PDB Full entry for 6R93
HEADER    DNA                                     02-APR-19   6R93              
TITLE     CRYO-EM STRUCTURE OF NCP-6-4PP                                        
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: HUMAN ALPHA-SATELLITE DNA (145-MER);                       
COMPND   3 CHAIN: I;                                                            
COMPND   4 ENGINEERED: YES;                                                     
COMPND   5 MOL_ID: 2;                                                           
COMPND   6 MOLECULE: HUMAN ALPHA-SATELLITE DNA (145-MER) WITH A 6-4PP AT        
COMPND   7 POSITIONS 95-96;                                                     
COMPND   8 CHAIN: J;                                                            
COMPND   9 ENGINEERED: YES;                                                     
COMPND  10 OTHER_DETAILS: 145 BP HUMAN ALPHA-SATELLITE WITH A 6-4 PYRIMIDINE-   
COMPND  11 PYRIMIDONE (6-4PP) AT BASE POSITIONS 95-96.;                         
COMPND  12 MOL_ID: 3;                                                           
COMPND  13 MOLECULE: HISTONE H3.1;                                              
COMPND  14 CHAIN: A, E;                                                         
COMPND  15 SYNONYM: HISTONE H3/A,HISTONE H3/B,HISTONE H3/C,HISTONE H3/D,HISTONE 
COMPND  16 H3/F,HISTONE H3/H,HISTONE H3/I,HISTONE H3/J,HISTONE H3/K,HISTONE     
COMPND  17 H3/L;                                                                
COMPND  18 ENGINEERED: YES;                                                     
COMPND  19 MOL_ID: 4;                                                           
COMPND  20 MOLECULE: HISTONE H4;                                                
COMPND  21 CHAIN: B, F;                                                         
COMPND  22 ENGINEERED: YES;                                                     
COMPND  23 MOL_ID: 5;                                                           
COMPND  24 MOLECULE: HISTONE H2A TYPE 1-B/E;                                    
COMPND  25 CHAIN: C, G;                                                         
COMPND  26 SYNONYM: HISTONE H2A.2,HISTONE H2A/A,HISTONE H2A/M;                  
COMPND  27 ENGINEERED: YES;                                                     
COMPND  28 OTHER_DETAILS:                                                       
COMPND  29 GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILEL
COMPND  30 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK;    
COMPND  31 MOL_ID: 6;                                                           
COMPND  32 MOLECULE: HISTONE H2B TYPE 1-J;                                      
COMPND  33 CHAIN: D, H;                                                         
COMPND  34 SYNONYM: HISTONE H2B.1,HISTONE H2B.R,H2B/R;                          
COMPND  35 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 SYNTHETIC: YES;                                                      
SOURCE   3 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   4 ORGANISM_COMMON: HUMAN;                                              
SOURCE   5 ORGANISM_TAXID: 9606;                                                
SOURCE   6 MOL_ID: 2;                                                           
SOURCE   7 SYNTHETIC: YES;                                                      
SOURCE   8 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   9 ORGANISM_COMMON: HUMAN;                                              
SOURCE  10 ORGANISM_TAXID: 9606;                                                
SOURCE  11 MOL_ID: 3;                                                           
SOURCE  12 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  13 ORGANISM_COMMON: HUMAN;                                              
SOURCE  14 ORGANISM_TAXID: 9606;                                                
SOURCE  15 GENE: HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D,      
SOURCE  16 H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H,      
SOURCE  17 H3FK, HIST1H3I, H3FF, HIST1H3J, H3FJ;                                
SOURCE  18 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  19 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  20 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  21 MOL_ID: 4;                                                           
SOURCE  22 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  23 ORGANISM_COMMON: HUMAN;                                              
SOURCE  24 ORGANISM_TAXID: 9606;                                                
SOURCE  25 GENE: HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G,    
SOURCE  26 H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C,    
SOURCE  27 H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E,    
SOURCE  28 H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N,    
SOURCE  29 H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4;                  
SOURCE  30 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE  31 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE  32 EXPRESSION_SYSTEM_CELL_LINE: JM109(DE3);                             
SOURCE  33 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  34 MOL_ID: 5;                                                           
SOURCE  35 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  36 ORGANISM_COMMON: HUMAN;                                              
SOURCE  37 ORGANISM_TAXID: 9606;                                                
SOURCE  38 GENE: HIST1H2AB, H2AFM, HIST1H2AE, H2AFA;                            
SOURCE  39 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  40 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  41 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  42 MOL_ID: 6;                                                           
SOURCE  43 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  44 ORGANISM_COMMON: HUMAN;                                              
SOURCE  45 ORGANISM_TAXID: 9606;                                                
SOURCE  46 GENE: HIST1H2BJ, H2BFR;                                              
SOURCE  47 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  48 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  49 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID                               
KEYWDS    DNA DAMAGE, NUCLEOSOME, 6-4 PHOTOPRODUCT, DNA                         
EXPDTA    ELECTRON MICROSCOPY                                                   
AUTHOR    S.MATSUMOTO,S.CAVADINI,R.D.BUNKER,N.H.THOMA                           
REVDAT   4   18-DEC-19 6R93    1       SCALE                                    
REVDAT   3   06-NOV-19 6R93    1       REMARK                                   
REVDAT   2   17-JUL-19 6R93    1       JRNL   REMARK                            
REVDAT   1   12-JUN-19 6R93    0                                                
JRNL        AUTH   S.MATSUMOTO,S.CAVADINI,R.D.BUNKER,R.S.GRAND,A.POTENZA,       
JRNL        AUTH 2 J.RABL,J.YAMAMOTO,A.D.SCHENK,D.SCHUBELER,S.IWAI,K.SUGASAWA,  
JRNL        AUTH 3 H.KURUMIZAKA,N.H.THOMA                                       
JRNL        TITL   DNA DAMAGE DETECTION IN NUCLEOSOMES INVOLVES DNA REGISTER    
JRNL        TITL 2 SHIFTING.                                                    
JRNL        REF    NATURE                        V. 571    79 2019              
JRNL        REFN                   ESSN 1476-4687                               
JRNL        PMID   31142837                                                     
JRNL        DOI    10.1038/S41586-019-1259-3                                    
REMARK   2                                                                      
REMARK   2 RESOLUTION.    4.00 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   SOFTWARE PACKAGES      : EPU, GCTF, COOT, RELION, RELION,          
REMARK   3                            RELION, REFMAC, PHENIX                    
REMARK   3   RECONSTRUCTION SCHEMA  : NULL                                      
REMARK   3                                                                      
REMARK   3 EM MAP-MODEL FITTING AND REFINEMENT                                  
REMARK   3   PDB ENTRY                    : 4ZUX                                
REMARK   3   REFINEMENT SPACE             : REAL                                
REMARK   3   REFINEMENT PROTOCOL          : FLEXIBLE FIT                        
REMARK   3   REFINEMENT TARGET            : CROSS-CORRELATION COEFFICIENT       
REMARK   3   OVERALL ANISOTROPIC B VALUE  : NULL                                
REMARK   3                                                                      
REMARK   3 FITTING PROCEDURE : NULL                                             
REMARK   3                                                                      
REMARK   3 EM IMAGE RECONSTRUCTION STATISTICS                                   
REMARK   3   NOMINAL PIXEL SIZE (ANGSTROMS)    : NULL                           
REMARK   3   ACTUAL PIXEL SIZE  (ANGSTROMS)    : NULL                           
REMARK   3   EFFECTIVE RESOLUTION (ANGSTROMS)  : 4.000                          
REMARK   3   NUMBER OF PARTICLES               : 98378                          
REMARK   3   CTF CORRECTION METHOD             : PHASE FLIPPING AND AMPLITUDE   
REMARK   3                                       CORRECTION                     
REMARK   3                                                                      
REMARK   3 EM RECONSTRUCTION MAGNIFICATION CALIBRATION: NULL                    
REMARK   3                                                                      
REMARK   3 OTHER DETAILS: NULL                                                  
REMARK   4                                                                      
REMARK   4 6R93 COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY PDBE ON 03-APR-19.                  
REMARK 100 THE DEPOSITION ID IS D_1292101591.                                   
REMARK 245                                                                      
REMARK 245 EXPERIMENTAL DETAILS                                                 
REMARK 245   RECONSTRUCTION METHOD          : SINGLE PARTICLE                   
REMARK 245   SPECIMEN TYPE                  : NULL                              
REMARK 245                                                                      
REMARK 245 ELECTRON MICROSCOPE SAMPLE                                           
REMARK 245   SAMPLE TYPE                    : PARTICLE                          
REMARK 245   PARTICLE TYPE                  : POINT                             
REMARK 245   NAME OF SAMPLE                 : 6-4PP NUCLEOSOME; DNA; HISTONE    
REMARK 245                                    H3.1, HISTONE H2A, HISTONE H2B;   
REMARK 245                                    HISTONE H4                        
REMARK 245   SAMPLE CONCENTRATION (MG ML-1) : 2.00                              
REMARK 245   SAMPLE SUPPORT DETAILS         : NULL                              
REMARK 245   SAMPLE VITRIFICATION DETAILS   : NULL                              
REMARK 245   SAMPLE BUFFER                  : NULL                              
REMARK 245   PH                             : 7.40                              
REMARK 245   SAMPLE DETAILS                 : NULL                              
REMARK 245                                                                      
REMARK 245 DATA ACQUISITION                                                     
REMARK 245   DATE OF EXPERIMENT                : NULL                           
REMARK 245   NUMBER OF MICROGRAPHS-IMAGES      : NULL                           
REMARK 245   TEMPERATURE (KELVIN)              : NULL                           
REMARK 245   MICROSCOPE MODEL                  : FEI TITAN KRIOS                
REMARK 245   DETECTOR TYPE                     : GATAN K2 SUMMIT (4K X 4K)      
REMARK 245   MINIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MAXIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MINIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   MAXIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   NOMINAL CS                        : 0.00                           
REMARK 245   IMAGING MODE                      : BRIGHT FIELD                   
REMARK 245   ELECTRON DOSE (ELECTRONS NM**-2)  : 40.00                          
REMARK 245   ILLUMINATION MODE                 : SPOT SCAN                      
REMARK 245   NOMINAL MAGNIFICATION             : 130000                         
REMARK 245   CALIBRATED MAGNIFICATION          : NULL                           
REMARK 245   SOURCE                            : FIELD EMISSION GUN             
REMARK 245   ACCELERATION VOLTAGE (KV)         : 300                            
REMARK 245   IMAGING DETAILS                   : NULL                           
REMARK 247                                                                      
REMARK 247 ELECTRON MICROSCOPY                                                  
REMARK 247  THE COORDINATES IN THIS ENTRY WERE GENERATED FROM ELECTRON          
REMARK 247  MICROSCOPY DATA. PROTEIN DATA BANK CONVENTIONS REQUIRE              
REMARK 247  THAT CRYST1 AND SCALE RECORDS BE INCLUDED, BUT THE VALUES           
REMARK 247  ON THESE RECORDS ARE MEANINGLESS EXCEPT FOR THE CALCULATION         
REMARK 247  OF THE STRUCTURE FACTORS.                                           
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: DECAMERIC                         
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: DECAMERIC                  
REMARK 350 SOFTWARE USED: PISA                                                  
REMARK 350 TOTAL BURIED SURFACE AREA: 57670 ANGSTROM**2                         
REMARK 350 SURFACE AREA OF THE COMPLEX: 74160 ANGSTROM**2                       
REMARK 350 CHANGE IN SOLVENT FREE ENERGY: -373.0 KCAL/MOL                       
REMARK 350 APPLY THE FOLLOWING TO CHAINS: I, J, A, B, C, D, E, F, G, H          
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     GLY A    -2                                                      
REMARK 465     SER A    -1                                                      
REMARK 465     HIS A     0                                                      
REMARK 465     MET A     1                                                      
REMARK 465     ALA A     2                                                      
REMARK 465     ARG A     3                                                      
REMARK 465     THR A     4                                                      
REMARK 465     LYS A     5                                                      
REMARK 465     GLN A     6                                                      
REMARK 465     THR A     7                                                      
REMARK 465     ALA A     8                                                      
REMARK 465     ARG A     9                                                      
REMARK 465     LYS A    10                                                      
REMARK 465     SER A    11                                                      
REMARK 465     THR A    12                                                      
REMARK 465     GLY A    13                                                      
REMARK 465     GLY A    14                                                      
REMARK 465     LYS A    15                                                      
REMARK 465     ALA A    16                                                      
REMARK 465     PRO A    17                                                      
REMARK 465     ARG A    18                                                      
REMARK 465     LYS A    19                                                      
REMARK 465     GLN A    20                                                      
REMARK 465     LEU A    21                                                      
REMARK 465     ALA A    22                                                      
REMARK 465     THR A    23                                                      
REMARK 465     LYS A    24                                                      
REMARK 465     ALA A    25                                                      
REMARK 465     ALA A    26                                                      
REMARK 465     ARG A    27                                                      
REMARK 465     LYS A    28                                                      
REMARK 465     SER A    29                                                      
REMARK 465     ALA A    30                                                      
REMARK 465     PRO A    31                                                      
REMARK 465     ALA A    32                                                      
REMARK 465     THR A    33                                                      
REMARK 465     GLY A    34                                                      
REMARK 465     GLY A    35                                                      
REMARK 465     VAL A    36                                                      
REMARK 465     LYS A    37                                                      
REMARK 465     GLY B    -2                                                      
REMARK 465     SER B    -1                                                      
REMARK 465     HIS B     0                                                      
REMARK 465     MET B     1                                                      
REMARK 465     SER B     2                                                      
REMARK 465     GLY B     3                                                      
REMARK 465     ARG B     4                                                      
REMARK 465     GLY B     5                                                      
REMARK 465     LYS B     6                                                      
REMARK 465     GLY B     7                                                      
REMARK 465     GLY B     8                                                      
REMARK 465     LYS B     9                                                      
REMARK 465     GLY B    10                                                      
REMARK 465     LEU B    11                                                      
REMARK 465     GLY B    12                                                      
REMARK 465     LYS B    13                                                      
REMARK 465     GLY B    14                                                      
REMARK 465     GLY B    15                                                      
REMARK 465     ALA B    16                                                      
REMARK 465     LYS B    17                                                      
REMARK 465     ARG B    18                                                      
REMARK 465     HIS B    19                                                      
REMARK 465     ARG B    20                                                      
REMARK 465     LYS B    21                                                      
REMARK 465     GLY C    -2                                                      
REMARK 465     SER C    -1                                                      
REMARK 465     HIS C     0                                                      
REMARK 465     MET C     1                                                      
REMARK 465     SER C     2                                                      
REMARK 465     GLY C     3                                                      
