PDB Short entry for 5ONG
HEADER    DNA BINDING PROTEIN                     03-AUG-17   5ONG              
TITLE     X-RAY CRYSTAL STRUCTURE OF A NUCLEOSOME CORE PARTICLE WITH ITS DNA    
TITLE    2 SITE-SPECIFICALLY CROSSLINKED TO THE HISTONE OCTAMER                 
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: DNA (147-MER);                                             
COMPND   3 CHAIN: I;                                                            
COMPND   4 ENGINEERED: YES;                                                     
COMPND   5 MOL_ID: 2;                                                           
COMPND   6 MOLECULE: DNA (147-MER);                                             
COMPND   7 CHAIN: J;                                                            
COMPND   8 ENGINEERED: YES;                                                     
COMPND   9 MOL_ID: 3;                                                           
COMPND  10 MOLECULE: HISTONE H3.2;                                              
COMPND  11 CHAIN: A, E;                                                         
COMPND  12 ENGINEERED: YES;                                                     
COMPND  13 MUTATION: YES;                                                       
COMPND  14 MOL_ID: 4;                                                           
COMPND  15 MOLECULE: HISTONE H4;                                                
COMPND  16 CHAIN: B, F;                                                         
COMPND  17 ENGINEERED: YES;                                                     
COMPND  18 MOL_ID: 5;                                                           
COMPND  19 MOLECULE: HISTONE H2A;                                               
COMPND  20 CHAIN: C, G;                                                         
COMPND  21 ENGINEERED: YES;                                                     
COMPND  22 MOL_ID: 6;                                                           
COMPND  23 MOLECULE: HISTONE H2B 1.1;                                           
COMPND  24 CHAIN: D, H;                                                         
COMPND  25 SYNONYM: H2B1.1;                                                     
COMPND  26 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE   6 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE   7 EXPRESSION_SYSTEM_VARIANT: DH10B;                                    
SOURCE   8 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE   9 EXPRESSION_SYSTEM_VECTOR: PUC57;                                     
SOURCE  10 MOL_ID: 2;                                                           
SOURCE  11 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  12 ORGANISM_COMMON: HUMAN;                                              
SOURCE  13 ORGANISM_TAXID: 9606;                                                
SOURCE  14 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE  15 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE  16 EXPRESSION_SYSTEM_VARIANT: DH10B;                                    
SOURCE  17 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  18 EXPRESSION_SYSTEM_VECTOR: PUC57;                                     
SOURCE  19 MOL_ID: 3;                                                           
SOURCE  20 ORGANISM_SCIENTIFIC: XENOPUS LAEVIS;                                 
SOURCE  21 ORGANISM_COMMON: AFRICAN CLAWED FROG;                                
SOURCE  22 ORGANISM_TAXID: 8355;                                                
SOURCE  23 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  24 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  25 EXPRESSION_SYSTEM_VARIANT: PLYSS;                                    
SOURCE  26 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  27 EXPRESSION_SYSTEM_VECTOR: PET3A;                                     
SOURCE  28 MOL_ID: 4;                                                           
SOURCE  29 ORGANISM_SCIENTIFIC: XENOPUS LAEVIS;                                 
SOURCE  30 ORGANISM_COMMON: AFRICAN CLAWED FROG;                                
SOURCE  31 ORGANISM_TAXID: 8355;                                                
SOURCE  32 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  33 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  34 EXPRESSION_SYSTEM_VARIANT: PLYSS;                                    
SOURCE  35 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  36 EXPRESSION_SYSTEM_VECTOR: PET3A;                                     
SOURCE  37 MOL_ID: 5;                                                           
SOURCE  38 ORGANISM_SCIENTIFIC: XENOPUS LAEVIS;                                 
SOURCE  39 ORGANISM_COMMON: AFRICAN CLAWED FROG;                                
SOURCE  40 ORGANISM_TAXID: 8355;                                                
SOURCE  41 GENE: HIST1H2AJ, LOC494591;                                          
SOURCE  42 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  43 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  44 EXPRESSION_SYSTEM_VARIANT: PLYSS;                                    
SOURCE  45 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  46 EXPRESSION_SYSTEM_VECTOR: PET3A;                                     
SOURCE  47 MOL_ID: 6;                                                           
SOURCE  48 ORGANISM_SCIENTIFIC: XENOPUS LAEVIS;                                 
SOURCE  49 ORGANISM_COMMON: AFRICAN CLAWED FROG;                                
SOURCE  50 ORGANISM_TAXID: 8355;                                                
SOURCE  51 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  52 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  53 EXPRESSION_SYSTEM_VARIANT: PLYSS;                                    
SOURCE  54 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  55 EXPRESSION_SYSTEM_VECTOR: PET3A                                      
KEYWDS    NUCLEOSOME CORE PARTICLE, HISTONES, DISULFIDE, CONVERTIBLE            
KEYWDS   2 NUCLEOTIDE, DNA, DNA BINDING PROTEIN                                 
EXPDTA    X-RAY DIFFRACTION                                                     
AUTHOR    T.D.FROUWS,P.D.BARTH,T.J.RICHMOND                                     
REVDAT   2   27-DEC-17 5ONG    1       JRNL                                     
REVDAT   1   22-NOV-17 5ONG    0                                                
JRNL        AUTH   T.D.FROUWS,P.D.BARTH,T.J.RICHMOND                            
JRNL        TITL   SITE-SPECIFIC DISULFIDE CROSSLINKED NUCLEOSOMES WITH         
JRNL        TITL 2 ENHANCED STABILITY.                                          
JRNL        REF    J. MOL. BIOL.                 V. 430    45 2018              
JRNL        REFN                   ESSN 1089-8638                               
JRNL        PMID   29113904                                                     
JRNL        DOI    10.1016/J.JMB.2017.10.029                                    
REMARK   2                                                                      
REMARK   2 RESOLUTION.    2.80 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   PROGRAM     : PHENIX (DEV_2447: ???)                               
REMARK   3   AUTHORS     : PAUL ADAMS,PAVEL AFONINE,VINCENT CHEN,IAN            
REMARK   3               : DAVIS,KRESHNA GOPAL,RALF GROSSE-KUNSTLEVE,           
REMARK   3               : LI-WEI HUNG,ROBERT IMMORMINO,TOM IOERGER,            
REMARK   3               : AIRLIE MCCOY,ERIK MCKEE,NIGEL MORIARTY,              
REMARK   3               : REETAL PAI,RANDY READ,JANE RICHARDSON,               
REMARK   3               : DAVID RICHARDSON,TOD ROMO,JIM SACCHETTINI,           
REMARK   3               : NICHOLAS SAUTER,JACOB SMITH,LAURENT                  
REMARK   3               : STORONI,TOM TERWILLIGER,PETER ZWART                  
REMARK   3                                                                      
REMARK   3    REFINEMENT TARGET : NULL                                          
REMARK   3                                                                      
REMARK   3  DATA USED IN REFINEMENT.                                            
REMARK   3   RESOLUTION RANGE HIGH (ANGSTROMS) : 2.80                           
REMARK   3   RESOLUTION RANGE LOW  (ANGSTROMS) : 29.50                          
REMARK   3   MIN(FOBS/SIGMA_FOBS)              : 1.340                          
REMARK   3   COMPLETENESS FOR RANGE        (%) : 89.4                           
REMARK   3   NUMBER OF REFLECTIONS             : 47779                          
REMARK   3                                                                      
REMARK   3  FIT TO DATA USED IN REFINEMENT.                                     
REMARK   3   R VALUE     (WORKING + TEST SET) : 0.210                           
REMARK   3   R VALUE            (WORKING SET) : 0.206                           
REMARK   3   FREE R VALUE                     : 0.247                           
REMARK   3   FREE R VALUE TEST SET SIZE   (%) : 10.070                          
REMARK   3   FREE R VALUE TEST SET COUNT      : 4812                            
REMARK   3                                                                      
REMARK   3  FIT TO DATA USED IN REFINEMENT (IN BINS).                           
REMARK   3   BIN  RESOLUTION RANGE  COMPL.    NWORK NFREE   RWORK  RFREE        
REMARK   3     1 29.5008 -  8.6215    0.90     1585   165  0.1725 0.2045        
REMARK   3     2  8.6215 -  6.8716    0.92     1533   170  0.1700 0.2270        
REMARK   3     3  6.8716 -  6.0113    0.91     1497   171  0.2040 0.2500        
REMARK   3     4  6.0113 -  5.4655    0.93     1515   165  0.1943 0.2386        
REMARK   3     5  5.4655 -  5.0759    0.94     1508   188  0.1803 0.2157        
REMARK   3     6  5.0759 -  4.7779    0.94     1512   176  0.1722 0.2076        
REMARK   3     7  4.7779 -  4.5395    0.94     1522   166  0.1688 0.2018        
REMARK   3     8  4.5395 -  4.3426    0.92     1480   164  0.1756 0.2190        
REMARK   3     9  4.3426 -  4.1759    0.93     1529   150  0.1744 0.2223        
REMARK   3    10  4.1759 -  4.0321    0.94     1500   174  0.1820 0.2336        
REMARK   3    11  4.0321 -  3.9064    0.95     1492   184  0.1911 0.2204        
REMARK   3    12  3.9064 -  3.7949    0.96     1528   170  0.1960 0.2453        
REMARK   3    13  3.7949 -  3.6952    0.95     1525   194  0.2127 0.2452        
REMARK   3    14  3.6952 -  3.6052    0.95     1510   173  0.2231 0.2571        
REMARK   3    15  3.6052 -  3.5234    0.94     1478   156  0.2124 0.2854        
REMARK   3    16  3.5234 -  3.4485    0.94     1488   169  0.2464 0.2672        
REMARK   3    17  3.4485 -  3.3797    0.93     1464   186  0.2746 0.2998        
REMARK   3    18  3.3797 -  3.3160    0.95     1496   151  0.2726 0.3054        
REMARK   3    19  3.3160 -  3.2568    0.95     1528   164  0.2519 0.2828        
REMARK   3    20  3.2568 -  3.2017    0.96     1521   166  0.2703 0.2920        
REMARK   3    21  3.2017 -  3.1501    0.94     1518   143  0.2427 0.2714        
REMARK   3    22  3.1501 -  3.1017    0.91     1431   170  0.2406 0.2869        
REMARK   3    23  3.1017 -  3.0561    0.92     1446   163  0.2528 0.2910        
REMARK   3    24  3.0561 -  3.0131    0.92     1483   141  0.2430 0.3014        
REMARK   3    25  3.0131 -  2.9724    0.92     1450   164  0.2629 0.3088        
REMARK   3    26  2.9724 -  2.9339    0.82     1289   149  0.2772 0.3258        
REMARK   3    27  2.9339 -  2.8972    0.70     1096   130  0.2771 0.3339        
REMARK   3    28  2.8972 -  2.8623    0.72     1145   135  0.3028 0.3384        
REMARK   3    29  2.8623 -  2.8291    0.69     1076   118  0.3508 0.4231        
REMARK   3    30  2.8291 -  2.7973    0.52      822    97  0.3838 0.4036        
REMARK   3                                                                      
REMARK   3  BULK SOLVENT MODELLING.                                             
REMARK   3   METHOD USED        : NULL                                          
REMARK   3   SOLVENT RADIUS     : 1.11                                          
REMARK   3   SHRINKAGE RADIUS   : 0.90                                          
REMARK   3   K_SOL              : NULL                                          
REMARK   3   B_SOL              : NULL                                          
REMARK   3                                                                      
REMARK   3  ERROR ESTIMATES.                                                    
REMARK   3   COORDINATE ERROR (MAXIMUM-LIKELIHOOD BASED)     : 0.350            
REMARK   3   PHASE ERROR (DEGREES, MAXIMUM-LIKELIHOOD BASED) : 25.760           
REMARK   3                                                                      
REMARK   3  B VALUES.                                                           
REMARK   3   FROM WILSON PLOT           (A**2) : NULL                           
REMARK   3   MEAN B VALUE      (OVERALL, A**2) : NULL                           
REMARK   3   OVERALL ANISOTROPIC B VALUE.                                       
REMARK   3    B11 (A**2) : NULL                                                 
REMARK   3    B22 (A**2) : NULL                                                 
REMARK   3    B33 (A**2) : NULL                                                 
REMARK   3    B12 (A**2) : NULL                                                 
REMARK   3    B13 (A**2) : NULL                                                 
REMARK   3    B23 (A**2) : NULL                                                 
REMARK   3                                                                      
REMARK   3  TWINNING INFORMATION.                                               
REMARK   3   FRACTION: NULL                                                     
REMARK   3   OPERATOR: NULL                                                     
REMARK   3                                                                      
REMARK   3  DEVIATIONS FROM IDEAL VALUES.                                       
REMARK   3                 RMSD          COUNT                                  
REMARK   3   BOND      :  0.003          12813                                  
REMARK   3   ANGLE     :  0.597          18563                                  
REMARK   3   CHIRALITY :  0.036           2109                                  
REMARK   3   PLANARITY :  0.024           1473                                  
REMARK   3   DIHEDRAL  : 26.102           6679                                  
REMARK   3                                                                      
REMARK   3  TLS DETAILS                                                         
REMARK   3   NUMBER OF TLS GROUPS  : 58                                         
REMARK   3   TLS GROUP : 1                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID -73 THROUGH -54 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):   9.6346 111.8531  19.4256              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.7174 T22:   1.6236                                     
REMARK   3      T33:   1.6799 T12:   0.0718                                     
REMARK   3      T13:   0.4319 T23:  -0.0460                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.0744 L22:   2.1049                                     
REMARK   3      L33:   0.2138 L12:   0.1589                                     
REMARK   3      L13:   0.2685 L23:   0.7135                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   1.1736 S12:  -0.8087 S13:   0.8527                       
REMARK   3      S21:   2.5658 S22:  -1.3786 S23:   2.2344                       
REMARK   3      S31:  -0.1767 S32:  -0.7504 S33:  -0.0987                       
REMARK   3   TLS GROUP : 2                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID -53 THROUGH -44 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  14.3378  65.7429  19.4159              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.0233 T22:   1.0603                                     
