 -14.408  1.00145.08           C  
ANISOU 3007  C2   DT I  73    19472  13177  22474  -2320   7899   1769       C  
ATOM   3008  O2   DT I  73      80.356 133.430 -15.257  1.00149.05           O  
ANISOU 3008  O2   DT I  73    19593  13696  23344  -2259   8178   2150       O  
ATOM   3009  N3   DT I  73      78.292 132.667 -14.718  1.00140.55           N  
ANISOU 3009  N3   DT I  73    19233  12834  21337  -1937   8059   1514       N  
ATOM   3010  C4   DT I  73      77.262 132.373 -13.847  1.00138.22           C  
ANISOU 3010  C4   DT I  73    19368  12560  20591  -1960   7779   1098       C  
ATOM   3011  O4   DT I  73      76.206 131.885 -14.225  1.00136.50           O  
ANISOU 3011  O4   DT I  73    19415  12566  19882  -1603   7951    909       O  
ATOM   3012  C5   DT I  73      77.518 132.680 -12.461  1.00137.78           C  
ANISOU 3012  C5   DT I  73    19420  12256  20672  -2438   7264    906       C  
ATOM   3013  C7   DT I  73      76.471 132.404 -11.422  1.00135.15           C  
ANISOU 3013  C7   DT I  73    19537  11942  19873  -2499   6929    464       C  
ATOM   3014  C6   DT I  73      78.707 133.210 -12.143  1.00139.62           C  
ANISOU 3014  C6   DT I  73    19337  12263  21450  -2823   7099   1140       C  
TER    3015       DT I  73                                                      
ATOM   3016  O5'  DA J -73      76.002 130.164 -24.926  1.00168.39           O  
ANISOU 3016  O5'  DA J -73    22284  20606  21090   3604   8387   1319       O  
ATOM   3017  C5'  DA J -73      76.664 131.195 -25.649  1.00171.25           C  
ANISOU 3017  C5'  DA J -73    22681  20695  21691   3816   8872   1764       C  
ATOM   3018  C4'  DA J -73      77.850 131.726 -24.866  1.00172.43           C  
ANISOU 3018  C4'  DA J -73    22408  20595  22515   3249   8906   2131       C  
ATOM   3019  O4'  DA J -73      77.386 132.282 -23.605  1.00169.50           O  
ANISOU 3019  O4'  DA J -73    21957  20186  22257   2656   8474   1814       O  
ATOM   3020  C3'  DA J -73      78.901 130.672 -24.513  1.00172.34           C  
ANISOU 3020  C3'  DA J -73    21983  20649  22849   3020   8859   2370       C  
ATOM   3021  O3'  DA J -73      80.212 131.172 -24.736  1.00176.39           O  
ANISOU 3021  O3'  DA J -73    22213  20913  23893   2932   9239   2934       O  
ATOM   3022  C2'  DA J -73      78.654 130.404 -23.035  1.00169.49           C  
ANISOU 3022  C2'  DA J -73    21389  20383  22625   2354   8299   2033       C  
ATOM   3023  C1'  DA J -73      78.140 131.745 -22.544  1.00169.09           C  
ANISOU 3023  C1'  DA J -73    21469  20154  22624   2085   8200   1879       C  
ATOM   3024  N9   DA J -73      77.281 131.618 -21.373  1.00165.04           N  
ANISOU 3024  N9   DA J -73    20955  19792  21963   1647   7646   1379       N  
ATOM   3025  C8   DA J -73      75.989 131.172 -21.343  1.00161.46           C  
ANISOU 3025  C8   DA J -73    20799  19587  20960   1826   7355    879       C  
ATOM   3026  N7   DA J -73      75.466 131.147 -20.141  1.00158.44           N  
ANISOU 3026  N7   DA J -73    20323  19302  20574   1332   6872    516       N  
ATOM   3027  C5   DA J -73      76.489 131.599 -19.324  1.00160.10           C  
ANISOU 3027  C5   DA J -73    20150  19315  21364    794   6838    787       C  
ATOM   3028  C6   DA J -73      76.573 131.805 -17.934  1.00158.34           C  
ANISOU 3028  C6   DA J -73    19661  19083  21417    134   6423    620       C  
ATOM   3029  N6   DA J -73      75.562 131.565 -17.095  1.00154.45           N  
ANISOU 3029  N6   DA J -73    19257  18793  20636    -96   5955    130       N  
ATOM   3030  N1   DA J -73      77.741 132.266 -17.440  1.00161.16           N  
ANISOU 3030  N1   DA J -73    19650  19224  22358   -278   6508    978       N  
ATOM   3031  C2   DA J -73      78.751 132.504 -18.284  1.00164.40           C  
ANISOU 3031  C2   DA J -73    19962  19440  23062    -47   6984   1478       C  
ATOM   3032  N3   DA J -73      78.790 132.349 -19.606  1.00165.49           N  
ANISOU 3032  N3   DA J -73    20326  19564  22988    569   7413   1694       N  
ATOM   3033  C4   DA J -73      77.616 131.890 -20.068  1.00163.88           C  
ANISOU 3033  C4   DA J -73    20493  19580  22196    972   7310   1318       C  
ATOM   3034  P    DT J -72      81.486 130.235 -24.440  1.00184.65           P  
ANISOU 3034  P    DT J -72    22797  21995  25367   2709   9268   3281       P  
ATOM   3035  OP1  DT J -72      82.560 130.620 -25.381  1.00192.21           O  
ANISOU 3035  OP1  DT J -72    23655  22758  26619   3011   9831   3868       O  
ATOM   3036  OP2  DT J -72      81.019 128.831 -24.394  1.00182.54           O  
ANISOU 3036  OP2  DT J -72    22578  22031  24749   2860   9003   2980       O  
ATOM   3037  O5'  DT J -72      81.930 130.643 -22.958  1.00177.40           O  
ANISOU 3037  O5'  DT J -72    21490  20975  24937   1899   8902   3244       O  
ATOM   3038  C5'  DT J -72      82.662 131.842 -22.739  1.00176.72           C  
ANISOU 3038  C5'  DT J -72    21223  20586  25337   1592   9098   3572       C  
ATOM   3039  C4'  DT J -72      83.564 131.709 -21.524  1.00175.54           C  
ANISOU 3039  C4'  DT J -72    20571  20400  25728    905   8832   3690       C  
ATOM   3040  O4'  DT J -72      82.751 131.623 -20.324  1.00172.06           O  
ANISOU 3040  O4'  DT J -72    20132  20088  25155    449   8270   3185       O  
ATOM   3041  C3'  DT J -72      84.463 130.475 -21.519  1.00176.08           C  
ANISOU 3041  C3'  DT J -72    20304  20625  25972    914   8858   3934       C  
ATOM   3042  O3'  DT J -72      85.741 130.804 -20.993  1.00180.08           O  
ANISOU 3042  O3'  DT J -72    20344  20971  27107    470   8942   4341       O  
ATOM   3043  C2'  DT J -72      83.716 129.497 -20.616  1.00171.38           C  
ANISOU 3043  C2'  DT J -72    19703  20309  25106    674   8316   3444       C  
ATOM   3044  C1'  DT J -72      83.042 130.433 -19.621  1.00170.13           C  
ANISOU 3044  C1'  DT J -72    19599  20068  24975    198   7958   3098       C  
ATOM   3045  N1   DT J -72      81.764 129.890 -19.077  1.00165.72           N  
ANISOU 3045  N1   DT J -72    19270  19753  23941    153   7496   2515       N  
ATOM   3046  C2   DT J -72      81.489 130.025 -17.735  1.00161.13           C  
ANISOU 3046  C2   DT J -72    18519  19223  23480   -441   7016   2214       C  
ATOM   3047  O2   DT J -72      82.240 130.576 -16.950  1.00159.34           O  
ANISOU 3047  O2   DT J -72    17962  18851  23730   -942   6936   2387       O  
ATOM   3048  N3   DT J -72      80.289 129.490 -17.342  1.00158.92           N  
ANISOU 3048  N3   DT J -72    18467  19179  22737   -425   6629   1698       N  
ATOM   3049  C4   DT J -72      79.360 128.847 -18.140  1.00157.30           C  
ANISOU 3049  C4   DT J -72    18629  19157  21981    101   6665   1450       C  
ATOM   3050  O4   DT J -72      78.309 128.399 -17.697  1.00152.73           O  
ANISOU 3050  O4   DT J -72    18220  18787  21023     58   6297    987       O  
ATOM   3051  C5   DT J -72      79.711 128.739 -19.532  1.00161.76           C  
ANISOU 3051  C5   DT J -72    19359  19658  22445    707   7167   1772       C  
ATOM   3052  C7   DT J -72      78.778 128.056 -20.487  1.00160.95           C  
ANISOU 3052  C7   DT J -72    19652  19749  21754   1310   7239   1527       C  
ATOM   3053  C6   DT J -72      80.882 129.258 -19.930  1.00165.99           C  
ANISOU 3053  C6   DT J -72    19679  19965  23423    711   7558   2288       C  
ATOM   3054  P    DC J -71      86.943 129.740 -21.070  1.00178.49           P  
ANISOU 3054  P    DC J -71    19740  20878  27200    479   9073   4731       P  
ATOM   3055  OP1  DC J -71      88.212 130.496 -21.153  1.00181.93           O  
ANISOU 3055  OP1  DC J -71    19834  21068  28224    277   9408   5270       O  
ATOM   3056  OP2  DC J -71      86.605 128.754 -22.120  1.00178.41           O  
ANISOU 3056  OP2  DC J -71    19995  21049  26743   1133   9270   4712       O  
ATOM   3057  O5'  DC J -71      86.872 128.989 -19.661  1.00176.67           O  
ANISOU 3057  O5'  DC J -71    19222  20844  27059    -91   8501   4420       O  
ATOM   3058  C5'  DC J -71      86.766 129.743 -18.462  1.00176.87           C  
ANISOU 3058  C5'  DC J -71    19082  20781  27340   -724   8144   4223       C  
ATOM   3059  C4'  DC J -71      86.590 128.831 -17.263  1.00175.21           C  
ANISOU 3059  C4'  DC J -71    18648  20811  27112  -1147   7617   3910       C  
ATOM   3060  O4'  DC J -71      85.187 128.486 -17.105  1.00171.03           O  
ANISOU 3060  O4'  DC J -71    18494  20459  26029  -1016   7291   3358       O  
ATOM   3061  C3'  DC J -71      87.342 127.496 -17.343  1.00176.83           C  
ANISOU 3061  C3'  DC J -71    18580  21208  27400  -1039   7653   4131       C  
ATOM   3062  O3'  DC J -71      87.875 127.173 -16.068  1.00175.90           O  
ANISOU 3062  O3'  DC J -71    18035  21179  27621  -1636   7282   4105       O  
ATOM   3063  C2'  DC J -71      86.233 126.520 -17.725  1.00173.19           C  
ANISOU 3063  C2'  DC J -71    18491  20979  26336   -631   7502   3735       C  
ATOM   3064  C1'  DC J -71      85.097 127.098 -16.906  1.00168.56           C  
ANISOU 3064  C1'  DC J -71    18105  20413  25527   -943   7084   3225       C  
ATOM   3065  N1   DC J -71      83.742 126.626 -17.300  1.00164.21           N  
ANISOU 3065  N1   DC J -71    18005  20033  24354   -568   6939   2770       N  
ATOM   3066  C2   DC J -71      82.751 126.534 -16.323  1.00159.50           C  
ANISOU 3066  C2   DC J -71    17497  19581  23526   -891   6441   2265       C  
ATOM   3067  O2   DC J -71      83.031 126.859 -15.164  1.00158.05           O  
ANISOU 3067  O2   DC J -71    17023  19376  23651  -1467   6137   2211       O  
ATOM   3068  N3   DC J -71      81.516 126.100 -16.675  1.00156.22           N  
ANISOU 3068  N3   DC J -71    17475  19330  22551   -560   6305   1853       N  
ATOM   3069  C4   DC J -71      81.266 125.763 -17.942  1.00156.40           C  
ANISOU 3069  C4   DC J -71    17797  19377  22249     66   6638   1921       C  
ATOM   3070  N4   DC J -71      80.034 125.340 -18.247  1.00152.76           N  
ANISOU 3070  N4   DC J -71    17710  19089  21241    366   6479   1494       N  
ATOM   3071  C5   DC J -71      82.269 125.847 -18.955  1.00161.19           C  
ANISOU 3071  C5   DC J -71    18329  19840  23076    416   7149   2431       C  
ATOM   3072  C6   DC J -71      83.483 126.277 -18.592  1.00164.77           C  
ANISOU 3072  C6   DC J -71    18387  20130  24087     82   7286   2846       C  
ATOM   3073  P    DC J -70      89.294 127.758 -15.596  1.00181.95           P  
ANISOU 3073  P    DC J -70    18302  21783  29050  -2075   7388   4556       P  
ATOM   3074  OP1  DC J -70      89.154 129.223 -15.441  1.00183.82           O  
ANISOU 3074  OP1  DC J -70    18621  21758  29466  -2315   7426   4533       O  
ATOM   3075  OP2  DC J -70      90.339 127.211 -16.489  1.00185.89           O  
ANISOU 3075  OP2  DC J -70    18725  22293  29611  -1674   7666   4963       O  
ATOM   3076  O5'  DC J -70      89.487 127.131 -14.138  1.00176.35           O  
ANISOU 3076  O5'  DC J -70    17290  21284  28430  -2625   6773   4299       O  
ATOM   3077  C5'  DC J -70      89.097 127.882 -12.999  1.00173.53           C  
ANISOU 3077  C5'  DC J -70    16880  20892  28164  -3166   6365   3988       C  
ATOM   3078  C4'  DC J -70      88.122 127.106 -12.127  1.00168.33           C  
ANISOU 3078  C4'  DC J -70    16224  20462  27270  -3383   5976   3555       C  
ATOM   3079  O4'  DC J -70      86.962 126.706 -12.896  1.00165.05           O  
ANISOU 3079  O4'  DC J -70    16301  20137  26276  -2872   6020   3254       O  
ATOM   3080  C3'  DC J -70      88.676 125.818 -11.499  1.00165.86           C  
ANISOU 3080  C3'  DC J -70    15670  20425  26923  -3489   5642   3542       C  
ATOM   3081  O3'  DC J -70      88.645 125.927 -10.082  1.00164.47           O  
ANISOU 3081  O3'  DC J -70    15354  20379  26757  -4026   5061   3238       O  
ATOM   3082  C2'  DC J -70      87.724 124.721 -12.000  1.00161.33           C  
ANISOU 3082  C2'  DC J -70    15340  20027  25930  -3092   5698   3329       C  
ATOM   3083  C1'  DC J -70      86.477 125.522 -12.327  1.00158.78           C  
ANISOU 3083  C1'  DC J -70    15491  19617  25219  -2921   5662   2959       C  
ATOM   3084  N1   DC J -70      85.546 124.846 -13.284  1.00152.58           N  
ANISOU 3084  N1   DC J -70    15146  18943  23886  -2335   5776   2749       N  
ATOM   3085  C2   DC J -70      84.252 124.513 -12.864  1.00146.37           C  
ANISOU 3085  C2   DC J -70    14641  18326  22647  -2346   5402   2220       C  
ATOM   3086  O2   DC J -70      83.903 124.792 -11.710  1.00141.99           O  
ANISOU 3086  O2   DC J -70    13973  17828  22148  -2830   4991   1944       O  
ATOM   3087  N3   DC J -70      83.415 123.897 -13.735  1.00144.38           N  
ANISOU 3087  N3   DC J -70    14775  18179  21905  -1825   5498   2023       N  
ATOM   3088  C4   DC J -70      83.828 123.615 -14.971  1.00146.33           C  
ANISOU 3088  C4   DC J -70    15137  18367  22095  -1299   5942   2326       C  
ATOM   3089  N4   DC J -70      82.967 123.006 -15.794  1.00143.60           N  
ANISOU 3089  N4   DC J -70    15174  18134  21252   -795   6010   2099       N  
ATOM   3090  C5   DC J -70      85.145 123.940 -15.417  1.00150.89           C  
ANISOU 3090  C5   DC J -70    15435  18774  23120  -1264   6336   2875       C  
ATOM   3091  C6   DC J -70      85.963 124.549 -14.549  1.00153.04           C  
ANISOU 3091  C6   DC J -70    15319  18945  23886  -1794   6239   3071       C  
ATOM   3092  P    DA J -69      89.492 124.911  -9.171  1.00168.54           P  
ANISOU 3092  P    DA J -69    15617  21160  27260  -4242   4659   3231       P  
ATOM   3093  OP1  DA J -69      90.053 125.687  -8.044  1.00170.92           O  
ANISOU 3093  OP1  DA J -69    15804  21478  27660  -4721   4269   3113       O  
ATOM   3094  OP2  DA J -69      90.395 124.147 -10.058  1.00171.13           O  
ANISOU 3094  OP2  DA J -69    15851  21495  27676  -3856   4997   3620       O  
ATOM   3095  O5'  DA J -69      88.391 123.898  -8.605  1.00160.59           O  
ANISOU 3095  O5'  DA J -69    14672  20390  25955  -4296   4360   2850       O  
ATOM   3096  C5'  DA J -69      87.277 124.395  -7.873  1.00155.96           C  
ANISOU 3096  C5'  DA J -69    14214  19827  25215  -4580   4049   2433       C  
ATOM   3097  C4'  DA J -69      86.303 123.279  -7.532  1.00148.67           C  
ANISOU 3097  C4'  DA J -69    13341  19128  24021  -4553   3829   2112       C  
ATOM   3098  O4'  DA J -69      85.550 122.901  -8.715  1.00145.91           O  
ANISOU 3098  O4'  DA J -69    13327  18746  23367  -4017   4156   2057       O  
ATOM   3099  C3'  DA J -69      86.938 121.994  -7.015  1.00146.13           C  
ANISOU 3099  C3'  DA J -69    12847  19059  23617  -4578   3587   2166       C  
ATOM   3100  O3'  DA J -69      86.083 121.404  -6.043  1.00142.06           O  
ANISOU 3100  O3'  DA J -69    12377  18772  22828  -4803   3129   1764       O  
ATOM   3101  C2'  DA J -69      87.033 121.137  -8.278  1.00146.37           C  
ANISOU 3101  C2'  DA J -69    12892  19051  23672  -4071   4075   2440       C  
ATOM   3102  C1'  DA J -69      85.751 121.531  -9.000  1.00143.05           C  
ANISOU 3102  C1'  DA J -69    12915  18557  22882  -3757   4198   2144       C  
ATOM   3103  N9   DA J -69      85.806 121.380 -10.453  1.00140.46           N  
ANISOU 3103  N9   DA J -69    12854  18130  22383  -3150   4663   2351       N  
ATOM   3104  C8   DA J -69      86.867 121.643 -11.274  1.00143.40           C  
ANISOU 3104  C8   DA J -69    13086  18344  23055  -2933   5115   2841       C  
ATOM   3105  N7   DA J -69      86.617 121.433 -12.547  1.00143.32           N  
ANISOU 3105  N7   DA J -69    13398  18286  22770  -2350   5471   2917       N  
ATOM   3106  C5   DA J -69      85.296 121.010 -12.561  1.00140.20           C  
ANISOU 3106  C5   DA J -69    13380  18027  21863  -2182   5228   2435       C  
ATOM   3107  C6   DA J -69      84.427 120.627 -13.606  1.00139.32           C  
ANISOU 3107  C6   DA J -69    13716  17954  21266  -1622   5387   2243       C  
ATOM   3108  N6   DA J -69      84.787 120.610 -14.893  1.00141.85           N  
ANISOU 3108  N6   DA J -69    14191  18175  21529  -1094   5853   2533       N  
ATOM   3109  N1   DA J -69      83.165 120.261 -13.271  1.00136.55           N  
ANISOU 3109  N1   DA J -69    13640  17759  20484  -1624   5045   1740       N  
ATOM   3110  C2   DA J -69      82.819 120.282 -11.979  1.00132.94           C  
ANISOU 3110  C2   DA J -69    13021  17408  20082  -2142   4588   1464       C  
ATOM   3111  N3   DA J -69      83.543 120.620 -10.917  1.00133.67           N  
ANISOU 3111  N3   DA J -69    12712  17482  20597  -2678   4397   1599       N  
ATOM   3112  C4   DA J -69      84.783 120.978 -11.278  1.00137.75           C  
ANISOU 3112  C4   DA J -69    12960  17843  21535  -2673   4735   2088       C  
ATOM   3113  P    DT J -68      86.693 120.556  -4.822  1.00142.67           P  
ANISOU 3113  P    DT J -68    12330  19132  22744  -5061   2681   1658       P  
ATOM   3114  OP1  DT J -68      86.281 121.214  -3.561  1.00143.25           O  
ANISOU 3114  OP1  DT J -68    12499  19332  22597  -5463   2219   1316       O  
ATOM   3115  OP2  DT J -68      88.127 120.324  -5.100  1.00143.66           O  
ANISOU 3115  OP2  DT J -68    12275  19208  23100  -4957   2892   2020       O  
ATOM   3116  O5'  DT J -68      85.940 119.153  -4.938  1.00135.65           O  
ANISOU 3116  O5'  DT J -68    11468  18416  21655  -4874   2621   1511       O  
ATOM   3117  C5'  DT J -68      85.620 118.641  -6.220  1.00132.70           C  
ANISOU 3117  C5'  DT J -68    11121  17930  21371  -4448   3081   1676       C  
ATOM   3118  C4'  DT J -68      84.192 118.142  -6.261  1.00129.40           C  
ANISOU 3118  C4'  DT J -68    10993  17618  20557  -4318   2919   1235       C  
ATOM   3119  O4'  DT J -68      83.653 118.340  -7.593  1.00132.45           O  
ANISOU 3119  O4'  DT J -68    11801  17888  20637  -3780   3254   1203       O  
ATOM   3120  C3'  DT J -68      84.041 116.659  -5.991  1.00126.74           C  
ANISOU 3120  C3'  DT J -68    10609  17494  20051  -4243   2746   1146       C  
ATOM   3121  O3'  DT J -68      82.737 116.384  -5.514  1.00119.98           O  
ANISOU 3121  O3'  DT J -68    10010  16785  18791  -4306   2391    652       O  
ATOM   3122  C2'  DT J -68      84.267 116.070  -7.376  1.00132.14           C  
ANISOU 3122  C2'  DT J -68    11499  18105  20602  -3654   3175   1365       C  
ATOM   3123  C1'  DT J -68      83.577 117.098  -8.270  1.00131.76           C  
ANISOU 3123  C1'  DT J -68    11841  17896  20324  -3370   3386   1235       C  
ATOM   3124  N1   DT J -68      84.222 117.253  -9.608  1.00129.62           N  
ANISOU 3124  N1   DT J -68    11665  17460  20125  -2897   3905   1607       N  
ATOM   3125  C2   DT J -68      83.508 116.946 -10.745  1.00128.08           C  
ANISOU 3125  C2   DT J -68    11891  17252  19521  -2353   4118   1473       C  
ATOM   3126  O2   DT J -68      82.357 116.548 -10.725  1.00125.96           O  
ANISOU 3126  O2   DT J -68    11922  17101  18836  -2245   3899   1056       O  
ATOM   3127  N3   DT J -68      84.196 117.125 -11.918  1.00129.39           N  
ANISOU 3127  N3   DT J -68    12109  17270  19783  -1935   4599   1847       N  
ATOM   3128  C4   DT J -68      85.499 117.568 -12.062  1.00131.06           C  
ANISOU 3128  C4   DT J -68    11992  17347  20458  -2012   4887   2342       C  
ATOM   3129  O4   DT J -68      86.032 117.696 -13.159  1.00132.46           O  
ANISOU 3129  O4   DT J -68    12242  17403  20682  -1602   5325   2664       O  
ATOM   3130  C5   DT J -68      86.189 117.870 -10.831  1.00130.74           C  
ANISOU 3130  C5   DT J -68    11509  17327  20840  -2606   4637   2453       C  
ATOM   3131  C7   DT J -68      87.607 118.358 -10.862  1.00130.21           C  
ANISOU 3131  C7   DT J -68    11042  17130  21301  -2756   4906   2974       C  
ATOM   3132  C6   DT J -68      85.525 117.700  -9.679  1.00129.90           C  
ANISOU 3132  C6   DT J -68    11356  17367  20634  -3010   4161   2081       C  
ATOM   3133  P    DA J -67      82.397 114.952  -4.870  1.00120.18           P  
ANISOU 3133  P    DA J -67     9969  17049  18646  -4373   2090    470       P  
ATOM   3134  OP1  DA J -67      81.720 115.191  -3.576  1.00117.56           O  
ANISOU 3134  OP1  DA J -67     9684  16780  18204  -4689   1550    182       O  
ATOM   3135  OP2  DA J -67      83.625 114.128  -4.914  1.00118.78           O  
ANISOU 3135  OP2  DA J -67     9455  16889  18786  -4340   2258    889       O  
ATOM   3136  O5'  DA J -67      81.352 114.321  -5.901  1.00116.05           O  
ANISOU 3136  O5'  DA J -67     9918  16549  17625  -3857   2206    211       O  
ATOM   3137  C5'  DA J -67      80.368 115.149  -6.501  1.00112.60           C  
ANISOU 3137  C5'  DA J -67     9873  16036  16873  -3651   2264    -61       C  
ATOM   3138  C4'  DA J -67      79.790 114.489  -7.738  1.00110.56           C  
ANISOU 3138  C4'  DA J -67     9999  15773  16236  -3078   2500   -156       C  
ATOM   3139  O4'  DA J -67      80.703 114.647  -8.856  1.00114.02           O  
ANISOU 3139  O4'  DA J -67    10433  16041  16848  -2707   2977    258       O  
ATOM   3140  C3'  DA J -67      79.522 112.994  -7.606  1.00105.26           C  
ANISOU 3140  C3'  DA J -67     9344  15268  15382  -2978   2350   -281       C  
ATOM   3141  O3'  DA J -67      78.247 112.692  -8.164  1.00 94.14           O  
ANISOU 3141  O3'  DA J -67     8357  13928  13483  -2673   2288   -678       O  
ATOM   3142  C2'  DA J -67      80.673 112.350  -8.392  1.00110.63           C  
ANISOU 3142  C2'  DA J -67     9888  15861  16286  -2669   2729    166       C  
ATOM   3143  C1'  DA J -67      80.955 113.396  -9.461  1.00113.53           C  
ANISOU 3143  C1'  DA J -67    10413  16032  16693  -2361   3130    372       C  
ATOM   3144  N9   DA J -67      82.340 113.408  -9.939  1.00114.98           N  
ANISOU 3144  N9   DA J -67    10335  16091  17260  -2242   3497    898       N  
ATOM   3145  C8   DA J -67      83.469 113.484  -9.176  1.00115.50           C  
ANISOU 3145  C8   DA J -67     9945  16151  17787  -2611   3463   1227       C  
ATOM   3146  N7   DA J -67      84.582 113.503  -9.871  1.00117.24           N  
ANISOU 3146  N7   DA J -67    10009  16257  18281  -2392   3852   1685       N  
ATOM   3147  C5   DA J -67      84.155 113.440 -11.185  1.00118.93           C  
ANISOU 3147  C5   DA J -67    10610  16394  18186  -1831   4167   1655       C  
ATOM   3148  C6   DA J -67      84.852 113.424 -12.412  1.00122.28           C  
ANISOU 3148  C6   DA J -67    11099  16694  18670  -1357   4647   2020       C  
ATOM   3149  N6   DA J -67      86.187 113.471 -12.505  1.00122.11           N  
ANISOU 3149  N6   DA J -67    10728  16599  19069  -1389   4906   2515       N  
ATOM   3150  N1   DA J -67      84.122 113.358 -13.543  1.00122.88           N  
ANISOU 3150  N1   DA J -67    11606  16733  18348   -842   4853   1860       N  
ATOM   3151  C2   DA J -67      82.789 113.306 -13.447  1.00120.01           C  
ANISOU 3151  C2   DA J -67    11576  16456  17565   -814   4590   1366       C  
ATOM   3152  N3   DA J -67      82.022 113.321 -12.357  1.00117.47           N  
ANISOU 3152  N3   DA J -67    11229  16253  17149  -1233   4141    996       N  
ATOM   3153  C4   DA J -67      82.774 113.387 -11.248  1.00116.28           C  
ANISOU 3153  C4   DA J -67    10654  16132  17394  -1732   3950   1167       C  
ATOM   3154  P    DT J -66      77.717 111.178  -8.227  1.00 94.11           P  
ANISOU 3154  P    DT J -66     8474  14074  13207  -2500   2150   -883       P  
ATOM   3155  OP1  DT J -66      76.249 111.214  -8.392  1.00 91.38           O  
ANISOU 3155  OP1  DT J -66     8506  13827  12388  -2379   1957  -1371       O  
ATOM   3156  OP2  DT J -66      78.330 110.420  -7.114  1.00 98.60           O  
ANISOU 3156  OP2  DT J -66     8664  14748  14051  -2887   1912   -761       O  
ATOM   3157  O5'  DT J -66      78.308 110.648  -9.602  1.00 99.09           O  
ANISOU 3157  O5'  DT J -66     9242  14589  13817  -1943   2599   -600       O  
ATOM   3158  C5'  DT J -66      78.085 111.397 -10.778  1.00100.89           C  
ANISOU 3158  C5'  DT J -66     9771  14693  13871  -1529   2922   -578       C  
ATOM   3159  C4'  DT J -66      78.402 110.567 -11.995  1.00102.55           C  
ANISOU 3159  C4'  DT J -66    10151  14851  13961   -983   3267   -411       C  
ATOM   3160  O4'  DT J -66      79.766 110.821 -12.412  1.00 99.41           O  
ANISOU 3160  O4'  DT J -66     9513  14311  13947   -883   3631    109       O  
ATOM   3161  C3'  DT J -66      78.283 109.059 -11.784  1.00106.08           C  
ANISOU 3161  C3'  DT J -66    10583  15417  14307   -942   3110   -518       C  
ATOM   3162  O3'  DT J -66      77.547 108.498 -12.860  1.00116.31           O  
ANISOU 3162  O3'  DT J -66    12274  16726  15194   -441   3242   -738       O  
ATOM   3163  C2'  DT J -66      79.742 108.583 -11.755  1.00102.88           C  
ANISOU 3163  C2'  DT J -66     9828  14943  14320   -952   3332    -19       C  
ATOM   3164  C1'  DT J -66      80.419 109.600 -12.655  1.00103.97           C  
ANISOU 3164  C1'  DT J -66     9984  14913  14608   -696   3747    316       C  
ATOM   3165  N1   DT J -66      81.869 109.788 -12.373  1.00107.58           N  
ANISOU 3165  N1   DT J -66    10021  15290  15565   -873   3931    823       N  
ATOM   3166  C2   DT J -66      82.741 109.893 -13.428  1.00110.30           C  
ANISOU 3166  C2   DT J -66    10365  15506  16039   -475   4386   1220       C  
ATOM   3167  O2   DT J -66      82.388 109.832 -14.593  1.00110.03           O  
ANISOU 3167  O2   DT J -66    10665  15419  15721     30   4649   1175       O  
ATOM   3168  N3   DT J -66      84.050 110.072 -13.076  1.00111.69           N  
ANISOU 3168  N3   DT J -66    10126  15627  16684   -681   4526   1676       N  
ATOM   3169  C4   DT J -66      84.567 110.156 -11.797  1.00108.02           C  
ANISOU 3169  C4   DT J -66     9254  15227  16562  -1235   4253   1765       C  
ATOM   3170  O4   DT J -66      85.766 110.319 -11.586  1.00110.44           O  
ANISOU 3170  O4   DT J -66     9192  15488  17283  -1380   4405   2187       O  
ATOM   3171  C5   DT J -66      83.598 110.041 -10.730  1.00106.61           C  
ANISOU 3171  C5   DT J -66     9108  15184  16216  -1623   3776   1328       C  
ATOM   3172  C7   DT J -66      84.039 110.116  -9.299  1.00104.35           C  
ANISOU 3172  C7   DT J -66     8405  14990  16253  -2219   3444   1375       C  
ATOM   3173  C6   DT J -66      82.309 109.866 -11.066  1.00106.16           C  
ANISOU 3173  C6   DT J -66     9455  15177  15703  -1427   3644    888       C  
ATOM   3174  P    DC J -65      77.289 106.917 -12.967  1.00118.15           P  
ANISOU 3174  P    DC J -65    12599  17047  15247   -271   3142   -887       P  
ATOM   3175  OP1  DC J -65      75.858 106.739 -13.293  1.00118.84           O  
ANISOU 3175  OP1  DC J -65    13072  17231  14850   -102   2963  -1390       O  
ATOM   3176  OP2  DC J -65      77.851 106.221 -11.788  1.00118.07           O  
ANISOU 3176  OP2  DC J -65    12221  17107  15535   -703   2900   -769       O  
ATOM   3177  O5'  DC J -65      78.145 106.514 -14.248  1.00119.33           O  
ANISOU 3177  O5'  DC J -65    12829  17070  15440    273   3611   -536       O  
ATOM   3178  C5'  DC J -65      78.266 107.439 -15.323  1.00119.37           C  
ANISOU 3178  C5'  DC J -65    13022  16964  15370    647   3967   -394       C  
ATOM   3179  C4'  DC J -65      79.288 106.955 -16.326  1.00119.15           C  
ANISOU 3179  C4'  DC J -65    12977  16830  15463   1094   4395      9       C  
ATOM   3180  O4'  DC J -65      80.612 107.380 -15.913  1.00119.16           O  
ANISOU 3180  O4'  DC J -65    12572  16749  15957    861   4553    496       O  
ATOM   3181  C3'  DC J -65      79.347 105.439 -16.483  1.00121.23           C  
ANISOU 3181  C3'  DC J -65    13289  17144  15630   1285   4361    -42       C  
ATOM   3182  O3'  DC J -65      79.422 105.099 -17.853  1.00125.48           O  
ANISOU 3182  O3'  DC J -65    14111  17618  15946   1901   4716     31       O  
ATOM   3183  C2'  DC J -65      80.615 105.045 -15.725  1.00121.19           C  
ANISOU 3183  C2'  DC J -65    12835  17117  16094    989   4376    372       C  
ATOM   3184  C1'  DC J -65      81.488 106.276 -15.904  1.00119.86           C  
ANISOU 3184  C1'  DC J -65    12468  16838  16235    945   4651    765       C  
ATOM   3185  N1   DC J -65      82.472 106.471 -14.802  1.00115.53           N  
ANISOU 3185  N1   DC J -65    11437  16295  16162    448   4543   1075       N  
ATOM   3186  C2   DC J -65      83.801 106.759 -15.112  1.00116.68           C  
ANISOU 3186  C2   DC J -65    11310  16343  16679    531   4886   1600       C  
ATOM   3187  O2   DC J -65      84.126 106.846 -16.299  1.00120.69           O  
ANISOU 3187  O2   DC J -65    11988  16759  17109   1023   5280   1803       O  
ATOM   3188  N3   DC J -65      84.689 106.936 -14.101  1.00113.44           N  
ANISOU 3188  N3   DC J -65    10450  15953  16699     72   4774   1871       N  
ATOM   3189  C4   DC J -65      84.286 106.834 -12.833  1.00109.27           C  
ANISOU 3189  C4   DC J -65     9756  15536  16224   -437   4344   1635       C  
ATOM   3190  N4   DC J -65      85.196 107.016 -11.868  1.00107.97           N  
ANISOU 3190  N4   DC J -65     9145  15401  16479   -869   4242   1909       N  
ATOM   3191  C5   DC J -65      82.931 106.540 -12.498  1.00108.39           C  
ANISOU 3191  C5   DC J -65     9925  15523  15734   -521   3998   1108       C  
ATOM   3192  C6   DC J -65      82.067 106.367 -13.504  1.00110.41           C  
ANISOU 3192  C6   DC J -65    10614  15758  15578    -78   4111    846       C  
ATOM   3193  P    DC J -64      79.022 103.623 -18.341  1.00120.78           P  
ANISOU 3193  P    DC J -64    13751  17068  15070   2232   4679   -187       P  
ATOM   3194  OP1  DC J -64      77.897 103.745 -19.295  1.00123.06           O  
ANISOU 3194  OP1  DC J -64    14493  17390  14875   2635   4712   -568       O  
ATOM   3195  OP2  DC J -64      78.885 102.766 -17.141  1.00117.16           O  
ANISOU 3195  OP2  DC J -64    13090  16696  14729   1783   4298   -333       O  
ATOM   3196  O5'  DC J -64      80.312 103.141 -19.143  1.00120.16           O  
ANISOU 3196  O5'  DC J -64    13571  16883  15202   2626   5109    302       O  
ATOM   3197  C5'  DC J -64      80.900 104.001 -20.104  1.00121.62           C  
ANISOU 3197  C5'  DC J -64    13800  16968  15440   2980   5527    623       C  
ATOM   3198  C4'  DC J -64      82.309 103.552 -20.421  1.00125.66           C  
ANISOU 3198  C4'  DC J -64    14065  17402  16280   3166   5861   1150       C  
ATOM   3199  O4'  DC J -64      83.207 103.996 -19.371  1.00125.84           O  
ANISOU 3199  O4'  DC J -64    13624  17412  16777   2660   5784   1474       O  
ATOM   3200  C3'  DC J -64      82.483 102.037 -20.528  1.00126.42           C  
ANISOU 3200  C3'  DC J -64    14204  17520  16310   3357   5834   1120       C  
ATOM   3201  O3'  DC J -64      83.269 101.724 -21.664  1.00129.61           O  
ANISOU 3201  O3'  DC J -64    14687  17846  16714   3909   6271   1452       O  
ATOM   3202  C2'  DC J -64      83.186 101.662 -19.222  1.00125.58           C  
ANISOU 3202  C2'  DC J -64    13658  17448  16609   2823   5611   1315       C  
ATOM   3203  C1'  DC J -64      83.993 102.915 -18.929  1.00125.72           C  
ANISOU 3203  C1'  DC J -64    13361  17417  16991   2576   5759   1690       C  
ATOM   3204  N1   DC J -64      84.288 103.109 -17.483  1.00122.10           N  
ANISOU 3204  N1   DC J -64    12503  17018  16871   1926   5438   1743       N  
ATOM   3205  C2   DC J -64      85.568 103.503 -17.093  1.00122.10           C  
ANISOU 3205  C2   DC J -64    12079  16981  17332   1719   5597   2233       C  
ATOM   3206  O2   DC J -64      86.422 103.684 -17.967  1.00121.79           O  
ANISOU 3206  O2   DC J -64    12004  16858  17414   2081   6009   2620       O  
ATOM   3207  N3   DC J -64      85.830 103.679 -15.774  1.00122.42           N  
ANISOU 3207  N3   DC J -64    11755  17089  17670   1134   5294   2268       N  
ATOM   3208  C4   DC J -64      84.869 103.472 -14.870  1.00119.73           C  
ANISOU 3208  C4   DC J -64    11470  16847  17175    774   4860   1846       C  
ATOM   3209  N4   DC J -64      85.171 103.656 -13.579  1.00117.71           N  
ANISOU 3209  N4   DC J -64    10849  16666  17211    215   4572   1897       N  
ATOM   3210  C5   DC J -64      83.555 103.067 -15.250  1.00117.30           C  
ANISOU 3210  C5   DC J -64    11589  16575  16403    974   4700   1354       C  
ATOM   3211  C6   DC J -64      83.311 102.899 -16.554  1.00118.52           C  
ANISOU 3211  C6   DC J -64    12095  16664  16272   1544   4994   1315       C  
ATOM   3212  P    DA J -63      83.540 100.194 -22.072  1.00133.48           P  
ANISOU 3212  P    DA J -63    15280  18328  17108   4247   6343   1464       P  
ATOM   3213  OP1  DA J -63      83.426 100.099 -23.544  1.00133.31           O  
ANISOU 3213  OP1  DA J -63    15621  18260  16771   4928   6694   1463       O  
ATOM   3214  OP2  DA J -63      82.707  99.317 -21.217  1.00122.89           O  
ANISOU 3214  OP2  DA J -63    13990  17063  15640   3926   5903   1045       O  
ATOM   3215  O5'  DA J -63      85.067  99.975 -21.670  1.00130.17           O  
ANISOU 3215  O5'  DA J -63    14413  17868  17176   4121   6537   2039       O  
ATOM   3216  C5'  DA J -63      86.048 100.899 -22.112  1.00129.41           C  
ANISOU 3216  C5'  DA J -63    14122  17708  17340   4243   6907   2514       C  
ATOM   3217  C4'  DA J -63      87.440 100.323 -21.948  1.00131.31           C  
ANISOU 3217  C4'  DA J -63    14005  17926  17960   4261   7115   3022       C  
ATOM   3218  O4'  DA J -63      87.968 100.689 -20.650  1.00131.01           O  
ANISOU 3218  O4'  DA J -63    13516  17931  18332   3640   6891   3196       O  
ATOM   3219  C3'  DA J -63      87.518  98.805 -22.028  1.00129.43           C  
ANISOU 3219  C3'  DA J -63    13860  17702  17617   4476   7070   2951       C  
ATOM   3220  O3'  DA J -63      88.725  98.412 -22.668  1.00133.22           O  
ANISOU 3220  O3'  DA J -63    14202  18135  18281   4852   7469   3439       O  
ATOM   3221  C2'  DA J -63      87.474  98.368 -20.564  1.00124.28           C  
ANISOU 3221  C2'  DA J -63    12913  17123  17185   3865   6652   2847       C  
ATOM   3222  C1'  DA J -63      88.109  99.546 -19.829  1.00124.54           C  
ANISOU 3222  C1'  DA J -63    12542  17170  17608   3413   6641   3143       C  
ATOM   3223  N9   DA J -63      87.472  99.826 -18.547  1.00116.05           N  
ANISOU 3223  N9   DA J -63    11326  16174  16595   2799   6184   2850       N  
ATOM   3224  C8   DA J -63      86.133  99.797 -18.272  1.00112.49           C  
ANISOU 3224  C8   DA J -63    11156  15769  15817   2654   5847   2312       C  
ATOM   3225  N7   DA J -63      85.841 100.090 -17.028  1.00110.30           N  
ANISOU 3225  N7   DA J -63    10658  15569  15683   2077   5474   2163       N  
ATOM   3226  C5   DA J -63      87.074 100.331 -16.446  1.00112.52           C  
ANISOU 3226  C5   DA J -63    10482  15855  16417   1821   5566   2626       C  
ATOM   3227  C6   DA J -63      87.450 100.691 -15.138  1.00113.97           C  
ANISOU 3227  C6   DA J -63    10256  16113  16934   1229   5299   2725       C  
ATOM   3228  N6   DA J -63      86.574 100.877 -14.147  1.00111.21           N  
ANISOU 3228  N6   DA J -63     9905  15847  16503    780   4876   2351       N  
ATOM   3229  N1   DA J -63      88.767 100.853 -14.888  1.00118.89           N  
ANISOU 3229  N1   DA J -63    10468  16732  17975   1121   5484   3224       N  
ATOM   3230  C2   DA J -63      89.641 100.665 -15.885  1.00121.73           C  
ANISOU 3230  C2   DA J -63    10825  17017  18412   1581   5915   3607       C  
ATOM   3231  N3   DA J -63      89.407 100.327 -17.152  1.00120.23           N  
ANISOU 3231  N3   DA J -63    11002  16751  17930   2166   6204   3568       N  
ATOM   3232  C4   DA J -63      88.091 100.173 -17.369  1.00115.81           C  
ANISOU 3232  C4   DA J -63    10849  16197  16957   2256   6003   3056       C  
ATOM   3233  P    DC J -62      89.151  96.863 -22.722  1.00127.85           P  
ANISOU 3233  P    DC J -62    13536  17451  17591   5081   7492   3504       P  
ATOM   3234  OP1  DC J -62      90.034  96.681 -23.895  1.00133.66           O  
ANISOU 3234  OP1  DC J -62    14422  18069  18293   5546   7771   3841       O  
ATOM   3235  OP2  DC J -62      87.931  96.035 -22.587  1.00119.90           O  
ANISOU 3235  OP2  DC J -62    12872  16463  16224   5071   7161   2942       O  
ATOM   3236  O5'  DC J -62      90.029  96.676 -21.402  1.00128.18           O  
ANISOU 3236  O5'  DC J -62    13057  17548  18097   4537   7316   3801       O  
ATOM   3237  C5'  DC J -62      90.985  97.668 -21.051  1.00130.23           C  
ANISOU 3237  C5'  DC J -62    12908  17819  18756   4282   7463   4238       C  
ATOM   3238  C4'  DC J -62      91.644  97.334 -19.731  1.00127.20           C  
ANISOU 3238  C4'  DC J -62    12065  17512  18754   3757   7225   4427       C  
ATOM   3239  O4'  DC J -62      90.796  97.764 -18.638  1.00125.07           O  
ANISOU 3239  O4'  DC J -62    11743  17303  18475   3187   6777   4060       O  
ATOM   3240  C3'  DC J -62      91.909  95.841 -19.507  1.00126.64           C  
ANISOU 3240  C3'  DC J -62    11986  17461  18672   3875   7159   4441       C  
ATOM   3241  O3'  DC J -62      93.274  95.640 -19.191  1.00129.64           O  
ANISOU 3241  O3'  DC J -62    11933  17875  19449   3819   7341   4972       O  
ATOM   3242  C2'  DC J -62      90.996  95.474 -18.333  1.00126.60           C  
ANISOU 3242  C2'  DC J -62    11984  17522  18596   3371   6650   4010       C  
ATOM   3243  C1'  DC J -62      90.865  96.804 -17.618  1.00126.32           C  
ANISOU 3243  C1'  DC J -62    11718  17533  18745   2874   6480   3996       C  
ATOM   3244  N1   DC J -62      89.645  96.909 -16.768  1.00121.78           N  
ANISOU 3244  N1   DC J -62    11265  17015  17990   2452   6018   3485       N  
ATOM   3245  C2   DC J -62      89.778  97.261 -15.422  1.00119.39           C  
ANISOU 3245  C2   DC J -62    10596  16806  17960   1838   5697   3500       C  
ATOM   3246  O2   DC J -62      90.910  97.483 -14.975  1.00122.85           O  
ANISOU 3246  O2   DC J -62    10613  17279  18786   1654   5799   3932       O  
ATOM   3247  N3   DC J -62      88.665  97.352 -14.653  1.00113.16           N  
ANISOU 3247  N3   DC J -62     9920  16078  16998   1470   5285   3041       N  
ATOM   3248  C4   DC J -62      87.466  97.102 -15.185  1.00112.91           C  
ANISOU 3248  C4   DC J -62    10335  16018  16550   1687   5189   2587       C  
ATOM   3249  N4   DC J -62      86.394  97.204 -14.392  1.00105.87           N  
ANISOU 3249  N4   DC J -62     9528  15197  15499   1312   4783   2153       N  
ATOM   3250  C5   DC J -62      87.312  96.739 -16.556  1.00114.23           C  
ANISOU 3250  C5   DC J -62    10876  16090  16436   2304   5504   2555       C  
ATOM   3251  C6   DC J -62      88.417  96.653 -17.304  1.00116.90           C  
ANISOU 3251  C6   DC J -62    11108  16367  16941   2673   5911   3008       C  
ATOM   3252  P    DC J -61      93.867  94.153 -19.059  1.00138.77           P  
ANISOU 3252  P    DC J -61    13022  19044  20659   4007   7375   5131       P  
ATOM   3253  OP1  DC J -61      95.210  94.150 -19.683  1.00134.99           O  
ANISOU 3253  OP1  DC J -61    12441  18490  20358   4274   7642   5627       O  
ATOM   3254  OP2  DC J -61      92.832  93.204 -19.529  1.00134.97           O  
ANISOU 3254  OP2  DC J -61    13021  18503  19757   4302   7259   4673       O  
ATOM   3255  O5'  DC J -61      94.025  93.952 -17.482  1.00133.33           O  
ANISOU 3255  O5'  DC J -61    11936  18466  20256   3356   6978   5127       O  
ATOM   3256  C5'  DC J -61      94.608  94.980 -16.693  1.00129.73           C  
ANISOU 3256  C5'  DC J -61    11042  18086  20163   2884   6907   5376       C  
ATOM   3257  C4'  DC J -61      94.669  94.564 -15.237  1.00133.12           C  
ANISOU 3257  C4'  DC J -61    11149  18631  20798   2331   6513   5324       C  
ATOM   3258  O4'  DC J -61      93.425  94.913 -14.577  1.00124.53           O  
ANISOU 3258  O4'  DC J -61    10230  17567  19517   1948   6104   4814       O  
ATOM   3259  C3'  DC J -61      94.870  93.066 -15.010  1.00136.46           C  
ANISOU 3259  C3'  DC J -61    11594  19070  21184   2480   6460   5344       C  
ATOM   3260  O3'  DC J -61      95.826  92.854 -13.985  1.00144.40           O  
ANISOU 3260  O3'  DC J -61    12154  20174  22537   2125   6315   5651       O  
ATOM   3261  C2'  DC J -61      93.480  92.577 -14.600  1.00130.06           C  
ANISOU 3261  C2'  DC J -61    11120  18248  20048   2313   6074   4759       C  
ATOM   3262  C1'  DC J -61      92.928  93.794 -13.880  1.00125.53           C  
ANISOU 3262  C1'  DC J -61    10426  17737  19534   1804   5800   4557       C  
ATOM   3263  N1   DC J -61      91.439  93.866 -13.877  1.00125.43           N  
ANISOU 3263  N1   DC J -61    10812  17697  19147   1725   5518   3974       N  
ATOM   3264  C2   DC J -61      90.771  94.182 -12.692  1.00124.08           C  
ANISOU 3264  C2   DC J -61    10522  17622  19001   1166   5089   3688       C  
ATOM   3265  O2   DC J -61      91.436  94.394 -11.673  1.00123.66           O  
ANISOU 3265  O2   DC J -61    10038  17672  19275    753   4949   3920       O  
ATOM   3266  N3   DC J -61      89.415  94.247 -12.698  1.00120.93           N  
ANISOU 3266  N3   DC J -61    10478  17211  18260   1101   4839   3167       N  
ATOM   3267  C4   DC J -61      88.742  94.012 -13.827  1.00117.07           C  
ANISOU 3267  C4   DC J -61    10440  16622  17420   1562   4997   2927       C  
ATOM   3268  N4   DC J -61      87.406  94.087 -13.789  1.00111.05           N  
ANISOU 3268  N4   DC J -61    10002  15865  16327   1477   4736   2412       N  
ATOM   3269  C5   DC J -61      89.408  93.688 -15.046  1.00124.98           C  
ANISOU 3269  C5   DC J -61    11576  17524  18386   2138   5429   3203       C  
ATOM   3270  C6   DC J -61      90.744  93.626 -15.026  1.00128.53           C  
ANISOU 3270  C6   DC J -61    11676  17985  19174   2202   5680   3725       C  
ATOM   3271  P    DT J -60      96.542  91.423 -13.835  1.00139.98           P  
ANISOU 3271  P    DT J -60    11522  19623  22041   2329   6361   5871       P  
ATOM   3272  OP1  DT J -60      97.995  91.661 -13.686  1.00145.15           O  
ANISOU 3272  OP1  DT J -60    11934  20258  22959   2268   6378   6299       O  
ATOM   3273  OP2  DT J -60      96.049  90.557 -14.930  1.00141.07           O  
ANISOU 3273  OP2  DT J -60    12065  19663  21874   2915   6626   5733       O  
ATOM   3274  O5'  DT J -60      95.964  90.855 -12.457  1.00138.77           O  
ANISOU 3274  O5'  DT J -60    11181  19600  21946   1843   5959   5637       O  
ATOM   3275  C5'  DT J -60      96.159  91.590 -11.259  1.00141.79           C  
ANISOU 3275  C5'  DT J -60    11289  20068  22518   1238   5571   5605       C  
ATOM   3276  C4'  DT J -60      95.341  91.009 -10.119  1.00146.12           C  
ANISOU 3276  C4'  DT J -60    11756  20730  23035    847   5201   5308       C  
ATOM   3277  O4'  DT J -60      93.934  91.323 -10.304  1.00145.76           O  
ANISOU 3277  O4'  DT J -60    12089  20629  22665    793   5018   4790       O  
ATOM   3278  C3'  DT J -60      95.416  89.486  -9.965  1.00153.16           C  
ANISOU 3278  C3'  DT J -60    12704  21618  23873   1043   5198   5336       C  
ATOM   3279  O3'  DT J -60      95.512  89.162  -8.589  1.00159.87           O  
ANISOU 3279  O3'  DT J -60    13281  22593  24867    569   4825   5310       O  
ATOM   3280  C2'  DT J -60      94.082  89.023 -10.547  1.00150.27           C  
ANISOU 3280  C2'  DT J -60    12894  21119  23083   1258   5101   4818       C  
ATOM   3281  C1'  DT J -60      93.180  90.153 -10.089  1.00146.36           C  
ANISOU 3281  C1'  DT J -60    12429  20673  22508    846   4820   4476       C  
ATOM   3282  N1   DT J -60      91.897  90.264 -10.840  1.00145.80           N  
ANISOU 3282  N1   DT J -60    12871  20490  22036   1046   4775   3993       N  
ATOM   3283  C2   DT J -60      90.756  90.627 -10.161  1.00142.26           C  
ANISOU 3283  C2   DT J -60    12533  20093  21426    661   4396   3549       C  
ATOM   3284  O2   DT J -60      90.737  90.861  -8.966  1.00138.74           O  
ANISOU 3284  O2   DT J -60    11794  19775  21146    165   4092   3528       O  
ATOM   3285  N3   DT J -60      89.629  90.708 -10.934  1.00143.33           N  
ANISOU 3285  N3   DT J -60    13134  20134  21190    886   4382   3128       N  
ATOM   3286  C4   DT J -60      89.531  90.466 -12.293  1.00146.08           C  
ANISOU 3286  C4   DT J -60    13846  20348  21311   1450   4699   3099       C  
ATOM   3287  O4   DT J -60      88.469  90.565 -12.900  1.00145.84           O  
ANISOU 3287  O4   DT J -60    14217  20256  20941   1616   4650   2696       O  
ATOM   3288  C5   DT J -60      90.765  90.090 -12.945  1.00148.77           C  
ANISOU 3288  C5   DT J -60    14056  20638  21833   1840   5091   3577       C  
ATOM   3289  C7   DT J -60      90.783  89.804 -14.418  1.00149.49           C  
ANISOU 3289  C7   DT J -60    14515  20592  21692   2481   5459   3591       C  
ATOM   3290  C6   DT J -60      91.876  90.009 -12.196  1.00149.67           C  
ANISOU 3290  C6   DT J -60    13709  20843  22318   1620   5113   3999       C  
ATOM   3291  P    DG J -59      96.296  87.846  -8.107  1.00166.07           P  
ANISOU 3291  P    DG J -59    13938  23403  25760    656   4801   5552       P  
ATOM   3292  OP1  DG J -59      97.745  88.145  -8.138  1.00168.23           O  
ANISOU 3292  OP1  DG J -59    14050  23654  26215    714   4878   5938       O  
ATOM   3293  OP2  DG J -59      95.763  86.695  -8.869  1.00169.60           O  
ANISOU 3293  OP2  DG J -59    14716  23736  25987   1105   4993   5427       O  
ATOM   3294  O5'  DG J -59      95.834  87.683  -6.585  1.00160.23           O  
ANISOU 3294  O5'  DG J -59    13060  22784  25036     89   4294   5302       O  
ATOM   3295  C5'  DG J -59      95.752  88.829  -5.748  1.00156.16           C  
ANISOU 3295  C5'  DG J -59    12466  22328  24539   -393   3944   5115       C  
ATOM   3296  C4'  DG J -59      94.475  88.815  -4.923  1.00149.34           C  
ANISOU 3296  C4'  DG J -59    11666  21543  23534   -773   3583   4684       C  
ATOM   3297  O4'  DG J -59      93.325  88.999  -5.789  1.00147.89           O  
ANISOU 3297  O4'  DG J -59    11681  21319  23191   -593   3755   4456       O  
ATOM   3298  C3'  DG J -59      94.220  87.534  -4.141  1.00146.27           C  
ANISOU 3298  C3'  DG J -59    11241  21212  23121   -865   3392   4621       C  
ATOM   3299  O3'  DG J -59      93.666  87.855  -2.875  1.00140.47           O  
ANISOU 3299  O3'  DG J -59    10504  20567  22303  -1360   2925   4290       O  
ATOM   3300  C2'  DG J -59      93.229  86.771  -5.022  1.00148.08           C  
ANISOU 3300  C2'  DG J -59    11766  21347  23153   -527   3576   4425       C  
ATOM   3301  C1'  DG J -59      92.443  87.898  -5.683  1.00147.03           C  
ANISOU 3301  C1'  DG J -59    11889  21147  22827   -518   3587   4126       C  
ATOM   3302  N9   DG J -59      91.976  87.575  -7.031  1.00147.44           N  
ANISOU 3302  N9   DG J -59    12415  21009  22598     -5   3842   3957       N  
ATOM   3303  C8   DG J -59      92.721  87.039  -8.052  1.00149.91           C  
ANISOU 3303  C8   DG J -59    12824  21209  22926    512   4232   4244       C  
ATOM   3304  N7   DG J -59      92.048  86.869  -9.155  1.00149.92           N  
ANISOU 3304  N7   DG J -59    13282  21055  22624    906   4381   3986       N  
ATOM   3305  C5   DG J -59      90.774  87.330  -8.851  1.00146.95           C  
ANISOU 3305  C5   DG J -59    13120  20694  22021    628   4072   3501       C  
ATOM   3306  C6   DG J -59      89.614  87.396  -9.660  1.00146.86           C  
ANISOU 3306  C6   DG J -59    13587  20571  21641    842   4054   3056       C  
ATOM   3307  O6   DG J -59      89.482  87.047 -10.841  1.00147.58           O  
ANISOU 3307  O6   DG J -59    14024  20523  21525   1336   4313   2995       O  
ATOM   3308  N1   DG J -59      88.531  87.927  -8.965  1.00146.21           N  
ANISOU 3308  N1   DG J -59    13562  20565  21425    428   3689   2653       N  
ATOM   3309  C2   DG J -59      88.565  88.346  -7.654  1.00145.25           C  
ANISOU 3309  C2   DG J -59    13088  20603  21496   -117   3380   2673       C  
ATOM   3310  N2   DG J -59      87.420  88.830  -7.152  1.00143.44           N  
ANISOU 3310  N2   DG J -59    12983  20434  21084   -443   3054   2249       N  
ATOM   3311  N3   DG J -59      89.647  88.289  -6.885  1.00144.44           N  
ANISOU 3311  N3   DG J -59    12538  20606  21735   -322   3387   3079       N  
ATOM   3312  C4   DG J -59      90.711  87.772  -7.548  1.00145.44           C  
ANISOU 3312  C4   DG J -59    12595  20664  22002     70   3741   3479       C  
ATOM   3313  P    DG J -58      93.644  86.762  -1.699  1.00144.42           P  
ANISOU 3313  P    DG J -58    10953  21138  22784  -1561   2632   4223       P  
ATOM   3314  OP1  DG J -58      93.964  87.459  -0.433  1.00141.83           O  
ANISOU 3314  OP1  DG J -58    10590  20874  22424  -1960   2262   4055       O  
ATOM   3315  OP2  DG J -58      94.466  85.612  -2.134  1.00147.00           O  
ANISOU 3315  OP2  DG J -58    11186  21425  23241  -1193   2916   4607       O  