REMARK 465     ARG C     4                                                      
REMARK 465     GLY C     5                                                      
REMARK 465     LYS C     6                                                      
REMARK 465     GLN C     7                                                      
REMARK 465     GLY C     8                                                      
REMARK 465     GLY C     9                                                      
REMARK 465     LYS C    10                                                      
REMARK 465     ALA C    11                                                      
REMARK 465     SER C   123                                                      
REMARK 465     HIS C   124                                                      
REMARK 465     HIS C   125                                                      
REMARK 465     LYS C   126                                                      
REMARK 465     ALA C   127                                                      
REMARK 465     LYS C   128                                                      
REMARK 465     GLY C   129                                                      
REMARK 465     LYS C   130                                                      
REMARK 465     GLY D    -2                                                      
REMARK 465     SER D    -1                                                      
REMARK 465     HIS D     0                                                      
REMARK 465     MET D     1                                                      
REMARK 465     PRO D     2                                                      
REMARK 465     GLU D     3                                                      
REMARK 465     PRO D     4                                                      
REMARK 465     ALA D     5                                                      
REMARK 465     LYS D     6                                                      
REMARK 465     SER D     7                                                      
REMARK 465     ALA D     8                                                      
REMARK 465     PRO D     9                                                      
REMARK 465     ALA D    10                                                      
REMARK 465     PRO D    11                                                      
REMARK 465     LYS D    12                                                      
REMARK 465     LYS D    13                                                      
REMARK 465     GLY D    14                                                      
REMARK 465     SER D    15                                                      
REMARK 465     LYS D    16                                                      
REMARK 465     LYS D    17                                                      
REMARK 465     ALA D    18                                                      
REMARK 465     VAL D    19                                                      
REMARK 465     THR D    20                                                      
REMARK 465     LYS D    21                                                      
REMARK 465     ALA D    22                                                      
REMARK 465     GLN D    23                                                      
REMARK 465     LYS D    24                                                      
REMARK 465     LYS D    25                                                      
REMARK 465     ASP D    26                                                      
REMARK 465     GLY D    27                                                      
REMARK 465     LYS D    28                                                      
REMARK 465     LYS D    29                                                      
REMARK 465     GLY E    -2                                                      
REMARK 465     SER E    -1                                                      
REMARK 465     HIS E     0                                                      
REMARK 465     MET E     1                                                      
REMARK 465     ALA E     2                                                      
REMARK 465     ARG E     3                                                      
REMARK 465     THR E     4                                                      
REMARK 465     LYS E     5                                                      
REMARK 465     GLN E     6                                                      
REMARK 465     THR E     7                                                      
REMARK 465     ALA E     8                                                      
REMARK 465     ARG E     9                                                      
REMARK 465     LYS E    10                                                      
REMARK 465     SER E    11                                                      
REMARK 465     THR E    12                                                      
REMARK 465     GLY E    13                                                      
REMARK 465     GLY E    14                                                      
REMARK 465     LYS E    15                                                      
REMARK 465     ALA E    16                                                      
REMARK 465     PRO E    17                                                      
REMARK 465     ARG E    18                                                      
REMARK 465     LYS E    19                                                      
REMARK 465     GLN E    20                                                      
REMARK 465     LEU E    21                                                      
REMARK 465     ALA E    22                                                      
REMARK 465     THR E    23                                                      
REMARK 465     LYS E    24                                                      
REMARK 465     ALA E    25                                                      
REMARK 465     ALA E    26                                                      
REMARK 465     ARG E    27                                                      
REMARK 465     LYS E    28                                                      
REMARK 465     SER E    29                                                      
REMARK 465     ALA E    30                                                      
REMARK 465     PRO E    31                                                      
REMARK 465     ALA E    32                                                      
REMARK 465     THR E    33                                                      
REMARK 465     GLY E    34                                                      
REMARK 465     GLY E    35                                                      
REMARK 465     VAL E    36                                                      
REMARK 465     LYS E    37                                                      
REMARK 465     GLY F    -2                                                      
REMARK 465     SER F    -1                                                      
REMARK 465     HIS F     0                                                      
REMARK 465     MET F     1                                                      
REMARK 465     SER F     2                                                      
REMARK 465     GLY F     3                                                      
REMARK 465     ARG F     4                                                      
REMARK 465     GLY F     5                                                      
REMARK 465     LYS F     6                                                      
REMARK 465     GLY F     7                                                      
REMARK 465     GLY F     8                                                      
REMARK 465     LYS F     9                                                      
REMARK 465     GLY F    10                                                      
REMARK 465     LEU F    11                                                      
REMARK 465     GLY F    12                                                      
REMARK 465     LYS F    13                                                      
REMARK 465     GLY F    14                                                      
REMARK 465     GLY F    15                                                      
REMARK 465     ALA F    16                                                      
REMARK 465     LYS F    17                                                      
REMARK 465     ARG F    18                                                      
REMARK 465     HIS F    19                                                      
REMARK 465     ARG F    20                                                      
REMARK 465     LYS F    21                                                      
REMARK 465     GLY G    -2                                                      
REMARK 465     SER G    -1                                                      
REMARK 465     HIS G     0                                                      
REMARK 465     MET G     1                                                      
REMARK 465     SER G     2                                                      
REMARK 465     GLY G     3                                                      
REMARK 465     ARG G     4                                                      
REMARK 465     GLY G     5                                                      
REMARK 465     LYS G     6                                                      
REMARK 465     GLN G     7                                                      
REMARK 465     GLY G     8                                                      
REMARK 465     GLY G     9                                                      
REMARK 465     LYS G    10                                                      
REMARK 465     ALA G    11                                                      
REMARK 465     LYS G   120                                                      
REMARK 465     THR G   121                                                      
REMARK 465     GLU G   122                                                      
REMARK 465     SER G   123                                                      
REMARK 465     HIS G   124                                                      
REMARK 465     HIS G   125                                                      
REMARK 465     LYS G   126                                                      
REMARK 465     ALA G   127                                                      
REMARK 465     LYS G   128                                                      
REMARK 465     GLY G   129                                                      
REMARK 465     LYS G   130                                                      
REMARK 465     GLY H    -2                                                      
REMARK 465     SER H    -1                                                      
REMARK 465     HIS H     0                                                      
REMARK 465     MET H     1                                                      
REMARK 465     PRO H     2                                                      
REMARK 465     GLU H     3                                                      
REMARK 465     PRO H     4                                                      
REMARK 465     ALA H     5                                                      
REMARK 465     LYS H     6                                                      
REMARK 465     SER H     7                                                      
REMARK 465     ALA H     8                                                      
REMARK 465     PRO H     9                                                      
REMARK 465     ALA H    10                                                      
REMARK 465     PRO H    11                                                      
REMARK 465     LYS H    12                                                      
REMARK 465     LYS H    13                                                      
REMARK 465     GLY H    14                                                      
REMARK 465     SER H    15                                                      
REMARK 465     LYS H    16                                                      
REMARK 465     LYS H    17                                                      
REMARK 465     ALA H    18                                                      
REMARK 465     VAL H    19                                                      
REMARK 465     THR H    20                                                      
REMARK 465     LYS H    21                                                      
REMARK 465     ALA H    22                                                      
REMARK 465     GLN H    23                                                      
REMARK 465     LYS H    24                                                      
REMARK 465     LYS H    25                                                      
REMARK 465     ASP H    26                                                      
REMARK 465     GLY H    27                                                      
REMARK 465     LYS H    28                                                      
REMARK 465     LYS H    29                                                      
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   O3'   DA I    82    HH22  ARG E    41              1.59            
REMARK 500   O5'   DG I    39     NH1  ARG D    87              2.13            
REMARK 500   OP1   DT I   119     NZ   LYS G    14              2.18            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND LENGTHS                                      
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,2(A3,1X,A1,I4,A1,1X,A4,3X),1X,F6.3)               
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   RES CSSEQI ATM2   DEVIATION                     
REMARK 500     DT I  38   O3'    DT I  38   C3'    -0.039                       
REMARK 500     DA I  55   O3'    DA I  56   P      -0.074                       
REMARK 500     DT I  90   O3'    DT I  91   P       0.100                       
REMARK 500     DT J  38   C1'    DT J  38   N1      0.080                       
REMARK 500     DT J  89   O3'    DT J  89   C3'    -0.038                       
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500     DC I  26   O4' -  C1' -  N1  ANGL. DEV. =   2.4 DEGREES          
REMARK 500     DT I  37   O4' -  C1' -  N1  ANGL. DEV. =   2.3 DEGREES          
REMARK 500     DT I  38   C3' -  C2' -  C1' ANGL. DEV. =  -5.1 DEGREES          
REMARK 500     DT I  38   O4' -  C1' -  N1  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG I  46   O4' -  C1' -  N9  ANGL. DEV. =   2.3 DEGREES          
REMARK 500     DC I  52   O4' -  C1' -  N1  ANGL. DEV. =   3.1 DEGREES          
REMARK 500     DC I  52   O4' -  C1' -  N1  ANGL. DEV. =   3.1 DEGREES          
REMARK 500     DA I  55   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DA I  55   O4' -  C1' -  N9  ANGL. DEV. =   3.0 DEGREES          
REMARK 500     DA I  57   O4' -  C1' -  N9  ANGL. DEV. =   1.9 DEGREES          
REMARK 500     DC I  66   O4' -  C1' -  N1  ANGL. DEV. =   1.8 DEGREES          
REMARK 500     DG I  68   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DA I  82   O4' -  C1' -  N9  ANGL. DEV. =   3.1 DEGREES          
REMARK 500     DC I  88   O4' -  C1' -  N1  ANGL. DEV. =   2.5 DEGREES          
REMARK 500     DT I  90   C3' -  O3' -  P   ANGL. DEV. =  14.7 DEGREES          
REMARK 500     DT I  90   C3' -  O3' -  P   ANGL. DEV. =  13.1 DEGREES          
REMARK 500     DT I  91   O3' -  P   -  O5' ANGL. DEV. = -36.2 DEGREES          
REMARK 500     DT I  91   O3' -  P   -  OP2 ANGL. DEV. = -22.9 DEGREES          
REMARK 500     DT I  91   O3' -  P   -  OP1 ANGL. DEV. =  13.2 DEGREES          
REMARK 500     DT I  91   O3' -  P   -  OP1 ANGL. DEV. = -29.7 DEGREES          
REMARK 500     DA I  94   C3' -  O3' -  P   ANGL. DEV. = -15.1 DEGREES          
REMARK 500    T64 I  95   O3' -  P   -  OP2 ANGL. DEV. =  17.6 DEGREES          
REMARK 500    T64 I  95   O3' -  P   -  OP1 ANGL. DEV. = -22.9 DEGREES          
REMARK 500     DG I  97   OP1 -  P   -  OP2 ANGL. DEV. =  11.3 DEGREES          
REMARK 500     DG I  97   O5' -  P   -  OP1 ANGL. DEV. = -18.1 DEGREES          
REMARK 500     DG I  97   O5' -  P   -  OP2 ANGL. DEV. = -32.2 DEGREES          
REMARK 500     DG I  97   O4' -  C1' -  N9  ANGL. DEV. =   3.1 DEGREES          
REMARK 500     DG I  99   C3' -  O3' -  P   ANGL. DEV. =  30.8 DEGREES          
REMARK 500     DG I  99   C3' -  O3' -  P   ANGL. DEV. =  23.3 DEGREES          
REMARK 500     DT I 111   O4' -  C1' -  N1  ANGL. DEV. =   2.3 DEGREES          
REMARK 500     DT J   8   O4' -  C1' -  N1  ANGL. DEV. =   2.4 DEGREES          
REMARK 500     DC J  26   O4' -  C1' -  N1  ANGL. DEV. =   2.1 DEGREES          
REMARK 500     DA J  42   O4' -  C1' -  N9  ANGL. DEV. =   2.0 DEGREES          
REMARK 500     DG J  46   O4' -  C1' -  N9  ANGL. DEV. =   2.9 DEGREES          
REMARK 500     DC J  60   O4' -  C1' -  N1  ANGL. DEV. =   2.3 DEGREES          
REMARK 500     DC J  75   O4' -  C1' -  N1  ANGL. DEV. =   2.1 DEGREES          
REMARK 500     DT J  79   O4' -  C1' -  N1  ANGL. DEV. =   2.8 DEGREES          
REMARK 500     DG J  80   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG J  86   O4' -  C1' -  N9  ANGL. DEV. =   1.8 DEGREES          
REMARK 500     DC J  88   O4' -  C1' -  N1  ANGL. DEV. =   3.1 DEGREES          
REMARK 500     DT J  90   C3' -  O3' -  P   ANGL. DEV. =  12.5 DEGREES          
REMARK 500     DT J  90   C3' -  O3' -  P   ANGL. DEV. =   9.9 DEGREES          
REMARK 500     DT J  91   O3' -  P   -  OP1 ANGL. DEV. =  15.6 DEGREES          
REMARK 500     DT J  91   O3' -  P   -  OP1 ANGL. DEV. =  10.2 DEGREES          
REMARK 500     DA J  94   C3' -  O3' -  P   ANGL. DEV. =   9.2 DEGREES          
REMARK 500    T64 J  95   O3' -  P   -  O5' ANGL. DEV. =  20.0 DEGREES          
REMARK 500     DT J  95   C3' -  O3' -  P   ANGL. DEV. =  47.6 DEGREES          
REMARK 500     DG J  96   C3' -  O3' -  P   ANGL. DEV. =  45.9 DEGREES          
REMARK 500     DG J  97   O4' -  C1' -  N9  ANGL. DEV. =   4.9 DEGREES          
REMARK 500     DG J  99   C3' -  O3' -  P   ANGL. DEV. =  28.9 DEGREES          
REMARK 500                                                                      
REMARK 500 THIS ENTRY HAS      59 ANGLE DEVIATIONS.                             
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    LEU B  23      -27.22     69.47                                   
REMARK 500    ARG B  24       -0.60   -154.92                                   
REMARK 500    ASN B  26     -150.93   -150.99                                   
REMARK 500    PRO C 110       78.09    -61.83                                   
REMARK 500    ASP D  52       73.63   -103.49                                   
REMARK 500    THR D  53      138.98   -171.88                                   
REMARK 500    ALA D 125       37.89    -97.21                                   
REMARK 500    ASP F  25       -3.13     71.43                                   
REMARK 500    ASN F  26      -15.31     82.55                                   
REMARK 500    PRO G 110       79.86    -62.15                                   
REMARK 500    ASP H  52       68.49   -102.32                                   