REMARK   3      T33:   1.7645 T12:  -0.5449                                     
REMARK   3      T13:   0.1480 T23:   0.1066                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   4.0147 L22:   4.0769                                     
REMARK   3      L33:   1.8688 L12:  -3.9246                                     
REMARK   3      L13:  -0.0241 L23:  -0.6589                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.3548 S12:   0.5799 S13:  -1.5657                       
REMARK   3      S21:   0.8115 S22:   0.4420 S23:   1.5324                       
REMARK   3      S31:   0.2000 S32:  -1.1332 S33:   0.3414                       
REMARK   3   TLS GROUP : 3                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID -43 THROUGH -14 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  67.2307  71.4162  20.9835              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.7614 T22:   1.1192                                     
REMARK   3      T33:   1.1240 T12:   0.3555                                     
REMARK   3      T13:  -0.1825 T23:   0.3074                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.3558 L22:   0.9251                                     
REMARK   3      L33:   1.7551 L12:  -1.0474                                     
REMARK   3      L13:   0.0449 L23:  -0.5801                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.2891 S12:  -0.4906 S13:  -0.5862                       
REMARK   3      S21:   0.1569 S22:  -0.3297 S23:  -0.9212                       
REMARK   3      S31:   0.9059 S32:   1.1955 S33:  -2.1260                       
REMARK   3   TLS GROUP : 4                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID -13 THROUGH 16 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  44.8810 124.8368   1.7113              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.9237 T22:   0.4749                                     
REMARK   3      T33:   0.9163 T12:  -0.0887                                     
REMARK   3      T13:   0.1875 T23:   0.0475                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.2379 L22:   1.1750                                     
REMARK   3      L33:   1.9165 L12:   0.2645                                     
REMARK   3      L13:   1.4192 L23:   0.6977                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.1186 S12:  -0.1171 S13:   1.2973                       
REMARK   3      S21:  -0.4303 S22:  -0.1837 S23:  -0.1339                       
REMARK   3      S31:  -0.9526 S32:  -0.1328 S33:  -0.0453                       
REMARK   3   TLS GROUP : 5                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID 17 THROUGH 36 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  14.4384  74.6390  -5.5661              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.0445 T22:   1.0283                                     
REMARK   3      T33:   0.9463 T12:  -0.2830                                     
REMARK   3      T13:  -0.0035 T23:  -0.1348                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.0526 L22:   0.9116                                     
REMARK   3      L33:   0.1501 L12:   0.1051                                     
REMARK   3      L13:   0.1446 L23:   0.3826                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.1458 S12:   0.4312 S13:  -0.9420                       
REMARK   3      S21:  -0.0947 S22:  -0.5667 S23:   1.6580                       
REMARK   3      S31:   0.4609 S32:  -0.6133 S33:   0.1862                       
REMARK   3   TLS GROUP : 6                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID 37 THROUGH 46 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  52.4968  50.0233  -2.4507              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.5401 T22:   0.9031                                     
REMARK   3      T33:   1.5313 T12:   0.1462                                     
REMARK   3      T13:   0.2683 T23:  -0.1639                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.1309 L22:   0.0282                                     
REMARK   3      L33:   0.5091 L12:  -0.0068                                     
REMARK   3      L13:   0.4932 L23:  -0.0925                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.2547 S12:  -0.1860 S13:  -1.5428                       
REMARK   3      S21:  -1.3592 S22:   0.2786 S23:  -0.2679                       
REMARK   3      S31:   0.8323 S32:   0.1049 S33:   0.1119                       
REMARK   3   TLS GROUP : 7                                                      
REMARK   3    SELECTION: CHAIN 'I' AND (RESID 47 THROUGH 73 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  82.5550  92.2212  -8.8689              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.0514 T22:   1.2001                                     
REMARK   3      T33:   1.7370 T12:   0.2495                                     
REMARK   3      T13:   0.4443 T23:   0.0349                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.9973 L22:   0.6057                                     
REMARK   3      L33:   1.5365 L12:   0.0553                                     
REMARK   3      L13:  -0.1191 L23:  -1.0141                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.5659 S12:   0.1519 S13:  -0.3137                       
REMARK   3      S21:  -0.3167 S22:  -1.0556 S23:  -2.2272                       
REMARK   3      S31:  -0.0104 S32:   0.9782 S33:  -0.2702                       
REMARK   3   TLS GROUP : 8                                                      
REMARK   3    SELECTION: CHAIN 'J' AND (RESID -73 THROUGH -54 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  85.1536 102.8163 -11.9129              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.8440 T22:   1.4744                                     
REMARK   3      T33:   1.5302 T12:  -0.0371                                     
REMARK   3      T13:   0.4086 T23:   0.1775                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.3906 L22:   0.7935                                     
REMARK   3      L33:   1.5614 L12:  -0.8590                                     
REMARK   3      L13:  -0.2763 L23:  -0.2520                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.8389 S12:   0.1657 S13:   0.2923                       
REMARK   3      S21:  -1.0209 S22:  -1.4779 S23:  -1.5467                       
REMARK   3      S31:   0.0095 S32:   0.6523 S33:  -0.0656                       
REMARK   3   TLS GROUP : 9                                                      
REMARK   3    SELECTION: CHAIN 'J' AND (RESID -53 THROUGH -34 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  58.0826  54.3866  -3.2055              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.3489 T22:   0.7045                                     
REMARK   3      T33:   1.6208 T12:   0.1639                                     
REMARK   3      T13:   0.1445 T23:  -0.1214                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.1965 L22:   2.0941                                     
REMARK   3      L33:   0.8239 L12:   0.1867                                     
REMARK   3      L13:  -0.3998 L23:   0.1204                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.5337 S12:   0.0310 S13:  -1.5423                       
REMARK   3      S21:  -0.4362 S22:   0.0165 S23:  -0.0494                       
REMARK   3      S31:   0.8755 S32:   0.3189 S33:   0.1772                       
REMARK   3   TLS GROUP : 10                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID -33 THROUGH -14 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  11.0782  83.2297  -6.5520              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6192 T22:   1.2293                                     
REMARK   3      T33:   1.0295 T12:  -0.0845                                     
REMARK   3      T13:  -0.0990 T23:  -0.3091                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.3359 L22:   0.0860                                     
REMARK   3      L33:   1.4198 L12:   0.2715                                     
REMARK   3      L13:   0.1892 L23:  -0.1956                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.2823 S12:   0.2528 S13:  -0.7325                       
REMARK   3      S21:  -0.0859 S22:  -0.9664 S23:   1.9412                       
REMARK   3      S31:   0.3839 S32:  -0.9915 S33:  -0.6209                       
REMARK   3   TLS GROUP : 11                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID -13 THROUGH 16 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  52.5542 124.2774   2.7742              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.9983 T22:   0.5460                                     
REMARK   3      T33:   0.8878 T12:  -0.2561                                     
REMARK   3      T13:   0.0688 T23:   0.0652                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.2004 L22:   1.7757                                     
REMARK   3      L33:   2.1627 L12:  -0.0006                                     
REMARK   3      L13:   1.0017 L23:  -0.3553                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1463 S12:   0.0760 S13:   0.8047                       
REMARK   3      S21:   0.0273 S22:  -0.1103 S23:  -0.6187                       
REMARK   3      S31:  -1.0569 S32:   0.3830 S33:  -0.2502                       
REMARK   3   TLS GROUP : 12                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID 17 THROUGH 26 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  85.0413  84.6061  18.2396              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.4731 T22:   2.1883                                     
REMARK   3      T33:   1.5688 T12:   0.4392                                     
REMARK   3      T13:  -0.2196 T23:   0.4227                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.0388 L22:   1.5208                                     
REMARK   3      L33:   1.3696 L12:  -0.0439                                     
REMARK   3      L13:   0.1575 L23:   0.8594                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.4998 S12:  -0.8288 S13:  -0.4236                       
REMARK   3      S21:   0.3496 S22:   0.0909 S23:  -1.4465                       
REMARK   3      S31:   0.6293 S32:   0.3281 S33:   4.5429                       
REMARK   3   TLS GROUP : 13                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID 27 THROUGH 46 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  49.4277  57.3249  22.1767              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.2142 T22:   0.6356                                     
REMARK   3      T33:   1.1222 T12:   0.1757                                     
REMARK   3      T13:   0.0637 T23:   0.1599                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.8091 L22:   1.3979                                     
REMARK   3      L33:   1.4480 L12:  -1.0505                                     
REMARK   3      L13:  -0.7814 L23:  -0.3511                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.6848 S12:   0.0425 S13:  -1.5578                       
REMARK   3      S21:   0.2888 S22:   0.5355 S23:   0.1457                       
REMARK   3      S31:   1.1088 S32:   0.0189 S33:  -0.0922                       
REMARK   3   TLS GROUP : 14                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID 47 THROUGH 56 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):   9.1927  74.1298  18.0998              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.6491 T22:   1.1902                                     
REMARK   3      T33:   2.6590 T12:  -0.2126                                     
REMARK   3      T13:   0.1353 T23:   0.4091                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.9071 L22:   0.5368                                     
REMARK   3      L33:   1.8951 L12:  -0.5147                                     
REMARK   3      L13:   0.2434 L23:  -0.0921                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.2234 S12:  -0.3015 S13:   0.1741                       
REMARK   3      S21:   0.8259 S22:   1.0462 S23:   3.9804                       
REMARK   3      S31:  -0.6157 S32:  -1.8657 S33:  -0.1292                       
REMARK   3   TLS GROUP : 15                                                     
REMARK   3    SELECTION: CHAIN 'J' AND (RESID 57 THROUGH 73 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  11.5047 116.1599  19.1574              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.5229 T22:   1.4448                                     
REMARK   3      T33:   1.5245 T12:   0.3154                                     
REMARK   3      T13:   0.3431 T23:   0.0451                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.4902 L22:   0.2120                                     
REMARK   3      L33:  -0.0080 L12:   0.3419                                     
REMARK   3      L13:   0.0498 L23:   0.0388                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0861 S12:  -1.1855 S13:   0.6149                       
REMARK   3      S21:   0.3630 S22:  -0.8421 S23:   1.1553                       
REMARK   3      S31:  -0.0528 S32:  -0.1033 S33:   0.3430                       
REMARK   3   TLS GROUP : 16                                                     
REMARK   3    SELECTION: CHAIN 'A' AND (RESID 39 THROUGH 56 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  72.6655 113.6031  -3.4580              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3838 T22:   0.8281                                     
REMARK   3      T33:   0.8929 T12:  -0.3424                                     
REMARK   3      T13:   0.4167 T23:  -0.0248                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.7788 L22:   0.6497                                     
REMARK   3      L33:   0.6201 L12:  -0.7060                                     
REMARK   3      L13:  -0.0492 L23:  -0.0031                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0696 S12:  -0.1256 S13:  -0.0862                       
REMARK   3      S21:  -0.0708 S22:  -0.3364 S23:  -0.4092                       
REMARK   3      S31:  -0.1665 S32:   0.4229 S33:  -1.2476                       
REMARK   3   TLS GROUP : 17                                                     
REMARK   3    SELECTION: CHAIN 'A' AND (RESID 57 THROUGH 77 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  70.3955  95.2141  15.7005              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2024 T22:   0.7875                                     
REMARK   3      T33:   0.6664 T12:  -0.1408                                     
REMARK   3      T13:  -0.0249 T23:   0.0187                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.5143 L22:   3.0498                                     
REMARK   3      L33:   1.7374 L12:   0.1244                                     
REMARK   3      L13:  -0.1685 L23:   0.5870                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0061 S12:  -1.0664 S13:  -0.0926                       
REMARK   3      S21:   0.5993 S22:  -0.2386 S23:  -0.9009                       
REMARK   3      S31:  -0.0068 S32:   0.4769 S33:   0.0019                       
REMARK   3   TLS GROUP : 18                                                     
REMARK   3    SELECTION: CHAIN 'A' AND (RESID 78 THROUGH 120 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  61.4884  99.5426   9.5716              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.1993 T22:   0.3750                                     
REMARK   3      T33:   0.5165 T12:  -0.1139                                     
REMARK   3      T13:  -0.0269 T23:   0.0229                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.4588 L22:   2.2821                                     