ATOM   3316  O5'  DG J -58      92.116  86.296  -1.656  1.00141.72           O  
ANISOU 3316  O5'  DG J -58    10752  20820  22275  -1668   2491   3862       O  
ATOM   3317  C5'  DG J -58      91.081  87.275  -1.659  1.00140.08           C  
ANISOU 3317  C5'  DG J -58    10669  20636  21919  -1897   2321   3500       C  
ATOM   3318  C4'  DG J -58      89.719  86.632  -1.843  1.00137.68           C  
ANISOU 3318  C4'  DG J -58    10637  20297  21379  -1875   2209   3128       C  
ATOM   3319  O4'  DG J -58      89.405  86.527  -3.261  1.00139.07           O  
ANISOU 3319  O4'  DG J -58    11233  20271  21335  -1393   2496   3006       O  
ATOM   3320  C3'  DG J -58      89.588  85.214  -1.286  1.00139.02           C  
ANISOU 3320  C3'  DG J -58    10841  20460  21522  -1869   2090   3112       C  
ATOM   3321  O3'  DG J -58      88.283  85.040  -0.759  1.00138.17           O  
ANISOU 3321  O3'  DG J -58    10951  20371  21176  -2122   1756   2651       O  
ATOM   3322  C2'  DG J -58      89.788  84.365  -2.536  1.00141.03           C  
ANISOU 3322  C2'  DG J -58    11422  20500  21663  -1306   2437   3183       C  
ATOM   3323  C1'  DG J -58      89.018  85.201  -3.538  1.00140.76           C  
ANISOU 3323  C1'  DG J -58    11733  20362  21386  -1139   2521   2875       C  
ATOM   3324  N9   DG J -58      89.317  84.898  -4.934  1.00145.02           N  
ANISOU 3324  N9   DG J -58    12558  20718  21825   -581   2903   2969       N  
ATOM   3325  C8   DG J -58      90.518  84.484  -5.457  1.00149.11           C  
ANISOU 3325  C8   DG J -58    12941  21186  22528   -236   3244   3413       C  
ATOM   3326  N7   DG J -58      90.481  84.291  -6.747  1.00150.78           N  
ANISOU 3326  N7   DG J -58    13488  21230  22571    256   3543   3382       N  
ATOM   3327  C5   DG J -58      89.173  84.599  -7.101  1.00148.66           C  
ANISOU 3327  C5   DG J -58    13598  20900  21987    231   3386   2883       C  
ATOM   3328  C6   DG J -58      88.541  84.577  -8.366  1.00152.58           C  
ANISOU 3328  C6   DG J -58    14551  21239  22184    649   3564   2622       C  
ATOM   3329  O6   DG J -58      89.030  84.271  -9.462  1.00158.21           O  
ANISOU 3329  O6   DG J -58    15438  21826  22848   1144   3909   2785       O  
ATOM   3330  N1   DG J -58      87.206  84.965  -8.283  1.00148.60           N  
ANISOU 3330  N1   DG J -58    14308  20743  21411    454   3297   2121       N  
ATOM   3331  C2   DG J -58      86.562  85.324  -7.122  1.00145.68           C  
ANISOU 3331  C2   DG J -58    13782  20514  21058    -72   2913   1904       C  
ATOM   3332  N2   DG J -58      85.269  85.665  -7.233  1.00144.95           N  
ANISOU 3332  N2   DG J -58    13982  20417  20674   -177   2703   1423       N  
ATOM   3333  N3   DG J -58      87.144  85.346  -5.930  1.00143.99           N  
ANISOU 3333  N3   DG J -58    13147  20444  21117   -461   2744   2144       N  
ATOM   3334  C4   DG J -58      88.445  84.974  -5.996  1.00145.21           C  
ANISOU 3334  C4   DG J -58    13039  20595  21537   -282   2995   2627       C  
ATOM   3335  P    DT J -57      88.050  84.802   0.813  1.00140.44           P  
ANISOU 3335  P    DT J -57    10995  20839  21528  -2610   1357   2573       P  
ATOM   3336  OP1  DT J -57      88.772  85.867   1.541  1.00141.01           O  
ANISOU 3336  OP1  DT J -57    11069  20905  21604  -2779   1223   2537       O  
ATOM   3337  OP2  DT J -57      88.350  83.383   1.107  1.00139.12           O  
ANISOU 3337  OP2  DT J -57    10776  20648  21437  -2498   1390   2753       O  
ATOM   3338  O5'  DT J -57      86.473  85.013   0.993  1.00136.84           O  
ANISOU 3338  O5'  DT J -57    10816  20399  20780  -2833   1061   2039       O  
ATOM   3339  C5'  DT J -57      85.870  86.252   0.620  1.00136.29           C  
ANISOU 3339  C5'  DT J -57    10869  20339  20574  -2917   1014   1788       C  
ATOM   3340  C4'  DT J -57      84.756  86.042  -0.398  1.00135.12           C  
ANISOU 3340  C4'  DT J -57    11235  20022  20083  -2637   1070   1380       C  
ATOM   3341  O4'  DT J -57      85.313  85.533  -1.640  1.00134.94           O  
ANISOU 3341  O4'  DT J -57    11413  19809  20048  -2120   1453   1560       O  
ATOM   3342  C3'  DT J -57      83.671  85.046   0.010  1.00133.93           C  
ANISOU 3342  C3'  DT J -57    11320  19849  19718  -2733    826   1028       C  
ATOM   3343  O3'  DT J -57      82.406  85.482  -0.483  1.00129.26           O  
ANISOU 3343  O3'  DT J -57    11087  19215  18811  -2718    717    563       O  
ATOM   3344  C2'  DT J -57      84.121  83.765  -0.681  1.00135.87           C  
ANISOU 3344  C2'  DT J -57    11737  19912  19976  -2320   1084   1190       C  
ATOM   3345  C1'  DT J -57      84.679  84.317  -1.982  1.00134.82           C  
ANISOU 3345  C1'  DT J -57    11730  19656  19837  -1907   1449   1341       C  
ATOM   3346  N1   DT J -57      85.684  83.426  -2.616  1.00139.12           N  
ANISOU 3346  N1   DT J -57    12277  20068  20515  -1499   1779   1695       N  
ATOM   3347  C2   DT J -57      85.678  83.261  -3.983  1.00136.98           C  
ANISOU 3347  C2   DT J -57    12345  19612  20089  -1010   2082   1653       C  
ATOM   3348  O2   DT J -57      84.881  83.813  -4.720  1.00134.48           O  
ANISOU 3348  O2   DT J -57    12329  19238  19529   -890   2095   1337       O  
ATOM   3349  N3   DT J -57      86.650  82.419  -4.459  1.00138.34           N  
ANISOU 3349  N3   DT J -57    12491  19677  20396   -651   2374   2000       N  
ATOM   3350  C4   DT J -57      87.605  81.744  -3.718  1.00140.22           C  
ANISOU 3350  C4   DT J -57    12401  19976  20902   -730   2392   2380       C  
ATOM   3351  O4   DT J -57      88.437  81.005  -4.233  1.00139.68           O  
ANISOU 3351  O4   DT J -57    12338  19804  20929   -372   2670   2677       O  
ATOM   3352  C5   DT J -57      87.547  81.958  -2.293  1.00144.67           C  
ANISOU 3352  C5   DT J -57    12617  20741  21612  -1252   2062   2401       C  
ATOM   3353  C7   DT J -57      88.531  81.276  -1.387  1.00147.20           C  
ANISOU 3353  C7   DT J -57    12558  21159  22211  -1370   2049   2800       C  
ATOM   3354  C6   DT J -57      86.603  82.780  -1.818  1.00144.57           C  
ANISOU 3354  C6   DT J -57    12630  20832  21469  -1606   1774   2060       C  
ATOM   3355  P    DC J -56      81.107  84.546  -0.331  1.00120.44           P  
ANISOU 3355  P    DC J -56    10290  18050  17423  -2768    492    130       P  
ATOM   3356  OP1  DC J -56      79.922  85.428  -0.396  1.00119.99           O  
ANISOU 3356  OP1  DC J -56    10426  18058  17107  -2928    293   -298       O  
ATOM   3357  OP2  DC J -56      81.307  83.671   0.845  1.00125.32           O  
ANISOU 3357  OP2  DC J -56    10668  18756  18194  -3038    299    262       O  
ATOM   3358  O5'  DC J -56      81.126  83.627  -1.642  1.00113.11           O  
ANISOU 3358  O5'  DC J -56     9738  16877  16363  -2240    793     98       O  
ATOM   3359  C5'  DC J -56      80.743  84.175  -2.897  1.00112.05           C  
ANISOU 3359  C5'  DC J -56     9926  16634  16013  -1909    981    -92       C  
ATOM   3360  C4'  DC J -56      80.623  83.092  -3.956  1.00117.40           C  
ANISOU 3360  C4'  DC J -56    10968  17093  16544  -1450   1200   -176       C  
ATOM   3361  O4'  DC J -56      81.936  82.539  -4.252  1.00127.30           O  
ANISOU 3361  O4'  DC J -56    12071  18259  18038  -1173   1499    284       O  
ATOM   3362  C3'  DC J -56      79.741  81.893  -3.578  1.00114.04           C  
ANISOU 3362  C3'  DC J -56    10741  16606  15982  -1544    989   -471       C  
ATOM   3363  O3'  DC J -56      78.970  81.503  -4.706  1.00111.34           O  
ANISOU 3363  O3'  DC J -56    10850  16103  15352  -1197   1086   -808       O  
ATOM   3364  C2'  DC J -56      80.772  80.824  -3.236  1.00121.70           C  
ANISOU 3364  C2'  DC J -56    11527  17507  17208  -1455   1120    -81       C  
ATOM   3365  C1'  DC J -56      81.819  81.139  -4.284  1.00131.20           C  
ANISOU 3365  C1'  DC J -56    12732  18617  18502  -1027   1511    242       C  
ATOM   3366  N1   DC J -56      83.151  80.518  -4.038  1.00143.32           N  
ANISOU 3366  N1   DC J -56    13992  20127  20334   -911   1707    739       N  
ATOM   3367  C2   DC J -56      83.847  79.954  -5.111  1.00150.71           C  
ANISOU 3367  C2   DC J -56    15096  20886  21282   -404   2065    942       C  
ATOM   3368  O2   DC J -56      83.343  79.993  -6.236  1.00152.23           O  
ANISOU 3368  O2   DC J -56    15658  20947  21235    -67   2205    700       O  
ATOM   3369  N3   DC J -56      85.053  79.384  -4.889  1.00155.11           N  
ANISOU 3369  N3   DC J -56    15401  21431  22103   -287   2247   1399       N  
ATOM   3370  C4   DC J -56      85.560  79.360  -3.657  1.00153.59           C  
ANISOU 3370  C4   DC J -56    14804  21398  22153   -655   2081   1645       C  
ATOM   3371  N4   DC J -56      86.757  78.788  -3.485  1.00155.63           N  
ANISOU 3371  N4   DC J -56    14819  21653  22661   -512   2271   2099       N  
ATOM   3372  C5   DC J -56      84.866  79.928  -2.545  1.00148.80           C  
ANISOU 3372  C5   DC J -56    14024  20976  21536  -1173   1711   1439       C  
ATOM   3373  C6   DC J -56      83.674  80.489  -2.779  1.00145.11           C  
ANISOU 3373  C6   DC J -56    13812  20513  20808  -1282   1538    990       C  
ATOM   3374  P    DC J -55      77.385  81.275  -4.583  1.00115.45           P  
ANISOU 3374  P    DC J -55    11663  16638  15565  -1374    785  -1369       P  
ATOM   3375  OP1  DC J -55      76.739  82.532  -5.019  1.00112.70           O  
ANISOU 3375  OP1  DC J -55    11424  16385  15012  -1389    740  -1618       O  
ATOM   3376  OP2  DC J -55      77.091  80.728  -3.240  1.00115.18           O  
ANISOU 3376  OP2  DC J -55    11420  16705  15640  -1812    482  -1391       O  
ATOM   3377  O5'  DC J -55      77.084  80.134  -5.668  1.00116.33           O  
ANISOU 3377  O5'  DC J -55    12189  16511  15501   -938    956  -1553       O  
ATOM   3378  C5'  DC J -55      77.077  80.460  -7.052  1.00116.77           C  
ANISOU 3378  C5'  DC J -55    12539  16458  15369   -480   1216  -1643       C  
ATOM   3379  C4'  DC J -55      77.942  79.500  -7.858  1.00119.58           C  
ANISOU 3379  C4'  DC J -55    13022  16604  15807    -23   1540  -1395       C  
ATOM   3380  O4'  DC J -55      79.241  79.381  -7.259  1.00123.09           O  
ANISOU 3380  O4'  DC J -55    13095  17079  16593    -85   1667   -880       O  
ATOM   3381  C3'  DC J -55      77.426  78.072  -7.954  1.00117.66           C  
ANISOU 3381  C3'  DC J -55    13043  16186  15475     70   1476  -1618       C  
ATOM   3382  O3'  DC J -55      76.618  77.931  -9.122  1.00115.98           O  
ANISOU 3382  O3'  DC J -55    13266  15858  14945    406   1541  -2007       O  
ATOM   3383  C2'  DC J -55      78.708  77.223  -8.054  1.00123.26           C  
ANISOU 3383  C2'  DC J -55    13637  16760  16436    328   1746  -1167       C  
ATOM   3384  C1'  DC J -55      79.844  78.211  -7.756  1.00125.40           C  
ANISOU 3384  C1'  DC J -55    13517  17177  16953    267   1890   -708       C  
ATOM   3385  N1   DC J -55      80.832  77.717  -6.743  1.00125.54           N  
ANISOU 3385  N1   DC J -55    13158  17240  17303     69   1885   -280       N  
ATOM   3386  C2   DC J -55      81.949  76.969  -7.155  1.00126.11           C  
ANISOU 3386  C2   DC J -55    13195  17179  17544    422   2186    100       C  
ATOM   3387  O2   DC J -55      82.102  76.718  -8.357  1.00125.19           O  
ANISOU 3387  O2   DC J -55    13367  16903  17296    898   2453     73       O  
ATOM   3388  N3   DC J -55      82.832  76.539  -6.214  1.00127.67           N  
ANISOU 3388  N3   DC J -55    13039  17437  18034    243   2175    488       N  
ATOM   3389  C4   DC J -55      82.630  76.832  -4.927  1.00126.18           C  
ANISOU 3389  C4   DC J -55    12547  17432  17966   -260   1880    500       C  
ATOM   3390  N4   DC J -55      83.521  76.392  -4.032  1.00127.57           N  
ANISOU 3390  N4   DC J -55    12376  17676  18419   -410   1877    887       N  
ATOM   3391  C5   DC J -55      81.504  77.591  -4.495  1.00122.93           C  
ANISOU 3391  C5   DC J -55    12171  17153  17385   -621   1573    115       C  
ATOM   3392  C6   DC J -55      80.642  78.010  -5.426  1.00122.15           C  
ANISOU 3392  C6   DC J -55    12418  16993  17002   -442   1590   -261       C  
ATOM   3393  P    DT J -54      75.715  76.617  -9.337  1.00121.90           P  
ANISOU 3393  P    DT J -54    14360  16431  15524    471   1418  -2392       P  
ATOM   3394  OP1  DT J -54      74.645  76.972 -10.295  1.00125.05           O  
ANISOU 3394  OP1  DT J -54    15125  16822  15565    663   1380  -2860       O  
ATOM   3395  OP2  DT J -54      75.359  76.089  -8.002  1.00113.96           O  
ANISOU 3395  OP2  DT J -54    13154  15489  14659    -14   1119  -2420       O  
ATOM   3396  O5'  DT J -54      76.706  75.572 -10.039  1.00129.01           O  
ANISOU 3396  O5'  DT J -54    15381  17097  16540    928   1745  -2111       O  
ATOM   3397  C5'  DT J -54      77.036  75.722 -11.417  1.00132.47           C  
ANISOU 3397  C5'  DT J -54    16077  17427  16827   1468   2055  -2100       C  
ATOM   3398  C4'  DT J -54      78.193  74.817 -11.813  1.00136.66           C  
ANISOU 3398  C4'  DT J -54    16613  17774  17536   1840   2361  -1725       C  
ATOM   3399  O4'  DT J -54      79.230  74.863 -10.793  1.00134.31           O  
ANISOU 3399  O4'  DT J -54    15879  17565  17587   1596   2382  -1242       O  
ATOM   3400  C3'  DT J -54      77.841  73.333 -11.989  1.00143.42           C  
ANISOU 3400  C3'  DT J -54    17758  18394  18340   1976   2334  -1927       C  
ATOM   3401  O3'  DT J -54      78.497  72.822 -13.150  1.00159.04           O  
ANISOU 3401  O3'  DT J -54    19977  20187  20266   2550   2675  -1802       O  
ATOM   3402  C2'  DT J -54      78.403  72.702 -10.718  1.00138.09           C  
ANISOU 3402  C2'  DT J -54    16758  17729  17982   1636   2231  -1613       C  
ATOM   3403  C1'  DT J -54      79.648  73.547 -10.524  1.00134.77           C  
ANISOU 3403  C1'  DT J -54    15963  17453  17792   1669   2431  -1097       C  
ATOM   3404  N1   DT J -54      80.224  73.483  -9.149  1.00127.62           N  
ANISOU 3404  N1   DT J -54    14625  16673  17194   1253   2297   -760       N  
ATOM   3405  C2   DT J -54      81.468  72.925  -8.971  1.00126.26           C  
ANISOU 3405  C2   DT J -54    14250  16441  17280   1417   2516   -283       C  
ATOM   3406  O2   DT J -54      82.132  72.470  -9.885  1.00121.79           O  
ANISOU 3406  O2   DT J -54    13846  15721  16709   1890   2822   -116       O  
ATOM   3407  N3   DT J -54      81.909  72.910  -7.675  1.00128.92           N  
ANISOU 3407  N3   DT J -54    14189  16920  17877   1017   2364     -6       N  
ATOM   3408  C4   DT J -54      81.248  73.392  -6.562  1.00126.67           C  
ANISOU 3408  C4   DT J -54    13694  16821  17613    485   2022   -156       C  
ATOM   3409  O4   DT J -54      81.730  73.335  -5.436  1.00128.24           O  
ANISOU 3409  O4   DT J -54    13534  17148  18045    168   1907    118       O  
ATOM   3410  C5   DT J -54      79.949  73.966  -6.817  1.00123.93           C  
ANISOU 3410  C5   DT J -54    13579  16522  16988    342   1811   -656       C  
ATOM   3411  C7   DT J -54      79.135  74.521  -5.685  1.00120.72           C  
ANISOU 3411  C7   DT J -54    12980  16321  16569   -210   1440   -856       C  
ATOM   3412  C6   DT J -54      79.504  73.981  -8.084  1.00124.11           C  
ANISOU 3412  C6   DT J -54    13988  16410  16757    727   1956   -930       C  
ATOM   3413  P    DA J -53      77.831  71.648 -14.026  1.00129.95           P  
ANISOU 3413  P    DA J -53    17646  16042  15687   1884   1620  -2875       P  
ATOM   3414  OP1  DA J -53      77.862  72.082 -15.441  1.00127.56           O  
ANISOU 3414  OP1  DA J -53    17662  15679  15125   1713   1741  -3261       O  
ATOM   3415  OP2  DA J -53      76.543  71.283 -13.394  1.00127.91           O  
ANISOU 3415  OP2  DA J -53    17425  15713  15464   1840   1403  -2761       O  
ATOM   3416  O5'  DA J -53      78.847  70.420 -13.865  1.00141.42           O  
ANISOU 3416  O5'  DA J -53    18868  17243  17621   2123   1927  -2769       O  
ATOM   3417  C5'  DA J -53      79.992  70.556 -13.033  1.00148.20           C  
ANISOU 3417  C5'  DA J -53    19383  18278  18647   2314   1963  -2492       C  
ATOM   3418  C4'  DA J -53      81.049  69.517 -13.364  1.00156.47           C  
ANISOU 3418  C4'  DA J -53    20292  19062  20099   2502   2313  -2517       C  
ATOM   3419  O4'  DA J -53      82.020  69.485 -12.297  1.00158.14           O  
ANISOU 3419  O4'  DA J -53    20122  19428  20536   2717   2297  -2180       O  
ATOM   3420  C3'  DA J -53      80.545  68.089 -13.459  1.00160.70           C  
ANISOU 3420  C3'  DA J -53    20884  19200  20975   2579   2461  -2544       C  
ATOM   3421  O3'  DA J -53      81.449  67.304 -14.228  1.00165.09           O  
ANISOU 3421  O3'  DA J -53    21429  19491  21807   2685   2825  -2698       O  
ATOM   3422  C2'  DA J -53      80.532  67.651 -11.997  1.00161.18           C  
ANISOU 3422  C2'  DA J -53    20642  19317  21283   2766   2313  -2137       C  
ATOM   3423  C1'  DA J -53      81.692  68.450 -11.387  1.00159.94           C  
ANISOU 3423  C1'  DA J -53    20197  19482  21093   2876   2263  -1927       C  
ATOM   3424  N9   DA J -53      81.353  69.050 -10.099  1.00157.38           N  
ANISOU 3424  N9   DA J -53    19710  19442  20646   2898   1939  -1602       N  
ATOM   3425  C8   DA J -53      80.264  69.824  -9.814  1.00154.27           C  
ANISOU 3425  C8   DA J -53    19471  19231  19913   2721   1652  -1591       C  
ATOM   3426  N7   DA J -53      80.205  70.219  -8.566  1.00153.40           N  
ANISOU 3426  N7   DA J -53    19169  19349  19767   2788   1413  -1261       N  
ATOM   3427  C5   DA J -53      81.335  69.667  -7.989  1.00156.02           C  
ANISOU 3427  C5   DA J -53    19198  19649  20432   3026   1536  -1038       C  
ATOM   3428  C6   DA J -53      81.851  69.716  -6.680  1.00158.66           C  
ANISOU 3428  C6   DA J -53    19238  20151  20894   3198   1389   -655       C  
ATOM   3429  N6   DA J -53      81.261  70.381  -5.682  1.00155.07           N  
ANISOU 3429  N6   DA J -53    18759  19934  20225   3146   1088   -426       N  
ATOM   3430  N1   DA J -53      82.999  69.052  -6.436  1.00164.37           N  
ANISOU 3430  N1   DA J -53    19699  20780  21974   3425   1562   -517       N  
ATOM   3431  C2   DA J -53      83.586  68.387  -7.439  1.00166.88           C  
ANISOU 3431  C2   DA J -53    20046  20851  22512   3477   1879   -748       C  
ATOM   3432  N3   DA J -53      83.196  68.269  -8.708  1.00164.76           N  
ANISOU 3432  N3   DA J -53    20054  20401  22147   3326   2058  -1114       N  
ATOM   3433  C4   DA J -53      82.055  68.941  -8.920  1.00158.86           C  
ANISOU 3433  C4   DA J -53    19566  19757  21036   3100   1862  -1242       C  
ATOM   3434  P    DC J -52      81.166  65.739 -14.468  1.00162.89           P  
ANISOU 3434  P    DC J -52    21207  18763  21919   2784   3056  -2753       P  
ATOM   3435  OP1  DC J -52      81.876  65.337 -15.703  1.00167.16           O  
ANISOU 3435  OP1  DC J -52    21891  19066  22557   2780   3416  -3052       O  
ATOM   3436  OP2  DC J -52      79.707  65.519 -14.349  1.00158.92           O  
ANISOU 3436  OP2  DC J -52    20912  18167  21305   2642   2851  -2791       O  
ATOM   3437  O5'  DC J -52      81.867  65.024 -13.220  1.00167.79           O  
ANISOU 3437  O5'  DC J -52    21434  19370  22949   3070   3080  -2361       O  
ATOM   3438  C5'  DC J -52      83.271  65.151 -13.021  1.00170.46           C  
ANISOU 3438  C5'  DC J -52    21488  19813  23466   3249   3230  -2237       C  
ATOM   3439  C4'  DC J -52      83.728  64.296 -11.853  1.00170.07           C  
ANISOU 3439  C4'  DC J -52    21106  19690  23823   3519   3233  -1873       C  
ATOM   3440  O4'  DC J -52      83.536  65.025 -10.612  1.00167.37           O  
ANISOU 3440  O4'  DC J -52    20579  19680  23334   3542   2890  -1553       O  
ATOM   3441  C3'  DC J -52      82.976  62.969 -11.695  1.00169.05           C  
ANISOU 3441  C3'  DC J -52    21061  19195  23975   3584   3314  -1841       C  
ATOM   3442  O3'  DC J -52      83.892  61.902 -11.480  1.00167.57           O  
ANISOU 3442  O3'  DC J -52    20651  18775  24244   3842   3569  -1710       O  
ATOM   3443  C2'  DC J -52      82.092  63.202 -10.472  1.00168.86           C  
ANISOU 3443  C2'  DC J -52    20970  19339  23849   3573   2967  -1554       C  
ATOM   3444  C1'  DC J -52      82.930  64.177  -9.666  1.00169.38           C  
ANISOU 3444  C1'  DC J -52    20759  19789  23810   3655   2790  -1305       C  
ATOM   3445  N1   DC J -52      82.122  65.000  -8.730  1.00170.19           N  
ANISOU 3445  N1   DC J -52    20860  20179  23625   3556   2420  -1106       N  
ATOM   3446  C2   DC J -52      82.521  65.127  -7.394  1.00174.10           C  
ANISOU 3446  C2   DC J -52    21069  20861  24218   3722   2235   -718       C  
ATOM   3447  O2   DC J -52      83.554  64.560  -7.016  1.00178.81           O  
ANISOU 3447  O2   DC J -52    21408  21389  25143   3952   2369   -544       O  
ATOM   3448  N3   DC J -52      81.765  65.875  -6.551  1.00170.98           N  
ANISOU 3448  N3   DC J -52    20694  20714  23555   3626   1913   -542       N  
ATOM   3449  C4   DC J -52      80.658  66.471  -7.000  1.00165.87           C  
ANISOU 3449  C4   DC J -52    20318  20130  22573   3384   1778   -738       C  
ATOM   3450  N4   DC J -52      79.944  67.197  -6.134  1.00162.05           N  
ANISOU 3450  N4   DC J -52    19842  19886  21844   3300   1474   -553       N  
ATOM   3451  C5   DC J -52      80.232  66.344  -8.356  1.00164.70           C  
ANISOU 3451  C5   DC J -52    20454  19796  22328   3217   1946  -1131       C  
ATOM   3452  C6   DC J -52      80.985  65.605  -9.176  1.00167.42           C  
ANISOU 3452  C6   DC J -52    20793  19894  22923   3308   2264  -1302       C  
ATOM   3453  P    DT J -51      83.355  60.395 -11.306  1.00178.01           P  
ANISOU 3453  P    DT J -51    22026  19684  25927   3955   3714  -1660       P  
ATOM   3454  OP1  DT J -51      84.302  59.508 -12.016  1.00181.63           O  
ANISOU 3454  OP1  DT J -51    22437  19845  26729   4104   4107  -1787       O  
ATOM   3455  OP2  DT J -51      81.919  60.360 -11.662  1.00171.65           O  
ANISOU 3455  OP2  DT J -51    21544  18778  24897   3727   3589  -1841       O  
ATOM   3456  O5'  DT J -51      83.483  60.121  -9.735  1.00177.88           O  
ANISOU 3456  O5'  DT J -51    21700  19771  26116   4169   3513  -1207       O  
ATOM   3457  C5'  DT J -51      84.764  60.135  -9.116  1.00178.62           C  
ANISOU 3457  C5'  DT J -51    21444  19983  26441   4408   3556   -960       C  
ATOM   3458  C4'  DT J -51      84.685  59.628  -7.687  1.00178.86           C  
ANISOU 3458  C4'  DT J -51    21252  20020  26685   4606   3379   -550       C  
ATOM   3459  O4'  DT J -51      84.050  60.628  -6.847  1.00173.68           O  
ANISOU 3459  O4'  DT J -51    20594  19703  25695   4489   3005   -376       O  
ATOM   3460  C3'  DT J -51      83.887  58.336  -7.500  1.00181.49           C  
ANISOU 3460  C3'  DT J -51    21708  19979  27271   4664   3475   -515       C  
ATOM   3461  O3'  DT J -51      84.591  57.447  -6.641  1.00186.53           O  
ANISOU 3461  O3'  DT J -51    22081  20479  28311   4959   3547   -208       O  
ATOM   3462  C2'  DT J -51      82.579  58.814  -6.869  1.00176.17           C  
ANISOU 3462  C2'  DT J -51    21182  19448  26305   4491   3156   -429       C  
ATOM   3463  C1'  DT J -51      83.039  60.026  -6.075  1.00172.28           C  
ANISOU 3463  C1'  DT J -51    20490  19390  25578   4499   2873   -206       C  
ATOM   3464  N1   DT J -51      81.958  61.026  -5.854  1.00167.51           N  
ANISOU 3464  N1   DT J -51    20057  19037  24553   4260   2573   -232       N  
ATOM   3465  C2   DT J -51      81.770  61.558  -4.598  1.00168.49           C  
ANISOU 3465  C2   DT J -51    20046  19413  24560   4299   2274     95       C  
ATOM   3466  O2   DT J -51      82.454  61.256  -3.635  1.00172.11           O  
ANISOU 3466  O2   DT J -51    20254  19905  25234   4519   2228    411       O  
ATOM   3467  N3   DT J -51      80.746  62.466  -4.509  1.00163.80           N  
ANISOU 3467  N3   DT J -51    19627  19026  23583   4069   2028     38       N  
ATOM   3468  C4   DT J -51      79.909  62.883  -5.529  1.00158.55           C  
ANISOU 3468  C4   DT J -51    19246  18344  22651   3815   2036   -304       C  
ATOM   3469  O4   DT J -51      79.016  63.705  -5.353  1.00155.42           O  
ANISOU 3469  O4   DT J -51    18982  18142  21929   3629   1800   -324       O  
ATOM   3470  C5   DT J -51      80.161  62.284  -6.819  1.00157.74           C  
ANISOU 3470  C5   DT J -51    19281  17973  22680   3787   2341   -634       C  
ATOM   3471  C7   DT J -51      79.320  62.660  -8.002  1.00152.26           C  
ANISOU 3471  C7   DT J -51    18910  17230  21710   3520   2360  -1018       C  
ATOM   3472  C6   DT J -51      81.159  61.395  -6.916  1.00163.24           C  
ANISOU 3472  C6   DT J -51    19815  18462  23748   4006   2599   -584       C  
ATOM   3473  P    DA J -50      83.939  56.041  -6.215  1.00173.04           P  
ANISOU 3473  P    DA J -50    20446  18385  26917   5074   3648    -94       P  
ATOM   3474  OP1  DA J -50      85.046  55.115  -5.889  1.00178.96           O  
ANISOU 3474  OP1  DA J -50    20940  18944  28112   5384   3855     93       O  
ATOM   3475  OP2  DA J -50      82.947  55.661  -7.245  1.00171.27           O  
ANISOU 3475  OP2  DA J -50    20566  17912  26598   4860   3790   -441       O  
ATOM   3476  O5'  DA J -50      83.148  56.381  -4.868  1.00171.93           O  
ANISOU 3476  O5'  DA J -50    20267  18434  26624   5061   3289    227       O  
ATOM   3477  C5'  DA J -50      83.831  57.005  -3.789  1.00172.74           C  
ANISOU 3477  C5'  DA J -50    20095  18841  26696   5199   3058    560       C  
ATOM   3478  C4'  DA J -50      83.116  56.754  -2.474  1.00173.21           C  
ANISOU 3478  C4'  DA J -50    20138  18909  26766   5259   2823    891       C  
ATOM   3479  O4'  DA J -50      82.225  57.859  -2.181  1.00169.97           O  
ANISOU 3479  O4'  DA J -50    19855  18793  25933   5027   2526    886       O  
ATOM   3480  C3'  DA J -50      82.260  55.493  -2.429  1.00175.51           C  
ANISOU 3480  C3'  DA J -50    20598  18800  27287   5285   2968    877       C  
ATOM   3481  O3'  DA J -50      82.363  54.900  -1.141  1.00176.44           O  
ANISOU 3481  O3'  DA J -50    20567  18851  27619   5503   2867   1263       O  
ATOM   3482  C2'  DA J -50      80.852  56.022  -2.708  1.00172.78           C  
ANISOU 3482  C2'  DA J -50    20534  18516  26600   4985   2819    689       C  
ATOM   3483  C1'  DA J -50      80.895  57.397  -2.056  1.00170.05           C  
ANISOU 3483  C1'  DA J -50    20095  18615  25900   4900   2490    843       C  
ATOM   3484  N9   DA J -50      80.022  58.380  -2.693  1.00167.79           N  
ANISOU 3484  N9   DA J -50    20027  18513  25213   4600   2359    585       N  
ATOM   3485  C8   DA J -50      79.816  58.557  -4.033  1.00167.38           C  
ANISOU 3485  C8   DA J -50    20168  18392  25035   4418   2509    193       C  
ATOM   3486  N7   DA J -50      78.986  59.535  -4.317  1.00163.17           N  
ANISOU 3486  N7   DA J -50    19807  18068  24121   4168   2318     40       N  
ATOM   3487  C5   DA J -50      78.631  60.039  -3.076  1.00162.13           C  
ANISOU 3487  C5   DA J -50    19583  18158  23861   4186   2036    352       C  
ATOM   3488  C6   DA J -50      77.777  61.091  -2.685  1.00159.14           C  
ANISOU 3488  C6   DA J -50    19298  18055  23114   3994   1750    384       C  
ATOM   3489  N6   DA J -50      77.099  61.851  -3.552  1.00155.98           N  
ANISOU 3489  N6   DA J -50    19107  17760  22400   3741   1687     87       N  
ATOM   3490  N1   DA J -50      77.647  61.331  -1.363  1.00159.47           N  
ANISOU 3490  N1   DA J -50    19218  18252  23121   4074   1530    736       N  
ATOM   3491  C2   DA J -50      78.326  60.569  -0.499  1.00162.53           C  
ANISOU 3491  C2   DA J -50    19410  18527  23816   4330   1581   1035       C  
ATOM   3492  N3   DA J -50      79.155  59.557  -0.746  1.00166.05           N  
ANISOU 3492  N3   DA J -50    19745  18722  24626   4534   1828   1044       N  
ATOM   3493  C4   DA J -50      79.265  59.342  -2.065  1.00165.19           C  
ANISOU 3493  C4   DA J -50    19753  18462  24549   4448   2056    689       C  
ATOM   3494  P    DC J -49      81.512  53.591  -0.765  1.00182.47           P  
ANISOU 3494  P    DC J -49    21474  19219  28636   5565   2981   1341       P  
ATOM   3495  OP1  DC J -49      82.332  52.788   0.171  1.00185.71           O  
ANISOU 3495  OP1  DC J -49    21660  19503  29397   5885   3018   1687       O  
ATOM   3496  OP2  DC J -49      81.011  52.972  -2.013  1.00183.84           O  
ANISOU 3496  OP2  DC J -49    21877  19093  28879   5429   3254    966       O  
ATOM   3497  O5'  DC J -49      80.268  54.180   0.042  1.00174.23           O  
ANISOU 3497  O5'  DC J -49    20569  18339  27290   5385   2682   1464       O  
ATOM   3498  C5'  DC J -49      80.496  55.061   1.133  1.00168.35           C  
ANISOU 3498  C5'  DC J -49    19676  17936  26354   5427   2377   1767       C  
ATOM   3499  C4'  DC J -49      79.217  55.301   1.909  1.00161.85           C  
ANISOU 3499  C4'  DC J -49    19013  17158  25324   5279   2163   1886       C  
ATOM   3500  O4'  DC J -49      78.467  56.381   1.294  1.00157.05           O  
ANISOU 3500  O4'  DC J -49    18563  16780  24329   4984   2032   1634       O  
ATOM   3501  C3'  DC J -49      78.269  54.106   1.977  1.00159.42           C  
ANISOU 3501  C3'  DC J -49    18882  16453  25237   5276   2318   1861       C  
ATOM   3502  O3'  DC J -49      77.709  54.020   3.276  1.00153.18           O  
ANISOU 3502  O3'  DC J -49    18100  15677  24425   5325   2135   2185       O  
ATOM   3503  C2'  DC J -49      77.212  54.440   0.923  1.00158.15           C  
ANISOU 3503  C2'  DC J -49    18967  16265  24857   4972   2352   1479       C  
ATOM   3504  C1'  DC J -49      77.151  55.955   1.025  1.00155.42           C  
ANISOU 3504  C1'  DC J -49    18598  16358  24096   4808   2075   1472       C  
ATOM   3505  N1   DC J -49      76.693  56.624  -0.224  1.00152.63           N  
ANISOU 3505  N1   DC J -49    18414  16092  23488   4548   2096   1077       N  
ATOM   3506  C2   DC J -49      75.864  57.746  -0.137  1.00148.09           C  
ANISOU 3506  C2   DC J -49    17944  15791  22530   4316   1849   1020       C  
ATOM   3507  O2   DC J -49      75.527  58.151   0.982  1.00145.85           O  
ANISOU 3507  O2   DC J -49    17614  15670  22134   4330   1630   1298       O  
ATOM   3508  N3   DC J -49      75.456  58.352  -1.280  1.00146.06           N  
ANISOU 3508  N3   DC J -49    17850  15608  22038   4086   1859    664       N  
ATOM   3509  C4   DC J -49      75.850  57.876  -2.464  1.00146.96           C  
ANISOU 3509  C4   DC J -49    18033  15529  22277   4077   2106    372       C  
ATOM   3510  N4   DC J -49      75.425  58.503  -3.567  1.00142.59           N  
ANISOU 3510  N4   DC J -49    17661  15049  21469   3846   2099     27       N  
ATOM   3511  C5   DC J -49      76.698  56.732  -2.570  1.00151.75           C  
ANISOU 3511  C5   DC J -49    18533  15851  23273   4307   2374    422       C  
ATOM   3512  C6   DC J -49      77.092  56.145  -1.436  1.00153.99           C  
ANISOU 3512  C6   DC J -49    18645  16069  23795   4539   2357    777       C  
ATOM   3513  P    DC J -48      76.931  52.697   3.748  1.00175.14           P  
ANISOU 3513  P    DC J -48    21011  18048  27487   5396   2279   2286       P  
ATOM   3514  OP1  DC J -48      77.563  52.229   5.001  1.00174.54           O  
ANISOU 3514  OP1  DC J -48    20780  17933  27604   5671   2213   2699       O  
ATOM   3515  OP2  DC J -48      76.825  51.778   2.592  1.00176.00           O  
ANISOU 3515  OP2  DC J -48    21231  17820  27822   5367   2589   1972       O  
ATOM   3516  O5'  DC J -48      75.466  53.234   4.079  1.00166.77           O  
ANISOU 3516  O5'  DC J -48    20149  17068  26148   5136   2098   2250       O  
ATOM   3517  C5'  DC J -48      75.290  54.574   4.528  1.00156.57           C  
ANISOU 3517  C5'  DC J -48    18830  16175  24484   5006   1807   2335       C  
ATOM   3518  C4'  DC J -48      73.828  54.971   4.467  1.00149.44           C  
ANISOU 3518  C4'  DC J -48    18137  15287  23358   4732   1706   2194       C  
ATOM   3519  O4'  DC J -48      73.569  55.706   3.239  1.00142.01           O  
ANISOU 3519  O4'  DC J -48    17284  14485  22189   4502   1704   1820       O  
ATOM   3520  C3'  DC J -48      72.849  53.799   4.465  1.00152.36           C  
ANISOU 3520  C3'  DC J -48    18670  15253  23969   4700   1882   2136       C  
ATOM   3521  O3'  DC J -48      71.688  54.151   5.196  1.00160.24           O  
ANISOU 3521  O3'  DC J -48    19782  16301  24802   4550   1720   2237       O  
ATOM   3522  C2'  DC J -48      72.541  53.637   2.981  1.00145.88           C  
ANISOU 3522  C2'  DC J -48    17973  14300  23154   4528   2053   1701       C  
ATOM   3523  C1'  DC J -48      72.500  55.092   2.552  1.00137.47           C  
ANISOU 3523  C1'  DC J -48    16908  13632  21692   4337   1840   1556       C  
ATOM   3524  N1   DC J -48      72.684  55.299   1.087  1.00128.87           N  
ANISOU 3524  N1   DC J -48    15892  12541  20532   4206   1960   1161       N  
ATOM   3525  C2   DC J -48      72.038  56.368   0.454  1.00123.09           C  
ANISOU 3525  C2   DC J -48    15276  12039  19455   3946   1805    921       C  
ATOM   3526  O2   DC J -48      71.328  57.123   1.129  1.00119.02           O  
ANISOU 3526  O2   DC J -48    14787  11728  18709   3832   1577   1042       O  
ATOM   3527  N3   DC J -48      72.213  56.544  -0.880  1.00118.83           N  
ANISOU 3527  N3   DC J -48    14826  11484  18839   3828   1915    564       N  
ATOM   3528  C4   DC J -48      72.990  55.703  -1.567  1.00119.12           C  
ANISOU 3528  C4   DC J -48    14839  11287  19134   3957   2179    444       C  
ATOM   3529  N4   DC J -48      73.136  55.912  -2.880  1.00117.25           N  
ANISOU 3529  N4   DC J -48    14715  11032  18802   3829   2288     89       N  
ATOM   3530  C5   DC J -48      73.653  54.608  -0.938  1.00122.78           C  
ANISOU 3530  C5   DC J -48    15172  11514  19964   4225   2346    685       C  
ATOM   3531  C6   DC J -48      73.473  54.444   0.376  1.00126.03           C  
ANISOU 3531  C6   DC J -48    15498  11946  20442   4342   2224   1038       C  
ATOM   3532  P    DA J -47      71.070  53.137   6.278  1.00146.24           P  
ANISOU 3532  P    DA J -47    18076  14228  23262   4653   1784   2502       P  
ATOM   3533  OP1  DA J -47      72.112  52.866   7.292  1.00151.29           O  
ANISOU 3533  OP1  DA J -47    18558  14894  24032   4940   1747   2877       O  
ATOM   3534  OP2  DA J -47      70.451  52.014   5.540  1.00150.69           O  
ANISOU 3534  OP2  DA J -47    18775  14395  24086   4596   2040   2261       O  
ATOM   3535  O5'  DA J -47      69.899  53.987   6.956  1.00142.19           O  
ANISOU 3535  O5'  DA J -47    17667  13895  22463   4445   1560   2577       O  
ATOM   3536  C5'  DA J -47      70.149  55.322   7.381  1.00136.42           C  
ANISOU 3536  C5'  DA J -47    16863  13579  21391   4390   1296   2695       C  
ATOM   3537  C4'  DA J -47      69.124  56.281   6.799  1.00131.17           C  
ANISOU 3537  C4'  DA J -47    16315  13095  20429   4090   1169   2435       C  
ATOM   3538  O4'  DA J -47      69.338  56.424   5.369  1.00131.45           O  
ANISOU 3538  O4'  DA J -47    16370  13144  20432   3984   1262   2059       O  
ATOM   3539  C3'  DA J -47      67.671  55.857   6.971  1.00129.68           C  
ANISOU 3539  C3'  DA J -47    16293  12680  20301   3923   1211   2366       C  
ATOM   3540  O3'  DA J -47      66.863  56.998   7.213  1.00125.39           O  
ANISOU 3540  O3'  DA J -47    15806  12402  19435   3717    993   2351       O  
ATOM   3541  C2'  DA J -47      67.341  55.205   5.631  1.00131.86           C  
ANISOU 3541  C2'  DA J -47    16656  12709  20734   3815   1409   1979       C  
ATOM   3542  C1'  DA J -47      68.186  56.016   4.656  1.00134.11           C  
ANISOU 3542  C1'  DA J -47    16872  13258  20826   3784   1357   1774       C  
ATOM   3543  N9   DA J -47      68.626  55.245   3.495  1.00141.66           N  
ANISOU 3543  N9   DA J -47    17851  13984  21987   3817   1589   1500       N  
ATOM   3544  C8   DA J -47      69.181  53.997   3.508  1.00145.68           C  
ANISOU 3544  C8   DA J -47    18326  14175  22850   4017   1825   1565       C  
ATOM   3545  N7   DA J -47      69.488  53.539   2.320  1.00147.65           N  
ANISOU 3545  N7   DA J -47    18620  14266  23215   3996   2013   1268       N  
ATOM   3546  C5   DA J -47      69.117  54.558   1.463  1.00143.45           C  
ANISOU 3546  C5   DA J -47    18163  13965  22379   3765   1886    989       C  
ATOM   3547  C6   DA J -47      69.188  54.686   0.063  1.00138.04           C  
ANISOU 3547  C6   DA J -47    17571  13253  21625   3631   1977    609       C  
ATOM   3548  N6   DA J -47      69.682  53.735  -0.736  1.00138.25           N  
ANISOU 3548  N6   DA J -47    17630  12997  21902   3713   2240    438       N  
ATOM   3549  N1   DA J -47      68.728  55.828  -0.485  1.00133.18           N  
ANISOU 3549  N1   DA J -47    17029  12905  20667   3410   1793    410       N  
ATOM   3550  C2   DA J -47      68.233  56.777   0.321  1.00130.69           C  
ANISOU 3550  C2   DA J -47    16685  12866  20105   3331   1541    583       C  
ATOM   3551  N3   DA J -47      68.115  56.772   1.652  1.00132.45           N  
ANISOU 3551  N3   DA J -47    16824  13141  20361   3436   1440    938       N  
ATOM   3552  C4   DA J -47      68.581  55.621   2.166  1.00140.44           C  
ANISOU 3552  C4   DA J -47    17772  13882  21709   3654   1622   1128       C  
ATOM   3553  P    DA J -46      65.344  56.831   7.710  1.00140.38           P  
ANISOU 3553  P    DA J -46    17847  14143  21348   3545    978   2360       P  
ATOM   3554  OP1  DA J -46      65.182  57.640   8.940  1.00139.54           O  
ANISOU 3554  OP1  DA J -46    17726  14270  21022   3551    777   2672       O  
ATOM   3555  OP2  DA J -46      65.013  55.389   7.733  1.00141.75           O  
ANISOU 3555  OP2  DA J -46    18083  13883  21895   3622   1220   2352       O  
ATOM   3556  O5'  DA J -46      64.497  57.505   6.537  1.00138.25           O  
ANISOU 3556  O5'  DA J -46    17666  13971  20890   3263    915   1964       O  
ATOM   3557  C5'  DA J -46      65.030  58.619   5.834  1.00131.18           C  
ANISOU 3557  C5'  DA J -46    16727  13413  19704   3189    773   1808       C  
ATOM   3558  C4'  DA J -46      64.481  58.683   4.421  1.00125.63           C  
ANISOU 3558  C4'  DA J -46    16124  12647  18962   2986    818   1381       C  
ATOM   3559  O4'  DA J -46      65.215  57.766   3.558  1.00126.22           O  
ANISOU 3559  O4'  DA J -46    16188  12496  19273   3094   1037   1214       O  
ATOM   3560  C3'  DA J -46      63.008  58.285   4.270  1.00125.14           C  
ANISOU 3560  C3'  DA J -46    16193  12357  18996   2791    847   1221       C  
ATOM   3561  O3'  DA J -46      62.438  59.041   3.228  1.00124.80           O  
ANISOU 3561  O3'  DA J -46    16232  12449  18736   2563    739    890       O  
ATOM   3562  C2'  DA J -46      63.129  56.831   3.841  1.00127.11           C  
ANISOU 3562  C2'  DA J -46    16477  12199  19619   2884   1114   1122       C  
ATOM   3563  C1'  DA J -46      64.273  56.986   2.863  1.00125.86           C  
ANISOU 3563  C1'  DA J -46    16273  12140  19407   2956   1170    953       C  
ATOM   3564  N9   DA J -46      64.883  55.736   2.424  1.00125.12           N  
ANISOU 3564  N9   DA J -46    16177  11725  19640   3108   1432    892       N  
ATOM   3565  C8   DA J -46      65.245  54.671   3.195  1.00126.71           C  
ANISOU 3565  C8   DA J -46    16327  11677  20142   3319   1592   1140       C  
ATOM   3566  N7   DA J -46      65.774  53.681   2.513  1.00130.02           N  
ANISOU 3566  N7   DA J -46    16759  11827  20817   3419   1826   1006       N  
ATOM   3567  C5   DA J -46      65.746  54.129   1.203  1.00128.01           C  
ANISOU 3567  C5   DA J -46    16578  11648  20412   3256   1820    642       C  
ATOM   3568  C6   DA J -46      66.159  53.547  -0.012  1.00128.02           C  
ANISOU 3568  C6   DA J -46    16645  11458  20540   3251   2018    347       C  
ATOM   3569  N6   DA J -46      66.708  52.331  -0.097  1.00132.81           N  
ANISOU 3569  N6   DA J -46    17238  11746  21478   3427   2275    378       N  
ATOM   3570  N1   DA J -46      65.989  54.268  -1.141  1.00125.26           N  
ANISOU 3570  N1   DA J -46    16386  11250  19956   3059   1946     19       N  
ATOM   3571  C2   DA J -46      65.445  55.485  -1.051  1.00122.89           C  
ANISOU 3571  C2   DA J -46    16102  11264  19327   2890   1690     -7       C  
ATOM   3572  N3   DA J -46      65.017  56.133   0.029  1.00122.45           N  
ANISOU 3572  N3   DA J -46    15983  11413  19132   2877   1493    249       N  
ATOM   3573  C4   DA J -46      65.199  55.393   1.133  1.00124.58           C  
ANISOU 3573  C4   DA J -46    16169  11532  19633   3065   1574    569       C  
ATOM   3574  P    DA J -45      61.303  60.138   3.512  1.00119.83           P  
ANISOU 3574  P    DA J -45    15655  12040  17836   2345    508    869       P  
ATOM   3575  OP1  DA J -45      61.912  61.222   4.316  1.00118.14           O  
ANISOU 3575  OP1  DA J -45    15354  12190  17345   2416    329   1130       O  
ATOM   3576  OP2  DA J -45      60.097  59.437   4.007  1.00119.92           O  
ANISOU 3576  OP2  DA J -45    15726  11777  18062   2265    572    903       O  
ATOM   3577  O5'  DA J -45      60.990  60.696   2.048  1.00118.51           O  
ANISOU 3577  O5'  DA J -45    15582  11956  17488   2140    440    452       O  
ATOM   3578  C5'  DA J -45      62.070  60.986   1.169  1.00116.19           C  
ANISOU 3578  C5'  DA J -45    15274  11793  17079   2196    468    302       C  
ATOM   3579  C4'  DA J -45      61.881  60.320  -0.185  1.00113.91           C  
ANISOU 3579  C4'  DA J -45    15103  11258  16920   2100    608    -74       C  
ATOM   3580  O4'  DA J -45      62.431  58.974  -0.180  1.00113.89           O  
ANISOU 3580  O4'  DA J -45    15075  10928  17271   2272    865    -27       O  
ATOM   3581  C3'  DA J -45      60.434  60.176  -0.660  1.00112.48           C  
ANISOU 3581  C3'  DA J -45    15050  10915  16774   1867    556   -316       C  
ATOM   3582  O3'  DA J -45      60.382  60.517  -2.022  1.00115.10           O  
ANISOU 3582  O3'  DA J -45    15501  11277  16955   1719    523   -683       O  
ATOM   3583  C2'  DA J -45      60.156  58.684  -0.458  1.00112.22           C  
ANISOU 3583  C2'  DA J -45    15030  10462  17145   1942    787   -286       C  
ATOM   3584  C1'  DA J -45      61.513  58.114  -0.816  1.00114.16           C  
ANISOU 3584  C1'  DA J -45    15232  10635  17510   2142    976   -272       C  
ATOM   3585  N9   DA J -45      61.754  56.753  -0.345  1.00118.63           N  
ANISOU 3585  N9   DA J -45    15764  10859  18449   2313   1212   -124       N  
ATOM   3586  C8   DA J -45      61.645  56.291   0.934  1.00120.06           C  
ANISOU 3586  C8   DA J -45    15867  10952  18797   2444   1248    212       C  
ATOM   3587  N7   DA J -45      61.954  55.023   1.070  1.00122.28           N  
ANISOU 3587  N7   DA J -45    16145  10904  19410   2592   1483    278       N  
ATOM   3588  C5   DA J -45      62.291  54.625  -0.212  1.00123.93           C  
ANISOU 3588  C5   DA J -45    16432  10976  19678   2553   1616    -40       C  
ATOM   3589  C6   DA J -45      62.713  53.390  -0.744  1.00127.55           C  
ANISOU 3589  C6   DA J -45    16934  11091  20439   2654   1884   -147       C  
ATOM   3590  N6   DA J -45      62.863  52.285  -0.007  1.00132.35           N  
ANISOU 3590  N6   DA J -45    17504  11422  21360   2827   2067     70       N  
ATOM   3591  N1   DA J -45      62.969  53.333  -2.068  1.00125.47           N  
ANISOU 3591  N1   DA J -45    16768  10769  20137   2569   1963   -485       N  
ATOM   3592  C2   DA J -45      62.815  54.440  -2.804  1.00121.56           C  
ANISOU 3592  C2   DA J -45    16327  10542  19317   2398   1780   -700       C  
ATOM   3593  N3   DA J -45      62.429  55.655  -2.417  1.00120.44           N  
ANISOU 3593  N3   DA J -45    16149  10737  18875   2294   1519   -628       N  
ATOM   3594  C4   DA J -45      62.178  55.680  -1.097  1.00121.69           C  
ANISOU 3594  C4   DA J -45    16206  10946  19086   2380   1451   -291       C  
ATOM   3595  P    DA J -44      59.045  61.116  -2.670  1.00112.16           P  
ANISOU 3595  P    DA J -44    15256  10942  16419   1443    335   -960       P  
ATOM   3596  OP1  DA J -44      59.371  62.489  -3.111  1.00110.74           O  
ANISOU 3596  OP1  DA J -44    15101  11130  15844   1367    139  -1046       O  
ATOM   3597  OP2  DA J -44      57.919  60.874  -1.739  1.00109.15           O  
ANISOU 3597  OP2  DA J -44    14837  10453  16180   1384    287   -803       O  
ATOM   3598  O5'  DA J -44      58.836  60.204  -3.961  1.00103.13           O  
ANISOU 3598  O5'  DA J -44    14258   9477  15448   1352    485  -1324       O  
ATOM   3599  C5'  DA J -44      59.964  59.813  -4.727  1.00 95.62           C  
ANISOU 3599  C5'  DA J -44    13342   8458  14532   1461    659  -1440       C  
ATOM   3600  C4'  DA J -44      59.688  58.517  -5.456  1.00 99.47           C  
ANISOU 3600  C4'  DA J -44    13940   8537  15319   1429    870  -1663       C  
ATOM   3601  O4'  DA J -44      60.097  57.389  -4.636  1.00106.48           O  
ANISOU 3601  O4'  DA J -44    14725   9185  16547   1631   1089  -1415       O  
ATOM   3602  C3'  DA J -44      58.215  58.279  -5.806  1.00101.10           C  
ANISOU 3602  C3'  DA J -44    14256   8563  15595   1200    778  -1876       C  
ATOM   3603  O3'  DA J -44      58.109  57.893  -7.161  1.00105.78           O  
ANISOU 3603  O3'  DA J -44    15029   8968  16196   1076    845  -2249       O  
ATOM   3604  C2'  DA J -44      57.808  57.142  -4.866  1.00105.44           C  
ANISOU 3604  C2'  DA J -44    14727   8823  16513   1291    936  -1666       C  
ATOM   3605  C1'  DA J -44      59.117  56.388  -4.735  1.00109.93           C  
ANISOU 3605  C1'  DA J -44    15237   9276  17254   1536   1183  -1527       C  
ATOM   3606  N9   DA J -44      59.192  55.528  -3.556  1.00113.65           N  
ANISOU 3606  N9   DA J -44    15595   9571  18016   1709   1327  -1207       N  
ATOM   3607  C8   DA J -44      58.878  55.860  -2.267  1.00113.19           C  
ANISOU 3607  C8   DA J -44    15420   9641  17946   1764   1226   -886       C  
ATOM   3608  N7   DA J -44      59.043  54.876  -1.412  1.00114.74           N  
ANISOU 3608  N7   DA J -44    15554   9608  18434   1928   1402   -645       N  
ATOM   3609  C5   DA J -44      59.498  53.828  -2.196  1.00118.24           C  
ANISOU 3609  C5   DA J -44    16068   9755  19101   1986   1637   -820       C  
ATOM   3610  C6   DA J -44      59.860  52.499  -1.893  1.00123.23           C  
ANISOU 3610  C6   DA J -44    16691  10046  20084   2153   1902   -710       C  
ATOM   3611  N6   DA J -44      59.819  51.988  -0.658  1.00124.32           N  
ANISOU 3611  N6   DA J -44    16745  10083  20407   2299   1968   -380       N  
ATOM   3612  N1   DA J -44      60.272  51.714  -2.913  1.00127.80           N  
ANISOU 3612  N1   DA J -44    17365  10384  20811   2167   2101   -952       N  
ATOM   3613  C2   DA J -44      60.316  52.229  -4.146  1.00126.32           C  
ANISOU 3613  C2   DA J -44    17284  10288  20424   2019   2037  -1282       C  
ATOM   3614  N3   DA J -44      60.000  53.457  -4.552  1.00122.42           N  
ANISOU 3614  N3   DA J -44    16817  10103  19594   1856   1790  -1416       N  
ATOM   3615  C4   DA J -44      59.594  54.213  -3.520  1.00118.34           C  
ANISOU 3615  C4   DA J -44    16194   9824  18945   1850   1597  -1168       C  
ATOM   3616  P    DG J -43      56.712  58.015  -7.944  1.00103.63           P  
ANISOU 3616  P    DG J -43    14907   8594  15872    796    679  -2570       P  
ATOM   3617  OP1  DG J -43      56.776  59.228  -8.789  1.00 95.93           O  
ANISOU 3617  OP1  DG J -43    14037   7901  14511    668    470  -2778       O  
ATOM   3618  OP2  DG J -43      55.605  57.858  -6.973  1.00105.42           O  
ANISOU 3618  OP2  DG J -43    15036   8761  16256    739    596  -2405       O  
ATOM   3619  O5'  DG J -43      56.720  56.730  -8.888  1.00110.29           O  
ANISOU 3619  O5'  DG J -43    15901   9031  16975    764    909  -2835       O  
ATOM   3620  C5'  DG J -43      57.961  56.181  -9.310  1.00113.32           C  
ANISOU 3620  C5'  DG J -43    16314   9312  17432    928   1152  -2851       C  
ATOM   3621  C4'  DG J -43      57.956  54.672  -9.168  1.00120.19           C  
ANISOU 3621  C4'  DG J -43    17190   9771  18704   1014   1428  -2827       C  
ATOM   3622  O4'  DG J -43      58.108  54.309  -7.778  1.00122.55           O  
ANISOU 3622  O4'  DG J -43    17296  10063  19203   1196   1501  -2444       O  
ATOM   3623  C3'  DG J -43      56.673  53.990  -9.646  1.00123.85           C  
ANISOU 3623  C3'  DG J -43    17782   9938  19337    803   1409  -3071       C  