REMARK 500    ALA H 125       35.30    -94.44                                   
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: NON-CIS, NON-TRANS                                         
REMARK 500                                                                      
REMARK 500 THE FOLLOWING PEPTIDE BONDS DEVIATE SIGNIFICANTLY FROM BOTH          
REMARK 500 CIS AND TRANS CONFORMATION.  CIS BONDS, IF ANY, ARE LISTED           
REMARK 500 ON CISPEP RECORDS.  TRANS IS DEFINED AS 180 +/- 30 AND               
REMARK 500 CIS IS DEFINED AS 0 +/- 30 DEGREES.                                  
REMARK 500                                 MODEL     OMEGA                      
REMARK 500 LEU C  117     PRO C  118                 -147.79                    
REMARK 500 LEU G  117     PRO G  118                 -148.41                    
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: MAIN CHAIN PLANARITY                                       
REMARK 500                                                                      
REMARK 500 THE FOLLOWING RESIDUES HAVE A PSEUDO PLANARITY                       
REMARK 500 TORSION ANGLE, C(I) - CA(I) - N(I+1) - O(I), GREATER                 
REMARK 500 10.0 DEGREES. (M=MODEL NUMBER; RES=RESIDUE NAME;                     
REMARK 500 C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;                            
REMARK 500 I=INSERTION CODE).                                                   
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        ANGLE                                           
REMARK 500    ARG A 135        -11.56                                           
REMARK 500    GLY B 102         11.98                                           
REMARK 500    ALA D 125        -12.49                                           
REMARK 500    ARG E 135        -11.10                                           
REMARK 500    GLY F 102         12.20                                           
REMARK 500    ALA H 125        -12.46                                           
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: EMD-4767   RELATED DB: EMDB                              
REMARK 900 CRYO-EM STRUCTURE OF NCP-6-4PP                                       
DBREF  6R93 I    1   145  PDB    6R93     6R93             1    145             
DBREF  6R93 J    1   145  PDB    6R93     6R93             1    145             
DBREF  6R93 A    1   136  UNP    P68431   H31_HUMAN        1    136             
DBREF  6R93 B    1   103  UNP    P62805   H4_HUMAN         1    103             
DBREF  6R93 C    1   130  UNP    P04908   H2A1B_HUMAN      1    130             
DBREF  6R93 D    1   126  UNP    P06899   H2B1J_HUMAN      1    126             
DBREF  6R93 E    1   136  UNP    P68431   H31_HUMAN        1    136             
DBREF  6R93 F    1   103  UNP    P62805   H4_HUMAN         1    103             
DBREF  6R93 G    1   130  UNP    P04908   H2A1B_HUMAN      1    130             
DBREF  6R93 H    1   126  UNP    P06899   H2B1J_HUMAN      1    126             
SEQADV 6R93 GLY A   -2  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 SER A   -1  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 HIS A    0  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 GLY B   -2  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 SER B   -1  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 HIS B    0  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 GLY C   -2  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 SER C   -1  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 HIS C    0  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 GLY D   -2  UNP  P06899              EXPRESSION TAG                 
SEQADV 6R93 SER D   -1  UNP  P06899              EXPRESSION TAG                 
SEQADV 6R93 HIS D    0  UNP  P06899              EXPRESSION TAG                 
SEQADV 6R93 GLY E   -2  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 SER E   -1  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 HIS E    0  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 GLY F   -2  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 SER F   -1  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 HIS F    0  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 GLY G   -2  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 SER G   -1  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 HIS G    0  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 GLY H   -2  UNP  P06899              EXPRESSION TAG                 
SEQADV 6R93 SER H   -1  UNP  P06899              EXPRESSION TAG                 
SEQADV 6R93 HIS H    0  UNP  P06899              EXPRESSION TAG                 
SEQRES   1 I  145   DA  DT  DC  DA  DA  DT  DA  DT  DC  DC  DA  DC  DC          
SEQRES   2 I  145   DT  DG  DC  DA  DG  DA  DT  DT  DC  DT  DA  DC  DC          
SEQRES   3 I  145   DA  DA  DA  DA  DG  DT  DG  DT  DA  DT  DT  DT  DG          
SEQRES   4 I  145   DG  DA  DA  DA  DC  DT  DG  DC  DT  DC  DA  DA  DC          
SEQRES   5 I  145   DC  DA  DA  DA  DA  DG  DG  DC  DA  DT  DG  DT  DT          
SEQRES   6 I  145   DC  DA  DG  DC  DT  DG  DG  DT  DT  DC  DA  DG  DC          
SEQRES   7 I  145   DT  DG  DA  DA  DC  DA  DT  DG  DC  DC  DT  DT  DT          
SEQRES   8 I  145   DT  DG  DA  DT  DG  DG  DA  DG  DC  DA  DG  DT  DT          
SEQRES   9 I  145   DT  DC  DC  DA  DA  DA  DT  DA  DC  DA  DC  DT  DT          
SEQRES  10 I  145   DT  DT  DG  DG  DT  DA  DG  DA  DA  DT  DC  DT  DG          
SEQRES  11 I  145   DC  DA  DG  DG  DT  DG  DG  DA  DT  DA  DT  DT  DG          
SEQRES  12 I  145   DA  DT                                                      
SEQRES   1 J  145   DA  DT  DC  DA  DA  DT  DA  DT  DC  DC  DA  DC  DC          
SEQRES   2 J  145   DT  DG  DC  DA  DG  DA  DT  DT  DC  DT  DA  DC  DC          
SEQRES   3 J  145   DA  DA  DA  DA  DG  DT  DG  DT  DA  DT  DT  DT  DG          
SEQRES   4 J  145   DG  DA  DA  DA  DC  DT  DG  DC  DT  DC  DC  DA  DT          
SEQRES   5 J  145   DC  DA  DA  DA  DA  DG  DG  DC  DA  DT  DG  DT  DT          
SEQRES   6 J  145   DC  DA  DG  DC  DT  DG  DA  DA  DC  DC  DA  DG  DC          
SEQRES   7 J  145   DT  DG  DA  DA  DC  DA  DT  DG  DC  DC  DT  DT  DT          
SEQRES   8 J  145   DT  DG  DA T64  DG  DG  DA  DG  DC  DA  DG  DT  DT          
SEQRES   9 J  145   DT  DC  DC  DA  DA  DA  DT  DA  DC  DA  DC  DT  DT          
SEQRES  10 J  145   DT  DT  DG  DG  DT  DA  DG  DA  DA  DT  DC  DT  DG          
SEQRES  11 J  145   DC  DA  DG  DG  DT  DG  DG  DA  DT  DA  DT  DT  DG          
SEQRES  12 J  145   DA  DT                                                      
SEQRES   1 A  139  GLY SER HIS MET ALA ARG THR LYS GLN THR ALA ARG LYS          
SEQRES   2 A  139  SER THR GLY GLY LYS ALA PRO ARG LYS GLN LEU ALA THR          
SEQRES   3 A  139  LYS ALA ALA ARG LYS SER ALA PRO ALA THR GLY GLY VAL          
SEQRES   4 A  139  LYS LYS PRO HIS ARG TYR ARG PRO GLY THR VAL ALA LEU          
SEQRES   5 A  139  ARG GLU ILE ARG ARG TYR GLN LYS SER THR GLU LEU LEU          
SEQRES   6 A  139  ILE ARG LYS LEU PRO PHE GLN ARG LEU VAL ARG GLU ILE          
SEQRES   7 A  139  ALA GLN ASP PHE LYS THR ASP LEU ARG PHE GLN SER SER          
SEQRES   8 A  139  ALA VAL MET ALA LEU GLN GLU ALA CYS GLU ALA TYR LEU          
SEQRES   9 A  139  VAL GLY LEU PHE GLU ASP THR ASN LEU CYS ALA ILE HIS          
SEQRES  10 A  139  ALA LYS ARG VAL THR ILE MET PRO LYS ASP ILE GLN LEU          
SEQRES  11 A  139  ALA ARG ARG ILE ARG GLY GLU ARG ALA                          
SEQRES   1 B  106  GLY SER HIS MET SER GLY ARG GLY LYS GLY GLY LYS GLY          
SEQRES   2 B  106  LEU GLY LYS GLY GLY ALA LYS ARG HIS ARG LYS VAL LEU          
SEQRES   3 B  106  ARG ASP ASN ILE GLN GLY ILE THR LYS PRO ALA ILE ARG          
SEQRES   4 B  106  ARG LEU ALA ARG ARG GLY GLY VAL LYS ARG ILE SER GLY          
SEQRES   5 B  106  LEU ILE TYR GLU GLU THR ARG GLY VAL LEU LYS VAL PHE          
SEQRES   6 B  106  LEU GLU ASN VAL ILE ARG ASP ALA VAL THR TYR THR GLU          
SEQRES   7 B  106  HIS ALA LYS ARG LYS THR VAL THR ALA MET ASP VAL VAL          
SEQRES   8 B  106  TYR ALA LEU LYS ARG GLN GLY ARG THR LEU TYR GLY PHE          
SEQRES   9 B  106  GLY GLY                                                      
SEQRES   1 C  133  GLY SER HIS MET SER GLY ARG GLY LYS GLN GLY GLY LYS          
SEQRES   2 C  133  ALA ARG ALA LYS ALA LYS THR ARG SER SER ARG ALA GLY          
SEQRES   3 C  133  LEU GLN PHE PRO VAL GLY ARG VAL HIS ARG LEU LEU ARG          
SEQRES   4 C  133  LYS GLY ASN TYR SER GLU ARG VAL GLY ALA GLY ALA PRO          
SEQRES   5 C  133  VAL TYR LEU ALA ALA VAL LEU GLU TYR LEU THR ALA GLU          
SEQRES   6 C  133  ILE LEU GLU LEU ALA GLY ASN ALA ALA ARG ASP ASN LYS          
SEQRES   7 C  133  LYS THR ARG ILE ILE PRO ARG HIS LEU GLN LEU ALA ILE          
SEQRES   8 C  133  ARG ASN ASP GLU GLU LEU ASN LYS LEU LEU GLY ARG VAL          
SEQRES   9 C  133  THR ILE ALA GLN GLY GLY VAL LEU PRO ASN ILE GLN ALA          
SEQRES  10 C  133  VAL LEU LEU PRO LYS LYS THR GLU SER HIS HIS LYS ALA          
SEQRES  11 C  133  LYS GLY LYS                                                  
SEQRES   1 D  129  GLY SER HIS MET PRO GLU PRO ALA LYS SER ALA PRO ALA          
SEQRES   2 D  129  PRO LYS LYS GLY SER LYS LYS ALA VAL THR LYS ALA GLN          
SEQRES   3 D  129  LYS LYS ASP GLY LYS LYS ARG LYS ARG SER ARG LYS GLU          
SEQRES   4 D  129  SER TYR SER ILE TYR VAL TYR LYS VAL LEU LYS GLN VAL          
SEQRES   5 D  129  HIS PRO ASP THR GLY ILE SER SER LYS ALA MET GLY ILE          
SEQRES   6 D  129  MET ASN SER PHE VAL ASN ASP ILE PHE GLU ARG ILE ALA          
SEQRES   7 D  129  GLY GLU ALA SER ARG LEU ALA HIS TYR ASN LYS ARG SER          
SEQRES   8 D  129  THR ILE THR SER ARG GLU ILE GLN THR ALA VAL ARG LEU          
SEQRES   9 D  129  LEU LEU PRO GLY GLU LEU ALA LYS HIS ALA VAL SER GLU          
SEQRES  10 D  129  GLY THR LYS ALA VAL THR LYS TYR THR SER ALA LYS              
SEQRES   1 E  139  GLY SER HIS MET ALA ARG THR LYS GLN THR ALA ARG LYS          
SEQRES   2 E  139  SER THR GLY GLY LYS ALA PRO ARG LYS GLN LEU ALA THR          
SEQRES   3 E  139  LYS ALA ALA ARG LYS SER ALA PRO ALA THR GLY GLY VAL          
SEQRES   4 E  139  LYS LYS PRO HIS ARG TYR ARG PRO GLY THR VAL ALA LEU          
SEQRES   5 E  139  ARG GLU ILE ARG ARG TYR GLN LYS SER THR GLU LEU LEU          
SEQRES   6 E  139  ILE ARG LYS LEU PRO PHE GLN ARG LEU VAL ARG GLU ILE          
SEQRES   7 E  139  ALA GLN ASP PHE LYS THR ASP LEU ARG PHE GLN SER SER          
SEQRES   8 E  139  ALA VAL MET ALA LEU GLN GLU ALA CYS GLU ALA TYR LEU          
SEQRES   9 E  139  VAL GLY LEU PHE GLU ASP THR ASN LEU CYS ALA ILE HIS          
SEQRES  10 E  139  ALA LYS ARG VAL THR ILE MET PRO LYS ASP ILE GLN LEU          
SEQRES  11 E  139  ALA ARG ARG ILE ARG GLY GLU ARG ALA                          
SEQRES   1 F  106  GLY SER HIS MET SER GLY ARG GLY LYS GLY GLY LYS GLY          
SEQRES   2 F  106  LEU GLY LYS GLY GLY ALA LYS ARG HIS ARG LYS VAL LEU          
SEQRES   3 F  106  ARG ASP ASN ILE GLN GLY ILE THR LYS PRO ALA ILE ARG          
SEQRES   4 F  106  ARG LEU ALA ARG ARG GLY GLY VAL LYS ARG ILE SER GLY          
SEQRES   5 F  106  LEU ILE TYR GLU GLU THR ARG GLY VAL LEU LYS VAL PHE          
SEQRES   6 F  106  LEU GLU ASN VAL ILE ARG ASP ALA VAL THR TYR THR GLU          
SEQRES   7 F  106  HIS ALA LYS ARG LYS THR VAL THR ALA MET ASP VAL VAL          
SEQRES   8 F  106  TYR ALA LEU LYS ARG GLN GLY ARG THR LEU TYR GLY PHE          
SEQRES   9 F  106  GLY GLY                                                      
SEQRES   1 G  133  GLY SER HIS MET SER GLY ARG GLY LYS GLN GLY GLY LYS          
SEQRES   2 G  133  ALA ARG ALA LYS ALA LYS THR ARG SER SER ARG ALA GLY          
SEQRES   3 G  133  LEU GLN PHE PRO VAL GLY ARG VAL HIS ARG LEU LEU ARG          
SEQRES   4 G  133  LYS GLY ASN TYR SER GLU ARG VAL GLY ALA GLY ALA PRO          
SEQRES   5 G  133  VAL TYR LEU ALA ALA VAL LEU GLU TYR LEU THR ALA GLU          
SEQRES   6 G  133  ILE LEU GLU LEU ALA GLY ASN ALA ALA ARG ASP ASN LYS          
SEQRES   7 G  133  LYS THR ARG ILE ILE PRO ARG HIS LEU GLN LEU ALA ILE          
SEQRES   8 G  133  ARG ASN ASP GLU GLU LEU ASN LYS LEU LEU GLY ARG VAL          
SEQRES   9 G  133  THR ILE ALA GLN GLY GLY VAL LEU PRO ASN ILE GLN ALA          
SEQRES  10 G  133  VAL LEU LEU PRO LYS LYS THR GLU SER HIS HIS LYS ALA          
SEQRES  11 G  133  LYS GLY LYS                                                  
SEQRES   1 H  129  GLY SER HIS MET PRO GLU PRO ALA LYS SER ALA PRO ALA          
SEQRES   2 H  129  PRO LYS LYS GLY SER LYS LYS ALA VAL THR LYS ALA GLN          
SEQRES   3 H  129  LYS LYS ASP GLY LYS LYS ARG LYS ARG SER ARG LYS GLU          
SEQRES   4 H  129  SER TYR SER ILE TYR VAL TYR LYS VAL LEU LYS GLN VAL          
SEQRES   5 H  129  HIS PRO ASP THR GLY ILE SER SER LYS ALA MET GLY ILE          
SEQRES   6 H  129  MET ASN SER PHE VAL ASN ASP ILE PHE GLU ARG ILE ALA          
SEQRES   7 H  129  GLY GLU ALA SER ARG LEU ALA HIS TYR ASN LYS ARG SER          
SEQRES   8 H  129  THR ILE THR SER ARG GLU ILE GLN THR ALA VAL ARG LEU          
SEQRES   9 H  129  LEU LEU PRO GLY GLU LEU ALA LYS HIS ALA VAL SER GLU          
SEQRES  10 H  129  GLY THR LYS ALA VAL THR LYS TYR THR SER ALA LYS              
HET    T64  I  95      64                                                       
HET    T64  J  95      64                                                       
HETNAM     T64 (6-4)PHOTOPRODUCT                                                
HETSYN     T64 [(2R,4S,5R,10S,11R,13R,18R,19S)-4,8,18-TRIHYDROXY-18,            
HETSYN   2 T64  24-DIMETHYL-8-OXIDO-15,17,22-TRIOXO-7,9,12,26-                  
HETSYN   3 T64  TETRAOXA-1,14,16,21-TETRAAZA-8-                                 
HETSYN   4 T64  PHOSPHAPENTACYCLO[18.2.2.1~2,5~.1~10,13~.0~14,                  
HETSYN   5 T64  19~]HEXACOSA-20,23-DIEN-11-YL]METHYL DIHYDROGEN                 
HETSYN   6 T64  PHOSPHATE                                                       
FORMUL   1  T64    2(C20 H28 N4 O15 P2)                                         
HELIX    1 AA1 GLY A   45  SER A   58  1                                  14    
HELIX    2 AA2 ARG A   64  LYS A   80  1                                  17    
HELIX    3 AA3 GLN A   86  ALA A  115  1                                  30    
HELIX    4 AA4 MET A  121  GLY A  133  1                                  13    
HELIX    5 AA5 ASN B   26  ILE B   30  5                                   5    
HELIX    6 AA6 THR B   31  GLY B   42  1                                  12    
HELIX    7 AA7 LEU B   50  ALA B   77  1                                  28    
HELIX    8 AA8 THR B   83  GLN B   94  1                                  12    
HELIX    9 AA9 THR C   17  GLY C   23  1                                   7    
HELIX   10 AB1 PRO C   27  LYS C   37  1                                  11    
HELIX   11 AB2 ALA C   46  ASN C   74  1                                  29    
HELIX   12 AB3 ILE C   80  ASN C   90  1                                  11    
HELIX   13 AB4 ASP C   91  LEU C   98  1                                   8    
HELIX   14 AB5 GLN C  113  LEU C  117  5                                   5    
HELIX   15 AB6 TYR D   38  HIS D   50  1                                  13    
HELIX   16 AB7 SER D   56  ASN D   85  1                                  30    
HELIX   17 AB8 THR D   91  LEU D  103  1                                  13    
HELIX   18 AB9 PRO D  104  ALA D  125  1                                  22    
HELIX   19 AC1 GLY E   45  SER E   58  1                                  14    
HELIX   20 AC2 ARG E   64  LYS E   80  1                                  17    
HELIX   21 AC3 GLN E   86  ALA E  115  1                                  30    
HELIX   22 AC4 MET E  121  GLY E  133  1                                  13    
HELIX   23 AC5 ASN F   26  ILE F   30  5                                   5    
HELIX   24 AC6 THR F   31  GLY F   42  1                                  12    
HELIX   25 AC7 LEU F   50  LYS F   78  1                                  29    
HELIX   26 AC8 THR F   83  GLN F   94  1                                  12    
HELIX   27 AC9 THR G   17  GLY G   23  1                                   7    
HELIX   28 AD1 PRO G   27  LYS G   37  1                                  11    
HELIX   29 AD2 ALA G   46  ASN G   74  1                                  29    
HELIX   30 AD3 ILE G   80  ASN G   90  1                                  11    
HELIX   31 AD4 ASP G   91  LEU G   98  1                                   8    
HELIX   32 AD5 GLN G  113  LEU G  117  5                                   5    
HELIX   33 AD6 TYR H   38  HIS H   50  1                                  13    
HELIX   34 AD7 SER H   56  ASN H   85  1                                  30    
HELIX   35 AD8 THR H   91  LEU H  103  1                                  13    
HELIX   36 AD9 PRO H  104  ALA H  125  1                                  22    
SHEET    1 AA1 2 ARG A  84  PHE A  85  0                                        
SHEET    2 AA1 2 THR B  81  VAL B  82  1  O  VAL B  82   N  ARG A  84           
SHEET    1 AA2 2 THR A 119  ILE A 120  0                                        
SHEET    2 AA2 2 ARG B  46  ILE B  47  1  O  ARG B  46   N  ILE A 120           
SHEET    1 AA3 2 THR B  97  TYR B  99  0                                        
SHEET    2 AA3 2 VAL G 101  ILE G 103  1  O  THR G 102   N  THR B  97           
SHEET    1 AA4 2 ARG C  43  VAL C  44  0                                        
SHEET    2 AA4 2 THR D  89  ILE D  90  1  O  ILE D  90   N  ARG C  43           
SHEET    1 AA5 2 ARG C  78  ILE C  79  0                                        
SHEET    2 AA5 2 GLY D  54  ILE D  55  1  O  GLY D  54   N  ILE C  79           
SHEET    1 AA6 2 VAL C 101  ILE C 103  0                                        
SHEET    2 AA6 2 THR F  97  TYR F  99  1  O  THR F  97   N  THR C 102           
SHEET    1 AA7 2 ARG E  84  PHE E  85  0                                        
SHEET    2 AA7 2 THR F  81  VAL F  82  1  O  VAL F  82   N  ARG E  84           
SHEET    1 AA8 2 THR E 119  ILE E 120  0                                        
SHEET    2 AA8 2 ARG F  46  ILE F  47  1  O  ARG F  46   N  ILE E 120           
SHEET    1 AA9 2 ARG G  43  VAL G  44  0                                        
SHEET    2 AA9 2 THR H  89  ILE H  90  1  O  ILE H  90   N  ARG G  43           
SHEET    1 AB1 2 ARG G  78  ILE G  79  0                                        
SHEET    2 AB1 2 GLY H  54  ILE H  55  1  O  GLY H  54   N  ILE G  79           
LINK         O3'B DA I  94                 P  BT64 I  95     1555   1555  1.60  
LINK         O3'BT64 I  95                 P  B DG I  97     1555   1555  1.60  
LINK         O3'A DA J  94                 P  AT64 J  95     1555   1555  1.61  
LINK         O3'AT64 J  95                 P  A DG J  97     1555   1555  1.60  
CRYST1    1.000    1.000    1.000  90.00  90.00  90.00 P 1           1          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      1.000000  0.000000  0.000000        0.00000                         
SCALE2      0.000000  1.000000  0.000000        0.00000                         
SCALE3      0.000000  0.000000  1.000000        0.00000                         
ATOM      1  O5'  DA I   1     138.742 148.908  65.705  1.00117.51           O  
ATOM      2  C5'  DA I   1     139.977 149.608  65.789  1.00117.51           C  
ATOM      3  C4'  DA I   1     140.197 150.472  64.560  1.00117.51           C  
ATOM      4  O4'  DA I   1     139.006 151.269  64.311  1.00117.51           O  
ATOM      5  C3'  DA I   1     141.339 151.472  64.678  1.00117.51           C  
ATOM      6  O3'  DA I   1     141.956 151.704  63.415  1.00117.51           O  