REMARK   3      L33:   1.8093 L12:  -0.6040                                     
REMARK   3      L13:   0.0980 L23:  -0.5325                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.3216 S12:  -0.0780 S13:   0.5184                       
REMARK   3      S21:   0.4989 S22:  -0.1586 S23:  -1.1876                       
REMARK   3      S31:  -0.4061 S32:   0.7872 S33:  -0.0072                       
REMARK   3   TLS GROUP : 19                                                     
REMARK   3    SELECTION: CHAIN 'A' AND (RESID 121 THROUGH 134 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  50.0350 106.5553  10.2840              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.4495 T22:   0.5133                                     
REMARK   3      T33:   0.5507 T12:  -0.0919                                     
REMARK   3      T13:   0.1386 T23:  -0.1168                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   4.8080 L22:   5.1982                                     
REMARK   3      L33:   4.1485 L12:   0.7423                                     
REMARK   3      L13:   1.2722 L23:   0.4976                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.4506 S12:  -1.1945 S13:  -0.0935                       
REMARK   3      S21:   0.8805 S22:  -0.7618 S23:   1.0566                       
REMARK   3      S31:  -0.5565 S32:  -0.4063 S33:  -0.0203                       
REMARK   3   TLS GROUP : 20                                                     
REMARK   3    SELECTION: CHAIN 'B' AND (RESID 25 THROUGH 49 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  67.3193 108.7102   9.0032              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6107 T22:   0.4870                                     
REMARK   3      T33:   0.7978 T12:  -0.2036                                     
REMARK   3      T13:  -0.0066 T23:  -0.0226                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.4955 L22:   1.0717                                     
REMARK   3      L33:   2.4880 L12:   0.2956                                     
REMARK   3      L13:   0.7685 L23:   0.2049                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0304 S12:  -0.2475 S13:   0.0610                       
REMARK   3      S21:   0.6098 S22:  -0.5493 S23:  -1.1474                       
REMARK   3      S31:  -0.5368 S32:   0.8307 S33:  -0.1388                       
REMARK   3   TLS GROUP : 21                                                     
REMARK   3    SELECTION: CHAIN 'B' AND (RESID 50 THROUGH 75 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  59.2601  94.5953  17.8604              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3074 T22:   0.5245                                     
REMARK   3      T33:   0.3832 T12:   0.0678                                     
REMARK   3      T13:  -0.0659 T23:  -0.0024                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.7205 L22:   6.1909                                     
REMARK   3      L33:   0.9874 L12:   1.7109                                     
REMARK   3      L13:  -0.0566 L23:  -0.7391                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0180 S12:  -0.4520 S13:   0.0071                       
REMARK   3      S21:   1.2143 S22:  -0.0650 S23:  -0.2736                       
REMARK   3      S31:  -0.0054 S32:   0.0307 S33:   0.0643                       
REMARK   3   TLS GROUP : 22                                                     
REMARK   3    SELECTION: CHAIN 'B' AND (RESID 76 THROUGH 102 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  60.1506  82.6925  11.8279              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2638 T22:   0.5897                                     
REMARK   3      T33:   0.4096 T12:   0.0874                                     
REMARK   3      T13:  -0.0230 T23:   0.1089                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.2835 L22:   3.4235                                     
REMARK   3      L33:   0.5764 L12:   0.0076                                     
REMARK   3      L13:   0.3224 L23:  -0.8198                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1590 S12:  -0.1817 S13:   0.0548                       
REMARK   3      S21:  -0.5915 S22:   0.2293 S23:  -0.4864                       
REMARK   3      S31:   0.4300 S32:   0.3161 S33:   0.1261                       
REMARK   3   TLS GROUP : 23                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 15 THROUGH 44 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  35.6843  68.4409  21.3428              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5358 T22:   0.3194                                     
REMARK   3      T33:   0.4058 T12:  -0.0251                                     
REMARK   3      T13:   0.0412 T23:   0.0269                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.8968 L22:   1.6075                                     
REMARK   3      L33:   2.5324 L12:  -1.0599                                     
REMARK   3      L13:   0.5060 L23:   0.7281                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1666 S12:   0.0808 S13:  -0.6830                       
REMARK   3      S21:  -0.3573 S22:   0.2407 S23:   0.3488                       
REMARK   3      S31:   0.4428 S32:   0.0151 S33:  -0.1605                       
REMARK   3   TLS GROUP : 24                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 45 THROUGH 72 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  32.9355  85.2080  26.3936              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3717 T22:   0.3766                                     
REMARK   3      T33:   0.2495 T12:   0.0054                                     
REMARK   3      T13:   0.1016 T23:   0.0735                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.1947 L22:   5.5645                                     
REMARK   3      L33:   0.7939 L12:  -3.3952                                     
REMARK   3      L13:   0.4820 L23:   0.6094                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.4340 S12:  -0.8270 S13:  -0.1648                       
REMARK   3      S21:   0.0259 S22:   0.7027 S23:   0.2206                       
REMARK   3      S31:  -0.2078 S32:   0.1686 S33:   0.0433                       
REMARK   3   TLS GROUP : 25                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 73 THROUGH 79 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  18.3580  96.8430  23.7279              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2703 T22:   0.8002                                     
REMARK   3      T33:   0.3186 T12:   0.0626                                     
REMARK   3      T13:  -0.0606 T23:   0.0207                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   4.6532 L22:   4.9455                                     
REMARK   3      L33:   2.2447 L12:  -1.0052                                     
REMARK   3      L13:  -2.5038 L23:  -1.5201                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.5635 S12:  -0.9157 S13:  -0.1688                       
REMARK   3      S21:   0.2940 S22:   0.7282 S23:  -0.2767                       
REMARK   3      S31:  -0.1703 S32:  -1.3193 S33:  -0.0052                       
REMARK   3   TLS GROUP : 26                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 80 THROUGH 89 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  29.3231  97.5309  18.9306              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2541 T22:   0.4772                                     
REMARK   3      T33:   0.1984 T12:  -0.0002                                     
REMARK   3      T13:   0.0487 T23:   0.0465                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.6068 L22:   1.2179                                     
REMARK   3      L33:   0.5622 L12:  -0.7601                                     
REMARK   3      L13:   0.9423 L23:  -0.3944                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.2845 S12:   0.2418 S13:  -0.0097                       
REMARK   3      S21:   0.1492 S22:   0.1991 S23:   0.1188                       
REMARK   3      S31:  -0.3184 S32:  -0.5476 S33:  -0.0480                       
REMARK   3   TLS GROUP : 27                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 90 THROUGH 96 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  40.4434  94.7753  20.7828              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.0172 T22:   0.3182                                     
REMARK   3      T33:   0.4609 T12:   0.0012                                     
REMARK   3      T13:   0.0248 T23:  -0.0676                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.9922 L22:   3.4427                                     
REMARK   3      L33:   4.3148 L12:   0.6083                                     
REMARK   3      L13:  -0.8689 L23:  -0.9444                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1513 S12:  -0.1437 S13:   0.1501                       
REMARK   3      S21:   0.0008 S22:  -0.2614 S23:  -0.5238                       
REMARK   3      S31:  -0.0936 S32:   0.9181 S33:  -1.4756                       
REMARK   3   TLS GROUP : 28                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 97 THROUGH 101 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  37.3980  92.8994  11.0128              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5009 T22:   0.3353                                     
REMARK   3      T33:   0.3040 T12:   0.0246                                     
REMARK   3      T13:  -0.0024 T23:  -0.0019                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.4505 L22:   6.5423                                     
REMARK   3      L33:   8.9277 L12:  -0.7409                                     
REMARK   3      L13:   3.5847 L23:  -2.4840                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.6904 S12:   0.5189 S13:   0.4384                       
REMARK   3      S21:  -0.5658 S22:  -0.0602 S23:  -1.0125                       
REMARK   3      S31:   0.6017 S32:   0.4569 S33:  -0.0325                       
REMARK   3   TLS GROUP : 29                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 102 THROUGH 111 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  29.4864 102.8808  13.6992              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2908 T22:   0.3195                                     
REMARK   3      T33:   0.1843 T12:   0.0288                                     
REMARK   3      T13:   0.0619 T23:   0.0657                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.4092 L22:   4.5557                                     
REMARK   3      L33:   0.5417 L12:  -0.4084                                     
REMARK   3      L13:   0.1462 L23:   0.2230                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0288 S12:   0.2258 S13:  -0.2106                       
REMARK   3      S21:  -0.3165 S22:   0.5739 S23:  -0.0451                       
REMARK   3      S31:  -0.2910 S32:  -0.0188 S33:   0.0341                       
REMARK   3   TLS GROUP : 30                                                     
REMARK   3    SELECTION: CHAIN 'C' AND (RESID 112 THROUGH 120 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  35.2114 123.7005  14.6502              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.9312 T22:   0.8985                                     
REMARK   3      T33:   0.9549 T12:   0.1109                                     
REMARK   3      T13:  -0.0555 T23:  -0.2366                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.9324 L22:   0.4752                                     
REMARK   3      L33:   1.6598 L12:   0.8505                                     
REMARK   3      L13:  -0.2498 L23:  -0.4514                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0272 S12:  -0.3764 S13:   1.9649                       
REMARK   3      S21:   0.8797 S22:   0.1767 S23:  -0.1678                       
REMARK   3      S31:  -1.1065 S32:  -0.3065 S33:  -0.1638                       
REMARK   3   TLS GROUP : 31                                                     
REMARK   3    SELECTION: CHAIN 'D' AND (RESID 28 THROUGH 52 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  22.6424  80.6206  22.7109              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6137 T22:   0.4085                                     
REMARK   3      T33:   0.2967 T12:  -0.1682                                     
REMARK   3      T13:   0.0251 T23:   0.0695                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.1519 L22:   0.4277                                     
REMARK   3      L33:   1.6744 L12:   0.1407                                     
REMARK   3      L13:   0.2722 L23:  -0.6906                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1299 S12:  -0.0455 S13:  -0.2432                       
REMARK   3      S21:   0.3825 S22:  -0.1658 S23:   0.5013                       
REMARK   3      S31:   0.7047 S32:  -0.7070 S33:   0.0876                       
REMARK   3   TLS GROUP : 32                                                     
REMARK   3    SELECTION: CHAIN 'D' AND (RESID 53 THROUGH 81 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  38.4818  80.2396  14.6818              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3998 T22:   0.2552                                     
REMARK   3      T33:   0.2417 T12:  -0.0383                                     
REMARK   3      T13:   0.0227 T23:  -0.0107                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   6.2435 L22:   1.9767                                     
REMARK   3      L33:   2.2534 L12:  -2.1733                                     
REMARK   3      L13:  -0.0970 L23:   0.2368                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0371 S12:   0.6828 S13:  -0.0967                       
REMARK   3      S21:  -0.1260 S22:  -0.1759 S23:  -0.0858                       
REMARK   3      S31:   0.7491 S32:  -0.1372 S33:  -0.0640                       
REMARK   3   TLS GROUP : 33                                                     
REMARK   3    SELECTION: CHAIN 'D' AND (RESID 82 THROUGH 121 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  45.5591  76.7593  26.4415              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6176 T22:   0.4110                                     
REMARK   3      T33:   0.3783 T12:   0.2300                                     
REMARK   3      T13:   0.0794 T23:   0.1024                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.4887 L22:   0.8570                                     
REMARK   3      L33:   1.4152 L12:  -0.0184                                     
REMARK   3      L13:   0.8711 L23:  -0.8686                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.5377 S12:   0.0305 S13:  -0.0842                       
REMARK   3      S21:   0.4238 S22:   0.4211 S23:  -0.0727                       
REMARK   3      S31:   0.6129 S32:   0.3164 S33:   0.4663                       
REMARK   3   TLS GROUP : 34                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 39 THROUGH 56 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  23.8723 118.7440   9.7664              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6343 T22:   0.4380                                     
REMARK   3      T33:   0.4322 T12:   0.1673                                     
REMARK   3      T13:   0.0534 T23:  -0.1281                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.5227 L22:   5.7478                                     
REMARK   3      L33:   3.5905 L12:   1.2291                                     
REMARK   3      L13:  -0.7986 L23:  -0.4734                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.1094 S12:  -0.1105 S13:   0.7131                       