ATOM   3624  O3'  DG J -43      56.951  53.182 -10.778  1.00127.49           O  
ANISOU 3624  O3'  DG J -43    18428  10114  19899    762   1597  -3361       O  
ATOM   3625  C2'  DG J -43      56.205  53.150  -8.446  1.00125.23           C  
ANISOU 3625  C2'  DG J -43    17818   9921  19841    892   1517  -2798       C  
ATOM   3626  C1'  DG J -43      57.442  53.095  -7.563  1.00125.89           C  
ANISOU 3626  C1'  DG J -43    17745  10117  19971   1176   1658  -2453       C  
ATOM   3627  N9   DG J -43      57.143  52.974  -6.137  1.00128.30           N  
ANISOU 3627  N9   DG J -43    17884  10447  20418   1281   1645  -2096       N  
ATOM   3628  C8   DG J -43      56.672  53.959  -5.301  1.00126.90           C  
ANISOU 3628  C8   DG J -43    17599  10558  20058   1242   1416  -1904       C  
ATOM   3629  N7   DG J -43      56.500  53.561  -4.071  1.00127.66           N  
ANISOU 3629  N7   DG J -43    17579  10587  20339   1356   1476  -1592       N  
ATOM   3630  C5   DG J -43      56.881  52.225  -4.090  1.00130.46           C  
ANISOU 3630  C5   DG J -43    17961  10589  21021   1482   1758  -1573       C  
ATOM   3631  C6   DG J -43      56.909  51.269  -3.045  1.00134.10           C  
ANISOU 3631  C6   DG J -43    18348  10821  21782   1640   1940  -1295       C  
ATOM   3632  O6   DG J -43      56.590  51.420  -1.857  1.00134.76           O  
ANISOU 3632  O6   DG J -43    18333  10972  21899   1698   1886  -1003       O  
ATOM   3633  N1   DG J -43      57.362  50.030  -3.493  1.00133.77           N  
ANISOU 3633  N1   DG J -43    18376  10434  22017   1735   2215  -1383       N  
ATOM   3634  C2   DG J -43      57.739  49.751  -4.787  1.00130.64           C  
ANISOU 3634  C2   DG J -43    18108   9924  21606   1679   2310  -1701       C  
ATOM   3635  N2   DG J -43      58.150  48.501  -5.037  1.00131.02           N  
ANISOU 3635  N2   DG J -43    18214   9621  21946   1787   2594  -1739       N  
ATOM   3636  N3   DG J -43      57.717  50.638  -5.773  1.00130.44           N  
ANISOU 3636  N3   DG J -43    18162  10105  21294   1527   2144  -1965       N  
ATOM   3637  C4   DG J -43      57.279  51.849  -5.354  1.00130.51           C  
ANISOU 3637  C4   DG J -43    18100  10454  21033   1438   1868  -1882       C  
ATOM   3638  P    DT J -42      55.753  52.656 -11.707  1.00128.26           P  
ANISOU 3638  P    DT J -42    18721   9933  20081    501   1545  -3720       P  
ATOM   3639  OP1  DT J -42      56.231  52.670 -13.107  1.00129.09           O  
ANISOU 3639  OP1  DT J -42    19051   9967  20029    424   1601  -4055       O  
ATOM   3640  OP2  DT J -42      54.533  53.407 -11.334  1.00127.76           O  
ANISOU 3640  OP2  DT J -42    18600  10035  19907    326   1247  -3715       O  
ATOM   3641  O5'  DT J -42      55.553  51.142 -11.241  1.00128.18           O  
ANISOU 3641  O5'  DT J -42    18682   9513  20508    580   1817  -3632       O  
ATOM   3642  C5'  DT J -42      56.688  50.323 -10.994  1.00131.55           C  
ANISOU 3642  C5'  DT J -42    19066   9785  21131    821   2122  -3475       C  
ATOM   3643  C4'  DT J -42      56.274  49.000 -10.380  1.00137.81           C  
ANISOU 3643  C4'  DT J -42    19822  10213  22325    878   2335  -3362       C  
ATOM   3644  O4'  DT J -42      56.175  49.136  -8.937  1.00140.95           O  
ANISOU 3644  O4'  DT J -42    20007  10734  22814   1013   2296  -2978       O  
ATOM   3645  C3'  DT J -42      54.918  48.467 -10.849  1.00141.83           C  
ANISOU 3645  C3'  DT J -42    20457  10461  22971    625   2276  -3620       C  
ATOM   3646  O3'  DT J -42      55.011  47.072 -11.086  1.00149.58           O  
ANISOU 3646  O3'  DT J -42    21531  11026  24277    667   2572  -3695       O  
ATOM   3647  C2'  DT J -42      53.998  48.775  -9.668  1.00141.38           C  
ANISOU 3647  C2'  DT J -42    20227  10512  22978    591   2118  -3382       C  
ATOM   3648  C1'  DT J -42      54.954  48.583  -8.506  1.00143.66           C  
ANISOU 3648  C1'  DT J -42    20343  10868  23372    882   2276  -2980       C  
ATOM   3649  N1   DT J -42      54.537  49.268  -7.246  1.00142.54           N  
ANISOU 3649  N1   DT J -42    20019  10966  23173    920   2107  -2670       N  
ATOM   3650  C2   DT J -42      54.556  48.561  -6.069  1.00142.70           C  
ANISOU 3650  C2   DT J -42    19926  10839  23455   1077   2263  -2358       C  
ATOM   3651  O2   DT J -42      54.894  47.393  -5.998  1.00144.13           O  
ANISOU 3651  O2   DT J -42    20141  10704  23918   1192   2531  -2320       O  
ATOM   3652  N3   DT J -42      54.164  49.269  -4.967  1.00142.89           N  
ANISOU 3652  N3   DT J -42    19807  11092  23393   1096   2100  -2090       N  
ATOM   3653  C4   DT J -42      53.761  50.591  -4.922  1.00139.33           C  
ANISOU 3653  C4   DT J -42    19309  10997  22634    977   1806  -2101       C  
ATOM   3654  O4   DT J -42      53.425  51.137  -3.875  1.00135.51           O  
ANISOU 3654  O4   DT J -42    18704  10688  22096   1004   1691  -1845       O  
ATOM   3655  C5   DT J -42      53.763  51.279  -6.193  1.00137.73           C  
ANISOU 3655  C5   DT J -42    19224  10936  22171    820   1651  -2434       C  
ATOM   3656  C7   DT J -42      53.344  52.718  -6.272  1.00131.78           C  
ANISOU 3656  C7   DT J -42    18440  10559  21071    688   1333  -2475       C  
ATOM   3657  C6   DT J -42      54.146  50.592  -7.282  1.00140.43           C  
ANISOU 3657  C6   DT J -42    19716  11054  22589    798   1806  -2700       C  
ATOM   3658  P    DG J -41      53.918  46.328 -11.999  1.00149.79           P  
ANISOU 3658  P    DG J -41    21745  10760  24410    406   2559  -4035       P  
ATOM   3659  OP1  DG J -41      54.641  45.638 -13.091  1.00153.08           O  
ANISOU 3659  OP1  DG J -41    22331  11072  24761    429   2721  -4203       O  
ATOM   3660  OP2  DG J -41      52.853  47.303 -12.320  1.00145.96           O  
ANISOU 3660  OP2  DG J -41    21282  10474  23701    160   2214  -4208       O  
ATOM   3661  O5'  DG J -41      53.296  45.228 -11.021  1.00153.94           O  
ANISOU 3661  O5'  DG J -41    22165  11044  25280    448   2701  -3821       O  
ATOM   3662  C5'  DG J -41      54.140  44.258 -10.413  1.00156.84           C  
ANISOU 3662  C5'  DG J -41    22473  11224  25893    696   3008  -3585       C  
ATOM   3663  C4'  DG J -41      53.424  43.560  -9.270  1.00159.09           C  
ANISOU 3663  C4'  DG J -41    22639  11355  26453    723   3077  -3346       C  
ATOM   3664  O4'  DG J -41      53.320  44.462  -8.137  1.00155.18           O  
ANISOU 3664  O4'  DG J -41    21975  11033  25954    807   2960  -3093       O  
ATOM   3665  C3'  DG J -41      51.995  43.110  -9.581  1.00163.23           C  
ANISOU 3665  C3'  DG J -41    23219  11785  27017    451   2949  -3522       C  
ATOM   3666  O3'  DG J -41      51.741  41.851  -8.973  1.00173.07           O  
ANISOU 3666  O3'  DG J -41    24434  12788  28538    510   3156  -3367       O  
ATOM   3667  C2'  DG J -41      51.148  44.211  -8.952  1.00156.70           C  
ANISOU 3667  C2'  DG J -41    22275  11146  26119    341   2692  -3468       C  
ATOM   3668  C1'  DG J -41      51.976  44.536  -7.722  1.00154.98           C  
ANISOU 3668  C1'  DG J -41    21906  10975  26005    614   2811  -3112       C  
ATOM   3669  N9   DG J -41      51.728  45.864  -7.173  1.00153.35           N  
ANISOU 3669  N9   DG J -41    21566  11164  25536    585   2525  -2970       N  
ATOM   3670  C8   DG J -41      51.631  47.050  -7.861  1.00151.41           C  
ANISOU 3670  C8   DG J -41    21350  11229  24951    453   2250  -3147       C  
ATOM   3671  N7   DG J -41      51.405  48.080  -7.090  1.00148.58           N  
ANISOU 3671  N7   DG J -41    20850  11191  24412    462   2039  -2945       N  
ATOM   3672  C5   DG J -41      51.354  47.540  -5.810  1.00149.32           C  
ANISOU 3672  C5   DG J -41    20820  11178  24736    607   2183  -2614       C  
ATOM   3673  C6   DG J -41      51.139  48.167  -4.557  1.00146.75           C  
ANISOU 3673  C6   DG J -41    20335  11068  24354    679   2076  -2288       C  
ATOM   3674  O6   DG J -41      50.943  49.368  -4.318  1.00141.40           O  
ANISOU 3674  O6   DG J -41    19582  10733  23409    626   1827  -2226       O  
ATOM   3675  N1   DG J -41      51.166  47.246  -3.511  1.00149.05           N  
ANISOU 3675  N1   DG J -41    20569  11128  24936    825   2298  -2017       N  
ATOM   3676  C2   DG J -41      51.374  45.894  -3.659  1.00151.87           C  
ANISOU 3676  C2   DG J -41    21005  11096  25601    897   2587  -2055       C  
ATOM   3677  N2   DG J -41      51.368  45.155  -2.544  1.00152.50           N  
ANISOU 3677  N2   DG J -41    21027  10989  25926   1041   2772  -1764       N  
ATOM   3678  N3   DG J -41      51.576  45.301  -4.824  1.00154.14           N  
ANISOU 3678  N3   DG J -41    21435  11182  25949    832   2693  -2358       N  
ATOM   3679  C4   DG J -41      51.553  46.179  -5.849  1.00152.56           C  
ANISOU 3679  C4   DG J -41    21299  11201  25466    686   2479  -2625       C  
ATOM   3680  P    DT J -40      50.373  41.067  -9.286  1.00164.10           P  
ANISOU 3680  P    DT J -40    23355  11498  27498    259   3097  -3532       P  
ATOM   3681  OP1  DT J -40      50.656  39.617  -9.189  1.00169.85           O  
ANISOU 3681  OP1  DT J -40    24128  11959  28449    356   3381  -3458       O  
ATOM   3682  OP2  DT J -40      49.819  41.626 -10.539  1.00163.70           O  
ANISOU 3682  OP2  DT J -40    23433  11567  27199     16   2848  -3871       O  
ATOM   3683  O5'  DT J -40      49.397  41.489  -8.088  1.00163.46           O  
ANISOU 3683  O5'  DT J -40    23108  11472  27526    207   2981  -3338       O  
ATOM   3684  C5'  DT J -40      49.548  40.894  -6.800  1.00164.33           C  
ANISOU 3684  C5'  DT J -40    23106  11463  27870    385   3177  -3006       C  
ATOM   3685  C4'  DT J -40      48.396  41.266  -5.876  1.00162.61           C  
ANISOU 3685  C4'  DT J -40    22763  11292  27730    271   3047  -2886       C  
ATOM   3686  O4'  DT J -40      48.567  42.629  -5.387  1.00161.73           O  
ANISOU 3686  O4'  DT J -40    22553  11422  27477    318   2868  -2774       O  
ATOM   3687  C3'  DT J -40      46.994  41.240  -6.511  1.00160.86           C  
ANISOU 3687  C3'  DT J -40    22573  11062  27485    -38   2856  -3154       C  
ATOM   3688  O3'  DT J -40      46.037  40.897  -5.524  1.00155.84           O  
ANISOU 3688  O3'  DT J -40    21830  10347  27037    -95   2887  -2994       O  
ATOM   3689  C2'  DT J -40      46.814  42.703  -6.876  1.00161.68           C  
ANISOU 3689  C2'  DT J -40    22649  11440  27342   -142   2559  -3278       C  
ATOM   3690  C1'  DT J -40      47.348  43.301  -5.592  1.00162.52           C  
ANISOU 3690  C1'  DT J -40    22618  11635  27497     66   2612  -2938       C  
ATOM   3691  N1   DT J -40      47.561  44.770  -5.619  1.00161.90           N  
ANISOU 3691  N1   DT J -40    22489  11823  27201     61   2385  -2955       N  
ATOM   3692  C2   DT J -40      47.462  45.471  -4.440  1.00158.89           C  
ANISOU 3692  C2   DT J -40    21967  11556  26848    147   2336  -2679       C  
ATOM   3693  O2   DT J -40      47.231  44.941  -3.368  1.00158.57           O  
ANISOU 3693  O2   DT J -40    21851  11394  27003    233   2479  -2418       O  
ATOM   3694  N3   DT J -40      47.654  46.819  -4.555  1.00155.83           N  
ANISOU 3694  N3   DT J -40    21524  11576  26109    131   2065  -2664       N  
ATOM   3695  C4   DT J -40      47.922  47.526  -5.714  1.00154.28           C  
ANISOU 3695  C4   DT J -40    21416  11568  25636     38   1881  -2933       C  
ATOM   3696  O4   DT J -40      48.080  48.743  -5.716  1.00148.55           O  
ANISOU 3696  O4   DT J -40    20638  11207  24599     31   1647  -2894       O  
ATOM   3697  C5   DT J -40      48.002  46.731  -6.920  1.00158.43           C  
ANISOU 3697  C5   DT J -40    22116  11825  26258    -54   1990  -3263       C  
ATOM   3698  C7   DT J -40      48.285  47.387  -8.238  1.00157.67           C  
ANISOU 3698  C7   DT J -40    22153  11885  25871   -163   1816  -3575       C  
ATOM   3699  C6   DT J -40      47.814  45.405  -6.816  1.00162.01           C  
ANISOU 3699  C6   DT J -40    22608  11981  26969    -38   2219  -3241       C  
ATOM   3700  P    DA J -39      45.675  39.374  -5.169  1.00173.02           P  
ANISOU 3700  P    DA J -39    24029  12240  29471    -88   3138  -2923       P  
ATOM   3701  OP1  DA J -39      46.930  38.620  -4.955  1.00173.13           O  
ANISOU 3701  OP1  DA J -39    24093  12128  29561    170   3404  -2755       O  
ATOM   3702  OP2  DA J -39      44.690  38.895  -6.164  1.00175.65           O  
ANISOU 3702  OP2  DA J -39    24443  12491  29807   -345   3040  -3232       O  
ATOM   3703  O5'  DA J -39      44.921  39.522  -3.765  1.00168.62           O  
ANISOU 3703  O5'  DA J -39    23321  11692  29055    -82   3148  -2655       O  
ATOM   3704  C5'  DA J -39      45.551  40.244  -2.708  1.00160.86           C  
ANISOU 3704  C5'  DA J -39    22245  10839  28037    118   3160  -2348       C  
ATOM   3705  C4'  DA J -39      44.572  41.157  -1.979  1.00153.75           C  
ANISOU 3705  C4'  DA J -39    21217  10085  27118     -2   2978  -2264       C  
ATOM   3706  O4'  DA J -39      44.847  42.547  -2.298  1.00149.62           O  
ANISOU 3706  O4'  DA J -39    20663   9810  26375    -17   2742  -2329       O  
ATOM   3707  C3'  DA J -39      43.085  40.935  -2.276  1.00152.04           C  
ANISOU 3707  C3'  DA J -39    20969   9819  26979   -283   2869  -2468       C  
ATOM   3708  O3'  DA J -39      42.378  40.881  -1.035  1.00149.83           O  
ANISOU 3708  O3'  DA J -39    20579   9513  26836   -284   2930  -2231       O  
ATOM   3709  C2'  DA J -39      42.704  42.171  -3.103  1.00149.96           C  
ANISOU 3709  C2'  DA J -39    20691   9786  26500   -453   2551  -2707       C  
ATOM   3710  C1'  DA J -39      43.628  43.219  -2.513  1.00146.89           C  
ANISOU 3710  C1'  DA J -39    20254   9579  25980   -264   2505  -2495       C  
ATOM   3711  N9   DA J -39      43.886  44.360  -3.388  1.00142.76           N  
ANISOU 3711  N9   DA J -39    19758   9275  25210   -332   2257  -2699       N  
ATOM   3712  C8   DA J -39      44.179  44.330  -4.723  1.00142.68           C  
ANISOU 3712  C8   DA J -39    19874   9287  25050   -412   2173  -2997       C  
ATOM   3713  N7   DA J -39      44.385  45.516  -5.247  1.00138.96           N  
ANISOU 3713  N7   DA J -39    19410   9048  24341   -458   1942  -3123       N  
ATOM   3714  C5   DA J -39      44.222  46.383  -4.179  1.00137.16           C  
ANISOU 3714  C5   DA J -39    19043   8950  24121   -403   1869  -2892       C  
ATOM   3715  C6   DA J -39      44.308  47.786  -4.073  1.00135.45           C  
ANISOU 3715  C6   DA J -39    18759   9037  23667   -413   1627  -2864       C  
ATOM   3716  N6   DA J -39      44.593  48.584  -5.105  1.00134.45           N  
ANISOU 3716  N6   DA J -39    18703   9138  23243   -484   1411  -3090       N  
ATOM   3717  N1   DA J -39      44.088  48.336  -2.858  1.00133.08           N  
ANISOU 3717  N1   DA J -39    18321   8905  23340   -341   1591  -2553       N  
ATOM   3718  C2   DA J -39      43.801  47.531  -1.830  1.00133.56           C  
ANISOU 3718  C2   DA J -39    18332   8726  23690   -272   1816  -2329       C  
ATOM   3719  N3   DA J -39      43.695  46.204  -1.808  1.00135.55           N  
ANISOU 3719  N3   DA J -39    18640   8658  24204   -256   2062  -2342       N  
ATOM   3720  C4   DA J -39      43.919  45.687  -3.026  1.00137.90           C  
ANISOU 3720  C4   DA J -39    19059   8890  24448   -324   2063  -2623       C  
ATOM   3721  P    DT J -38      40.772  40.810  -0.968  1.00158.50           P  
ANISOU 3721  P    DT J -38    21592  10589  28041   -547   2828  -2359       P  
ATOM   3722  OP1  DT J -38      40.448  39.752   0.013  1.00162.17           O  
ANISOU 3722  OP1  DT J -38    22038  10855  28726   -491   3080  -2155       O  
ATOM   3723  OP2  DT J -38      40.194  40.726  -2.327  1.00159.26           O  
ANISOU 3723  OP2  DT J -38    21746  10687  28077   -767   2662  -2728       O  
ATOM   3724  O5'  DT J -38      40.371  42.216  -0.320  1.00152.45           O  
ANISOU 3724  O5'  DT J -38    20697  10063  27162   -582   2621  -2241       O  
ATOM   3725  C5'  DT J -38      40.993  42.630   0.895  1.00145.92           C  
ANISOU 3725  C5'  DT J -38    19825   9299  26319   -376   2710  -1889       C  
ATOM   3726  C4'  DT J -38      40.492  43.995   1.334  1.00137.25           C  
ANISOU 3726  C4'  DT J -38    18614   8431  25103   -448   2489  -1827       C  
ATOM   3727  O4'  DT J -38      40.999  45.013   0.438  1.00131.13           O  
ANISOU 3727  O4'  DT J -38    17862   7846  24113   -468   2263  -2004       O  
ATOM   3728  C3'  DT J -38      38.971  44.146   1.367  1.00138.08           C  
ANISOU 3728  C3'  DT J -38    18615   8557  25291   -698   2370  -1957       C  
ATOM   3729  O3'  DT J -38      38.559  44.581   2.662  1.00141.82           O  
ANISOU 3729  O3'  DT J -38    18992   9089  25805   -660   2410  -1677       O  
ATOM   3730  C2'  DT J -38      38.665  45.183   0.277  1.00133.72           C  
ANISOU 3730  C2'  DT J -38    18044   8210  24555   -865   2053  -2247       C  
ATOM   3731  C1'  DT J -38      39.982  45.931   0.121  1.00129.43           C  
ANISOU 3731  C1'  DT J -38    17561   7799  23818   -684   2000  -2173       C  
ATOM   3732  N1   DT J -38      40.225  46.411  -1.273  1.00128.05           N  
ANISOU 3732  N1   DT J -38    17459   7743  23451   -782   1787  -2496       N  
ATOM   3733  C2   DT J -38      40.427  47.756  -1.512  1.00125.51           C  
ANISOU 3733  C2   DT J -38    17106   7671  22911   -802   1541  -2547       C  
ATOM   3734  O2   DT J -38      40.414  48.601  -0.635  1.00122.96           O  
ANISOU 3734  O2   DT J -38    16692   7473  22554   -745   1486  -2337       O  
ATOM   3735  N3   DT J -38      40.647  48.075  -2.831  1.00124.31           N  
ANISOU 3735  N3   DT J -38    17046   7621  22563   -893   1360  -2851       N  
ATOM   3736  C4   DT J -38      40.685  47.201  -3.905  1.00125.02           C  
ANISOU 3736  C4   DT J -38    17263   7587  22654   -963   1403  -3092       C  
ATOM   3737  O4   DT J -38      40.888  47.579  -5.055  1.00122.58           O  
ANISOU 3737  O4   DT J -38    17052   7392  22131  -1042   1230  -3344       O  
ATOM   3738  C5   DT J -38      40.467  45.812  -3.581  1.00129.74           C  
ANISOU 3738  C5   DT J -38    17881   7914  23502   -938   1665  -3021       C  
ATOM   3739  C7   DT J -38      40.485  44.774  -4.663  1.00132.45           C  
ANISOU 3739  C7   DT J -38    18362   8095  23867  -1011   1732  -3259       C  
ATOM   3740  C6   DT J -38      40.252  45.489  -2.299  1.00129.67           C  
ANISOU 3740  C6   DT J -38    17776   7809  23685   -850   1841  -2735       C  
ATOM   3741  P    DT J -37      37.041  45.027   2.943  1.00136.34           P  
ANISOU 3741  P    DT J -37    18158   8465  25180   -886   2283  -1747       P  
ATOM   3742  OP1  DT J -37      36.764  44.754   4.371  1.00136.91           O  
ANISOU 3742  OP1  DT J -37    18187   8469  25363   -803   2479  -1429       O  
ATOM   3743  OP2  DT J -37      36.160  44.434   1.912  1.00136.50           O  
ANISOU 3743  OP2  DT J -37    18173   8400  25291  -1099   2213  -2075       O  
ATOM   3744  O5'  DT J -37      37.082  46.610   2.732  1.00130.41           O  
ANISOU 3744  O5'  DT J -37    17342   7995  24211   -929   1991  -1785       O  
ATOM   3745  C5'  DT J -37      38.205  47.347   3.200  1.00126.34           C  
ANISOU 3745  C5'  DT J -37    16862   7598  23541   -729   1981  -1563       C  
ATOM   3746  C4'  DT J -37      38.028  48.830   2.943  1.00121.58           C  
ANISOU 3746  C4'  DT J -37    16189   7258  22748   -813   1689  -1638       C  
ATOM   3747  O4'  DT J -37      38.389  49.137   1.573  1.00121.56           O  
ANISOU 3747  O4'  DT J -37    16247   7341  22599   -881   1497  -1952       O  
ATOM   3748  C3'  DT J -37      36.611  49.354   3.153  1.00120.69           C  
ANISOU 3748  C3'  DT J -37    15940   7239  22679  -1024   1547  -1709       C  
ATOM   3749  O3'  DT J -37      36.651  50.553   3.909  1.00121.20           O  
ANISOU 3749  O3'  DT J -37    15938   7494  22620   -982   1437  -1509       O  
ATOM   3750  C2'  DT J -37      36.088  49.585   1.732  1.00119.29           C  
ANISOU 3750  C2'  DT J -37    15756   7150  22417  -1223   1296  -2101       C  
ATOM   3751  C1'  DT J -37      37.362  49.873   0.947  1.00120.00           C  
ANISOU 3751  C1'  DT J -37    15969   7306  22320  -1106   1225  -2191       C  
ATOM   3752  N1   DT J -37      37.294  49.436  -0.481  1.00121.84           N  
ANISOU 3752  N1   DT J -37    16288   7515  22490  -1226   1119  -2540       N  
ATOM   3753  C2   DT J -37      37.604  50.330  -1.484  1.00122.33           C  
ANISOU 3753  C2   DT J -37    16397   7785  22297  -1281    856  -2756       C  
ATOM   3754  O2   DT J -37      37.928  51.486  -1.275  1.00122.52           O  
ANISOU 3754  O2   DT J -37    16385   8014  22154  -1241    696  -2690       O  
ATOM   3755  N3   DT J -37      37.513  49.816  -2.754  1.00122.54           N  
ANISOU 3755  N3   DT J -37    16528   7775  22256  -1387    784  -3051       N  
ATOM   3756  C4   DT J -37      37.158  48.529  -3.112  1.00125.97           C  
ANISOU 3756  C4   DT J -37    17018   7981  22863  -1443    942  -3149       C  
ATOM   3757  O4   DT J -37      37.105  48.160  -4.281  1.00129.15           O  
ANISOU 3757  O4   DT J -37    17531   8366  23175  -1539    858  -3405       O  
ATOM   3758  C5   DT J -37      36.851  47.646  -2.015  1.00128.13           C  
ANISOU 3758  C5   DT J -37    17226   8043  23415  -1382   1212  -2924       C  
ATOM   3759  C7   DT J -37      36.450  46.226  -2.284  1.00131.61           C  
ANISOU 3759  C7   DT J -37    17718   8229  24058  -1439   1399  -3012       C  
ATOM   3760  C6   DT J -37      36.936  48.135  -0.768  1.00125.57           C  
ANISOU 3760  C6   DT J -37    16806   7761  23143  -1276   1289  -2632       C  
ATOM   3761  P    DT J -36      35.290  51.258   4.389  1.00126.47           P  
ANISOU 3761  P    DT J -36    16453   8281  23319  -1160   1313  -1504       P  
ATOM   3762  OP1  DT J -36      35.552  51.882   5.705  1.00125.02           O  
ANISOU 3762  OP1  DT J -36    16249   8170  23081  -1031   1392  -1142       O  
ATOM   3763  OP2  DT J -36      34.188  50.281   4.243  1.00125.46           O  
ANISOU 3763  OP2  DT J -36    16271   7993  23404  -1308   1412  -1646       O  
ATOM   3764  O5'  DT J -36      35.077  52.416   3.311  1.00125.29           O  
ANISOU 3764  O5'  DT J -36    16261   8377  22968  -1300    954  -1783       O  
ATOM   3765  C5'  DT J -36      36.173  53.247   2.953  1.00121.44           C  
ANISOU 3765  C5'  DT J -36    15842   8131  22170  -1179    800  -1756       C  
ATOM   3766  C4'  DT J -36      35.790  54.212   1.846  1.00115.71           C  
ANISOU 3766  C4'  DT J -36    15086   7647  21232  -1337    455  -2054       C  
ATOM   3767  O4'  DT J -36      35.927  53.564   0.552  1.00112.51           O  
ANISOU 3767  O4'  DT J -36    14773   7088  20888  -1420    413  -2391       O  
ATOM   3768  C3'  DT J -36      34.353  54.734   1.902  1.00113.49           C  
ANISOU 3768  C3'  DT J -36    14657   7394  21072  -1551    300  -2169       C  
ATOM   3769  O3'  DT J -36      34.335  56.094   1.504  1.00110.28           O  
ANISOU 3769  O3'  DT J -36    14219   7332  20350  -1594    -10  -2238       O  
ATOM   3770  C2'  DT J -36      33.646  53.855   0.874  1.00113.33           C  
ANISOU 3770  C2'  DT J -36    14649   7278  21132  -1697    274  -2461       C  
ATOM   3771  C1'  DT J -36      34.734  53.747  -0.177  1.00111.63           C  
ANISOU 3771  C1'  DT J -36    14592   7081  20742  -1632    206  -2635       C  
ATOM   3772  N1   DT J -36      34.573  52.605  -1.116  1.00113.50           N  
ANISOU 3772  N1   DT J -36    14915   7152  21059  -1703    274  -2859       N  
ATOM   3773  C2   DT J -36      34.832  52.800  -2.453  1.00116.16           C  
ANISOU 3773  C2   DT J -36    15361   7604  21171  -1768     74  -3133       C  
ATOM   3774  O2   DT J -36      35.185  53.871  -2.915  1.00118.17           O  
ANISOU 3774  O2   DT J -36    15643   8101  21154  -1769   -158  -3208       O  
ATOM   3775  N3   DT J -36      34.663  51.692  -3.237  1.00118.68           N  
ANISOU 3775  N3   DT J -36    15770   7746  21575  -1832    157  -3311       N  
ATOM   3776  C4   DT J -36      34.268  50.432  -2.827  1.00118.61           C  
ANISOU 3776  C4   DT J -36    15744   7466  21855  -1838    409  -3253       C  
ATOM   3777  O4   DT J -36      34.144  49.496  -3.611  1.00115.73           O  
ANISOU 3777  O4   DT J -36    15472   6957  21545  -1902    460  -3427       O  
ATOM   3778  C5   DT J -36      34.013  50.294  -1.411  1.00118.64           C  
ANISOU 3778  C5   DT J -36    15628   7373  22076  -1765    611  -2967       C  
ATOM   3779  C7   DT J -36      33.577  48.974  -0.849  1.00120.42           C  
ANISOU 3779  C7   DT J -36    15836   7322  22597  -1763    894  -2880       C  
ATOM   3780  C6   DT J -36      34.176  51.376  -0.632  1.00116.00           C  
ANISOU 3780  C6   DT J -36    15215   7207  21653  -1701    537  -2781       C  
ATOM   3781  P    DG J -35      33.955  57.252   2.549  1.00106.28           P  
ANISOU 3781  P    DG J -35    13604   7087  19692  -1570    -88  -1976       P  
ATOM   3782  OP1  DG J -35      34.921  57.177   3.669  1.00104.20           O  
ANISOU 3782  OP1  DG J -35    13400   6883  19309  -1341    122  -1593       O  
ATOM   3783  OP2  DG J -35      32.502  57.164   2.817  1.00112.12           O  
ANISOU 3783  OP2  DG J -35    14192   7675  20734  -1759    -88  -2057       O  
ATOM   3784  O5'  DG J -35      34.228  58.598   1.727  1.00 95.98           O  
ANISOU 3784  O5'  DG J -35    12321   6178  17969  -1596   -439  -2114       O  
ATOM   3785  C5'  DG J -35      35.551  58.918   1.314  1.00 92.73           C  
ANISOU 3785  C5'  DG J -35    12042   5986  17206  -1439   -492  -2074       C  
ATOM   3786  C4'  DG J -35      35.575  59.452  -0.113  1.00 96.29           C  
ANISOU 3786  C4'  DG J -35    12557   6587  17442  -1549   -782  -2417       C  
ATOM   3787  O4'  DG J -35      35.224  58.399  -1.046  1.00103.37           O  
ANISOU 3787  O4'  DG J -35    13500   7174  18603  -1671   -745  -2722       O  
ATOM   3788  C3'  DG J -35      34.625  60.604  -0.403  1.00 98.27           C  
ANISOU 3788  C3'  DG J -35    12715   7048  17573  -1706  -1083  -2548       C  
ATOM   3789  O3'  DG J -35      35.221  61.488  -1.341  1.00100.36           O  
ANISOU 3789  O3'  DG J -35    13084   7600  17449  -1696  -1333  -2698       O  
ATOM   3790  C2'  DG J -35      33.399  59.903  -0.989  1.00 99.62           C  
ANISOU 3790  C2'  DG J -35    12815   6950  18086  -1914  -1116  -2825       C  
ATOM   3791  C1'  DG J -35      34.015  58.710  -1.717  1.00105.15           C  
ANISOU 3791  C1'  DG J -35    13652   7433  18867  -1879   -965  -2968       C  
ATOM   3792  N9   DG J -35      33.176  57.514  -1.684  1.00110.44           N  
ANISOU 3792  N9   DG J -35    14273   7858  19829  -1958   -782  -3008       N  
ATOM   3793  C8   DG J -35      32.471  57.040  -0.606  1.00112.50           C  
ANISOU 3793  C8   DG J -35    14408   7949  20389  -1969   -580  -2823       C  
ATOM   3794  N7   DG J -35      31.820  55.940  -0.852  1.00115.38           N  
ANISOU 3794  N7   DG J -35    14759   8116  20965  -2046   -450  -2918       N  
ATOM   3795  C5   DG J -35      32.116  55.658  -2.179  1.00115.20           C  
ANISOU 3795  C5   DG J -35    14869   8123  20777  -2092   -574  -3175       C  
ATOM   3796  C6   DG J -35      31.689  54.585  -2.993  1.00116.94           C  
ANISOU 3796  C6   DG J -35    15149   8182  21101  -2184   -524  -3366       C  
ATOM   3797  O6   DG J -35      30.943  53.647  -2.688  1.00121.27           O  
ANISOU 3797  O6   DG J -35    15630   8525  21921  -2244   -363  -3355       O  
ATOM   3798  N1   DG J -35      32.214  54.670  -4.279  1.00114.06           N  
ANISOU 3798  N1   DG J -35    14947   7914  20475  -2206   -682  -3584       N  
ATOM   3799  C2   DG J -35      33.051  55.668  -4.723  1.00109.39           C  
ANISOU 3799  C2   DG J -35    14446   7557  19559  -2143   -858  -3619       C  
ATOM   3800  N2   DG J -35      33.458  55.583  -6.000  1.00109.51           N  
ANISOU 3800  N2   DG J -35    14636   7638  19336  -2177   -972  -3831       N  
ATOM   3801  N3   DG J -35      33.461  56.684  -3.967  1.00109.10           N  
ANISOU 3801  N3   DG J -35    14345   7682  19427  -2056   -915  -3451       N  
ATOM   3802  C4   DG J -35      32.954  56.614  -2.709  1.00112.00           C  
ANISOU 3802  C4   DG J -35    14557   7947  20052  -2037   -769  -3232       C  
ATOM   3803  P    DG J -34      34.627  62.965  -1.552  1.00 99.09           P  
ANISOU 3803  P    DG J -34    12864   7761  17024  -1791  -1658  -2760       P  
ATOM   3804  OP1  DG J -34      35.746  63.839  -1.974  1.00 96.20           O  
ANISOU 3804  OP1  DG J -34    12629   7722  16200  -1677  -1787  -2732       O  
ATOM   3805  OP2  DG J -34      33.829  63.310  -0.354  1.00 99.30           O  
ANISOU 3805  OP2  DG J -34    12731   7797  17201  -1807  -1590  -2524       O  
ATOM   3806  O5'  DG J -34      33.625  62.794  -2.783  1.00 98.28           O  
ANISOU 3806  O5'  DG J -34    12762   7630  16950  -1979  -1835  -3094       O  
ATOM   3807  C5'  DG J -34      34.116  62.340  -4.033  1.00 96.68           C  
ANISOU 3807  C5'  DG J -34    12724   7432  16578  -1989  -1865  -3311       C  
ATOM   3808  C4'  DG J -34      32.981  61.897  -4.933  1.00101.27           C  
ANISOU 3808  C4'  DG J -34    13294   8006  17177  -2137  -1919  -3487       C  
ATOM   3809  O4'  DG J -34      32.452  60.624  -4.469  1.00104.96           O  
ANISOU 3809  O4'  DG J -34    13685   8132  18064  -2175  -1694  -3468       O  
ATOM   3810  C3'  DG J -34      31.776  62.850  -4.987  1.00107.60           C  
ANISOU 3810  C3'  DG J -34    13972   9060  17849  -2232  -2111  -3473       C  
ATOM   3811  O3'  DG J -34      31.272  62.896  -6.315  1.00125.31           O  
ANISOU 3811  O3'  DG J -34    16307  11432  19872  -2330  -2249  -3663       O  
ATOM   3812  C2'  DG J -34      30.779  62.157  -4.064  1.00106.72           C  
ANISOU 3812  C2'  DG J -34    13679   8707  18162  -2287  -1954  -3381       C  
ATOM   3813  C1'  DG J -34      31.053  60.724  -4.463  1.00107.64           C  
ANISOU 3813  C1'  DG J -34    13885   8515  18499  -2299  -1768  -3491       C  
ATOM   3814  N9   DG J -34      30.479  59.708  -3.586  1.00108.19           N  
ANISOU 3814  N9   DG J -34    13832   8281  18995  -2320  -1530  -3397       N  
ATOM   3815  C8   DG J -34      30.260  59.785  -2.232  1.00106.12           C  
ANISOU 3815  C8   DG J -34    13428   7924  18970  -2276  -1378  -3168       C  
ATOM   3816  N7   DG J -34      29.717  58.704  -1.734  1.00106.34           N  
ANISOU 3816  N7   DG J -34    13385   7677  19343  -2308  -1152  -3124       N  
ATOM   3817  C5   DG J -34      29.565  57.865  -2.834  1.00113.02           C  
ANISOU 3817  C5   DG J -34    14326   8429  20189  -2382  -1173  -3348       C  
ATOM   3818  C6   DG J -34      29.032  56.555  -2.927  1.00122.07           C  
ANISOU 3818  C6   DG J -34    15459   9302  21620  -2445   -996  -3416       C  
ATOM   3819  O6   DG J -34      28.571  55.845  -2.022  1.00127.61           O  
ANISOU 3819  O6   DG J -34    16058   9790  22636  -2445   -768  -3289       O  
ATOM   3820  N1   DG J -34      29.068  56.076  -4.236  1.00123.16           N  
ANISOU 3820  N1   DG J -34    15733   9429  21631  -2517  -1099  -3653       N  
ATOM   3821  C2   DG J -34      29.557  56.775  -5.315  1.00120.31           C  
ANISOU 3821  C2   DG J -34    15513   9296  20903  -2522  -1327  -3794       C  
ATOM   3822  N2   DG J -34      29.516  56.160  -6.504  1.00121.07           N  
ANISOU 3822  N2   DG J -34    15752   9337  20911  -2600  -1383  -4000       N  
ATOM   3823  N3   DG J -34      30.055  57.995  -5.238  1.00117.75           N  
ANISOU 3823  N3   DG J -34    15201   9237  20302  -2458  -1482  -3729       N  
ATOM   3824  C4   DG J -34      30.027  58.475  -3.976  1.00113.20           C  
ANISOU 3824  C4   DG J -34    14483   8672  19854  -2392  -1402  -3511       C  
ATOM   3825  P    DA J -33      31.645  64.110  -7.299  1.00102.97           P  
ANISOU 3825  P    DA J -33    16421  13146   9558   -894    444   1845       P  
ATOM   3826  OP1  DA J -33      33.117  64.254  -7.299  1.00102.24           O  
ANISOU 3826  OP1  DA J -33    15825  13361   9662   -473    401   1964       O  
ATOM   3827  OP2  DA J -33      30.793  65.264  -6.935  1.00106.79           O  
ANISOU 3827  OP2  DA J -33    16626  13805  10142  -1010    468   1739       O  
ATOM   3828  O5'  DA J -33      31.177  63.585  -8.738  1.00112.48           O  
ANISOU 3828  O5'  DA J -33    17528  14264  10946   -668      8   1354       O  
ATOM   3829  C5'  DA J -33      31.972  62.631  -9.439  1.00113.73           C  
ANISOU 3829  C5'  DA J -33    17947  14308  10957   -456   -134   1369       C  
ATOM   3830  C4'  DA J -33      31.108  61.618 -10.178  1.00117.65           C  
ANISOU 3830  C4'  DA J -33    18269  14509  11926   -503   -331    872       C  
ATOM   3831  O4'  DA J -33      30.548  60.663  -9.238  1.00120.56           O  
ANISOU 3831  O4'  DA J -33    18554  14502  12751   -900      6    861       O  
ATOM   3832  C3'  DA J -33      29.918  62.193 -10.943  1.00120.50           C  
ANISOU 3832  C3'  DA J -33    18267  14964  12553   -466   -642    385       C  
ATOM   3833  O3'  DA J -33      29.714  61.428 -12.125  1.00125.39           O  
ANISOU 3833  O3'  DA J -33    18866  15461  13317   -292   -975     -5       O  
ATOM   3834  C2'  DA J -33      28.770  62.006  -9.953  1.00123.07           C  
ANISOU 3834  C2'  DA J -33    18300  15065  13394   -900   -350    260       C  
ATOM   3835  C1'  DA J -33      29.138  60.663  -9.343  1.00125.13           C  
ANISOU 3835  C1'  DA J -33    18751  14962  13832  -1110    -68    420       C  
ATOM   3836  N9   DA J -33      28.588  60.437  -8.011  1.00127.29           N  
ANISOU 3836  N9   DA J -33    18893  15042  14429  -1540    348    556       N  
ATOM   3837  C8   DA J -33      28.742  61.234  -6.914  1.00126.11           C  
ANISOU 3837  C8   DA J -33    18736  15053  14127  -1701    655    904       C  
ATOM   3838  N7   DA J -33      28.151  60.772  -5.838  1.00128.59           N  
ANISOU 3838  N7   DA J -33    18914  15142  14803  -2102   1003    955       N  
ATOM   3839  C5   DA J -33      27.577  59.585  -6.256  1.00131.67           C  
ANISOU 3839  C5   DA J -33    19223  15191  15615  -2216    918    626       C  
ATOM   3840  C6   DA J -33      26.808  58.616  -5.583  1.00135.48           C  
ANISOU 3840  C6   DA J -33    19554  15321  16601  -2611   1157    512       C  
ATOM   3841  N6   DA J -33      26.480  58.708  -4.291  1.00133.40           N  
ANISOU 3841  N6   DA J -33    19182  15005  16498  -2973   1549    730       N  
ATOM   3842  N1   DA J -33      26.387  57.547  -6.292  1.00143.24           N  
ANISOU 3842  N1   DA J -33    20500  16011  17914  -2627    976    162       N  
ATOM   3843  C2   DA J -33      26.719  57.462  -7.586  1.00143.30           C  
ANISOU 3843  C2   DA J -33    20613  16085  17751  -2264    584    -63       C  
ATOM   3844  N3   DA J -33      27.437  58.309  -8.325  1.00138.57           N  
ANISOU 3844  N3   DA J -33    20150  15818  16681  -1872    331     15       N  
ATOM   3845  C4   DA J -33      27.840  59.359  -7.592  1.00132.39           C  
ANISOU 3845  C4   DA J -33    19405  15313  15584  -1872    517    372       C  
ATOM   3846  P    DA J -32      28.848  62.012 -13.346  1.00128.98           P  
ANISOU 3846  P    DA J -32    19030  16096  13879    -99  -1422   -493       P  
ATOM   3847  OP1  DA J -32      29.746  62.104 -14.518  1.00123.82           O  
ANISOU 3847  OP1  DA J -32    18594  15657  12793    324  -1772   -492       O  
ATOM   3848  OP2  DA J -32      28.129  63.216 -12.872  1.00130.42           O  
ANISOU 3848  OP2  DA J -32    18949  16485  14121   -209  -1367   -498       O  
ATOM   3849  O5'  DA J -32      27.774  60.860 -13.626  1.00127.51           O  
ANISOU 3849  O5'  DA J -32    18623  15540  14284   -321  -1472   -964       O  
ATOM   3850  C5'  DA J -32      27.242  60.113 -12.541  1.00123.96           C  
ANISOU 3850  C5'  DA J -32    18093  14754  14253   -734  -1102   -924       C  
ATOM   3851  C4'  DA J -32      26.161  59.164 -13.017  1.00126.57           C  
ANISOU 3851  C4'  DA J -32    18186  14784  15119   -907  -1231  -1422       C  
ATOM   3852  O4'  DA J -32      25.524  58.555 -11.874  1.00128.22           O  
ANISOU 3852  O4'  DA J -32    18274  14688  15757  -1348   -857  -1378       O  
ATOM   3853  C3'  DA J -32      25.028  59.821 -13.774  1.00127.45           C  
ANISOU 3853  C3'  DA J -32    17921  15063  15440   -861  -1542  -1873       C  
ATOM   3854  O3'  DA J -32      24.361  58.852 -14.570  1.00127.98           O  
ANISOU 3854  O3'  DA J -32    17861  14894  15870   -903  -1758  -2331       O  
ATOM   3855  C2'  DA J -32      24.141  60.330 -12.639  1.00129.80           C  
ANISOU 3855  C2'  DA J -32    17943  15346  16029  -1216  -1239  -1821       C  
ATOM   3856  C1'  DA J -32      24.330  59.254 -11.564  1.00131.66           C  
ANISOU 3856  C1'  DA J -32    18321  15217  16487  -1552   -834  -1595       C  
ATOM   3857  N9   DA J -32      24.457  59.792 -10.211  1.00130.55           N  
ANISOU 3857  N9   DA J -32    18186  15133  16286  -1784   -432  -1203       N  
ATOM   3858  C8   DA J -32      25.163  60.897  -9.825  1.00126.21           C  
ANISOU 3858  C8   DA J -32    17762  14895  15296  -1632   -350   -837       C  
ATOM   3859  N7   DA J -32      25.107  61.139  -8.536  1.00124.63           N  
ANISOU 3859  N7   DA J -32    17535  14672  15148  -1917     44   -541       N  
ATOM   3860  C5   DA J -32      24.311  60.118  -8.041  1.00129.38           C  
ANISOU 3860  C5   DA J -32    17978  14926  16256  -2281    232   -718       C  
ATOM   3861  C6   DA J -32      23.867  59.803  -6.740  1.00133.65           C  
ANISOU 3861  C6   DA J -32    18409  15287  17084  -2702    647   -560       C  
ATOM   3862  N6   DA J -32      24.181  60.525  -5.659  1.00132.53           N  
ANISOU 3862  N6   DA J -32    18305  15304  16748  -2824    961   -182       N  
ATOM   3863  N1   DA J -32      23.084  58.713  -6.593  1.00137.48           N  
ANISOU 3863  N1   DA J -32    18743  15429  18063  -3001    725   -808       N  
ATOM   3864  C2   DA J -32      22.772  57.993  -7.677  1.00139.82           C  
ANISOU 3864  C2   DA J -32    19007  15568  18551  -2885    409  -1195       C  
ATOM   3865  N3   DA J -32      23.129  58.189  -8.945  1.00138.56           N  
ANISOU 3865  N3   DA J -32    18938  15553  18156  -2498     11  -1386       N  
ATOM   3866  C4   DA J -32      23.905  59.278  -9.060  1.00132.35           C  
ANISOU 3866  C4   DA J -32    18295  15114  16878  -2207    -58  -1124       C  
ATOM   3867  P    DA J -31      23.141  59.282 -15.522  1.00129.30           P  
ANISOU 3867  P    DA J -31    17633  15197  16300   -856  -2122  -2863       P  
ATOM   3868  OP1  DA J -31      23.151  58.380 -16.695  1.00132.16           O  
ANISOU 3868  OP1  DA J -31    18048  15425  16740   -696  -2440  -3220       O  
ATOM   3869  OP2  DA J -31      23.214  60.747 -15.721  1.00123.38           O  
ANISOU 3869  OP2  DA J -31    16789  14865  15223   -629  -2268  -2760       O  
ATOM   3870  O5'  DA J -31      21.847  58.966 -14.638  1.00129.70           O  
ANISOU 3870  O5'  DA J -31    17346  15011  16924  -1320  -1866  -3046       O  
ATOM   3871  C5'  DA J -31      21.695  57.683 -14.043  1.00129.89           C  
ANISOU 3871  C5'  DA J -31    17436  14619  17299  -1638  -1614  -3052       C  
ATOM   3872  C4'  DA J -31      20.421  57.615 -13.221  1.00131.10           C  
ANISOU 3872  C4'  DA J -31    17228  14630  17953  -2065  -1392  -3215       C  
ATOM   3873  O4'  DA J -31      20.689  58.050 -11.863  1.00127.93           O  
ANISOU 3873  O4'  DA J -31    16880  14254  17472  -2271   -977  -2784       O  
ATOM   3874  C3'  DA J -31      19.272  58.482 -13.736  1.00134.24           C  
ANISOU 3874  C3'  DA J -31    17209  15271  18527  -2042  -1636  -3590       C  
ATOM   3875  O3'  DA J -31      18.067  57.730 -13.734  1.00145.29           O  
ANISOU 3875  O3'  DA J -31    18307  16426  20472  -2361  -1635  -3982       O  
ATOM   3876  C2'  DA J -31      19.223  59.645 -12.741  1.00129.56           C  
ANISOU 3876  C2'  DA J -31    16519  14913  17797  -2119  -1383  -3284       C  
ATOM   3877  C1'  DA J -31      19.718  58.989 -11.462  1.00129.21           C  
ANISOU 3877  C1'  DA J -31    16681  14611  17801  -2412   -929  -2895       C  
ATOM   3878  N9   DA J -31      20.350  59.924 -10.533  1.00128.81           N  
ANISOU 3878  N9   DA J -31    16754  14770  17417  -2393   -664  -2439       N  
ATOM   3879  C8   DA J -31      21.257  60.900 -10.841  1.00126.13           C  
ANISOU 3879  C8   DA J -31    16612  14746  16564  -2044   -786  -2188       C  
ATOM   3880  N7   DA J -31      21.667  61.588  -9.803  1.00124.09           N  
ANISOU 3880  N7   DA J -31    16434  14616  16100  -2129   -482  -1791       N  
ATOM   3881  C5   DA J -31      20.985  61.025  -8.737  1.00126.34           C  
ANISOU 3881  C5   DA J -31    16557  14659  16789  -2560   -133  -1780       C  
ATOM   3882  C6   DA J -31      20.980  61.310  -7.356  1.00123.55           C  
ANISOU 3882  C6   DA J -31    16181  14302  16459  -2847    292  -1454       C  
ATOM   3883  N6   DA J -31      21.719  62.277  -6.803  1.00116.17           N  
ANISOU 3883  N6   DA J -31    15404  13617  15119  -2735    438  -1067       N  
ATOM   3884  N1   DA J -31      20.186  60.559  -6.563  1.00130.31           N  
ANISOU 3884  N1   DA J -31    16848  14896  17770  -3263    559  -1540       N  
ATOM   3885  C2   DA J -31      19.448  59.591  -7.123  1.00136.86           C  
ANISOU 3885  C2   DA J -31    17525  15472  19003  -3385    407  -1928       C  
ATOM   3886  N3   DA J -31      19.368  59.231  -8.406  1.00137.89           N  
ANISOU 3886  N3   DA J -31    17662  15570  19158  -3147     16  -2267       N  
ATOM   3887  C4   DA J -31      20.169  59.995  -9.168  1.00131.45           C  
ANISOU 3887  C4   DA J -31    17032  15029  17882  -2730   -240  -2172       C  
ATOM   3888  P    DC J -30      16.693  58.387 -14.248  1.00153.61           P  
ANISOU 3888  P    DC J -30    18881  17673  21810  -2401  -1875  -4429       P  
ATOM   3889  OP1  DC J -30      15.917  57.318 -14.915  1.00157.94           O  
ANISOU 3889  OP1  DC J -30    19274  17968  22766  -2549  -2057  -4884       O  
ATOM   3890  OP2  DC J -30      17.014  59.627 -14.989  1.00151.27           O  
ANISOU 3890  OP2  DC J -30    18574  17784  21117  -2002  -2165  -4413       O  
ATOM   3891  O5'  DC J -30      15.943  58.789 -12.896  1.00153.37           O  
ANISOU 3891  O5'  DC J -30    18598  17633  22043  -2778  -1490  -4290       O  
ATOM   3892  C5'  DC J -30      15.695  57.795 -11.911  1.00151.31           C  
ANISOU 3892  C5'  DC J -30    18347  17024  22121  -3192  -1137  -4199       C  
ATOM   3893  C4'  DC J -30      15.070  58.401 -10.669  1.00144.79           C  
ANISOU 3893  C4'  DC J -30    17278  16275  21459  -3494   -792  -4041       C  
ATOM   3894  O4'  DC J -30      16.065  59.159  -9.937  1.00138.70           O  
ANISOU 3894  O4'  DC J -30    16759  15674  20267  -3372   -565  -3549       O  
ATOM   3895  C3'  DC J -30      13.904  59.363 -10.929  1.00142.81           C  
ANISOU 3895  C3'  DC J -30    16582  16296  21382  -3489   -956  -4359       C  
ATOM   3896  O3'  DC J -30      12.799  59.005 -10.111  1.00146.00           O  
ANISOU 3896  O3'  DC J -30    16663  16557  22255  -3924   -712  -4498       O  
ATOM   3897  C2'  DC J -30      14.473  60.731 -10.541  1.00137.27           C  
ANISOU 3897  C2'  DC J -30    15958  15932  20268  -3265   -882  -4029       C  
ATOM   3898  C1'  DC J -30      15.468  60.338  -9.465  1.00135.32           C  
ANISOU 3898  C1'  DC J -30    16055  15524  19838  -3404   -490  -3538       C  
ATOM   3899  N1   DC J -30      16.533  61.354  -9.212  1.00127.04           N  
ANISOU 3899  N1   DC J -30    15267  14737  18268  -3134   -429  -3125       N  
ATOM   3900  C2   DC J -30      16.744  61.809  -7.908  1.00123.69           C  
ANISOU 3900  C2   DC J -30    14875  14360  17762  -3333    -29  -2753       C  
ATOM   3901  O2   DC J -30      16.039  61.354  -7.001  1.00129.77           O  
ANISOU 3901  O2   DC J -30    15452  14960  18894  -3725    263  -2775       O  
ATOM   3902  N3   DC J -30      17.713  62.730  -7.679  1.00113.80           N  
ANISOU 3902  N3   DC J -30    13862  13345  16032  -3098     24  -2381       N  
ATOM   3903  C4   DC J -30      18.448  63.189  -8.695  1.00108.90           C  
ANISOU 3903  C4   DC J -30    13439  12911  15026  -2684   -305  -2367       C  
ATOM   3904  N4   DC J -30      19.394  64.096  -8.426  1.00101.78           N  
ANISOU 3904  N4   DC J -30    12771  12244  13656  -2476   -241  -1989       N  
ATOM   3905  C5   DC J -30      18.247  62.735 -10.034  1.00114.57           C  
ANISOU 3905  C5   DC J -30    14121  13594  15817  -2472   -714  -2741       C  
ATOM   3906  C6   DC J -30      17.288  61.826 -10.244  1.00122.27           C  
ANISOU 3906  C6   DC J -30    14861  14330  17266  -2706   -761  -3113       C  
ATOM   3907  P    DT J -29      11.361  59.683 -10.343  1.00134.80           P  
ANISOU 3907  P    DT J -29    14724  15345  21147  -4006   -861  -4901       P  
ATOM   3908  OP1  DT J -29      10.334  58.680  -9.983  1.00134.96           O  
ANISOU 3908  OP1  DT J -29    14489  15096  21694  -4438   -732  -5157       O  
ATOM   3909  OP2  DT J -29      11.357  60.286 -11.694  1.00137.98           O  
ANISOU 3909  OP2  DT J -29    15076  15992  21357  -3602  -1321  -5166       O  
ATOM   3910  O5'  DT J -29      11.324  60.868  -9.270  1.00132.83           O  
ANISOU 3910  O5'  DT J -29    14371  15343  20754  -4054   -574  -4606       O  
ATOM   3911  C5'  DT J -29      11.522  60.578  -7.893  1.00132.79           C  
ANISOU 3911  C5'  DT J -29    14447  15191  20815  -4384   -114  -4264       C  
ATOM   3912  C4'  DT J -29      11.571  61.852  -7.070  1.00129.60           C  
ANISOU 3912  C4'  DT J -29    13964  15073  20206  -4347     93  -4010       C  
ATOM   3913  O4'  DT J -29      12.852  62.518  -7.259  1.00125.89           O  
ANISOU 3913  O4'  DT J -29    13866  14764  19201  -3989     36  -3665       O  
ATOM   3914  C3'  DT J -29      10.502  62.902  -7.414  1.00128.55           C  
ANISOU 3914  C3'  DT J -29    13408  15231  20203  -4255    -97  -4328       C  
ATOM   3915  O3'  DT J -29      10.016  63.488  -6.216  1.00123.69           O  
ANISOU 3915  O3'  DT J -29    12585  14717  19694  -4501    249  -4186       O  
ATOM   3916  C2'  DT J -29      11.301  63.923  -8.221  1.00127.08           C  
ANISOU 3916  C2'  DT J -29    13422  15317  19547  -3773   -384  -4226       C  
ATOM   3917  C1'  DT J -29      12.593  63.886  -7.435  1.00125.62           C  
ANISOU 3917  C1'  DT J -29    13660  15072  18997  -3762    -94  -3708       C  
ATOM   3918  N1   DT J -29      13.757  64.550  -8.089  1.00127.16           N  
ANISOU 3918  N1   DT J -29    14193  15455  18668  -3330   -308  -3485       N  
ATOM   3919  C2   DT J -29      14.663  65.206  -7.295  1.00123.77           C  
ANISOU 3919  C2   DT J -29    14015  15143  17871  -3274    -62  -3035       C  
ATOM   3920  O2   DT J -29      14.568  65.260  -6.082  1.00121.34           O  
ANISOU 3920  O2   DT J -29    13669  14793  17643  -3559    325  -2812       O  
ATOM   3921  N3   DT J -29      15.697  65.795  -7.965  1.00122.59           N  
ANISOU 3921  N3   DT J -29    14161  15173  17245  -2881   -282  -2850       N  
ATOM   3922  C4   DT J -29      15.914  65.803  -9.326  1.00125.97           C  
ANISOU 3922  C4   DT J -29    14654  15682  17526  -2539   -717  -3064       C  
ATOM   3923  O4   DT J -29      16.884  66.368  -9.827  1.00124.76           O  
ANISOU 3923  O4   DT J -29    14772  15708  16924  -2203   -885  -2858       O  
ATOM   3924  C5   DT J -29      14.922  65.100 -10.113  1.00130.38           C  
ANISOU 3924  C5   DT J -29    14936  16115  18489  -2613   -959  -3544       C  
ATOM   3925  C7   DT J -29      15.050  65.037 -11.605  1.00130.51           C  
ANISOU 3925  C7   DT J -29    14987  16218  18384  -2270  -1434  -3819       C  
ATOM   3926  C6   DT J -29      13.899  64.515  -9.463  1.00131.43           C  
ANISOU 3926  C6   DT J -29    14780  16064  19095  -3003   -745  -3731       C  
ATOM   3927  P    DG J -28       8.531  63.182  -5.686  1.00141.78           P  
ANISOU 3927  P    DG J -28    14393  16955  22523  -4904    395  -4497       P  
ATOM   3928  OP1  DG J -28       8.379  61.713  -5.598  1.00140.81           O  
ANISOU 3928  OP1  DG J -28    14317  16474  22708  -5220    484  -4577       O  
ATOM   3929  OP2  DG J -28       7.582  63.970  -6.502  1.00140.77           O  
ANISOU 3929  OP2  DG J -28    13897  17075  22513  -4715     70  -4892       O  
ATOM   3930  O5'  DG J -28       8.535  63.791  -4.206  1.00140.96           O  
ANISOU 3930  O5'  DG J -28    14234  16950  22373  -5132    846  -4169       O  
ATOM   3931  C5'  DG J -28       9.352  63.199  -3.200  1.00137.42           C  
ANISOU 3931  C5'  DG J -28    14086  16312  21815  -5352   1218  -3754       C  