ATOM      7  C2'  DA I   1     140.640 152.706  65.219  1.00117.51           C  
ATOM      8  C1'  DA I   1     139.278 152.640  64.548  1.00117.51           C  
ATOM      9  N9   DA I   1     138.208 153.204  65.359  1.00117.51           N  
ATOM     10  C8   DA I   1     137.504 152.582  66.352  1.00117.51           C  
ATOM     11  N7   DA I   1     136.603 153.347  66.919  1.00117.51           N  
ATOM     12  C5   DA I   1     136.726 154.550  66.249  1.00117.51           C  
ATOM     13  C6   DA I   1     136.051 155.777  66.373  1.00117.51           C  
ATOM     14  N6   DA I   1     135.076 155.992  67.257  1.00117.51           N  
ATOM     15  N1   DA I   1     136.418 156.777  65.548  1.00117.51           N  
ATOM     16  C2   DA I   1     137.396 156.558  64.661  1.00117.51           C  
ATOM     17  N3   DA I   1     138.099 155.450  64.451  1.00117.51           N  
ATOM     18  C4   DA I   1     137.710 154.476  65.284  1.00117.51           C  
ATOM     19  H5'  DA I   1     140.701 148.968  65.864  1.00117.51           H  
ATOM     20 H5''  DA I   1     139.968 150.173  66.578  1.00117.51           H  
ATOM     21  H4'  DA I   1     140.359 149.897  63.795  1.00117.51           H  
ATOM     22  H3'  DA I   1     141.994 151.154  65.318  1.00117.51           H  
ATOM     23  H2'  DA I   1     140.552 152.647  66.179  1.00117.51           H  
ATOM     24 H2''  DA I   1     141.109 153.512  64.964  1.00117.51           H  
ATOM     25  H1'  DA I   1     139.318 153.111  63.701  1.00117.51           H  
ATOM     26  H8   DA I   1     137.654 151.701  66.605  1.00117.51           H  
ATOM     27  H61  DA I   1     134.639 156.733  67.243  1.00117.51           H  
ATOM     28  H62  DA I   1     134.882 155.390  67.839  1.00117.51           H  
ATOM     29  H2   DA I   1     137.612 157.278  64.116  1.00117.51           H  
ATOM     30 HO5'  DA I   1     138.035 149.325  65.525  1.00117.51           H  
ATOM     31  P    DT I   2     143.376 152.452  63.332  1.00120.99           P  
ATOM     32  OP1  DT I   2     143.911 152.234  61.971  1.00120.99           O  
ATOM     33  OP2  DT I   2     144.180 152.057  64.509  1.00120.99           O  
ATOM     34  O5'  DT I   2     143.006 153.999  63.493  1.00120.99           O  
ATOM     35  C5'  DT I   2     142.198 154.637  62.511  1.00120.99           C  
ATOM     36  C4'  DT I   2     142.206 156.154  62.661  1.00120.99           C  
ATOM     37  O4'  DT I   2     141.082 156.559  63.489  1.00120.99           O  
ATOM     38  C3'  DT I   2     143.460 156.766  63.313  1.00120.99           C  
ATOM     39  O3'  DT I   2     143.941 157.851  62.529  1.00120.99           O  
ATOM     40  C2'  DT I   2     142.966 157.209  64.693  1.00120.99           C  
ATOM     41  C1'  DT I   2     141.506 157.529  64.417  1.00120.99           C  
ATOM     42  N1   DT I   2     140.581 157.471  65.615  1.00120.99           N  
ATOM     43  C2   DT I   2     139.824 158.577  65.944  1.00120.99           C  
ATOM     44  O2   DT I   2     139.875 159.634  65.341  1.00120.99           O  
ATOM     45  N3   DT I   2     139.002 158.404  67.024  1.00120.99           N  
ATOM     46  C4   DT I   2     138.851 157.267  67.787  1.00120.99           C  
ATOM     47  O4   DT I   2     138.083 157.216  68.742  1.00120.99           O  
ATOM     48  C5   DT I   2     139.660 156.147  67.390  1.00120.99           C  
ATOM     49  C7   DT I   2     139.577 154.859  68.144  1.00120.99           C  
ATOM     50  C6   DT I   2     140.468 156.293  66.330  1.00120.99           C  
ATOM     51  H5'  DT I   2     141.285 154.318  62.601  1.00120.99           H  
ATOM     52 H5''  DT I   2     142.529 154.404  61.630  1.00120.99           H  
ATOM     53  H4'  DT I   2     142.096 156.548  61.782  1.00120.99           H  
ATOM     54  H3'  DT I   2     144.155 156.099  63.408  1.00120.99           H  
ATOM     55  H2'  DT I   2     143.052 156.488  65.334  1.00120.99           H  
ATOM     56 H2''  DT I   2     143.440 157.999  64.995  1.00120.99           H  
ATOM     57  H1'  DT I   2     141.449 158.403  64.005  1.00120.99           H  
ATOM     58  H3   DT I   2     138.525 159.084  67.253  1.00120.99           H  
ATOM     59  H71  DT I   2     139.540 154.127  67.520  1.00120.99           H  
ATOM     60  H72  DT I   2     140.360 154.764  68.708  1.00120.99           H  
ATOM     61  H73  DT I   2     138.779 154.853  68.693  1.00120.99           H  
ATOM     62  H6   DT I   2     140.988 155.568  66.071  1.00120.99           H  
ATOM     63  P    DC I   3     145.359 158.532  62.857  1.00111.14           P  
ATOM     64  OP1  DC I   3     146.244 158.263  61.703  1.00111.14           O  
ATOM     65  OP2  DC I   3     145.786 158.106  64.207  1.00111.14           O  
ATOM     66  O5'  DC I   3     145.040 160.102  62.896  1.00111.14           O  
ATOM     67  C5'  DC I   3     143.758 160.580  63.319  1.00111.14           C  
ATOM     68  C4'  DC I   3     143.860 161.658  64.385  1.00111.14           C  
ATOM     69  O4'  DC I   3     143.002 161.277  65.504  1.00111.14           O  
ATOM     70  C3'  DC I   3     145.237 161.876  65.016  1.00111.14           C  
ATOM     71  O3'  DC I   3     145.363 163.208  65.479  1.00111.14           O  
ATOM     72  C2'  DC I   3     145.188 160.886  66.150  1.00111.14           C  
ATOM     73  C1'  DC I   3     143.798 161.195  66.667  1.00111.14           C  
ATOM     74  N1   DC I   3     143.189 160.205  67.647  1.00111.14           N  
ATOM     75  C2   DC I   3     142.184 160.657  68.493  1.00111.14           C  
ATOM     76  O2   DC I   3     141.829 161.835  68.405  1.00111.14           O  
ATOM     77  N3   DC I   3     141.631 159.801  69.380  1.00111.14           N  
ATOM     78  C4   DC I   3     142.053 158.541  69.440  1.00111.14           C  
ATOM     79  N4   DC I   3     141.476 157.730  70.329  1.00111.14           N  
ATOM     80  C5   DC I   3     143.081 158.056  68.591  1.00111.14           C  
ATOM     81  C6   DC I   3     143.619 158.912  67.719  1.00111.14           C  
ATOM     82  H5'  DC I   3     143.247 159.848  63.677  1.00111.14           H  
ATOM     83 H5''  DC I   3     143.291 160.943  62.553  1.00111.14           H  
ATOM     84  H4'  DC I   3     143.546 162.496  64.018  1.00111.14           H  
ATOM     85  H3'  DC I   3     145.949 161.663  64.402  1.00111.14           H  
ATOM     86  H2'  DC I   3     145.257 159.982  65.814  1.00111.14           H  
ATOM     87 H2''  DC I   3     145.865 161.076  66.816  1.00111.14           H  
ATOM     88  H1'  DC I   3     143.820 162.066  67.081  1.00111.14           H  
ATOM     89  H41  DC I   3     141.796 156.943  70.462  1.00111.14           H  
ATOM     90  H42  DC I   3     140.783 157.991  70.763  1.00111.14           H  
ATOM     91  H5   DC I   3     143.367 157.176  68.640  1.00111.14           H  
ATOM     92  H6   DC I   3     144.290 158.621  67.153  1.00111.14           H  
ATOM     93  P    DA I   4     146.653 164.090  65.112  1.00119.03           P  
ATOM     94  OP1  DA I   4     146.662 164.288  63.647  1.00119.03           O  
ATOM     95  OP2  DA I   4     147.823 163.476  65.782  1.00119.03           O  
ATOM     96  O5'  DA I   4     146.363 165.493  65.825  1.00119.03           O  
ATOM     97  C5'  DA I   4     145.118 166.160  65.618  1.00119.03           C  
ATOM     98  C4'  DA I   4     144.645 166.844  66.890  1.00119.03           C  
ATOM     99  O4'  DA I   4     144.002 165.869  67.768  1.00119.03           O  
ATOM    100  C3'  DA I   4     145.752 167.470  67.724  1.00119.03           C  
ATOM    101  O3'  DA I   4     145.285 168.637  68.372  1.00119.03           O  
ATOM    102  C2'  DA I   4     146.079 166.359  68.698  1.00119.03           C  
ATOM    103  C1'  DA I   4     144.689 165.825  69.006  1.00119.03           C  
ATOM    104  N9   DA I   4     144.646 164.454  69.531  1.00119.03           N  
ATOM    105  C8   DA I   4     145.348 163.369  69.083  1.00119.03           C  
ATOM    106  N7   DA I   4     145.099 162.264  69.744  1.00119.03           N  
ATOM    107  C5   DA I   4     144.166 162.645  70.688  1.00119.03           C  
ATOM    108  C6   DA I   4     143.496 161.930  71.699  1.00119.03           C  
ATOM    109  N6   DA I   4     143.688 160.626  71.925  1.00119.03           N  
ATOM    110  N1   DA I   4     142.622 162.610  72.473  1.00119.03           N  
ATOM    111  C2   DA I   4     142.440 163.914  72.240  1.00119.03           C  
ATOM    112  N3   DA I   4     143.012 164.691  71.321  1.00119.03           N  
ATOM    113  C4   DA I   4     143.871 163.989  70.570  1.00119.03           C  
ATOM    114  H5'  DA I   4     144.452 165.514  65.338  1.00119.03           H  
ATOM    115 H5''  DA I   4     145.227 166.826  64.921  1.00119.03           H  
ATOM    116  H4'  DA I   4     144.002 167.531  66.659  1.00119.03           H  
ATOM    117  H3'  DA I   4     146.520 167.671  67.170  1.00119.03           H  
ATOM    118  H2'  DA I   4     146.629 165.687  68.277  1.00119.03           H  
ATOM    119 H2''  DA I   4     146.501 166.708  69.484  1.00119.03           H  
ATOM    120  H1'  DA I   4     144.253 166.422  69.634  1.00119.03           H  
ATOM    121  H8   DA I   4     145.951 163.412  68.377  1.00119.03           H  
ATOM    122  H61  DA I   4     143.463 160.283  72.682  1.00119.03           H  
ATOM    123  H62  DA I   4     144.046 160.130  71.317  1.00119.03           H  
ATOM    124  H2   DA I   4     141.830 164.337  72.797  1.00119.03           H  
ATOM    125  P    DA I   5     146.315 169.654  69.065  1.00120.26           P  
ATOM    126  OP1  DA I   5     146.353 170.877  68.233  1.00120.26           O  
ATOM    127  OP2  DA I   5     147.573 168.929  69.349  1.00120.26           O  
ATOM    128  O5'  DA I   5     145.612 170.003  70.459  1.00120.26           O  
ATOM    129  C5'  DA I   5     144.306 170.569  70.468  1.00120.26           C  
ATOM    130  C4'  DA I   5     143.671 170.483  71.848  1.00120.26           C  
ATOM    131  O4'  DA I   5     143.506 169.085  72.223  1.00120.26           O  
ATOM    132  C3'  DA I   5     144.477 171.106  72.976  1.00120.26           C  
ATOM    133  O3'  DA I   5     143.603 171.596  73.993  1.00120.26           O  
ATOM    134  C2'  DA I   5     145.322 169.934  73.445  1.00120.26           C  
ATOM    135  C1'  DA I   5     144.340 168.778  73.329  1.00120.26           C  
ATOM    136  N9   DA I   5     144.951 167.477  73.089  1.00120.26           N  
ATOM    137  C8   DA I   5     145.780 167.146  72.066  1.00120.26           C  
ATOM    138  N7   DA I   5     146.170 165.896  72.076  1.00120.26           N  
ATOM    139  C5   DA I   5     145.540 165.362  73.182  1.00120.26           C  
ATOM    140  C6   DA I   5     145.542 164.070  73.741  1.00120.26           C  
ATOM    141  N6   DA I   5     146.235 163.051  73.229  1.00120.26           N  
ATOM    142  N1   DA I   5     144.802 163.866  74.852  1.00120.26           N  
ATOM    143  C2   DA I   5     144.109 164.895  75.363  1.00120.26           C  
ATOM    144  N3   DA I   5     144.031 166.154  74.924  1.00120.26           N  
ATOM    145  C4   DA I   5     144.776 166.321  73.819  1.00120.26           C  
ATOM    146  H5'  DA I   5     143.750 170.089  69.834  1.00120.26           H  
ATOM    147 H5''  DA I   5     144.361 171.500  70.202  1.00120.26           H  
ATOM    148  H4'  DA I   5     142.799 170.905  71.818  1.00120.26           H  
ATOM    149  H3'  DA I   5     145.040 171.818  72.638  1.00120.26           H  
ATOM    150  H2'  DA I   5     146.084 169.804  72.864  1.00120.26           H  
ATOM    151 H2''  DA I   5     145.604 170.055  74.357  1.00120.26           H  
ATOM    152  H1'  DA I   5     143.802 168.734  74.134  1.00120.26           H  
ATOM    153  H8   DA I   5     146.055 167.757  71.421  1.00120.26           H  
ATOM    154  H61  DA I   5     146.177 162.270  73.584  1.00120.26           H  
ATOM    155  H62  DA I   5     146.739 163.175  72.544  1.00120.26           H  
ATOM    156  H2   DA I   5     143.614 164.706  76.127  1.00120.26           H  
ATOM    157  P    DT I   6     144.098 172.704  75.045  1.00109.91           P  
ATOM    158  OP1  DT I   6     143.296 173.928  74.829  1.00109.91           O  
ATOM    159  OP2  DT I   6     145.574 172.773  74.958  1.00109.91           O  
ATOM    160  O5'  DT I   6     143.717 172.073  76.468  1.00109.91           O  
ATOM    161  C5'  DT I   6     144.617 171.174  77.088  1.00109.91           C  
ATOM    162  C4'  DT I   6     143.945 170.350  78.170  1.00109.91           C  
ATOM    163  O4'  DT I   6     143.979 168.950  77.772  1.00109.91           O  
ATOM    164  C3'  DT I   6     144.626 170.403  79.530  1.00109.91           C  
ATOM    165  O3'  DT I   6     143.701 170.252  80.593  1.00109.91           O  
ATOM    166  C2'  DT I   6     145.607 169.250  79.458  1.00109.91           C  
ATOM    167  C1'  DT I   6     144.895 168.228  78.579  1.00109.91           C  
ATOM    168  N1   DT I   6     145.833 167.425  77.689  1.00109.91           N  
ATOM    169  C2   DT I   6     146.036 166.085  77.941  1.00109.91           C  
ATOM    170  O2   DT I   6     145.494 165.481  78.846  1.00109.91           O  
ATOM    171  N3   DT I   6     146.902 165.467  77.083  1.00109.91           N  
ATOM    172  C4   DT I   6     147.575 166.031  76.026  1.00109.91           C  
ATOM    173  O4   DT I   6     148.336 165.387  75.312  1.00109.91           O  
ATOM    174  C5   DT I   6     147.328 167.428  75.817  1.00109.91           C  
ATOM    175  C7   DT I   6     148.016 168.144  74.698  1.00109.91           C  
ATOM    176  C6   DT I   6     146.480 168.053  76.646  1.00109.91           C  
ATOM    177  H5'  DT I   6     145.349 171.678  77.471  1.00109.91           H  
ATOM    178 H5''  DT I   6     144.966 170.577  76.422  1.00109.91           H  
ATOM    179  H4'  DT I   6     143.024 170.633  78.264  1.00109.91           H  
ATOM    180  H3'  DT I   6     145.103 171.235  79.632  1.00109.91           H  
ATOM    181  H2'  DT I   6     146.439 169.532  79.053  1.00109.91           H  
ATOM    182 H2''  DT I   6     145.757 168.892  80.334  1.00109.91           H  
ATOM    183  H1'  DT I   6     144.401 167.624  79.146  1.00109.91           H  
ATOM    184  H3   DT I   6     147.041 164.632  77.219  1.00109.91           H  
ATOM    185  H71  DT I   6     147.670 169.043  74.628  1.00109.91           H  
ATOM    186  H72  DT I   6     148.968 168.178  74.874  1.00109.91           H  
ATOM    187  H73  DT I   6     147.860 167.671  73.868  1.00109.91           H  
ATOM    188  H6   DT I   6     146.324 168.953  76.513  1.00109.91           H  
ATOM    189  P    DA I   7     144.187 170.496  82.108  1.00108.52           P  
ATOM    190  OP1  DA I   7     143.034 171.034  82.858  1.00108.52           O  
ATOM    191  OP2  DA I   7     145.455 171.253  82.074  1.00108.52           O  
ATOM    192  O5'  DA I   7     144.513 169.025  82.647  1.00108.52           O  
ATOM    193  C5'  DA I   7     143.535 168.024  82.511  1.00108.52           C  
ATOM    194  C4'  DA I   7     143.942 166.712  83.165  1.00108.52           C  
ATOM    195  O4'  DA I   7     144.755 165.936  82.250  1.00108.52           O  
ATOM    196  C3'  DA I   7     144.729 166.815  84.465  1.00108.52           C  
ATOM    197  O3'  DA I   7     144.188 165.911  85.428  1.00108.52           O  
ATOM    198  C2'  DA I   7     146.157 166.459  84.060  1.00108.52           C  
ATOM    199  C1'  DA I   7     145.965 165.541  82.862  1.00108.52           C  
ATOM    200  N9   DA I   7     147.008 165.632  81.842  1.00108.52           N  
ATOM    201  C8   DA I   7     147.355 166.745  81.144  1.00108.52           C  
ATOM    202  N7   DA I   7     148.294 166.553  80.263  1.00108.52           N  
ATOM    203  C5   DA I   7     148.572 165.211  80.366  1.00108.52           C  
ATOM    204  C6   DA I   7     149.481 164.394  79.690  1.00108.52           C  
ATOM    205  N6   DA I   7     150.295 164.851  78.743  1.00108.52           N  
ATOM    206  N1   DA I   7     149.522 163.092  80.019  1.00108.52           N  
ATOM    207  C2   DA I   7     148.698 162.641  80.975  1.00108.52           C  
ATOM    208  N3   DA I   7     147.795 163.321  81.688  1.00108.52           N  
ATOM    209  C4   DA I   7     147.784 164.615  81.329  1.00108.52           C  
ATOM    210  H5'  DA I   7     143.380 167.868  81.569  1.00108.52           H  
ATOM    211 H5''  DA I   7     142.712 168.332  82.917  1.00108.52           H  
ATOM    212  H4'  DA I   7     143.147 166.223  83.344  1.00108.52           H  
ATOM    213  H3'  DA I   7     144.694 167.721  84.803  1.00108.52           H  
ATOM    214  H2'  DA I   7     146.645 167.254  83.809  1.00108.52           H  
ATOM    215 H2''  DA I   7     146.608 165.991  84.775  1.00108.52           H  
ATOM    216  H1'  DA I   7     145.889 164.625  83.168  1.00108.52           H  
ATOM    217  H8   DA I   7     146.978 167.569  81.302  1.00108.52           H  
ATOM    218  H61  DA I   7     150.858 164.320  78.367  1.00108.52           H  
ATOM    219  H62  DA I   7     150.256 165.676  78.506  1.00108.52           H  
ATOM    220  H2   DA I   7     148.762 161.734  81.166  1.00108.52           H  
ATOM    221  P    DT I   8     144.778 165.838  86.921  1.00108.75           P  
ATOM    222  OP1  DT I   8     143.680 165.380  87.802  1.00108.75           O  
ATOM    223  OP2  DT I   8     145.468 167.113  87.206  1.00108.75           O  
ATOM    224  O5'  DT I   8     145.875 164.677  86.836  1.00108.75           O  
ATOM    225  C5'  DT I   8     145.482 163.380  86.422  1.00108.75           C  
ATOM    226  C4'  DT I   8     146.680 162.476  86.208  1.00108.75           C  
ATOM    227  O4'  DT I   8     147.441 162.941  85.062  1.00108.75           O  
ATOM    228  C3'  DT I   8     147.669 162.414  87.377  1.00108.75           C  
ATOM    229  O3'  DT I   8     147.937 161.058  87.722  1.00108.75           O  
ATOM    230  C2'  DT I   8     148.898 163.136  86.838  1.00108.75           C  
ATOM    231  C1'  DT I   8     148.807 162.831  85.359  1.00108.75           C  
ATOM    232  N1   DT I   8     149.575 163.758  84.456  1.00108.75           N  
ATOM    233  C2   DT I   8     150.530 163.248  83.605  1.00108.75           C  
ATOM    234  O2   DT I   8     150.820 162.068  83.546  1.00108.75           O  
ATOM    235  N3   DT I   8     151.150 164.177  82.822  1.00108.75           N  
ATOM    236  C4   DT I   8     150.919 165.532  82.793  1.00108.75           C  
ATOM    237  O4   DT I   8     151.534 166.286  82.048  1.00108.75           O  
ATOM    238  C5   DT I   8     149.902 166.000  83.696  1.00108.75           C  
ATOM    239  C7   DT I   8     149.569 167.462  83.761  1.00108.75           C  
ATOM    240  C6   DT I   8     149.284 165.099  84.471  1.00108.75           C  
ATOM    241  H5'  DT I   8     144.987 163.451  85.591  1.00108.75           H  
ATOM    242 H5''  DT I   8     144.910 162.991  87.100  1.00108.75           H  
ATOM    243  H4'  DT I   8     146.363 161.579  86.027  1.00108.75           H  
ATOM    244  H3'  DT I   8     147.311 162.888  88.140  1.00108.75           H  
ATOM    245  H2'  DT I   8     148.834 164.085  87.004  1.00108.75           H  
ATOM    246 H2''  DT I   8     149.704 162.771  87.216  1.00108.75           H  
ATOM    247  H1'  DT I   8     149.089 161.922  85.209  1.00108.75           H  
ATOM    248  H3   DT I   8     151.753 163.883  82.288  1.00108.75           H  
ATOM    249  H71  DT I   8     148.850 167.602  84.395  1.00108.75           H  
ATOM    250  H72  DT I   8     150.352 167.958  84.048  1.00108.75           H  
ATOM    251  H73  DT I   8     149.296 167.772  82.886  1.00108.75           H  