REMARK   3      S21:  -0.0346 S22:   0.4047 S23:   0.9499                       
REMARK   3      S31:  -0.6243 S32:  -0.8444 S33:   0.1715                       
REMARK   3   TLS GROUP : 35                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 57 THROUGH 78 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  23.1304  96.4902  -5.8569              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3791 T22:   0.5365                                     
REMARK   3      T33:   0.2981 T12:  -0.0038                                     
REMARK   3      T13:  -0.0705 T23:  -0.0400                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.6128 L22:   3.6614                                     
REMARK   3      L33:   2.6700 L12:  -0.1381                                     
REMARK   3      L13:   1.1448 L23:   1.2318                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.1526 S12:   0.0593 S13:  -0.1451                       
REMARK   3      S21:  -1.0130 S22:  -0.1041 S23:   0.5094                       
REMARK   3      S31:  -0.4714 S32:  -0.0355 S33:  -0.0429                       
REMARK   3   TLS GROUP : 36                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 79 THROUGH 85 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  23.1323  83.4224 -11.3389              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5774 T22:   0.7442                                     
REMARK   3      T33:   0.4529 T12:  -0.0811                                     
REMARK   3      T13:  -0.1314 T23:  -0.1461                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.7089 L22:   2.8843                                     
REMARK   3      L33:   0.4189 L12:   0.2599                                     
REMARK   3      L13:  -0.3197 L23:  -0.9932                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.3863 S12:   1.0623 S13:  -0.6338                       
REMARK   3      S21:  -0.7662 S22:  -0.7980 S23:   1.1109                       
REMARK   3      S31:   0.6323 S32:  -0.7022 S33:  -0.3702                       
REMARK   3   TLS GROUP : 37                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 86 THROUGH 120 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  34.5082 105.5658   2.8024              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2705 T22:   0.1507                                     
REMARK   3      T33:   0.3440 T12:   0.1356                                     
REMARK   3      T13:   0.0648 T23:  -0.0331                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.3608 L22:   1.7015                                     
REMARK   3      L33:   1.5154 L12:   0.3165                                     
REMARK   3      L13:   0.4409 L23:   0.4521                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.3189 S12:   0.1339 S13:   0.2354                       
REMARK   3      S21:   0.0887 S22:  -0.1001 S23:   0.0140                       
REMARK   3      S31:  -0.0633 S32:  -0.4060 S33:   0.0857                       
REMARK   3   TLS GROUP : 38                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 121 THROUGH 130 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  44.4056 108.0556  -2.3793              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3844 T22:   0.1960                                     
REMARK   3      T33:   0.4055 T12:   0.1977                                     
REMARK   3      T13:   0.1607 T23:  -0.0274                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.3925 L22:   1.9050                                     
REMARK   3      L33:   1.5448 L12:  -1.4871                                     
REMARK   3      L13:   1.2006 L23:  -1.7073                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0447 S12:   0.1901 S13:  -0.0379                       
REMARK   3      S21:  -0.2884 S22:  -0.5725 S23:   0.0996                       
REMARK   3      S31:   0.0903 S32:  -0.1446 S33:  -1.2320                       
REMARK   3   TLS GROUP : 39                                                     
REMARK   3    SELECTION: CHAIN 'E' AND (RESID 131 THROUGH 135 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  45.8173 100.6839  -2.4830              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.8899 T22:   0.4045                                     
REMARK   3      T33:   0.6848 T12:  -0.0271                                     
REMARK   3      T13:   0.2428 T23:   0.0224                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   8.4170 L22:   3.5193                                     
REMARK   3      L33:   4.6400 L12:  -0.3713                                     
REMARK   3      L13:   5.3455 L23:   1.4898                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0941 S12:   1.6713 S13:   0.2386                       
REMARK   3      S21:  -1.7656 S22:   0.0061 S23:  -1.8701                       
REMARK   3      S31:  -0.0210 S32:   0.7368 S33:  -0.0942                       
REMARK   3   TLS GROUP : 40                                                     
REMARK   3    SELECTION: CHAIN 'F' AND (RESID 19 THROUGH 24 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  19.8753  95.7554 -19.6522              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.7180 T22:   0.9284                                     
REMARK   3      T33:   0.3297 T12:   0.0478                                     
REMARK   3      T13:   0.0351 T23:  -0.0684                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   5.2534 L22:   8.2671                                     
REMARK   3      L33:   3.9294 L12:   3.0474                                     
REMARK   3      L13:  -0.8701 L23:  -2.9710                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.5575 S12:   0.0634 S13:  -0.3180                       
REMARK   3      S21:  -0.6619 S22:  -0.4300 S23:  -0.6717                       
REMARK   3      S31:  -0.0415 S32:  -0.3308 S33:  -0.0674                       
REMARK   3   TLS GROUP : 41                                                     
REMARK   3    SELECTION: CHAIN 'F' AND (RESID 25 THROUGH 49 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  27.9587 110.7331  -1.4715              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5058 T22:   0.2683                                     
REMARK   3      T33:   0.4099 T12:   0.1949                                     
REMARK   3      T13:   0.0398 T23:   0.0397                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.1581 L22:   0.1870                                     
REMARK   3      L33:   2.6944 L12:   0.0124                                     
REMARK   3      L13:   0.4822 L23:  -0.2620                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0492 S12:   0.2937 S13:   0.3982                       
REMARK   3      S21:  -0.5960 S22:  -0.3104 S23:   0.1734                       
REMARK   3      S31:  -0.1510 S32:  -0.4767 S33:  -0.1753                       
REMARK   3   TLS GROUP : 42                                                     
REMARK   3    SELECTION: CHAIN 'F' AND (RESID 50 THROUGH 82 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  31.9735  90.8442  -7.4967              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.3102 T22:   0.3891                                     
REMARK   3      T33:   0.2206 T12:  -0.0192                                     
REMARK   3      T13:   0.0055 T23:  -0.0836                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.8315 L22:   3.8489                                     
REMARK   3      L33:   1.0015 L12:   0.2929                                     
REMARK   3      L13:   0.0292 L23:   0.9043                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.4867 S12:   0.3802 S13:  -0.1609                       
REMARK   3      S21:  -0.2090 S22:   0.7880 S23:  -0.5165                       
REMARK   3      S31:   0.0608 S32:  -0.2748 S33:   0.0795                       
REMARK   3   TLS GROUP : 43                                                     
REMARK   3    SELECTION: CHAIN 'F' AND (RESID 83 THROUGH 102 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  32.7693  86.1628   3.6712              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.2943 T22:   0.2873                                     
REMARK   3      T33:   0.2934 T12:   0.0142                                     
REMARK   3      T13:   0.0093 T23:  -0.0529                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.7000 L22:   1.2985                                     
REMARK   3      L33:   3.5934 L12:  -0.3228                                     
REMARK   3      L13:   0.9639 L23:   1.1617                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.3701 S12:  -0.0630 S13:  -0.3029                       
REMARK   3      S21:   0.2822 S22:   0.0438 S23:   0.3122                       
REMARK   3      S31:   0.9118 S32:  -0.0093 S33:  -0.0048                       
REMARK   3   TLS GROUP : 44                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 14 THROUGH 26 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  57.6242  63.0571 -13.7248              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.9481 T22:   0.4517                                     
REMARK   3      T33:   0.8920 T12:   0.1605                                     
REMARK   3      T13:   0.4070 T23:  -0.2974                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.6838 L22:   2.5007                                     
REMARK   3      L33:   3.3317 L12:  -0.0151                                     
REMARK   3      L13:   2.5712 L23:   1.3182                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.3149 S12:   0.5831 S13:  -0.8711                       
REMARK   3      S21:   0.0572 S22:  -0.0064 S23:   0.2224                       
REMARK   3      S31:   0.9912 S32:   0.5204 S33:   1.3979                       
REMARK   3   TLS GROUP : 45                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 27 THROUGH 36 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  53.5158  64.8841  -1.2892              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.8415 T22:   0.3866                                     
REMARK   3      T33:   0.7184 T12:   0.1199                                     
REMARK   3      T13:   0.1075 T23:   0.0137                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   5.5663 L22:   0.5398                                     
REMARK   3      L33:   4.2442 L12:   0.3944                                     
REMARK   3      L13:  -3.7075 L23:  -0.4968                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0723 S12:  -0.4527 S13:  -1.0877                       
REMARK   3      S21:   0.3627 S22:  -0.4772 S23:  -0.8961                       
REMARK   3      S31:   0.0978 S32:   0.7302 S33:  -0.0100                       
REMARK   3   TLS GROUP : 46                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 37 THROUGH 46 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  44.5082  65.1070   0.5924              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6964 T22:   0.7515                                     
REMARK   3      T33:   0.4723 T12:   0.2591                                     
REMARK   3      T13:   0.1187 T23:  -0.1305                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.4293 L22:   3.7958                                     
REMARK   3      L33:   2.1084 L12:   1.5295                                     
REMARK   3      L13:   0.8524 L23:  -0.1664                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.3540 S12:  -0.1698 S13:   0.1349                       
REMARK   3      S21:   0.2304 S22:  -0.6919 S23:   0.4896                       
REMARK   3      S31:   0.3196 S32:  -0.3969 S33:  -0.0593                       
REMARK   3   TLS GROUP : 47                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 47 THROUGH 72 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  58.5252  79.9926 -13.7023              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.7286 T22:   0.6901                                     
REMARK   3      T33:   0.4571 T12:   0.1318                                     
REMARK   3      T13:   0.1977 T23:  -0.0588                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.0682 L22:   1.7004                                     
REMARK   3      L33:   0.7277 L12:   1.1102                                     
REMARK   3      L13:   1.2754 L23:   0.9632                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.6236 S12:   1.4804 S13:  -0.3494                       
REMARK   3      S21:  -1.1767 S22:   0.5617 S23:  -0.4066                       
REMARK   3      S31:  -0.0341 S32:   0.1621 S33:   0.0674                       
REMARK   3   TLS GROUP : 48                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 73 THROUGH 80 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  73.7419  88.6878 -12.0699              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.7449 T22:   0.7785                                     
REMARK   3      T33:   0.8064 T12:   0.3208                                     
REMARK   3      T13:   0.3367 T23:   0.1646                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.0056 L22:   0.9491                                     
REMARK   3      L33:   2.4772 L12:   0.2033                                     
REMARK   3      L13:   0.9123 L23:  -0.1884                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0175 S12:   0.3023 S13:   0.5773                       
REMARK   3      S21:  -0.3284 S22:  -0.5894 S23:  -0.4820                       
REMARK   3      S31:   0.0676 S32:   0.0072 S33:  -1.0287                       
REMARK   3   TLS GROUP : 49                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 81 THROUGH 89 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  63.4262  92.4151  -8.8487              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.4183 T22:   0.6297                                     
REMARK   3      T33:   0.5837 T12:   0.1343                                     
REMARK   3      T13:   0.1877 T23:  -0.0101                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.7010 L22:   2.5085                                     
REMARK   3      L33:   0.6284 L12:   1.3269                                     
REMARK   3      L13:   0.6627 L23:   1.2537                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.4460 S12:   0.4596 S13:  -0.3888                       
REMARK   3      S21:  -0.5671 S22:   0.0953 S23:   0.1608                       
REMARK   3      S31:   0.4026 S32:   0.8624 S33:  -0.5278                       
REMARK   3   TLS GROUP : 50                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 90 THROUGH 101 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  53.3624  90.7091  -6.3182              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5298 T22:   0.3338                                     
REMARK   3      T33:   0.4475 T12:   0.0273                                     
REMARK   3      T13:   0.1530 T23:   0.0676                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   4.1632 L22:   3.9034                                     
REMARK   3      L33:   5.9519 L12:   0.1219                                     
REMARK   3      L13:   0.6444 L23:  -0.3090                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.0920 S12:   0.8046 S13:   0.4662                       
REMARK   3      S21:  -0.1242 S22:  -0.1962 S23:   0.9479                       
REMARK   3      S31:  -0.0984 S32:  -0.3505 S33:  -0.0118                       