ATOM   3932  C4'  DG J -28      10.061  64.255  -2.363  1.00128.96           C  
ANISOU 3932  C4'  DG J -28    13175  15455  20368  -5252   1461  -3354       C  
ATOM   3933  O4'  DG J -28      11.162  64.833  -3.112  1.00120.72           O  
ANISOU 3933  O4'  DG J -28    12476  14540  18853  -4813   1220  -3182       O  
ATOM   3934  C3'  DG J -28       9.201  65.431  -1.908  1.00134.24           C  
ANISOU 3934  C3'  DG J -28    13479  16410  21117  -5268   1534  -3473       C  
ATOM   3935  O3'  DG J -28       9.592  65.799  -0.595  1.00146.52           O  
ANISOU 3935  O3'  DG J -28    15123  18020  22527  -5456   1954  -3095       O  
ATOM   3936  C2'  DG J -28       9.555  66.517  -2.926  1.00126.35           C  
ANISOU 3936  C2'  DG J -28    12555  15663  19788  -4783   1162  -3546       C  
ATOM   3937  C1'  DG J -28      11.035  66.241  -3.129  1.00118.69           C  
ANISOU 3937  C1'  DG J -28    12099  14605  18393  -4581   1145  -3179       C  
ATOM   3938  N9   DG J -28      11.578  66.719  -4.396  1.00112.41           N  
ANISOU 3938  N9   DG J -28    11472  13943  17295  -4128    723  -3259       N  
ATOM   3939  C8   DG J -28      11.177  66.354  -5.657  1.00114.70           C  
ANISOU 3939  C8   DG J -28    11658  14201  17722  -3957    322  -3632       C  
ATOM   3940  N7   DG J -28      11.867  66.922  -6.606  1.00113.68           N  
ANISOU 3940  N7   DG J -28    11731  14228  17234  -3547      2  -3601       N  
ATOM   3941  C5   DG J -28      12.795  67.704  -5.933  1.00107.83           C  
ANISOU 3941  C5   DG J -28    11252  13625  16095  -3444    203  -3176       C  
ATOM   3942  C6   DG J -28      13.812  68.547  -6.437  1.00102.60           C  
ANISOU 3942  C6   DG J -28    10881  13164  14937  -3056     17  -2949       C  
ATOM   3943  O6   DG J -28      14.105  68.775  -7.619  1.00 98.89           O  
ANISOU 3943  O6   DG J -28    10496  12801  14278  -2712   -374  -3079       O  
ATOM   3944  N1   DG J -28      14.529  69.158  -5.413  1.00 99.67           N  
ANISOU 3944  N1   DG J -28    10713  12882  14276  -3100    335  -2525       N  
ATOM   3945  C2   DG J -28      14.297  68.977  -4.071  1.00 99.51           C  
ANISOU 3945  C2   DG J -28    10618  12774  14417  -3469    777  -2346       C  
ATOM   3946  N2   DG J -28      15.095  69.652  -3.230  1.00 86.58           N  
ANISOU 3946  N2   DG J -28     9205  11256  12437  -3457   1033  -1936       N  
ATOM   3947  N3   DG J -28      13.345  68.188  -3.583  1.00100.03           N  
ANISOU 3947  N3   DG J -28    10406  12657  14944  -3833    955  -2552       N  
ATOM   3948  C4   DG J -28      12.637  67.585  -4.570  1.00106.66           C  
ANISOU 3948  C4   DG J -28    11050  13401  16075  -3798    649  -2963       C  
ATOM   3949  P    DC J -27       8.591  66.599   0.372  1.00148.66           P  
ANISOU 3949  P    DC J -27    15051  18498  22935  -5586   2174  -3124       P  
ATOM   3950  OP1  DC J -27       8.752  66.036   1.731  1.00147.29           O  
ANISOU 3950  OP1  DC J -27    15088  18217  22659  -5733   2515  -2692       O  
ATOM   3951  OP2  DC J -27       7.253  66.616  -0.257  1.00174.67           O  
ANISOU 3951  OP2  DC J -27    17934  21849  26583  -5574   1928  -3588       O  
ATOM   3952  O5'  DC J -27       9.180  68.084   0.359  1.00138.30           O  
ANISOU 3952  O5'  DC J -27    13810  17481  21257  -5316   2152  -2989       O  
ATOM   3953  C5'  DC J -27      10.577  68.282   0.532  1.00124.60           C  
ANISOU 3953  C5'  DC J -27    12536  15752  19054  -5143   2231  -2557       C  
ATOM   3954  C4'  DC J -27      10.984  69.694   0.154  1.00115.39           C  
ANISOU 3954  C4'  DC J -27    11454  14872  17517  -4751   2048  -2489       C  
ATOM   3955  O4'  DC J -27      11.306  69.763  -1.265  1.00113.98           O  
ANISOU 3955  O4'  DC J -27    11403  14719  17185  -4365   1587  -2655       O  
ATOM   3956  C3'  DC J -27       9.920  70.771   0.387  1.00112.92           C  
ANISOU 3956  C3'  DC J -27    10736  14795  17375  -4739   2050  -2733       C  
ATOM   3957  O3'  DC J -27      10.564  71.954   0.813  1.00110.67           O  
ANISOU 3957  O3'  DC J -27    10620  14721  16708  -4552   2144  -2457       O  
ATOM   3958  C2'  DC J -27       9.345  70.950  -1.012  1.00111.32           C  
ANISOU 3958  C2'  DC J -27    10352  14655  17290  -4445   1568  -3141       C  
ATOM   3959  C1'  DC J -27      10.629  70.871  -1.810  1.00110.52           C  
ANISOU 3959  C1'  DC J -27    10700  14522  16769  -4123   1337  -2920       C  
ATOM   3960  N1   DC J -27      10.452  70.674  -3.281  1.00108.97           N  
ANISOU 3960  N1   DC J -27    10467  14324  16613  -3838    860  -3237       N  
ATOM   3961  C2   DC J -27      11.405  71.205  -4.156  1.00105.19           C  
ANISOU 3961  C2   DC J -27    10293  13961  15712  -3431    565  -3106       C  
ATOM   3962  O2   DC J -27      12.369  71.819  -3.683  1.00100.19           O  
ANISOU 3962  O2   DC J -27     9956  13424  14687  -3323    707  -2727       O  
ATOM   3963  N3   DC J -27      11.246  71.029  -5.492  1.00107.04           N  
ANISOU 3963  N3   DC J -27    10487  14209  15973  -3176    132  -3394       N  
ATOM   3964  C4   DC J -27      10.188  70.358  -5.953  1.00108.26           C  
ANISOU 3964  C4   DC J -27    10315  14263  16554  -3317     -7  -3801       C  
ATOM   3965  N4   DC J -27      10.070  70.208  -7.278  1.00104.65           N  
ANISOU 3965  N4   DC J -27     9827  13836  16100  -3061   -436  -4079       N  
ATOM   3966  C5   DC J -27       9.203  69.812  -5.074  1.00113.06           C  
ANISOU 3966  C5   DC J -27    10611  14749  17599  -3736    289  -3940       C  
ATOM   3967  C6   DC J -27       9.372  69.993  -3.758  1.00112.36           C  
ANISOU 3967  C6   DC J -27    10562  14652  17477  -3982    715  -3648       C  
ATOM   3968  P    DT J -26       9.852  72.975   1.826  1.00105.90           P  
ANISOU 3968  P    DT J -26     9724  14320  16193  -4684   2412  -2477       P  
ATOM   3969  OP1  DT J -26       9.684  72.286   3.125  1.00102.39           O  
ANISOU 3969  OP1  DT J -26     9369  13724  15809  -4925   2751  -2210       O  
ATOM   3970  OP2  DT J -26       8.675  73.559   1.144  1.00107.15           O  
ANISOU 3970  OP2  DT J -26     9472  14617  16624  -4539   2135  -2922       O  
ATOM   3971  O5'  DT J -26      10.950  74.125   1.986  1.00101.70           O  
ANISOU 3971  O5'  DT J -26     9532  13973  15136  -4400   2426  -2122       O  
ATOM   3972  C5'  DT J -26      12.325  73.769   2.080  1.00 98.31           C  
ANISOU 3972  C5'  DT J -26     9575  13462  14318  -4345   2501  -1711       C  
ATOM   3973  C4'  DT J -26      13.167  74.555   1.087  1.00 97.83           C  
ANISOU 3973  C4'  DT J -26     9792  13539  13840  -3889   2146  -1621       C  
ATOM   3974  O4'  DT J -26      12.833  74.169  -0.272  1.00100.45           O  
ANISOU 3974  O4'  DT J -26    10041  13818  14309  -3668   1711  -1949       O  
ATOM   3975  C3'  DT J -26      13.004  76.075   1.155  1.00 96.38           C  
ANISOU 3975  C3'  DT J -26     9520  13617  13481  -3664   2081  -1636       C  
ATOM   3976  O3'  DT J -26      14.279  76.683   1.254  1.00 91.50           O  
ANISOU 3976  O3'  DT J -26     9315  13100  12352  -3469   2101  -1237       O  
ATOM   3977  C2'  DT J -26      12.308  76.430  -0.165  1.00 97.59           C  
ANISOU 3977  C2'  DT J -26     9451  13848  13783  -3359   1609  -2041       C  
ATOM   3978  C1'  DT J -26      12.798  75.321  -1.079  1.00 98.26           C  
ANISOU 3978  C1'  DT J -26     9732  13756  13847  -3288   1378  -2067       C  
ATOM   3979  N1   DT J -26      11.900  75.050  -2.242  1.00102.71           N  
ANISOU 3979  N1   DT J -26    10010  14302  14712  -3154    991  -2521       N  
ATOM   3980  C2   DT J -26      12.365  75.260  -3.526  1.00105.07           C  
ANISOU 3980  C2   DT J -26    10466  14670  14786  -2777    562  -2589       C  
ATOM   3981  O2   DT J -26      13.483  75.676  -3.775  1.00100.10           O  
ANISOU 3981  O2   DT J -26    10199  14119  13715  -2541    475  -2293       O  
ATOM   3982  N3   DT J -26      11.457  74.969  -4.514  1.00112.18           N  
ANISOU 3982  N3   DT J -26    11073  15558  15993  -2694    234  -3019       N  
ATOM   3983  C4   DT J -26      10.168  74.495  -4.350  1.00116.44           C  
ANISOU 3983  C4   DT J -26    11190  16025  17028  -2946    291  -3376       C  
ATOM   3984  O4   DT J -26       9.426  74.262  -5.297  1.00120.41           O  
ANISOU 3984  O4   DT J -26    11449  16533  17769  -2852    -25  -3748       O  
ATOM   3985  C5   DT J -26       9.751  74.294  -2.986  1.00114.07           C  
ANISOU 3985  C5   DT J -26    10747  15657  16939  -3335    746  -3278       C  
ATOM   3986  C7   DT J -26       8.372  73.788  -2.694  1.00117.21           C  
ANISOU 3986  C7   DT J -26    10683  15989  17861  -3639    844  -3636       C  
ATOM   3987  C6   DT J -26      10.626  74.575  -2.009  1.00107.70           C  
ANISOU 3987  C6   DT J -26    10223  14861  15838  -3419   1072  -2862       C  
ATOM   3988  P    DC J -25      14.426  78.156   1.875  1.00 90.58           P  
ANISOU 3988  P    DC J -25     9219  13216  11980  -3363   2223  -1079       P  
ATOM   3989  OP1  DC J -25      15.700  78.200   2.629  1.00 88.49           O  
ANISOU 3989  OP1  DC J -25     9363  12966  11292  -3428   2492   -586       O  
ATOM   3990  OP2  DC J -25      13.151  78.485   2.552  1.00 91.69           O  
ANISOU 3990  OP2  DC J -25     8922  13406  12512  -3574   2410  -1351       O  
ATOM   3991  O5'  DC J -25      14.555  79.092   0.588  1.00 87.21           O  
ANISOU 3991  O5'  DC J -25     8839  12946  11349  -2897   1739  -1220       O  
ATOM   3992  C5'  DC J -25      15.439  78.731  -0.463  1.00 81.96           C  
ANISOU 3992  C5'  DC J -25     8478  12251  10412  -2636   1424  -1122       C  
ATOM   3993  C4'  DC J -25      15.095  79.481  -1.735  1.00 80.29           C  
ANISOU 3993  C4'  DC J -25     8153  12177  10176  -2251    946  -1393       C  
ATOM   3994  O4'  DC J -25      13.981  78.829  -2.408  1.00 89.26           O  
ANISOU 3994  O4'  DC J -25     8930  13221  11762  -2292    744  -1838       O  
ATOM   3995  C3'  DC J -25      14.662  80.939  -1.533  1.00 75.24           C  
ANISOU 3995  C3'  DC J -25     7359  11743   9486  -2098    912  -1454       C  
ATOM   3996  O3'  DC J -25      15.173  81.737  -2.588  1.00 75.11           O  
ANISOU 3996  O3'  DC J -25     7509  11873   9155  -1693    512  -1427       O  
ATOM   3997  C2'  DC J -25      13.144  80.838  -1.632  1.00 80.93           C  
ANISOU 3997  C2'  DC J -25     7575  12442  10732  -2205    862  -1917       C  
ATOM   3998  C1'  DC J -25      13.042  79.818  -2.747  1.00 90.83           C  
ANISOU 3998  C1'  DC J -25     8806  13577  12128  -2129    552  -2132       C  
ATOM   3999  N1   DC J -25      11.695  79.201  -2.912  1.00 99.71           N  
ANISOU 3999  N1   DC J -25     9485  14618  13784  -2305    514  -2566       N  
ATOM   4000  C2   DC J -25      11.308  78.758  -4.178  1.00 98.44           C  
ANISOU 4000  C2   DC J -25     9200  14431  13771  -2128    111  -2876       C  
ATOM   4001  O2   DC J -25      12.104  78.878  -5.115  1.00100.11           O  
ANISOU 4001  O2   DC J -25     9677  14693  13668  -1830   -197  -2779       O  
ATOM   4002  N3   DC J -25      10.081  78.203  -4.337  1.00 96.34           N  
ANISOU 4002  N3   DC J -25     8525  14099  13980  -2296     72  -3270       N  
ATOM   4003  C4   DC J -25       9.261  78.094  -3.289  1.00 99.83           C  
ANISOU 4003  C4   DC J -25     8686  14505  14739  -2622    415  -3354       C  
ATOM   4004  N4   DC J -25       8.059  77.541  -3.490  1.00102.42           N  
ANISOU 4004  N4   DC J -25     8609  14781  15526  -2786    360  -3742       N  
ATOM   4005  C5   DC J -25       9.637  78.549  -1.988  1.00101.15           C  
ANISOU 4005  C5   DC J -25     8970  14703  14760  -2802    830  -3043       C  
ATOM   4006  C6   DC J -25      10.850  79.095  -1.847  1.00100.59           C  
ANISOU 4006  C6   DC J -25     9307  14694  14220  -2635    864  -2659       C  
ATOM   4007  P    DC J -24      16.611  82.443  -2.477  1.00 70.09           P  
ANISOU 4007  P    DC J -24     7344  11358   7931  -1509    522   -964       P  
ATOM   4008  OP1  DC J -24      17.604  81.412  -2.104  1.00 67.85           O  
ANISOU 4008  OP1  DC J -24     7382  10944   7453  -1679    733   -648       O  
ATOM   4009  OP2  DC J -24      16.464  83.653  -1.639  1.00 71.83           O  
ANISOU 4009  OP2  DC J -24     7519  11711   8064  -1527    719   -861       O  
ATOM   4010  O5'  DC J -24      16.906  82.903  -3.980  1.00 75.76           O  
ANISOU 4010  O5'  DC J -24     8153  12199   8435  -1079    -12  -1063       O  
ATOM   4011  C5'  DC J -24      17.153  81.921  -4.980  1.00 75.60           C  
ANISOU 4011  C5'  DC J -24     8208  12093   8426   -982   -275  -1165       C  
ATOM   4012  C4'  DC J -24      16.372  82.220  -6.250  1.00 77.92           C  
ANISOU 4012  C4'  DC J -24     8236  12468   8901   -709   -736  -1556       C  
ATOM   4013  O4'  DC J -24      15.036  81.663  -6.160  1.00 84.01           O  
ANISOU 4013  O4'  DC J -24     8576  13131  10214   -911   -687  -1961       O  
ATOM   4014  C3'  DC J -24      16.196  83.707  -6.580  1.00 72.58           C  
ANISOU 4014  C3'  DC J -24     7497  12005   8076   -424   -958  -1583       C  
ATOM   4015  O3'  DC J -24      16.671  83.957  -7.894  1.00 67.73           O  
ANISOU 4015  O3'  DC J -24     7019  11510   7206    -68  -1414  -1601       O  
ATOM   4016  C2'  DC J -24      14.681  83.932  -6.471  1.00 76.30           C  
ANISOU 4016  C2'  DC J -24     7471  12469   9049   -511   -960  -2003       C  
ATOM   4017  C1'  DC J -24      14.135  82.547  -6.775  1.00 82.04           C  
ANISOU 4017  C1'  DC J -24     8018  13022  10132   -701   -971  -2266       C  
ATOM   4018  N1   DC J -24      12.774  82.296  -6.211  1.00 81.58           N  
ANISOU 4018  N1   DC J -24     7512  12890  10593   -962   -784  -2598       N  
ATOM   4019  C2   DC J -24      11.753  81.788  -7.033  1.00 82.76           C  
ANISOU 4019  C2   DC J -24     7313  13009  11121   -940  -1042  -3025       C  
ATOM   4020  O2   DC J -24      11.991  81.563  -8.226  1.00 77.34           O  
ANISOU 4020  O2   DC J -24     6696  12356  10331   -701  -1425  -3129       O  
ATOM   4021  N3   DC J -24      10.527  81.561  -6.490  1.00 91.98           N  
ANISOU 4021  N3   DC J -24     8072  14126  12751  -1189   -863  -3315       N  
ATOM   4022  C4   DC J -24      10.314  81.815  -5.197  1.00 91.67           C  
ANISOU 4022  C4   DC J -24     7965  14067  12799  -1444   -446  -3193       C  
ATOM   4023  N4   DC J -24       9.094  81.579  -4.701  1.00 93.75           N  
ANISOU 4023  N4   DC J -24     7812  14297  13513  -1684   -282  -3485       N  
ATOM   4024  C5   DC J -24      11.340  82.329  -4.352  1.00 84.68           C  
ANISOU 4024  C5   DC J -24     7432  13210  11534  -1468   -180  -2766       C  
ATOM   4025  C6   DC J -24      12.540  82.549  -4.894  1.00 77.94           C  
ANISOU 4025  C6   DC J -24     6981  12404  10228  -1227   -360  -2481       C  
ATOM   4026  P    DA J -23      16.975  85.455  -8.389  1.00 60.69           P  
ANISOU 4026  P    DA J -23     6221  10846   5993    280  -1691  -1493       P  
ATOM   4027  OP1  DA J -23      18.382  85.494  -8.845  1.00 55.24           O  
ANISOU 4027  OP1  DA J -23     5975  10239   4775    466  -1829  -1132       O  
ATOM   4028  OP2  DA J -23      16.526  86.402  -7.345  1.00 59.65           O  
ANISOU 4028  OP2  DA J -23     5966  10749   5948    167  -1417  -1449       O  
ATOM   4029  O5'  DA J -23      16.017  85.620  -9.656  1.00 68.43           O  
ANISOU 4029  O5'  DA J -23     6866  11903   7230    521  -2148  -1921       O  
ATOM   4030  C5'  DA J -23      15.953  84.583 -10.626  1.00 64.83           C  
ANISOU 4030  C5'  DA J -23     6368  11388   6878    569  -2397  -2124       C  
ATOM   4031  C4'  DA J -23      14.713  84.722 -11.488  1.00 68.53           C  
ANISOU 4031  C4'  DA J -23     6410  11911   7717    695  -2719  -2583       C  
ATOM   4032  O4'  DA J -23      13.542  84.301 -10.740  1.00 71.24           O  
ANISOU 4032  O4'  DA J -23     6384  12125   8559    395  -2451  -2855       O  
ATOM   4033  C3'  DA J -23      14.427  86.136 -11.981  1.00 69.17           C  
ANISOU 4033  C3'  DA J -23     6386  12198   7699   1000  -3002  -2631       C  
ATOM   4034  O3'  DA J -23      14.034  86.092 -13.342  1.00 79.60           O  
ANISOU 4034  O3'  DA J -23     7701  13394   9149   1189  -3232  -2738       O  
ATOM   4035  C2'  DA J -23      13.294  86.614 -11.069  1.00 68.21           C  
ANISOU 4035  C2'  DA J -23     5911  12041   7964    821  -2746  -2820       C  
ATOM   4036  C1'  DA J -23      12.563  85.316 -10.752  1.00 75.99           C  
ANISOU 4036  C1'  DA J -23     6655  12843   9373    501  -2547  -3075       C  
ATOM   4037  N9   DA J -23      11.910  85.318  -9.445  1.00 88.48           N  
ANISOU 4037  N9   DA J -23     8043  14331  11243    186  -2112  -3105       N  
ATOM   4038  C8   DA J -23      12.454  85.719  -8.256  1.00 87.58           C  
ANISOU 4038  C8   DA J -23     8135  14193  10950     31  -1730  -2785       C  
ATOM   4039  N7   DA J -23      11.641  85.598  -7.233  1.00 89.94           N  
ANISOU 4039  N7   DA J -23     8172  14417  11583   -256  -1384  -2904       N  
ATOM   4040  C5   DA J -23      10.486  85.074  -7.786  1.00 92.55           C  
ANISOU 4040  C5   DA J -23     8099  14719  12346   -295  -1550  -3329       C  
ATOM   4041  C6   DA J -23       9.245  84.712  -7.225  1.00100.76           C  
ANISOU 4041  C6   DA J -23     8718  15698  13869   -555  -1350  -3635       C  
ATOM   4042  N6   DA J -23       8.962  84.835  -5.923  1.00102.06           N  
ANISOU 4042  N6   DA J -23     8797  15820  14163   -831   -920  -3554       N  
ATOM   4043  N1   DA J -23       8.303  84.218  -8.056  1.00108.05           N  
ANISOU 4043  N1   DA J -23     9304  16620  15129   -526  -1612  -4027       N  
ATOM   4044  C2   DA J -23       8.591  84.097  -9.358  1.00105.90           C  
ANISOU 4044  C2   DA J -23     9114  16404  14719   -253  -2042  -4110       C  
ATOM   4045  N3   DA J -23       9.719  84.401 -10.000  1.00 95.35           N  
ANISOU 4045  N3   DA J -23     8156  15133  12939     10  -2265  -3852       N  
ATOM   4046  C4   DA J -23      10.635  84.890  -9.149  1.00 90.80           C  
ANISOU 4046  C4   DA J -23     7908  14555  12036    -27  -1998  -3460       C  
ATOM   4047  P    DT J -22      13.873  87.447 -14.188  1.00 89.94           P  
ANISOU 4047  P    DT J -22     9138  14631  10402   1438  -3299  -2576       P  
ATOM   4048  OP1  DT J -22      14.364  87.186 -15.560  1.00 90.85           O  
ANISOU 4048  OP1  DT J -22     9511  14599  10410   1558  -3404  -2428       O  
ATOM   4049  OP2  DT J -22      14.457  88.555 -13.399  1.00 83.41           O  
ANISOU 4049  OP2  DT J -22     8513  13845   9334   1461  -3131  -2268       O  
ATOM   4050  O5'  DT J -22      12.293  87.657 -14.232  1.00 94.90           O  
ANISOU 4050  O5'  DT J -22     9268  15320  11472   1437  -3401  -3023       O  
ATOM   4051  C5'  DT J -22      11.435  86.526 -14.222  1.00 97.12           C  
ANISOU 4051  C5'  DT J -22     9182  15599  12121   1268  -3458  -3425       C  
ATOM   4052  C4'  DT J -22      10.014  86.942 -13.912  1.00 99.29           C  
ANISOU 4052  C4'  DT J -22     8993  15923  12811   1217  -3444  -3775       C  
ATOM   4053  O4'  DT J -22       9.731  86.724 -12.512  1.00 98.43           O  
ANISOU 4053  O4'  DT J -22     8584  15900  12913    932  -3214  -3922       O  
ATOM   4054  C3'  DT J -22       9.707  88.419 -14.183  1.00104.88           C  
ANISOU 4054  C3'  DT J -22     9753  16656  13442   1450  -3483  -3662       C  
ATOM   4055  O3'  DT J -22       8.711  88.520 -15.186  1.00117.14           O  
ANISOU 4055  O3'  DT J -22    11128  18164  15215   1567  -3646  -3887       O  
ATOM   4056  C2'  DT J -22       9.217  88.963 -12.830  1.00104.01           C  
ANISOU 4056  C2'  DT J -22     9350  16661  13509   1310  -3287  -3774       C  
ATOM   4057  C1'  DT J -22       8.809  87.694 -12.100  1.00101.49           C  
ANISOU 4057  C1'  DT J -22     8696  16349  13518    968  -3144  -4055       C  
ATOM   4058  N1   DT J -22       8.858  87.811 -10.614  1.00 96.40           N  
ANISOU 4058  N1   DT J -22     7980  15706  12940    698  -2745  -3968       N  
ATOM   4059  C2   DT J -22       7.754  87.449  -9.882  1.00100.23           C  
ANISOU 4059  C2   DT J -22     8092  16120  13870    425  -2480  -4224       C  
ATOM   4060  O2   DT J -22       6.728  87.030 -10.386  1.00106.79           O  
ANISOU 4060  O2   DT J -22     8548  16961  15064    397  -2636  -4592       O  
ATOM   4061  N3   DT J -22       7.890  87.593  -8.529  1.00 98.39           N  
ANISOU 4061  N3   DT J -22     7933  15817  13636    175  -2025  -4031       N  
ATOM   4062  C4   DT J -22       8.999  88.056  -7.845  1.00 93.20           C  
ANISOU 4062  C4   DT J -22     7678  15150  12583    169  -1811  -3618       C  
ATOM   4063  O4   DT J -22       9.021  88.148  -6.621  1.00 95.65           O  
ANISOU 4063  O4   DT J -22     8015  15405  12924    -74  -1398  -3478       O  
ATOM   4064  C5   DT J -22      10.125  88.423  -8.672  1.00 86.62           C  
ANISOU 4064  C5   DT J -22     7226  14392  11293    461  -2109  -3364       C  
ATOM   4065  C7   DT J -22      11.385  88.942  -8.044  1.00 78.21           C  
ANISOU 4065  C7   DT J -22     6613  13339   9766    475  -1918  -2906       C  
ATOM   4066  C6   DT J -22      10.001  88.285 -10.002  1.00 89.83           C  
ANISOU 4066  C6   DT J -22     7563  14872  11698    711  -2557  -3548       C  
ATOM   4067  P    DC J -21       8.381  89.933 -15.875  1.00102.80           P  
ANISOU 4067  P    DC J -21     9404  16342  13313   1819  -3737  -3781       P  
ATOM   4068  OP1  DC J -21       8.460  89.739 -17.339  1.00101.85           O  
ANISOU 4068  OP1  DC J -21     9450  16143  13104   1955  -3909  -3737       O  
ATOM   4069  OP2  DC J -21       9.199  90.983 -15.226  1.00101.61           O  
ANISOU 4069  OP2  DC J -21     9513  16215  12879   1880  -3616  -3456       O  
ATOM   4070  O5'  DC J -21       6.860  90.183 -15.472  1.00106.95           O  
ANISOU 4070  O5'  DC J -21     9444  16927  14263   1771  -3727  -4165       O  
ATOM   4071  C5'  DC J -21       5.982  89.077 -15.342  1.00113.71           C  
ANISOU 4071  C5'  DC J -21     9939  17778  15489   1576  -3715  -4520       C  
ATOM   4072  C4'  DC J -21       4.832  89.417 -14.417  1.00121.26           C  
ANISOU 4072  C4'  DC J -21    10470  18794  16810   1452  -3568  -4789       C  
ATOM   4073  O4'  DC J -21       5.238  89.243 -13.042  1.00122.77           O  
ANISOU 4073  O4'  DC J -21    10583  19032  17034   1224  -3313  -4742       O  
ATOM   4074  C3'  DC J -21       4.321  90.853 -14.534  1.00123.62           C  
ANISOU 4074  C3'  DC J -21    10748  19137  17085   1670  -3614  -4755       C  
ATOM   4075  O3'  DC J -21       2.992  90.846 -15.032  1.00131.08           O  
ANISOU 4075  O3'  DC J -21    11376  20084  18343   1697  -3700  -5060       O  
ATOM   4076  C2'  DC J -21       4.401  91.415 -13.101  1.00122.14           C  
ANISOU 4076  C2'  DC J -21    10439  19022  16945   1555  -3369  -4717       C  
ATOM   4077  C1'  DC J -21       4.537  90.160 -12.248  1.00122.88           C  
ANISOU 4077  C1'  DC J -21    10357  19112  17218   1219  -3167  -4830       C  
ATOM   4078  N1   DC J -21       5.308  90.371 -10.984  1.00120.36           N  
ANISOU 4078  N1   DC J -21    10093  18865  16773   1068  -2918  -4652       N  
ATOM   4079  C2   DC J -21       4.683  90.172  -9.746  1.00126.92           C  
ANISOU 4079  C2   DC J -21    10563  19731  17929    775  -2595  -4828       C  
ATOM   4080  O2   DC J -21       3.497  89.827  -9.723  1.00133.72           O  
ANISOU 4080  O2   DC J -21    11088  20550  19169    656  -2533  -5118       O  
ATOM   4081  N3   DC J -21       5.402  90.366  -8.609  1.00125.84           N  
ANISOU 4081  N3   DC J -21    10545  19626  17643    614  -2293  -4609       N  
ATOM   4082  C4   DC J -21       6.682  90.738  -8.684  1.00121.86           C  
ANISOU 4082  C4   DC J -21    10505  19123  16672    748  -2333  -4234       C  
ATOM   4083  N4   DC J -21       7.354  90.917  -7.540  1.00120.64           N  
ANISOU 4083  N4   DC J -21    10614  18905  16320    567  -1944  -3926       N  
ATOM   4084  C5   DC J -21       7.333  90.943  -9.937  1.00117.54           C  
ANISOU 4084  C5   DC J -21    10205  18630  15824   1065  -2752  -4130       C  
ATOM   4085  C6   DC J -21       6.616  90.749 -11.048  1.00116.35           C  
ANISOU 4085  C6   DC J -21    10000  18385  15822   1199  -2972  -4300       C  
ATOM   4086  P    DA J -20       2.274  92.221 -15.445  1.00138.37           P  
ANISOU 4086  P    DA J -20    12255  21042  19276   1937  -3801  -5076       P  
ATOM   4087  OP1  DA J -20       1.220  91.905 -16.434  1.00142.46           O  
ANISOU 4087  OP1  DA J -20    12569  21554  20006   1988  -3965  -5327       O  
ATOM   4088  OP2  DA J -20       3.329  93.205 -15.778  1.00133.11           O  
ANISOU 4088  OP2  DA J -20    12010  20355  18211   2137  -3861  -4711       O  
ATOM   4089  O5'  DA J -20       1.577  92.691 -14.092  1.00137.51           O  
ANISOU 4089  O5'  DA J -20    11821  20998  19429   1812  -3572  -5231       O  
ATOM   4090  C5'  DA J -20       0.834  91.759 -13.321  1.00137.06           C  
ANISOU 4090  C5'  DA J -20    11393  20949  19735   1527  -3384  -5503       C  
ATOM   4091  C4'  DA J -20      -0.021  92.483 -12.305  1.00137.33           C  
ANISOU 4091  C4'  DA J -20    11126  21041  20010   1469  -3182  -5645       C  
ATOM   4092  O4'  DA J -20       0.602  92.403 -10.997  1.00132.93           O  
ANISOU 4092  O4'  DA J -20    10569  20509  19430   1265  -2892  -5533       O  
ATOM   4093  C3'  DA J -20      -0.217  93.963 -12.594  1.00137.69           C  
ANISOU 4093  C3'  DA J -20    11265  21122  19929   1761  -3301  -5558       C  
ATOM   4094  O3'  DA J -20      -1.524  94.354 -12.227  1.00139.92           O  
ANISOU 4094  O3'  DA J -20    11184  21445  20534   1740  -3220  -5818       O  
ATOM   4095  C2'  DA J -20       0.848  94.631 -11.725  1.00132.70           C  
ANISOU 4095  C2'  DA J -20    10863  20516  19041   1776  -3157  -5284       C  
ATOM   4096  C1'  DA J -20       0.913  93.697 -10.522  1.00129.95           C  
ANISOU 4096  C1'  DA J -20    10308  20185  18884   1431  -2846  -5368       C  
ATOM   4097  N9   DA J -20       2.232  93.643  -9.891  1.00120.66           N  
ANISOU 4097  N9   DA J -20     9392  19032  17423   1358  -2722  -5090       N  
ATOM   4098  C8   DA J -20       3.448  93.643 -10.517  1.00115.60           C  
ANISOU 4098  C8   DA J -20     9164  18371  16388   1498  -2897  -4801       C  
ATOM   4099  N7   DA J -20       4.468  93.577  -9.692  1.00113.03           N  
ANISOU 4099  N7   DA J -20     8996  18096  15855   1384  -2727  -4587       N  
ATOM   4100  C5   DA J -20       3.880  93.525  -8.439  1.00113.11           C  
ANISOU 4100  C5   DA J -20     8662  18158  16156   1138  -2394  -4748       C  
ATOM   4101  C6   DA J -20       4.416  93.444  -7.135  1.00107.57           C  
ANISOU 4101  C6   DA J -20     7952  17506  15413    891  -2029  -4620       C  
ATOM   4102  N6   DA J -20       5.729  93.401  -6.875  1.00 95.50           N  
ANISOU 4102  N6   DA J -20     6906  15919  13462    859  -1924  -4224       N  
ATOM   4103  N1   DA J -20       3.547  93.412  -6.104  1.00113.35           N  
ANISOU 4103  N1   DA J -20     8379  18221  16469    651  -1675  -4786       N  
ATOM   4104  C2   DA J -20       2.235  93.456  -6.365  1.00115.74           C  
ANISOU 4104  C2   DA J -20     8324  18519  17132    678  -1742  -5108       C  
ATOM   4105  N3   DA J -20       1.615  93.531  -7.539  1.00116.19           N  
ANISOU 4105  N3   DA J -20     8367  18533  17247    901  -2076  -5246       N  
ATOM   4106  C4   DA J -20       2.501  93.562  -8.545  1.00116.32           C  
ANISOU 4106  C4   DA J -20     8730  18534  16934   1119  -2383  -5051       C  
ATOM   4107  P    DA J -19      -2.188  95.662 -12.879  1.00147.66           P  
ANISOU 4107  P    DA J -19    12162  22451  21491   2037  -3408  -5842       P  
ATOM   4108  OP1  DA J -19      -3.461  95.255 -13.514  1.00148.78           O  
ANISOU 4108  OP1  DA J -19    12005  22610  21915   2026  -3511  -6134       O  
ATOM   4109  OP2  DA J -19      -1.152  96.347 -13.682  1.00142.41           O  
ANISOU 4109  OP2  DA J -19    11930  21748  20433   2272  -3605  -5532       O  
ATOM   4110  O5'  DA J -19      -2.507  96.573 -11.609  1.00142.65           O  
ANISOU 4110  O5'  DA J -19    11364  21866  20971   2013  -3171  -5870       O  
ATOM   4111  C5'  DA J -19      -2.991  95.966 -10.421  1.00135.39           C  
ANISOU 4111  C5'  DA J -19    10139  20972  20332   1723  -2857  -6039       C  
ATOM   4112  C4'  DA J -19      -2.571  96.757  -9.198  1.00125.70           C  
ANISOU 4112  C4'  DA J -19     8939  19779  19041   1692  -2606  -5915       C  
ATOM   4113  O4'  DA J -19      -1.239  96.360  -8.779  1.00119.14           O  
ANISOU 4113  O4'  DA J -19     8370  18938  17959   1583  -2504  -5666       O  
ATOM   4114  C3'  DA J -19      -2.522  98.276  -9.393  1.00124.56           C  
ANISOU 4114  C3'  DA J -19     8943  19650  18735   2001  -2741  -5803       C  
ATOM   4115  O3'  DA J -19      -3.230  98.904  -8.343  1.00131.31           O  
ANISOU 4115  O3'  DA J -19     9547  20548  19797   1949  -2499  -5933       O  
ATOM   4116  C2'  DA J -19      -1.024  98.595  -9.329  1.00118.42           C  
ANISOU 4116  C2'  DA J -19     8571  18857  17565   2077  -2770  -5461       C  
ATOM   4117  C1'  DA J -19      -0.537  97.512  -8.387  1.00114.41           C  
ANISOU 4117  C1'  DA J -19     7988  18367  17114   1752  -2484  -5447       C  
ATOM   4118  N9   DA J -19       0.898  97.248  -8.470  1.00103.62           N  
ANISOU 4118  N9   DA J -19     6980  16996  15393   1749  -2523  -5149       N  
ATOM   4119  C8   DA J -19       1.638  97.051  -9.600  1.00101.58           C  
ANISOU 4119  C8   DA J -19     7052  16689  14854   1901  -2804  -4969       C  
ATOM   4120  N7   DA J -19       2.912  96.829  -9.368  1.00 98.50           N  
ANISOU 4120  N7   DA J -19     6957  16312  14158   1858  -2765  -4699       N  
ATOM   4121  C5   DA J -19       3.013  96.888  -7.989  1.00 96.82           C  
ANISOU 4121  C5   DA J -19     6579  16174  14034   1660  -2433  -4708       C  
ATOM   4122  C6   DA J -19       4.104  96.738  -7.108  1.00 89.93           C  
ANISOU 4122  C6   DA J -19     5855  15374  12940   1516  -2221  -4484       C  
ATOM   4123  N6   DA J -19       5.354  96.487  -7.514  1.00 86.51           N  
ANISOU 4123  N6   DA J -19     5802  14948  12122   1572  -2355  -4196       N  
ATOM   4124  N1   DA J -19       3.860  96.857  -5.787  1.00101.89           N  
ANISOU 4124  N1   DA J -19     7147  16946  14622   1297  -1833  -4544       N  
ATOM   4125  C2   DA J -19       2.610  97.108  -5.382  1.00103.74           C  
ANISOU 4125  C2   DA J -19     7028  17166  15221   1241  -1691  -4818       C  
ATOM   4126  N3   DA J -19       1.508  97.268  -6.112  1.00102.32           N  
ANISOU 4126  N3   DA J -19     6679  16931  15267   1377  -1892  -5047       N  
ATOM   4127  C4   DA J -19       1.781  97.145  -7.420  1.00 99.51           C  
ANISOU 4127  C4   DA J -19     6542  16526  14739   1583  -2263  -4980       C  
ATOM   4128  P    DA J -18      -3.805 100.393  -8.514  1.00134.76           P  
ANISOU 4128  P    DA J -18     9968  20998  20235   2240  -2622  -5961       P  
ATOM   4129  OP1  DA J -18      -5.169 100.289  -9.080  1.00134.24           O  
ANISOU 4129  OP1  DA J -18     9606  20952  20449   2280  -2735  -6237       O  
ATOM   4130  OP2  DA J -18      -2.783 101.213  -9.202  1.00135.14           O  
ANISOU 4130  OP2  DA J -18    10427  21007  19915   2493  -2855  -5673       O  
ATOM   4131  O5'  DA J -18      -3.902 100.914  -7.008  1.00137.13           O  
ANISOU 4131  O5'  DA J -18    10126  21339  20640   2118  -2260  -5983       O  
ATOM   4132  C5'  DA J -18      -3.616 100.021  -5.938  1.00135.09           C  
ANISOU 4132  C5'  DA J -18     9769  21095  20463   1784  -1911  -5983       C  
ATOM   4133  C4'  DA J -18      -2.712 100.678  -4.913  1.00129.12           C  
ANISOU 4133  C4'  DA J -18     9184  20361  19514   1762  -1675  -5775       C  
ATOM   4134  O4'  DA J -18      -1.348 100.209  -5.080  1.00124.04           O  
ANISOU 4134  O4'  DA J -18     8848  19713  18567   1720  -1718  -5513       O  
ATOM   4135  C3'  DA J -18      -2.653 102.202  -4.986  1.00129.66           C  
ANISOU 4135  C3'  DA J -18     9384  20431  19449   2077  -1804  -5696       C  
ATOM   4136  O3'  DA J -18      -2.752 102.738  -3.680  1.00133.90           O  
ANISOU 4136  O3'  DA J -18     9821  20999  20056   1972  -1451  -5710       O  
ATOM   4137  C2'  DA J -18      -1.283 102.478  -5.615  1.00125.43           C  
ANISOU 4137  C2'  DA J -18     9272  19875  18509   2247  -2030  -5382       C  
ATOM   4138  C1'  DA J -18      -0.466 101.309  -5.091  1.00118.85           C  
ANISOU 4138  C1'  DA J -18     8489  19068  17600   1954  -1816  -5275       C  
ATOM   4139  N9   DA J -18       0.683 100.957  -5.925  1.00107.20           N  
ANISOU 4139  N9   DA J -18     7365  17576  15792   2039  -2060  -5027       N  
ATOM   4140  C8   DA J -18       0.681 100.721  -7.270  1.00103.88           C  
ANISOU 4140  C8   DA J -18     7093  17096  15280   2195  -2411  -5005       C  
ATOM   4141  N7   DA J -18       1.858 100.404  -7.755  1.00 98.52           N  
ANISOU 4141  N7   DA J -18     6763  16401  14268   2227  -2542  -4742       N  
ATOM   4142  C5   DA J -18       2.692 100.427  -6.650  1.00 96.02           C  
ANISOU 4142  C5   DA J -18     6515  16157  13811   2089  -2278  -4584       C  
ATOM   4143  C6   DA J -18       4.072 100.180  -6.494  1.00 87.67           C  
ANISOU 4143  C6   DA J -18     5782  15141  12388   2049  -2259  -4279       C  
ATOM   4144  N6   DA J -18       4.880  99.847  -7.507  1.00 83.36           N  
ANISOU 4144  N6   DA J -18     5590  14538  11546   2148  -2518  -4067       N  
ATOM   4145  N1   DA J -18       4.591 100.288  -5.253  1.00 83.56           N  
ANISOU 4145  N1   DA J -18     5242  14712  11797   1884  -1925  -4177       N  
ATOM   4146  C2   DA J -18       3.780 100.621  -4.241  1.00 85.68           C  
ANISOU 4146  C2   DA J -18     5239  14976  12338   1749  -1597  -4350       C  
ATOM   4147  N3   DA J -18       2.471 100.877  -4.264  1.00 98.17           N  
ANISOU 4147  N3   DA J -18     6458  16548  14295   1791  -1604  -4667       N  
ATOM   4148  C4   DA J -18       1.984 100.761  -5.510  1.00102.48           C  
ANISOU 4148  C4   DA J -18     7026  17021  14892   1963  -1961  -4758       C  
ATOM   4149  P    DA J -17      -3.110 104.287  -3.461  1.00122.46           P  
ANISOU 4149  P    DA J -17     8385  19547  18598   2244  -1493  -5729       P  
ATOM   4150  OP1  DA J -17      -4.154 104.364  -2.415  1.00126.99           O  
ANISOU 4150  OP1  DA J -17     8636  20147  19469   2079  -1165  -5950       O  
ATOM   4151  OP2  DA J -17      -3.358 104.887  -4.790  1.00121.31           O  
ANISOU 4151  OP2  DA J -17     8346  19360  18385   2561  -1923  -5729       O  
ATOM   4152  O5'  DA J -17      -1.753 104.899  -2.882  1.00123.02           O  
ANISOU 4152  O5'  DA J -17     8780  19629  18332   2291  -1381  -5436       O  
ATOM   4153  C5'  DA J -17      -1.074 104.232  -1.823  1.00123.83           C  
ANISOU 4153  C5'  DA J -17     8908  19773  18367   1986  -1000  -5328       C  
ATOM   4154  C4'  DA J -17       0.288 104.855  -1.568  1.00121.02           C  
ANISOU 4154  C4'  DA J -17     8901  19448  17633   2091   -981  -5026       C  
ATOM   4155  O4'  DA J -17       1.271 104.287  -2.478  1.00118.22           O  
ANISOU 4155  O4'  DA J -17     8808  19102  17008   2148  -1256  -4820       O  
ATOM   4156  C3'  DA J -17       0.360 106.368  -1.776  1.00120.93           C  
ANISOU 4156  C3'  DA J -17     9051  19408  17490   2437  -1173  -4962       C  
ATOM   4157  O3'  DA J -17       1.258 106.930  -0.834  1.00115.01           O  
ANISOU 4157  O3'  DA J -17     8489  18703  16505   2409   -912  -4772       O  
ATOM   4158  C2'  DA J -17       0.925 106.468  -3.188  1.00120.44           C  
ANISOU 4158  C2'  DA J -17     9274  19302  17184   2685  -1649  -4794       C  
ATOM   4159  C1'  DA J -17       1.936 105.338  -3.144  1.00115.10           C  
ANISOU 4159  C1'  DA J -17     8739  18683  16312   2476  -1571  -4615       C  
ATOM   4160  N9   DA J -17       2.373 104.863  -4.453  1.00110.45           N  
ANISOU 4160  N9   DA J -17     8377  18047  15541   2583  -1949  -4490       N  
ATOM   4161  C8   DA J -17       1.623 104.758  -5.592  1.00111.85           C  
ANISOU 4161  C8   DA J -17     8500  18147  15850   2705  -2245  -4621       C  
ATOM   4162  N7   DA J -17       2.290 104.288  -6.621  1.00110.06           N  
ANISOU 4162  N7   DA J -17     8553  17877  15390   2755  -2499  -4445       N  
ATOM   4163  C5   DA J -17       3.564 104.067  -6.120  1.00106.11           C  
ANISOU 4163  C5   DA J -17     8308  17431  14577   2670  -2387  -4177       C  
ATOM   4164  C6   DA J -17       4.747 103.571  -6.707  1.00102.95           C  
ANISOU 4164  C6   DA J -17     8288  17014  13814   2663  -2528  -3885       C  
ATOM   4165  N6   DA J -17       4.833 103.196  -7.987  1.00103.24           N  
ANISOU 4165  N6   DA J -17     8516  16949  13760   2738  -2793  -3820       N  
ATOM   4166  N1   DA J -17       5.843 103.477  -5.923  1.00101.07           N  
ANISOU 4166  N1   DA J -17     8233  16871  13299   2566  -2356  -3649       N  
ATOM   4167  C2   DA J -17       5.753 103.851  -4.643  1.00 98.59           C  
ANISOU 4167  C2   DA J -17     7770  16628  13062   2451  -2014  -3687       C  
ATOM   4168  N3   DA J -17       4.702 104.332  -3.982  1.00101.01           N  
ANISOU 4168  N3   DA J -17     7726  16942  13712   2437  -1822  -3956       N  
ATOM   4169  C4   DA J -17       3.630 104.414  -4.785  1.00105.34           C  
ANISOU 4169  C4   DA J -17     8064  17424  14536   2564  -2049  -4202       C  
ATOM   4170  P    DG J -16       0.712 107.720   0.454  1.00120.44           P  
ANISOU 4170  P    DG J -16     9035  19387  17340   2336   -521  -4892       P  
ATOM   4171  OP1  DG J -16      -0.129 106.788   1.239  1.00121.51           O  
ANISOU 4171  OP1  DG J -16     8867  19527  17774   1976   -164  -5085       O  
ATOM   4172  OP2  DG J -16       0.152 109.008  -0.011  1.00119.92           O  
ANISOU 4172  OP2  DG J -16     8976  19256  17334   2682   -790  -4977       O  
ATOM   4173  O5'  DG J -16       2.043 108.035   1.280  1.00109.98           O  
ANISOU 4173  O5'  DG J -16     8162  18033  15591   2208   -253  -4528       O  
ATOM   4174  C5'  DG J -16       2.977 106.994   1.535  1.00104.46           C  
ANISOU 4174  C5'  DG J -16     7749  17305  14638   1890    -73  -4251       C  
ATOM   4175  C4'  DG J -16       4.348 107.341   0.978  1.00103.87           C  
ANISOU 4175  C4'  DG J -16     8215  17178  14071   2025   -305  -3851       C  
ATOM   4176  O4'  DG J -16       4.402 107.053  -0.448  1.00110.51           O  
ANISOU 4176  O4'  DG J -16     9043  18046  14901   2265   -794  -3874       O  
ATOM   4177  C3'  DG J -16       4.765 108.809   1.123  1.00 98.51           C  
ANISOU 4177  C3'  DG J -16     7805  16460  13164   2277   -384  -3709       C  
ATOM   4178  O3'  DG J -16       6.129 108.866   1.482  1.00 92.18           O  
ANISOU 4178  O3'  DG J -16     7523  15614  11888   2146   -262  -3289       O  
ATOM   4179  C2'  DG J -16       4.559 109.353  -0.290  1.00102.03           C  
ANISOU 4179  C2'  DG J -16     8199  16926  13641   2697   -944  -3788       C  
ATOM   4180  C1'  DG J -16       5.006 108.149  -1.096  1.00104.74           C  
ANISOU 4180  C1'  DG J -16     8609  17297  13889   2599  -1127  -3690       C  
ATOM   4181  N9   DG J -16       4.595 108.165  -2.499  1.00 98.52           N  
ANISOU 4181  N9   DG J -16     7646  16562  13224   2911  -1634  -3842       N  
ATOM   4182  C8   DG J -16       3.413 108.632  -3.014  1.00 99.50           C  
ANISOU 4182  C8   DG J -16     7464  16658  13682   3104  -1829  -4136       C  
ATOM   4183  N7   DG J -16       3.327 108.509  -4.311  1.00101.86           N  
ANISOU 4183  N7   DG J -16     7909  16868  13924   3227  -2199  -4089       N  
ATOM   4184  C5   DG J -16       4.533 107.924  -4.679  1.00 97.63           C  
ANISOU 4184  C5   DG J -16     7707  16356  13033   3169  -2290  -3797       C  
ATOM   4185  C6   DG J -16       5.017 107.549  -5.959  1.00 97.03           C  
ANISOU 4185  C6   DG J -16     7938  16187  12743   3218  -2590  -3615       C  
ATOM   4186  O6   DG J -16       4.456 107.665  -7.058  1.00 97.93           O  
ANISOU 4186  O6   DG J -16     8069  16194  12947   3326  -2828  -3682       O  
ATOM   4187  N1   DG J -16       6.290 106.988  -5.885  1.00 90.39           N  
ANISOU 4187  N1   DG J -16     7415  15388  11542   3112  -2557  -3315       N  
ATOM   4188  C2   DG J -16       7.005 106.812  -4.724  1.00 86.01           C  
ANISOU 4188  C2   DG J -16     6861  14988  10830   2983  -2289  -3200       C  
ATOM   4189  N2   DG J -16       8.214 106.247  -4.842  1.00 87.24           N  
ANISOU 4189  N2   DG J -16     7377  15169  10600   2882  -2300  -2880       N  
ATOM   4190  N3   DG J -16       6.561 107.157  -3.521  1.00 87.44           N  
ANISOU 4190  N3   DG J -16     6886  15157  11179   2842  -1911  -3306       N  
ATOM   4191  C4   DG J -16       5.324 107.706  -3.575  1.00 93.15           C  
ANISOU 4191  C4   DG J -16     7187  15905  12300   3010  -1981  -3661       C  
ATOM   4192  P    DG J -15       6.577 109.253   2.974  1.00 85.19           P  
ANISOU 4192  P    DG J -15     6846  14696  10825   1880    241  -3122       P  
ATOM   4193  OP1  DG J -15       5.697 108.527   3.915  1.00 95.46           O  
ANISOU 4193  OP1  DG J -15     7764  16032  12474   1575    648  -3372       O  
ATOM   4194  OP2  DG J -15       6.675 110.727   3.046  1.00 84.85           O  
ANISOU 4194  OP2  DG J -15     6963  14612  10665   2151    133  -3087       O  
ATOM   4195  O5'  DG J -15       8.059 108.659   3.074  1.00 77.15           O  
ANISOU 4195  O5'  DG J -15     6331  13661   9322   1669    326  -2667       O  
ATOM   4196  C5'  DG J -15       8.289 107.281   2.797  1.00 76.97           C  
ANISOU 4196  C5'  DG J -15     6284  13655   9305   1455    348  -2609       C  
ATOM   4197  C4'  DG J -15       9.588 107.073   2.027  1.00 77.30           C  
ANISOU 4197  C4'  DG J -15     6779  13693   8899   1529     88  -2234       C  
ATOM   4198  O4'  DG J -15       9.379 107.308   0.611  1.00 82.02           O  
ANISOU 4198  O4'  DG J -15     7305  14312   9546   1888   -441  -2336       O  
ATOM   4199  C3'  DG J -15      10.747 107.970   2.428  1.00 73.11           C  
ANISOU 4199  C3'  DG J -15     6738  13145   7896   1555    149  -1858       C  
ATOM   4200  O3'  DG J -15      11.965 107.250   2.267  1.00 74.40           O  
ANISOU 4200  O3'  DG J -15     7280  13322   7668   1410    155  -1491       O  
ATOM   4201  C2'  DG J -15      10.631 109.136   1.442  1.00 74.61           C  
ANISOU 4201  C2'  DG J -15     6970  13331   8048   1984   -313  -1907       C  
ATOM   4202  C1'  DG J -15      10.101 108.452   0.185  1.00 77.06           C  
ANISOU 4202  C1'  DG J -15     7020  13678   8582   2157   -701  -2109       C  
ATOM   4203  N9   DG J -15       9.183 109.273  -0.600  1.00 78.68           N  
ANISOU 4203  N9   DG J -15     6946  13891   9058   2518  -1059  -2394       N  
ATOM   4204  C8   DG J -15       8.196 110.097  -0.122  1.00 80.20           C  
ANISOU 4204  C8   DG J -15     6851  14062   9560   2621   -961  -2672       C  
ATOM   4205  N7   DG J -15       7.507 110.682  -1.061  1.00 79.73           N  
ANISOU 4205  N7   DG J -15     6571  14020   9703   2967  -1355  -2885       N  
ATOM   4206  C5   DG J -15       8.066 110.209  -2.239  1.00 81.64           C  
ANISOU 4206  C5   DG J -15     6959  14305   9757   3092  -1737  -2743       C  
ATOM   4207  C6   DG J -15       7.733 110.494  -3.584  1.00 88.32           C  
ANISOU 4207  C6   DG J -15     7676  15198  10682   3441  -2251  -2856       C  
ATOM   4208  O6   DG J -15       6.848 111.245  -4.013  1.00 92.67           O  
ANISOU 4208  O6   DG J -15     8085  15647  11477   3618  -2400  -3051       O  
ATOM   4209  N1   DG J -15       8.550 109.802  -4.474  1.00 89.43           N  
ANISOU 4209  N1   DG J -15     8150  15282  10547   3366  -2426  -2604       N  
ATOM   4210  C2   DG J -15       9.560 108.942  -4.110  1.00 90.80           C  
ANISOU 4210  C2   DG J -15     8524  15556  10420   3173  -2293  -2362       C  
ATOM   4211  N2   DG J -15      10.244 108.363  -5.109  1.00 84.59           N  
ANISOU 4211  N2   DG J -15     8087  14623   9431   3097  -2429  -2133       N  
ATOM   4212  N3   DG J -15       9.880 108.667  -2.851  1.00 90.12           N  
ANISOU 4212  N3   DG J -15     8559  15421  10260   2847  -1814  -2245       N  
ATOM   4213  C4   DG J -15       9.094 109.334  -1.973  1.00 82.07           C  
ANISOU 4213  C4   DG J -15     7325  14362   9498   2822  -1559  -2447       C  
ATOM   4214  P    DC J -14      13.386 107.960   2.509  1.00 82.85           P  
ANISOU 4214  P    DC J -14     8909  14397   8172   1416    174  -1036       P  
ATOM   4215  OP1  DC J -14      14.349 106.904   2.899  1.00 77.37           O  
ANISOU 4215  OP1  DC J -14     8472  13723   7202   1113    409   -730       O  
ATOM   4216  OP2  DC J -14      13.182 109.128   3.394  1.00 91.10           O  
ANISOU 4216  OP2  DC J -14     9985  15413   9216   1428    383  -1068       O  
ATOM   4217  O5'  DC J -14      13.787 108.489   1.056  1.00 75.94           O  
ANISOU 4217  O5'  DC J -14     8201  13546   7105   1804   -398   -945       O  
ATOM   4218  C5'  DC J -14      13.750 107.596  -0.050  1.00 67.12           C  
ANISOU 4218  C5'  DC J -14     6986  12464   6051   1898   -710  -1004       C  
ATOM   4219  C4'  DC J -14      14.131 108.304  -1.334  1.00 60.48           C  
ANISOU 4219  C4'  DC J -14     6312  11663   5004   2273  -1239   -908       C  
ATOM   4220  O4'  DC J -14      13.026 109.131  -1.790  1.00 62.79           O  
ANISOU 4220  O4'  DC J -14     6275  11939   5642   2558  -1481  -1242       O  
ATOM   4221  C3'  DC J -14      15.335 109.242  -1.231  1.00 51.32           C  
ANISOU 4221  C3'  DC J -14     5654  10400   3446   2290  -1231   -502       C  
ATOM   4222  O3'  DC J -14      16.073 109.159  -2.426  1.00 50.74           O  
ANISOU 4222  O3'  DC J -14     5837   9883   3560   2211  -1350   -306       O  
ATOM   4223  C2'  DC J -14      14.671 110.609  -1.102  1.00 55.31           C  
ANISOU 4223  C2'  DC J -14     6038  10974   4002   2570  -1382   -678       C  
ATOM   4224  C1'  DC J -14      13.518 110.421  -2.067  1.00 59.18           C  
ANISOU 4224  C1'  DC J -14     6091  11476   4918   2806  -1709  -1061       C  
ATOM   4225  N1   DC J -14      12.415 111.402  -1.915  1.00 65.95           N  
ANISOU 4225  N1   DC J -14     6647  12284   6129   3000  -1748  -1374       N  
ATOM   4226  C2   DC J -14      11.703 111.798  -3.045  1.00 70.50           C  
ANISOU 4226  C2   DC J -14     7003  12843   6940   3314  -2161  -1591       C  
ATOM   4227  O2   DC J -14      12.019 111.320  -4.139  1.00 76.25           O  
ANISOU 4227  O2   DC J -14     7933  13357   7679   3223  -2262  -1472       O  
ATOM   4228  N3   DC J -14      10.695 112.693  -2.908  1.00 75.70           N  
ANISOU 4228  N3   DC J -14     7357  13497   7909   3534  -2232  -1880       N  
ATOM   4229  C4   DC J -14      10.397 113.179  -1.702  1.00 81.07           C  
ANISOU 4229  C4   DC J -14     8000  14110   8691   3389  -1841  -1952       C  
ATOM   4230  N4   DC J -14       9.394 114.059  -1.611  1.00 90.05           N  
ANISOU 4230  N4   DC J -14     8856  15206  10153   3597  -1892  -2240       N  
ATOM   4231  C5   DC J -14      11.115 112.785  -0.534  1.00 71.92           C  
ANISOU 4231  C5   DC J -14     7089  12935   7304   3028  -1380  -1730       C  
ATOM   4232  C6   DC J -14      12.109 111.905  -0.687  1.00 67.43           C  
ANISOU 4232  C6   DC J -14     6793  12410   6416   2845  -1352  -1441       C  
ATOM   4233  P    DA J -13      17.677 109.180  -2.411  1.00 55.24           P  
ANISOU 4233  P    DA J -13     6962   8724   5302   1423    232   1583       P  
ATOM   4234  OP1  DA J -13      18.139 107.814  -2.079  1.00 56.54           O  
ANISOU 4234  OP1  DA J -13     7101   9008   5372   1187    190   1630       O  
ATOM   4235  OP2  DA J -13      18.114 110.324  -1.581  1.00 55.01           O  
ANISOU 4235  OP2  DA J -13     6978   8606   5318   1554    378   1401       O  
ATOM   4236  O5'  DA J -13      18.042 109.489  -3.936  1.00 61.70           O  
ANISOU 4236  O5'  DA J -13     8011   9270   6164   1441    144   1672       O  
ATOM   4237  C5'  DA J -13      17.531 108.643  -4.960  1.00 65.11           C  
ANISOU 4237  C5'  DA J -13     8444   9735   6560   1364    -14   1844       C  
ATOM   4238  C4'  DA J -13      17.054 109.445  -6.161  1.00 69.25           C  
ANISOU 4238  C4'  DA J -13     9074  10089   7148   1515    -92   1922       C  
ATOM   4239  O4'  DA J -13      15.879 110.222  -5.810  1.00 72.37           O  
ANISOU 4239  O4'  DA J -13     9283  10599   7615   1721    -86   1910       O  