ATOM    252  H6   DT I   8     148.633 165.397  85.058  1.00108.75           H  
ATOM    253  P    DC I   9     148.861 160.696  88.985  1.00117.76           P  
ATOM    254  OP1  DC I   9     148.098 159.756  89.833  1.00117.76           O  
ATOM    255  OP2  DC I   9     149.371 161.957  89.563  1.00117.76           O  
ATOM    256  O5'  DC I   9     150.093 159.911  88.337  1.00117.76           O  
ATOM    257  C5'  DC I   9     149.843 158.835  87.443  1.00117.76           C  
ATOM    258  C4'  DC I   9     151.139 158.232  86.919  1.00117.76           C  
ATOM    259  O4'  DC I   9     151.707 159.113  85.918  1.00117.76           O  
ATOM    260  C3'  DC I   9     152.222 158.008  87.967  1.00117.76           C  
ATOM    261  O3'  DC I   9     152.826 156.738  87.785  1.00117.76           O  
ATOM    262  C2'  DC I   9     153.197 159.164  87.752  1.00117.76           C  
ATOM    263  C1'  DC I   9     153.009 159.523  86.281  1.00117.76           C  
ATOM    264  N1   DC I   9     153.132 161.009  85.965  1.00117.76           N  
ATOM    265  C2   DC I   9     154.062 161.466  85.011  1.00117.76           C  
ATOM    266  O2   DC I   9     154.815 160.659  84.459  1.00117.76           O  
ATOM    267  N3   DC I   9     154.134 162.796  84.759  1.00117.76           N  
ATOM    268  C4   DC I   9     153.317 163.639  85.385  1.00117.76           C  
ATOM    269  N4   DC I   9     153.411 164.935  85.098  1.00117.76           N  
ATOM    270  C5   DC I   9     152.363 163.195  86.334  1.00117.76           C  
ATOM    271  C6   DC I   9     152.294 161.891  86.579  1.00117.76           C  
ATOM    272  H5'  DC I   9     149.320 159.162  86.695  1.00117.76           H  
ATOM    273 H5''  DC I   9     149.338 158.150  87.905  1.00117.76           H  
ATOM    274  H4'  DC I   9     150.936 157.381  86.501  1.00117.76           H  
ATOM    275  H3'  DC I   9     151.838 158.065  88.853  1.00117.76           H  
ATOM    276  H2'  DC I   9     152.970 159.906  88.327  1.00117.76           H  
ATOM    277 H2''  DC I   9     154.106 158.879  87.913  1.00117.76           H  
ATOM    278  H1'  DC I   9     153.651 159.024  85.758  1.00117.76           H  
ATOM    279  H41  DC I   9     152.895 165.500  85.488  1.00117.76           H  
ATOM    280  H42  DC I   9     153.988 165.206  84.523  1.00117.76           H  
ATOM    281  H5   DC I   9     151.791 163.793  86.755  1.00117.76           H  
ATOM    282  H6   DC I   9     151.676 161.577  87.199  1.00117.76           H  
ATOM    283  P    DC I  10     153.925 156.205  88.826  1.00116.99           P  
ATOM    284  OP1  DC I  10     153.915 154.726  88.778  1.00116.99           O  
ATOM    285  OP2  DC I  10     153.702 156.903  90.111  1.00116.99           O  
ATOM    286  O5'  DC I  10     155.299 156.739  88.212  1.00116.99           O  
ATOM    287  C5'  DC I  10     155.567 156.554  86.829  1.00116.99           C  
ATOM    288  C4'  DC I  10     156.859 157.234  86.415  1.00116.99           C  
ATOM    289  O4'  DC I  10     156.593 158.628  86.106  1.00116.99           O  
ATOM    290  C3'  DC I  10     157.967 157.242  87.471  1.00116.99           C  
ATOM    291  O3'  DC I  10     159.190 156.822  86.907  1.00116.99           O  
ATOM    292  C2'  DC I  10     158.009 158.694  87.923  1.00116.99           C  
ATOM    293  C1'  DC I  10     157.622 159.411  86.649  1.00116.99           C  
ATOM    294  N1   DC I  10     157.118 160.836  86.822  1.00116.99           N  
ATOM    295  C2   DC I  10     157.727 161.893  86.116  1.00116.99           C  
ATOM    296  O2   DC I  10     158.702 161.655  85.396  1.00116.99           O  
ATOM    297  N3   DC I  10     157.258 163.154  86.285  1.00116.99           N  
ATOM    298  C4   DC I  10     156.215 163.376  87.084  1.00116.99           C  
ATOM    299  N4   DC I  10     155.776 164.632  87.207  1.00116.99           N  
ATOM    300  C5   DC I  10     155.571 162.320  87.795  1.00116.99           C  
ATOM    301  C6   DC I  10     156.045 161.080  87.630  1.00116.99           C  
ATOM    302  H5'  DC I  10     154.836 156.928  86.314  1.00116.99           H  
ATOM    303 H5''  DC I  10     155.635 155.606  86.643  1.00116.99           H  
ATOM    304  H4'  DC I  10     157.197 156.799  85.618  1.00116.99           H  
ATOM    305  H3'  DC I  10     157.730 156.669  88.212  1.00116.99           H  
ATOM    306  H2'  DC I  10     157.365 158.852  88.625  1.00116.99           H  
ATOM    307 H2''  DC I  10     158.900 158.940  88.202  1.00116.99           H  
ATOM    308  H1'  DC I  10     158.374 159.398  86.047  1.00116.99           H  
ATOM    309  H41  DC I  10     155.011 164.786  87.568  1.00116.99           H  
ATOM    310  H42  DC I  10     156.256 165.284  86.921  1.00116.99           H  
ATOM    311  H5   DC I  10     154.839 162.487  88.342  1.00116.99           H  
ATOM    312  H6   DC I  10     155.641 160.372  88.077  1.00116.99           H  
ATOM    313  P    DA I  11     160.386 156.328  87.855  1.00120.42           P  
ATOM    314  OP1  DA I  11     160.678 154.919  87.510  1.00120.42           O  
ATOM    315  OP2  DA I  11     160.033 156.687  89.246  1.00120.42           O  
ATOM    316  O5'  DA I  11     161.621 157.239  87.411  1.00120.42           O  
ATOM    317  C5'  DA I  11     162.087 157.194  86.070  1.00120.42           C  
ATOM    318  C4'  DA I  11     163.069 158.314  85.799  1.00120.42           C  
ATOM    319  O4'  DA I  11     162.340 159.559  85.676  1.00120.42           O  
ATOM    320  C3'  DA I  11     164.117 158.519  86.892  1.00120.42           C  
ATOM    321  O3'  DA I  11     165.427 158.538  86.340  1.00120.42           O  
ATOM    322  C2'  DA I  11     163.741 159.847  87.541  1.00120.42           C  
ATOM    323  C1'  DA I  11     162.935 160.558  86.467  1.00120.42           C  
ATOM    324  N9   DA I  11     161.878 161.410  87.002  1.00120.42           N  
ATOM    325  C8   DA I  11     160.809 161.013  87.749  1.00120.42           C  
ATOM    326  N7   DA I  11     160.021 161.991  88.107  1.00120.42           N  
ATOM    327  C5   DA I  11     160.596 163.105  87.533  1.00120.42           C  
ATOM    328  C6   DA I  11     160.235 164.457  87.540  1.00120.42           C  
ATOM    329  N6   DA I  11     159.149 164.915  88.154  1.00120.42           N  
ATOM    330  N1   DA I  11     161.031 165.322  86.886  1.00120.42           N  
ATOM    331  C2   DA I  11     162.120 164.854  86.268  1.00120.42           C  
ATOM    332  N3   DA I  11     162.564 163.602  86.194  1.00120.42           N  
ATOM    333  C4   DA I  11     161.747 162.770  86.855  1.00120.42           C  
ATOM    334  H5'  DA I  11     161.332 157.281  85.470  1.00120.42           H  
ATOM    335 H5''  DA I  11     162.523 156.343  85.913  1.00120.42           H  
ATOM    336  H4'  DA I  11     163.524 158.135  84.963  1.00120.42           H  
ATOM    337  H3'  DA I  11     164.048 157.807  87.545  1.00120.42           H  
ATOM    338  H2'  DA I  11     163.203 159.696  88.331  1.00120.42           H  
ATOM    339 H2''  DA I  11     164.535 160.356  87.760  1.00120.42           H  
ATOM    340  H1'  DA I  11     163.531 161.089  85.919  1.00120.42           H  
ATOM    341  H8   DA I  11     160.663 160.130  87.994  1.00120.42           H  
ATOM    342  H61  DA I  11     158.973 165.757  88.145  1.00120.42           H  
ATOM    343  H62  DA I  11     158.618 164.369  88.551  1.00120.42           H  
ATOM    344  H2   DA I  11     162.637 165.489  85.830  1.00120.42           H  
ATOM    345  P    DC I  12     166.713 158.468  87.304  1.00117.55           P  
ATOM    346  OP1  DC I  12     167.840 157.937  86.507  1.00117.55           O  
ATOM    347  OP2  DC I  12     166.322 157.788  88.560  1.00117.55           O  
ATOM    348  O5'  DC I  12     167.005 159.999  87.653  1.00117.55           O  
ATOM    349  C5'  DC I  12     167.253 160.924  86.606  1.00117.55           C  
ATOM    350  C4'  DC I  12     167.154 162.355  87.097  1.00117.55           C  
ATOM    351  O4'  DC I  12     165.784 162.667  87.415  1.00117.55           O  
ATOM    352  C3'  DC I  12     167.932 162.669  88.378  1.00117.55           C  
ATOM    353  O3'  DC I  12     169.183 163.274  88.079  1.00117.55           O  
ATOM    354  C2'  DC I  12     167.002 163.612  89.157  1.00117.55           C  
ATOM    355  C1'  DC I  12     165.807 163.802  88.231  1.00117.55           C  
ATOM    356  N1   DC I  12     164.500 163.934  88.959  1.00117.55           N  
ATOM    357  C2   DC I  12     163.920 165.200  89.134  1.00117.55           C  
ATOM    358  O2   DC I  12     164.493 166.194  88.678  1.00117.55           O  
ATOM    359  N3   DC I  12     162.753 165.296  89.809  1.00117.55           N  
ATOM    360  C4   DC I  12     162.174 164.202  90.294  1.00117.55           C  
ATOM    361  N4   DC I  12     161.018 164.344  90.947  1.00117.55           N  
ATOM    362  C5   DC I  12     162.748 162.910  90.127  1.00117.55           C  
ATOM    363  C6   DC I  12     163.901 162.825  89.465  1.00117.55           C  
ATOM    364  H5'  DC I  12     166.601 160.786  85.900  1.00117.55           H  
ATOM    365 H5''  DC I  12     168.141 160.771  86.251  1.00117.55           H  
ATOM    366  H4'  DC I  12     167.456 162.949  86.394  1.00117.55           H  
ATOM    367  H3'  DC I  12     168.074 161.857  88.886  1.00117.55           H  
ATOM    368  H2'  DC I  12     166.724 163.200  89.989  1.00117.55           H  
ATOM    369 H2''  DC I  12     167.436 164.458  89.324  1.00117.55           H  
ATOM    370  H1'  DC I  12     165.955 164.581  87.678  1.00117.55           H  
ATOM    371  H41  DC I  12     160.578 163.650  91.201  1.00117.55           H  
ATOM    372  H42  DC I  12     160.713 165.131  91.116  1.00117.55           H  
ATOM    373  H5   DC I  12     162.333 162.152  90.467  1.00117.55           H  
ATOM    374  H6   DC I  12     164.297 161.995  89.342  1.00117.55           H  
ATOM    375  P    DC I  13     170.196 163.665  89.264  1.00108.66           P  
ATOM    376  OP1  DC I  13     171.562 163.698  88.701  1.00108.66           O  
ATOM    377  OP2  DC I  13     169.889 162.793  90.418  1.00108.66           O  
ATOM    378  O5'  DC I  13     169.769 165.152  89.657  1.00108.66           O  
ATOM    379  C5'  DC I  13     169.557 166.112  88.638  1.00108.66           C  
ATOM    380  C4'  DC I  13     169.012 167.404  89.209  1.00108.66           C  
ATOM    381  O4'  DC I  13     167.622 167.220  89.593  1.00108.66           O  
ATOM    382  C3'  DC I  13     169.740 167.897  90.457  1.00108.66           C  
ATOM    383  O3'  DC I  13     170.124 169.258  90.309  1.00108.66           O  
ATOM    384  C2'  DC I  13     168.722 167.695  91.570  1.00108.66           C  
ATOM    385  C1'  DC I  13     167.405 167.837  90.836  1.00108.66           C  
ATOM    386  N1   DC I  13     166.204 167.172  91.519  1.00108.66           N  
ATOM    387  C2   DC I  13     165.134 167.952  92.001  1.00108.66           C  
ATOM    388  O2   DC I  13     165.179 169.183  91.886  1.00108.66           O  
ATOM    389  N3   DC I  13     164.078 167.328  92.588  1.00108.66           N  
ATOM    390  C4   DC I  13     164.065 166.000  92.696  1.00108.66           C  
ATOM    391  N4   DC I  13     163.013 165.427  93.276  1.00108.66           N  
ATOM    392  C5   DC I  13     165.129 165.197  92.215  1.00108.66           C  
ATOM    393  C6   DC I  13     166.164 165.813  91.635  1.00108.66           C  
ATOM    394  H5'  DC I  13     168.924 165.757  87.996  1.00108.66           H  
ATOM    395 H5''  DC I  13     170.396 166.290  88.192  1.00108.66           H  
ATOM    396  H4'  DC I  13     169.060 168.091  88.530  1.00108.66           H  
ATOM    397  H3'  DC I  13     170.518 167.346  90.618  1.00108.66           H  
ATOM    398  H2'  DC I  13     168.811 166.811  91.948  1.00108.66           H  
ATOM    399 H2''  DC I  13     168.815 168.377  92.250  1.00108.66           H  
ATOM    400  H1'  DC I  13     167.224 168.776  90.692  1.00108.66           H  
ATOM    401  H41  DC I  13     163.064 164.613  93.545  1.00108.66           H  
ATOM    402  H42  DC I  13     162.285 165.869  93.377  1.00108.66           H  
ATOM    403  H5   DC I  13     165.103 164.273  92.294  1.00108.66           H  
ATOM    404  H6   DC I  13     166.872 165.307  91.311  1.00108.66           H  
ATOM    405  P    DT I  14     171.340 169.866  91.167  1.00101.98           P  
ATOM    406  OP1  DT I  14     172.081 170.783  90.275  1.00101.98           O  
ATOM    407  OP2  DT I  14     172.059 168.773  91.855  1.00101.98           O  
ATOM    408  O5'  DT I  14     170.612 170.737  92.288  1.00101.98           O  
ATOM    409  C5'  DT I  14     169.833 171.857  91.909  1.00101.98           C  
ATOM    410  C4'  DT I  14     168.990 172.349  93.067  1.00101.98           C  
ATOM    411  O4'  DT I  14     167.887 171.426  93.291  1.00101.98           O  
ATOM    412  C3'  DT I  14     169.732 172.457  94.408  1.00101.98           C  
ATOM    413  O3'  DT I  14     169.593 173.762  94.945  1.00101.98           O  
ATOM    414  C2'  DT I  14     169.064 171.395  95.276  1.00101.98           C  
ATOM    415  C1'  DT I  14     167.673 171.329  94.672  1.00101.98           C  
ATOM    416  N1   DT I  14     166.879 170.065  94.984  1.00101.98           N  
ATOM    417  C2   DT I  14     165.605 170.179  95.496  1.00101.98           C  
ATOM    418  O2   DT I  14     165.062 171.244  95.723  1.00101.98           O  
ATOM    419  N3   DT I  14     164.979 168.990  95.736  1.00101.98           N  
ATOM    420  C4   DT I  14     165.477 167.725  95.522  1.00101.98           C  
ATOM    421  O4   DT I  14     164.835 166.712  95.770  1.00101.98           O  
ATOM    422  C5   DT I  14     166.800 167.669  94.990  1.00101.98           C  
ATOM    423  C7   DT I  14     167.429 166.343  94.730  1.00101.98           C  
ATOM    424  C6   DT I  14     167.435 168.822  94.743  1.00101.98           C  
ATOM    425  H5'  DT I  14     169.251 171.605  91.175  1.00101.98           H  
ATOM    426 H5''  DT I  14     170.421 172.570  91.619  1.00101.98           H  
ATOM    427  H4'  DT I  14     168.627 173.219  92.842  1.00101.98           H  
ATOM    428  H3'  DT I  14     170.670 172.245  94.289  1.00101.98           H  
ATOM    429  H2'  DT I  14     169.529 170.551  95.192  1.00101.98           H  
ATOM    430 H2''  DT I  14     169.024 171.679  96.197  1.00101.98           H  
ATOM    431  H1'  DT I  14     167.171 172.102  94.963  1.00101.98           H  
ATOM    432  H3   DT I  14     164.183 169.038  96.056  1.00101.98           H  
ATOM    433  H71  DT I  14     168.092 166.431  94.040  1.00101.98           H  
ATOM    434  H72  DT I  14     167.847 166.021  95.541  1.00101.98           H  
ATOM    435  H73  DT I  14     166.748 165.715  94.448  1.00101.98           H  
ATOM    436  H6   DT I  14     168.295 168.784  94.401  1.00101.98           H  
ATOM    437  P    DG I  15     170.525 174.251  96.159  1.00 94.25           P  
ATOM    438  OP1  DG I  15     171.657 174.975  95.543  1.00 94.25           O  
ATOM    439  OP2  DG I  15     170.819 173.096  97.035  1.00 94.25           O  
ATOM    440  O5'  DG I  15     169.632 175.322  96.968  1.00 94.25           O  
ATOM    441  C5'  DG I  15     168.180 175.340  96.890  1.00 94.25           C  
ATOM    442  C4'  DG I  15     167.545 175.252  98.267  1.00 94.25           C  
ATOM    443  O4'  DG I  15     167.109 173.878  98.512  1.00 94.25           O  
ATOM    444  C3'  DG I  15     168.465 175.583  99.432  1.00 94.25           C  
ATOM    445  O3'  DG I  15     167.721 176.082 100.529  1.00 94.25           O  
ATOM    446  C2'  DG I  15     169.071 174.222  99.727  1.00 94.25           C  
ATOM    447  C1'  DG I  15     167.825 173.346  99.616  1.00 94.25           C  
ATOM    448  N9   DG I  15     168.049 171.918  99.394  1.00 94.25           N  
ATOM    449  C8   DG I  15     169.199 171.296  98.990  1.00 94.25           C  
ATOM    450  N7   DG I  15     169.076 170.005  98.873  1.00 94.25           N  
ATOM    451  C5   DG I  15     167.760 169.758  99.225  1.00 94.25           C  
ATOM    452  C6   DG I  15     167.042 168.541  99.285  1.00 94.25           C  
ATOM    453  O6   DG I  15     167.444 167.397  99.038  1.00 94.25           O  
ATOM    454  N1   DG I  15     165.726 168.738  99.694  1.00 94.25           N  
ATOM    455  C2   DG I  15     165.178 169.958  99.996  1.00 94.25           C  
ATOM    456  N2   DG I  15     163.891 169.961 100.371  1.00 94.25           N  
ATOM    457  N3   DG I  15     165.842 171.102  99.940  1.00 94.25           N  
ATOM    458  C4   DG I  15     167.117 170.926  99.540  1.00 94.25           C  
ATOM    459  H5'  DG I  15     167.873 174.594  96.361  1.00 94.25           H  
ATOM    460 H5''  DG I  15     167.896 176.166  96.467  1.00 94.25           H  
ATOM    461  H4'  DG I  15     166.774 175.839  98.297  1.00 94.25           H  
ATOM    462  H3'  DG I  15     169.147 176.217  99.166  1.00 94.25           H  
ATOM    463  H2'  DG I  15     169.731 173.988  99.061  1.00 94.25           H  
ATOM    464 H2''  DG I  15     169.446 174.196 100.613  1.00 94.25           H  
ATOM    465  H1'  DG I  15     167.291 173.452 100.412  1.00 94.25           H  
ATOM    466  H8   DG I  15     169.987 171.752  98.811  1.00 94.25           H  
ATOM    467  H1   DG I  15     165.219 168.043  99.761  1.00 94.25           H  
ATOM    468  H21  DG I  15     163.499 170.703 100.560  1.00 94.25           H  
ATOM    469  H22  DG I  15     163.457 169.218 100.424  1.00 94.25           H  
ATOM    470  P    DC I  16     167.379 177.645 100.643  1.00 88.18           P  
ATOM    471  OP1  DC I  16     166.726 178.060  99.383  1.00 88.18           O  
ATOM    472  OP2  DC I  16     168.604 178.338 101.099  1.00 88.18           O  
ATOM    473  O5'  DC I  16     166.308 177.705 101.832  1.00 88.18           O  
ATOM    474  C5'  DC I  16     165.013 177.127 101.662  1.00 88.18           C  
ATOM    475  C4'  DC I  16     164.614 176.285 102.866  1.00 88.18           C  
ATOM    476  O4'  DC I  16     165.010 174.896 102.643  1.00 88.18           O  
ATOM    477  C3'  DC I  16     165.266 176.688 104.188  1.00 88.18           C  
ATOM    478  O3'  DC I  16     164.377 176.519 105.248  1.00 88.18           O  
ATOM    479  C2'  DC I  16     166.429 175.725 104.273  1.00 88.18           C  
ATOM    480  C1'  DC I  16     165.765 174.458 103.750  1.00 88.18           C  
ATOM    481  N1   DC I  16     166.690 173.320 103.320  1.00 88.18           N  
ATOM    482  C2   DC I  16     166.167 172.027 103.198  1.00 88.18           C  
ATOM    483  O2   DC I  16     164.970 171.836 103.434  1.00 88.18           O  
ATOM    484  N3   DC I  16     166.989 171.021 102.817  1.00 88.18           N  
ATOM    485  C4   DC I  16     168.273 171.262 102.582  1.00 88.18           C  
ATOM    486  N4   DC I  16     169.047 170.249 102.196  1.00 88.18           N  
ATOM    487  C5   DC I  16     168.822 172.556 102.703  1.00 88.18           C  
ATOM    488  C6   DC I  16     168.013 173.544 103.073  1.00 88.18           C  
ATOM    489  H5'  DC I  16     165.019 176.566 100.871  1.00 88.18           H  
ATOM    490 H5''  DC I  16     164.363 177.836 101.544  1.00 88.18           H  
ATOM    491  H4'  DC I  16     163.651 176.323 102.972  1.00 88.18           H  
ATOM    492  H3'  DC I  16     165.579 177.602 104.152  1.00 88.18           H  
ATOM    493  H2'  DC I  16     167.146 176.024 103.700  1.00 88.18           H  
ATOM    494 H2''  DC I  16     166.726 175.614 105.187  1.00 88.18           H  
ATOM    495  H1'  DC I  16     165.158 174.126 104.427  1.00 88.18           H  