REMARK   3   TLS GROUP : 51                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 102 THROUGH 111 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  64.4944  98.2274  -4.5290              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.4440 T22:   0.4813                                     
REMARK   3      T33:   0.5598 T12:  -0.1324                                     
REMARK   3      T13:   0.0519 T23:   0.0158                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.1690 L22:   3.8293                                     
REMARK   3      L33:   0.7442 L12:   0.7411                                     
REMARK   3      L13:   0.0140 L23:  -0.5898                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.2056 S12:   0.0837 S13:   0.2192                       
REMARK   3      S21:   0.1780 S22:   0.0646 S23:  -0.5961                       
REMARK   3      S31:  -1.0810 S32:   0.7053 S33:   0.0951                       
REMARK   3   TLS GROUP : 52                                                     
REMARK   3    SELECTION: CHAIN 'G' AND (RESID 112 THROUGH 119 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  61.1728 117.7313  -8.5479              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.9118 T22:   0.7331                                     
REMARK   3      T33:   1.0727 T12:  -0.0643                                     
REMARK   3      T13:   0.1669 T23:   0.2252                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.2659 L22:   0.2288                                     
REMARK   3      L33:   2.0434 L12:  -0.3064                                     
REMARK   3      L13:  -0.8812 L23:   0.4152                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.2496 S12:   0.8638 S13:   0.8072                       
REMARK   3      S21:   0.0566 S22:  -0.5894 S23:  -0.6900                       
REMARK   3      S31:  -0.2212 S32:  -0.5060 S33:  -0.0268                       
REMARK   3   TLS GROUP : 53                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 29 THROUGH 34 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  65.1283  68.2014   1.8873              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   1.2247 T22:   0.5547                                     
REMARK   3      T33:   0.5649 T12:   0.0453                                     
REMARK   3      T13:   0.0021 T23:  -0.0281                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.4174 L22:   2.8610                                     
REMARK   3      L33:   8.4705 L12:  -3.0345                                     
REMARK   3      L13:   5.3244 L23:  -4.8996                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.2744 S12:  -0.5404 S13:   0.8392                       
REMARK   3      S21:  -0.3062 S22:  -0.3124 S23:   0.2085                       
REMARK   3      S31:   0.7005 S32:  -0.2139 S33:  -0.0002                       
REMARK   3   TLS GROUP : 54                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 35 THROUGH 52 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  68.3065  76.3388 -13.9303              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5616 T22:   0.8205                                     
REMARK   3      T33:   0.7498 T12:   0.3954                                     
REMARK   3      T13:   0.4591 T23:   0.0411                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   0.9763 L22:   1.1218                                     
REMARK   3      L33:   1.3011 L12:   0.4309                                     
REMARK   3      L13:   1.1308 L23:   0.4432                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.2344 S12:   0.5689 S13:   0.0267                       
REMARK   3      S21:  -0.4986 S22:   0.1849 S23:  -0.5605                       
REMARK   3      S31:  -0.1559 S32:   0.6618 S33:   1.9792                       
REMARK   3   TLS GROUP : 55                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 53 THROUGH 81 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  51.8775  77.5863  -1.1694              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.4860 T22:   0.4010                                     
REMARK   3      T33:   0.3911 T12:   0.1198                                     
REMARK   3      T13:   0.0900 T23:  -0.0580                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   3.7580 L22:   1.2539                                     
REMARK   3      L33:   1.4031 L12:   0.9330                                     
REMARK   3      L13:  -0.0722 L23:  -0.3542                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0835 S12:  -0.7253 S13:   0.0035                       
REMARK   3      S21:  -0.3242 S22:  -0.2289 S23:  -0.3059                       
REMARK   3      S31:   0.2024 S32:   0.2017 S33:  -0.0341                       
REMARK   3   TLS GROUP : 56                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 82 THROUGH 87 )                   
REMARK   3    ORIGIN FOR THE GROUP (A):  37.0605  66.6074  -1.5037              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.6005 T22:   0.2998                                     
REMARK   3      T33:   0.5699 T12:   0.0931                                     
REMARK   3      T13:   0.0063 T23:  -0.1686                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   6.3441 L22:   0.1644                                     
REMARK   3      L33:   3.5558 L12:   0.7996                                     
REMARK   3      L13:  -4.6624 L23:  -0.5663                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.3553 S12:   0.5399 S13:  -0.6970                       
REMARK   3      S21:  -0.4898 S22:  -0.1729 S23:   0.0433                       
REMARK   3      S31:  -0.2132 S32:   0.1933 S33:   0.0616                       
REMARK   3   TLS GROUP : 57                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 88 THROUGH 100 )                  
REMARK   3    ORIGIN FOR THE GROUP (A):  42.1947  77.0195  -8.8871              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.5120 T22:   0.2559                                     
REMARK   3      T33:   0.2027 T12:  -0.0933                                     
REMARK   3      T13:  -0.0631 T23:  -0.1096                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   2.7472 L22:   2.6616                                     
REMARK   3      L33:   0.5303 L12:  -2.3492                                     
REMARK   3      L13:  -1.1366 L23:   1.1696                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:   0.0307 S12:  -0.1226 S13:   0.4746                       
REMARK   3      S21:  -0.9739 S22:  -0.1708 S23:  -0.0027                       
REMARK   3      S31:  -0.1516 S32:  -0.5086 S33:  -0.1293                       
REMARK   3   TLS GROUP : 58                                                     
REMARK   3    SELECTION: CHAIN 'H' AND (RESID 101 THROUGH 121 )                 
REMARK   3    ORIGIN FOR THE GROUP (A):  48.1280  72.3466 -17.8824              
REMARK   3    T TENSOR                                                          
REMARK   3      T11:   0.8271 T22:   0.4956                                     
REMARK   3      T33:   0.3862 T12:   0.0147                                     
REMARK   3      T13:   0.0730 T23:  -0.1478                                     
REMARK   3    L TENSOR                                                          
REMARK   3      L11:   1.8167 L22:   7.1874                                     
REMARK   3      L33:   1.1581 L12:  -0.1976                                     
REMARK   3      L13:   1.0604 L23:   1.8696                                     
REMARK   3    S TENSOR                                                          
REMARK   3      S11:  -0.4196 S12:   1.0392 S13:  -0.0854                       
REMARK   3      S21:  -1.1874 S22:   0.3928 S23:  -0.6884                       
REMARK   3      S31:  -0.4380 S32:   0.1858 S33:   0.0889                       
REMARK   3                                                                      
REMARK   3  NCS DETAILS                                                         
REMARK   3   NUMBER OF NCS GROUPS : NULL                                        
REMARK   3                                                                      
REMARK   3  OTHER REFINEMENT REMARKS: NULL                                      
REMARK   4                                                                      
REMARK   4 5ONG COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY PDBE ON 03-AUG-17.                  
REMARK 100 THE DEPOSITION ID IS D_1200006072.                                   
REMARK 200                                                                      
REMARK 200 EXPERIMENTAL DETAILS                                                 
REMARK 200  EXPERIMENT TYPE                : X-RAY DIFFRACTION                  
REMARK 200  DATE OF DATA COLLECTION        : 11-SEP-14                          
REMARK 200  TEMPERATURE           (KELVIN) : 90                                 
REMARK 200  PH                             : 6                                  
REMARK 200  NUMBER OF CRYSTALS USED        : 1                                  
REMARK 200                                                                      
REMARK 200  SYNCHROTRON              (Y/N) : Y                                  
REMARK 200  RADIATION SOURCE               : SLS                                
REMARK 200  BEAMLINE                       : X06SA                              
REMARK 200  X-RAY GENERATOR MODEL          : NULL                               
REMARK 200  MONOCHROMATIC OR LAUE    (M/L) : M                                  
REMARK 200  WAVELENGTH OR RANGE        (A) : 1.0                                
REMARK 200  MONOCHROMATOR                  : NULL                               
REMARK 200  OPTICS                         : NULL                               
REMARK 200                                                                      
REMARK 200  DETECTOR TYPE                  : PIXEL                              
REMARK 200  DETECTOR MANUFACTURER          : DECTRIS PILATUS 6M-F               
REMARK 200  INTENSITY-INTEGRATION SOFTWARE : XDS                                
REMARK 200  DATA SCALING SOFTWARE          : SCALA                              
REMARK 200                                                                      
REMARK 200  NUMBER OF UNIQUE REFLECTIONS   : 47952                              
REMARK 200  RESOLUTION RANGE HIGH      (A) : 2.797                              
REMARK 200  RESOLUTION RANGE LOW       (A) : 29.540                             
REMARK 200  REJECTION CRITERIA  (SIGMA(I)) : NULL                               
REMARK 200                                                                      
REMARK 200 OVERALL.                                                             
REMARK 200  COMPLETENESS FOR RANGE     (%) : 90.3                               
REMARK 200  DATA REDUNDANCY                : 3.300                              
REMARK 200  R MERGE                    (I) : 0.08400                            
REMARK 200  R SYM                      (I) : NULL                               
REMARK 200  <I/SIGMA(I)> FOR THE DATA SET  : 12.7000                            
REMARK 200                                                                      
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.                                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 2.80                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE LOW  (A) : 2.95                     
REMARK 200  COMPLETENESS FOR SHELL     (%) : 68.0                               
REMARK 200  DATA REDUNDANCY IN SHELL       : NULL                               
REMARK 200  R MERGE FOR SHELL          (I) : 0.23100                            
REMARK 200  R SYM FOR SHELL            (I) : NULL                               
REMARK 200  <I/SIGMA(I)> FOR SHELL         : 2.500                              
REMARK 200                                                                      
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH                              
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: MOLECULAR REPLACEMENT        
REMARK 200 SOFTWARE USED: PHASER                                                
REMARK 200 STARTING MODEL: 1KX5                                                 
REMARK 200                                                                      
REMARK 200 REMARK: HOLLOW HEXAGONAL RODS                                        
REMARK 280                                                                      
REMARK 280 CRYSTAL                                                              
REMARK 280 SOLVENT CONTENT, VS   (%): 59.09                                     
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 3.01                     
REMARK 280                                                                      
REMARK 280 CRYSTALLIZATION CONDITIONS: SAMPLE WAS MIXED IN A 1:1 RATIO WITH     
REMARK 280  10 MM NA-CACODYLATE, PH 6.0, 130-180 MM MNCL2, 100-160 MM KCL       
REMARK 280  AND EQUILIBRATED AGAINST A 1:4 DILUTION OF THE SAME SOLUTION,       
REMARK 280  VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 295K                     
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY                                            
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 21 21 21                       
REMARK 290                                                                      
REMARK 290      SYMOP   SYMMETRY                                                
REMARK 290     NNNMMM   OPERATOR                                                
REMARK 290       1555   X,Y,Z                                                   
REMARK 290       2555   -X+1/2,-Y,Z+1/2                                         
REMARK 290       3555   -X,Y+1/2,-Z+1/2                                         
REMARK 290       4555   X+1/2,-Y+1/2,-Z                                         
REMARK 290                                                                      
REMARK 290     WHERE NNN -> OPERATOR NUMBER                                     
REMARK 290           MMM -> TRANSLATION VECTOR                                  
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS                            
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM             
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY                
REMARK 290 RELATED MOLECULES.                                                   
REMARK 290   SMTRY1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   2 -1.000000  0.000000  0.000000       53.12000            
REMARK 290   SMTRY2   2  0.000000 -1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   2  0.000000  0.000000  1.000000       54.74500            
REMARK 290   SMTRY1   3 -1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   3  0.000000  1.000000  0.000000       91.56500            
REMARK 290   SMTRY3   3  0.000000  0.000000 -1.000000       54.74500            
REMARK 290   SMTRY1   4  1.000000  0.000000  0.000000       53.12000            
REMARK 290   SMTRY2   4  0.000000 -1.000000  0.000000       91.56500            
REMARK 290   SMTRY3   4  0.000000  0.000000 -1.000000        0.00000            
REMARK 290                                                                      
REMARK 290 REMARK: NULL                                                         
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: DECAMERIC                         
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: DECAMERIC                  
REMARK 350 SOFTWARE USED: PISA                                                  
REMARK 350 TOTAL BURIED SURFACE AREA: 60470 ANGSTROM**2                         
REMARK 350 SURFACE AREA OF THE COMPLEX: 72040 ANGSTROM**2                       
REMARK 350 CHANGE IN SOLVENT FREE ENERGY: -518.0 KCAL/MOL                       