ATOM   4240  C3'  DA J -13      18.071 110.427  -6.740  1.00 65.54           C  
ANISOU 4240  C3'  DA J -13     8868   9311   6722   1566    -23   1858       C  
ATOM   4241  O3'  DA J -13      18.121 110.268  -8.145  1.00 64.52           O  
ANISOU 4241  O3'  DA J -13     8912   9031   6572   1540   -139   1990       O  
ATOM   4242  C2'  DA J -13      17.520 111.800  -6.343  1.00 66.09           C  
ANISOU 4242  C2'  DA J -13     8888   9332   6891   1800     41   1769       C  
ATOM   4243  C1'  DA J -13      16.021 111.542  -6.281  1.00 68.12           C  
ANISOU 4243  C1'  DA J -13     8896   9825   7161   1901    -53   1857       C  
ATOM   4244  N9   DA J -13      15.304 112.421  -5.358  1.00 67.88           N  
ANISOU 4244  N9   DA J -13     8695   9901   7195   2108     32   1748       N  
ATOM   4245  C8   DA J -13      15.496 112.525  -4.009  1.00 72.41           C  
ANISOU 4245  C8   DA J -13     9156  10608   7750   2120    171   1599       C  
ATOM   4246  N7   DA J -13      14.697 113.384  -3.423  1.00 77.80           N  
ANISOU 4246  N7   DA J -13     9700  11372   8489   2346    226   1516       N  
ATOM   4247  C5   DA J -13      13.918 113.875  -4.458  1.00 78.51           C  
ANISOU 4247  C5   DA J -13     9804  11375   8652   2495    108   1622       C  
ATOM   4248  C6   DA J -13      12.874 114.822  -4.494  1.00 84.77           C  
ANISOU 4248  C6   DA J -13    10485  12189   9533   2770     88   1604       C  
ATOM   4249  N6   DA J -13      12.425 115.463  -3.409  1.00 78.02           N  
ANISOU 4249  N6   DA J -13     9480  11463   8702   2959    205   1456       N  
ATOM   4250  N1   DA J -13      12.307 115.084  -5.692  1.00 86.03           N  
ANISOU 4250  N1   DA J -13    10701  12235   9753   2855    -61   1739       N  
ATOM   4251  C2   DA J -13      12.759 114.435  -6.772  1.00 76.36           C  
ANISOU 4251  C2   DA J -13     9641  10886   8486   2673   -174   1879       C  
ATOM   4252  N3   DA J -13      13.731 113.527  -6.860  1.00 73.61           N  
ANISOU 4252  N3   DA J -13     9411  10509   8049   2420   -159   1902       N  
ATOM   4253  C4   DA J -13      14.274 113.288  -5.657  1.00 71.89           C  
ANISOU 4253  C4   DA J -13     9123  10403   7787   2344    -16   1769       C  
ATOM   4254  P    DT J -12      19.393 110.767  -8.987  1.00 63.09           P  
ANISOU 4254  P    DT J -12     9029   8555   6386   1496    -86   1977       P  
ATOM   4255  OP1  DT J -12      19.862 109.629  -9.811  1.00 67.96           O  
ANISOU 4255  OP1  DT J -12     9759   9162   6901   1332   -166   2075       O  
ATOM   4256  OP2  DT J -12      20.333 111.442  -8.064  1.00 54.89           O  
ANISOU 4256  OP2  DT J -12     8026   7436   5393   1494     75   1817       O  
ATOM   4257  O5'  DT J -12      18.769 111.874  -9.949  1.00 63.41           O  
ANISOU 4257  O5'  DT J -12     9174   8426   6493   1676   -153   2047       O  
ATOM   4258  C5'  DT J -12      17.416 111.757 -10.360  1.00 63.51           C  
ANISOU 4258  C5'  DT J -12     9056   8553   6521   1779   -297   2157       C  
ATOM   4259  C4'  DT J -12      16.881 113.097 -10.814  1.00 69.86           C  
ANISOU 4259  C4'  DT J -12     9926   9197   7421   1993   -324   2166       C  
ATOM   4260  O4'  DT J -12      16.178 113.744  -9.725  1.00 73.77           O  
ANISOU 4260  O4'  DT J -12    10213   9816   8002   2160   -261   2058       O  
ATOM   4261  C3'  DT J -12      17.950 114.084 -11.289  1.00 70.02           C  
ANISOU 4261  C3'  DT J -12    10220   8915   7467   2002   -243   2123       C  
ATOM   4262  O3'  DT J -12      17.616 114.554 -12.581  1.00 77.19           O  
ANISOU 4262  O3'  DT J -12    11298   9652   8377   2074   -362   2253       O  
ATOM   4263  C2'  DT J -12      17.910 115.206 -10.243  1.00 71.87           C  
ANISOU 4263  C2'  DT J -12    10391   9112   7806   2156   -134   1967       C  
ATOM   4264  C1'  DT J -12      16.478 115.115  -9.738  1.00 75.84           C  
ANISOU 4264  C1'  DT J -12    10619   9847   8349   2311   -201   1975       C  
ATOM   4265  N1   DT J -12      16.279 115.654  -8.356  1.00 71.98           N  
ANISOU 4265  N1   DT J -12     9966   9466   7915   2432    -81   1805       N  
ATOM   4266  C2   DT J -12      15.293 116.591  -8.132  1.00 78.59           C  
ANISOU 4266  C2   DT J -12    10703  10314   8844   2687   -105   1765       C  
ATOM   4267  O2   DT J -12      14.568 117.021  -9.011  1.00 85.56           O  
ANISOU 4267  O2   DT J -12    11617  11115   9775   2817   -229   1868       O  
ATOM   4268  N3   DT J -12      15.189 117.011  -6.831  1.00 76.89           N  
ANISOU 4268  N3   DT J -12    10352  10206   8656   2793     18   1596       N  
ATOM   4269  C4   DT J -12      15.952 116.596  -5.756  1.00 76.10           C  
ANISOU 4269  C4   DT J -12    10213  10200   8500   2660    150   1472       C  
ATOM   4270  O4   DT J -12      15.784 117.032  -4.622  1.00 77.15           O  
ANISOU 4270  O4   DT J -12    10237  10427   8648   2773    252   1320       O  
ATOM   4271  C5   DT J -12      16.964 115.614  -6.059  1.00 73.87           C  
ANISOU 4271  C5   DT J -12    10035   9897   8135   2389    157   1530       C  
ATOM   4272  C7   DT J -12      17.853 115.091  -4.969  1.00 74.03           C  
ANISOU 4272  C7   DT J -12    10024  10007   8096   2231    279   1411       C  
ATOM   4273  C6   DT J -12      17.077 115.193  -7.329  1.00 69.15           C  
ANISOU 4273  C6   DT J -12     9566   9198   7511   2296     47   1688       C  
ATOM   4274  P    DG J -11      18.752 115.117 -13.565  1.00 71.30           P  
ANISOU 4274  P    DG J -11    10876   8614   7601   2003   -321   2294       P  
ATOM   4275  OP1  DG J -11      18.564 114.461 -14.876  1.00 72.92           O  
ANISOU 4275  OP1  DG J -11    11209   8793   7704   1936   -454   2458       O  
ATOM   4276  OP2  DG J -11      20.054 115.021 -12.868  1.00 73.88           O  
ANISOU 4276  OP2  DG J -11    11249   8908   7915   1864   -154   2176       O  
ATOM   4277  O5'  DG J -11      18.378 116.661 -13.703  1.00 56.87           O  
ANISOU 4277  O5'  DG J -11     9139   6578   5889   2207   -339   2275       O  
ATOM   4278  C5'  DG J -11      17.013 117.042 -13.776  1.00 74.26           C  
ANISOU 4278  C5'  DG J -11    11208   8846   8161   2409   -467   2318       C  
ATOM   4279  C4'  DG J -11      16.814 118.457 -13.265  1.00 77.17           C  
ANISOU 4279  C4'  DG J -11    11599   9064   8658   2614   -430   2214       C  
ATOM   4280  O4'  DG J -11      16.654 118.449 -11.821  1.00 81.39           O  
ANISOU 4280  O4'  DG J -11    11910   9775   9240   2673   -320   2047       O  
ATOM   4281  C3'  DG J -11      17.966 119.425 -13.557  1.00 79.49           C  
ANISOU 4281  C3'  DG J -11    12179   9049   8975   2566   -352   2183       C  
ATOM   4282  O3'  DG J -11      17.434 120.647 -14.037  1.00 87.27           O  
ANISOU 4282  O3'  DG J -11    13287   9822  10050   2762   -446   2216       O  
ATOM   4283  C2'  DG J -11      18.620 119.604 -12.185  1.00 86.24           C  
ANISOU 4283  C2'  DG J -11    12947   9951   9871   2536   -191   1992       C  
ATOM   4284  C1'  DG J -11      17.404 119.511 -11.288  1.00 85.53           C  
ANISOU 4284  C1'  DG J -11    12571  10095   9830   2719   -215   1915       C  
ATOM   4285  N9   DG J -11      17.703 119.227  -9.885  1.00 82.64           N  
ANISOU 4285  N9   DG J -11    12039   9898   9463   2684    -79   1748       N  
ATOM   4286  C8   DG J -11      18.616 118.327  -9.387  1.00 80.05           C  
ANISOU 4286  C8   DG J -11    11682   9675   9058   2464     22   1705       C  
ATOM   4287  N7   DG J -11      18.652 118.292  -8.082  1.00 79.39           N  
ANISOU 4287  N7   DG J -11    11447   9733   8985   2488    123   1551       N  
ATOM   4288  C5   DG J -11      17.700 119.227  -7.692  1.00 81.20           C  
ANISOU 4288  C5   DG J -11    11597   9957   9299   2747     98   1481       C  
ATOM   4289  C6   DG J -11      17.289 119.633  -6.399  1.00 79.81           C  
ANISOU 4289  C6   DG J -11    11264   9906   9156   2898    180   1310       C  
ATOM   4290  O6   DG J -11      17.698 119.232  -5.301  1.00 80.09           O  
ANISOU 4290  O6   DG J -11    11200  10085   9145   2816    290   1189       O  
ATOM   4291  N1   DG J -11      16.296 120.611  -6.456  1.00 82.80           N  
ANISOU 4291  N1   DG J -11    11608  10230   9621   3179    120   1282       N  
ATOM   4292  C2   DG J -11      15.767 121.127  -7.616  1.00 80.46           C  
ANISOU 4292  C2   DG J -11    11418   9770   9381   3293    -17   1412       C  
ATOM   4293  N2   DG J -11      14.816 122.062  -7.483  1.00 83.09           N  
ANISOU 4293  N2   DG J -11    11697  10069   9806   3583    -68   1359       N  
ATOM   4294  N3   DG J -11      16.146 120.757  -8.829  1.00 81.45           N  
ANISOU 4294  N3   DG J -11    11700   9775   9471   3140   -100   1579       N  
ATOM   4295  C4   DG J -11      17.109 119.808  -8.791  1.00 82.64           C  
ANISOU 4295  C4   DG J -11    11884   9985   9530   2874    -30   1601       C  
ATOM   4296  P    DT J -10      18.377 121.733 -14.753  1.00 90.98           P  
ANISOU 4296  P    DT J -10    14094   9934  10540   2718   -432   2257       P  
ATOM   4297  OP1  DT J -10      17.898 121.880 -16.146  1.00 93.04           O  
ANISOU 4297  OP1  DT J -10    14516  10073  10763   2755   -590   2445       O  
ATOM   4298  OP2  DT J -10      19.790 121.373 -14.499  1.00 91.32           O  
ANISOU 4298  OP2  DT J -10    14226   9948  10525   2482   -277   2209       O  
ATOM   4299  O5'  DT J -10      18.058 123.079 -13.951  1.00 90.32           O  
ANISOU 4299  O5'  DT J -10    14015   9700  10601   2942   -427   2116       O  
ATOM   4300  C5'  DT J -10      16.722 123.363 -13.553  1.00 93.69           C  
ANISOU 4300  C5'  DT J -10    14247  10242  11108   3204   -517   2072       C  
ATOM   4301  C4'  DT J -10      16.705 124.290 -12.352  1.00 98.35           C  
ANISOU 4301  C4'  DT J -10    14792  10773  11802   3371   -441   1870       C  
ATOM   4302  O4'  DT J -10      16.957 123.535 -11.151  1.00 99.91           O  
ANISOU 4302  O4'  DT J -10    14775  11225  11962   3288   -298   1732       O  
ATOM   4303  C3'  DT J -10      17.764 125.392 -12.379  1.00 97.56           C  
ANISOU 4303  C3'  DT J -10    14987  10329  11752   3320   -402   1820       C  
ATOM   4304  O3'  DT J -10      17.151 126.644 -12.651  1.00101.97           O  
ANISOU 4304  O3'  DT J -10    15675  10651  12418   3564   -524   1816       O  
ATOM   4305  C2'  DT J -10      18.404 125.361 -10.978  1.00 97.63           C  
ANISOU 4305  C2'  DT J -10    14903  10420  11772   3270   -244   1614       C  
ATOM   4306  C1'  DT J -10      17.511 124.400 -10.199  1.00 98.99           C  
ANISOU 4306  C1'  DT J -10    14733  10971  11908   3345   -207   1553       C  
ATOM   4307  N1   DT J -10      18.249 123.585  -9.187  1.00 95.29           N  
ANISOU 4307  N1   DT J -10    14140  10693  11373   3163    -55   1441       N  
ATOM   4308  C2   DT J -10      17.974 123.761  -7.849  1.00 94.57           C  
ANISOU 4308  C2   DT J -10    13887  10738  11306   3287     29   1251       C  
ATOM   4309  O2   DT J -10      17.147 124.555  -7.436  1.00 95.87           O  
ANISOU 4309  O2   DT J -10    13999  10883  11543   3552     -5   1159       O  
ATOM   4310  N3   DT J -10      18.705 122.967  -7.006  1.00 91.34           N  
ANISOU 4310  N3   DT J -10    13385  10493  10826   3098    153   1169       N  
ATOM   4311  C4   DT J -10      19.664 122.036  -7.357  1.00 91.72           C  
ANISOU 4311  C4   DT J -10    13476  10579  10795   2815    199   1251       C  
ATOM   4312  O4   DT J -10      20.268 121.369  -6.522  1.00 92.45           O  
ANISOU 4312  O4   DT J -10    13479  10816  10833   2669    299   1167       O  
ATOM   4313  C5   DT J -10      19.905 121.902  -8.775  1.00 91.23           C  
ANISOU 4313  C5   DT J -10    13579  10374  10710   2712    117   1441       C  
ATOM   4314  C7   DT J -10      20.924 120.923  -9.277  1.00 89.68           C  
ANISOU 4314  C7   DT J -10    13442  10210  10422   2434    165   1533       C  
ATOM   4315  C6   DT J -10      19.194 122.674  -9.612  1.00 90.18           C  
ANISOU 4315  C6   DT J -10    13546  10082  10635   2883     -4   1528       C  
ATOM   4316  P    DT J  -9      18.045 127.972 -12.779  1.00118.24           P  
ANISOU 4316  P    DT J  -9    18067  12308  14549   3544   -535   1785       P  
ATOM   4317  OP1  DT J  -9      17.328 128.916 -13.665  1.00114.72           O  
ANISOU 4317  OP1  DT J  -9    17787  11626  14175   3741   -716   1889       O  
ATOM   4318  OP2  DT J  -9      19.428 127.560 -13.109  1.00115.63           O  
ANISOU 4318  OP2  DT J  -9    17884  11911  14139   3218   -431   1851       O  
ATOM   4319  O5'  DT J  -9      18.054 128.565 -11.296  1.00117.42           O  
ANISOU 4319  O5'  DT J  -9    17879  12210  14524   3693   -452   1532       O  
ATOM   4320  C5'  DT J  -9      16.831 128.707 -10.585  1.00114.35           C  
ANISOU 4320  C5'  DT J  -9    17264  11993  14189   3994   -481   1413       C  
ATOM   4321  C4'  DT J  -9      17.065 129.372  -9.243  1.00111.18           C  
ANISOU 4321  C4'  DT J  -9    16857  11546  13841   4112   -394   1169       C  
ATOM   4322  O4'  DT J  -9      17.586 128.400  -8.300  1.00105.62           O  
ANISOU 4322  O4'  DT J  -9    15967  11111  13052   3935   -230   1073       O  
ATOM   4323  C3'  DT J  -9      18.059 130.530  -9.267  1.00112.28           C  
ANISOU 4323  C3'  DT J  -9    17334  11282  14044   4050   -420   1121       C  
ATOM   4324  O3'  DT J  -9      17.564 131.606  -8.489  1.00120.28           O  
ANISOU 4324  O3'  DT J  -9    18393  12157  15151   4343   -463    934       O  
ATOM   4325  C2'  DT J  -9      19.329 129.927  -8.664  1.00106.83           C  
ANISOU 4325  C2'  DT J  -9    16645  10661  13285   3746   -266   1063       C  
ATOM   4326  C1'  DT J  -9      18.766 128.890  -7.704  1.00101.09           C  
ANISOU 4326  C1'  DT J  -9    15576  10344  12491   3793   -155    957       C  
ATOM   4327  N1   DT J  -9      19.680 127.733  -7.473  1.00 89.27           N  
ANISOU 4327  N1   DT J  -9    13986   9040  10894   3483    -28    984       N  
ATOM   4328  C2   DT J  -9      19.877 127.275  -6.191  1.00 86.73           C  
ANISOU 4328  C2   DT J  -9    13497   8927  10529   3456     95    813       C  
ATOM   4329  O2   DT J  -9      19.345 127.772  -5.215  1.00 94.01           O  
ANISOU 4329  O2   DT J  -9    14345   9895  11481   3673    116    635       O  
ATOM   4330  N3   DT J  -9      20.729 126.206  -6.090  1.00 81.01           N  
ANISOU 4330  N3   DT J  -9    12703   8358   9719   3172    190    856       N  
ATOM   4331  C4   DT J  -9      21.387 125.562  -7.121  1.00 77.87           C  
ANISOU 4331  C4   DT J  -9    12380   7935   9272   2931    185   1038       C  
ATOM   4332  O4   DT J  -9      22.134 124.606  -6.926  1.00 72.80           O  
ANISOU 4332  O4   DT J  -9    11665   7439   8557   2704    271   1053       O  
ATOM   4333  C5   DT J  -9      21.135 126.091  -8.440  1.00 77.39           C  
ANISOU 4333  C5   DT J  -9    12496   7662   9246   2975     67   1207       C  
ATOM   4334  C7   DT J  -9      21.794 125.474  -9.638  1.00 68.77           C  
ANISOU 4334  C7   DT J  -9    11509   6534   8086   2739     61   1407       C  
ATOM   4335  C6   DT J  -9      20.303 127.139  -8.552  1.00 80.08           C  
ANISOU 4335  C6   DT J  -9    12910   7842   9674   3239    -38   1177       C  
ATOM   4336  P    DC J  -8      18.253 133.053  -8.581  1.00112.86           P  
ANISOU 4336  P    DC J  -8    17828  10747  14306   4366   -556    885       P  
ATOM   4337  OP1  DC J  -8      17.181 134.073  -8.524  1.00117.82           O  
ANISOU 4337  OP1  DC J  -8    18501  11229  15037   4751   -692    805       O  
ATOM   4338  OP2  DC J  -8      19.194 133.035  -9.723  1.00107.72           O  
ANISOU 4338  OP2  DC J  -8    17407   9888  13632   4068   -592   1100       O  
ATOM   4339  O5'  DC J  -8      19.115 133.135  -7.241  1.00109.31           O  
ANISOU 4339  O5'  DC J  -8    17385  10306  13841   4270   -425    665       O  
ATOM   4340  C5'  DC J  -8      18.540 132.730  -6.012  1.00107.25           C  
ANISOU 4340  C5'  DC J  -8    16863  10344  13543   4437   -319    466       C  
ATOM   4341  C4'  DC J  -8      19.592 132.679  -4.926  1.00106.33           C  
ANISOU 4341  C4'  DC J  -8    16792  10219  13390   4261   -203    301       C  
ATOM   4342  O4'  DC J  -8      20.244 131.382  -4.933  1.00103.32           O  
ANISOU 4342  O4'  DC J  -8    16248  10101  12908   3951    -78    389       O  
ATOM   4343  C3'  DC J  -8      20.706 133.719  -5.067  1.00105.76           C  
ANISOU 4343  C3'  DC J  -8    17077   9718  13390   4118   -275    290       C  
ATOM   4344  O3'  DC J  -8      20.918 134.362  -3.823  1.00104.76           O  
ANISOU 4344  O3'  DC J  -8    17020   9502  13281   4232   -252     39       O  
ATOM   4345  C2'  DC J  -8      21.919 132.887  -5.492  1.00103.99           C  
ANISOU 4345  C2'  DC J  -8    16861   9546  13103   3709   -189    436       C  
ATOM   4346  C1'  DC J  -8      21.630 131.567  -4.802  1.00102.37           C  
ANISOU 4346  C1'  DC J  -8    16320   9784  12792   3671    -45    381       C  
ATOM   4347  N1   DC J  -8      22.330 130.396  -5.408  1.00100.27           N  
ANISOU 4347  N1   DC J  -8    15963   9690  12447   3351     33    554       N  
ATOM   4348  C2   DC J  -8      22.859 129.409  -4.573  1.00 96.56           C  
ANISOU 4348  C2   DC J  -8    15313   9482  11895   3180    166    477       C  
ATOM   4349  O2   DC J  -8      22.733 129.536  -3.351  1.00 96.74           O  
ANISOU 4349  O2   DC J  -8    15259   9594  11904   3287    219    274       O  
ATOM   4350  N3   DC J  -8      23.493 128.346  -5.128  1.00 94.63           N  
ANISOU 4350  N3   DC J  -8    14993   9382  11580   2910    229    625       N  
ATOM   4351  C4   DC J  -8      23.603 128.254  -6.456  1.00 94.84           C  
ANISOU 4351  C4   DC J  -8    15121   9309  11607   2813    174    837       C  
ATOM   4352  N4   DC J  -8      24.238 127.189  -6.961  1.00 85.37           N  
ANISOU 4352  N4   DC J  -8    13850   8257  10327   2565    242    964       N  
ATOM   4353  C5   DC J  -8      23.069 129.253  -7.325  1.00100.31           C  
ANISOU 4353  C5   DC J  -8    16001   9740  12373   2973     42    925       C  
ATOM   4354  C6   DC J  -8      22.447 130.297  -6.763  1.00101.57           C  
ANISOU 4354  C6   DC J  -8    16230   9750  12612   3238    -30    781       C  
ATOM   4355  P    DA J  -7      21.646 135.792  -3.757  1.00114.37           P  
ANISOU 4355  P    DA J  -7    18624  10231  14602   4226   -381    -35       P  
ATOM   4356  OP1  DA J  -7      20.651 136.790  -3.304  1.00119.11           O  
ANISOU 4356  OP1  DA J  -7    19293  10698  15265   4637   -478   -210       O  
ATOM   4357  OP2  DA J  -7      22.371 136.004  -5.029  1.00112.95           O  
ANISOU 4357  OP2  DA J  -7    18652   9799  14463   3971   -461    211       O  
ATOM   4358  O5'  DA J  -7      22.735 135.590  -2.610  1.00107.96           O  
ANISOU 4358  O5'  DA J  -7    17825   9452  13744   4012   -278   -196       O  
ATOM   4359  C5'  DA J  -7      22.420 134.793  -1.480  1.00 98.22           C  
ANISOU 4359  C5'  DA J  -7    16324   8583  12412   4080   -137   -361       C  
ATOM   4360  C4'  DA J  -7      23.633 134.015  -1.011  1.00 93.21           C  
ANISOU 4360  C4'  DA J  -7    15638   8064  11714   3723    -27   -359       C  
ATOM   4361  O4'  DA J  -7      23.903 132.915  -1.925  1.00 88.01           O  
ANISOU 4361  O4'  DA J  -7    14829   7602  11010   3478     36   -127       O  
ATOM   4362  C3'  DA J  -7      24.933 134.822  -0.939  1.00 96.44           C  
ANISOU 4362  C3'  DA J  -7    16347   8102  12194   3494   -100   -375       C  
ATOM   4363  O3'  DA J  -7      25.660 134.430   0.209  1.00 97.49           O  
ANISOU 4363  O3'  DA J  -7    16419   8357  12267   3349    -13   -530       O  
ATOM   4364  C2'  DA J  -7      25.655 134.391  -2.213  1.00 93.37           C  
ANISOU 4364  C2'  DA J  -7    15993   7661  11824   3186   -100    -99       C  
ATOM   4365  C1'  DA J  -7      25.275 132.925  -2.234  1.00 89.11           C  
ANISOU 4365  C1'  DA J  -7    15120   7565  11173   3135     39    -33       C  
ATOM   4366  N9   DA J  -7      25.490 132.256  -3.514  1.00 93.31           N  
ANISOU 4366  N9   DA J  -7    15609   8157  11687   2944     54    225       N  
ATOM   4367  C8   DA J  -7      25.175 132.720  -4.759  1.00 95.84           C  
ANISOU 4367  C8   DA J  -7    16069   8290  12055   2983    -45    407       C  
ATOM   4368  N7   DA J  -7      25.486 131.889  -5.728  1.00 96.00           N  
ANISOU 4368  N7   DA J  -7    16021   8431  12023   2780      1    614       N  
ATOM   4369  C5   DA J  -7      26.047 130.806  -5.068  1.00 92.04           C  
ANISOU 4369  C5   DA J  -7    15319   8208  11443   2602    135    562       C  
ATOM   4370  C6   DA J  -7      26.584 129.585  -5.525  1.00 90.34           C  
ANISOU 4370  C6   DA J  -7    14959   8221  11145   2363    232    695       C  
ATOM   4371  N6   DA J  -7      26.641 129.241  -6.816  1.00 89.01           N  
ANISOU 4371  N6   DA J  -7    14829   8042  10947   2260    218    913       N  
ATOM   4372  N1   DA J  -7      27.062 128.727  -4.598  1.00 92.08           N  
ANISOU 4372  N1   DA J  -7    15004   8676  11306   2241    338    591       N  
ATOM   4373  C2   DA J  -7      27.000 129.072  -3.309  1.00 90.19           C  
ANISOU 4373  C2   DA J  -7    14739   8449  11078   2344    351    373       C  
ATOM   4374  N3   DA J  -7      26.520 130.185  -2.762  1.00 90.68           N  
ANISOU 4374  N3   DA J  -7    14930   8319  11204   2569    275    224       N  
ATOM   4375  C4   DA J  -7      26.056 131.018  -3.704  1.00 92.39           C  
ANISOU 4375  C4   DA J  -7    15317   8297  11490   2693    166    329       C  
ATOM   4376  P    DG J  -6      25.785 135.404   1.479  1.00 95.82           P  
ANISOU 4376  P    DG J  -6    16388   7949  12069   3506    -70   -813       P  
ATOM   4377  OP1  DG J  -6      24.426 135.869   1.834  1.00 98.76           O  
ANISOU 4377  OP1  DG J  -6    16718   8378  12430   3933    -92   -962       O  
ATOM   4378  OP2  DG J  -6      26.846 136.390   1.177  1.00 97.12           O  
ANISOU 4378  OP2  DG J  -6    16879   7681  12343   3309   -202   -774       O  
ATOM   4379  O5'  DG J  -6      26.320 134.439   2.637  1.00 96.27           O  
ANISOU 4379  O5'  DG J  -6    16254   8314  12012   3346     67   -937       O  
ATOM   4380  C5'  DG J  -6      25.708 133.166   2.843  1.00 91.94           C  
ANISOU 4380  C5'  DG J  -6    15370   8213  11349   3373    210   -909       C  
ATOM   4381  C4'  DG J  -6      26.707 132.150   3.378  1.00 88.59           C  
ANISOU 4381  C4'  DG J  -6    14818   7990  10852   3056    308   -899       C  
ATOM   4382  O4'  DG J  -6      27.204 131.327   2.293  1.00 89.03           O  
ANISOU 4382  O4'  DG J  -6    14782   8124  10922   2795    341   -648       O  
ATOM   4383  C3'  DG J  -6      27.939 132.735   4.043  1.00 90.46           C  
ANISOU 4383  C3'  DG J  -6    15270   7974  11127   2860    249  -1009       C  
ATOM   4384  O3'  DG J  -6      28.392 131.856   5.073  1.00 86.86           O  
ANISOU 4384  O3'  DG J  -6    14656   7782  10566   2723    345  -1108       O  
ATOM   4385  C2'  DG J  -6      28.936 132.831   2.885  1.00 88.35           C  
ANISOU 4385  C2'  DG J  -6    15120   7486  10961   2561    196   -779       C  
ATOM   4386  C1'  DG J  -6      28.559 131.638   2.010  1.00 91.40           C  
ANISOU 4386  C1'  DG J  -6    15259   8175  11295   2495    294   -575       C  
ATOM   4387  N9   DG J  -6      28.657 131.926   0.583  1.00 99.40           N  
ANISOU 4387  N9   DG J  -6    16378   9001  12387   2418    236   -348       N  
ATOM   4388  C8   DG J  -6      28.203 133.054  -0.050  1.00103.51           C  
ANISOU 4388  C8   DG J  -6    17115   9219  12997   2584    116   -314       C  
ATOM   4389  N7   DG J  -6      28.413 133.052  -1.332  1.00100.77           N  
ANISOU 4389  N7   DG J  -6    16830   8766  12691   2458     87    -85       N  
ATOM   4390  C5   DG J  -6      29.039 131.841  -1.574  1.00 99.06           C  
ANISOU 4390  C5   DG J  -6    16425   8803  12408   2204    202     33       C  
ATOM   4391  C6   DG J  -6      29.499 131.294  -2.788  1.00 97.94           C  
ANISOU 4391  C6   DG J  -6    16261   8692  12259   1996    236    274       C  
ATOM   4392  O6   DG J  -6      29.436 131.791  -3.919  1.00 97.10           O  
ANISOU 4392  O6   DG J  -6    16303   8393  12199   1982    171    443       O  
ATOM   4393  N1   DG J  -6      30.080 130.045  -2.605  1.00 98.17           N  
ANISOU 4393  N1   DG J  -6    16082   9006  12212   1794    355    309       N  
ATOM   4394  C2   DG J  -6      30.201 129.401  -1.396  1.00100.38           C  
ANISOU 4394  C2   DG J  -6    16198   9512  12432   1782    424    144       C  
ATOM   4395  N2   DG J  -6      30.795 128.197  -1.423  1.00 98.34           N  
ANISOU 4395  N2   DG J  -6    15760   9497  12107   1577    521    212       N  
ATOM   4396  N3   DG J  -6      29.771 129.906  -0.240  1.00104.01           N  
ANISOU 4396  N3   DG J  -6    16678   9953  12888   1965    397    -76       N  
ATOM   4397  C4   DG J  -6      29.200 131.128  -0.407  1.00100.44           C  
ANISOU 4397  C4   DG J  -6    16426   9227  12509   2176    289   -124       C  
ATOM   4398  P    DC J  -5      29.864 132.024   5.695  1.00 87.89           P  
ANISOU 4398  P    DC J  -5    14927   7743  10725   2424    301  -1170       P  
ATOM   4399  OP1  DC J  -5      29.897 131.362   7.011  1.00 90.66           O  
ANISOU 4399  OP1  DC J  -5    15141   8362  10946   2424    380  -1344       O  
ATOM   4400  OP2  DC J  -5      30.257 133.446   5.593  1.00 95.63           O  
ANISOU 4400  OP2  DC J  -5    16233   8280  11822   2450    150  -1230       O  
ATOM   4401  O5'  DC J  -5      30.786 131.186   4.704  1.00 89.88           O  
ANISOU 4401  O5'  DC J  -5    15077   8053  11018   2082    342   -916       O  
ATOM   4402  C5'  DC J  -5      30.652 129.773   4.618  1.00 89.65           C  
ANISOU 4402  C5'  DC J  -5    14766   8400  10895   1991    463   -822       C  
ATOM   4403  C4'  DC J  -5      31.864 129.165   3.934  1.00 89.54           C  
ANISOU 4403  C4'  DC J  -5    14716   8376  10927   1646    484   -637       C  
ATOM   4404  O4'  DC J  -5      31.920 129.622   2.556  1.00 94.40           O  
ANISOU 4404  O4'  DC J  -5    15444   8789  11636   1604    442   -439       O  
ATOM   4405  C3'  DC J  -5      33.206 129.560   4.541  1.00 91.43           C  
ANISOU 4405  C3'  DC J  -5    15085   8427  11225   1405    428   -706       C  
ATOM   4406  O3'  DC J  -5      34.159 128.547   4.285  1.00 91.03           O  
ANISOU 4406  O3'  DC J  -5    14885   8533  11168   1123    492   -579       O  
ATOM   4407  C2'  DC J  -5      33.538 130.818   3.756  1.00 95.01           C  
ANISOU 4407  C2'  DC J  -5    15800   8484  11814   1375    317   -629       C  
ATOM   4408  C1'  DC J  -5      33.088 130.401   2.367  1.00 96.36           C  
ANISOU 4408  C1'  DC J  -5    15892   8728  11992   1387    366   -401       C  
ATOM   4409  N1   DC J  -5      32.765 131.539   1.464  1.00 96.28           N  
ANISOU 4409  N1   DC J  -5    16107   8398  12076   1485    267   -315       N  
ATOM   4410  C2   DC J  -5      32.943 131.387   0.090  1.00 95.24           C  
ANISOU 4410  C2   DC J  -5    15986   8222  11980   1367    283    -72       C  
ATOM   4411  O2   DC J  -5      33.363 130.306  -0.335  1.00 88.69           O  
ANISOU 4411  O2   DC J  -5    14977   7622  11100   1197    383     54       O  
ATOM   4412  N3   DC J  -5      32.649 132.424  -0.732  1.00102.63           N  
ANISOU 4412  N3   DC J  -5    17138   8862  12994   1449    184     16       N  
ATOM   4413  C4   DC J  -5      32.198 133.571  -0.222  1.00105.40           C  
ANISOU 4413  C4   DC J  -5    17691   8958  13399   1649     66   -135       C  
ATOM   4414  N4   DC J  -5      31.921 134.569  -1.070  1.00111.04           N  
ANISOU 4414  N4   DC J  -5    18627   9369  14194   1725    -45    -36       N  
ATOM   4415  C5   DC J  -5      32.012 133.747   1.183  1.00103.78           C  
ANISOU 4415  C5   DC J  -5    17481   8792  13159   1785     52   -396       C  
ATOM   4416  C6   DC J  -5      32.307 132.715   1.981  1.00100.37           C  
ANISOU 4416  C6   DC J  -5    16833   8665  12639   1692    157   -474       C  
ATOM   4417  P    DT J  -4      34.568 127.499   5.430  1.00 83.91           P  
ANISOU 4417  P    DT J  -4    13802   7913  10167   1018    550   -688       P  
ATOM   4418  OP1  DT J  -4      33.323 126.998   6.054  1.00 79.06           O  
ANISOU 4418  OP1  DT J  -4    13050   7568   9422   1265    609   -796       O  
ATOM   4419  OP2  DT J  -4      35.609 128.130   6.271  1.00 81.13           O  
ANISOU 4419  OP2  DT J  -4    13593   7362   9871    865    466   -811       O  
ATOM   4420  O5'  DT J  -4      35.244 126.309   4.607  1.00 78.59           O  
ANISOU 4420  O5'  DT J  -4    12948   7421   9491    785    627   -483       O  
ATOM   4421  C5'  DT J  -4      34.556 125.741   3.501  1.00 76.19           C  
ANISOU 4421  C5'  DT J  -4    12546   7246   9159    857    685   -317       C  
ATOM   4422  C4'  DT J  -4      35.438 125.722   2.265  1.00 75.49           C  
ANISOU 4422  C4'  DT J  -4    12497   7035   9152    648    696   -109       C  
ATOM   4423  O4'  DT J  -4      35.301 126.969   1.535  1.00 80.74           O  
ANISOU 4423  O4'  DT J  -4    13379   7387   9910    706    627    -50       O  
ATOM   4424  C3'  DT J  -4      36.932 125.536   2.535  1.00 74.70           C  
ANISOU 4424  C3'  DT J  -4    12383   6889   9111    359    696    -93       C  
ATOM   4425  O3'  DT J  -4      37.418 124.465   1.746  1.00 68.59           O  
ANISOU 4425  O3'  DT J  -4    11458   6291   8312    213    777     70       O  
ATOM   4426  C2'  DT J  -4      37.552 126.878   2.120  1.00 80.47           C  
ANISOU 4426  C2'  DT J  -4    13343   7259   9974    269    616    -52       C  
ATOM   4427  C1'  DT J  -4      36.566 127.379   1.077  1.00 80.37           C  
ANISOU 4427  C1'  DT J  -4    13428   7146   9964    451    607     52       C  
ATOM   4428  N1   DT J  -4      36.551 128.869   0.931  1.00 83.77           N  
ANISOU 4428  N1   DT J  -4    14121   7211  10496    499    496     31       N  
ATOM   4429  C2   DT J  -4      36.447 129.427  -0.325  1.00 87.98           C  
ANISOU 4429  C2   DT J  -4    14782   7564  11083    490    476    210       C  
ATOM   4430  O2   DT J  -4      36.368 128.768  -1.344  1.00 90.34           O  
ANISOU 4430  O2   DT J  -4    14991   7992  11341    449    550    383       O  
ATOM   4431  N3   DT J  -4      36.437 130.799  -0.340  1.00 88.98           N  
ANISOU 4431  N3   DT J  -4    15163   7342  11304    532    355    178       N  
ATOM   4432  C4   DT J  -4      36.516 131.648   0.748  1.00 92.70           C  
ANISOU 4432  C4   DT J  -4    15776   7626  11820    590    251    -20       C  
ATOM   4433  O4   DT J  -4      36.501 132.867   0.633  1.00 96.96           O  
ANISOU 4433  O4   DT J  -4    16561   7833  12446    627    130    -36       O  
ATOM   4434  C5   DT J  -4      36.623 131.000   2.031  1.00 94.09           C  
ANISOU 4434  C5   DT J  -4    15810   8015  11927    601    285   -209       C  
ATOM   4435  C7   DT J  -4      36.725 131.823   3.283  1.00101.00           C  
ANISOU 4435  C7   DT J  -4    16838   8712  12824    665    177   -440       C  
ATOM   4436  C6   DT J  -4      36.633 129.658   2.061  1.00 87.96           C  
ANISOU 4436  C6   DT J  -4    14777   7583  11059    552    405   -169       C  
ATOM   4437  P    DG J  -3      38.837 123.782   2.061  1.00 67.38           P  
ANISOU 4437  P    DG J  -3    11193   6220   8189    -57    804     90       P  
ATOM   4438  OP1  DG J  -3      38.585 122.364   2.400  1.00 68.02           O  
ANISOU 4438  OP1  DG J  -3    11065   6621   8158    -38    861     75       O  
ATOM   4439  OP2  DG J  -3      39.587 124.646   2.999  1.00 75.75           O  
ANISOU 4439  OP2  DG J  -3    12363   7086   9332   -158    720    -38       O  
ATOM   4440  O5'  DG J  -3      39.573 123.827   0.649  1.00 71.95           O  
ANISOU 4440  O5'  DG J  -3    11796   6710   8832   -215    855    310       O  
ATOM   4441  C5'  DG J  -3      38.840 123.512  -0.524  1.00 73.83           C  
ANISOU 4441  C5'  DG J  -3    12030   7009   9014   -111    905    453       C  
ATOM   4442  C4'  DG J  -3      39.458 124.173  -1.737  1.00 77.18           C  
ANISOU 4442  C4'  DG J  -3    12577   7236   9513   -238    924    634       C  
ATOM   4443  O4'  DG J  -3      39.267 125.609  -1.661  1.00 83.59           O  
ANISOU 4443  O4'  DG J  -3    13605   7743  10411   -192    831    600       O  
ATOM   4444  C3'  DG J  -3      40.953 123.940  -1.902  1.00 79.30           C  
ANISOU 4444  C3'  DG J  -3    12777   7508   9847   -508    974    713       C  
ATOM   4445  O3'  DG J  -3      41.241 123.681  -3.263  1.00 84.49           O  
ANISOU 4445  O3'  DG J  -3    13434   8187  10482   -580   1058    913       O  
ATOM   4446  C2'  DG J  -3      41.582 125.250  -1.416  1.00 79.48           C  
ANISOU 4446  C2'  DG J  -3    12958   7243  10000   -620    884    663       C  
ATOM   4447  C1'  DG J  -3      40.507 126.279  -1.744  1.00 85.14           C  
ANISOU 4447  C1'  DG J  -3    13878   7750  10721   -429    812    658       C  
ATOM   4448  N9   DG J  -3      40.468 127.405  -0.810  1.00 88.59           N  
ANISOU 4448  N9   DG J  -3    14477   7948  11236   -395    689    507       N  
ATOM   4449  C8   DG J  -3      40.604 127.353   0.558  1.00 87.59           C  
ANISOU 4449  C8   DG J  -3    14313   7860  11110   -384    636    306       C  
ATOM   4450  N7   DG J  -3      40.512 128.519   1.136  1.00 88.07           N  
ANISOU 4450  N7   DG J  -3    14569   7657  11238   -340    517    194       N  
ATOM   4451  C5   DG J  -3      40.294 129.403   0.086  1.00 90.98           C  
ANISOU 4451  C5   DG J  -3    15115   7791  11663   -323    486    334       C  
ATOM   4452  C6   DG J  -3      40.116 130.809   0.097  1.00 92.44           C  
ANISOU 4452  C6   DG J  -3    15564   7624  11934   -274    355    302       C  
ATOM   4453  O6   DG J  -3      40.115 131.576   1.070  1.00 93.12           O  
ANISOU 4453  O6   DG J  -3    15788   7531  12062   -228    239    127       O  
ATOM   4454  N1   DG J  -3      39.926 131.314  -1.187  1.00 92.80           N  
ANISOU 4454  N1   DG J  -3    15732   7518  12010   -281    355    496       N  
ATOM   4455  C2   DG J  -3      39.909 130.556  -2.336  1.00 88.83           C  
ANISOU 4455  C2   DG J  -3    15113   7189  11450   -325    474    691       C  
ATOM   4456  N2   DG J  -3      39.709 131.213  -3.486  1.00 83.86           N  
ANISOU 4456  N2   DG J  -3    14643   6373  10846   -327    452    866       N  
ATOM   4457  N3   DG J  -3      40.075 129.240  -2.358  1.00 88.32           N  
ANISOU 4457  N3   DG J  -3    14806   7450  11301   -362    598    712       N  
ATOM   4458  C4   DG J  -3      40.263 128.733  -1.118  1.00 89.65           C  
ANISOU 4458  C4   DG J  -3    14849   7763  11449   -360    593    530       C  
ATOM   4459  P    DG J  -2      42.684 123.134  -3.705  1.00 80.13           P  
ANISOU 4459  P    DG J  -2    12759   7724   9965   -826   1153   1027       P  
ATOM   4460  OP1  DG J  -2      42.466 122.002  -4.635  1.00 72.25           O  
ANISOU 4460  OP1  DG J  -2    11660   6941   8849   -775   1251   1135       O  
ATOM   4461  OP2  DG J  -2      43.504 122.938  -2.487  1.00 84.47           O  
ANISOU 4461  OP2  DG J  -2    13196   8320  10578   -945   1117    893       O  
ATOM   4462  O5'  DG J  -2      43.286 124.359  -4.525  1.00 81.50           O  
ANISOU 4462  O5'  DG J  -2    13101   7632  10234   -973   1149   1177       O  
ATOM   4463  C5'  DG J  -2      42.410 125.199  -5.257  1.00 88.88           C  
ANISOU 4463  C5'  DG J  -2    14234   8382  11155   -851   1105   1252       C  
ATOM   4464  C4'  DG J  -2      43.112 126.471  -5.682  1.00 98.24           C  
ANISOU 4464  C4'  DG J  -2    15589   9282  12454  -1026   1068   1365       C  
ATOM   4465  O4'  DG J  -2      42.846 127.527  -4.720  1.00 99.19           O  
ANISOU 4465  O4'  DG J  -2    15855   9166  12667   -980    923   1221       O  
ATOM   4466  C3'  DG J  -2      44.631 126.369  -5.782  1.00101.30           C  
ANISOU 4466  C3'  DG J  -2    15868   9703  12919  -1312   1140   1457       C  
ATOM   4467  O3'  DG J  -2      45.071 127.139  -6.881  1.00108.03           O  
ANISOU 4467  O3'  DG J  -2    16851  10390  13804  -1454   1172   1663       O  
ATOM   4468  C2'  DG J  -2      45.092 126.974  -4.457  1.00 97.22           C  
ANISOU 4468  C2'  DG J  -2    15367   9052  12521  -1396   1022   1296       C  
ATOM   4469  C1'  DG J  -2      44.070 128.083  -4.295  1.00 98.46           C  
ANISOU 4469  C1'  DG J  -2    15768   8944  12698  -1229    890   1230       C  
ATOM   4470  N9   DG J  -2      43.909 128.564  -2.927  1.00 97.80           N  
ANISOU 4470  N9   DG J  -2    15739   8750  12671  -1173    761   1013       N  
ATOM   4471  C8   DG J  -2      43.906 127.818  -1.773  1.00 96.09           C  
ANISOU 4471  C8   DG J  -2    15371   8717  12421  -1121    753    830       C  
ATOM   4472  N7   DG J  -2      43.730 128.533  -0.695  1.00 94.40           N  
ANISOU 4472  N7   DG J  -2    15271   8341  12254  -1070    625    654       N  
ATOM   4473  C5   DG J  -2      43.600 129.834  -1.168  1.00 98.97           C  
ANISOU 4473  C5   DG J  -2    16096   8597  12912  -1083    534    721       C  
ATOM   4474  C6   DG J  -2      43.388 131.047  -0.467  1.00102.72           C  
ANISOU 4474  C6   DG J  -2    16800   8769  13461  -1033    372    592       C  
ATOM   4475  O6   DG J  -2      43.268 131.219   0.753  1.00102.13           O  
ANISOU 4475  O6   DG J  -2    16756   8661  13387   -963    283    381       O  
ATOM   4476  N1   DG J  -2      43.319 132.137  -1.333  1.00111.50           N  
ANISOU 4476  N1   DG J  -2    18135   9589  14642  -1070    308    731       N  
ATOM   4477  C2   DG J  -2      43.439 132.062  -2.701  1.00115.72           C  
ANISOU 4477  C2   DG J  -2    18668  10135  15164  -1151    397    970       C  
ATOM   4478  N2   DG J  -2      43.347 133.215  -3.380  1.00122.34           N  
ANISOU 4478  N2   DG J  -2    19752  10661  16069  -1186    307   1087       N  
ATOM   4479  N3   DG J  -2      43.637 130.934  -3.365  1.00111.73           N  
ANISOU 4479  N3   DG J  -2    17952   9922  14579  -1193    558   1086       N  
ATOM   4480  C4   DG J  -2      43.706 129.865  -2.538  1.00102.46           C  
ANISOU 4480  C4   DG J  -2    16560   9021  13347  -1152    615    948       C  
ATOM   4481  P    DA J  -1      46.489 126.849  -7.574  1.00111.20           P  
ANISOU 4481  P    DA J  -1    17120  10895  14235  -1725   1311   1841       P  
ATOM   4482  OP1  DA J  -1      46.224 126.157  -8.856  1.00110.18           O  
ANISOU 4482  OP1  DA J  -1    16970  10927  13965  -1660   1446   1992       O  
ATOM   4483  OP2  DA J  -1      47.381 126.223  -6.573  1.00102.77           O  
ANISOU 4483  OP2  DA J  -1    15835   9982  13232  -1837   1323   1724       O  
ATOM   4484  O5'  DA J  -1      47.039 128.315  -7.885  1.00116.28           O  
ANISOU 4484  O5'  DA J  -1    17957  11219  15003  -1929   1238   1972       O  
ATOM   4485  C5'  DA J  -1      46.139 129.317  -8.341  1.00116.33           C  
ANISOU 4485  C5'  DA J  -1    18231  10965  15004  -1820   1136   2020       C  
ATOM   4486  C4'  DA J  -1      46.527 130.678  -7.795  1.00117.96           C  
ANISOU 4486  C4'  DA J  -1    18616  10838  15365  -1965    980   2004       C  
ATOM   4487  O4'  DA J  -1      46.102 130.794  -6.416  1.00115.38           O  
ANISOU 4487  O4'  DA J  -1    18299  10454  15088  -1834    848   1752       O  
ATOM   4488  C3'  DA J  -1      48.028 130.972  -7.811  1.00119.78           C  
ANISOU 4488  C3'  DA J  -1    18756  11043  15711  -2309   1019   2126       C  
ATOM   4489  O3'  DA J  -1      48.275 132.166  -8.538  1.00120.09           O  
ANISOU 4489  O3'  DA J  -1    19014  10800  15816  -2472    960   2314       O  
ATOM   4490  C2'  DA J  -1      48.405 131.115  -6.329  1.00119.86           C  
ANISOU 4490  C2'  DA J  -1    18708  10999  15834  -2354    894   1915       C  
ATOM   4491  C1'  DA J  -1      47.079 131.497  -5.692  1.00117.35           C  
ANISOU 4491  C1'  DA J  -1    18571  10535  15483  -2063    753   1721       C  
ATOM   4492  N9   DA J  -1      46.971 131.116  -4.285  1.00113.46           N  
ANISOU 4492  N9   DA J  -1    17984  10119  15005  -1971    681   1470       N  
ATOM   4493  C8   DA J  -1      47.025 129.851  -3.768  1.00109.93           C  
ANISOU 4493  C8   DA J  -1    17293   9989  14487  -1902    772   1363       C  
ATOM   4494  N7   DA J  -1      46.896 129.806  -2.463  1.00108.14           N  
ANISOU 4494  N7   DA J  -1    17047   9760  14282  -1834    672   1143       N  
ATOM   4495  C5   DA J  -1      46.742 131.133  -2.097  1.00109.93           C  
ANISOU 4495  C5   DA J  -1    17527   9644  14599  -1848    506   1092       C  
ATOM   4496  C6   DA J  -1      46.559 131.759  -0.847  1.00106.97           C  
ANISOU 4496  C6   DA J  -1    17278   9095  14272  -1789    342    877       C  
ATOM   4497  N6   DA J  -1      46.497 131.091   0.310  1.00105.36           N  
ANISOU 4497  N6   DA J  -1    16948   9060  14024  -1710    326    676       N  
ATOM   4498  N1   DA J  -1      46.438 133.102  -0.833  1.00108.15           N  
ANISOU 4498  N1   DA J  -1    17703   8881  14507  -1811    187    876       N  
ATOM   4499  C2   DA J  -1      46.499 133.768  -1.992  1.00111.43           C  
ANISOU 4499  C2   DA J  -1    18255   9122  14962  -1899    195   1089       C  
ATOM   4500  N3   DA J  -1      46.669 133.292  -3.226  1.00112.56           N  
ANISOU 4500  N3   DA J  -1    18299   9411  15058  -1970    348   1311       N  
ATOM   4501  C4   DA J  -1      46.785 131.954  -3.208  1.00112.44           C  
ANISOU 4501  C4   DA J  -1    18011   9757  14955  -1933    503   1293       C  
ATOM   4502  P    DT J   0      49.778 132.591  -8.906  1.00114.09           P  
ANISOU 4502  P    DT J   0    18178  10006  15164  -2857   1017   2518       P  
ATOM   4503  OP1  DT J   0      49.735 133.326 -10.190  1.00115.49           O  
ANISOU 4503  OP1  DT J   0    18500  10064  15315  -2927   1037   2754       O  
ATOM   4504  OP2  DT J   0      50.633 131.391  -8.773  1.00109.71           O  
ANISOU 4504  OP2  DT J   0    17294   9805  14586  -2939   1184   2508       O  
ATOM   4505  O5'  DT J   0      50.174 133.611  -7.743  1.00110.95           O  
ANISOU 4505  O5'  DT J   0    17894   9318  14944  -2992    801   2398       O  
ATOM   4506  C5'  DT J   0      49.330 134.717  -7.461  1.00112.28           C  
ANISOU 4506  C5'  DT J   0    18374   9134  15153  -2868    600   2321       C  
ATOM   4507  C4'  DT J   0      49.806 135.457  -6.227  1.00116.55           C  
ANISOU 4507  C4'  DT J   0    18988   9449  15846  -2989    405   2171       C  
ATOM   4508  O4'  DT J   0      49.387 134.750  -5.041  1.00116.10           O  
ANISOU 4508  O4'  DT J   0    18812   9545  15755  -2784    378   1895       O  
ATOM   4509  C3'  DT J   0      51.327 135.613  -6.116  1.00121.16           C  
ANISOU 4509  C3'  DT J   0    19397  10075  16564  -3357    421   2291       C  
ATOM   4510  O3'  DT J   0      51.673 136.988  -6.188  1.00127.71           O  
ANISOU 4510  O3'  DT J   0    20365  10631  17530  -3485    252   2355       O  
ATOM   4511  C2'  DT J   0      51.680 135.005  -4.747  1.00120.56           C  
ANISOU 4511  C2'  DT J   0    19161  10117  16531  -3356    373   2062       C  
ATOM   4512  C1'  DT J   0      50.334 134.978  -4.035  1.00119.12           C  
ANISOU 4512  C1'  DT J   0    19127   9867  16264  -2992    276   1807       C  
ATOM   4513  N1   DT J   0      50.213 133.896  -3.015  1.00117.58           N  
ANISOU 4513  N1   DT J   0    18716   9945  16012  -2845    317   1584       N  
ATOM   4514  C2   DT J   0      50.005 134.235  -1.698  1.00121.88           C  
ANISOU 4514  C2   DT J   0    19353  10358  16597  -2766    146   1341       C  
ATOM   4515  O2   DT J   0      49.914 135.386  -1.311  1.00125.97           O  
ANISOU 4515  O2   DT J   0    20128  10537  17198  -2799    -43   1288       O  
ATOM   4516  N3   DT J   0      49.905 133.171  -0.841  1.00121.39           N  
ANISOU 4516  N3   DT J   0    19086  10571  16466  -2643    198   1161       N  
ATOM   4517  C4   DT J   0      49.990 131.829  -1.162  1.00121.53           C  
ANISOU 4517  C4   DT J   0    18827  10960  16390  -2592    386   1198       C  
ATOM   4518  O4   DT J   0      49.887 130.944  -0.318  1.00122.09           O  
ANISOU 4518  O4   DT J   0    18741  11244  16404  -2489    405   1033       O  
ATOM   4519  C5   DT J   0      50.209 131.542  -2.562  1.00119.46           C  
ANISOU 4519  C5   DT J   0    18487  10809  16092  -2667    554   1443       C  
ATOM   4520  C7   DT J   0      50.322 130.121  -3.031  1.00117.33           C  
ANISOU 4520  C7   DT J   0    17945  10919  15717  -2608    754   1492       C  
ATOM   4521  C6   DT J   0      50.307 132.577  -3.411  1.00116.37           C  
ANISOU 4521  C6   DT J   0    18291  10166  15758  -2789    518   1623       C  
ATOM   4522  P    DT J   1      53.202 137.434  -6.395  1.00127.98           P  
ANISOU 4522  P    DT J   1    20196  10715  17715  -3838    268   2526       P  
ATOM   4523  OP1  DT J   1      53.217 138.571  -7.343  1.00127.08           O  
ANISOU 4523  OP1  DT J   1    20225  10417  17644  -3903    219   2708       O  
ATOM   4524  OP2  DT J   1      53.995 136.217  -6.686  1.00127.30           O  
ANISOU 4524  OP2  DT J   1    19777  11003  17588  -3950    494   2614       O  
ATOM   4525  O5'  DT J   1      53.636 137.957  -4.951  1.00121.22           O  
ANISOU 4525  O5'  DT J   1    19393   9667  16998  -3935     49   2327       O  
ATOM   4526  C5'  DT J   1      52.675 138.571  -4.106  1.00118.16           C  
ANISOU 4526  C5'  DT J   1    19297   8993  16604  -3727   -158   2105       C  
ATOM   4527  C4'  DT J   1      53.148 138.564  -2.666  1.00124.13           C  
ANISOU 4527  C4'  DT J   1    20028   9691  17444  -3801   -308   1892       C  
ATOM   4528  O4'  DT J   1      52.715 137.349  -2.013  1.00123.97           O  
ANISOU 4528  O4'  DT J   1    19924   9861  17316  -3655   -225   1726       O  
ATOM   4529  C3'  DT J   1      54.668 138.627  -2.490  1.00131.40           C  
ANISOU 4529  C3'  DT J   1    20697  10719  18510  -4141   -304   1998       C  
ATOM   4530  O3'  DT J   1      55.017 139.796  -1.767  1.00139.60           O  
ANISOU 4530  O3'  DT J   1    21894  11473  19675  -4241   -543   1913       O  
ATOM   4531  C2'  DT J   1      55.020 137.345  -1.714  1.00129.32           C  
ANISOU 4531  C2'  DT J   1    20198  10723  18213  -4158   -221   1879       C  
ATOM   4532  C1'  DT J   1      53.690 136.971  -1.079  1.00126.71           C  
ANISOU 4532  C1'  DT J   1    20081  10315  17748  -3844   -269   1644       C  
ATOM   4533  N1   DT J   1      53.538 135.507  -0.800  1.00126.62           N  
ANISOU 4533  N1   DT J   1    19815  10671  17622  -3707    -98   1547       N  
ATOM   4534  C2   DT J   1      53.242 135.093   0.479  1.00126.35           C  
ANISOU 4534  C2   DT J   1    19753  10701  17552  -3548   -185   1276       C  
ATOM   4535  O2   DT J   1      53.102 135.861   1.413  1.00129.88           O  
ANISOU 4535  O2   DT J   1    20410  10889  18049  -3534   -395   1109       O  
ATOM   4536  N3   DT J   1      53.116 133.737   0.629  1.00122.39           N  
ANISOU 4536  N3   DT J   1    18981  10576  16944  -3406    -21   1205       N  
ATOM   4537  C4   DT J   1      53.253 132.772  -0.353  1.00122.23           C  
ANISOU 4537  C4   DT J   1    18729  10859  16853  -3395    210   1364       C  
ATOM   4538  O4   DT J   1      53.121 131.575  -0.119  1.00122.34           O  
ANISOU 4538  O4   DT J   1    18526  11182  16775  -3261    326   1282       O  
ATOM   4539  C5   DT J   1      53.562 133.273  -1.673  1.00123.02           C  
ANISOU 4539  C5   DT J   1    18875  10880  16986  -3553    298   1635       C  
ATOM   4540  C7   DT J   1      53.735 132.321  -2.820  1.00121.13           C  
ANISOU 4540  C7   DT J   1    18416  10950  16657  -3545    549   1815       C  
ATOM   4541  C6   DT J   1      53.687 134.600  -1.831  1.00125.79           C  
ANISOU 4541  C6   DT J   1    19482  10872  17440  -3705    144   1719       C  
ATOM   4542  P    DC J   2      56.559 140.206  -1.581  1.00137.02           P  
ANISOU 4542  P    DC J   2    21364  11180  19517  -4596   -590   2026       P  
ATOM   4543  OP1  DC J   2      56.630 141.685  -1.582  1.00142.62           O  
ANISOU 4543  OP1  DC J   2    22316  11554  20318  -4671   -793   2050       O  
ATOM   4544  OP2  DC J   2      57.361 139.430  -2.553  1.00135.80           O  
ANISOU 4544  OP2  DC J   2    20886  11350  19362  -4758   -338   2261       O  
ATOM   4545  O5'  DC J   2      56.906 139.678  -0.114  1.00136.56           O  
ANISOU 4545  O5'  DC J   2    21218  11177  19491  -4613   -702   1790       O  
ATOM   4546  C5'  DC J   2      56.032 139.980   0.962  1.00137.54           C  
ANISOU 4546  C5'  DC J   2    21607  11086  19565  -4396   -892   1514       C  
ATOM   4547  C4'  DC J   2      56.428 139.214   2.208  1.00136.61           C  
ANISOU 4547  C4'  DC J   2    21351  11104  19452  -4422   -946   1319       C  