ATOM    496  H41  DC I  16     169.899 170.347 102.164  1.00 88.18           H  
ATOM    497  H42  DC I  16     168.691 169.504 101.958  1.00 88.18           H  
ATOM    498  H5   DC I  16     169.718 172.714 102.520  1.00 88.18           H  
ATOM    499  H6   DC I  16     168.353 174.400 103.151  1.00 88.18           H  
ATOM    500  P    DA I  17     163.346 177.677 105.646  1.00 84.55           P  
ATOM    501  OP1  DA I  17     163.010 178.409 104.406  1.00 84.55           O  
ATOM    502  OP2  DA I  17     163.902 178.402 106.810  1.00 84.55           O  
ATOM    503  O5'  DA I  17     162.066 176.861 106.132  1.00 84.55           O  
ATOM    504  C5'  DA I  17     161.485 175.910 105.265  1.00 84.55           C  
ATOM    505  C4'  DA I  17     160.750 174.823 106.031  1.00 84.55           C  
ATOM    506  O4'  DA I  17     161.620 173.680 106.208  1.00 84.55           O  
ATOM    507  C3'  DA I  17     160.296 175.186 107.431  1.00 84.55           C  
ATOM    508  O3'  DA I  17     159.139 174.415 107.773  1.00 84.55           O  
ATOM    509  C2'  DA I  17     161.529 174.854 108.272  1.00 84.55           C  
ATOM    510  C1'  DA I  17     162.143 173.652 107.529  1.00 84.55           C  
ATOM    511  N9   DA I  17     163.611 173.621 107.410  1.00 84.55           N  
ATOM    512  C8   DA I  17     164.488 174.665 107.495  1.00 84.55           C  
ATOM    513  N7   DA I  17     165.736 174.331 107.301  1.00 84.55           N  
ATOM    514  C5   DA I  17     165.681 172.977 107.060  1.00 84.55           C  
ATOM    515  C6   DA I  17     166.676 172.033 106.783  1.00 84.55           C  
ATOM    516  N6   DA I  17     167.968 172.340 106.705  1.00 84.55           N  
ATOM    517  N1   DA I  17     166.294 170.759 106.590  1.00 84.55           N  
ATOM    518  C2   DA I  17     164.994 170.458 106.667  1.00 84.55           C  
ATOM    519  N3   DA I  17     163.965 171.261 106.925  1.00 84.55           N  
ATOM    520  C4   DA I  17     164.381 172.521 107.111  1.00 84.55           C  
ATOM    521  H5'  DA I  17     162.184 175.502 104.732  1.00 84.55           H  
ATOM    522 H5''  DA I  17     160.862 176.359 104.677  1.00 84.55           H  
ATOM    523  H4'  DA I  17     159.977 174.549 105.515  1.00 84.55           H  
ATOM    524  H3'  DA I  17     160.098 176.132 107.485  1.00 84.55           H  
ATOM    525  H2'  DA I  17     162.125 175.611 108.291  1.00 84.55           H  
ATOM    526 H2''  DA I  17     161.277 174.602 109.167  1.00 84.55           H  
ATOM    527  H1'  DA I  17     161.850 172.839 107.961  1.00 84.55           H  
ATOM    528  H8   DA I  17     164.219 175.537 107.676  1.00 84.55           H  
ATOM    529  H61  DA I  17     168.541 171.735 106.496  1.00 84.55           H  
ATOM    530  H62  DA I  17     168.229 173.141 106.868  1.00 84.55           H  
ATOM    531  H2   DA I  17     164.780 169.566 106.530  1.00 84.55           H  
ATOM    532  P    DG I  18     158.476 174.472 109.236  1.00 79.13           P  
ATOM    533  OP1  DG I  18     157.014 174.570 109.046  1.00 79.13           O  
ATOM    534  OP2  DG I  18     159.171 175.487 110.055  1.00 79.13           O  
ATOM    535  O5'  DG I  18     158.798 173.025 109.824  1.00 79.13           O  
ATOM    536  C5'  DG I  18     158.374 171.885 109.102  1.00 79.13           C  
ATOM    537  C4'  DG I  18     159.259 170.689 109.380  1.00 79.13           C  
ATOM    538  O4'  DG I  18     160.654 171.054 109.177  1.00 79.13           O  
ATOM    539  C3'  DG I  18     159.183 170.138 110.802  1.00 79.13           C  
ATOM    540  O3'  DG I  18     159.178 168.726 110.764  1.00 79.13           O  
ATOM    541  C2'  DG I  18     160.441 170.703 111.443  1.00 79.13           C  
ATOM    542  C1'  DG I  18     161.403 170.612 110.286  1.00 79.13           C  
ATOM    543  N9   DG I  18     162.618 171.422 110.407  1.00 79.13           N  
ATOM    544  C8   DG I  18     162.706 172.761 110.685  1.00 79.13           C  
ATOM    545  N7   DG I  18     163.931 173.207 110.707  1.00 79.13           N  
ATOM    546  C5   DG I  18     164.703 172.090 110.429  1.00 79.13           C  
ATOM    547  C6   DG I  18     166.104 171.952 110.320  1.00 79.13           C  
ATOM    548  O6   DG I  18     166.975 172.819 110.456  1.00 79.13           O  
ATOM    549  N1   DG I  18     166.469 170.648 110.024  1.00 79.13           N  
ATOM    550  C2   DG I  18     165.590 169.611 109.844  1.00 79.13           C  
ATOM    551  N2   DG I  18     166.116 168.415 109.574  1.00 79.13           N  
ATOM    552  N3   DG I  18     164.282 169.728 109.946  1.00 79.13           N  
ATOM    553  C4   DG I  18     163.910 170.988 110.237  1.00 79.13           C  
ATOM    554  H5'  DG I  18     158.401 172.083 108.154  1.00 79.13           H  
ATOM    555 H5''  DG I  18     157.465 171.672 109.354  1.00 79.13           H  
ATOM    556  H4'  DG I  18     159.028 169.981 108.762  1.00 79.13           H  
ATOM    557  H3'  DG I  18     158.395 170.469 111.252  1.00 79.13           H  
ATOM    558  H2'  DG I  18     160.309 171.623 111.715  1.00 79.13           H  
ATOM    559 H2''  DG I  18     160.733 170.156 112.181  1.00 79.13           H  
ATOM    560  H1'  DG I  18     161.647 169.685 110.154  1.00 79.13           H  
ATOM    561  H8   DG I  18     161.964 173.300 110.835  1.00 79.13           H  
ATOM    562  H1   DG I  18     167.304 170.480 109.942  1.00 79.13           H  
ATOM    563  H21  DG I  18     165.608 167.721 109.544  1.00 79.13           H  
ATOM    564  H22  DG I  18     166.960 168.336 109.445  1.00 79.13           H  
ATOM    565  P    DA I  19     158.884 167.862 112.080  1.00 74.02           P  
ATOM    566  OP1  DA I  19     157.579 167.200 111.882  1.00 74.02           O  
ATOM    567  OP2  DA I  19     159.101 168.703 113.273  1.00 74.02           O  
ATOM    568  O5'  DA I  19     160.015 166.742 112.033  1.00 74.02           O  
ATOM    569  C5'  DA I  19     160.158 165.961 110.869  1.00 74.02           C  
ATOM    570  C4'  DA I  19     161.389 165.082 110.940  1.00 74.02           C  
ATOM    571  O4'  DA I  19     162.572 165.912 110.870  1.00 74.02           O  
ATOM    572  C3'  DA I  19     161.526 164.275 112.212  1.00 74.02           C  
ATOM    573  O3'  DA I  19     162.167 163.042 111.957  1.00 74.02           O  
ATOM    574  C2'  DA I  19     162.342 165.191 113.097  1.00 74.02           C  
ATOM    575  C1'  DA I  19     163.263 165.878 112.101  1.00 74.02           C  
ATOM    576  N9   DA I  19     163.628 167.248 112.464  1.00 74.02           N  
ATOM    577  C8   DA I  19     162.784 168.295 112.696  1.00 74.02           C  
ATOM    578  N7   DA I  19     163.398 169.414 112.998  1.00 74.02           N  
ATOM    579  C5   DA I  19     164.735 169.075 112.959  1.00 74.02           C  
ATOM    580  C6   DA I  19     165.905 169.820 113.164  1.00 74.02           C  
ATOM    581  N6   DA I  19     165.904 171.113 113.481  1.00 74.02           N  
ATOM    582  N1   DA I  19     167.082 169.182 113.029  1.00 74.02           N  
ATOM    583  C2   DA I  19     167.075 167.891 112.698  1.00 74.02           C  
ATOM    584  N3   DA I  19     166.044 167.090 112.478  1.00 74.02           N  
ATOM    585  C4   DA I  19     164.894 167.753 112.608  1.00 74.02           C  
ATOM    586  H5'  DA I  19     160.231 166.547 110.104  1.00 74.02           H  
ATOM    587 H5''  DA I  19     159.377 165.404 110.767  1.00 74.02           H  
ATOM    588  H4'  DA I  19     161.391 164.478 110.193  1.00 74.02           H  
ATOM    589  H3'  DA I  19     160.658 164.125 112.604  1.00 74.02           H  
ATOM    590  H2'  DA I  19     161.768 165.832 113.536  1.00 74.02           H  
ATOM    591 H2''  DA I  19     162.853 164.687 113.743  1.00 74.02           H  
ATOM    592  H1'  DA I  19     164.067 165.349 111.998  1.00 74.02           H  
ATOM    593  H8   DA I  19     161.856 168.217 112.659  1.00 74.02           H  
ATOM    594  H61  DA I  19     166.632 171.495 113.729  1.00 74.02           H  
ATOM    595  H62  DA I  19     165.176 171.566 113.426  1.00 74.02           H  
ATOM    596  H2   DA I  19     167.910 167.494 112.623  1.00 74.02           H  
ATOM    597  P    DT I  20     162.389 161.996 113.151  1.00 77.14           P  
ATOM    598  OP1  DT I  20     162.327 160.632 112.600  1.00 77.14           O  
ATOM    599  OP2  DT I  20     161.518 162.398 114.273  1.00 77.14           O  
ATOM    600  O5'  DT I  20     163.888 162.265 113.595  1.00 77.14           O  
ATOM    601  C5'  DT I  20     164.916 162.139 112.644  1.00 77.14           C  
ATOM    602  C4'  DT I  20     166.277 162.360 113.279  1.00 77.14           C  
ATOM    603  O4'  DT I  20     166.480 163.782 113.510  1.00 77.14           O  
ATOM    604  C3'  DT I  20     166.469 161.672 114.631  1.00 77.14           C  
ATOM    605  O3'  DT I  20     167.661 160.919 114.634  1.00 77.14           O  
ATOM    606  C2'  DT I  20     166.494 162.828 115.636  1.00 77.14           C  
ATOM    607  C1'  DT I  20     167.010 163.986 114.801  1.00 77.14           C  
ATOM    608  N1   DT I  20     166.599 165.380 115.274  1.00 77.14           N  
ATOM    609  C2   DT I  20     167.569 166.320 115.551  1.00 77.14           C  
ATOM    610  O2   DT I  20     168.762 166.104 115.467  1.00 77.14           O  
ATOM    611  N3   DT I  20     167.086 167.539 115.937  1.00 77.14           N  
ATOM    612  C4   DT I  20     165.776 167.913 116.068  1.00 77.14           C  
ATOM    613  O4   DT I  20     165.445 169.035 116.428  1.00 77.14           O  
ATOM    614  C5   DT I  20     164.816 166.898 115.766  1.00 77.14           C  
ATOM    615  C7   DT I  20     163.361 167.206 115.881  1.00 77.14           C  
ATOM    616  C6   DT I  20     165.261 165.700 115.370  1.00 77.14           C  
ATOM    617  H5'  DT I  20     164.779 162.793 111.942  1.00 77.14           H  
ATOM    618 H5''  DT I  20     164.884 161.250 112.260  1.00 77.14           H  
ATOM    619  H4'  DT I  20     166.961 162.041 112.670  1.00 77.14           H  
ATOM    620  H3'  DT I  20     165.716 161.092 114.815  1.00 77.14           H  
ATOM    621  H2'  DT I  20     165.602 163.007 115.964  1.00 77.14           H  
ATOM    622 H2''  DT I  20     167.101 162.636 116.366  1.00 77.14           H  
ATOM    623  H1'  DT I  20     167.975 163.931 114.756  1.00 77.14           H  
ATOM    624  H3   DT I  20     167.670 168.137 116.120  1.00 77.14           H  
ATOM    625  H71  DT I  20     162.850 166.509 115.456  1.00 77.14           H  
ATOM    626  H72  DT I  20     163.117 167.261 116.817  1.00 77.14           H  
ATOM    627  H73  DT I  20     163.178 168.053 115.451  1.00 77.14           H  
ATOM    628  H6   DT I  20     164.638 165.043 115.177  1.00 77.14           H  
ATOM    629  P    DT I  21     168.003 159.957 115.869  1.00 85.23           P  
ATOM    630  OP1  DT I  21     168.577 158.717 115.308  1.00 85.23           O  
ATOM    631  OP2  DT I  21     166.813 159.890 116.742  1.00 85.23           O  
ATOM    632  O5'  DT I  21     169.146 160.752 116.642  1.00 85.23           O  
ATOM    633  C5'  DT I  21     170.292 161.159 115.931  1.00 85.23           C  
ATOM    634  C4'  DT I  21     171.092 162.194 116.702  1.00 85.23           C  
ATOM    635  O4'  DT I  21     170.311 163.414 116.833  1.00 85.23           O  
ATOM    636  C3'  DT I  21     171.491 161.791 118.131  1.00 85.23           C  
ATOM    637  O3'  DT I  21     172.911 161.922 118.302  1.00 85.23           O  
ATOM    638  C2'  DT I  21     170.693 162.759 119.013  1.00 85.23           C  
ATOM    639  C1'  DT I  21     170.552 163.963 118.103  1.00 85.23           C  
ATOM    640  N1   DT I  21     169.433 164.905 118.451  1.00 85.23           N  
ATOM    641  C2   DT I  21     169.720 166.209 118.801  1.00 85.23           C  
ATOM    642  O2   DT I  21     170.850 166.653 118.885  1.00 85.23           O  
ATOM    643  N3   DT I  21     168.625 166.974 119.086  1.00 85.23           N  
ATOM    644  C4   DT I  21     167.304 166.589 119.036  1.00 85.23           C  
ATOM    645  O4   DT I  21     166.386 167.355 119.304  1.00 85.23           O  
ATOM    646  C5   DT I  21     167.074 165.225 118.652  1.00 85.23           C  
ATOM    647  C7   DT I  21     165.675 164.703 118.571  1.00 85.23           C  
ATOM    648  C6   DT I  21     168.135 164.459 118.373  1.00 85.23           C  
ATOM    649  H5'  DT I  21     170.018 161.538 115.083  1.00 85.23           H  
ATOM    650 H5''  DT I  21     170.850 160.385 115.765  1.00 85.23           H  
ATOM    651  H4'  DT I  21     171.898 162.395 116.202  1.00 85.23           H  
ATOM    652  H3'  DT I  21     171.218 160.877 118.307  1.00 85.23           H  
ATOM    653  H2'  DT I  21     169.824 162.387 119.233  1.00 85.23           H  
ATOM    654 H2''  DT I  21     171.185 162.985 119.813  1.00 85.23           H  
ATOM    655  H1'  DT I  21     171.390 164.447 118.084  1.00 85.23           H  
ATOM    656  H3   DT I  21     168.776 167.786 119.315  1.00 85.23           H  
ATOM    657  H71  DT I  21     165.665 163.887 118.057  1.00 85.23           H  
ATOM    658  H72  DT I  21     165.346 164.524 119.465  1.00 85.23           H  
ATOM    659  H73  DT I  21     165.109 165.362 118.146  1.00 85.23           H  
ATOM    660  H6   DT I  21     167.989 163.578 118.124  1.00 85.23           H  
ATOM    661  P    DC I  22     173.625 161.507 119.680  1.00 89.47           P  
ATOM    662  OP1  DC I  22     174.892 160.836 119.328  1.00 89.47           O  
ATOM    663  OP2  DC I  22     172.631 160.812 120.525  1.00 89.47           O  
ATOM    664  O5'  DC I  22     173.970 162.910 120.365  1.00 89.47           O  
ATOM    665  C5'  DC I  22     174.587 163.930 119.591  1.00 89.47           C  
ATOM    666  C4'  DC I  22     174.989 165.123 120.449  1.00 89.47           C  
ATOM    667  O4'  DC I  22     173.847 166.007 120.642  1.00 89.47           O  
ATOM    668  C3'  DC I  22     175.478 164.779 121.848  1.00 89.47           C  
ATOM    669  O3'  DC I  22     176.500 165.689 122.247  1.00 89.47           O  
ATOM    670  C2'  DC I  22     174.212 164.905 122.687  1.00 89.47           C  
ATOM    671  C1'  DC I  22     173.505 166.083 122.018  1.00 89.47           C  
ATOM    672  N1   DC I  22     171.981 166.101 122.111  1.00 89.47           N  
ATOM    673  C2   DC I  22     171.301 167.288 122.460  1.00 89.47           C  
ATOM    674  O2   DC I  22     171.948 168.305 122.742  1.00 89.47           O  
ATOM    675  N3   DC I  22     169.942 167.277 122.492  1.00 89.47           N  
ATOM    676  C4   DC I  22     169.275 166.165 122.180  1.00 89.47           C  
ATOM    677  N4   DC I  22     167.942 166.196 122.224  1.00 89.47           N  
ATOM    678  C5   DC I  22     169.943 164.966 121.817  1.00 89.47           C  
ATOM    679  C6   DC I  22     171.275 164.986 121.772  1.00 89.47           C  
ATOM    680  H5'  DC I  22     173.967 164.225 118.907  1.00 89.47           H  
ATOM    681 H5''  DC I  22     175.377 163.565 119.163  1.00 89.47           H  
ATOM    682  H4'  DC I  22     175.687 165.615 119.989  1.00 89.47           H  
ATOM    683  H3'  DC I  22     175.807 163.868 121.871  1.00 89.47           H  
ATOM    684  H2'  DC I  22     173.689 164.094 122.629  1.00 89.47           H  
ATOM    685 H2''  DC I  22     174.429 165.111 123.608  1.00 89.47           H  
ATOM    686  H1'  DC I  22     173.860 166.904 122.383  1.00 89.47           H  
ATOM    687  H41  DC I  22     167.486 165.559 121.870  1.00 89.47           H  
ATOM    688  H42  DC I  22     167.539 166.854 122.603  1.00 89.47           H  
ATOM    689  H5   DC I  22     169.466 164.200 121.593  1.00 89.47           H  
ATOM    690  H6   DC I  22     171.734 164.212 121.540  1.00 89.47           H  
ATOM    691  P    DT I  23     177.400 165.399 123.545  1.00 89.27           P  
ATOM    692  OP1  DT I  23     178.801 165.725 123.196  1.00 89.27           O  
ATOM    693  OP2  DT I  23     177.063 164.050 124.051  1.00 89.27           O  
ATOM    694  O5'  DT I  23     176.876 166.467 124.613  1.00 89.27           O  
ATOM    695  C5'  DT I  23     176.871 167.857 124.295  1.00 89.27           C  
ATOM    696  C4'  DT I  23     176.137 168.645 125.361  1.00 89.27           C  
ATOM    697  O4'  DT I  23     174.696 168.516 125.157  1.00 89.27           O  
ATOM    698  C3'  DT I  23     176.400 168.170 126.790  1.00 89.27           C  
ATOM    699  O3'  DT I  23     176.545 169.265 127.672  1.00 89.27           O  
ATOM    700  C2'  DT I  23     175.167 167.340 127.095  1.00 89.27           C  
ATOM    701  C1'  DT I  23     174.096 168.145 126.377  1.00 89.27           C  
ATOM    702  N1   DT I  23     172.768 167.423 126.104  1.00 89.27           N  
ATOM    703  C2   DT I  23     171.584 168.114 126.268  1.00 89.27           C  
ATOM    704  O2   DT I  23     171.528 169.273 126.629  1.00 89.27           O  
ATOM    705  N3   DT I  23     170.454 167.394 125.997  1.00 89.27           N  
ATOM    706  C4   DT I  23     170.383 166.083 125.579  1.00 89.27           C  
ATOM    707  O4   DT I  23     169.316 165.521 125.361  1.00 89.27           O  
ATOM    708  C5   DT I  23     171.646 165.415 125.422  1.00 89.27           C  
ATOM    709  C7   DT I  23     171.685 163.983 124.978  1.00 89.27           C  
ATOM    710  C6   DT I  23     172.765 166.106 125.683  1.00 89.27           C  
ATOM    711  H5'  DT I  23     176.431 167.989 123.441  1.00 89.27           H  
ATOM    712 H5''  DT I  23     177.784 168.176 124.236  1.00 89.27           H  
ATOM    713  H4'  DT I  23     176.384 169.578 125.290  1.00 89.27           H  
ATOM    714  H3'  DT I  23     177.192 167.615 126.816  1.00 89.27           H  
ATOM    715  H2'  DT I  23     175.258 166.452 126.722  1.00 89.27           H  
ATOM    716 H2''  DT I  23     175.001 167.306 128.044  1.00 89.27           H  
ATOM    717  H1'  DT I  23     173.921 168.945 126.892  1.00 89.27           H  
ATOM    718  H3   DT I  23     169.707 167.805 126.094  1.00 89.27           H  
ATOM    719  H71  DT I  23     172.549 163.787 124.591  1.00 89.27           H  
ATOM    720  H72  DT I  23     171.537 163.405 125.742  1.00 89.27           H  
ATOM    721  H73  DT I  23     170.992 163.829 124.319  1.00 89.27           H  
ATOM    722  H6   DT I  23     173.580 165.675 125.583  1.00 89.27           H  
ATOM    723  P    DA I  24     177.054 169.018 129.173  1.00 85.81           P  
ATOM    724  OP1  DA I  24     178.274 169.829 129.361  1.00 85.81           O  
ATOM    725  OP2  DA I  24     177.096 167.561 129.413  1.00 85.81           O  
ATOM    726  O5'  DA I  24     175.895 169.639 130.075  1.00 85.81           O  
ATOM    727  C5'  DA I  24     175.777 171.040 130.172  1.00 85.81           C  
ATOM    728  C4'  DA I  24     174.379 171.452 130.593  1.00 85.81           C  
ATOM    729  O4'  DA I  24     173.407 170.668 129.854  1.00 85.81           O  
ATOM    730  C3'  DA I  24     174.063 171.240 132.070  1.00 85.81           C  
ATOM    731  O3'  DA I  24     173.345 172.353 132.595  1.00 85.81           O  
ATOM    732  C2'  DA I  24     173.234 169.972 132.075  1.00 85.81           C  
ATOM    733  C1'  DA I  24     172.511 170.051 130.747  1.00 85.81           C  
ATOM    734  N9   DA I  24     172.125 168.756 130.202  1.00 85.81           N  
ATOM    735  C8   DA I  24     172.946 167.716 129.880  1.00 85.81           C  
ATOM    736  N7   DA I  24     172.318 166.673 129.400  1.00 85.81           N  
ATOM    737  C5   DA I  24     170.995 167.058 129.409  1.00 85.81           C  
ATOM    738  C6   DA I  24     169.821 166.402 129.021  1.00 85.81           C  
ATOM    739  N6   DA I  24     169.806 165.163 128.530  1.00 85.81           N  
ATOM    740  N1   DA I  24     168.657 167.071 129.158  1.00 85.81           N  