REMARK 350 APPLY THE FOLLOWING TO CHAINS: I, J, A, B, C, D, E, F, G, H          
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     ALA A     1                                                      
REMARK 465     ARG A     2                                                      
REMARK 465     THR A     3                                                      
REMARK 465     LYS A     4                                                      
REMARK 465     GLN A     5                                                      
REMARK 465     THR A     6                                                      
REMARK 465     ALA A     7                                                      
REMARK 465     ARG A     8                                                      
REMARK 465     LYS A     9                                                      
REMARK 465     SER A    10                                                      
REMARK 465     THR A    11                                                      
REMARK 465     GLY A    12                                                      
REMARK 465     GLY A    13                                                      
REMARK 465     LYS A    14                                                      
REMARK 465     ALA A    15                                                      
REMARK 465     PRO A    16                                                      
REMARK 465     ARG A    17                                                      
REMARK 465     LYS A    18                                                      
REMARK 465     GLN A    19                                                      
REMARK 465     LEU A    20                                                      
REMARK 465     ALA A    21                                                      
REMARK 465     THR A    22                                                      
REMARK 465     LYS A    23                                                      
REMARK 465     ALA A    24                                                      
REMARK 465     ALA A    25                                                      
REMARK 465     ARG A    26                                                      
REMARK 465     LYS A    27                                                      
REMARK 465     SER A    28                                                      
REMARK 465     ALA A    29                                                      
REMARK 465     PRO A    30                                                      
REMARK 465     ALA A    31                                                      
REMARK 465     THR A    32                                                      
REMARK 465     GLY A    33                                                      
REMARK 465     GLY A    34                                                      
REMARK 465     VAL A    35                                                      
REMARK 465     LYS A    36                                                      
REMARK 465     LYS A    37                                                      
REMARK 465     PRO A    38                                                      
REMARK 465     ALA A   135                                                      
REMARK 465     MET B     0                                                      
REMARK 465     SER B     1                                                      
REMARK 465     GLY B     2                                                      
REMARK 465     ARG B     3                                                      
REMARK 465     GLY B     4                                                      
REMARK 465     LYS B     5                                                      
REMARK 465     GLY B     6                                                      
REMARK 465     GLY B     7                                                      
REMARK 465     LYS B     8                                                      
REMARK 465     GLY B     9                                                      
REMARK 465     LEU B    10                                                      
REMARK 465     GLY B    11                                                      
REMARK 465     LYS B    12                                                      
REMARK 465     GLY B    13                                                      
REMARK 465     GLY B    14                                                      
REMARK 465     ALA B    15                                                      
REMARK 465     LYS B    16                                                      
REMARK 465     ARG B    17                                                      
REMARK 465     HIS B    18                                                      
REMARK 465     ARG B    19                                                      
REMARK 465     LYS B    20                                                      
REMARK 465     VAL B    21                                                      
REMARK 465     LEU B    22                                                      
REMARK 465     ARG B    23                                                      
REMARK 465     ASP B    24                                                      
REMARK 465     SER C     1                                                      
REMARK 465     GLY C     2                                                      
REMARK 465     ARG C     3                                                      
REMARK 465     GLY C     4                                                      
REMARK 465     LYS C     5                                                      
REMARK 465     GLN C     6                                                      
REMARK 465     GLY C     7                                                      
REMARK 465     GLY C     8                                                      
REMARK 465     LYS C     9                                                      
REMARK 465     THR C    10                                                      
REMARK 465     ARG C    11                                                      
REMARK 465     ALA C    12                                                      
REMARK 465     LYS C    13                                                      
REMARK 465     ALA C    14                                                      
REMARK 465     GLU C   121                                                      
REMARK 465     SER C   122                                                      
REMARK 465     SER C   123                                                      
REMARK 465     LYS C   124                                                      
REMARK 465     SER C   125                                                      
REMARK 465     ALA C   126                                                      
REMARK 465     LYS C   127                                                      
REMARK 465     SER C   128                                                      
REMARK 465     LYS C   129                                                      
REMARK 465     ALA D     1                                                      
REMARK 465     LYS D     2                                                      
REMARK 465     SER D     3                                                      
REMARK 465     ALA D     4                                                      
REMARK 465     PRO D     5                                                      
REMARK 465     ALA D     6                                                      
REMARK 465     PRO D     7                                                      
REMARK 465     LYS D     8                                                      
REMARK 465     LYS D     9                                                      
REMARK 465     GLY D    10                                                      
REMARK 465     SER D    11                                                      
REMARK 465     LYS D    12                                                      
REMARK 465     LYS D    13                                                      
REMARK 465     ALA D    14                                                      
REMARK 465     VAL D    15                                                      
REMARK 465     THR D    16                                                      
REMARK 465     LYS D    17                                                      
REMARK 465     THR D    18                                                      
REMARK 465     GLN D    19                                                      
REMARK 465     LYS D    20                                                      
REMARK 465     LYS D    21                                                      
REMARK 465     ASP D    22                                                      
REMARK 465     GLY D    23                                                      
REMARK 465     LYS D    24                                                      
REMARK 465     LYS D    25                                                      
REMARK 465     ARG D    26                                                      
REMARK 465     ARG D    27                                                      
REMARK 465     LYS D   122                                                      
REMARK 465     ALA E     1                                                      
REMARK 465     ARG E     2                                                      
REMARK 465     THR E     3                                                      
REMARK 465     LYS E     4                                                      
REMARK 465     GLN E     5                                                      
REMARK 465     THR E     6                                                      
REMARK 465     ALA E     7                                                      
REMARK 465     ARG E     8                                                      
REMARK 465     LYS E     9                                                      
REMARK 465     SER E    10                                                      
REMARK 465     THR E    11                                                      
REMARK 465     GLY E    12                                                      
REMARK 465     GLY E    13                                                      
REMARK 465     LYS E    14                                                      
REMARK 465     ALA E    15                                                      
REMARK 465     PRO E    16                                                      
REMARK 465     ARG E    17                                                      
REMARK 465     LYS E    18                                                      
REMARK 465     GLN E    19                                                      
REMARK 465     LEU E    20                                                      
REMARK 465     ALA E    21                                                      
REMARK 465     THR E    22                                                      
REMARK 465     LYS E    23                                                      
REMARK 465     ALA E    24                                                      
REMARK 465     ALA E    25                                                      
REMARK 465     ARG E    26                                                      
REMARK 465     LYS E    27                                                      
REMARK 465     SER E    28                                                      
REMARK 465     ALA E    29                                                      
REMARK 465     PRO E    30                                                      
REMARK 465     ALA E    31                                                      
REMARK 465     THR E    32                                                      
REMARK 465     GLY E    33                                                      
REMARK 465     GLY E    34                                                      
REMARK 465     VAL E    35                                                      
REMARK 465     LYS E    36                                                      
REMARK 465     LYS E    37                                                      
REMARK 465     PRO E    38                                                      
REMARK 465     MET F     0                                                      
REMARK 465     SER F     1                                                      
REMARK 465     GLY F     2                                                      
REMARK 465     ARG F     3                                                      
REMARK 465     GLY F     4                                                      
REMARK 465     LYS F     5                                                      
REMARK 465     GLY F     6                                                      
REMARK 465     GLY F     7                                                      
REMARK 465     LYS F     8                                                      
REMARK 465     GLY F     9                                                      
REMARK 465     LEU F    10                                                      
REMARK 465     GLY F    11                                                      
REMARK 465     LYS F    12                                                      
REMARK 465     GLY F    13                                                      
REMARK 465     GLY F    14                                                      
REMARK 465     ALA F    15                                                      
REMARK 465     LYS F    16                                                      
REMARK 465     ARG F    17                                                      
REMARK 465     HIS F    18                                                      
REMARK 465     SER G     1                                                      
REMARK 465     GLY G     2                                                      
REMARK 465     ARG G     3                                                      
REMARK 465     GLY G     4                                                      
REMARK 465     LYS G     5                                                      
REMARK 465     GLN G     6                                                      
REMARK 465     GLY G     7                                                      
REMARK 465     GLY G     8                                                      
REMARK 465     LYS G     9                                                      
REMARK 465     THR G    10                                                      
REMARK 465     ARG G    11                                                      
REMARK 465     ALA G    12                                                      
REMARK 465     LYS G    13                                                      
REMARK 465     THR G   120                                                      
REMARK 465     GLU G   121                                                      
REMARK 465     SER G   122                                                      
REMARK 465     SER G   123                                                      
REMARK 465     LYS G   124                                                      
REMARK 465     SER G   125                                                      
REMARK 465     ALA G   126                                                      
REMARK 465     LYS G   127                                                      
REMARK 465     SER G   128                                                      
REMARK 465     LYS G   129                                                      
REMARK 465     ALA H     1                                                      
REMARK 465     LYS H     2                                                      
REMARK 465     SER H     3                                                      