ATOM   4548  O4'  DC J   2      55.969 137.840   2.108  1.00135.76           O  
ANISOU 4548  O4'  DC J   2    21095  11269  19217  -4287   -758   1286       O  
ATOM   4549  C3'  DC J   2      57.935 139.145   2.466  1.00135.15           C  
ANISOU 4549  C3'  DC J   2    20883  11053  19412  -4745   -964   1417       C  
ATOM   4550  O3'  DC J   2      58.200 139.456   3.822  1.00131.77           O  
ANISOU 4550  O3'  DC J   2    20534  10501  19029  -4768  -1186   1198       O  
ATOM   4551  C2'  DC J   2      58.285 137.692   2.142  1.00133.69           C  
ANISOU 4551  C2'  DC J   2    20364  11252  19181  -4777   -732   1496       C  
ATOM   4552  C1'  DC J   2      57.000 136.983   2.528  1.00132.97           C  
ANISOU 4552  C1'  DC J   2    20427  11177  18920  -4475   -701   1303       C  
ATOM   4553  N1   DC J   2      56.815 135.652   1.871  1.00130.87           N  
ANISOU 4553  N1   DC J   2    19948  11231  18547  -4413   -448   1393       N  
ATOM   4554  C2   DC J   2      56.406 134.560   2.640  1.00128.69           C  
ANISOU 4554  C2   DC J   2    19563  11173  18160  -4224   -402   1196       C  
ATOM   4555  O2   DC J   2      56.210 134.726   3.848  1.00130.48           O  
ANISOU 4555  O2   DC J   2    19903  11293  18379  -4149   -576    964       O  
ATOM   4556  N3   DC J   2      56.237 133.356   2.037  1.00125.24           N  
ANISOU 4556  N3   DC J   2    18873  11096  17615  -4090   -162   1253       N  
ATOM   4557  C4   DC J   2      56.462 133.228   0.727  1.00124.67           C  
ANISOU 4557  C4   DC J   2    18703  11127  17539  -4171     22   1499       C  
ATOM   4558  N4   DC J   2      56.285 132.022   0.174  1.00120.93           N  
ANISOU 4558  N4   DC J   2    17999  10998  16950  -4025    244   1536       N  
ATOM   4559  C5   DC J   2      56.879 134.332  -0.074  1.00128.53           C  
ANISOU 4559  C5   DC J   2    19337  11365  18132  -4409    -21   1720       C  
ATOM   4560  C6   DC J   2      57.042 135.513   0.533  1.00131.94           C  
ANISOU 4560  C6   DC J   2    19950  11505  18674  -4478   -249   1645       C  
ATOM   4561  P    DC J   3      59.539 140.243   4.229  1.00143.47           P  
ANISOU 4561  P    DC J   3    21924  11902  20684  -5075  -1344   1261       P  
ATOM   4562  OP1  DC J   3      59.160 141.613   4.644  1.00144.08           O  
ANISOU 4562  OP1  DC J   3    22350  11608  20784  -5024  -1582   1157       O  
ATOM   4563  OP2  DC J   3      60.526 140.048   3.143  1.00142.08           O  
ANISOU 4563  OP2  DC J   3    21456  11928  20599  -5316  -1162   1552       O  
ATOM   4564  O5'  DC J   3      60.056 139.446   5.509  1.00139.37           O  
ANISOU 4564  O5'  DC J   3    21239  11543  20173  -5111  -1421   1075       O  
ATOM   4565  C5'  DC J   3      59.118 138.915   6.435  1.00134.66           C  
ANISOU 4565  C5'  DC J   3    20788  10937  19441  -4856  -1476    810       C  
ATOM   4566  C4'  DC J   3      59.677 137.677   7.105  1.00131.81           C  
ANISOU 4566  C4'  DC J   3    20141  10870  19069  -4912  -1424    740       C  
ATOM   4567  O4'  DC J   3      59.277 136.490   6.361  1.00130.20           O  
ANISOU 4567  O4'  DC J   3    19762  10933  18774  -4819  -1176    830       O  
ATOM   4568  C3'  DC J   3      61.203 137.628   7.184  1.00133.53           C  
ANISOU 4568  C3'  DC J   3    20051  11232  19452  -5221  -1446    876       C  
ATOM   4569  O3'  DC J   3      61.595 137.053   8.417  1.00137.03           O  
ANISOU 4569  O3'  DC J   3    20397  11780  19890  -5234  -1563    694       O  
ATOM   4570  C2'  DC J   3      61.561 136.717   6.012  1.00131.66           C  
ANISOU 4570  C2'  DC J   3    19501  11299  19227  -5292  -1168   1111       C  
ATOM   4571  C1'  DC J   3      60.423 135.717   6.092  1.00127.28           C  
ANISOU 4571  C1'  DC J   3    19008  10855  18495  -5028  -1057    983       C  
ATOM   4572  N1   DC J   3      60.200 134.929   4.838  1.00121.29           N  
ANISOU 4572  N1   DC J   3    18085  10323  17676  -4988   -781   1175       N  
ATOM   4573  C2   DC J   3      59.716 133.623   4.933  1.00114.01           C  
ANISOU 4573  C2   DC J   3    17052   9640  16627  -4847   -646   1106       C  
ATOM   4574  O2   DC J   3      59.478 133.159   6.052  1.00110.70           O  
ANISOU 4574  O2   DC J   3    16664   9247  16149  -4752   -754    886       O  
ATOM   4575  N3   DC J   3      59.517 132.909   3.796  1.00112.68           N  
ANISOU 4575  N3   DC J   3    16738   9688  16386  -4793   -394   1272       N  
ATOM   4576  C4   DC J   3      59.787 133.457   2.609  1.00115.51           C  
ANISOU 4576  C4   DC J   3    17072  10020  16796  -4889   -282   1505       C  
ATOM   4577  N4   DC J   3      59.577 132.717   1.513  1.00115.32           N  
ANISOU 4577  N4   DC J   3    16920  10216  16682  -4828    -34   1659       N  
ATOM   4578  C5   DC J   3      60.286 134.789   2.494  1.00119.20           C  
ANISOU 4578  C5   DC J   3    17649  10247  17396  -5041   -416   1584       C  
ATOM   4579  C6   DC J   3      60.478 135.481   3.623  1.00121.56           C  
ANISOU 4579  C6   DC J   3    18085  10335  17766  -5089   -665   1415       C  
ATOM   4580  P    DA J   4      61.981 137.978   9.673  1.00136.08           P  
ANISOU 4580  P    DA J   4    20459  11427  19818  -5299  -1860    515       P  
ATOM   4581  OP1  DA J   4      60.942 139.023   9.802  1.00138.22           O  
ANISOU 4581  OP1  DA J   4    21138  11369  20012  -5112  -1981    388       O  
ATOM   4582  OP2  DA J   4      63.400 138.372   9.534  1.00138.42           O  
ANISOU 4582  OP2  DA J   4    20531  11766  20295  -5609  -1912    686       O  
ATOM   4583  O5'  DA J   4      61.863 136.978  10.916  1.00127.65           O  
ANISOU 4583  O5'  DA J   4    19326  10522  18653  -5187  -1921    281       O  
ATOM   4584  C5'  DA J   4      60.590 136.467  11.288  1.00121.96           C  
ANISOU 4584  C5'  DA J   4    18795   9799  17747  -4898  -1885     85       C  
ATOM   4585  C4'  DA J   4      60.656 134.982  11.618  1.00119.02           C  
ANISOU 4585  C4'  DA J   4    18172   9748  17302  -4857  -1773     35       C  
ATOM   4586  O4'  DA J   4      60.689 134.193  10.400  1.00119.30           O  
ANISOU 4586  O4'  DA J   4    17973  10004  17351  -4889  -1520    251       O  
ATOM   4587  C3'  DA J   4      61.855 134.534  12.439  1.00119.86           C  
ANISOU 4587  C3'  DA J   4    18022  10021  17500  -5041  -1878     15       C  
ATOM   4588  O3'  DA J   4      61.434 133.514  13.329  1.00118.30           O  
ANISOU 4588  O3'  DA J   4    17801   9985  17162  -4894  -1890   -177       O  
ATOM   4589  C2'  DA J   4      62.823 134.006  11.374  1.00120.99           C  
ANISOU 4589  C2'  DA J   4    17787  10400  17783  -5242  -1694    292       C  
ATOM   4590  C1'  DA J   4      61.867 133.406  10.349  1.00119.87           C  
ANISOU 4590  C1'  DA J   4    17662  10352  17533  -5083  -1459    373       C  
ATOM   4591  N9   DA J   4      62.349 133.453   8.971  1.00122.65           N  
ANISOU 4591  N9   DA J   4    17820  10801  17981  -5213  -1265    653       N  
ATOM   4592  C8   DA J   4      62.956 134.507   8.352  1.00126.92           C  
ANISOU 4592  C8   DA J   4    18372  11196  18653  -5386  -1288    820       C  
ATOM   4593  N7   DA J   4      63.251 134.286   7.094  1.00127.37           N  
ANISOU 4593  N7   DA J   4    18241  11402  18752  -5460  -1070   1058       N  
ATOM   4594  C5   DA J   4      62.791 133.003   6.864  1.00123.97           C  
ANISOU 4594  C5   DA J   4    17669  11224  18208  -5321   -894   1044       C  
ATOM   4595  C6   DA J   4      62.806 132.185   5.718  1.00123.01           C  
ANISOU 4595  C6   DA J   4    17332  11356  18050  -5302   -627   1228       C  
ATOM   4596  N6   DA J   4      63.323 132.573   4.550  1.00125.76           N  
ANISOU 4596  N6   DA J   4    17563  11748  18472  -5423   -478   1467       N  
ATOM   4597  N1   DA J   4      62.271 130.951   5.821  1.00118.99           N  
ANISOU 4597  N1   DA J   4    16740  11059  17412  -5151   -515   1153       N  
ATOM   4598  C2   DA J   4      61.756 130.569   6.996  1.00118.84           C  
ANISOU 4598  C2   DA J   4    16824  11028  17300  -4995   -648    903       C  
ATOM   4599  N3   DA J   4      61.684 131.251   8.143  1.00120.95           N  
ANISOU 4599  N3   DA J   4    17315  11050  17591  -5030   -906    721       N  
ATOM   4600  C4   DA J   4      62.225 132.473   8.006  1.00122.25           C  
ANISOU 4600  C4   DA J   4    17559  11004  17885  -5175  -1014    799       C  
ATOM   4601  P    DG J   5      62.406 132.966  14.483  1.00116.23           P  
ANISOU 4601  P    DG J   5    17341   9881  16939  -5008  -2036   -271       P  
ATOM   4602  OP1  DG J   5      61.602 132.843  15.719  1.00110.37           O  
ANISOU 4602  OP1  DG J   5    16845   9079  16012  -4803  -2165   -557       O  
ATOM   4603  OP2  DG J   5      63.641 133.781  14.483  1.00120.25           O  
ANISOU 4603  OP2  DG J   5    17744  10306  17640  -5261  -2157   -149       O  
ATOM   4604  O5'  DG J   5      62.773 131.500  13.977  1.00116.28           O  
ANISOU 4604  O5'  DG J   5    16975  10248  16958  -5042  -1842   -147       O  
ATOM   4605  C5'  DG J   5      61.810 130.743  13.251  1.00113.82           C  
ANISOU 4605  C5'  DG J   5    16677  10050  16522  -4881  -1637   -118       C  
ATOM   4606  C4'  DG J   5      62.457 129.534  12.608  1.00111.51           C  
ANISOU 4606  C4'  DG J   5    15993  10089  16286  -4967  -1458     50       C  
ATOM   4607  O4'  DG J   5      62.859 129.859  11.249  1.00112.50           O  
ANISOU 4607  O4'  DG J   5    15980  10235  16529  -5083  -1287    308       O  
ATOM   4608  C3'  DG J   5      63.723 129.042  13.305  1.00113.08           C  
ANISOU 4608  C3'  DG J   5    15896  10468  16602  -5118  -1563     53       C  
ATOM   4609  O3'  DG J   5      63.806 127.635  13.197  1.00116.64           O  
ANISOU 4609  O3'  DG J   5    16085  11230  17004  -5064  -1437     77       O  
ATOM   4610  C2'  DG J   5      64.818 129.720  12.493  1.00113.80           C  
ANISOU 4610  C2'  DG J   5    15799  10541  16901  -5339  -1520    280       C  
ATOM   4611  C1'  DG J   5      64.234 129.583  11.101  1.00113.71           C  
ANISOU 4611  C1'  DG J   5    15777  10575  16853  -5282  -1271    451       C  
ATOM   4612  N9   DG J   5      64.799 130.503  10.121  1.00119.05           N  
ANISOU 4612  N9   DG J   5    16411  11156  17668  -5440  -1202    663       N  
ATOM   4613  C8   DG J   5      65.271 131.774  10.341  1.00125.02           C  
ANISOU 4613  C8   DG J   5    17302  11669  18531  -5581  -1363    677       C  
ATOM   4614  N7   DG J   5      65.716 132.355   9.260  1.00128.24           N  
ANISOU 4614  N7   DG J   5    17633  12054  19040  -5713  -1247    897       N  
ATOM   4615  C5   DG J   5      65.527 131.406   8.263  1.00125.11           C  
ANISOU 4615  C5   DG J   5    17037  11906  18593  -5644   -986   1031       C  
ATOM   4616  C6   DG J   5      65.819 131.462   6.879  1.00130.53           C  
ANISOU 4616  C6   DG J   5    17573  12699  19325  -5714   -757   1276       C  
ATOM   4617  O6   DG J   5      66.321 132.394   6.236  1.00136.52           O  
ANISOU 4617  O6   DG J   5    18341  13349  20183  -5867   -740   1434       O  
ATOM   4618  N1   DG J   5      65.466 130.279   6.233  1.00127.30           N  
ANISOU 4618  N1   DG J   5    16996  12556  18818  -5587   -531   1333       N  
ATOM   4619  C2   DG J   5      64.903 129.184   6.847  1.00121.36           C  
ANISOU 4619  C2   DG J   5    16224  11941  17946  -5427   -534   1178       C  
ATOM   4620  N2   DG J   5      64.627 128.130   6.069  1.00116.68           N  
ANISOU 4620  N2   DG J   5    15470  11602  17262  -5323   -304   1263       N  
ATOM   4621  N3   DG J   5      64.627 129.123   8.139  1.00119.25           N  
ANISOU 4621  N3   DG J   5    16095  11577  17637  -5370   -746    952       N  
ATOM   4622  C4   DG J   5      64.964 130.263   8.781  1.00120.50           C  
ANISOU 4622  C4   DG J   5    16417  11483  17884  -5478   -960    889       C  
ATOM   4623  P    DC J   6      63.872 126.720  14.514  1.00126.28           P  
ANISOU 4623  P    DC J   6    17249  12604  18129  -4976  -1572   -122       P  
ATOM   4624  OP1  DC J   6      62.575 126.857  15.213  1.00127.89           O  
ANISOU 4624  OP1  DC J   6    17777  12709  18108  -4711  -1607   -349       O  
ATOM   4625  OP2  DC J   6      65.130 127.035  15.228  1.00130.27           O  
ANISOU 4625  OP2  DC J   6    17606  13098  18790  -5160  -1758   -120       O  
ATOM   4626  O5'  DC J   6      63.976 125.235  13.932  1.00117.94           O  
ANISOU 4626  O5'  DC J   6    15850  11932  17028  -4839  -1343    -36       O  
ATOM   4627  C5'  DC J   6      62.837 124.641  13.327  1.00107.33           C  
ANISOU 4627  C5'  DC J   6    14557  10723  15501  -4546  -1118    -55       C  
ATOM   4628  C4'  DC J   6      63.142 124.170  11.914  1.00 99.29           C  
ANISOU 4628  C4'  DC J   6    13287   9892  14547  -4549   -864    166       C  
ATOM   4629  O4'  DC J   6      63.770 125.236  11.150  1.00100.93           O  
ANISOU 4629  O4'  DC J   6    13495   9924  14929  -4789   -860    346       O  
ATOM   4630  C3'  DC J   6      64.082 122.971  11.815  1.00 96.18           C  
ANISOU 4630  C3'  DC J   6    12516   9800  14227  -4593   -804    244       C  
ATOM   4631  O3'  DC J   6      63.602 122.088  10.822  1.00 95.35           O  
ANISOU 4631  O3'  DC J   6    12291   9917  14022  -4393   -549    323       O  
ATOM   4632  C2'  DC J   6      65.405 123.610  11.397  1.00101.02           C  
ANISOU 4632  C2'  DC J   6    12938  10358  15087  -4913   -849    428       C  
ATOM   4633  C1'  DC J   6      64.913 124.727  10.498  1.00101.52           C  
ANISOU 4633  C1'  DC J   6    13210  10204  15157  -4951   -760    534       C  
ATOM   4634  N1   DC J   6      65.886 125.846  10.326  1.00107.71           N  
ANISOU 4634  N1   DC J   6    13973  10795  16157  -5288   -876    679       N  
ATOM   4635  C2   DC J   6      66.394 126.154   9.051  1.00111.55           C  
ANISOU 4635  C2   DC J   6    14299  11341  16743  -5391   -684    913       C  
ATOM   4636  O2   DC J   6      66.042 125.481   8.072  1.00113.92           O  
ANISOU 4636  O2   DC J   6    14495  11829  16961  -5261   -442   1011       O  
ATOM   4637  N3   DC J   6      67.268 127.187   8.930  1.00113.97           N  
ANISOU 4637  N3   DC J   6    14570  11524  17208  -5578   -750   1008       N  
ATOM   4638  C4   DC J   6      67.623 127.892  10.007  1.00117.36           C  
ANISOU 4638  C4   DC J   6    15121  11771  17701  -5666  -1002    882       C  
ATOM   4639  N4   DC J   6      68.484 128.899   9.841  1.00122.00           N  
ANISOU 4639  N4   DC J   6    15675  12243  18438  -5862  -1065    986       N  
ATOM   4640  C5   DC J   6      67.118 127.592  11.302  1.00115.77           C  
ANISOU 4640  C5   DC J   6    15087  11505  17397  -5557  -1199    643       C  
ATOM   4641  C6   DC J   6      66.257 126.578  11.413  1.00111.35           C  
ANISOU 4641  C6   DC J   6    14558  11070  16678  -5374  -1127    550       C  
ATOM   4642  P    DT J   7      63.617 120.501  11.061  1.00 97.34           P  
ANISOU 4642  P    DT J   7    12328  10477  14182  -4216   -488    266       P  
ATOM   4643  OP1  DT J   7      62.232 120.018  10.858  1.00 87.19           O  
ANISOU 4643  OP1  DT J   7    11214   9244  12672  -3929   -366    181       O  
ATOM   4644  OP2  DT J   7      64.312 120.227  12.338  1.00101.54           O  
ANISOU 4644  OP2  DT J   7    12785  11022  14773  -4325   -723    154       O  
ATOM   4645  O5'  DT J   7      64.534 119.965   9.870  1.00100.69           O  
ANISOU 4645  O5'  DT J   7    12417  11112  14727  -4283   -293    475       O  
ATOM   4646  C5'  DT J   7      64.331 120.466   8.558  1.00 94.33           C  
ANISOU 4646  C5'  DT J   7    11636  10276  13929  -4287    -89    637       C  
ATOM   4647  C4'  DT J   7      65.649 120.632   7.826  1.00 91.07           C  
ANISOU 4647  C4'  DT J   7    10931   9954  13717  -4514    -10    840       C  
ATOM   4648  O4'  DT J   7      66.337 121.822   8.289  1.00 93.67           O  
ANISOU 4648  O4'  DT J   7    11311  10060  14221  -4805   -194    879       O  
ATOM   4649  C3'  DT J   7      66.644 119.476   7.991  1.00 90.38           C  
ANISOU 4649  C3'  DT J   7    10487  10144  13711  -4516      0    858       C  
ATOM   4650  O3'  DT J   7      67.035 119.023   6.712  1.00 91.06           O  
ANISOU 4650  O3'  DT J   7    10353  10431  13814  -4480    253   1027       O  
ATOM   4651  C2'  DT J   7      67.820 120.114   8.743  1.00 91.40           C  
ANISOU 4651  C2'  DT J   7    10487  10182  14060  -4817   -214    885       C  
ATOM   4652  C1'  DT J   7      67.714 121.553   8.281  1.00 95.49           C  
ANISOU 4652  C1'  DT J   7    11197  10442  14643  -5005   -217    991       C  
ATOM   4653  N1   DT J   7      68.410 122.533   9.165  1.00 98.41           N  
ANISOU 4653  N1   DT J   7    11615  10594  15181  -5290   -483    975       N  
ATOM   4654  C2   DT J   7      69.059 123.603   8.595  1.00100.22           C  
ANISOU 4654  C2   DT J   7    11821  10712  15548  -5473   -451   1120       C  
ATOM   4655  O2   DT J   7      69.095 123.799   7.394  1.00 98.02           O  
ANISOU 4655  O2   DT J   7    11478  10490  15275  -5489   -232   1294       O  
ATOM   4656  N3   DT J   7      69.667 124.446   9.486  1.00105.25           N  
ANISOU 4656  N3   DT J   7    12523  11175  16294  -5617   -680   1049       N  
ATOM   4657  C4   DT J   7      69.695 124.327  10.862  1.00107.46           C  
ANISOU 4657  C4   DT J   7    12890  11383  16559  -5603   -932    854       C  
ATOM   4658  O4   DT J   7      70.272 125.139  11.579  1.00111.11           O  
ANISOU 4658  O4   DT J   7    13416  11689  17112  -5738  -1127    804       O  
ATOM   4659  C5   DT J   7      68.998 123.179  11.397  1.00100.99           C  
ANISOU 4659  C5   DT J   7    12091  10687  15593  -5421   -953    716       C  
ATOM   4660  C7   DT J   7      68.959 122.944  12.878  1.00 98.56           C  
ANISOU 4660  C7   DT J   7    11889  10326  15235  -5383  -1211    502       C  
ATOM   4661  C6   DT J   7      68.400 122.345  10.532  1.00 97.81           C  
ANISOU 4661  C6   DT J   7    11620  10455  15088  -5283   -733    784       C  
ATOM   4662  P    DG J   8      67.664 117.560   6.507  1.00 82.96           P  
ANISOU 4662  P    DG J   8     8997   9730  12792  -4344    352   1035       P  
ATOM   4663  OP1  DG J   8      66.568 116.650   6.109  1.00 77.22           O  
ANISOU 4663  OP1  DG J   8     8396   9101  11844  -4039    483    959       O  
ATOM   4664  OP2  DG J   8      68.506 117.232   7.678  1.00 82.84           O  
ANISOU 4664  OP2  DG J   8     8817   9753  12906  -4451    125    950       O  
ATOM   4665  O5'  DG J   8      68.622 117.764   5.250  1.00 86.45           O  
ANISOU 4665  O5'  DG J   8     9172  10313  13361  -4477    571   1266       O  
ATOM   4666  C5'  DG J   8      68.194 118.582   4.172  1.00 88.09           C  
ANISOU 4666  C5'  DG J   8     9527  10423  13522  -4518    742   1404       C  
ATOM   4667  C4'  DG J   8      69.362 119.339   3.569  1.00 97.31           C  
ANISOU 4667  C4'  DG J   8    10473  11616  14886  -4806    813   1618       C  
ATOM   4668  O4'  DG J   8      69.791 120.391   4.471  1.00104.62           O  
ANISOU 4668  O4'  DG J   8    11468  12309  15972  -5081    564   1607       O  
ATOM   4669  C3'  DG J   8      70.600 118.498   3.291  1.00100.43           C  
ANISOU 4669  C3'  DG J   8    10439  12316  15404  -4832    913   1704       C  
ATOM   4670  O3'  DG J   8      71.204 118.949   2.103  1.00105.29           O  
ANISOU 4670  O3'  DG J   8    10896  13028  16082  -4970   1135   1930       O  
ATOM   4671  C2'  DG J   8      71.482 118.776   4.507  1.00101.34           C  
ANISOU 4671  C2'  DG J   8    10416  12366  15720  -5052    640   1653       C  
ATOM   4672  C1'  DG J   8      71.164 120.238   4.766  1.00106.93           C  
ANISOU 4672  C1'  DG J   8    11422  12746  16462  -5237    508   1659       C  
ATOM   4673  N9   DG J   8      71.377 120.660   6.146  1.00114.22           N  
ANISOU 4673  N9   DG J   8    12440  13488  17469  -5342    200   1510       N  
ATOM   4674  C8   DG J   8      70.900 120.054   7.283  1.00113.97           C  
ANISOU 4674  C8   DG J   8    12503  13423  17376  -5254     -3   1326       C  
ATOM   4675  N7   DG J   8      71.238 120.672   8.381  1.00115.09           N  
ANISOU 4675  N7   DG J   8    12741  13391  17599  -5371   -258   1216       N  
ATOM   4676  C5   DG J   8      71.980 121.762   7.943  1.00119.65           C  
ANISOU 4676  C5   DG J   8    13281  13875  18307  -5558   -230   1339       C  
ATOM   4677  C6   DG J   8      72.610 122.794   8.680  1.00122.91           C  
ANISOU 4677  C6   DG J   8    13766  14095  18841  -5747   -442   1304       C  
ATOM   4678  O6   DG J   8      72.641 122.952   9.909  1.00121.19           O  
ANISOU 4678  O6   DG J   8    13665  13749  18633  -5774   -700   1147       O  
ATOM   4679  N1   DG J   8      73.261 123.700   7.845  1.00126.08           N  
ANISOU 4679  N1   DG J   8    14095  14462  19346  -5914   -332   1477       N  
ATOM   4680  C2   DG J   8      73.292 123.621   6.471  1.00125.25           C  
ANISOU 4680  C2   DG J   8    13873  14496  19220  -5893    -43   1656       C  
ATOM   4681  N2   DG J   8      73.965 124.586   5.829  1.00128.78           N  
ANISOU 4681  N2   DG J   8    14274  14889  19767  -6078     24   1810       N  
ATOM   4682  N3   DG J   8      72.705 122.661   5.771  1.00123.27           N  
ANISOU 4682  N3   DG J   8    13562  14428  18846  -5704    164   1684       N  
ATOM   4683  C4   DG J   8      72.070 121.770   6.569  1.00120.25           C  
ANISOU 4683  C4   DG J   8    13241  14077  18372  -5547     51   1522       C  
ATOM   4684  P    DA J   9      72.202 117.991   1.296  1.00109.36           P  
ANISOU 4684  P    DA J   9    11016  13904  16632  -4873   1368   2020       P  
ATOM   4685  OP1  DA J   9      71.800 118.045  -0.127  1.00108.56           O  
ANISOU 4685  OP1  DA J   9    10982  13881  16384  -4779   1661   2155       O  
ATOM   4686  OP2  DA J   9      72.258 116.689   1.997  1.00109.88           O  
ANISOU 4686  OP2  DA J   9    10938  14134  16678  -4674   1281   1865       O  
ATOM   4687  O5'  DA J   9      73.620 118.703   1.470  1.00114.99           O  
ANISOU 4687  O5'  DA J   9    11503  14634  17555  -5100   1313   2081       O  
ATOM   4688  C5'  DA J   9      73.814 120.028   0.991  1.00118.04           C  
ANISOU 4688  C5'  DA J   9    12019  14845  17987  -5299   1347   2197       C  
ATOM   4689  C4'  DA J   9      75.219 120.509   1.301  1.00119.00           C  
ANISOU 4689  C4'  DA J   9    11886  15019  18311  -5509   1270   2243       C  
ATOM   4690  O4'  DA J   9      75.263 121.050   2.648  1.00115.86           O  
ANISOU 4690  O4'  DA J   9    11610  14392  18021  -5643    943   2122       O  
ATOM   4691  C3'  DA J   9      76.292 119.425   1.246  1.00123.00           C  
ANISOU 4691  C3'  DA J   9    11974  15866  18896  -5425   1357   2240       C  
ATOM   4692  O3'  DA J   9      77.489 119.955   0.703  1.00131.99           O  
ANISOU 4692  O3'  DA J   9    12876  17117  20155  -5594   1464   2372       O  
ATOM   4693  C2'  DA J   9      76.462 119.034   2.711  1.00120.64           C  
ANISOU 4693  C2'  DA J   9    11634  15509  18695  -5433   1051   2074       C  
ATOM   4694  C1'  DA J   9      76.231 120.364   3.412  1.00118.57           C  
ANISOU 4694  C1'  DA J   9    11654  14905  18492  -5649    822   2049       C  
ATOM   4695  N9   DA J   9      75.726 120.232   4.776  1.00119.30           N  
ANISOU 4695  N9   DA J   9    11921  14824  18583  -5627    525   1866       N  
ATOM   4696  C8   DA J   9      74.834 119.306   5.241  1.00118.08           C  
ANISOU 4696  C8   DA J   9    11869  14689  18309  -5429    468   1736       C  
ATOM   4697  N7   DA J   9      74.556 119.433   6.517  1.00118.94           N  
ANISOU 4697  N7   DA J   9    12143  14619  18428  -5460    183   1579       N  
ATOM   4698  C5   DA J   9      75.316 120.521   6.916  1.00119.38           C  
ANISOU 4698  C5   DA J   9    12210  14526  18623  -5686     41   1605       C  
ATOM   4699  C6   DA J   9      75.468 121.170   8.159  1.00119.47           C  
ANISOU 4699  C6   DA J   9    12376  14320  18698  -5812   -261   1483       C  
ATOM   4700  N6   DA J   9      74.832 120.790   9.272  1.00118.08           N  
ANISOU 4700  N6   DA J   9    12382  14042  18442  -5718   -474   1298       N  
ATOM   4701  N1   DA J   9      76.306 122.227   8.213  1.00123.36           N  
ANISOU 4701  N1   DA J   9    12836  14708  19327  -6036   -337   1559       N  
ATOM   4702  C2   DA J   9      76.942 122.603   7.098  1.00128.12           C  
ANISOU 4702  C2   DA J   9    13259  15421  19999  -6136   -121   1747       C  
ATOM   4703  N3   DA J   9      76.880 122.073   5.878  1.00129.22           N  
ANISOU 4703  N3   DA J   9    13247  15771  20080  -6032    179   1870       N  
ATOM   4704  C4   DA J   9      76.040 121.027   5.855  1.00122.54           C  
ANISOU 4704  C4   DA J   9    12442  15021  19098  -5800    245   1787       C  
ATOM   4705  P    DA J  10      78.569 118.980   0.020  1.00135.72           P  
ANISOU 4705  P    DA J  10    12920  17982  20665  -5486   1688   2429       P  
ATOM   4706  OP1  DA J  10      78.789 119.460  -1.363  1.00133.19           O  
ANISOU 4706  OP1  DA J  10    12580  17752  20275  -5531   1980   2598       O  
ATOM   4707  OP2  DA J  10      78.146 117.582   0.261  1.00132.18           O  
ANISOU 4707  OP2  DA J  10    12391  17698  20133  -5209   1699   2309       O  
ATOM   4708  O5'  DA J  10      79.896 119.248   0.865  1.00137.22           O  
ANISOU 4708  O5'  DA J  10    12837  18214  21088  -5681   1496   2418       O  
ATOM   4709  C5'  DA J  10      80.438 120.549   0.903  1.00138.59           C  
ANISOU 4709  C5'  DA J  10    13057  18223  21377  -5966   1418   2518       C  
ATOM   4710  C4'  DA J  10      81.067 120.841   2.250  1.00138.53           C  
ANISOU 4710  C4'  DA J  10    12986  18102  21546  -6123   1092   2428       C  
ATOM   4711  O4'  DA J  10      80.083 120.713   3.309  1.00130.98           O  
ANISOU 4711  O4'  DA J  10    12318  16921  20529  -6046    847   2260       O  
ATOM   4712  C3'  DA J  10      82.223 119.915   2.628  1.00143.77           C  
ANISOU 4712  C3'  DA J  10    13233  19053  22342  -6069   1064   2390       C  
ATOM   4713  O3'  DA J  10      83.390 120.691   2.854  1.00155.94           O  
ANISOU 4713  O3'  DA J  10    14588  20594  24067  -6325    972   2475       O  
ATOM   4714  C2'  DA J  10      81.737 119.216   3.909  1.00137.95           C  
ANISOU 4714  C2'  DA J  10    12590  18228  21596  -5945    794   2195       C  
ATOM   4715  C1'  DA J  10      80.733 120.217   4.450  1.00134.26           C  
ANISOU 4715  C1'  DA J  10    12559  17389  21065  -6054    611   2144       C  
ATOM   4716  N9   DA J  10      79.738 119.633   5.353  1.00133.12           N  
ANISOU 4716  N9   DA J  10    12637  17121  20821  -5895    431   1967       N  
ATOM   4717  C8   DA J  10      78.808 118.679   5.049  1.00130.29           C  
ANISOU 4717  C8   DA J  10    12353  16844  20307  -5650    547   1910       C  
ATOM   4718  N7   DA J  10      78.039 118.344   6.059  1.00127.15           N  
ANISOU 4718  N7   DA J  10    12161  16304  19846  -5566    330   1750       N  
ATOM   4719  C5   DA J  10      78.497 119.130   7.103  1.00129.67           C  
ANISOU 4719  C5   DA J  10    12557  16435  20278  -5758     56   1689       C  
ATOM   4720  C6   DA J  10      78.097 119.247   8.452  1.00129.58           C  
ANISOU 4720  C6   DA J  10    12766  16218  20249  -5774   -251   1519       C  
ATOM   4721  N6   DA J  10      77.100 118.535   8.989  1.00125.12           N  
ANISOU 4721  N6   DA J  10    12383  15608  19548  -5597   -333   1380       N  
ATOM   4722  N1   DA J  10      78.764 120.127   9.229  1.00134.05           N  
ANISOU 4722  N1   DA J  10    13366  16631  20934  -5980   -471   1498       N  
ATOM   4723  C2   DA J  10      79.761 120.838   8.687  1.00136.73           C  
ANISOU 4723  C2   DA J  10    13520  17020  21412  -6170   -394   1646       C  
ATOM   4724  N3   DA J  10      80.227 120.815   7.435  1.00137.58           N  
ANISOU 4724  N3   DA J  10    13405  17317  21550  -6185   -112   1816       N  
ATOM   4725  C4   DA J  10      79.545 119.932   6.687  1.00133.68           C  
ANISOU 4725  C4   DA J  10    12894  16974  20926  -5965    108   1824       C  
ATOM   4726  P    DC J  11      84.825 120.168   2.357  1.00141.45           P  
ANISOU 4726  P    DC J  11    12263  19118  22364  -6334   1132   2566       P  
ATOM   4727  OP1  DC J  11      85.430 121.222   1.512  1.00145.80           O  
ANISOU 4727  OP1  DC J  11    12758  19669  22971  -6568   1280   2756       O  
ATOM   4728  OP2  DC J  11      84.649 118.798   1.825  1.00138.56           O  
ANISOU 4728  OP2  DC J  11    11723  19029  21895  -6025   1337   2514       O  
ATOM   4729  O5'  DC J  11      85.654 120.066   3.713  1.00148.81           O  
ANISOU 4729  O5'  DC J  11    13030  20031  23480  -6433    807   2468       O  
ATOM   4730  C5'  DC J  11      84.980 119.691   4.889  1.00149.68           C  
ANISOU 4730  C5'  DC J  11    13346  19971  23554  -6341    536   2290       C  
ATOM   4731  C4'  DC J  11      85.502 120.445   6.084  1.00156.24           C  
ANISOU 4731  C4'  DC J  11    14232  20605  24527  -6566    201   2243       C  
ATOM   4732  O4'  DC J  11      84.443 120.550   7.068  1.00157.96           O  
ANISOU 4732  O4'  DC J  11    14828  20543  24647  -6516    -39   2083       O  
ATOM   4733  C3'  DC J  11      86.621 119.730   6.802  1.00157.20           C  
ANISOU 4733  C3'  DC J  11    14000  20927  24802  -6549     56   2189       C  
ATOM   4734  O3'  DC J  11      87.347 120.636   7.610  1.00153.83           O  
ANISOU 4734  O3'  DC J  11    13574  20350  24523  -6810   -198   2206       O  
ATOM   4735  C2'  DC J  11      85.840 118.732   7.640  1.00159.06           C  
ANISOU 4735  C2'  DC J  11    14375  21124  24936  -6316    -98   1999       C  
ATOM   4736  C1'  DC J  11      84.629 119.562   8.066  1.00160.94           C  
ANISOU 4736  C1'  DC J  11    15095  21005  25050  -6378   -231   1933       C  
ATOM   4737  N1   DC J  11      83.365 118.762   8.201  1.00164.05           N  
ANISOU 4737  N1   DC J  11    15717  21351  25262  -6131   -216   1806       N  
ATOM   4738  C2   DC J  11      82.732 118.687   9.444  1.00167.14           C  
ANISOU 4738  C2   DC J  11    16374  21536  25594  -6096   -501   1634       C  
ATOM   4739  O2   DC J  11      83.230 119.289  10.399  1.00171.38           O  
ANISOU 4739  O2   DC J  11    16963  21931  26223  -6261   -758   1587       O  
ATOM   4740  N3   DC J  11      81.590 117.961   9.560  1.00163.43           N  
ANISOU 4740  N3   DC J  11    16103  21032  24961  -5883   -486   1526       N  
ATOM   4741  C4   DC J  11      81.089 117.329   8.496  1.00160.40           C  
ANISOU 4741  C4   DC J  11    15661  20805  24480  -5709   -209   1587       C  
ATOM   4742  N4   DC J  11      79.962 116.624   8.656  1.00156.84           N  
ANISOU 4742  N4   DC J  11    15407  20314  23872  -5512   -213   1485       N  
ATOM   4743  C5   DC J  11      81.724 117.392   7.219  1.00160.84           C  
ANISOU 4743  C5   DC J  11    15458  21070  24584  -5729     86   1756       C  
ATOM   4744  C6   DC J  11      82.848 118.111   7.119  1.00163.67           C  
ANISOU 4744  C6   DC J  11    15621  21466  25100  -5942     75   1859       C  
ATOM   4745  P    DA J  12      88.865 120.303   8.012  1.00164.93           P  
ANISOU 4745  P    DA J  12    14541  21986  26138  -6894   -295   2238       P  
ATOM   4746  OP1  DA J  12      89.672 121.532   7.844  1.00167.50           O  
ANISOU 4746  OP1  DA J  12    14804  22235  26602  -7209   -330   2389       O  
ATOM   4747  OP2  DA J  12      89.245 119.067   7.291  1.00160.58           O  
ANISOU 4747  OP2  DA J  12    13638  21792  25583  -6657    -52   2251       O  
ATOM   4748  O5'  DA J  12      88.775 119.938   9.564  1.00164.51           O  
ANISOU 4748  O5'  DA J  12    14610  21795  26102  -6852   -666   2051       O  
ATOM   4749  C5'  DA J  12      88.000 120.744  10.445  1.00165.96           C  
ANISOU 4749  C5'  DA J  12    15219  21625  26214  -6954   -915   1957       C  
ATOM   4750  C4'  DA J  12      88.026 120.176  11.854  1.00169.12           C  
ANISOU 4750  C4'  DA J  12    15681  21962  26615  -6876  -1232   1778       C  
ATOM   4751  O4'  DA J  12      86.825 119.396  12.092  1.00166.76           O  
ANISOU 4751  O4'  DA J  12    15623  21606  26131  -6628  -1229   1633       O  
ATOM   4752  C3'  DA J  12      89.190 119.241  12.145  1.00173.60           C  
ANISOU 4752  C3'  DA J  12    15823  22813  27324  -6812  -1285   1773       C  
ATOM   4753  O3'  DA J  12      89.562 119.347  13.514  1.00176.39           O  
ANISOU 4753  O3'  DA J  12    16251  23037  27732  -6891  -1637   1665       O  
ATOM   4754  C2'  DA J  12      88.601 117.869  11.823  1.00170.86           C  
ANISOU 4754  C2'  DA J  12    15409  22649  26860  -6492  -1137   1690       C  
ATOM   4755  C1'  DA J  12      87.157 118.032  12.285  1.00166.21           C  
ANISOU 4755  C1'  DA J  12    15292  21785  26075  -6413  -1227   1563       C  
ATOM   4756  N9   DA J  12      86.213 117.227  11.519  1.00161.52           N  
ANISOU 4756  N9   DA J  12    14755  21284  25331  -6170   -994   1544       N  
ATOM   4757  C8   DA J  12      86.288 116.920  10.193  1.00161.33           C  
ANISOU 4757  C8   DA J  12    14527  21473  25297  -6083   -661   1666       C  
ATOM   4758  N7   DA J  12      85.292 116.188   9.757  1.00157.14           N  
ANISOU 4758  N7   DA J  12    14119  20977  24611  -5858   -517   1617       N  
ATOM   4759  C5   DA J  12      84.508 115.996  10.878  1.00155.04           C  
ANISOU 4759  C5   DA J  12    14150  20510  24250  -5799   -773   1454       C  
ATOM   4760  C6   DA J  12      83.303 115.297  11.084  1.00150.71           C  
ANISOU 4760  C6   DA J  12    13841  19894  23526  -5594   -787   1338       C  
ATOM   4761  N6   DA J  12      82.656 114.637  10.116  1.00146.93           N  
ANISOU 4761  N6   DA J  12    13341  19543  22941  -5404   -532   1375       N  
ATOM   4762  N1   DA J  12      82.786 115.305  12.328  1.00149.45           N  
ANISOU 4762  N1   DA J  12    13951  19534  23298  -5593  -1072   1184       N  
ATOM   4763  C2   DA J  12      83.433 115.966  13.295  1.00152.49           C  
ANISOU 4763  C2   DA J  12    14371  19793  23776  -5774  -1324   1145       C  
ATOM   4764  N3   DA J  12      84.569 116.656  13.223  1.00157.13           N  
ANISOU 4764  N3   DA J  12    14750  20419  24534  -5977  -1350   1246       N  
ATOM   4765  C4   DA J  12      85.060 116.632  11.976  1.00157.72           C  
ANISOU 4765  C4   DA J  12    14550  20697  24681  -5983  -1064   1402       C  
ATOM   4766  P    DT J  13      91.008 118.843  14.004  1.00191.97           P  
ANISOU 4766  P    DT J  13    17805  25234  29901  -6933  -1775   1686       P  
ATOM   4767  OP1  DT J  13      91.704 119.991  14.625  1.00196.85           O  
ANISOU 4767  OP1  DT J  13    18468  25682  30644  -7231  -2001   1740       O  
ATOM   4768  OP2  DT J  13      91.642 118.121  12.878  1.00194.23           O  
ANISOU 4768  OP2  DT J  13    17666  25866  30265  -6822  -1477   1796       O  
ATOM   4769  O5'  DT J  13      90.663 117.772  15.138  1.00187.26           O  
ANISOU 4769  O5'  DT J  13    17305  24627  29218  -6718  -2005   1493       O  
ATOM   4770  C5'  DT J  13      89.700 116.766  14.877  1.00180.09           C  
ANISOU 4770  C5'  DT J  13    16496  23780  28150  -6440  -1879   1401       C  
ATOM   4771  C4'  DT J  13      88.861 116.486  16.104  1.00173.40           C  
ANISOU 4771  C4'  DT J  13    16010  22723  27153  -6345  -2143   1215       C  
ATOM   4772  O4'  DT J  13      87.522 116.110  15.698  1.00165.59           O  
ANISOU 4772  O4'  DT J  13    15280  21668  25969  -6161  -1995   1152       O  
ATOM   4773  C3'  DT J  13      89.366 115.340  16.956  1.00171.18           C  
ANISOU 4773  C3'  DT J  13    15559  22581  26899  -6189  -2335   1113       C  
ATOM   4774  O3'  DT J  13      89.020 115.542  18.315  1.00168.41           O  
ANISOU 4774  O3'  DT J  13    15527  22002  26459  -6224  -2649    973       O  
ATOM   4775  C2'  DT J  13      88.654 114.130  16.357  1.00166.33           C  
ANISOU 4775  C2'  DT J  13    14904  22124  26171  -5897  -2146   1070       C  
ATOM   4776  C1'  DT J  13      87.337 114.714  15.846  1.00160.56           C  
ANISOU 4776  C1'  DT J  13    14532  21200  25272  -5898  -1995   1065       C  
ATOM   4777  N1   DT J  13      86.904 114.151  14.522  1.00153.59           N  
ANISOU 4777  N1   DT J  13    13519  20496  24343  -5732  -1658   1141       N  
ATOM   4778  C2   DT J  13      85.750 113.403  14.448  1.00148.17           C  
ANISOU 4778  C2   DT J  13    13036  19781  23480  -5516  -1602   1052       C  
ATOM   4779  O2   DT J  13      85.046 113.164  15.413  1.00145.22           O  
ANISOU 4779  O2   DT J  13    12945  19249  22982  -5452  -1808    911       O  
ATOM   4780  N3   DT J  13      85.448 112.940  13.193  1.00145.45           N  
ANISOU 4780  N3   DT J  13    12557  19607  23102  -5374  -1290   1135       N  
ATOM   4781  C4   DT J  13      86.167 113.146  12.029  1.00144.14           C  
ANISOU 4781  C4   DT J  13    12085  19638  23042  -5418  -1022   1290       C  
ATOM   4782  O4   DT J  13      85.812 112.687  10.947  1.00140.00           O  
ANISOU 4782  O4   DT J  13    11477  19260  22456  -5267   -743   1351       O  
ATOM   4783  C5   DT J  13      87.365 113.937  12.177  1.00147.50           C  
ANISOU 4783  C5   DT J  13    12305  20089  23647  -5652  -1092   1376       C  
ATOM   4784  C7   DT J  13      88.229 114.226  10.986  1.00148.03           C  
ANISOU 4784  C7   DT J  13    12037  20375  23832  -5723   -812   1547       C  
ATOM   4785  C6   DT J  13      87.672 114.395  13.400  1.00152.35           C  
ANISOU 4785  C6   DT J  13    13043  20532  24311  -5799  -1408   1301       C  
ATOM   4786  P    DG J  14      89.942 114.917  19.471  1.00172.80           P  
ANISOU 4786  P    DG J  14    15927  22632  27097  -6203  -2943    902       P  
ATOM   4787  OP1  DG J  14      89.685 115.670  20.719  1.00174.00           O  
ANISOU 4787  OP1  DG J  14    16438  22504  27171  -6336  -3234    802       O  
ATOM   4788  OP2  DG J  14      91.320 114.822  18.940  1.00174.68           O  
ANISOU 4788  OP2  DG J  14    15687  23118  27566  -6283  -2872   1036       O  
ATOM   4789  O5'  DG J  14      89.381 113.430  19.632  1.00168.19           O  
ANISOU 4789  O5'  DG J  14    15344  22173  26388  -5893  -2934    790       O  
ATOM   4790  C5'  DG J  14      88.004 113.227  19.907  1.00162.24           C  
ANISOU 4790  C5'  DG J  14    14982  21256  25407  -5762  -2937    672       C  
ATOM   4791  C4'  DG J  14      87.572 111.825  19.518  1.00157.96           C  
ANISOU 4791  C4'  DG J  14    14336  20894  24787  -5476  -2824    629       C  
ATOM   4792  O4'  DG J  14      87.380 111.742  18.076  1.00156.63           O  
ANISOU 4792  O4'  DG J  14    13988  20873  24652  -5415  -2488    741       O  
ATOM   4793  C3'  DG J  14      88.568 110.708  19.870  1.00156.90           C  
ANISOU 4793  C3'  DG J  14    13869  20981  24766  -5346  -2944    617       C  
ATOM   4794  O3'  DG J  14      87.853 109.578  20.343  1.00152.22           O  
ANISOU 4794  O3'  DG J  14    13429  20392  24016  -5110  -3029    498       O  
ATOM   4795  C2'  DG J  14      89.202 110.404  18.514  1.00157.53           C  
ANISOU 4795  C2'  DG J  14    13529  21331  24996  -5288  -2656    753       C  
ATOM   4796  C1'  DG J  14      87.972 110.545  17.644  1.00153.36           C  
ANISOU 4796  C1'  DG J  14    13218  20734  24320  -5217  -2409    764       C  
ATOM   4797  N9   DG J  14      88.219 110.587  16.203  1.00149.44           N  
ANISOU 4797  N9   DG J  14    12445  20431  23905  -5192  -2073    901       N  
ATOM   4798  C8   DG J  14      89.317 111.089  15.547  1.00151.65           C  
ANISOU 4798  C8   DG J  14    12385  20865  24368  -5329  -1942   1037       C  
ATOM   4799  N7   DG J  14      89.242 110.972  14.247  1.00149.98           N  
ANISOU 4799  N7   DG J  14    12003  20819  24165  -5251  -1617   1137       N  
ATOM   4800  C5   DG J  14      88.023 110.337  14.034  1.00146.97           C  
ANISOU 4800  C5   DG J  14    11857  20384  23602  -5050  -1538   1065       C  
ATOM   4801  C6   DG J  14      87.394 109.936  12.828  1.00147.08           C  
ANISOU 4801  C6   DG J  14    11841  20512  23531  -4886  -1225   1119       C  
ATOM   4802  O6   DG J  14      87.800 110.068  11.665  1.00149.98           O  
ANISOU 4802  O6   DG J  14    11971  21060  23955  -4878   -936   1242       O  
ATOM   4803  N1   DG J  14      86.164 109.326  13.069  1.00142.76           N  
ANISOU 4803  N1   DG J  14    11586  19852  22803  -4716  -1268   1017       N  
ATOM   4804  C2   DG J  14      85.616 109.128  14.315  1.00138.12           C  
ANISOU 4804  C2   DG J  14    11285  19073  22120  -4707  -1565    877       C  
ATOM   4805  N2   DG J  14      84.421 108.525  14.362  1.00130.42           N  
ANISOU 4805  N2   DG J  14    10564  18020  20971  -4541  -1561    797       N  
ATOM   4806  N3   DG J  14      86.195 109.499  15.444  1.00140.48           N  
ANISOU 4806  N3   DG J  14    11628  19268  22482  -4850  -1845    821       N  
ATOM   4807  C4   DG J  14      87.389 110.093  15.229  1.00144.60           C  
ANISOU 4807  C4   DG J  14    11864  19890  23187  -5016  -1818    922       C  
ATOM   4808  P    DC J  15      87.665 109.304  21.914  1.00140.47           P  
ANISOU 4808  P    DC J  15    12225  18745  22401  -5091  -3368    354       P  
ATOM   4809  OP1  DC J  15      87.549 110.613  22.595  1.00139.77           O  
ANISOU 4809  OP1  DC J  15    12411  18416  22280  -5326  -3497    331       O  
ATOM   4810  OP2  DC J  15      88.719 108.354  22.331  1.00142.20           O  
ANISOU 4810  OP2  DC J  15    12144  19146  22740  -4992  -3521    353       O  
ATOM   4811  O5'  DC J  15      86.255 108.544  21.994  1.00137.74           O  
ANISOU 4811  O5'  DC J  15    12192  18329  21813  -4880  -3328    247       O  
ATOM   4812  C5'  DC J  15      85.040 109.283  21.854  1.00137.91           C  
ANISOU 4812  C5'  DC J  15    12572  18155  21671  -4932  -3231    210       C  
ATOM   4813  C4'  DC J  15      83.956 108.467  21.158  1.00137.58           C  
ANISOU 4813  C4'  DC J  15    12615  18168  21492  -4722  -3052    188       C  
ATOM   4814  O4'  DC J  15      84.244 108.356  19.739  1.00142.25           O  
ANISOU 4814  O4'  DC J  15    12894  18940  22215  -4685  -2771    318       O  
ATOM   4815  C3'  DC J  15      83.769 107.042  21.662  1.00134.28           C  
ANISOU 4815  C3'  DC J  15    12203  17839  20979  -4491  -3177    105       C  
ATOM   4816  O3'  DC J  15      82.387 106.707  21.631  1.00127.19           O  
ANISOU 4816  O3'  DC J  15    11616  16849  19863  -4369  -3117     32       O  
ATOM   4817  C2'  DC J  15      84.571 106.215  20.658  1.00138.75           C  
ANISOU 4817  C2'  DC J  15    12328  18668  21722  -4360  -3029    203       C  
ATOM   4818  C1'  DC J  15      84.365 106.996  19.364  1.00142.91           C  
ANISOU 4818  C1'  DC J  15    12761  19225  22314  -4446  -2727    317       C  
ATOM   4819  N1   DC J  15      85.513 106.897  18.418  1.00150.30           N  
ANISOU 4819  N1   DC J  15    13239  20398  23472  -4445  -2561    444       N  
ATOM   4820  C2   DC J  15      85.317 106.454  17.096  1.00150.99           C  
ANISOU 4820  C2   DC J  15    13128  20655  23586  -4303  -2267    527       C  
ATOM   4821  O2   DC J  15      84.184 106.123  16.719  1.00146.15           O  
ANISOU 4821  O2   DC J  15    12721  19987  22821  -4184  -2162    497       O  
ATOM   4822  N3   DC J  15      86.391 106.395  16.266  1.00157.14           N  
ANISOU 4822  N3   DC J  15    13492  21664  24551  -4295  -2101    637       N  
ATOM   4823  C4   DC J  15      87.597 106.761  16.705  1.00161.85           C  
ANISOU 4823  C4   DC J  15    13865  22319  25311  -4433  -2227    669       C  
ATOM   4824  N4   DC J  15      88.625 106.687  15.855  1.00165.94           N  
ANISOU 4824  N4   DC J  15    13967  23080  26003  -4417  -2047    776       N  
ATOM   4825  C5   DC J  15      87.807 107.210  18.037  1.00161.01           C  
ANISOU 4825  C5   DC J  15    13952  22033  25191  -4587  -2538    593       C  
ATOM   4826  C6   DC J  15      86.750 107.267  18.845  1.00156.76           C  
ANISOU 4826  C6   DC J  15    13832  21270  24458  -4583  -2689    482       C  
ATOM   4827  P    DC J  16      81.838 105.426  22.430  1.00129.88           P  
ANISOU 4827  P    DC J  16    12127  17197  20025  -4161  -3283    -80       P  
ATOM   4828  OP1  DC J  16      80.461 105.733  22.876  1.00124.66           O  
ANISOU 4828  OP1  DC J  16    11894  16355  19117  -4156  -3286   -174       O  
ATOM   4829  OP2  DC J  16      82.863 105.031  23.420  1.00131.12           O  
ANISOU 4829  OP2  DC J  16    12174  17394  20252  -4168  -3531   -109       O  
ATOM   4830  O5'  DC J  16      81.772 104.285  21.314  1.00128.00           O  
ANISOU 4830  O5'  DC J  16    11635  17157  19842  -3946  -3114    -20       O  
ATOM   4831  C5'  DC J  16      80.994 104.483  20.138  1.00122.24           C  
ANISOU 4831  C5'  DC J  16    10912  16445  19090  -3914  -2850     40       C  
ATOM   4832  C4'  DC J  16      81.230 103.367  19.132  1.00120.71           C  
ANISOU 4832  C4'  DC J  16    10413  16466  18987  -3701  -2710    102       C  
ATOM   4833  O4'  DC J  16      82.542 103.522  18.523  1.00126.30           O  
ANISOU 4833  O4'  DC J  16    10701  17351  19936  -3738  -2616    205       O  
ATOM   4834  C3'  DC J  16      81.219 101.953  19.709  1.00119.62           C  
ANISOU 4834  C3'  DC J  16    10285  16386  18780  -3482  -2899     25       C  
ATOM   4835  O3'  DC J  16      80.753 101.047  18.717  1.00117.94           O  
ANISOU 4835  O3'  DC J  16     9964  16288  18561  -3271  -2742     56       O  
ATOM   4836  C2'  DC J  16      82.698 101.728  19.989  1.00125.82           C  
ANISOU 4836  C2'  DC J  16    10735  17305  19767  -3488  -3015     56       C  
ATOM   4837  C1'  DC J  16      83.281 102.336  18.729  1.00130.17           C  
ANISOU 4837  C1'  DC J  16    10956  17996  20506  -3551  -2740    185       C  
ATOM   4838  N1   DC J  16      84.729 102.674  18.807  1.00141.11           N  
ANISOU 4838  N1   DC J  16    12004  19504  22107  -3651  -2780    246       N  
ATOM   4839  C2   DC J  16      85.478 102.703  17.630  1.00146.90           C  
ANISOU 4839  C2   DC J  16    12344  20452  23018  -3612  -2536    359       C  
ATOM   4840  O2   DC J  16      84.910 102.445  16.564  1.00147.39           O  
ANISOU 4840  O2   DC J  16    12362  20589  23049  -3489  -2289    405       O  
ATOM   4841  N3   DC J  16      86.796 103.012  17.694  1.00151.65           N  
ANISOU 4841  N3   DC J  16    12629  21179  23813  -3708  -2568    417       N  
ATOM   4842  C4   DC J  16      87.359 103.283  18.873  1.00153.46           C  
ANISOU 4842  C4   DC J  16    12924  21315  24068  -3840  -2844    368       C  
ATOM   4843  N4   DC J  16      88.663 103.583  18.890  1.00158.66           N  
ANISOU 4843  N4   DC J  16    13252  22106  24926  -3937  -2875    433       N  
ATOM   4844  C5   DC J  16      86.610 103.257  20.088  1.00149.57           C  
ANISOU 4844  C5   DC J  16    12841  20599  23390  -3874  -3093    253       C  
ATOM   4845  C6   DC J  16      85.310 102.947  20.009  1.00144.20           C  
ANISOU 4845  C6   DC J  16    12470  19808  22512  -3775  -3045    194       C  
ATOM   4846  P    DT J  17      79.626  99.955  19.060  1.00124.63           P  
ANISOU 4846  P    DT J  17     9460  23038  14856   2260    392   1961       P  
ATOM   4847  OP1  DT J  17      78.396 100.688  19.434  1.00121.22           O  
ANISOU 4847  OP1  DT J  17     9223  22835  13999   2180    429   2005       O  
ATOM   4848  OP2  DT J  17      80.212  98.970  19.995  1.00125.59           O  
ANISOU 4848  OP2  DT J  17     9391  23236  15090   2273    140   2088       O  
ATOM   4849  O5'  DT J  17      79.378  99.221  17.660  1.00117.52           O  
ANISOU 4849  O5'  DT J  17     8667  21904  14081   2344    527   1975       O  
ATOM   4850  C5'  DT J  17      78.731  99.920  16.602  1.00106.25           C  
ANISOU 4850  C5'  DT J  17     7454  20355  12561   2345    749   1873       C  
ATOM   4851  C4'  DT J  17      79.483  99.759  15.292  1.00101.57           C  
ANISOU 4851  C4'  DT J  17     6843  19417  12331   2423    922   1731       C  
ATOM   4852  O4'  DT J  17      80.878 100.116  15.483  1.00103.66           O  
ANISOU 4852  O4'  DT J  17     6883  19555  12947   2429    933   1572       O  
ATOM   4853  C3'  DT J  17      79.473  98.345  14.710  1.00100.16           C  
ANISOU 4853  C3'  DT J  17     6647  19133  12278   2508    873   1859       C  
ATOM   4854  O3'  DT J  17      79.197  98.392  13.316  1.00 95.79           O  
ANISOU 4854  O3'  DT J  17     6261  18338  11798   2554   1081   1774       O  
ATOM   4855  C2'  DT J  17      80.884  97.833  14.987  1.00104.21           C  
ANISOU 4855  C2'  DT J  17     6887  19533  13176   2559    774   1806       C  