ATOM    741  C2   DA I  24     168.684 168.314 129.650  1.00 85.81           C  
ATOM    742  N3   DA I  24     169.726 169.031 130.047  1.00 85.81           N  
ATOM    743  C4   DA I  24     170.860 168.340 129.898  1.00 85.81           C  
ATOM    744  H5'  DA I  24     175.978 171.432 129.310  1.00 85.81           H  
ATOM    745 H5''  DA I  24     176.414 171.366 130.824  1.00 85.81           H  
ATOM    746  H4'  DA I  24     174.251 172.387 130.381  1.00 85.81           H  
ATOM    747  H3'  DA I  24     174.881 171.102 132.562  1.00 85.81           H  
ATOM    748  H2'  DA I  24     173.806 169.191 132.112  1.00 85.81           H  
ATOM    749 H2''  DA I  24     172.604 169.977 132.810  1.00 85.81           H  
ATOM    750  H1'  DA I  24     171.723 170.607 130.845  1.00 85.81           H  
ATOM    751  H8   DA I  24     173.869 167.746 129.991  1.00 85.81           H  
ATOM    752  H61  DA I  24     169.058 164.768 128.380  1.00 85.81           H  
ATOM    753  H62  DA I  24     170.546 164.763 128.354  1.00 85.81           H  
ATOM    754  H2   DA I  24     167.859 168.734 129.725  1.00 85.81           H  
ATOM    755  P    DC I  25     173.701 172.971 134.036  1.00 86.46           P  
ATOM    756  OP1  DC I  25     173.826 174.428 133.831  1.00 86.46           O  
ATOM    757  OP2  DC I  25     174.804 172.227 134.681  1.00 86.46           O  
ATOM    758  O5'  DC I  25     172.388 172.702 134.899  1.00 86.46           O  
ATOM    759  C5'  DC I  25     171.267 173.545 134.741  1.00 86.46           C  
ATOM    760  C4'  DC I  25     169.994 172.845 135.164  1.00 86.46           C  
ATOM    761  O4'  DC I  25     169.895 171.578 134.481  1.00 86.46           O  
ATOM    762  C3'  DC I  25     169.896 172.539 136.656  1.00 86.46           C  
ATOM    763  O3'  DC I  25     168.851 173.323 137.224  1.00 86.46           O  
ATOM    764  C2'  DC I  25     169.639 171.015 136.730  1.00 86.46           C  
ATOM    765  C1'  DC I  25     169.235 170.654 135.305  1.00 86.46           C  
ATOM    766  N1   DC I  25     169.621 169.256 134.826  1.00 86.46           N  
ATOM    767  C2   DC I  25     168.653 168.409 134.250  1.00 86.46           C  
ATOM    768  O2   DC I  25     167.476 168.787 134.181  1.00 86.46           O  
ATOM    769  N3   DC I  25     169.038 167.187 133.798  1.00 86.46           N  
ATOM    770  C4   DC I  25     170.317 166.815 133.890  1.00 86.46           C  
ATOM    771  N4   DC I  25     170.658 165.611 133.434  1.00 86.46           N  
ATOM    772  C5   DC I  25     171.307 167.661 134.449  1.00 86.46           C  
ATOM    773  C6   DC I  25     170.924 168.861 134.886  1.00 86.46           C  
ATOM    774  H5'  DC I  25     171.195 173.803 133.810  1.00 86.46           H  
ATOM    775 H5''  DC I  25     171.388 174.338 135.283  1.00 86.46           H  
ATOM    776  H4'  DC I  25     169.237 173.396 134.911  1.00 86.46           H  
ATOM    777  H3'  DC I  25     170.736 172.751 137.088  1.00 86.46           H  
ATOM    778  H2'  DC I  25     170.445 170.551 136.991  1.00 86.46           H  
ATOM    779 H2''  DC I  25     168.918 170.815 137.344  1.00 86.46           H  
ATOM    780  H1'  DC I  25     168.282 170.779 135.213  1.00 86.46           H  
ATOM    781  H41  DC I  25     171.470 165.338 133.510  1.00 86.46           H  
ATOM    782  H42  DC I  25     170.071 165.112 133.058  1.00 86.46           H  
ATOM    783  H5   DC I  25     172.192 167.389 134.505  1.00 86.46           H  
ATOM    784  H6   DC I  25     171.554 169.432 135.259  1.00 86.46           H  
ATOM    785  P    DC I  26     168.473 173.210 138.779  1.00 83.46           P  
ATOM    786  OP1  DC I  26     167.939 174.519 139.213  1.00 83.46           O  
ATOM    787  OP2  DC I  26     169.629 172.615 139.486  1.00 83.46           O  
ATOM    788  O5'  DC I  26     167.285 172.144 138.785  1.00 83.46           O  
ATOM    789  C5'  DC I  26     166.270 172.192 137.779  1.00 83.46           C  
ATOM    790  C4'  DC I  26     165.368 170.986 137.883  1.00 83.46           C  
ATOM    791  O4'  DC I  26     166.005 169.827 137.244  1.00 83.46           O  
ATOM    792  C3'  DC I  26     165.079 170.557 139.314  1.00 83.46           C  
ATOM    793  O3'  DC I  26     163.752 170.120 139.450  1.00 83.46           O  
ATOM    794  C2'  DC I  26     166.085 169.442 139.511  1.00 83.46           C  
ATOM    795  C1'  DC I  26     165.994 168.757 138.161  1.00 83.46           C  
ATOM    796  N1   DC I  26     167.108 167.759 137.842  1.00 83.46           N  
ATOM    797  C2   DC I  26     166.812 166.582 137.127  1.00 83.46           C  
ATOM    798  O2   DC I  26     165.653 166.376 136.745  1.00 83.46           O  
ATOM    799  N3   DC I  26     167.813 165.703 136.867  1.00 83.46           N  
ATOM    800  C4   DC I  26     169.051 165.957 137.287  1.00 83.46           C  
ATOM    801  N4   DC I  26     170.006 165.062 137.016  1.00 83.46           N  
ATOM    802  C5   DC I  26     169.367 167.134 138.016  1.00 83.46           C  
ATOM    803  C6   DC I  26     168.381 167.994 138.266  1.00 83.46           C  
ATOM    804  H5'  DC I  26     166.683 172.205 136.904  1.00 83.46           H  
ATOM    805 H5''  DC I  26     165.741 172.996 137.896  1.00 83.46           H  
ATOM    806  H4'  DC I  26     164.530 171.176 137.437  1.00 83.46           H  
ATOM    807  H3'  DC I  26     165.257 171.286 139.925  1.00 83.46           H  
ATOM    808  H2'  DC I  26     166.962 169.810 139.671  1.00 83.46           H  
ATOM    809 H2''  DC I  26     165.821 168.854 140.219  1.00 83.46           H  
ATOM    810  H1'  DC I  26     165.141 168.306 138.107  1.00 83.46           H  
ATOM    811  H41  DC I  26     170.825 165.314 136.950  1.00 83.46           H  
ATOM    812  H42  DC I  26     169.801 164.231 136.916  1.00 83.46           H  
ATOM    813  H5   DC I  26     170.233 167.299 138.308  1.00 83.46           H  
ATOM    814  H6   DC I  26     168.565 168.766 138.743  1.00 83.46           H  
ATOM    815  P    DA I  27     162.720 170.966 140.338  1.00 76.51           P  
ATOM    816  OP1  DA I  27     162.611 172.303 139.714  1.00 76.51           O  
ATOM    817  OP2  DA I  27     163.115 170.841 141.757  1.00 76.51           O  
ATOM    818  O5'  DA I  27     161.343 170.194 140.133  1.00 76.51           O  
ATOM    819  C5'  DA I  27     160.750 170.205 138.866  1.00 76.51           C  
ATOM    820  C4'  DA I  27     160.162 168.854 138.514  1.00 76.51           C  
ATOM    821  O4'  DA I  27     161.221 167.864 138.435  1.00 76.51           O  
ATOM    822  C3'  DA I  27     159.151 168.310 139.506  1.00 76.51           C  
ATOM    823  O3'  DA I  27     158.106 167.632 138.796  1.00 76.51           O  
ATOM    824  C2'  DA I  27     159.997 167.403 140.407  1.00 76.51           C  
ATOM    825  C1'  DA I  27     161.102 166.905 139.472  1.00 76.51           C  
ATOM    826  N9   DA I  27     162.434 166.752 140.077  1.00 76.51           N  
ATOM    827  C8   DA I  27     163.046 167.602 140.953  1.00 76.51           C  
ATOM    828  N7   DA I  27     164.245 167.227 141.306  1.00 76.51           N  
ATOM    829  C5   DA I  27     164.464 166.078 140.580  1.00 76.51           C  
ATOM    830  C6   DA I  27     165.562 165.209 140.507  1.00 76.51           C  
ATOM    831  N6   DA I  27     166.682 165.391 141.199  1.00 76.51           N  
ATOM    832  N1   DA I  27     165.464 164.141 139.700  1.00 76.51           N  
ATOM    833  C2   DA I  27     164.338 163.962 139.005  1.00 76.51           C  
ATOM    834  N3   DA I  27     163.232 164.711 138.994  1.00 76.51           N  
ATOM    835  C4   DA I  27     163.366 165.770 139.807  1.00 76.51           C  
ATOM    836  H5'  DA I  27     161.421 170.438 138.209  1.00 76.51           H  
ATOM    837 H5''  DA I  27     160.047 170.870 138.852  1.00 76.51           H  
ATOM    838  H4'  DA I  27     159.737 168.920 137.647  1.00 76.51           H  
ATOM    839  H3'  DA I  27     158.780 169.037 140.027  1.00 76.51           H  
ATOM    840  H2'  DA I  27     160.361 167.914 141.140  1.00 76.51           H  
ATOM    841 H2''  DA I  27     159.479 166.662 140.738  1.00 76.51           H  
ATOM    842  H1'  DA I  27     160.830 166.056 139.088  1.00 76.51           H  
ATOM    843  H8   DA I  27     162.633 168.361 141.292  1.00 76.51           H  
ATOM    844  H61  DA I  27     167.315 164.810 141.152  1.00 76.51           H  
ATOM    845  H62  DA I  27     166.770 166.085 141.698  1.00 76.51           H  
ATOM    846  H2   DA I  27     164.316 163.209 138.465  1.00 76.51           H  
ATOM    847  P    DA I  28     156.971 166.782 139.549  1.00 70.92           P  
ATOM    848  OP1  DA I  28     155.702 166.999 138.823  1.00 70.92           O  
ATOM    849  OP2  DA I  28     157.045 167.064 140.999  1.00 70.92           O  
ATOM    850  O5'  DA I  28     157.441 165.278 139.301  1.00 70.92           O  
ATOM    851  C5'  DA I  28     157.829 164.887 137.994  1.00 70.92           C  
ATOM    852  C4'  DA I  28     158.429 163.501 137.988  1.00 70.92           C  
ATOM    853  O4'  DA I  28     159.772 163.536 138.565  1.00 70.92           O  
ATOM    854  C3'  DA I  28     157.662 162.468 138.793  1.00 70.92           C  
ATOM    855  O3'  DA I  28     157.685 161.237 138.105  1.00 70.92           O  
ATOM    856  C2'  DA I  28     158.435 162.444 140.104  1.00 70.92           C  
ATOM    857  C1'  DA I  28     159.858 162.580 139.603  1.00 70.92           C  
ATOM    858  N9   DA I  28     160.839 163.039 140.592  1.00 70.92           N  
ATOM    859  C8   DA I  28     160.757 164.152 141.371  1.00 70.92           C  
ATOM    860  N7   DA I  28     161.792 164.332 142.153  1.00 70.92           N  
ATOM    861  C5   DA I  28     162.620 163.266 141.863  1.00 70.92           C  
ATOM    862  C6   DA I  28     163.884 162.888 142.355  1.00 70.92           C  
ATOM    863  N6   DA I  28     164.543 163.578 143.284  1.00 70.92           N  
ATOM    864  N1   DA I  28     164.446 161.771 141.857  1.00 70.92           N  
ATOM    865  C2   DA I  28     163.783 161.085 140.919  1.00 70.92           C  
ATOM    866  N3   DA I  28     162.590 161.346 140.373  1.00 70.92           N  
ATOM    867  C4   DA I  28     162.055 162.459 140.899  1.00 70.92           C  
ATOM    868  H5'  DA I  28     158.483 165.513 137.655  1.00 70.92           H  
ATOM    869 H5''  DA I  28     157.052 164.898 137.417  1.00 70.92           H  
ATOM    870  H4'  DA I  28     158.492 163.194 137.072  1.00 70.92           H  
ATOM    871  H3'  DA I  28     156.751 162.760 138.938  1.00 70.92           H  
ATOM    872  H2'  DA I  28     158.191 163.198 140.660  1.00 70.92           H  
ATOM    873 H2''  DA I  28     158.306 161.613 140.568  1.00 70.92           H  
ATOM    874  H1'  DA I  28     160.148 161.734 139.234  1.00 70.92           H  
ATOM    875  H8   DA I  28     160.029 164.724 141.357  1.00 70.92           H  
ATOM    876  H61  DA I  28     165.264 163.258 143.625  1.00 70.92           H  
ATOM    877  H62  DA I  28     164.250 164.344 143.537  1.00 70.92           H  
ATOM    878  H2   DA I  28     164.206 160.321 140.607  1.00 70.92           H  
ATOM    879  P    DA I  29     156.838 159.971 138.603  1.00 64.69           P  
ATOM    880  OP1  DA I  29     155.820 159.731 137.565  1.00 64.69           O  
ATOM    881  OP2  DA I  29     156.409 160.178 140.000  1.00 64.69           O  
ATOM    882  O5'  DA I  29     157.907 158.782 138.556  1.00 64.69           O  
ATOM    883  C5'  DA I  29     158.978 158.852 137.625  1.00 64.69           C  
ATOM    884  C4'  DA I  29     159.922 157.668 137.745  1.00 64.69           C  
ATOM    885  O4'  DA I  29     160.987 157.967 138.683  1.00 64.69           O  
ATOM    886  C3'  DA I  29     159.313 156.392 138.252  1.00 64.69           C  
ATOM    887  O3'  DA I  29     160.030 155.295 137.700  1.00 64.69           O  
ATOM    888  C2'  DA I  29     159.446 156.539 139.772  1.00 64.69           C  
ATOM    889  C1'  DA I  29     160.747 157.324 139.928  1.00 64.69           C  
ATOM    890  N9   DA I  29     160.733 158.368 140.960  1.00 64.69           N  
ATOM    891  C8   DA I  29     159.809 159.357 141.114  1.00 64.69           C  
ATOM    892  N7   DA I  29     160.069 160.183 142.096  1.00 64.69           N  
ATOM    893  C5   DA I  29     161.251 159.710 142.621  1.00 64.69           C  
ATOM    894  C6   DA I  29     162.058 160.163 143.672  1.00 64.69           C  
ATOM    895  N6   DA I  29     161.757 161.223 144.415  1.00 64.69           N  
ATOM    896  N1   DA I  29     163.185 159.481 143.935  1.00 64.69           N  
ATOM    897  C2   DA I  29     163.485 158.421 143.177  1.00 64.69           C  
ATOM    898  N3   DA I  29     162.806 157.903 142.156  1.00 64.69           N  
ATOM    899  C4   DA I  29     161.692 158.607 141.920  1.00 64.69           C  
ATOM    900  H5'  DA I  29     159.479 159.662 137.781  1.00 64.69           H  
ATOM    901 H5''  DA I  29     158.613 158.875 136.730  1.00 64.69           H  
ATOM    902  H4'  DA I  29     160.311 157.496 136.877  1.00 64.69           H  
ATOM    903  H3'  DA I  29     158.388 156.351 138.003  1.00 64.69           H  
ATOM    904  H2'  DA I  29     158.697 157.035 140.125  1.00 64.69           H  
ATOM    905 H2''  DA I  29     159.515 155.682 140.205  1.00 64.69           H  
ATOM    906  H1'  DA I  29     161.469 156.704 140.111  1.00 64.69           H  
ATOM    907  H8   DA I  29     159.051 159.430 140.578  1.00 64.69           H  
ATOM    908  H61  DA I  29     162.234 161.415 145.102  1.00 64.69           H  
ATOM    909  H62  DA I  29     161.094 161.724 144.198  1.00 64.69           H  
ATOM    910  H2   DA I  29     164.271 157.980 143.399  1.00 64.69           H  
ATOM    911  P    DA I  30     159.804 153.800 138.219  1.00 66.42           P  
ATOM    912  OP1  DA I  30     160.275 152.879 137.164  1.00 66.42           O  
ATOM    913  OP2  DA I  30     158.422 153.707 138.736  1.00 66.42           O  
ATOM    914  O5'  DA I  30     160.797 153.704 139.461  1.00 66.42           O  
ATOM    915  C5'  DA I  30     160.997 152.470 140.083  1.00 66.42           C  
ATOM    916  C4'  DA I  30     162.267 152.457 140.894  1.00 66.42           C  
ATOM    917  O4'  DA I  30     162.472 153.760 141.506  1.00 66.42           O  
ATOM    918  C3'  DA I  30     162.261 151.469 142.042  1.00 66.42           C  
ATOM    919  O3'  DA I  30     163.568 150.992 142.298  1.00 66.42           O  
ATOM    920  C2'  DA I  30     161.719 152.312 143.172  1.00 66.42           C  
ATOM    921  C1'  DA I  30     162.410 153.633 142.913  1.00 66.42           C  
ATOM    922  N9   DA I  30     161.724 154.800 143.453  1.00 66.42           N  
ATOM    923  C8   DA I  30     160.593 155.384 142.972  1.00 66.42           C  
ATOM    924  N7   DA I  30     160.212 156.436 143.653  1.00 66.42           N  
ATOM    925  C5   DA I  30     161.168 156.550 144.642  1.00 66.42           C  
ATOM    926  C6   DA I  30     161.343 157.468 145.688  1.00 66.42           C  
ATOM    927  N6   DA I  30     160.515 158.480 145.917  1.00 66.42           N  
ATOM    928  N1   DA I  30     162.404 157.302 146.498  1.00 66.42           N  
ATOM    929  C2   DA I  30     163.236 156.290 146.259  1.00 66.42           C  
ATOM    930  N3   DA I  30     163.174 155.363 145.311  1.00 66.42           N  
ATOM    931  C4   DA I  30     162.110 155.556 144.527  1.00 66.42           C  
ATOM    932  H5'  DA I  30     161.058 151.790 139.406  1.00 66.42           H  
ATOM    933 H5''  DA I  30     160.244 152.280 140.664  1.00 66.42           H  
ATOM    934  H4'  DA I  30     163.014 152.259 140.311  1.00 66.42           H  
ATOM    935  H3'  DA I  30     161.662 150.733 141.852  1.00 66.42           H  
ATOM    936  H2'  DA I  30     160.758 152.406 143.104  1.00 66.42           H  
ATOM    937 H2''  DA I  30     161.975 151.948 144.022  1.00 66.42           H  
ATOM    938  H1'  DA I  30     163.309 153.596 143.270  1.00 66.42           H  
ATOM    939  H8   DA I  30     160.130 155.060 142.236  1.00 66.42           H  
ATOM    940  H61  DA I  30     160.586 158.938 146.639  1.00 66.42           H  
ATOM    941  H62  DA I  30     159.911 158.677 145.340  1.00 66.42           H  
ATOM    942  H2   DA I  30     163.948 156.213 146.846  1.00 66.42           H  
ATOM    943  P    DG I  31     163.784 149.579 143.025  1.00 71.24           P  
ATOM    944  OP1  DG I  31     164.322 148.634 142.021  1.00 71.24           O  
ATOM    945  OP2  DG I  31     162.537 149.255 143.750  1.00 71.24           O  
ATOM    946  O5'  DG I  31     164.909 149.893 144.114  1.00 71.24           O  
ATOM    947  C5'  DG I  31     164.828 151.084 144.864  1.00 71.24           C  
ATOM    948  C4'  DG I  31     165.539 150.951 146.191  1.00 71.24           C  
ATOM    949  O4'  DG I  31     165.152 152.060 147.034  1.00 71.24           O  
ATOM    950  C3'  DG I  31     165.168 149.727 146.997  1.00 71.24           C  
ATOM    951  O3'  DG I  31     166.156 149.446 147.993  1.00 71.24           O  
ATOM    952  C2'  DG I  31     163.848 150.166 147.587  1.00 71.24           C  
ATOM    953  C1'  DG I  31     164.126 151.638 147.921  1.00 71.24           C  
ATOM    954  N9   DG I  31     162.984 152.550 147.784  1.00 71.24           N  
ATOM    955  C8   DG I  31     162.033 152.566 146.796  1.00 71.24           C  
ATOM    956  N7   DG I  31     161.146 153.510 146.940  1.00 71.24           N  
ATOM    957  C5   DG I  31     161.540 154.167 148.091  1.00 71.24           C  
ATOM    958  C6   DG I  31     160.976 155.285 148.735  1.00 71.24           C  
ATOM    959  O6   DG I  31     159.972 155.929 148.412  1.00 71.24           O  
ATOM    960  N1   DG I  31     161.693 155.639 149.868  1.00 71.24           N  
ATOM    961  C2   DG I  31     162.819 154.997 150.315  1.00 71.24           C  
ATOM    962  N2   DG I  31     163.384 155.478 151.426  1.00 71.24           N  
ATOM    963  N3   DG I  31     163.360 153.954 149.716  1.00 71.24           N  
ATOM    964  C4   DG I  31     162.677 153.601 148.611  1.00 71.24           C  
ATOM    965  H5'  DG I  31     163.901 151.291 145.026  1.00 71.24           H  
ATOM    966 H5''  DG I  31     165.228 151.806 144.361  1.00 71.24           H  
ATOM    967  H4'  DG I  31     166.494 150.970 146.052  1.00 71.24           H  
ATOM    968  H3'  DG I  31     165.042 148.964 146.416  1.00 71.24           H  
ATOM    969  H2'  DG I  31     163.144 150.078 146.933  1.00 71.24           H  
ATOM    970 H2''  DG I  31     163.643 149.665 148.385  1.00 71.24           H  
ATOM    971  H1'  DG I  31     164.456 151.695 148.823  1.00 71.24           H  
ATOM    972  H8   DG I  31     162.011 151.948 146.106  1.00 71.24           H  
ATOM    973  H1   DG I  31     161.412 156.311 150.321  1.00 71.24           H  
ATOM    974  H21  DG I  31     164.106 155.123 151.729  1.00 71.24           H  
ATOM    975  H22  DG I  31     163.026 156.142 151.836  1.00 71.24           H  
ATOM    976  P    DT I  32     166.064 148.115 148.895  1.00 81.78           P  
ATOM    977  OP1  DT I  32     167.303 147.342 148.658  1.00 81.78           O  
ATOM    978  OP2  DT I  32     164.755 147.475 148.647  1.00 81.78           O  
ATOM    979  O5'  DT I  32     166.082 148.666 150.405  1.00 81.78           O  
ATOM    980  C5'  DT I  32     165.452 149.904 150.706  1.00 81.78           C  
ATOM    981  C4'  DT I  32     165.550 150.259 152.178  1.00 81.78           C  
ATOM    982  O4'  DT I  32     164.742 151.439 152.422  1.00 81.78           O  
ATOM    983  C3'  DT I  32     165.036 149.205 153.140  1.00 81.78           C  
ATOM    984  O3'  DT I  32     165.757 149.241 154.363  1.00 81.78           O  
ATOM    985  C2'  DT I  32     163.568 149.574 153.319  1.00 81.78           C  