REMARK 465     ALA H     4                                                      
REMARK 465     PRO H     5                                                      
REMARK 465     ALA H     6                                                      
REMARK 465     PRO H     7                                                      
REMARK 465     LYS H     8                                                      
REMARK 465     LYS H     9                                                      
REMARK 465     GLY H    10                                                      
REMARK 465     SER H    11                                                      
REMARK 465     LYS H    12                                                      
REMARK 465     LYS H    13                                                      
REMARK 465     ALA H    14                                                      
REMARK 465     VAL H    15                                                      
REMARK 465     THR H    16                                                      
REMARK 465     LYS H    17                                                      
REMARK 465     THR H    18                                                      
REMARK 465     GLN H    19                                                      
REMARK 465     LYS H    20                                                      
REMARK 465     LYS H    21                                                      
REMARK 465     ASP H    22                                                      
REMARK 465     GLY H    23                                                      
REMARK 465     LYS H    24                                                      
REMARK 465     LYS H    25                                                      
REMARK 465     ARG H    26                                                      
REMARK 465     ARG H    27                                                      
REMARK 465     LYS H    28                                                      
REMARK 465     LYS H   122                                                      
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   O    ARG F    40     O    HOH F   201              1.95            
REMARK 500   N2    DG I    56     O2    DC J   -56              2.06            
REMARK 500   OP2   DC J   -27     O    HOH J   201              2.15            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500     DG I -34   O4' -  C1' -  N9  ANGL. DEV. =   2.0 DEGREES          
REMARK 500     DG I   5   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG I  14   O4' -  C1' -  N9  ANGL. DEV. =   1.9 DEGREES          
REMARK 500     DG I  25   O4' -  C1' -  N9  ANGL. DEV. =   2.1 DEGREES          
REMARK 500     DG I  27   O4' -  C1' -  N9  ANGL. DEV. =   2.3 DEGREES          
REMARK 500     DA J -46   O4' -  C1' -  N9  ANGL. DEV. =   1.8 DEGREES          
REMARK 500     DT J -40   O4' -  C1' -  N1  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG J -34   O4' -  C1' -  N9  ANGL. DEV. =   1.9 DEGREES          
REMARK 500     DT J -29   O4' -  C1' -  N1  ANGL. DEV. =   1.9 DEGREES          
REMARK 500     DG J  14   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG J  25   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG J  27   O4' -  C1' -  N9  ANGL. DEV. =   1.9 DEGREES          
REMARK 500     DC J  59   O4' -  C1' -  N1  ANGL. DEV. =   2.0 DEGREES          
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    CYS A  40      -62.60   -163.79                                   
REMARK 500    ASN C  38       60.82     28.10                                   
REMARK 500    LEU C  97       42.33    -97.77                                   
REMARK 500    ARG F  95       69.54   -113.41                                   
REMARK 500    LEU G  97       33.77    -97.22                                   
REMARK 500    SER H 120       36.61    -75.48                                   
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 525                                                                      
REMARK 525 SOLVENT                                                              
REMARK 525                                                                      
REMARK 525 THE SOLVENT MOLECULES HAVE CHAIN IDENTIFIERS THAT                    
REMARK 525 INDICATE THE POLYMER CHAIN WITH WHICH THEY ARE MOST                  
REMARK 525 CLOSELY ASSOCIATED. THE REMARK LISTS ALL THE SOLVENT                 
REMARK 525 MOLECULES WHICH ARE MORE THAN 5A AWAY FROM THE                       
REMARK 525 NEAREST POLYMER CHAIN (M = MODEL NUMBER;                             
REMARK 525 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE                  
REMARK 525 NUMBER; I=INSERTION CODE):                                           
REMARK 525                                                                      
REMARK 525  M RES CSSEQI                                                        
REMARK 525    HOH J 217        DISTANCE = 10.00 ANGSTROMS                       
REMARK 620                                                                      
REMARK 620 METAL COORDINATION                                                   
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):                             
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN I 110  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1  DG I -35   N7                                                     
REMARK 620 2  DG I -34   O6   81.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN I 107  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1  DG I  27   N7                                                     
REMARK 620 2 HOH J 208   O    97.1                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN I 103  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1  DG I  55   N7                                                     
REMARK 620 2  DG I  56   N7  106.5                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN J 103  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1  DG J -35   N7                                                     
REMARK 620 2  DG J -34   O6   91.0                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN J 104  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 G47 J  70   N7                                                     
REMARK 620 2  DG J  71   O6  106.8                                              
REMARK 620 N                    1                                               
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN E 201  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 ASP E  77   OD1                                                    
REMARK 620 2 HOH F 206   O   137.2                                              
REMARK 620 3 VAL D  45   O    41.2 105.1                                        
REMARK 620 4 HOH D 301   O    73.0  72.5  75.3                                  
REMARK 620 N                    1     2     3                                   
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              MN J 109  MN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HOH J 204   O                                                      
REMARK 620 2 HOH J 203   O    57.7                                              
REMARK 620 N                    1                                               
REMARK 800                                                                      
REMARK 800 SITE                                                                 
REMARK 800 SITE_IDENTIFIER: AC1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 101                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 102                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 103                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 105                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 106                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 107                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 108                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 109                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN I 110                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 101                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 102                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 103                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 104                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 106                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 107                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 108                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN J 109                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue CL A 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue CL D 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue MN E 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue CL E 202                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue CL G 201                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for Di-peptide CYS E 40 and G47 J     
REMARK 800  70                                                                  
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: 5OMX   RELATED DB: PDB                                   
REMARK 900 RELATED X-RAY STRUCTURE                                              
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 CONSTRUCTS WERE ALL SEQUENCED AND THE EXPRESSED PROTEIN MW WAS       
REMARK 999 CONFIRMED BY MASS SPEC: 30268543:42-452 EXPRESSION VECTOR PET3-H3    
REMARK 999 H3 GENE FOR XENOPUS LAEVIS-LIKE HISTONE H3                           
REMARK 999 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 
REMARK 999 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 
REMARK 999 30268542|EMB|CAD89678.1| XENOPUS LAEVIS-LIKE HISTONE H2B             
REMARK 999 [EXPRESSION VECTOR PET3-H2B]                                         
REMARK 999                                                                      
REMARK 999 MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVF 
DBREF  5ONG I  -73    73  PDB    5ONG     5ONG           -73     73             
DBREF  5ONG J  -73    73  PDB    5ONG     5ONG           -73     73             
DBREF  5ONG A    1   135  UNP    P84233   H32_XENLA        2    136             
DBREF  5ONG B    0   102  UNP    P62799   H4_XENLA         1    103             
DBREF  5ONG C    1   129  UNP    Q6AZJ8   Q6AZJ8_XENLA     2    130             
DBREF  5ONG D    1   122  UNP    P02281   H2B11_XENLA      5    126             
DBREF  5ONG E    1   135  UNP    P84233   H32_XENLA        2    136             
DBREF  5ONG F    0   102  UNP    P62799   H4_XENLA         1    103             
DBREF  5ONG G    1   129  UNP    Q6AZJ8   Q6AZJ8_XENLA     2    130             
DBREF  5ONG H    1   122  UNP    P02281   H2B11_XENLA      5    126             
SEQADV 5ONG CYS A   40  UNP  P84233    ARG    41 ENGINEERED MUTATION            
SEQADV 5ONG ALA A  102  UNP  P84233    GLY   103 CONFLICT                       
SEQADV 5ONG ALA A  110  UNP  P84233    CYS   111 ENGINEERED MUTATION            
SEQADV 5ONG THR D   29  UNP  P02281    SER    33 CONFLICT                       
SEQADV 5ONG CYS E   40  UNP  P84233    ARG    41 ENGINEERED MUTATION            
SEQADV 5ONG ALA E  102  UNP  P84233    GLY   103 CONFLICT                       
SEQADV 5ONG ALA E  110  UNP  P84233    CYS   111 ENGINEERED MUTATION            
SEQADV 5ONG THR H   29  UNP  P02281    SER    33 CONFLICT                       
SEQRES   1 I  147   DA  DT  DC  DC  DA  DT  DA  DT  DC  DC  DA  DC  DC          
SEQRES   2 I  147   DT  DG  DG  DT  DC  DC  DT  DA  DC  DT  DA  DC  DC          
SEQRES   3 I  147   DA  DA  DA  DA  DG  DT  DG  DT  DA  DT  DT  DT  DG          
SEQRES   4 I  147   DG  DA  DA  DA  DC  DT  DG  DC  DT  DC  DC  DA  DT          
SEQRES   5 I  147   DC  DA  DA  DA  DA  DG  DG  DC  DA  DT  DG  DT  DT          
SEQRES   6 I  147   DC  DA  DG  DC  DT  DG  DG  DA  DA  DT  DC  DC  DA          
SEQRES   7 I  147   DG  DC  DT  DG  DA  DA  DC  DA  DT  DG  DC  DC  DT          
SEQRES   8 I  147   DT  DT  DT  DG  DA  DT  DG  DG  DA  DG  DC  DA  DG          
SEQRES   9 I  147   DT  DT  DT  DC  DC  DA  DA  DA  DT  DA  DC  DA  DC          
SEQRES  10 I  147   DT  DT  DT  DT  DG  DG  DT  DA  DG  DT  DA  DG  DG          
SEQRES  11 I  147   DA  DC  DC  DA  DG  DG  DT  DG  DG  DA  DT  DA  DT          
SEQRES  12 I  147  G47  DG  DA  DT                                              
SEQRES   1 J  147   DA  DT  DC  DC  DA  DT  DA  DT  DC  DC  DA  DC  DC          
SEQRES   2 J  147   DT  DG  DG  DT  DC  DC  DT  DA  DC  DT  DA  DC  DC          
SEQRES   3 J  147   DA  DA  DA  DA  DG  DT  DG  DT  DA  DT  DT  DT  DG          
SEQRES   4 J  147   DG  DA  DA  DA  DC  DT  DG  DC  DT  DC  DC  DA  DT          
SEQRES   5 J  147   DC  DA  DA  DA  DA  DG  DG  DC  DA  DT  DG  DT  DT          
SEQRES   6 J  147   DC  DA  DG  DC  DT  DG  DG  DA  DT  DT  DC  DC  DA          
SEQRES   7 J  147   DG  DC  DT  DG  DA  DA  DC  DA  DT  DG  DC  DC  DT          
SEQRES   8 J  147   DT  DT  DT  DG  DA  DT  DG  DG  DA  DG  DC  DA  DG          
SEQRES   9 J  147   DT  DT  DT  DC  DC  DA  DA  DA  DT  DA  DC  DA  DC          
SEQRES  10 J  147   DT  DT  DT  DT  DG  DG  DT  DA  DG  DT  DA  DG  DG          
SEQRES  11 J  147   DA  DC  DC  DA  DG  DG  DT  DG  DG  DA  DT  DA  DT          
SEQRES  12 J  147  G47  DG  DA  DT                                              
SEQRES   1 A  135  ALA ARG THR LYS GLN THR ALA ARG LYS SER THR GLY GLY          
SEQRES   2 A  135  LYS ALA PRO ARG LYS GLN LEU ALA THR LYS ALA ALA ARG          
SEQRES   3 A  135  LYS SER ALA PRO ALA THR GLY GLY VAL LYS LYS PRO HIS          
SEQRES   4 A  135  CYS TYR ARG PRO GLY THR VAL ALA LEU ARG GLU ILE ARG          
SEQRES   5 A  135  ARG TYR GLN LYS SER THR GLU LEU LEU ILE ARG LYS LEU          
SEQRES   6 A  135  PRO PHE GLN ARG LEU VAL ARG GLU ILE ALA GLN ASP PHE          
SEQRES   7 A  135  LYS THR ASP LEU ARG PHE GLN SER SER ALA VAL MET ALA          
SEQRES   8 A  135  LEU GLN GLU ALA SER GLU ALA TYR LEU VAL ALA LEU PHE          
SEQRES   9 A  135  GLU ASP THR ASN LEU ALA ALA ILE HIS ALA LYS ARG VAL          
SEQRES  10 A  135  THR ILE MET PRO LYS ASP ILE GLN LEU ALA ARG ARG ILE          
SEQRES  11 A  135  ARG GLY GLU ARG ALA                                          
SEQRES   1 B  103  MET SER GLY ARG GLY LYS GLY GLY LYS GLY LEU GLY LYS          
SEQRES   2 B  103  GLY GLY ALA LYS ARG HIS ARG LYS VAL LEU ARG ASP ASN          
SEQRES   3 B  103  ILE GLN GLY ILE THR LYS PRO ALA ILE ARG ARG LEU ALA          
SEQRES   4 B  103  ARG ARG GLY GLY VAL LYS ARG ILE SER GLY LEU ILE TYR          
SEQRES   5 B  103  GLU GLU THR ARG GLY VAL LEU LYS VAL PHE LEU GLU ASN          
SEQRES   6 B  103  VAL ILE ARG ASP ALA VAL THR TYR THR GLU HIS ALA LYS          
SEQRES   7 B  103  ARG LYS THR VAL THR ALA MET ASP VAL VAL TYR ALA LEU          
SEQRES   8 B  103  LYS ARG GLN GLY ARG THR LEU TYR GLY PHE GLY GLY              
SEQRES   1 C  129  SER GLY ARG GLY LYS GLN GLY GLY LYS THR ARG ALA LYS          
SEQRES   2 C  129  ALA LYS THR ARG SER SER ARG ALA GLY LEU GLN PHE PRO          
SEQRES   3 C  129  VAL GLY ARG VAL HIS ARG LEU LEU ARG LYS GLY ASN TYR          
SEQRES   4 C  129  ALA GLU ARG VAL GLY ALA GLY ALA PRO VAL TYR LEU ALA          
SEQRES   5 C  129  ALA VAL LEU GLU TYR LEU THR ALA GLU ILE LEU GLU LEU          
SEQRES   6 C  129  ALA GLY ASN ALA ALA ARG ASP ASN LYS LYS THR ARG ILE          
SEQRES   7 C  129  ILE PRO ARG HIS LEU GLN LEU ALA VAL ARG ASN ASP GLU          
SEQRES   8 C  129  GLU LEU ASN LYS LEU LEU GLY ARG VAL THR ILE ALA GLN          
SEQRES   9 C  129  GLY GLY VAL LEU PRO ASN ILE GLN SER VAL LEU LEU PRO          
SEQRES  10 C  129  LYS LYS THR GLU SER SER LYS SER ALA LYS SER LYS              