ATOM   4856  C1'  DT J  17      81.702  99.113  14.935  1.00108.35           C  
ANISOU 4856  C1'  DT J  17     7336  19951  13880   2516    915   1567       C  
ATOM   4857  N1   DT J  17      82.963  99.047  15.737  1.00120.15           N  
ANISOU 4857  N1   DT J  17     8546  21450  15654   2524    773   1504       N  
ATOM   4858  C2   DT J  17      84.180  99.169  15.100  1.00122.93           C  
ANISOU 4858  C2   DT J  17     8738  21544  16425   2566    889   1309       C  
ATOM   4859  O2   DT J  17      84.293  99.332  13.898  1.00120.79           O  
ANISOU 4859  O2   DT J  17     8555  21034  16304   2590   1117   1184       O  
ATOM   4860  N3   DT J  17      85.268  99.094  15.931  1.00126.10           N  
ANISOU 4860  N3   DT J  17     8873  21973  17069   2574    727   1256       N  
ATOM   4861  C4   DT J  17      85.262  98.914  17.302  1.00128.36           C  
ANISOU 4861  C4   DT J  17     9053  22501  17217   2546    458   1379       C  
ATOM   4862  O4   DT J  17      86.292  98.858  17.964  1.00134.49           O  
ANISOU 4862  O4   DT J  17     9592  23269  18240   2561    310   1313       O  
ATOM   4863  C5   DT J  17      83.957  98.790  17.903  1.00124.16           C  
ANISOU 4863  C5   DT J  17     8711  22228  16236   2494    361   1583       C  
ATOM   4864  C7   DT J  17      83.830  98.583  19.382  1.00125.37           C  
ANISOU 4864  C7   DT J  17     8788  22647  16201   2447     84   1724       C  
ATOM   4865  C6   DT J  17      82.883  98.865  17.103  1.00123.07           C  
ANISOU 4865  C6   DT J  17     8819  22077  15863   2485    525   1633       C  
ATOM   4866  P    DT J  18      78.780  97.053  12.530  1.00 97.19           P  
ANISOU 4866  P    DT J  18     6507  18418  12001   2639   1066   1919       P  
ATOM   4867  OP1  DT J  18      77.933  97.449  11.382  1.00 96.69           O  
ANISOU 4867  OP1  DT J  18     6702  18218  11817   2646   1256   1857       O  
ATOM   4868  OP2  DT J  18      78.261  96.088  13.524  1.00 89.57           O  
ANISOU 4868  OP2  DT J  18     5487  17711  10833   2627    832   2164       O  
ATOM   4869  O5'  DT J  18      80.170  96.494  11.971  1.00100.23           O  
ANISOU 4869  O5'  DT J  18     6698  18541  12844   2721   1101   1811       O  
ATOM   4870  C5'  DT J  18      80.902  97.255  11.025  1.00101.55           C  
ANISOU 4870  C5'  DT J  18     6874  18437  13275   2726   1330   1566       C  
ATOM   4871  C4'  DT J  18      82.263  96.636  10.759  1.00107.79           C  
ANISOU 4871  C4'  DT J  18     7430  19034  14491   2798   1319   1471       C  
ATOM   4872  O4'  DT J  18      83.150  96.881  11.881  1.00110.18           O  
ANISOU 4872  O4'  DT J  18     7485  19450  14928   2771   1168   1433       O  
ATOM   4873  C3'  DT J  18      82.264  95.121  10.536  1.00111.65           C  
ANISOU 4873  C3'  DT J  18     7872  19490  15060   2900   1185   1639       C  
ATOM   4874  O3'  DT J  18      83.016  94.820   9.371  1.00118.96           O  
ANISOU 4874  O3'  DT J  18     8769  20122  16309   2971   1344   1489       O  
ATOM   4875  C2'  DT J  18      82.937  94.575  11.801  1.00111.69           C  
ANISOU 4875  C2'  DT J  18     7627  19650  15158   2913    910   1729       C  
ATOM   4876  C1'  DT J  18      83.885  95.712  12.138  1.00112.89           C  
ANISOU 4876  C1'  DT J  18     7627  19762  15504   2857    984   1506       C  
ATOM   4877  N1   DT J  18      84.336  95.738  13.562  1.00118.85           N  
ANISOU 4877  N1   DT J  18     8185  20720  16253   2826    737   1562       N  
ATOM   4878  C2   DT J  18      85.674  95.915  13.839  1.00131.04           C  
ANISOU 4878  C2   DT J  18     9470  22163  18157   2847    693   1397       C  
ATOM   4879  O2   DT J  18      86.522  96.044  12.975  1.00137.91           O  
ANISOU 4879  O2   DT J  18    10254  22790  19355   2885    861   1202       O  
ATOM   4880  N3   DT J  18      85.986  95.933  15.173  1.00134.77           N  
ANISOU 4880  N3   DT J  18     9787  22828  18593   2819    445   1461       N  
ATOM   4881  C4   DT J  18      85.111  95.796  16.236  1.00132.58           C  
ANISOU 4881  C4   DT J  18     9592  22828  17953   2763    252   1666       C  
ATOM   4882  O4   DT J  18      85.486  95.824  17.404  1.00135.40           O  
ANISOU 4882  O4   DT J  18     9811  23333  18303   2737     31   1702       O  
ATOM   4883  C5   DT J  18      83.724  95.616  15.876  1.00128.08           C  
ANISOU 4883  C5   DT J  18     9286  22358  17019   2735    327   1826       C  
ATOM   4884  C7   DT J  18      82.684  95.453  16.945  1.00131.77           C  
ANISOU 4884  C7   DT J  18     9857  23128  17083   2662    152   2041       C  
ATOM   4885  C6   DT J  18      83.408  95.596  14.571  1.00119.75           C  
ANISOU 4885  C6   DT J  18     8378  21115  16004   2772    557   1767       C  
ATOM   4886  P    DT J  19      82.776  93.448   8.572  1.00112.69           P  
ANISOU 4886  P    DT J  19     8039  19211  15567   3082   1314   1622       P  
ATOM   4887  OP1  DT J  19      82.724  93.775   7.130  1.00113.32           O  
ANISOU 4887  OP1  DT J  19     8290  19032  15734   3096   1585   1461       O  
ATOM   4888  OP2  DT J  19      81.642  92.738   9.204  1.00112.85           O  
ANISOU 4888  OP2  DT J  19     8160  19465  15254   3078   1129   1903       O  
ATOM   4889  O5'  DT J  19      84.104  92.613   8.864  1.00120.37           O  
ANISOU 4889  O5'  DT J  19     8724  20098  16914   3170   1163   1582       O  
ATOM   4890  C5'  DT J  19      85.371  93.249   8.765  1.00126.68           C  
ANISOU 4890  C5'  DT J  19     9328  20756  18050   3160   1257   1322       C  
ATOM   4891  C4'  DT J  19      86.426  92.462   9.516  1.00135.20           C  
ANISOU 4891  C4'  DT J  19    10118  21854  19399   3236   1012   1335       C  
ATOM   4892  O4'  DT J  19      86.456  92.877  10.912  1.00138.90           O  
ANISOU 4892  O4'  DT J  19    10470  22554  19753   3170    812   1402       O  
ATOM   4893  C3'  DT J  19      86.207  90.945   9.533  1.00137.80           C  
ANISOU 4893  C3'  DT J  19    10451  22190  19716   3348    804   1554       C  
ATOM   4894  O3'  DT J  19      87.437  90.285   9.311  1.00139.39           O  
ANISOU 4894  O3'  DT J  19    10433  22227  20303   3455    731   1430       O  
ATOM   4895  C2'  DT J  19      85.705  90.696  10.952  1.00139.89           C  
ANISOU 4895  C2'  DT J  19    10684  22731  19736   3306    517   1776       C  
ATOM   4896  C1'  DT J  19      86.526  91.722  11.708  1.00142.78           C  
ANISOU 4896  C1'  DT J  19    10859  23151  20238   3239    502   1597       C  
ATOM   4897  N1   DT J  19      86.020  92.022  13.084  1.00147.84           N  
ANISOU 4897  N1   DT J  19    11496  24073  20603   3155    298   1743       N  
ATOM   4898  C2   DT J  19      86.923  92.322  14.078  1.00151.17           C  
ANISOU 4898  C2   DT J  19    11690  24558  21189   3140    126   1661       C  
ATOM   4899  O2   DT J  19      88.126  92.374  13.892  1.00151.99           O  
ANISOU 4899  O2   DT J  19    11580  24502  21667   3194    135   1467       O  
ATOM   4900  N3   DT J  19      86.369  92.569  15.307  1.00151.78           N  
ANISOU 4900  N3   DT J  19    11796  24895  20978   3058    -56   1804       N  
ATOM   4901  C4   DT J  19      85.025  92.540  15.634  1.00146.39           C  
ANISOU 4901  C4   DT J  19    11333  24418  19870   2986    -74   2009       C  
ATOM   4902  O4   DT J  19      84.620  92.777  16.768  1.00141.97           O  
ANISOU 4902  O4   DT J  19    10783  24089  19069   2908   -234   2115       O  
ATOM   4903  C5   DT J  19      84.131  92.211  14.546  1.00145.99           C  
ANISOU 4903  C5   DT J  19    11500  24292  19680   3007    110   2082       C  
ATOM   4904  C7   DT J  19      82.650  92.148  14.779  1.00144.22           C  
ANISOU 4904  C7   DT J  19    11506  24278  19014   2934    108   2288       C  
ATOM   4905  C6   DT J  19      84.666  91.970  13.339  1.00147.40           C  
ANISOU 4905  C6   DT J  19    11662  24208  20134   3092    280   1951       C  
ATOM   4906  P    DT J  20      87.691  89.450   7.964  1.00151.23           P  
ANISOU 4906  P    DT J  20    11992  23480  21988   3569    861   1375       P  
ATOM   4907  OP1  DT J  20      87.967  90.417   6.878  1.00150.87           O  
ANISOU 4907  OP1  DT J  20    12014  23260  22049   3518   1197   1109       O  
ATOM   4908  OP2  DT J  20      86.593  88.468   7.816  1.00147.02           O  
ANISOU 4908  OP2  DT J  20    11662  23003  21197   3612    767   1661       O  
ATOM   4909  O5'  DT J  20      89.030  88.642   8.290  1.00153.75           O  
ANISOU 4909  O5'  DT J  20    12019  23718  22681   3690    654   1283       O  
ATOM   4910  C5'  DT J  20      89.875  89.082   9.351  1.00156.60           C  
ANISOU 4910  C5'  DT J  20    12129  24171  23203   3664    492   1178       C  
ATOM   4911  C4'  DT J  20      90.019  88.002  10.407  1.00160.99           C  
ANISOU 4911  C4'  DT J  20    12575  24834  23760   3745    105   1376       C  
ATOM   4912  O4'  DT J  20      89.493  88.472  11.680  1.00158.30           O  
ANISOU 4912  O4'  DT J  20    12246  24734  23166   3642    -63   1519       O  
ATOM   4913  C3'  DT J  20      89.272  86.692  10.105  1.00167.50           C  
ANISOU 4913  C3'  DT J  20    13574  25640  24429   3831    -16   1639       C  
ATOM   4914  O3'  DT J  20      90.064  85.571  10.501  1.00184.04           O  
ANISOU 4914  O3'  DT J  20    15507  27677  26744   3968   -308   1669       O  
ATOM   4915  C2'  DT J  20      88.045  86.813  11.007  1.00160.33           C  
ANISOU 4915  C2'  DT J  20    12832  24978  23107   3725   -135   1902       C  
ATOM   4916  C1'  DT J  20      88.701  87.444  12.217  1.00158.15           C  
ANISOU 4916  C1'  DT J  20    12352  24833  22904   3671   -306   1816       C  
ATOM   4917  N1   DT J  20      87.758  88.003  13.238  1.00152.61           N  
ANISOU 4917  N1   DT J  20    11760  24393  21829   3538   -386   1979       N  
ATOM   4918  C2   DT J  20      88.261  88.409  14.452  1.00152.01           C  
ANISOU 4918  C2   DT J  20    11524  24451  21781   3495   -589   1946       C  
ATOM   4919  O2   DT J  20      89.444  88.354  14.734  1.00155.09           O  
ANISOU 4919  O2   DT J  20    11679  24753  22497   3560   -712   1786       O  
ATOM   4920  N3   DT J  20      87.329  88.893  15.329  1.00146.96           N  
ANISOU 4920  N3   DT J  20    11009  24056  20774   3371   -647   2096       N  
ATOM   4921  C4   DT J  20      85.967  89.004  15.123  1.00142.29           C  
ANISOU 4921  C4   DT J  20    10668  23594  19803   3291   -525   2264       C  
ATOM   4922  O4   DT J  20      85.211  89.455  15.980  1.00139.88           O  
ANISOU 4922  O4   DT J  20    10449  23517  19181   3181   -586   2375       O  
ATOM   4923  C5   DT J  20      85.499  88.551  13.831  1.00141.20           C  
ANISOU 4923  C5   DT J  20    10680  23302  19667   3347   -323   2290       C  
ATOM   4924  C7   DT J  20      84.040  88.617  13.489  1.00138.07           C  
ANISOU 4924  C7   DT J  20    10548  23023  18889   3274   -189   2456       C  
ATOM   4925  C6   DT J  20      86.408  88.071  12.964  1.00145.10           C  
ANISOU 4925  C6   DT J  20    11067  23549  20513   3466   -265   2154       C  
ATOM   4926  P    DG J  21      91.407  85.151   9.720  1.00164.97           P  
ANISOU 4926  P    DG J  21    12890  25035  24757   4113   -266   1408       P  
ATOM   4927  OP1  DG J  21      91.891  86.248   8.853  1.00168.24           O  
ANISOU 4927  OP1  DG J  21    13253  25347  25325   4054     81   1106       O  
ATOM   4928  OP2  DG J  21      91.149  83.825   9.119  1.00166.98           O  
ANISOU 4928  OP2  DG J  21    13268  25174  25003   4241   -350   1569       O  
ATOM   4929  O5'  DG J  21      92.451  84.932  10.910  1.00167.40           O  
ANISOU 4929  O5'  DG J  21    12918  25403  25282   4173   -604   1334       O  
ATOM   4930  C5'  DG J  21      92.285  85.655  12.127  1.00166.65           C  
ANISOU 4930  C5'  DG J  21    12768  25499  25053   4059   -739   1385       C  
ATOM   4931  C4'  DG J  21      92.551  84.768  13.329  1.00167.68           C  
ANISOU 4931  C4'  DG J  21    12814  25712  25185   4132  -1173   1534       C  
ATOM   4932  O4'  DG J  21      91.672  85.155  14.421  1.00167.71           O  
ANISOU 4932  O4'  DG J  21    12936  25943  24843   4000  -1300   1741       O  
ATOM   4933  C3'  DG J  21      92.298  83.282  13.113  1.00166.74           C  
ANISOU 4933  C3'  DG J  21    12815  25512  25026   4265  -1373   1734       C  
ATOM   4934  O3'  DG J  21      93.180  82.537  13.944  1.00167.85           O  
ANISOU 4934  O3'  DG J  21    12786  25634  25356   4387  -1748   1710       O  
ATOM   4935  C2'  DG J  21      90.846  83.137  13.557  1.00165.85           C  
ANISOU 4935  C2'  DG J  21    12976  25570  24471   4149  -1413   2056       C  
ATOM   4936  C1'  DG J  21      90.813  84.078  14.750  1.00168.92           C  
ANISOU 4936  C1'  DG J  21    13289  26159  24734   4023  -1509   2042       C  
ATOM   4937  N9   DG J  21      89.488  84.618  15.040  1.00169.65           N  
ANISOU 4937  N9   DG J  21    13601  26449  24409   3864  -1398   2230       N  
ATOM   4938  C8   DG J  21      88.436  84.758  14.167  1.00167.28           C  
ANISOU 4938  C8   DG J  21    13520  26154  23885   3806  -1129   2325       C  
ATOM   4939  N7   DG J  21      87.374  85.284  14.713  1.00165.27           N  
ANISOU 4939  N7   DG J  21    13418  26111  23265   3667  -1095   2470       N  
ATOM   4940  C5   DG J  21      87.747  85.505  16.034  1.00167.34           C  
ANISOU 4940  C5   DG J  21    13564  26516  23502   3624  -1352   2478       C  
ATOM   4941  C6   DG J  21      87.012  86.056  17.110  1.00167.27           C  
ANISOU 4941  C6   DG J  21    13637  26757  23162   3483  -1436   2598       C  
ATOM   4942  O6   DG J  21      85.844  86.470  17.111  1.00165.65           O  
ANISOU 4942  O6   DG J  21    13618  26709  22611   3368  -1294   2719       O  
ATOM   4943  N1   DG J  21      87.767  86.099  18.281  1.00169.51           N  
ANISOU 4943  N1   DG J  21    13762  27102  23544   3489  -1720   2557       N  
ATOM   4944  C2   DG J  21      89.068  85.667  18.393  1.00170.79           C  
ANISOU 4944  C2   DG J  21    13704  27105  24084   3620  -1909   2411       C  
ATOM   4945  N2   DG J  21      89.642  85.785  19.598  1.00171.87           N  
ANISOU 4945  N2   DG J  21    13717  27324  24263   3611  -2190   2385       N  
ATOM   4946  N3   DG J  21      89.765  85.151  17.392  1.00171.90           N  
ANISOU 4946  N3   DG J  21    13754  27021  24541   3755  -1831   2288       N  
ATOM   4947  C4   DG J  21      89.045  85.101  16.248  1.00170.27           C  
ANISOU 4947  C4   DG J  21    13708  26750  24236   3745  -1546   2333       C  
ATOM   4948  P    DA J  22      93.200  80.930  13.914  1.00178.96           P  
ANISOU 4948  P    DA J  22    14284  26937  26775   4551  -2036   1884       P  
ATOM   4949  OP1  DA J  22      94.612  80.522  13.738  1.00180.14           O  
ANISOU 4949  OP1  DA J  22    14179  26947  27318   4734  -2164   1623       O  
ATOM   4950  OP2  DA J  22      92.180  80.440  12.961  1.00176.53           O  
ANISOU 4950  OP2  DA J  22    14236  26570  26268   4535  -1840   2072       O  
ATOM   4951  O5'  DA J  22      92.726  80.533  15.388  1.00174.45           O  
ANISOU 4951  O5'  DA J  22    13804  26532  25949   4499  -2417   2128       O  
ATOM   4952  C5'  DA J  22      93.017  81.403  16.478  1.00171.57           C  
ANISOU 4952  C5'  DA J  22    13306  26315  25567   4407  -2531   2052       C  
ATOM   4953  C4'  DA J  22      92.243  81.000  17.719  1.00170.24           C  
ANISOU 4953  C4'  DA J  22    13314  26313  25056   4329  -2832   2328       C  
ATOM   4954  O4'  DA J  22      91.030  81.801  17.834  1.00166.93           O  
ANISOU 4954  O4'  DA J  22    13071  26082  24274   4133  -2614   2471       O  
ATOM   4955  C3'  DA J  22      91.783  79.539  17.753  1.00171.96           C  
ANISOU 4955  C3'  DA J  22    13739  26462  25137   4415  -3072   2573       C  
ATOM   4956  O3'  DA J  22      91.936  79.033  19.068  1.00177.90           O  
ANISOU 4956  O3'  DA J  22    14521  27283  25790   4430  -3483   2680       O  
ATOM   4957  C2'  DA J  22      90.311  79.657  17.380  1.00168.07           C  
ANISOU 4957  C2'  DA J  22    13512  26077  24269   4263  -2842   2805       C  
ATOM   4958  C1'  DA J  22      89.955  80.935  18.110  1.00166.45           C  
ANISOU 4958  C1'  DA J  22    13273  26088  23881   4091  -2744   2771       C  
ATOM   4959  N9   DA J  22      88.702  81.549  17.671  1.00162.30           N  
ANISOU 4959  N9   DA J  22    12931  25694  23043   3937  -2437   2886       N  
ATOM   4960  C8   DA J  22      88.193  81.571  16.402  1.00160.02           C  
ANISOU 4960  C8   DA J  22    12740  25319  22742   3943  -2122   2887       C  
ATOM   4961  N7   DA J  22      87.038  82.189  16.306  1.00157.91           N  
ANISOU 4961  N7   DA J  22    12636  25209  22152   3796  -1912   2992       N  
ATOM   4962  C5   DA J  22      86.769  82.599  17.603  1.00158.34           C  
ANISOU 4962  C5   DA J  22    12698  25474  21989   3682  -2090   3067       C  
ATOM   4963  C6   DA J  22      85.690  83.309  18.173  1.00156.59           C  
ANISOU 4963  C6   DA J  22    12611  25493  21393   3509  -2004   3177       C  
ATOM   4964  N6   DA J  22      84.645  83.747  17.465  1.00153.60           N  
ANISOU 4964  N6   DA J  22    12386  25185  20790   3426  -1713   3230       N  
ATOM   4965  N1   DA J  22      85.731  83.555  19.502  1.00158.15           N  
ANISOU 4965  N1   DA J  22    12783  25854  21452   3429  -2233   3222       N  
ATOM   4966  C2   DA J  22      86.782  83.114  20.205  1.00158.81           C  
ANISOU 4966  C2   DA J  22    12722  25858  21761   3522  -2540   3160       C  
ATOM   4967  N3   DA J  22      87.852  82.437  19.781  1.00159.46           N  
ANISOU 4967  N3   DA J  22    12664  25721  22203   3694  -2661   3050       N  
ATOM   4968  C4   DA J  22      87.783  82.210  18.458  1.00160.29           C  
ANISOU 4968  C4   DA J  22    12792  25675  22436   3764  -2415   3007       C  
ATOM   4969  P    DT J  23      91.809  77.460  19.376  1.00179.98           P  
ANISOU 4969  P    DT J  23    14973  27444  25967   4547  -3836   2886       P  
ATOM   4970  OP1  DT J  23      93.125  76.842  19.100  1.00185.91           O  
ANISOU 4970  OP1  DT J  23    15530  28006  27102   4778  -4014   2680       O  
ATOM   4971  OP2  DT J  23      90.596  76.926  18.718  1.00177.38           O  
ANISOU 4971  OP2  DT J  23    14912  27112  25372   4474  -3670   3129       O  
ATOM   4972  O5'  DT J  23      91.541  77.426  20.949  1.00176.92           O  
ANISOU 4972  O5'  DT J  23    14686  27214  25321   4458  -4179   3028       O  
ATOM   4973  C5'  DT J  23      91.721  78.610  21.719  1.00171.15           C  
ANISOU 4973  C5'  DT J  23    13818  26646  24567   4344  -4152   2916       C  
ATOM   4974  C4'  DT J  23      90.624  78.747  22.757  1.00165.25           C  
ANISOU 4974  C4'  DT J  23    13302  26104  23382   4157  -4247   3154       C  
ATOM   4975  O4'  DT J  23      89.520  79.517  22.206  1.00160.81           O  
ANISOU 4975  O4'  DT J  23    12840  25681  22580   3984  -3865   3233       O  
ATOM   4976  C3'  DT J  23      90.030  77.420  23.230  1.00162.37           C  
ANISOU 4976  C3'  DT J  23    13219  25700  22774   4173  -4533   3416       C  
ATOM   4977  O3'  DT J  23      89.914  77.412  24.644  1.00160.07           O  
ANISOU 4977  O3'  DT J  23    13025  25527  22267   4099  -4835   3505       O  
ATOM   4978  C2'  DT J  23      88.664  77.378  22.549  1.00160.17           C  
ANISOU 4978  C2'  DT J  23    13157  25498  22205   4028  -4238   3615       C  
ATOM   4979  C1'  DT J  23      88.307  78.854  22.476  1.00159.40           C  
ANISOU 4979  C1'  DT J  23    12954  25585  22027   3877  -3915   3514       C  
ATOM   4980  N1   DT J  23      87.330  79.177  21.387  1.00157.65           N  
ANISOU 4980  N1   DT J  23    12827  25403  21668   3790  -3523   3577       N  
ATOM   4981  C2   DT J  23      86.192  79.899  21.685  1.00155.71           C  
ANISOU 4981  C2   DT J  23    12710  25381  21072   3595  -3342   3685       C  
ATOM   4982  O2   DT J  23      85.930  80.303  22.803  1.00158.45           O  
ANISOU 4982  O2   DT J  23    13096  25897  21210   3480  -3473   3735       O  
ATOM   4983  N3   DT J  23      85.368  80.133  20.612  1.00150.07           N  
ANISOU 4983  N3   DT J  23    12080  24681  20260   3545  -3002   3722       N  
ATOM   4984  C4   DT J  23      85.562  79.725  19.305  1.00147.98           C  
ANISOU 4984  C4   DT J  23    11796  24227  20203   3663  -2826   3670       C  
ATOM   4985  O4   DT J  23      84.765  79.982  18.408  1.00143.70           O  
ANISOU 4985  O4   DT J  23    11348  23706  19545   3611  -2530   3706       O  
ATOM   4986  C5   DT J  23      86.767  78.974  19.065  1.00151.80           C  
ANISOU 4986  C5   DT J  23    12147  24483  21048   3857  -3018   3562       C  
ATOM   4987  C7   DT J  23      87.077  78.478  17.684  1.00150.27           C  
ANISOU 4987  C7   DT J  23    11929  24070  21098   3995  -2843   3493       C  
ATOM   4988  C6   DT J  23      87.583  78.737  20.104  1.00156.99           C  
ANISOU 4988  C6   DT J  23    12710  25131  21807   3914  -3356   3518       C  
ATOM   4989  P    DG J  24      90.127  76.044  25.459  1.00177.56           P  
ANISOU 4989  P    DG J  24    15433  27629  24402   4208  -5296   3641       P  
ATOM   4990  OP1  DG J  24      91.430  76.119  26.157  1.00181.32           O  
ANISOU 4990  OP1  DG J  24    15709  28042  25144   4365  -5604   3434       O  
ATOM   4991  OP2  DG J  24      89.852  74.930  24.523  1.00178.38           O  
ANISOU 4991  OP2  DG J  24    15680  27567  24531   4300  -5261   3755       O  
ATOM   4992  O5'  DG J  24      88.949  76.057  26.537  1.00166.98           O  
ANISOU 4992  O5'  DG J  24    14377  26477  22592   3991  -5379   3883       O  
ATOM   4993  C5'  DG J  24      87.618  75.791  26.126  1.00152.39           C  
ANISOU 4993  C5'  DG J  24    12764  24700  20438   3834  -5167   4104       C  
ATOM   4994  C4'  DG J  24      86.628  76.597  26.940  1.00143.03           C  
ANISOU 4994  C4'  DG J  24    11689  23766  18890   3595  -5061   4207       C  
ATOM   4995  O4'  DG J  24      86.008  77.593  26.092  1.00138.38           O  
ANISOU 4995  O4'  DG J  24    11008  23304  18265   3485  -4630   4161       O  
ATOM   4996  C3'  DG J  24      85.478  75.791  27.508  1.00140.24           C  
ANISOU 4996  C3'  DG J  24    11675  23467  18142   3448  -5166   4475       C  
ATOM   4997  O3'  DG J  24      84.967  76.410  28.678  1.00137.41           O  
ANISOU 4997  O3'  DG J  24    11402  23312  17498   3273  -5219   4528       O  
ATOM   4998  C2'  DG J  24      84.465  75.812  26.370  1.00140.06           C  
ANISOU 4998  C2'  DG J  24    11718  23481  18020   3358  -4801   4568       C  
ATOM   4999  C1'  DG J  24      84.709  77.171  25.714  1.00137.31           C  
ANISOU 4999  C1'  DG J  24    11105  23232  17837   3351  -4465   4369       C  
ATOM   5000  N9   DG J  24      84.647  77.128  24.253  1.00134.88           N  
ANISOU 5000  N9   DG J  24    10724  22818  17705   3427  -4175   4320       N  
ATOM   5001  C8   DG J  24      85.593  76.610  23.405  1.00136.58           C  
ANISOU 5001  C8   DG J  24    10811  22807  18276   3633  -4208   4205       C  
ATOM   5002  N7   DG J  24      85.276  76.709  22.144  1.00134.52           N  
ANISOU 5002  N7   DG J  24    10527  22490  18094   3655  -3899   4183       N  
ATOM   5003  C5   DG J  24      84.035  77.329  22.154  1.00131.88           C  
ANISOU 5003  C5   DG J  24    10311  22363  17435   3458  -3655   4288       C  
ATOM   5004  C6   DG J  24      83.194  77.697  21.077  1.00126.41           C  
ANISOU 5004  C6   DG J  24     9661  21712  16657   3399  -3292   4309       C  
ATOM   5005  O6   DG J  24      83.388  77.539  19.863  1.00124.40           O  
ANISOU 5005  O6   DG J  24     9359  21308  16600   3507  -3104   4243       O  
ATOM   5006  N1   DG J  24      82.023  78.304  21.522  1.00124.33           N  
ANISOU 5006  N1   DG J  24     9515  21689  16035   3197  -3152   4409       N  
ATOM   5007  C2   DG J  24      81.706  78.528  22.843  1.00126.32           C  
ANISOU 5007  C2   DG J  24     9837  22117  16044   3060  -3326   4481       C  
ATOM   5008  N2   DG J  24      80.531  79.128  23.083  1.00121.79           N  
ANISOU 5008  N2   DG J  24     9365  21767  15140   2873  -3141   4559       N  
ATOM   5009  N3   DG J  24      82.487  78.189  23.862  1.00130.54           N  
ANISOU 5009  N3   DG J  24    10344  22603  16650   3110  -3663   4469       N  
ATOM   5010  C4   DG J  24      83.631  77.595  23.445  1.00132.59           C  
ANISOU 5010  C4   DG J  24    10488  22633  17258   3314  -3816   4371       C  
ATOM   5011  P    DG J  25      84.248  75.519  29.806  1.00137.48           P  
ANISOU 5011  P    DG J  25    11751  23343  17144   3156  -5492   4752       P  
ATOM   5012  OP1  DG J  25      84.275  76.277  31.077  1.00139.58           O  
ANISOU 5012  OP1  DG J  25    12017  23771  17246   3050  -5609   4717       O  
ATOM   5013  OP2  DG J  25      84.839  74.164  29.743  1.00138.15           O  
ANISOU 5013  OP2  DG J  25    11958  23182  17351   3336  -5803   4803       O  
ATOM   5014  O5'  DG J  25      82.739  75.402  29.291  1.00133.69           O  
ANISOU 5014  O5'  DG J  25    11457  22976  16361   2953  -5194   4935       O  
ATOM   5015  C5'  DG J  25      82.047  76.561  28.848  1.00129.34           C  
ANISOU 5015  C5'  DG J  25    10791  22631  15721   2816  -4814   4885       C  
ATOM   5016  C4'  DG J  25      80.866  76.181  27.975  1.00126.87           C  
ANISOU 5016  C4'  DG J  25    10618  22346  15240   2710  -4554   5026       C  
ATOM   5017  O4'  DG J  25      81.274  76.118  26.577  1.00125.52           O  
ANISOU 5017  O4'  DG J  25    10298  22036  15358   2862  -4367   4937       O  
ATOM   5018  C3'  DG J  25      80.239  74.813  28.287  1.00128.25           C  
ANISOU 5018  C3'  DG J  25    11100  22419  15209   2650  -4752   5242       C  
ATOM   5019  O3'  DG J  25      78.829  74.919  28.222  1.00132.45           O  
ANISOU 5019  O3'  DG J  25    11781  23116  15427   2431  -4523   5371       O  
ATOM   5020  C2'  DG J  25      80.763  73.946  27.145  1.00128.45           C  
ANISOU 5020  C2'  DG J  25    11098  22201  15505   2843  -4767   5234       C  
ATOM   5021  C1'  DG J  25      80.705  74.960  26.022  1.00126.39           C  
ANISOU 5021  C1'  DG J  25    10607  22018  15399   2864  -4387   5099       C  
ATOM   5022  N9   DG J  25      81.415  74.573  24.801  1.00125.20           N  
ANISOU 5022  N9   DG J  25    10334  21657  15581   3067  -4322   5013       N  
ATOM   5023  C8   DG J  25      82.565  73.828  24.700  1.00127.71           C  
ANISOU 5023  C8   DG J  25    10596  21745  16184   3280  -4578   4948       C  
ATOM   5024  N7   DG J  25      82.954  73.636  23.468  1.00126.84           N  
ANISOU 5024  N7   DG J  25    10377  21481  16335   3425  -4425   4871       N  
ATOM   5025  C5   DG J  25      81.990  74.281  22.703  1.00123.54           C  
ANISOU 5025  C5   DG J  25     9957  21195  15788   3301  -4053   4894       C  
ATOM   5026  C6   DG J  25      81.873  74.412  21.297  1.00121.34           C  
ANISOU 5026  C6   DG J  25     9605  20835  15663   3372  -3753   4836       C  
ATOM   5027  O6   DG J  25      82.624  73.969  20.417  1.00123.43           O  
ANISOU 5027  O6   DG J  25     9783  20890  16225   3555  -3745   4752       O  
ATOM   5028  N1   DG J  25      80.743  75.146  20.940  1.00118.34           N  
ANISOU 5028  N1   DG J  25     9267  20645  15053   3210  -3437   4875       N  
ATOM   5029  C2   DG J  25      79.842  75.682  21.830  1.00117.59           C  
ANISOU 5029  C2   DG J  25     9259  20792  14626   3004  -3409   4954       C  
ATOM   5030  N2   DG J  25      78.813  76.362  21.309  1.00114.70           N  
ANISOU 5030  N2   DG J  25     8916  20588  14075   2882  -3091   4966       N  
ATOM   5031  N3   DG J  25      79.942  75.566  23.145  1.00119.61           N  
ANISOU 5031  N3   DG J  25     9582  21125  14740   2928  -3674   5009       N  
ATOM   5032  C4   DG J  25      81.035  74.857  23.509  1.00122.52           C  
ANISOU 5032  C4   DG J  25     9924  21305  15323   3085  -3990   4978       C  
ATOM   5033  P    DA J  26      77.940  75.053  29.552  1.00128.01           P  
ANISOU 5033  P    DA J  26    11414  22741  14482   2196  -4597   5481       P  
ATOM   5034  OP1  DA J  26      78.634  75.983  30.470  1.00127.82           O  
ANISOU 5034  OP1  DA J  26    11252  22819  14495   2212  -4701   5354       O  
ATOM   5035  OP2  DA J  26      77.601  73.686  30.009  1.00128.92           O  
ANISOU 5035  OP2  DA J  26    11830  22716  14438   2154  -4844   5662       O  
ATOM   5036  O5'  DA J  26      76.596  75.750  29.024  1.00123.40           O  
ANISOU 5036  O5'  DA J  26    10822  22380  13685   2004  -4203   5507       O  
ATOM   5037  C5'  DA J  26      76.655  77.064  28.472  1.00120.94           C  
ANISOU 5037  C5'  DA J  26    10271  22217  13464   2020  -3911   5349       C  
ATOM   5038  C4'  DA J  26      75.610  77.275  27.378  1.00117.85           C  
ANISOU 5038  C4'  DA J  26     9878  21911  12987   1947  -3561   5371       C  
ATOM   5039  O4'  DA J  26      76.127  76.845  26.094  1.00117.17           O  
ANISOU 5039  O4'  DA J  26     9713  21628  13178   2131  -3493   5334       O  
ATOM   5040  C3'  DA J  26      74.291  76.543  27.549  1.00117.53           C  
ANISOU 5040  C3'  DA J  26    10073  21931  12653   1755  -3526   5544       C  
ATOM   5041  O3'  DA J  26      73.266  77.320  26.947  1.00114.58           O  
ANISOU 5041  O3'  DA J  26     9642  21750  12143   1647  -3179   5505       O  
ATOM   5042  C2'  DA J  26      74.536  75.240  26.782  1.00118.37           C  
ANISOU 5042  C2'  DA J  26    10288  21779  12910   1875  -3646   5639       C  
ATOM   5043  C1'  DA J  26      75.400  75.722  25.619  1.00117.07           C  
ANISOU 5043  C1'  DA J  26     9894  21513  13074   2088  -3503   5490       C  
ATOM   5044  N9   DA J  26      76.383  74.751  25.149  1.00118.81           N  
ANISOU 5044  N9   DA J  26    10121  21454  13568   2291  -3709   5499       N  
ATOM   5045  C8   DA J  26      77.300  74.086  25.906  1.00121.88           C  
ANISOU 5045  C8   DA J  26    10562  21693  14055   2388  -4060   5517       C  
ATOM   5046  N7   DA J  26      78.089  73.301  25.217  1.00122.93           N  
ANISOU 5046  N7   DA J  26    10675  21581  14450   2584  -4178   5502       N  
ATOM   5047  C5   DA J  26      77.676  73.477  23.910  1.00120.32           C  
ANISOU 5047  C5   DA J  26    10277  21236  14204   2614  -3875   5477       C  
ATOM   5048  C6   DA J  26      78.120  72.921  22.696  1.00119.93           C  
ANISOU 5048  C6   DA J  26    10184  20973  14412   2790  -3816   5448       C  
ATOM   5049  N6   DA J  26      79.123  72.041  22.618  1.00122.29           N  
ANISOU 5049  N6   DA J  26    10491  21030  14944   2976  -4070   5436       N  
ATOM   5050  N1   DA J  26      77.493  73.303  21.565  1.00117.11           N  
ANISOU 5050  N1   DA J  26     9780  20655  14060   2774  -3487   5425       N  
ATOM   5051  C2   DA J  26      76.490  74.185  21.652  1.00114.86           C  
ANISOU 5051  C2   DA J  26     9489  20614  13538   2601  -3243   5424       C  
ATOM   5052  N3   DA J  26      75.985  74.777  22.738  1.00114.97           N  
ANISOU 5052  N3   DA J  26     9531  20850  13302   2427  -3267   5444       N  
ATOM   5053  C4   DA J  26      76.631  74.375  23.844  1.00117.77           C  
ANISOU 5053  C4   DA J  26     9935  21154  13659   2440  -3589   5473       C  
ATOM   5054  P    DG J  27      71.718  77.010  27.231  1.00 93.13           P  
ANISOU 5054  P    DG J  27    10661  12615  12108   3947  -2893   -307       P  
ATOM   5055  OP1  DG J  27      70.982  78.291  27.127  1.00 96.12           O  
ANISOU 5055  OP1  DG J  27    10971  12999  12551   3763  -2922   -360       O  
ATOM   5056  OP2  DG J  27      71.631  76.196  28.465  1.00 93.62           O  
ANISOU 5056  OP2  DG J  27    10909  12712  11952   4143  -2918   -259       O  
ATOM   5057  O5'  DG J  27      71.291  76.096  25.995  1.00 91.61           O  
ANISOU 5057  O5'  DG J  27    10550  12310  11949   3927  -2737   -184       O  
ATOM   5058  C5'  DG J  27      71.568  76.527  24.668  1.00 86.27           C  
ANISOU 5058  C5'  DG J  27     9692  11622  11466   3794  -2689   -205       C  
ATOM   5059  C4'  DG J  27      71.378  75.389  23.687  1.00 81.82           C  
ANISOU 5059  C4'  DG J  27     9224  10973  10893   3857  -2559   -124       C  
ATOM   5060  O4'  DG J  27      72.587  74.579  23.635  1.00 84.57           O  
ANISOU 5060  O4'  DG J  27     9519  11322  11290   4021  -2553   -144       O  
ATOM   5061  C3'  DG J  27      70.246  74.416  24.040  1.00 81.30           C  
ANISOU 5061  C3'  DG J  27     9446  10804  10638   3936  -2482    -13       C  
ATOM   5062  O3'  DG J  27      69.612  73.977  22.848  1.00 83.49           O  
ANISOU 5062  O3'  DG J  27     9773  11011  10940   3891  -2374     28       O  
ATOM   5063  C2'  DG J  27      71.010  73.271  24.693  1.00 86.06           C  
ANISOU 5063  C2'  DG J  27    10144  11373  11180   4160  -2472     17       C  
ATOM   5064  C1'  DG J  27      72.209  73.233  23.771  1.00 88.77           C  
ANISOU 5064  C1'  DG J  27    10282  11747  11700   4180  -2463    -57       C  
ATOM   5065  N9   DG J  27      73.336  72.439  24.251  1.00100.29           N  
ANISOU 5065  N9   DG J  27    11728  13212  13166   4376  -2477    -55       N  
ATOM   5066  C8   DG J  27      73.709  72.206  25.553  1.00105.51           C  
ANISOU 5066  C8   DG J  27    12446  13924  13718   4508  -2554    -32       C  
ATOM   5067  N7   DG J  27      74.763  71.440  25.660  1.00109.52           N  
ANISOU 5067  N7   DG J  27    12912  14436  14266   4679  -2545    -19       N  
ATOM   5068  C5   DG J  27      75.102  71.143  24.344  1.00108.18           C  
ANISOU 5068  C5   DG J  27    12659  14201  14242   4658  -2448    -44       C  
ATOM   5069  C6   DG J  27      76.156  70.350  23.823  1.00112.98           C  
ANISOU 5069  C6   DG J  27    13193  14780  14956   4802  -2384    -46       C  
ATOM   5070  O6   DG J  27      77.034  69.732  24.442  1.00119.29           O  
ANISOU 5070  O6   DG J  27    13979  15599  15748   4976  -2404    -11       O  
ATOM   5071  N1   DG J  27      76.132  70.314  22.429  1.00110.63           N  
ANISOU 5071  N1   DG J  27    12821  14437  14777   4738  -2282    -94       N  
ATOM   5072  C2   DG J  27      75.207  70.960  21.643  1.00105.96           C  
ANISOU 5072  C2   DG J  27    12221  13844  14195   4559  -2255   -125       C  
ATOM   5073  N2   DG J  27      75.335  70.817  20.317  1.00103.73           N  
ANISOU 5073  N2   DG J  27    11848  13552  14012   4540  -2154   -175       N  
ATOM   5074  N3   DG J  27      74.220  71.701  22.120  1.00103.86           N  
ANISOU 5074  N3   DG J  27    12021  13601  13841   4418  -2317   -106       N  
ATOM   5075  C4   DG J  27      74.228  71.747  23.471  1.00104.35           C  
ANISOU 5075  C4   DG J  27    12163  13693  13792   4477  -2408    -70       C  
ATOM   5076  P    DC J  28      68.250  74.658  22.332  1.00 83.16           P  
ANISOU 5076  P    DC J  28     9761  10973  10864   3706  -2346     76       P  
ATOM   5077  OP1  DC J  28      68.354  76.116  22.558  1.00 80.27           O  
ANISOU 5077  OP1  DC J  28     9205  10705  10587   3544  -2430     23       O  
ATOM   5078  OP2  DC J  28      67.117  73.902  22.910  1.00 82.67           O  
ANISOU 5078  OP2  DC J  28     9974  10809  10627   3763  -2292    186       O  
ATOM   5079  O5'  DC J  28      68.271  74.380  20.756  1.00 86.88           O  
ANISOU 5079  O5'  DC J  28    10137  11449  11423   3677  -2265     54       O  
ATOM   5080  C5'  DC J  28      69.267  74.990  19.943  1.00 87.35           C  
ANISOU 5080  C5'  DC J  28     9922  11609  11658   3619  -2274    -22       C  
ATOM   5081  C4'  DC J  28      69.766  74.039  18.866  1.00 82.19           C  
ANISOU 5081  C4'  DC J  28     9261  10930  11037   3672  -2140    -57       C  
ATOM   5082  O4'  DC J  28      70.753  73.134  19.422  1.00 80.14           O  
ANISOU 5082  O4'  DC J  28     9050  10609  10793   3936  -2178    -91       O  
ATOM   5083  C3'  DC J  28      68.705  73.157  18.219  1.00 81.31           C  
ANISOU 5083  C3'  DC J  28     9376  10721  10798   3527  -1944    -17       C  
ATOM   5084  O3'  DC J  28      69.010  73.003  16.841  1.00 86.77           O  
ANISOU 5084  O3'  DC J  28     9952  11477  11539   3406  -1798    -71       O  
ATOM   5085  C2'  DC J  28      68.848  71.838  18.982  1.00 78.88           C  
ANISOU 5085  C2'  DC J  28     9303  10244  10423   3753  -1923     -2       C  
ATOM   5086  C1'  DC J  28      70.348  71.793  19.231  1.00 81.34           C  
ANISOU 5086  C1'  DC J  28     9447  10606  10852   3991  -2025    -65       C  
ATOM   5087  N1   DC J  28      70.746  71.025  20.447  1.00 86.37           N  
ANISOU 5087  N1   DC J  28    10227  11152  11437   4259  -2095    -21       N  
ATOM   5088  C2   DC J  28      71.805  70.116  20.376  1.00 89.14           C  
ANISOU 5088  C2   DC J  28    10569  11446  11853   4444  -2040    -49       C  
ATOM   5089  O2   DC J  28      72.382  69.947  19.296  1.00 92.96           O  
ANISOU 5089  O2   DC J  28    10928  11955  12438   4450  -1963   -130       O  
ATOM   5090  N3   DC J  28      72.166  69.442  21.495  1.00 86.19           N  
ANISOU 5090  N3   DC J  28    10319  11005  11424   4588  -2050     24       N  
ATOM   5091  C4   DC J  28      71.522  69.657  22.642  1.00 82.67           C  
ANISOU 5091  C4   DC J  28     9996  10563  10851   4560  -2109    111       C  
ATOM   5092  N4   DC J  28      71.912  68.966  23.719  1.00 73.20           N  
ANISOU 5092  N4   DC J  28     8896   9329   9589   4719  -2112    192       N  
ATOM   5093  C5   DC J  28      70.439  70.575  22.733  1.00 81.34           C  
ANISOU 5093  C5   DC J  28     9846  10447  10612   4376  -2159    125       C  
ATOM   5094  C6   DC J  28      70.095  71.240  21.625  1.00 86.14           C  
ANISOU 5094  C6   DC J  28    10334  11107  11289   4227  -2152     62       C  
ATOM   5095  P    DA J  29      67.970  72.291  15.846  1.00 90.02           P  
ANISOU 5095  P    DA J  29    10522  11849  11834   3203  -1598    -79       P  
ATOM   5096  OP1  DA J  29      68.153  72.894  14.507  1.00 93.15           O  
ANISOU 5096  OP1  DA J  29    10699  12429  12266   3036  -1509   -107       O  
ATOM   5097  OP2  DA J  29      66.638  72.312  16.488  1.00 97.26           O  
ANISOU 5097  OP2  DA J  29    11633  12687  12633   3100  -1608      9       O  
ATOM   5098  O5'  DA J  29      68.475  70.775  15.802  1.00 88.32           O  
ANISOU 5098  O5'  DA J  29    10477  11464  11617   3375  -1495   -157       O  
ATOM   5099  C5'  DA J  29      69.862  70.496  15.663  1.00 88.26           C  
ANISOU 5099  C5'  DA J  29    10338  11474  11721   3576  -1509   -224       C  
ATOM   5100  C4'  DA J  29      70.141  69.011  15.814  1.00 91.84           C  
ANISOU 5100  C4'  DA J  29    10996  11723  12176   3752  -1404   -273       C  
ATOM   5101  O4'  DA J  29      70.337  68.682  17.215  1.00 94.60           O  
ANISOU 5101  O4'  DA J  29    11466  11953  12527   3986  -1521   -187       O  
ATOM   5102  C3'  DA J  29      69.030  68.081  15.332  1.00 92.25           C  
ANISOU 5102  C3'  DA J  29    11281  11626  12144   3596  -1234   -311       C  
ATOM   5103  O3'  DA J  29      69.617  66.905  14.826  1.00 96.42           O  
ANISOU 5103  O3'  DA J  29    11884  12021  12729   3713  -1093   -422       O  
ATOM   5104  C2'  DA J  29      68.278  67.789  16.625  1.00 92.66           C  
ANISOU 5104  C2'  DA J  29    11549  11515  12145   3667  -1296   -184       C  
ATOM   5105  C1'  DA J  29      69.457  67.634  17.561  1.00 96.06           C  
ANISOU 5105  C1'  DA J  29    11932  11920  12647   3986  -1412   -144       C  
ATOM   5106  N9   DA J  29      69.137  67.743  18.977  1.00 98.15           N  
ANISOU 5106  N9   DA J  29    12308  12134  12851   4129  -1540     -7       N  
ATOM   5107  C8   DA J  29      68.106  68.433  19.555  1.00 96.62           C  
ANISOU 5107  C8   DA J  29    12171  11983  12557   4005  -1614     84       C  
ATOM   5108  N7   DA J  29      68.088  68.348  20.868  1.00100.11           N  
ANISOU 5108  N7   DA J  29    12709  12390  12940   4212  -1722    196       N  
ATOM   5109  C5   DA J  29      69.186  67.552  21.162  1.00 99.93           C  
ANISOU 5109  C5   DA J  29    12685  12299  12984   4489  -1722    188       C  
ATOM   5110  C6   DA J  29      69.727  67.076  22.376  1.00 99.96           C  
ANISOU 5110  C6   DA J  29    12755  12271  12957   4774  -1794    291       C  
ATOM   5111  N6   DA J  29      69.214  67.354  23.580  1.00102.97           N  
ANISOU 5111  N6   DA J  29    13214  12698  13214   4742  -1852    408       N  
ATOM   5112  N1   DA J  29      70.832  66.304  22.303  1.00 99.19           N  
ANISOU 5112  N1   DA J  29    12618  12120  12952   4942  -1739    267       N  
ATOM   5113  C2   DA J  29      71.348  66.027  21.103  1.00 99.07           C  
ANISOU 5113  C2   DA J  29    12519  12070  13054   4951  -1655    138       C  
ATOM   5114  N3   DA J  29      70.932  66.411  19.905  1.00 98.30           N  
ANISOU 5114  N3   DA J  29    12355  12013  12980   4661  -1565     25       N  
ATOM   5115  C4   DA J  29      69.838  67.176  20.005  1.00 98.80           C  
ANISOU 5115  C4   DA J  29    12450  12140  12950   4438  -1608     63       C  
ATOM   5116  P    DG J  30      68.948  66.128  13.595  1.00102.82           P  
ANISOU 5116  P    DG J  30    12794  12779  13494   3515   -891   -573       P  
ATOM   5117  OP1  DG J  30      69.649  66.579  12.371  1.00101.89           O  
ANISOU 5117  OP1  DG J  30    12447  12890  13375   3462   -840   -682       O  
ATOM   5118  OP2  DG J  30      67.479  66.263  13.700  1.00102.51           O  
ANISOU 5118  OP2  DG J  30    12889  12707  13355   3278   -878   -523       O  
ATOM   5119  O5'  DG J  30      69.334  64.600  13.857  1.00102.90           O  
ANISOU 5119  O5'  DG J  30    13006  12491  13600   3717   -767   -639       O  
ATOM   5120  C5'  DG J  30      70.689  64.190  13.754  1.00104.74           C  
ANISOU 5120  C5'  DG J  30    13148  12710  13939   3967   -744   -693       C  
ATOM   5121  C4'  DG J  30      70.956  62.974  14.622  1.00107.05           C  
ANISOU 5121  C4'  DG J  30    13643  12698  14333   4217   -687   -642       C  
ATOM   5122  O4'  DG J  30      70.867  63.341  16.020  1.00104.00           O  
ANISOU 5122  O4'  DG J  30    13299  12291  13926   4357   -847   -438       O  
ATOM   5123  C3'  DG J  30      69.994  61.803  14.414  1.00110.39           C  
ANISOU 5123  C3'  DG J  30    14321  12834  14787   4109   -508   -717       C  
ATOM   5124  O3'  DG J  30      70.738  60.608  14.211  1.00116.95           O  
ANISOU 5124  O3'  DG J  30    15231  13445  15759   4312   -360   -813       O  
ATOM   5125  C2'  DG J  30      69.175  61.759  15.711  1.00107.80           C  
ANISOU 5125  C2'  DG J  30    14161  12362  14438   4139   -579   -507       C  
ATOM   5126  C1'  DG J  30      70.137  62.365  16.722  1.00105.20           C  
ANISOU 5126  C1'  DG J  30    13709  12159  14104   4407   -761   -352       C  
ATOM   5127  N9   DG J  30      69.475  63.022  17.849  1.00101.30           N  
ANISOU 5127  N9   DG J  30    13260  11717  13512   4404   -909   -165       N  
ATOM   5128  C8   DG J  30      68.547  64.033  17.789  1.00 96.75           C  
ANISOU 5128  C8   DG J  30    12639  11301  12819   4156   -993   -137       C  
ATOM   5129  N7   DG J  30      68.137  64.434  18.961  1.00 95.64           N  
ANISOU 5129  N7   DG J  30    12557  11176  12605   4235  -1115     32       N  
ATOM   5130  C5   DG J  30      68.845  63.644  19.858  1.00 99.37           C  
ANISOU 5130  C5   DG J  30    13113  11511  13134   4559  -1118    132       C  
ATOM   5131  C6   DG J  30      68.820  63.624  21.274  1.00104.97           C  
ANISOU 5131  C6   DG J  30    13902  12204  13776   4793  -1224    327       C  
ATOM   5132  O6   DG J  30      68.144  64.326  22.041  1.00104.46           O  
ANISOU 5132  O6   DG J  30    13860  12241  13589   4754  -1338    434       O  
ATOM   5133  N1   DG J  30      69.693  62.669  21.791  1.00110.85           N  
ANISOU 5133  N1   DG J  30    14701  12815  14602   5115  -1180    398       N  
ATOM   5134  C2   DG J  30      70.488  61.839  21.035  1.00112.46           C  
ANISOU 5134  C2   DG J  30    14887  12890  14951   5198  -1045    288       C  
ATOM   5135  N2   DG J  30      71.268  60.980  21.706  1.00116.04           N  
ANISOU 5135  N2   DG J  30    15393  13220  15477   5535  -1012    399       N  
ATOM   5136  N3   DG J  30      70.519  61.848  19.709  1.00108.07           N  
ANISOU 5136  N3   DG J  30    14261  12342  14458   4979   -943     85       N  
ATOM   5137  C4   DG J  30      69.676  62.772  19.190  1.00102.20           C  
ANISOU 5137  C4   DG J  30    13461  11751  13620   4667   -990     21       C  
ATOM   5138  P    DT J  31      69.989  59.212  13.946  1.00114.54           P  
ANISOU 5138  P    DT J  31    15177  12781  15563   4240   -146   -929       P  
ATOM   5139  OP1  DT J  31      70.890  58.373  13.126  1.00114.99           O  
ANISOU 5139  OP1  DT J  31    15213  12744  15733   4373      9  -1130       O  
ATOM   5140  OP2  DT J  31      68.618  59.503  13.472  1.00111.01           O  
ANISOU 5140  OP2  DT J  31    14786  12381  15013   3891   -130   -996       O  
ATOM   5141  O5'  DT J  31      69.886  58.565  15.402  1.00115.46           O  
ANISOU 5141  O5'  DT J  31    15473  12619  15778   4472   -153   -684       O  
ATOM   5142  C5'  DT J  31      71.048  58.474  16.214  1.00115.27           C  
ANISOU 5142  C5'  DT J  31    15389  12596  15812   4826   -224   -538       C  
ATOM   5143  C4'  DT J  31      70.776  57.629  17.440  1.00117.82           C  
ANISOU 5143  C4'  DT J  31    15912  12627  16226   5033   -175   -313       C  
ATOM   5144  O4'  DT J  31      70.306  58.474  18.519  1.00116.32           O  
ANISOU 5144  O4'  DT J  31    15714  12593  15891   5043   -359    -92       O  
ATOM   5145  C3'  DT J  31      69.718  56.543  17.241  1.00121.25           C  
ANISOU 5145  C3'  DT J  31    16579  12700  16790   4881     36   -363       C  
ATOM   5146  O3'  DT J  31      70.213  55.296  17.701  1.00127.76           O  
ANISOU 5146  O3'  DT J  31    17534  13188  17820   5161    193   -279       O  
ATOM   5147  C2'  DT J  31      68.527  57.027  18.071  1.00118.97           C  
ANISOU 5147  C2'  DT J  31    16379  12434  16390   4740    -50   -166       C  
ATOM   5148  C1'  DT J  31      69.194  57.878  19.140  1.00117.75           C  
ANISOU 5148  C1'  DT J  31    16110  12526  16104   4983   -267     49       C  
ATOM   5149  N1   DT J  31      68.318  58.967  19.667  1.00116.06           N  
ANISOU 5149  N1   DT J  31    15869  12524  15703   4817   -429    163       N  
ATOM   5150  C2   DT J  31      68.212  59.150  21.027  1.00119.84           C  
ANISOU 5150  C2   DT J  31    16402  13031  16101   5022   -534    423       C  
ATOM   5151  O2   DT J  31      68.800  58.462  21.842  1.00124.54           O  
ANISOU 5151  O2   DT J  31    17060  13500  16758   5342   -505    585       O  
ATOM   5152  N3   DT J  31      67.386  60.178  21.403  1.00117.40           N  
ANISOU 5152  N3   DT J  31    16064  12919  15623   4854   -672    492       N  
ATOM   5153  C4   DT J  31      66.671  61.023  20.574  1.00115.25           C  
ANISOU 5153  C4   DT J  31    15713  12807  15271   4511   -710    352       C  
ATOM   5154  O4   DT J  31      65.954  61.919  21.010  1.00115.80           O  
ANISOU 5154  O4   DT J  31    15760  13036  15202   4394   -826    437       O  
ATOM   5155  C5   DT J  31      66.828  60.776  19.159  1.00111.14           C  
ANISOU 5155  C5   DT J  31    15131  12265  14831   4315   -598    101       C  
ATOM   5156  C7   DT J  31      66.102  61.627  18.161  1.00105.00           C  
ANISOU 5156  C7   DT J  31    14252  11686  13958   3962   -624    -43       C  
ATOM   5157  C6   DT J  31      67.635  59.774  18.779  1.00113.06           C  
ANISOU 5157  C6   DT J  31    15407  12324  15228   4475   -467      9       C  
ATOM   5158  P    DT J  32      69.418  53.938  17.379  1.00131.38           P  
ANISOU 5158  P    DT J  32    18215  13193  18510   5051    457   -371       P  
ATOM   5159  OP1  DT J  32      70.410  52.939  16.922  1.00132.01           O  
ANISOU 5159  OP1  DT J  32    18308  13055  18794   5270    625   -501       O  
ATOM   5160  OP2  DT J  32      68.257  54.268  16.521  1.00126.24           O  
ANISOU 5160  OP2  DT J  32    17579  12601  17786   4635    471   -574       O  
ATOM   5161  O5'  DT J  32      68.865  53.490  18.809  1.00133.61           O  
ANISOU 5161  O5'  DT J  32    18660  13252  18853   5218    482    -14       O  
ATOM   5162  C5'  DT J  32      69.743  53.487  19.924  1.00130.88           C  
ANISOU 5162  C5'  DT J  32    18284  12962  18483   5610    401    262       C  
ATOM   5163  C4'  DT J  32      68.970  53.417  21.226  1.00128.36           C  
ANISOU 5163  C4'  DT J  32    18092  12558  18121   5700    382    601       C  
ATOM   5164  O4'  DT J  32      68.347  54.700  21.503  1.00124.81           O  
ANISOU 5164  O4'  DT J  32    17562  12449  17409   5513    167    643       O  
ATOM   5165  C3'  DT J  32      67.846  52.379  21.261  1.00129.95           C  
ANISOU 5165  C3'  DT J  32    18504  12334  18538   5554    619    653       C  
ATOM   5166  O3'  DT J  32      67.909  51.666  22.492  1.00134.37           O  
ANISOU 5166  O3'  DT J  32    19157  12709  19188   5836    696   1004       O  
ATOM   5167  C2'  DT J  32      66.579  53.236  21.161  1.00125.98           C  
ANISOU 5167  C2'  DT J  32    18002  12002  17863   5195    518    626       C  
ATOM   5168  C1'  DT J  32      67.017  54.483  21.907  1.00124.83           C  
ANISOU 5168  C1'  DT J  32    17718  12284  17429   5337    248    775       C  
ATOM   5169  N1   DT J  32      66.212  55.709  21.594  1.00122.69           N  
ANISOU 5169  N1   DT J  32    17363  12313  16942   5015     86    684       N  
ATOM   5170  C2   DT J  32      65.745  56.487  22.631  1.00122.87           C  
ANISOU 5170  C2   DT J  32    17382  12534  16768   5068    -66    915       C  
ATOM   5171  O2   DT J  32      65.947  56.228  23.804  1.00126.91           O  
ANISOU 5171  O2   DT J  32    17955  13014  17250   5368    -81   1190       O  
ATOM   5172  N3   DT J  32      65.027  57.588  22.244  1.00119.59           N  
ANISOU 5172  N3   DT J  32    16883  12371  16184   4770   -194    815       N  
ATOM   5173  C4   DT J  32      64.735  57.982  20.951  1.00117.59           C  
ANISOU 5173  C4   DT J  32    16544  12209  15926   4438   -188    535       C  
ATOM   5174  O4   DT J  32      64.079  58.990  20.704  1.00115.58           O  
ANISOU 5174  O4   DT J  32    16211  12188  15518   4201   -301    492       O  
ATOM   5175  C5   DT J  32      65.254  57.124  19.911  1.00118.54           C  
ANISOU 5175  C5   DT J  32    16669  12141  16227   4406    -34    300       C  
ATOM   5176  C7   DT J  32      64.998  57.451  18.469  1.00115.47           C  
ANISOU 5176  C7   DT J  32    16185  11874  15814   4078    -15    -13       C  
ATOM   5177  C6   DT J  32      65.960  56.041  20.278  1.00122.06           C  
ANISOU 5177  C6   DT J  32    17204  12318  16854   4689     95    374       C  
ATOM   5178  P    DT J  33      67.190  50.239  22.659  1.00141.71           P  
ANISOU 5178  P    DT J  33    20266  13133  20444   5780    982   1105       P  
ATOM   5179  OP1  DT J  33      68.236  49.246  22.992  1.00141.20           O  
ANISOU 5179  OP1  DT J  33    20147  12951  20554   5994   1062   1184       O  
ATOM   5180  OP2  DT J  33      66.314  50.020  21.486  1.00144.10           O  
ANISOU 5180  OP2  DT J  33    20662  13198  20892   5448   1125    796       O  
ATOM   5181  O5'  DT J  33      66.263  50.452  23.942  1.00141.73           O  
ANISOU 5181  O5'  DT J  33    20308  13226  20315   5743    921   1459       O  
ATOM   5182  C5'  DT J  33      65.643  51.709  24.138  1.00137.40           C  
ANISOU 5182  C5'  DT J  33    19731  12995  19480   5634    731   1491       C  
ATOM   5183  C4'  DT J  33      65.225  51.905  25.579  1.00136.52           C  
ANISOU 5183  C4'  DT J  33    19597  13076  19198   5685    640   1837       C  
ATOM   5184  O4'  DT J  33      64.690  53.239  25.733  1.00131.36           O  
ANISOU 5184  O4'  DT J  33    18895  12764  18253   5574    436   1832       O  
ATOM   5185  C3'  DT J  33      64.103  51.004  26.038  1.00137.41           C  
ANISOU 5185  C3'  DT J  33    19861  12850  19500   5589    852   2044       C  
ATOM   5186  O3'  DT J  33      64.070  50.972  27.456  1.00135.21           O  
ANISOU 5186  O3'  DT J  33    19538  12770  19064   5718    786   2369       O  
ATOM   5187  C2'  DT J  33      62.885  51.723  25.464  1.00134.88           C  
ANISOU 5187  C2'  DT J  33    19625  12507  19116   5335    849   1947       C  
ATOM   5188  C1'  DT J  33      63.275  53.195  25.640  1.00129.61           C  
ANISOU 5188  C1'  DT J  33    18818  12345  18083   5371    551   1898       C  
ATOM   5189  N1   DT J  33      62.850  54.077  24.507  1.00121.85           N  
ANISOU 5189  N1   DT J  33    17781  11509  17009   5056    456   1588       N  
ATOM   5190  C2   DT J  33      62.256  55.284  24.785  1.00115.76           C  
ANISOU 5190  C2   DT J  33    16940  11075  15970   4916    267   1622       C  
ATOM   5191  O2   DT J  33      62.047  55.680  25.918  1.00116.66           O  
ANISOU 5191  O2   DT J  33    17077  11335  15914   5102    183   1894       O  
ATOM   5192  N3   DT J  33      61.912  56.020  23.684  1.00110.03           N  
ANISOU 5192  N3   DT J  33    16112  10518  15175   4562    184   1326       N  
ATOM   5193  C4   DT J  33      62.098  55.677  22.357  1.00109.49           C  
ANISOU 5193  C4   DT J  33    16003  10349  15248   4343    263    999       C  
ATOM   5194  O4   DT J  33      61.751  56.410  21.436  1.00107.36           O  
ANISOU 5194  O4   DT J  33    15632  10282  14879   4047    181    771       O  
ATOM   5195  C5   DT J  33      62.728  54.398  22.134  1.00112.98           C  
ANISOU 5195  C5   DT J  33    16528  10441  15960   4503    456    951       C  
ATOM   5196  C7   DT J  33      62.984  53.917  20.736  1.00111.44           C  
ANISOU 5196  C7   DT J  33    16301  10122  15921   4304    558    580       C  
ATOM   5197  C6   DT J  33      63.068  53.669  23.207  1.00119.23           C  
ANISOU 5197  C6   DT J  33    17421  11034  16848   4845    546   1249       C  
ATOM   5198  P    DC J  34      63.110  49.939  28.224  1.00138.29           P  
ANISOU 5198  P    DC J  34    20047  12866  19630   5686   1002   2659       P  
ATOM   5199  OP1  DC J  34      63.651  49.751  29.589  1.00140.70           O  
ANISOU 5199  OP1  DC J  34    20278  13408  19773   5920    936   2942       O  
ATOM   5200  OP2  DC J  34      62.911  48.769  27.341  1.00140.33           O  
ANISOU 5200  OP2  DC J  34    20417  12608  20293   5592   1262   2529       O  
ATOM   5201  O5'  DC J  34      61.720  50.719  28.326  1.00131.78           O  
ANISOU 5201  O5'  DC J  34    19278  12125  18666   5459    968   2718       O  
ATOM   5202  C5'  DC J  34      61.674  52.013  28.911  1.00127.15           C  
ANISOU 5202  C5'  DC J  34    18597  12007  17707   5470    721   2759       C  
ATOM   5203  C4'  DC J  34      60.263  52.569  28.875  1.00125.08           C  
ANISOU 5203  C4'  DC J  34    18405  11745  17375   5240    738   2813       C  
ATOM   5204  O4'  DC J  34      60.037  53.261  27.617  1.00123.47           O  
ANISOU 5204  O4'  DC J  34    18225  11510  17177   5066    690   2532       O  
ATOM   5205  C3'  DC J  34      59.151  51.523  28.975  1.00125.45           C  
ANISOU 5205  C3'  DC J  34    18581  11385  17700   5108   1005   2984       C  
ATOM   5206  O3'  DC J  34      58.062  52.066  29.694  1.00124.59           O  
ANISOU 5206  O3'  DC J  34    18478  11448  17412   5004    973   3177       O  
ATOM   5207  C2'  DC J  34      58.780  51.310  27.512  1.00123.77           C  
ANISOU 5207  C2'  DC J  34    18460  10815  17752   4892   1135   2705       C  
ATOM   5208  C1'  DC J  34      58.876  52.738  27.013  1.00120.75           C  
ANISOU 5208  C1'  DC J  34    18019  10785  17076   4838    903   2520       C  
ATOM   5209  N1   DC J  34      58.998  52.872  25.537  1.00114.94           N  
ANISOU 5209  N1   DC J  34    17243   9991  16439   4565    893   2105       N  
ATOM   5210  C2   DC J  34      58.617  54.070  24.938  1.00101.70           C  
ANISOU 5210  C2   DC J  34    15450   8666  14525   4285    696   1891       C  
ATOM   5211  O2   DC J  34      58.191  54.978  25.658  1.00 93.86           O  
ANISOU 5211  O2   DC J  34    14428   7954  13279   4318    557   2066       O  
ATOM   5212  N3   DC J  34      58.726  54.200  23.594  1.00101.23           N  
ANISOU 5212  N3   DC J  34    15310   8636  14516   3999    672   1505       N  
ATOM   5213  C4   DC J  34      59.192  53.185  22.863  1.00108.48           C  
ANISOU 5213  C4   DC J  34    16266   9248  15703   3986    830   1307       C  
ATOM   5214  N4   DC J  34      59.283  53.356  21.539  1.00108.82           N  
ANISOU 5214  N4   DC J  34    16224   9365  15757   3716    800    920       N  
ATOM   5215  C5   DC J  34      59.586  51.949  23.459  1.00114.91           C  
ANISOU 5215  C5   DC J  34    17204   9671  16786   4262   1034   1502       C  
ATOM   5216  C6   DC J  34      59.471  51.836  24.787  1.00118.07           C  
ANISOU 5216  C6   DC J  34    17676  10047  17137   4546   1061   1913       C  
ATOM   5217  P    DC J  35      57.458  51.298  30.968  1.00127.23           P  
ANISOU 5217  P    DC J  35    18836  11730  17775   5075   1116   3534       P  
ATOM   5218  OP1  DC J  35      58.444  51.406  32.066  1.00130.38           O  
ANISOU 5218  OP1  DC J  35    19141  12461  17936   5356    988   3660       O  
ATOM   5219  OP2  DC J  35      57.005  49.964  30.519  1.00129.96           O  
ANISOU 5219  OP2  DC J  35    19282  11553  18544   4975   1401   3575       O  
ATOM   5220  O5'  DC J  35      56.165  52.164  31.339  1.00121.46           O  
ANISOU 5220  O5'  DC J  35    18108  11197  16846   4894   1065   3639       O  
ATOM   5221  C5'  DC J  35      56.297  53.558  31.599  1.00114.78           C  
ANISOU 5221  C5'  DC J  35    17173  10808  15631   4906    808   3555       C  
ATOM   5222  C4'  DC J  35      55.191  54.353  30.921  1.00111.20           C  
ANISOU 5222  C4'  DC J  35    16750  10359  15141   4640    784   3470       C  
ATOM   5223  O4'  DC J  35      55.478  54.499  29.502  1.00106.07           O  
ANISOU 5223  O4'  DC J  35    16140   9526  14637   4527    777   3191       O  
ATOM   5224  C3'  DC J  35      53.792  53.737  31.002  1.00114.80           C  
ANISOU 5224  C3'  DC J  35    17288  10535  15795   4444   1006   3659       C  
ATOM   5225  O3'  DC J  35      52.839  54.767  31.180  1.00118.12           O  
ANISOU 5225  O3'  DC J  35    17678  11208  15994   4294    910   3695       O  
ATOM   5226  C2'  DC J  35      53.637  53.093  29.628  1.00110.78           C  
ANISOU 5226  C2'  DC J  35    16872   9569  15650   4261   1170   3470       C  
ATOM   5227  C1'  DC J  35      54.331  54.133  28.769  1.00106.39           C  
ANISOU 5227  C1'  DC J  35    16282   9224  14917   4269    964   3186       C  
ATOM   5228  N1   DC J  35      54.751  53.636  27.431  1.00104.69           N  
ANISOU 5228  N1   DC J  35    16083   8738  14957   4110   1036   2854       N  
ATOM   5229  C2   DC J  35      54.615  54.468  26.313  1.00 96.91           C  
ANISOU 5229  C2   DC J  35    14982   7981  13859   3776    879   2485       C  
ATOM   5230  O2   DC J  35      54.149  55.605  26.463  1.00 88.04           O  
ANISOU 5230  O2   DC J  35    13785   7201  12464   3680    712   2497       O  
ATOM   5231  N3   DC J  35      55.003  54.003  25.099  1.00 98.16           N  
ANISOU 5231  N3   DC J  35    15107   7983  14207   3584    922   2131       N  
ATOM   5232  C4   DC J  35      55.502  52.771  24.986  1.00101.99           C  
ANISOU 5232  C4   DC J  35    15675   8078  14999   3705   1113   2119       C  
ATOM   5233  N4   DC J  35      55.872  52.351  23.772  1.00103.64           N  
ANISOU 5233  N4   DC J  35    15849   8154  15375   3518   1152   1741       N  
ATOM   5234  C5   DC J  35      55.641  51.909  26.113  1.00105.63           C  
ANISOU 5234  C5   DC J  35    16254   8273  15609   4038   1283   2501       C  
ATOM   5235  C6   DC J  35      55.260  52.379  27.305  1.00105.80           C  
ANISOU 5235  C6   DC J  35    16301   8477  15420   4234   1237   2867       C  
ATOM   5236  P    DA J  36      51.937  54.833  32.505  1.00122.51           P  
ANISOU 5236  P    DA J  36    18202  11957  16388   4314    952   3979       P  
ATOM   5237  OP1  DA J  36      52.842  54.772  33.674  1.00123.31           O  
ANISOU 5237  OP1  DA J  36    18243  12321  16289   4601    868   4071       O  
ATOM   5238  OP2  DA J  36      50.851  53.837  32.366  1.00122.27           O  
ANISOU 5238  OP2  DA J  36    18244  11540  16672   4142   1215   4148       O  
ATOM   5239  O5'  DA J  36      51.274  56.286  32.424  1.00118.85           O  
ANISOU 5239  O5'  DA J  36    17680  11837  15642   4166    772   3894       O  
ATOM   5240  C5'  DA J  36      52.083  57.418  32.117  1.00114.58           C  
ANISOU 5240  C5'  DA J  36    17064  11603  14867   4220    523   3664       C  
ATOM   5241  C4'  DA J  36      51.455  58.265  31.018  1.00107.43           C  
ANISOU 5241  C4'  DA J  36    16166  10704  13947   3983    461   3514       C  
ATOM   5242  O4'  DA J  36      51.632  57.618  29.732  1.00103.02           O  
ANISOU 5242  O4'  DA J  36    15702   9765  13675   3891    581   3385       O  
ATOM   5243  C3'  DA J  36      49.960  58.520  31.160  1.00107.26           C  
ANISOU 5243  C3'  DA J  36    16156  10685  13913   3765    550   3666       C  
ATOM   5244  O3'  DA J  36      49.652  59.830  30.692  1.00107.43           O  
ANISOU 5244  O3'  DA J  36    16116  10971  13733   3636    381   3532       O  
ATOM   5245  C2'  DA J  36      49.336  57.437  30.279  1.00104.19           C  
ANISOU 5245  C2'  DA J  36    15877   9810  13899   3584    799   3714       C  
ATOM   5246  C1'  DA J  36      50.378  57.261  29.180  1.00 99.59           C  
ANISOU 5246  C1'  DA J  36    15310   9091  13440   3584    750   3424       C  
ATOM   5247  N9   DA J  36      50.480  55.887  28.701  1.00 97.61           N  
ANISOU 5247  N9   DA J  36    15125   8395  13567   3513    967   3383       N  
ATOM   5248  C8   DA J  36      50.365  54.749  29.448  1.00100.43           C  
ANISOU 5248  C8   DA J  36    15564   8458  14137   3669   1178   3654       C  
ATOM   5249  N7   DA J  36      50.513  53.645  28.758  1.00104.80           N  
ANISOU 5249  N7   DA J  36    16184   8568  15066   3587   1369   3557       N  
ATOM   5250  C5   DA J  36      50.745  54.088  27.469  1.00 99.17           C  
ANISOU 5250  C5   DA J  36    15376   7970  14335   3291   1231   3113       C  
ATOM   5251  C6   DA J  36      50.985  53.404  26.262  1.00 94.52           C  
ANISOU 5251  C6   DA J  36    14767   7130  14015   3053   1301   2758       C  
ATOM   5252  N6   DA J  36      51.023  52.072  26.167  1.00 99.02           N  
ANISOU 5252  N6   DA J  36    15420   7230  14972   3064   1538   2783       N  
ATOM   5253  N1   DA J  36      51.176  54.143  25.153  1.00 89.44           N  
ANISOU 5253  N1   DA J  36    14011   6739  13233   2810   1126   2377       N  
ATOM   5254  C2   DA J  36      51.135  55.478  25.251  1.00 90.92           C  
ANISOU 5254  C2   DA J  36    14108   7367  13069   2800    906   2366       C  
ATOM   5255  N3   DA J  36      50.920  56.233  26.328  1.00 89.64           N  
ANISOU 5255  N3   DA J  36    13956   7446  12656   3000    819   2658       N  
ATOM   5256  C4   DA J  36      50.732  55.469  27.415  1.00 94.11           C  
ANISOU 5256  C4   DA J  36    14638   7783  13335   3245    988   3020       C  
ATOM   5257  P    DA J  37      48.127  60.328  30.577  1.00108.92           P  
ANISOU 5257  P    DA J  37    16293  11204  13889   3378    443   3647       P  
ATOM   5258  OP1  DA J  37      48.121  61.776  30.880  1.00106.25           O  
ANISOU 5258  OP1  DA J  37    15839  11289  13244   3372    222   3539       O  
ATOM   5259  OP2  DA J  37      47.258  59.423  31.362  1.00107.23           O  
ANISOU 5259  OP2  DA J  37    16109  10825  13807   3349    645   3898       O  
ATOM   5260  O5'  DA J  37      47.792  60.141  29.025  1.00106.78           O  
ANISOU 5260  O5'  DA J  37    16005  10732  13834   3026    494   3418       O  
ATOM   5261  C5'  DA J  37      48.561  60.839  28.051  1.00 96.95           C  
ANISOU 5261  C5'  DA J  37    14651   9673  12513   2909    307   3065       C  
ATOM   5262  C4'  DA J  37      48.192  60.406  26.645  1.00 90.73           C  
ANISOU 5262  C4'  DA J  37    13797   8733  11942   2513    371   2788       C  
ATOM   5263  O4'  DA J  37      48.557  59.013  26.446  1.00 93.04           O  
ANISOU 5263  O4'  DA J  37    14181   8640  12531   2544    545   2764       O  
ATOM   5264  C3'  DA J  37      46.702  60.501  26.300  1.00 85.74           C  
ANISOU 5264  C3'  DA J  37    13115   8095  11368   2171    456   2840       C  
ATOM   5265  O3'  DA J  37      46.554  60.977  24.972  1.00 83.52           O  
ANISOU 5265  O3'  DA J  37    12698   7957  11078   1840    366   2521       O  
ATOM   5266  C2'  DA J  37      46.240  59.052  26.417  1.00 88.90           C  
ANISOU 5266  C2'  DA J  37    13615   8069  12095   2116    702   2962       C  
ATOM   5267  C1'  DA J  37      47.462  58.341  25.872  1.00 90.77           C  
ANISOU 5267  C1'  DA J  37    13886   8123  12479   2212    706   2732       C  
ATOM   5268  N9   DA J  37      47.540  56.925  26.215  1.00 88.94           N  
ANISOU 5268  N9   DA J  37    13775   7456  12561   2314    931   2866       N  
ATOM   5269  C8   DA J  37      47.446  56.364  27.456  1.00 91.55           C  
ANISOU 5269  C8   DA J  37    14221   7618  12947   2605   1072   3253       C  
ATOM   5270  N7   DA J  37      47.560  55.055  27.454  1.00 94.08           N  
ANISOU 5270  N7   DA J  37    14624   7512  13608   2636   1284   3307       N  
ATOM   5271  C5   DA J  37      47.743  54.741  26.116  1.00 94.32           C  
ANISOU 5271  C5   DA J  37    14596   7430  13813   2340   1271   2897       C  
ATOM   5272  C6   DA J  37      47.926  53.517  25.441  1.00102.22           C  
ANISOU 5272  C6   DA J  37    15635   8015  15190   2218   1439   2708       C  
ATOM   5273  N6   DA J  37      47.959  52.331  26.058  1.00104.99           N  
ANISOU 5273  N6   DA J  37    16096   7942  15854   2384   1675   2944       N  
ATOM   5274  N1   DA J  37      48.081  53.562  24.100  1.00104.99           N  
ANISOU 5274  N1   DA J  37    15901   8402  15587   1928   1364   2267       N  
ATOM   5275  C2   DA J  37      48.051  54.749  23.486  1.00 95.01           C  
ANISOU 5275  C2   DA J  37    14517   7563  14017   1778   1146   2067       C  
ATOM   5276  N3   DA J  37      47.883  55.958  24.012  1.00 91.86           N  
ANISOU 5276  N3   DA J  37    14069   7550  13284   1864    983   2228       N  
ATOM   5277  C4   DA J  37      47.734  55.884  25.342  1.00 91.81           C  
ANISOU 5277  C4   DA J  37    14154   7493  13236   2146   1053   2630       C  
ATOM   5278  P    DA J  38      45.246  61.802  24.540  1.00 75.66           P  
ANISOU 5278  P    DA J  38    11579   7184   9983   1522    332   2529       P  
ATOM   5279  OP1  DA J  38      45.464  63.223  24.889  1.00 71.01           O  
ANISOU 5279  OP1  DA J  38    10918   6959   9103   1648    150   2568       O  
ATOM   5280  OP2  DA J  38      44.066  61.088  25.075  1.00 71.41           O  
ANISOU 5280  OP2  DA J  38    11100   6428   9606   1431    520   2778       O  
ATOM   5281  O5'  DA J  38      45.216  61.656  22.948  1.00 84.02           O  
ANISOU 5281  O5'  DA J  38    12518   8267  11139   1170    306   2159       O  
ATOM   5282  C5'  DA J  38      46.393  61.276  22.241  1.00 85.67           C  
ANISOU 5282  C5'  DA J  38    12727   8413  11409   1223    267   1886       C  
ATOM   5283  C4'  DA J  38      46.057  60.270  21.157  1.00 86.24           C  
ANISOU 5283  C4'  DA J  38    12779   8270  11720    928    379   1630       C  
ATOM   5284  O4'  DA J  38      46.264  58.922  21.667  1.00 89.40           O  
ANISOU 5284  O4'  DA J  38    13328   8242  12398   1054    559   1713       O  
ATOM   5285  C3'  DA J  38      44.609  60.332  20.667  1.00 82.92           C  
ANISOU 5285  C3'  DA J  38    12262   7906  11339    567    425   1624       C  
ATOM   5286  O3'  DA J  38      44.557  60.288  19.239  1.00 78.99           O  
ANISOU 5286  O3'  DA J  38    11639   7522  10851    276    380   1265       O  
ATOM   5287  C2'  DA J  38      43.965  59.103  21.303  1.00 87.18           C  
ANISOU 5287  C2'  DA J  38    12919   8034  12173    552    634   1801       C  
ATOM   5288  C1'  DA J  38      45.127  58.132  21.406  1.00 90.50           C  
ANISOU 5288  C1'  DA J  38    13463   8150  12772    773    710   1710       C  
ATOM   5289  N9   DA J  38      44.968  57.166  22.495  1.00 95.11           N  
ANISOU 5289  N9   DA J  38    14193   8361  13581    961    899   2010       N  
ATOM   5290  C8   DA J  38      44.719  57.446  23.810  1.00 95.19           C  
ANISOU 5290  C8   DA J  38    14278   8398  13492   1212    931   2409       C  
ATOM   5291  N7   DA J  38      44.615  56.381  24.570  1.00 97.54           N  
ANISOU 5291  N7   DA J  38    14695   8325  14041   1354   1132   2644       N  
ATOM   5292  C5   DA J  38      44.803  55.326  23.692  1.00100.78           C  
ANISOU 5292  C5   DA J  38    15113   8414  14764   1173   1239   2366       C  
ATOM   5293  C6   DA J  38      44.815  53.927  23.875  1.00104.63           C  
ANISOU 5293  C6   DA J  38    15698   8409  15648   1199   1470   2424       C  
ATOM   5294  N6   DA J  38      44.622  53.337  25.061  1.00101.93           N  
ANISOU 5294  N6   DA J  38    15463   7819  15445   1439   1647   2834       N  
ATOM   5295  N1   DA J  38      45.035  53.155  22.789  1.00108.04           N  
ANISOU 5295  N1   DA J  38    16107   8611  16330    980   1523   2046       N  
ATOM   5296  C2   DA J  38      45.231  53.750  21.605  1.00105.53           C  
ANISOU 5296  C2   DA J  38    15677   8575  15845    762   1352   1652       C  
ATOM   5297  N3   DA J  38      45.242  55.050  21.310  1.00101.28           N  
ANISOU 5297  N3   DA J  38    15034   8512  14935    722   1138   1590       N  
ATOM   5298  C4   DA J  38      45.021  55.791  22.408  1.00 98.77           C  
ANISOU 5298  C4   DA J  38    14743   8378  14407    931   1092   1959       C  
ATOM   5299  P    DT J  39      43.144  60.220  18.469  1.00 83.18           P  
ANISOU 5299  P    DT J  39    12039   8132  11434   -133    413   1171       P  
ATOM   5300  OP1  DT J  39      43.212  61.118  17.300  1.00 80.48           O  
ANISOU 5300  OP1  DT J  39    11520   8190  10868   -305    264    935       O  
ATOM   5301  OP2  DT J  39      42.035  60.401  19.430  1.00 84.60           O  
ANISOU 5301  OP2  DT J  39    12237   8279  11628   -146    480   1519       O  
ATOM   5302  O5'  DT J  39      43.095  58.722  17.927  1.00 85.74           O  
ANISOU 5302  O5'  DT J  39    12419   8065  12094   -296    564    927       O  
ATOM   5303  C5'  DT J  39      44.201  58.200  17.206  1.00 86.57           C  
ANISOU 5303  C5'  DT J  39    12554   8078  12260   -234    557    614       C  
ATOM   5304  C4'  DT J  39      43.960  56.752  16.837  1.00 94.95           C  
ANISOU 5304  C4'  DT J  39    13674   8719  13681   -398    724    407       C  
ATOM   5305  O4'  DT J  39      43.950  55.942  18.041  1.00 95.73           O  
ANISOU 5305  O4'  DT J  39    13938   8403  14034   -196    891    709       O  
ATOM   5306  C3'  DT J  39      42.632  56.486  16.130  1.00105.06           C  
ANISOU 5306  C3'  DT J  39    14828  10025  15066   -807    753    252       C  
ATOM   5307  O3'  DT J  39      42.825  55.548  15.083  1.00119.60           O  
ANISOU 5307  O3'  DT J  39    16648  11695  17099   -997    804   -175       O  
ATOM   5308  C2'  DT J  39      41.750  55.921  17.242  1.00100.90           C  
ANISOU 5308  C2'  DT J  39    14382   9168  14785   -802    913    600       C  
ATOM   5309  C1'  DT J  39      42.768  55.174  18.088  1.00 99.07           C  
ANISOU 5309  C1'  DT J  39    14344   8563  14735   -455   1034    744       C  
ATOM   5310  N1   DT J  39      42.364  55.011  19.518  1.00 96.32           N  
ANISOU 5310  N1   DT J  39    14104   8007  14486   -253   1158   1218       N  
ATOM   5311  C2   DT J  39      42.330  53.749  20.061  1.00100.03           C  
ANISOU 5311  C2   DT J  39    14692   7973  15340   -187   1377   1333       C  
ATOM   5312  O2   DT J  39      42.616  52.745  19.435  1.00102.13           O  
ANISOU 5312  O2   DT J  39    14984   7926  15894   -294   1475   1048       O  
ATOM   5313  N3   DT J  39      41.953  53.703  21.376  1.00103.99           N  
ANISOU 5313  N3   DT J  39    15279   8349  15883     21   1489   1801       N  
ATOM   5314  C4   DT J  39      41.609  54.765  22.187  1.00102.25           C  
ANISOU 5314  C4   DT J  39    15042   8452  15355    166   1399   2128       C  
ATOM   5315  O4   DT J  39      41.280  54.619  23.360  1.00102.88           O  
ANISOU 5315  O4   DT J  39    15202   8409  15478    366   1517   2536       O  
ATOM   5316  C5   DT J  39      41.660  56.060  21.560  1.00 96.63           C  
ANISOU 5316  C5   DT J  39    14209   8235  14271     78   1168   1962       C  
ATOM   5317  C7   DT J  39      41.301  57.283  22.349  1.00 92.70           C  
ANISOU 5317  C7   DT J  39    13683   8092  13448    221   1063   2267       C  
ATOM   5318  C6   DT J  39      42.032  56.124  20.268  1.00 94.13           C  
ANISOU 5318  C6   DT J  39    13801   8046  13917   -125   1063   1535       C  
ATOM   5319  P    DA J  40      41.739  55.412  13.908  1.00116.67           P  
ANISOU 5319  P    DA J  40    16095  11489  16746  -1437    765   -504       P  
ATOM   5320  OP1  DA J  40      42.462  55.416  12.617  1.00118.72           O  
ANISOU 5320  OP1  DA J  40    16280  11961  16866  -1501    676   -949       O  
ATOM   5321  OP2  DA J  40      40.670  56.405  14.158  1.00110.49           O  
ANISOU 5321  OP2  DA J  40    15185  11037  15757  -1565    680   -245       O  
ATOM   5322  O5'  DA J  40      41.116  53.963  14.148  1.00118.41           O  
ANISOU 5322  O5'  DA J  40    16385  11159  17445  -1603    968   -568       O  
ATOM   5323  C5'  DA J  40      41.951  52.900  14.581  1.00121.48           C  
ANISOU 5323  C5'  DA J  40    16951  11064  18143  -1395   1127   -586       C  
ATOM   5324  C4'  DA J  40      41.123  51.665  14.865  1.00128.81           C  
ANISOU 5324  C4'  DA J  40    17912  11482  19547  -1588   1329   -584       C  
ATOM   5325  O4'  DA J  40      40.934  51.520  16.296  1.00127.53           O  
ANISOU 5325  O4'  DA J  40    17873  11051  19532  -1362   1467    -67       O  
ATOM   5326  C3'  DA J  40      39.733  51.680  14.241  1.00134.24           C  
ANISOU 5326  C3'  DA J  40    18415  12303  20287  -2019   1292   -743       C  
ATOM   5327  O3'  DA J  40      39.443  50.409  13.684  1.00141.96           O  
ANISOU 5327  O3'  DA J  40    19381  12870  21686  -2266   1423  -1099       O  
ATOM   5328  C2'  DA J  40      38.811  52.025  15.414  1.00131.32           C  
ANISOU 5328  C2'  DA J  40    18048  11896  19950  -1984   1358   -222       C  
ATOM   5329  C1'  DA J  40      39.558  51.439  16.606  1.00127.55           C  
ANISOU 5329  C1'  DA J  40    17785  10996  19684  -1614   1531    115       C  
ATOM   5330  N9   DA J  40      39.335  52.170  17.852  1.00118.57           N  
ANISOU 5330  N9   DA J  40    16701   9982  18368  -1370   1537    652       N  
ATOM   5331  C8   DA J  40      39.350  53.526  18.024  1.00112.53           C  
ANISOU 5331  C8   DA J  40    15881   9714  17161  -1261   1358    821       C  
ATOM   5332  N7   DA J  40      39.128  53.906  19.261  1.00111.10           N  
ANISOU 5332  N7   DA J  40    15772   9532  16909  -1030   1410   1293       N  
ATOM   5333  C5   DA J  40      38.961  52.717  19.950  1.00112.66           C  
ANISOU 5333  C5   DA J  40    16077   9210  17520   -974   1646   1474       C  
ATOM   5334  C6   DA J  40      38.695  52.435  21.307  1.00110.79           C  
ANISOU 5334  C6   DA J  40    15945   8739  17410   -739   1816   1968       C  
ATOM   5335  N6   DA J  40      38.548  53.381  22.241  1.00105.12           N  
ANISOU 5335  N6   DA J  40    15249   8307  16384   -510   1757   2350       N  
ATOM   5336  N1   DA J  40      38.587  51.138  21.666  1.00118.14           N  
ANISOU 5336  N1   DA J  40    16954   9131  18803   -738   2057   2057       N  
ATOM   5337  C2   DA J  40      38.733  50.195  20.727  1.00125.00           C  
ANISOU 5337  C2   DA J  40    17799   9698  19996   -969   2118   1644       C  
ATOM   5338  N3   DA J  40      38.986  50.339  19.425  1.00125.90           N  
ANISOU 5338  N3   DA J  40    17823   9999  20015  -1201   1965   1131       N  
ATOM   5339  C4   DA J  40      39.088  51.636  19.098  1.00118.39           C  
ANISOU 5339  C4   DA J  40    16792   9604  18586  -1186   1731   1086       C  
ATOM   5340  P    DC J  41      38.043  50.149  12.944  1.00138.21           P  
ANISOU 5340  P    DC J  41    18701  12459  21355  -2747   1397  -1358       P  
ATOM   5341  OP1  DC J  41      38.257  49.091  11.932  1.00142.82           O  
ANISOU 5341  OP1  DC J  41    19263  12787  22214  -2953   1444  -1925       O  
ATOM   5342  OP2  DC J  41      37.479  51.457  12.540  1.00132.26           O  
ANISOU 5342  OP2  DC J  41    17773  12338  20140  -2858   1185  -1298       O  
ATOM   5343  O5'  DC J  41      37.127  49.556  14.103  1.00139.27           O  
ANISOU 5343  O5'  DC J  41    18875  12152  21890  -2786   1601   -936       O  
ATOM   5344  C5'  DC J  41      37.656  48.568  14.970  1.00138.56           C  
ANISOU 5344  C5'  DC J  41    18974  11477  22197  -2557   1831   -733       C  
ATOM   5345  C4'  DC J  41      36.558  47.973  15.820  1.00137.67           C  
ANISOU 5345  C4'  DC J  41    18838  10986  22484  -2687   2027   -393       C  
ATOM   5346  O4'  DC J  41      36.558  48.603  17.125  1.00132.38           O  
ANISOU 5346  O4'  DC J  41    18262  10397  21640  -2369   2071    219       O  
ATOM   5347  C3'  DC J  41      35.152  48.147  15.252  1.00137.18           C  
ANISOU 5347  C3'  DC J  41    18542  11124  22456  -3132   1953   -538       C  
ATOM   5348  O3'  DC J  41      34.431  46.935  15.401  1.00138.99           O  
ANISOU 5348  O3'  DC J  41    18736  10799  23275  -3371   2166   -582       O  
ATOM   5349  C2'  DC J  41      34.565  49.283  16.094  1.00132.03           C  
ANISOU 5349  C2'  DC J  41    17852  10845  21470  -3010   1887    -18       C  
ATOM   5350  C1'  DC J  41      35.272  49.094  17.426  1.00131.27           C  
ANISOU 5350  C1'  DC J  41    17977  10448  21452  -2574   2054    468       C  
ATOM   5351  N1   DC J  41      35.428  50.356  18.204  1.00128.15           N  
ANISOU 5351  N1   DC J  41    17623  10478  20589  -2281   1942    889       N  
ATOM   5352  C2   DC J  41      35.189  50.348  19.580  1.00132.25           C  
ANISOU 5352  C2   DC J  41    18241  10827  21181  -2028   2099   1452       C  
ATOM   5353  O2   DC J  41      34.847  49.289  20.116  1.00139.76           O  
ANISOU 5353  O2   DC J  41    19237  11274  22591  -2052   2337   1622       O  
ATOM   5354  N3   DC J  41      35.338  51.501  20.281  1.00127.68           N  
ANISOU 5354  N3   DC J  41    17699  10640  20174  -1760   1991   1793       N  
ATOM   5355  C4   DC J  41      35.709  52.619  19.653  1.00120.73           C  
ANISOU 5355  C4   DC J  41    16756  10268  18847  -1750   1748   1602       C  
ATOM   5356  N4   DC J  41      35.844  53.734  20.382  1.00116.42           N  
ANISOU 5356  N4   DC J  41    16245  10069  17922  -1488   1653   1928       N  
ATOM   5357  C5   DC J  41      35.959  52.645  18.248  1.00118.65           C  
ANISOU 5357  C5   DC J  41    16388  10184  18510  -2000   1598   1065       C  
ATOM   5358  C6   DC J  41      35.809  51.502  17.570  1.00122.57           C  
ANISOU 5358  C6   DC J  41    16854  10322  19396  -2253   1697    719       C  
ATOM   5359  P    DA J  42      32.929  46.787  14.852  1.00143.25           P  
ANISOU 5359  P    DA J  42    19018  11406  24004  -3870   2134   -764       P  
ATOM   5360  OP1  DA J  42      32.866  45.520  14.090  1.00143.08           O  
ANISOU 5360  OP1  DA J  42    18953  10932  24479  -4155   2232  -1280       O  
ATOM   5361  OP2  DA J  42      32.508  48.048  14.201  1.00136.28           O  
ANISOU 5361  OP2  DA J  42    17967  11235  22579  -3995   1864   -856       O  
ATOM   5362  O5'  DA J  42      32.085  46.606  16.190  1.00140.98           O  
ANISOU 5362  O5'  DA J  42    18744  10826  23996  -3808   2347   -137       O  
ATOM   5363  C5'  DA J  42      32.723  46.069  17.342  1.00140.82           C  
ANISOU 5363  C5'  DA J  42    18940  10357  24208  -3439   2578    288       C  
ATOM   5364  C4'  DA J  42      31.765  45.997  18.513  1.00143.09           C  
ANISOU 5364  C4'  DA J  42    19198  10462  24707  -3412   2767    878       C  
ATOM   5365  O4'  DA J  42      32.001  47.113  19.411  1.00137.65           O  
ANISOU 5365  O4'  DA J  42    18599  10170  23533  -3050   2694   1365       O  
ATOM   5366  C3'  DA J  42      30.291  46.067  18.146  1.00148.50           C  
ANISOU 5366  C3'  DA J  42    19625  11266  25532  -3857   2736    814       C  
ATOM   5367  O3'  DA J  42      29.543  45.302  19.085  1.00157.75           O  
ANISOU 5367  O3'  DA J  42    20780  11956  27200  -3888   3019   1235       O  
ATOM   5368  C2'  DA J  42      30.000  47.564  18.262  1.00141.58           C  
ANISOU 5368  C2'  DA J  42    18682  11079  24033  -3764   2516   1037       C  
ATOM   5369  C1'  DA J  42      30.853  47.939  19.468  1.00137.85           C  
ANISOU 5369  C1'  DA J  42    18444  10587  23345  -3243   2599   1543       C  
ATOM   5370  N9   DA J  42      31.295  49.332  19.479  1.00134.30           N  
ANISOU 5370  N9   DA J  42    18024  10745  22260  -3020   2366   1628       N  
ATOM   5371  C8   DA J  42      31.739  50.068  18.415  1.00132.99           C  
ANISOU 5371  C8   DA J  42    17796  11029  21706  -3101   2107   1214       C  
ATOM   5372  N7   DA J  42      32.084  51.296  18.729  1.00129.13           N  
ANISOU 5372  N7   DA J  42    17346  11004  20716  -2851   1955   1426       N  
ATOM   5373  C5   DA J  42      31.857  51.368  20.094  1.00128.64           C  
ANISOU 5373  C5   DA J  42    17383  10800  20694  -2584   2114   1992       C  
ATOM   5374  C6   DA J  42      32.026  52.407  21.035  1.00124.27           C  
ANISOU 5374  C6   DA J  42    16908  10557  19752  -2245   2065   2416       C  
ATOM   5375  N6   DA J  42      32.484  53.624  20.718  1.00117.05           N  
ANISOU 5375  N6   DA J  42    15980  10145  18350  -2130   1836   2333       N  
ATOM   5376  N1   DA J  42      31.704  52.145  22.321  1.00125.41           N  
ANISOU 5376  N1   DA J  42    17140  10472  20038  -2026   2267   2928       N  
ATOM   5377  C2   DA J  42      31.247  50.927  22.633  1.00131.63           C  
ANISOU 5377  C2   DA J  42    17930  10740  21343  -2140   2515   3038       C  
ATOM   5378  N3   DA J  42      31.047  49.875  21.840  1.00135.68           N  
ANISOU 5378  N3   DA J  42    18370  10888  22294  -2464   2591   2677       N  
ATOM   5379  C4   DA J  42      31.375  50.165  20.572  1.00132.63           C  
ANISOU 5379  C4   DA J  42    17904  10756  21734  -2675   2373   2141       C  
ATOM   5380  P    DC J  43      28.047  44.818  18.755  1.00151.08           P  
ANISOU 5380  P    DC J  43    19664  10960  26778  -4390   3087   1138       P  
ATOM   5381  OP1  DC J  43      28.021  43.340  18.846  1.00155.78           O  
ANISOU 5381  OP1  DC J  43    20283  10903  28002  -4477   3315   1033       O  
ATOM   5382  OP2  DC J  43      27.608  45.487  17.511  1.00152.81           O  
ANISOU 5382  OP2  DC J  43    19678  11714  26670  -4730   2789    640       O  
ATOM   5383  O5'  DC J  43      27.202  45.424  19.965  1.00151.14           O  
ANISOU 5383  O5'  DC J  43    19635  11119  26671  -4242   3195   1843       O  
ATOM   5384  C5'  DC J  43      27.588  46.673  20.508  1.00147.09           C  
ANISOU 5384  C5'  DC J  43    19225  11124  25539  -3889   3056   2171       C  
ATOM   5385  C4'  DC J  43      26.933  46.924  21.843  1.00147.67           C  
ANISOU 5385  C4'  DC J  43    19313  11175  25622  -3681   3241   2867       C  
ATOM   5386  O4'  DC J  43      27.487  48.133  22.414  1.00144.58           O  
ANISOU 5386  O4'  DC J  43    19052  11266  24616  -3287   3102   3151       O  
ATOM   5387  C3'  DC J  43      25.441  47.172  21.771  1.00149.64           C  
ANISOU 5387  C3'  DC J  43    19299  11620  25937  -4019   3229   2975       C  
ATOM   5388  O3'  DC J  43      24.839  46.861  23.017  1.00153.22           O  
ANISOU 5388  O3'  DC J  43    19782  12025  26409  -3776   3390   3496       O  
ATOM   5389  C2'  DC J  43      25.378  48.665  21.465  1.00145.66           C  
ANISOU 5389  C2'  DC J  43    18738  11816  24790  -3970   2955   2958       C  
ATOM   5390  C1'  DC J  43      26.592  49.213  22.219  1.00143.62           C  
ANISOU 5390  C1'  DC J  43    18753  11677  24141  -3442   2934   3213       C  
ATOM   5391  N1   DC J  43      27.309  50.311  21.484  1.00140.89           N  
ANISOU 5391  N1   DC J  43    18434  11874  23225  -3359   2626   2898       N  
ATOM   5392  C2   DC J  43      27.610  51.504  22.151  1.00138.88           C  
ANISOU 5392  C2   DC J  43    18270  12041  22457  -3013   2526   3222       C  
ATOM   5393  O2   DC J  43      27.286  51.621  23.337  1.00140.36           O  
ANISOU 5393  O2   DC J  43    18522  12168  22643  -2771   2686   3747       O  
ATOM   5394  N3   DC J  43      28.254  52.491  21.476  1.00135.69           N  
ANISOU 5394  N3   DC J  43    17875  12100  21582  -2948   2263   2949       N  
ATOM   5395  C4   DC J  43      28.585  52.318  20.194  1.00135.91           C  
ANISOU 5395  C4   DC J  43    17827  12204  21611  -3198   2107   2396       C  
ATOM   5396  N4   DC J  43      29.218  53.316  19.566  1.00134.23           N  
ANISOU 5396  N4   DC J  43    17614  12454  20935  -3114   1867   2175       N  
ATOM   5397  C5   DC J  43      28.282  51.110  19.497  1.00137.57           C  
ANISOU 5397  C5   DC J  43    17950  12017  22306  -3543   2197   2040       C  
ATOM   5398  C6   DC J  43      27.648  50.145  20.173  1.00140.46           C  
ANISOU 5398  C6   DC J  43    18305  11899  23163  -3619   2453   2297       C  
ATOM   5399  P    DT J  44      23.268  47.109  23.245  1.00166.40           P  
ANISOU 5399  P    DT J  44    21209  13939  28075  -4009   3393   3711       P  
ATOM   5400  OP1  DT J  44      22.784  46.059  24.168  1.00170.10           O  
ANISOU 5400  OP1  DT J  44    21692  14083  28855  -3884   3615   4008       O  
ATOM   5401  OP2  DT J  44      22.620  47.274  21.924  1.00167.10           O  
ANISOU 5401  OP2  DT J  44    21044  14168  28278  -4536   3232   3235       O  
ATOM   5402  O5'  DT J  44      23.222  48.514  24.001  1.00160.81           O  
ANISOU 5402  O5'  DT J  44    20559  13756  26784  -3689   3310   4137       O  
ATOM   5403  C5'  DT J  44      24.062  48.732  25.126  1.00157.17           C  
ANISOU 5403  C5'  DT J  44    20344  13330  26042  -3156   3375   4505       C  
ATOM   5404  C4'  DT J  44      23.880  50.135  25.668  1.00148.89           C  
ANISOU 5404  C4'  DT J  44    19311  12829  24431  -2921   3254   4801       C  
ATOM   5405  O4'  DT J  44      24.625  51.076  24.851  1.00141.54           O  
ANISOU 5405  O4'  DT J  44    18406  12133  23239  -2966   3068   4567       O  
ATOM   5406  C3'  DT J  44      22.434  50.631  25.691  1.00149.63           C  
ANISOU 5406  C3'  DT J  44    19175  13234  24443  -3147   3225   4931       C  
ATOM   5407  O3'  DT J  44      22.167  51.268  26.932  1.00151.52           O  
ANISOU 5407  O3'  DT J  44    19491  13780  24299  -2753   3252   5352       O  
ATOM   5408  C2'  DT J  44      22.381  51.616  24.521  1.00143.60           C  
ANISOU 5408  C2'  DT J  44    18265  12803  23492  -3446   3013   4644       C  
ATOM   5409  C1'  DT J  44      23.797  52.164  24.515  1.00137.47           C  
ANISOU 5409  C1'  DT J  44    17706  12081  22443  -3143   2928   4604       C  
ATOM   5410  N1   DT J  44      24.232  52.700  23.187  1.00130.20           N  
ANISOU 5410  N1   DT J  44    16712  11454  21304  -3361   2656   4075       N  
ATOM   5411  C2   DT J  44      24.778  53.962  23.119  1.00123.58           C  
ANISOU 5411  C2   DT J  44    15939  11112  19906  -3132   2441   4055       C  
ATOM   5412  O2   DT J  44      24.926  54.679  24.093  1.00116.62           O  
ANISOU 5412  O2   DT J  44    15170  10407  18734  -2780   2470   4448       O  
ATOM   5413  N3   DT J  44      25.147  54.359  21.861  1.00124.04           N  
ANISOU 5413  N3   DT J  44    15915  11454  19759  -3327   2193   3551       N  
ATOM   5414  C4   DT J  44      25.030  53.638  20.688  1.00124.41           C  
ANISOU 5414  C4   DT J  44    15832  11372  20067  -3711   2130   3054       C  
ATOM   5415  O4   DT J  44      25.393  54.083  19.604  1.00120.97           O  
ANISOU 5415  O4   DT J  44    15327  11252  19384  -3840   1907   2633       O  
ATOM   5416  C5   DT J  44      24.451  52.323  20.827  1.00126.81           C  
ANISOU 5416  C5   DT J  44    16076  11146  20960  -3945   2351   3062       C  
ATOM   5417  C7   DT J  44      24.272  51.450  19.621  1.00128.37           C  
ANISOU 5417  C7   DT J  44    16127  11157  21492  -4372   2298   2501       C  
ATOM   5418  C6   DT J  44      24.084  51.921  22.056  1.00130.02           C  
ANISOU 5418  C6   DT J  44    16556  11242  21603  -3764   2606   3578       C  
ATOM   5419  P    DT J  45      20.669  51.687  27.337  1.00153.41           P  
ANISOU 5419  P    DT J  45    19536  14315  24439  -2856   3273   5575       P  
ATOM   5420  OP1  DT J  45      20.380  51.074  28.653  1.00155.62           O  
ANISOU 5420  OP1  DT J  45    19884  14463  24782  -2547   3461   5928       O  
ATOM   5421  OP2  DT J  45      19.766  51.421  26.196  1.00156.80           O  
ANISOU 5421  OP2  DT J  45    19706  14693  25179  -3398   3231   5294       O  
ATOM   5422  O5'  DT J  45      20.775  53.268  27.530  1.00147.15           O  
ANISOU 5422  O5'  DT J  45    18778  14085  23048  -2634   3091   5673       O  
ATOM   5423  C5'  DT J  45      21.842  53.807  28.296  1.00138.06           C  
ANISOU 5423  C5'  DT J  45    17859  13073  21525  -2169   3041   5800       C  
ATOM   5424  C4'  DT J  45      22.044  55.277  27.986  1.00124.23           C  
ANISOU 5424  C4'  DT J  45    16103  11800  19297  -2095   2831   5740       C  
ATOM   5425  O4'  DT J  45      22.534  55.429  26.633  1.00121.35           O  
ANISOU 5425  O4'  DT J  45    15671  11400  19038  -2412   2712   5428       O  
ATOM   5426  C3'  DT J  45      20.785  56.137  28.096  1.00119.82           C  
ANISOU 5426  C3'  DT J  45    15366  11637  18521  -2181   2779   5845       C  
ATOM   5427  O3'  DT J  45      21.017  57.199  29.014  1.00114.13           O  
ANISOU 5427  O3'  DT J  45    14763  11283  17319  -1769   2693   5989       O  
ATOM   5428  C2'  DT J  45      20.545  56.644  26.666  1.00119.60           C  
ANISOU 5428  C2'  DT J  45    15145  11777  18520  -2600   2632   5579       C  
ATOM   5429  C1'  DT J  45      21.926  56.546  26.039  1.00118.70           C  
ANISOU 5429  C1'  DT J  45    15162  11500  18437  -2584   2556   5372       C  
ATOM   5430  N1   DT J  45      21.912  56.331  24.553  1.00122.04           N  
ANISOU 5430  N1   DT J  45    15391  11848  19131  -3071   2471   5036       N  
ATOM   5431  C2   DT J  45      22.484  57.275  23.727  1.00120.95           C  
ANISOU 5431  C2   DT J  45    15236  12094  18627  -3080   2219   4743       C  
ATOM   5432  O2   DT J  45      22.996  58.301  24.138  1.00118.65           O  
ANISOU 5432  O2   DT J  45    15056  12101  17925  -2767   2122   4873       O  
ATOM   5433  N3   DT J  45      22.430  56.973  22.390  1.00120.27           N  
ANISOU 5433  N3   DT J  45    14994  12056  18646  -3457   2070   4250       N  
ATOM   5434  C4   DT J  45      21.880  55.848  21.807  1.00122.68           C  
ANISOU 5434  C4   DT J  45    15157  12046  19412  -3839   2148   4020       C  
ATOM   5435  O4   DT J  45      21.880  55.670  20.592  1.00121.46           O  
ANISOU 5435  O4   DT J  45    14864  11994  19290  -4152   1990   3545       O  
ATOM   5436  C5   DT J  45      21.302  54.897  22.727  1.00127.12           C  
ANISOU 5436  C5   DT J  45    15732  12151  20416  -3841   2434   4374       C  
ATOM   5437  C7   DT J  45      20.674  53.639  22.207  1.00132.18           C  
ANISOU 5437  C7   DT J  45    16211  12387  21624  -4255   2547   4154       C  
ATOM   5438  C6   DT J  45      21.348  55.179  24.040  1.00126.09           C  
ANISOU 5438  C6   DT J  45    15763  12005  20140  -3445   2576   4858       C  
ATOM   5439  P    DT J  46      19.855  58.245  29.383  1.00113.69           P  
ANISOU 5439  P    DT J  46    14570  11654  16972  -1728   2638   6098       P  
ATOM   5440  OP1  DT J  46      19.936  58.488  30.840  1.00112.36           O  
ANISOU 5440  OP1  DT J  46    14533  11601  16558  -1281   2685   6304       O  
ATOM   5441  OP2  DT J  46      18.578  57.785  28.793  1.00115.92           O  
ANISOU 5441  OP2  DT J  46    14613  11870  17561  -2130   2714   6096       O  
ATOM   5442  O5'  DT J  46      20.314  59.573  28.626  1.00115.74           O  
ANISOU 5442  O5'  DT J  46    14815  12284  16876  -1739   2415   5911       O  
ATOM   5443  C5'  DT J  46      21.679  59.959  28.677  1.00115.44           C  
ANISOU 5443  C5'  DT J  46    14968  12271  16623  -1492   2308   5818       C  
ATOM   5444  C4'  DT J  46      22.003  60.974  27.600  1.00112.14           C  
ANISOU 5444  C4'  DT J  46    14470  12137  16001  -1640   2117   5624       C  
ATOM   5445  O4'  DT J  46      21.941  60.351  26.293  1.00117.15           O  
ANISOU 5445  O4'  DT J  46    14950  12595  16966  -2091   2118   5466       O  
ATOM   5446  C3'  DT J  46      21.071  62.185  27.545  1.00113.22           C  
ANISOU 5446  C3'  DT J  46    14456  12704  15858  -1647   2017   5626       C  
ATOM   5447  O3'  DT J  46      21.853  63.367  27.537  1.00110.40           O  
ANISOU 5447  O3'  DT J  46    14183  12631  15135  -1414   1846   5520       O  
ATOM   5448  C2'  DT J  46      20.303  61.995  26.227  1.00116.29           C  
ANISOU 5448  C2'  DT J  46    14582  13136  16466  -2135   1993   5516       C  
ATOM   5449  C1'  DT J  46      21.317  61.232  25.393  1.00116.29           C  
ANISOU 5449  C1'  DT J  46    14622  12852  16711  -2337   1979   5362       C  
ATOM   5450  N1   DT J  46      20.730  60.421  24.275  1.00117.49           N  
ANISOU 5450  N1   DT J  46    14538  12847  17254  -2855   2003   5209       N  
ATOM   5451  C2   DT J  46      21.066  60.723  22.972  1.00118.15           C  
ANISOU 5451  C2   DT J  46    14488  13126  17280  -3129   1810   4882       C  
ATOM   5452  O2   DT J  46      21.806  61.642  22.669  1.00117.12           O  
ANISOU 5452  O2   DT J  46    14423  13284  16795  -2962   1637   4745       O  
ATOM   5453  N3   DT J  46      20.491  59.909  22.030  1.00123.17           N  
ANISOU 5453  N3   DT J  46    14925  13650  18222  -3557   1795   4592       N  
ATOM   5454  C4   DT J  46      19.640  58.842  22.254  1.00128.51           C  
ANISOU 5454  C4   DT J  46    15495  13983  19349  -3795   1983   4701       C  
ATOM   5455  O4   DT J  46      19.175  58.169  21.341  1.00137.07           O  
ANISOU 5455  O4   DT J  46    16392  14990  20699  -4189   1942   4383       O  
ATOM   5456  C5   DT J  46      19.337  58.574  23.638  1.00122.44           C  
ANISOU 5456  C5   DT J  46    14883  13012  18628  -3483   2194   5081       C  
ATOM   5457  C7   DT J  46      18.422  57.442  24.000  1.00122.42           C  
ANISOU 5457  C7   DT J  46    14808  12680  19024  -3646   2381   5142       C  
ATOM   5458  C6   DT J  46      19.892  59.365  24.572  1.00120.04           C  
ANISOU 5458  C6   DT J  46    14797  12875  17939  -3016   2176   5273       C  
ATOM   5459  P    DT J  47      21.232  64.769  28.011  1.00111.93           P  
ANISOU 5459  P    DT J  47    20608   9504  12417  -4024   3780   -598       P  
ATOM   5460  OP1  DT J  47      22.166  65.363  28.992  1.00100.19           O  
ANISOU 5460  OP1  DT J  47    19793   8217  10058  -3700   4408  -1055       O  
ATOM   5461  OP2  DT J  47      19.818  64.548  28.383  1.00122.77           O  
ANISOU 5461  OP2  DT J  47    21350  10489  14808  -4120   4293     11       O  
ATOM   5462  O5'  DT J  47      21.265  65.643  26.678  1.00110.11           O  
ANISOU 5462  O5'  DT J  47    20244   9233  12360  -4031   3122   -606       O  
ATOM   5463  C5'  DT J  47      22.324  65.458  25.745  1.00102.07           C  
ANISOU 5463  C5'  DT J  47    19348   8748  10684  -4009   2237   -890       C  
ATOM   5464  C4'  DT J  47      21.943  66.008  24.385  1.00101.22           C  
ANISOU 5464  C4'  DT J  47    18866   8518  11075  -4077   1557   -744       C  
ATOM   5465  O4'  DT J  47      21.397  64.946  23.555  1.00 96.83           O  
ANISOU 5465  O4'  DT J  47    17766   7962  11063  -4373    840   -468       O  
ATOM   5466  C3'  DT J  47      20.881  67.109  24.417  1.00108.55           C  
ANISOU 5466  C3'  DT J  47    19631   8826  12788  -4059   2076   -461       C  
ATOM   5467  O3'  DT J  47      21.255  68.158  23.545  1.00106.77           O  
ANISOU 5467  O3'  DT J  47    19492   8671  12403  -3896   1692   -626       O  
ATOM   5468  C2'  DT J  47      19.625  66.393  23.921  1.00113.30           C  
ANISOU 5468  C2'  DT J  47    19531   9106  14412  -4417   1810    102       C  
ATOM   5469  C1'  DT J  47      20.227  65.417  22.930  1.00103.88           C  
ANISOU 5469  C1'  DT J  47    18176   8375  12917  -4560    743    -60       C  
ATOM   5470  N1   DT J  47      19.353  64.251  22.612  1.00109.02           N  
ANISOU 5470  N1   DT J  47    18215   8929  14277  -4899    375    353       N  
ATOM   5471  C2   DT J  47      19.317  63.774  21.322  1.00112.34           C  
ANISOU 5471  C2   DT J  47    18215   9577  14894  -4984   -546    391       C  
ATOM   5472  O2   DT J  47      19.967  64.259