SEQRES   1 D  122  ALA LYS SER ALA PRO ALA PRO LYS LYS GLY SER LYS LYS          
SEQRES   2 D  122  ALA VAL THR LYS THR GLN LYS LYS ASP GLY LYS LYS ARG          
SEQRES   3 D  122  ARG LYS THR ARG LYS GLU SER TYR ALA ILE TYR VAL TYR          
SEQRES   4 D  122  LYS VAL LEU LYS GLN VAL HIS PRO ASP THR GLY ILE SER          
SEQRES   5 D  122  SER LYS ALA MET SER ILE MET ASN SER PHE VAL ASN ASP          
SEQRES   6 D  122  VAL PHE GLU ARG ILE ALA GLY GLU ALA SER ARG LEU ALA          
SEQRES   7 D  122  HIS TYR ASN LYS ARG SER THR ILE THR SER ARG GLU ILE          
SEQRES   8 D  122  GLN THR ALA VAL ARG LEU LEU LEU PRO GLY GLU LEU ALA          
SEQRES   9 D  122  LYS HIS ALA VAL SER GLU GLY THR LYS ALA VAL THR LYS          
SEQRES  10 D  122  TYR THR SER ALA LYS                                          
SEQRES   1 E  135  ALA ARG THR LYS GLN THR ALA ARG LYS SER THR GLY GLY          
SEQRES   2 E  135  LYS ALA PRO ARG LYS GLN LEU ALA THR LYS ALA ALA ARG          
SEQRES   3 E  135  LYS SER ALA PRO ALA THR GLY GLY VAL LYS LYS PRO HIS          
SEQRES   4 E  135  CYS TYR ARG PRO GLY THR VAL ALA LEU ARG GLU ILE ARG          
SEQRES   5 E  135  ARG TYR GLN LYS SER THR GLU LEU LEU ILE ARG LYS LEU          
SEQRES   6 E  135  PRO PHE GLN ARG LEU VAL ARG GLU ILE ALA GLN ASP PHE          
SEQRES   7 E  135  LYS THR ASP LEU ARG PHE GLN SER SER ALA VAL MET ALA          
SEQRES   8 E  135  LEU GLN GLU ALA SER GLU ALA TYR LEU VAL ALA LEU PHE          
SEQRES   9 E  135  GLU ASP THR ASN LEU ALA ALA ILE HIS ALA LYS ARG VAL          
SEQRES  10 E  135  THR ILE MET PRO LYS ASP ILE GLN LEU ALA ARG ARG ILE          
SEQRES  11 E  135  ARG GLY GLU ARG ALA                                          
SEQRES   1 F  103  MET SER GLY ARG GLY LYS GLY GLY LYS GLY LEU GLY LYS          
SEQRES   2 F  103  GLY GLY ALA LYS ARG HIS ARG LYS VAL LEU ARG ASP ASN          
SEQRES   3 F  103  ILE GLN GLY ILE THR LYS PRO ALA ILE ARG ARG LEU ALA          
SEQRES   4 F  103  ARG ARG GLY GLY VAL LYS ARG ILE SER GLY LEU ILE TYR          
SEQRES   5 F  103  GLU GLU THR ARG GLY VAL LEU LYS VAL PHE LEU GLU ASN          
SEQRES   6 F  103  VAL ILE ARG ASP ALA VAL THR TYR THR GLU HIS ALA LYS          
SEQRES   7 F  103  ARG LYS THR VAL THR ALA MET ASP VAL VAL TYR ALA LEU          
SEQRES   8 F  103  LYS ARG GLN GLY ARG THR LEU TYR GLY PHE GLY GLY              
SEQRES   1 G  129  SER GLY ARG GLY LYS GLN GLY GLY LYS THR ARG ALA LYS          
SEQRES   2 G  129  ALA LYS THR ARG SER SER ARG ALA GLY LEU GLN PHE PRO          
SEQRES   3 G  129  VAL GLY ARG VAL HIS ARG LEU LEU ARG LYS GLY ASN TYR          
SEQRES   4 G  129  ALA GLU ARG VAL GLY ALA GLY ALA PRO VAL TYR LEU ALA          
SEQRES   5 G  129  ALA VAL LEU GLU TYR LEU THR ALA GLU ILE LEU GLU LEU          
SEQRES   6 G  129  ALA GLY ASN ALA ALA ARG ASP ASN LYS LYS THR ARG ILE          
SEQRES   7 G  129  ILE PRO ARG HIS LEU GLN LEU ALA VAL ARG ASN ASP GLU          
SEQRES   8 G  129  GLU LEU ASN LYS LEU LEU GLY ARG VAL THR ILE ALA GLN          
SEQRES   9 G  129  GLY GLY VAL LEU PRO ASN ILE GLN SER VAL LEU LEU PRO          
SEQRES  10 G  129  LYS LYS THR GLU SER SER LYS SER ALA LYS SER LYS              
SEQRES   1 H  122  ALA LYS SER ALA PRO ALA PRO LYS LYS GLY SER LYS LYS          
SEQRES   2 H  122  ALA VAL THR LYS THR GLN LYS LYS ASP GLY LYS LYS ARG          
SEQRES   3 H  122  ARG LYS THR ARG LYS GLU SER TYR ALA ILE TYR VAL TYR          
SEQRES   4 H  122  LYS VAL LEU LYS GLN VAL HIS PRO ASP THR GLY ILE SER          
SEQRES   5 H  122  SER LYS ALA MET SER ILE MET ASN SER PHE VAL ASN ASP          
SEQRES   6 H  122  VAL PHE GLU ARG ILE ALA GLY GLU ALA SER ARG LEU ALA          
SEQRES   7 H  122  HIS TYR ASN LYS ARG SER THR ILE THR SER ARG GLU ILE          
SEQRES   8 H  122  GLN THR ALA VAL ARG LEU LEU LEU PRO GLY GLU LEU ALA          
SEQRES   9 H  122  LYS HIS ALA VAL SER GLU GLY THR LYS ALA VAL THR LYS          
SEQRES  10 H  122  TYR THR SER ALA LYS                                          
HET    G47  I  70      25                                                       
HET    G47  J  70      25                                                       
HET     MN  I 101       1                                                       
HET     MN  I 102       1                                                       
HET     MN  I 103       1                                                       
HET     MN  I 104       1                                                       
HET     MN  I 105       1                                                       
HET     MN  I 106       1                                                       
HET     MN  I 107       1                                                       
HET     MN  I 108       1                                                       
HET     MN  I 109       1                                                       
HET     MN  I 110       1                                                       
HET     MN  J 101       1                                                       
HET     MN  J 102       1                                                       
HET     MN  J 103       1                                                       
HET     MN  J 104       1                                                       
HET     MN  J 105       1                                                       
HET     MN  J 106       1                                                       
HET     MN  J 107       1                                                       
HET     MN  J 108       1                                                       
HET     MN  J 109       1                                                       
HET     CL  A 201       1                                                       
HET     CL  D 201       1                                                       
HET     MN  E 201       1                                                       
HET     CL  E 202       1                                                       
HET     CL  G 201       1                                                       
HETNAM     G47 N2-ETHANETHIOL-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE               
HETNAM      MN MANGANESE (II) ION                                               
HETNAM      CL CHLORIDE ION                                                     
FORMUL   1  G47    2(C12 H18 N5 O7 P S)                                         
FORMUL  11   MN    20(MN 2+)                                                    
FORMUL  30   CL    4(CL 1-)                                                     
FORMUL  35  HOH   *87(H2 O)                                                     
HELIX    1 AA1 GLY A   44  SER A   57  1                                  14    
HELIX    2 AA2 ARG A   63  ASP A   77  1                                  15    
HELIX    3 AA3 GLN A   85  ALA A  114  1                                  30    
HELIX    4 AA4 MET A  120  ARG A  131  1                                  12    
HELIX    5 AA5 ASN B   25  ILE B   29  5                                   5    
HELIX    6 AA6 THR B   30  GLY B   41  1                                  12    
HELIX    7 AA7 LEU B   49  ALA B   76  1                                  28    
HELIX    8 AA8 THR B   82  GLN B   93  1                                  12    
HELIX    9 AA9 THR C   16  GLY C   22  1                                   7    
HELIX   10 AB1 PRO C   26  GLY C   37  1                                  12    
HELIX   11 AB2 ALA C   45  ASN C   73  1                                  29    
HELIX   12 AB3 ILE C   79  ASP C   90  1                                  12    
HELIX   13 AB4 ASP C   90  LEU C   97  1                                   8    
HELIX   14 AB5 GLN C  112  LEU C  116  5                                   5    
HELIX   15 AB6 TYR D   34  HIS D   46  1                                  13    
HELIX   16 AB7 SER D   52  ASN D   81  1                                  30    
HELIX   17 AB8 THR D   87  LEU D   99  1                                  13    
HELIX   18 AB9 PRO D  100  SER D  120  1                                  21    
HELIX   19 AC1 GLY E   44  SER E   57  1                                  14    
HELIX   20 AC2 ARG E   63  LYS E   79  1                                  17    
HELIX   21 AC3 GLN E   85  ALA E  114  1                                  30    
HELIX   22 AC4 MET E  120  ARG E  131  1                                  12    
HELIX   23 AC5 ASP F   24  ILE F   29  5                                   6    
HELIX   24 AC6 THR F   30  GLY F   41  1                                  12    
HELIX   25 AC7 LEU F   49  ALA F   76  1                                  28    
HELIX   26 AC8 THR F   82  GLN F   93  1                                  12    
HELIX   27 AC9 THR G   16  ALA G   21  1                                   6    
HELIX   28 AD1 PRO G   26  GLY G   37  1                                  12    
HELIX   29 AD2 GLY G   46  ASN G   73  1                                  28    
HELIX   30 AD3 ILE G   79  ASP G   90  1                                  12    
HELIX   31 AD4 ASP G   90  LEU G   97  1                                   8    
HELIX   32 AD5 GLN G  112  LEU G  116  5                                   5    
HELIX   33 AD6 TYR H   34  HIS H   46  1                                  13    
HELIX   34 AD7 SER H   52  ASN H   81  1                                  30    
HELIX   35 AD8 THR H   87  LEU H   99  1                                  13    
HELIX   36 AD9 PRO H  100  SER H  120  1                                  21    
SHEET    1 AA1 2 ARG A  83  PHE A  84  0                                        
SHEET    2 AA1 2 THR B  80  VAL B  81  1  O  VAL B  81   N  ARG A  83           
SHEET    1 AA2 2 THR A 118  ILE A 119  0                                        
SHEET    2 AA2 2 ARG B  45  ILE B  46  1  O  ARG B  45   N  ILE A 119           
SHEET    1 AA3 2 THR B  96  TYR B  98  0                                        
SHEET    2 AA3 2 VAL G 100  ILE G 102  1  O  THR G 101   N  TYR B  98           
SHEET    1 AA4 2 ARG C  42  VAL C  43  0                                        
SHEET    2 AA4 2 THR D  85  ILE D  86  1  O  ILE D  86   N  ARG C  42           
SHEET    1 AA5 2 ARG C  77  ILE C  78  0                                        
SHEET    2 AA5 2 GLY D  50  ILE D  51  1  O  GLY D  50   N  ILE C  78           
SHEET    1 AA6 2 VAL C 100  ILE C 102  0                                        
SHEET    2 AA6 2 THR F  96  TYR F  98  1  O  TYR F  98   N  THR C 101           
SHEET    1 AA7 2 ARG E  83  PHE E  84  0                                        
SHEET    2 AA7 2 THR F  80  VAL F  81  1  O  VAL F  81   N  ARG E  83           
SHEET    1 AA8 2 THR E 118  ILE E 119  0                                        
SHEET    2 AA8 2 ARG F  45  ILE F  46  1  O  ARG F  45   N  ILE E 119           
SHEET    1 AA9 2 ARG G  42  VAL G  43  0                                        
SHEET    2 AA9 2 THR H  85  ILE H  86  1  O  ILE H  86   N  ARG G  42           
SHEET    1 AB1 2 ARG G  77  ILE G  78  0                                        
SHEET    2 AB1 2 GLY H  50  ILE H  51  1  O  GLY H  50   N  ILE G  78           
LINK         O6   DG I -58                MN    MN I 102     1555   1555  2.28  
LINK         N7   DG I -35                MN    MN I 110     1555   1555  2.71  
LINK         O6   DG I -34                MN    MN I 110     1555   1555  2.77  
LINK         O6   DG I   5                MN    MN I 108     1555   1555  2.16  
LINK         N7   DG I  27                MN    MN I 107     1555   1555  2.69  
LINK         N7   DG I  48                MN    MN I 105     1555   1555  2.67  
LINK         N7   DG I  55                MN    MN I 103     1555   1555  2.56  
LINK         N7   DG I  56                MN    MN I 103     1555   1555  2.46  
LINK         O3'  DT I  69                 P   G47 I  70     1555   1555  1.61  
LINK         O3' G47 I  70                 P    DG I  71     1555   1555  1.61  
LINK         SG  G47 I  70                 SG  CYS A  40     1555   1555  2.09  
LINK         O6   DG I  71                MN    MN I 101     1555   1555  2.11  
LINK         N7   DG J -35                MN    MN J 103     1555   1555  2.48  
LINK         O6   DG J -34                MN    MN J 103     1555   1555  2.36  
LINK         N7   DG J  -3                MN    MN J 108     1555   1555  2.53  
LINK         N7   DG J  27                MN    MN J 107     1555   1555  2.35  
LINK         N7   DG J  61                MN    MN J 106     1555   1555  2.71  
LINK         O3'  DT J  69                 P   G47 J  70     1555   1555  1.61  
LINK         O3' G47 J  70                 P    DG J  71     1555   1555  1.61  
LINK         N7  G47 J  70                MN    MN J 104     1555   1555  2.53  
LINK         SG  G47 J  70                 SG  CYS E  40     1555   1555  2.08  
LINK         O6   DG J  71                MN    MN J 104     1555   1555  1.84  
LINK         OD1 ASP E  77                MN    MN E 201     1555   1555  2.34  
LINK        MN    MN I 107                 O   HOH J 208     1555   1555  2.51  
LINK        MN    MN J 109                 O   HOH J 204     1555   1555  2.59  
LINK        MN    MN J 109                 O   HOH J 203     1555   1555  2.67  
LINK        MN    MN E 201                 O   HOH F 206     1555   1555  1.98  
LINK         O   VAL D  45                MN    MN E 201     1555   2565  2.37  
LINK        MN    MN E 201                 O   HOH D 301     1555   2564  2.10  
SITE     1 AC1  2 G47 I  70   DG I  71                                          
SITE     1 AC2  2  DG I -59   DG I -58                                          
SITE     1 AC3  2  DG I  55   DG I  56                                          
SITE     1 AC4  2  DT I  47   DG I  48                                          
SITE     1 AC5  1  DG I  61                                                     
SITE     1 AC6  2  DG I  27  HOH J 208                                          
SITE     1 AC7  1  DG I   5                                                     
SITE     1 AC8  2  DG I  -3   DG I  -2                                          
SITE     1 AC9  2  DG I -35   DG I -34                                          
SITE     1 AD1  1  DG J -59                                                     
SITE     1 AD2  1  DG J -16                                                     
SITE     1 AD3  2  DG J -35   DG J -34                                          
SITE     1 AD4  2 G47 J  70   DG J  71                                          
SITE     1 AD5  1  DG J  61                                                     
SITE     1 AD6  1  DG J  27                                                     
SITE     1 AD7  1  DG J  -3                                                     
SITE     1 AD8  3  DG J  48  HOH J 203  HOH J 204                               
SITE     1 AD9  2 PRO A 121  LYS A 122                                          
SITE     1 AE1  3 GLY C  46  THR D  87  SER D  88                               
SITE     1 AE2  4 VAL D  45  HOH D 301  ASP E  77  HOH F 206                    
SITE     1 AE3  2 PRO E 121  LYS E 122                                          
SITE     1 AE4  4 GLY G  44  GLY G  46  THR H  87  SER H  88                    
SITE     1 AE5 23 HIS E  39  TYR E  41  PRO E  66  PHE E  67                    
SITE     2 AE5 23 GLN E  68  ARG E  69  VAL E  71  ARG E  72                    
SITE     3 AE5 23 GLU E  73  ILE E  74  ILE F  26  ILE F  29                    
SITE     4 AE5 23 LEU F  62   DA I -39   DG I -41   DT I -40                    
SITE     5 AE5 23  DA I -69   DC I -70   DT J  39   DC J  41                    
SITE     6 AE5 23  DT J  69   DG J  71   MN J 104                               
CRYST1  106.240  183.130  109.490  90.00  90.00  90.00 P 21 21 21    8          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.009413  0.000000  0.000000        0.00000                         
SCALE2      0.000000  0.005461  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.009133        0.00000