ATOM    986  C1'  DT I  32     163.544 151.096 153.098  1.00 81.78           C  
ATOM    987  N1   DT I  32     162.336 151.637 152.287  1.00 81.78           N  
ATOM    988  C2   DT I  32     161.656 152.753 152.738  1.00 81.78           C  
ATOM    989  O2   DT I  32     161.943 153.349 153.759  1.00 81.78           O  
ATOM    990  N3   DT I  32     160.613 153.148 151.943  1.00 81.78           N  
ATOM    991  C4   DT I  32     160.191 152.567 150.775  1.00 81.78           C  
ATOM    992  O4   DT I  32     159.242 152.995 150.135  1.00 81.78           O  
ATOM    993  C5   DT I  32     160.932 151.415 150.358  1.00 81.78           C  
ATOM    994  C7   DT I  32     160.554 150.704 149.100  1.00 81.78           C  
ATOM    995  C6   DT I  32     161.964 151.018 151.108  1.00 81.78           C  
ATOM    996  H5'  DT I  32     164.520 149.851 150.459  1.00 81.78           H  
ATOM    997 H5''  DT I  32     165.877 150.602 150.189  1.00 81.78           H  
ATOM    998  H4'  DT I  32     166.473 150.459 152.395  1.00 81.78           H  
ATOM    999  H3'  DT I  32     165.109 148.329 152.737  1.00 81.78           H  
ATOM   1000  H2'  DT I  32     163.028 149.110 152.670  1.00 81.78           H  
ATOM   1001 H2''  DT I  32     163.274 149.363 154.216  1.00 81.78           H  
ATOM   1002  H1'  DT I  32     163.551 151.525 153.965  1.00 81.78           H  
ATOM   1003  H3   DT I  32     160.174 153.835 152.205  1.00 81.78           H  
ATOM   1004  H71  DT I  32     161.347 150.349 148.680  1.00 81.78           H  
ATOM   1005  H72  DT I  32     159.947 149.977 149.310  1.00 81.78           H  
ATOM   1006  H73  DT I  32     160.117 151.324 148.496  1.00 81.78           H  
ATOM   1007  H6   DT I  32     162.438 150.270 150.837  1.00 81.78           H  
ATOM   1008  P    DG I  33     165.533 148.095 155.467  1.00 90.36           P  
ATOM   1009  OP1  DG I  33     166.746 148.044 156.309  1.00 90.36           O  
ATOM   1010  OP2  DG I  33     165.060 146.874 154.778  1.00 90.36           O  
ATOM   1011  O5'  DG I  33     164.323 148.651 156.348  1.00 90.36           O  
ATOM   1012  C5'  DG I  33     164.452 149.902 156.993  1.00 90.36           C  
ATOM   1013  C4'  DG I  33     163.096 150.476 157.365  1.00 90.36           C  
ATOM   1014  O4'  DG I  33     162.380 150.839 156.166  1.00 90.36           O  
ATOM   1015  C3'  DG I  33     162.166 149.525 158.125  1.00 90.36           C  
ATOM   1016  O3'  DG I  33     162.102 149.886 159.503  1.00 90.36           O  
ATOM   1017  C2'  DG I  33     160.809 149.664 157.410  1.00 90.36           C  
ATOM   1018  C1'  DG I  33     161.013 150.836 156.468  1.00 90.36           C  
ATOM   1019  N9   DG I  33     160.243 150.740 155.232  1.00 90.36           N  
ATOM   1020  C8   DG I  33     160.407 149.829 154.224  1.00 90.36           C  
ATOM   1021  N7   DG I  33     159.570 149.985 153.242  1.00 90.36           N  
ATOM   1022  C5   DG I  33     158.797 151.068 153.627  1.00 90.36           C  
ATOM   1023  C6   DG I  33     157.725 151.700 152.964  1.00 90.36           C  
ATOM   1024  O6   DG I  33     157.230 151.416 151.868  1.00 90.36           O  
ATOM   1025  N1   DG I  33     157.218 152.763 153.699  1.00 90.36           N  
ATOM   1026  C2   DG I  33     157.690 153.164 154.923  1.00 90.36           C  
ATOM   1027  N2   DG I  33     157.076 154.213 155.488  1.00 90.36           N  
ATOM   1028  N3   DG I  33     158.695 152.579 155.555  1.00 90.36           N  
ATOM   1029  C4   DG I  33     159.198 151.542 154.850  1.00 90.36           C  
ATOM   1030  H5'  DG I  33     164.906 150.519 156.397  1.00 90.36           H  
ATOM   1031 H5''  DG I  33     164.981 149.790 157.797  1.00 90.36           H  
ATOM   1032  H4'  DG I  33     163.231 151.272 157.902  1.00 90.36           H  
ATOM   1033  H3'  DG I  33     162.487 148.615 158.040  1.00 90.36           H  
ATOM   1034  H2'  DG I  33     160.608 148.860 156.912  1.00 90.36           H  
ATOM   1035 H2''  DG I  33     160.103 149.860 158.039  1.00 90.36           H  
ATOM   1036  H1'  DG I  33     160.784 151.657 156.926  1.00 90.36           H  
ATOM   1037  H8   DG I  33     161.056 149.166 154.239  1.00 90.36           H  
ATOM   1038  H1   DG I  33     156.559 153.201 153.362  1.00 90.36           H  
ATOM   1039  H21  DG I  33     157.376 154.542 156.223  1.00 90.36           H  
ATOM   1040  H22  DG I  33     156.381 154.556 155.115  1.00 90.36           H  
ATOM   1041  P    DT I  34     161.162 149.072 160.522  1.00 93.78           P  
ATOM   1042  OP1  DT I  34     161.739 149.203 161.877  1.00 93.78           O  
ATOM   1043  OP2  DT I  34     160.920 147.733 159.944  1.00 93.78           O  
ATOM   1044  O5'  DT I  34     159.781 149.871 160.471  1.00 93.78           O  
ATOM   1045  C5'  DT I  34     159.793 151.289 160.430  1.00 93.78           C  
ATOM   1046  C4'  DT I  34     158.390 151.845 160.313  1.00 93.78           C  
ATOM   1047  O4'  DT I  34     157.963 151.785 158.921  1.00 93.78           O  
ATOM   1048  C3'  DT I  34     157.329 151.085 161.117  1.00 93.78           C  
ATOM   1049  O3'  DT I  34     156.492 151.982 161.842  1.00 93.78           O  
ATOM   1050  C2'  DT I  34     156.569 150.324 160.049  1.00 93.78           C  
ATOM   1051  C1'  DT I  34     156.653 151.280 158.872  1.00 93.78           C  
ATOM   1052  N1   DT I  34     156.399 150.650 157.506  1.00 93.78           N  
ATOM   1053  C2   DT I  34     155.407 151.159 156.689  1.00 93.78           C  
ATOM   1054  O2   DT I  34     154.701 152.103 156.992  1.00 93.78           O  
ATOM   1055  N3   DT I  34     155.270 150.517 155.491  1.00 93.78           N  
ATOM   1056  C4   DT I  34     156.002 149.446 155.030  1.00 93.78           C  
ATOM   1057  O4   DT I  34     155.802 148.937 153.934  1.00 93.78           O  
ATOM   1058  C5   DT I  34     157.016 148.963 155.922  1.00 93.78           C  
ATOM   1059  C7   DT I  34     157.873 147.804 155.520  1.00 93.78           C  
ATOM   1060  C6   DT I  34     157.170 149.581 157.100  1.00 93.78           C  
ATOM   1061  H5'  DT I  34     160.311 151.580 159.666  1.00 93.78           H  
ATOM   1062 H5''  DT I  34     160.202 151.627 161.239  1.00 93.78           H  
ATOM   1063  H4'  DT I  34     158.394 152.770 160.599  1.00 93.78           H  
ATOM   1064  H3'  DT I  34     157.755 150.464 161.726  1.00 93.78           H  
ATOM   1065  H2'  DT I  34     157.010 149.485 159.854  1.00 93.78           H  
ATOM   1066 H2''  DT I  34     155.656 150.184 160.315  1.00 93.78           H  
ATOM   1067  H1'  DT I  34     156.030 152.008 159.015  1.00 93.78           H  
ATOM   1068  H3   DT I  34     154.661 150.816 154.967  1.00 93.78           H  
ATOM   1069  H71  DT I  34     158.750 147.898 155.919  1.00 93.78           H  
ATOM   1070  H72  DT I  34     157.466 146.979 155.824  1.00 93.78           H  
ATOM   1071  H73  DT I  34     157.959 147.787 154.555  1.00 93.78           H  
ATOM   1072  H6   DT I  34     157.825 149.268 157.679  1.00 93.78           H  
ATOM   1073  P    DA I  35     155.393 151.411 162.867  1.00 94.31           P  
ATOM   1074  OP1  DA I  35     155.501 152.184 164.122  1.00 94.31           O  
ATOM   1075  OP2  DA I  35     155.525 149.939 162.894  1.00 94.31           O  
ATOM   1076  O5'  DA I  35     154.001 151.769 162.173  1.00 94.31           O  
ATOM   1077  C5'  DA I  35     153.603 153.119 162.085  1.00 94.31           C  
ATOM   1078  C4'  DA I  35     152.419 153.290 161.157  1.00 94.31           C  
ATOM   1079  O4'  DA I  35     152.689 152.602 159.907  1.00 94.31           O  
ATOM   1080  C3'  DA I  35     151.102 152.723 161.681  1.00 94.31           C  
ATOM   1081  O3'  DA I  35     150.030 153.625 161.420  1.00 94.31           O  
ATOM   1082  C2'  DA I  35     150.956 151.410 160.929  1.00 94.31           C  
ATOM   1083  C1'  DA I  35     151.632 151.719 159.604  1.00 94.31           C  
ATOM   1084  N9   DA I  35     152.186 150.552 158.917  1.00 94.31           N  
ATOM   1085  C8   DA I  35     153.106 149.671 159.402  1.00 94.31           C  
ATOM   1086  N7   DA I  35     153.435 148.726 158.557  1.00 94.31           N  
ATOM   1087  C5   DA I  35     152.679 149.007 157.440  1.00 94.31           C  
ATOM   1088  C6   DA I  35     152.568 148.375 156.197  1.00 94.31           C  
ATOM   1089  N6   DA I  35     153.254 147.285 155.873  1.00 94.31           N  
ATOM   1090  N1   DA I  35     151.721 148.908 155.296  1.00 94.31           N  
ATOM   1091  C2   DA I  35     151.036 150.004 155.629  1.00 94.31           C  
ATOM   1092  N3   DA I  35     151.055 150.688 156.769  1.00 94.31           N  
ATOM   1093  C4   DA I  35     151.907 150.132 157.639  1.00 94.31           C  
ATOM   1094  H5'  DA I  35     154.345 153.645 161.753  1.00 94.31           H  
ATOM   1095 H5''  DA I  35     153.361 153.434 162.968  1.00 94.31           H  
ATOM   1096  H4'  DA I  35     152.300 154.233 160.974  1.00 94.31           H  
ATOM   1097  H3'  DA I  35     151.172 152.554 162.632  1.00 94.31           H  
ATOM   1098  H2'  DA I  35     151.417 150.697 161.396  1.00 94.31           H  
ATOM   1099 H2''  DA I  35     150.021 151.190 160.795  1.00 94.31           H  
ATOM   1100  H1'  DA I  35     151.000 152.165 159.021  1.00 94.31           H  
ATOM   1101  H8   DA I  35     153.469 149.738 160.255  1.00 94.31           H  
ATOM   1102  H61  DA I  35     153.033 146.829 155.181  1.00 94.31           H  
ATOM   1103  H62  DA I  35     153.917 147.038 156.358  1.00 94.31           H  
ATOM   1104  H2   DA I  35     150.466 150.335 154.974  1.00 94.31           H  
ATOM   1105  P    DT I  36     148.582 153.378 162.070  1.00 90.99           P  
ATOM   1106  OP1  DT I  36     148.072 154.689 162.525  1.00 90.99           O  
ATOM   1107  OP2  DT I  36     148.689 152.253 163.025  1.00 90.99           O  
ATOM   1108  O5'  DT I  36     147.691 152.891 160.838  1.00 90.99           O  
ATOM   1109  C5'  DT I  36     147.514 153.745 159.723  1.00 90.99           C  
ATOM   1110  C4'  DT I  36     146.896 152.999 158.554  1.00 90.99           C  
ATOM   1111  O4'  DT I  36     147.794 151.951 158.114  1.00 90.99           O  
ATOM   1112  C3'  DT I  36     145.561 152.310 158.852  1.00 90.99           C  
ATOM   1113  O3'  DT I  36     144.539 152.864 158.037  1.00 90.99           O  
ATOM   1114  C2'  DT I  36     145.822 150.823 158.550  1.00 90.99           C  
ATOM   1115  C1'  DT I  36     147.027 150.877 157.638  1.00 90.99           C  
ATOM   1116  N1   DT I  36     147.888 149.641 157.628  1.00 90.99           N  
ATOM   1117  C2   DT I  36     147.974 148.882 156.480  1.00 90.99           C  
ATOM   1118  O2   DT I  36     147.365 149.136 155.457  1.00 90.99           O  
ATOM   1119  N3   DT I  36     148.804 147.798 156.571  1.00 90.99           N  
ATOM   1120  C4   DT I  36     149.545 147.406 157.663  1.00 90.99           C  
ATOM   1121  O4   DT I  36     150.261 146.410 157.644  1.00 90.99           O  
ATOM   1122  C5   DT I  36     149.413 148.243 158.827  1.00 90.99           C  
ATOM   1123  C7   DT I  36     150.170 147.914 160.072  1.00 90.99           C  
ATOM   1124  C6   DT I  36     148.609 149.312 158.753  1.00 90.99           C  
ATOM   1125  H5'  DT I  36     148.376 154.099 159.456  1.00 90.99           H  
ATOM   1126 H5''  DT I  36     146.934 154.479 159.975  1.00 90.99           H  
ATOM   1127  H4'  DT I  36     146.765 153.623 157.823  1.00 90.99           H  
ATOM   1128  H3'  DT I  36     145.334 152.423 159.786  1.00 90.99           H  
ATOM   1129  H2'  DT I  36     146.029 150.338 159.362  1.00 90.99           H  
ATOM   1130 H2''  DT I  36     145.066 150.426 158.093  1.00 90.99           H  
ATOM   1131  H1'  DT I  36     146.733 151.076 156.740  1.00 90.99           H  
ATOM   1132  H3   DT I  36     148.870 147.308 155.870  1.00 90.99           H  
ATOM   1133  H71  DT I  36     150.300 148.720 160.592  1.00 90.99           H  
ATOM   1134  H72  DT I  36     149.668 147.269 160.594  1.00 90.99           H  
ATOM   1135  H73  DT I  36     151.032 147.537 159.835  1.00 90.99           H  
ATOM   1136  H6   DT I  36     148.525 149.852 159.502  1.00 90.99           H  
ATOM   1137  P    DT I  37     142.995 152.509 158.300  1.00 86.46           P  
ATOM   1138  OP1  DT I  37     142.370 153.724 158.861  1.00 86.46           O  
ATOM   1139  OP2  DT I  37     142.922 151.240 159.049  1.00 86.46           O  
ATOM   1140  O5'  DT I  37     142.394 152.255 156.838  1.00 86.46           O  
ATOM   1141  C5'  DT I  37     143.220 151.749 155.795  1.00 86.46           C  
ATOM   1142  C4'  DT I  37     142.579 150.587 155.052  1.00 86.46           C  
ATOM   1143  O4'  DT I  37     143.504 149.453 155.101  1.00 86.46           O  
ATOM   1144  C3'  DT I  37     141.262 150.049 155.633  1.00 86.46           C  
ATOM   1145  O3'  DT I  37     140.465 149.387 154.661  1.00 86.46           O  
ATOM   1146  C2'  DT I  37     141.804 149.061 156.625  1.00 86.46           C  
ATOM   1147  C1'  DT I  37     142.854 148.382 155.741  1.00 86.46           C  
ATOM   1148  N1   DT I  37     143.864 147.484 156.444  1.00 86.46           N  
ATOM   1149  C2   DT I  37     144.473 146.479 155.725  1.00 86.46           C  
ATOM   1150  O2   DT I  37     144.267 146.286 154.545  1.00 86.46           O  
ATOM   1151  N3   DT I  37     145.346 145.712 156.443  1.00 86.46           N  
ATOM   1152  C4   DT I  37     145.659 145.839 157.781  1.00 86.46           C  
ATOM   1153  O4   DT I  37     146.457 145.101 158.347  1.00 86.46           O  
ATOM   1154  C5   DT I  37     144.981 146.898 158.473  1.00 86.46           C  
ATOM   1155  C7   DT I  37     145.240 147.134 159.932  1.00 86.46           C  
ATOM   1156  C6   DT I  37     144.128 147.656 157.785  1.00 86.46           C  
ATOM   1157  H5'  DT I  37     144.054 151.444 156.174  1.00 86.46           H  
ATOM   1158 H5''  DT I  37     143.401 152.462 155.166  1.00 86.46           H  
ATOM   1159  H4'  DT I  37     142.444 150.838 154.134  1.00 86.46           H  
ATOM   1160  H3'  DT I  37     140.757 150.743 156.074  1.00 86.46           H  
ATOM   1161  H2'  DT I  37     142.201 149.525 157.372  1.00 86.46           H  
ATOM   1162 H2''  DT I  37     141.121 148.437 156.908  1.00 86.46           H  
ATOM   1163  H1'  DT I  37     142.398 147.859 155.069  1.00 86.46           H  
ATOM   1164  H3   DT I  37     145.742 145.085 156.016  1.00 86.46           H  
ATOM   1165  H71  DT I  37     145.188 148.085 160.118  1.00 86.46           H  
ATOM   1166  H72  DT I  37     144.575 146.664 160.459  1.00 86.46           H  
ATOM   1167  H73  DT I  37     146.124 146.809 160.161  1.00 86.46           H  
ATOM   1168  H6   DT I  37     143.695 148.336 158.234  1.00 86.46           H  
ATOM   1169  P    DT I  38     139.730 150.169 153.468  1.00 89.06           P  
ATOM   1170  OP1  DT I  38     140.295 151.524 153.304  1.00 89.06           O  
ATOM   1171  OP2  DT I  38     138.281 150.043 153.734  1.00 89.06           O  
ATOM   1172  O5'  DT I  38     140.049 149.259 152.184  1.00 89.06           O  
ATOM   1173  C5'  DT I  38     141.348 148.640 152.005  1.00 89.06           C  
ATOM   1174  C4'  DT I  38     141.239 147.209 151.480  1.00 89.06           C  
ATOM   1175  O4'  DT I  38     141.956 146.291 152.376  1.00 89.06           O  
ATOM   1176  C3'  DT I  38     139.838 146.624 151.426  1.00 89.06           C  
ATOM   1177  O3'  DT I  38     139.791 145.581 150.523  1.00 89.06           O  
ATOM   1178  C2'  DT I  38     139.706 146.125 152.828  1.00 89.06           C  
ATOM   1179  C1'  DT I  38     141.013 145.352 152.882  1.00 89.06           C  
ATOM   1180  N1   DT I  38     141.448 144.840 154.203  1.00 89.06           N  
ATOM   1181  C2   DT I  38     142.274 143.740 154.232  1.00 89.06           C  
ATOM   1182  O2   DT I  38     142.666 143.166 153.232  1.00 89.06           O  
ATOM   1183  N3   DT I  38     142.626 143.330 155.475  1.00 89.06           N  
ATOM   1184  C4   DT I  38     142.246 143.898 156.674  1.00 89.06           C  
ATOM   1185  O4   DT I  38     142.614 143.462 157.751  1.00 89.06           O  
ATOM   1186  C5   DT I  38     141.382 145.038 156.572  1.00 89.06           C  
ATOM   1187  C7   DT I  38     140.900 145.731 157.807  1.00 89.06           C  
ATOM   1188  C6   DT I  38     141.023 145.445 155.359  1.00 89.06           C  
ATOM   1189  H5'  DT I  38     141.816 148.626 152.849  1.00 89.06           H  
ATOM   1190 H5''  DT I  38     141.859 149.166 151.373  1.00 89.06           H  
ATOM   1191  H4'  DT I  38     141.633 147.164 150.597  1.00 89.06           H  
ATOM   1192  H3'  DT I  38     139.175 147.291 151.219  1.00 89.06           H  
ATOM   1193  H2'  DT I  38     139.693 146.866 153.449  1.00 89.06           H  
ATOM   1194 H2''  DT I  38     138.941 145.554 152.932  1.00 89.06           H  
ATOM   1195  H1'  DT I  38     140.962 144.602 152.278  1.00 89.06           H  
ATOM   1196  H3   DT I  38     143.145 142.646 155.521  1.00 89.06           H  
ATOM   1197  H71  DT I  38     140.617 145.070 158.457  1.00 89.06           H  
ATOM   1198  H72  DT I  38     141.618 146.265 158.178  1.00 89.06           H  
ATOM   1199  H73  DT I  38     140.150 146.304 157.583  1.00 89.06           H  
ATOM   1200  H6   DT I  38     140.469 146.183 155.293  1.00 89.06           H  
ATOM   1201  P    DG I  39     139.144 145.815 149.101  1.00 89.77           P  
ATOM   1202  OP1  DG I  39     139.741 147.069 148.648  1.00 89.77           O  
ATOM   1203  OP2  DG I  39     137.676 145.768 149.266  1.00 89.77           O  
ATOM   1204  O5'  DG I  39     139.509 144.470 148.256  1.00 89.77           O  
ATOM   1205  C5'  DG I  39     140.871 144.073 147.979  1.00 89.77           C  
ATOM   1206  C4'  DG I  39     141.058 142.535 147.960  1.00 89.77           C  
ATOM   1207  O4'  DG I  39     141.202 142.057 149.316  1.00 89.77           O  
ATOM   1208  C3'  DG I  39     139.936 141.681 147.341  1.00 89.77           C  
ATOM   1209  O3'  DG I  39     140.488 140.565 146.593  1.00 89.77           O  
ATOM   1210  C2'  DG I  39     139.114 141.216 148.550  1.00 89.77           C  
ATOM   1211  C1'  DG I  39     140.107 141.241 149.699  1.00 89.77           C  
ATOM   1212  N9   DG I  39     139.610 141.773 150.964  1.00 89.77           N  
ATOM   1213  C8   DG I  39     138.791 142.853 151.179  1.00 89.77           C  
ATOM   1214  N7   DG I  39     138.578 143.094 152.441  1.00 89.77           N  
ATOM   1215  C5   DG I  39     139.336 142.141 153.096  1.00 89.77           C  
ATOM   1216  C6   DG I  39     139.513 141.898 154.473  1.00 89.77           C  
ATOM   1217  O6   DG I  39     139.032 142.509 155.433  1.00 89.77           O  
ATOM   1218  N1   DG I  39     140.367 140.822 154.692  1.00 89.77           N  
ATOM   1219  C2   DG I  39     140.961 140.079 153.704  1.00 89.77           C  
ATOM   1220  N2   DG I  39     141.751 139.074 154.087  1.00 89.77           N  
ATOM   1221  N3   DG I  39     140.796 140.298 152.426  1.00 89.77           N  
ATOM   1222  C4   DG I  39     139.977 141.334 152.195  1.00 89.77           C  
ATOM   1223  H5'  DG I  39     141.449 144.450 148.661  1.00 89.77           H  
ATOM   1224 H5''  DG I  39     141.136 144.430 147.115  1.00 89.77           H  
ATOM   1225  H4'  DG I  39     141.880 142.339 147.483  1.00 89.77           H  
ATOM   1226  H3'  DG I  39     139.400 142.218 146.758  1.00 89.77           H  
ATOM   1227  H2'  DG I  39     138.382 141.795 148.719  1.00 89.77           H  
ATOM   1228 H2''  DG I  39     138.797 140.329 148.411  1.00 89.77           H  
ATOM   1229  H1'  DG I  39     140.427 140.340 149.845  1.00 89.77           H  
ATOM   1230  H8   DG I  39     138.404 143.345 150.491  1.00 89.77           H  
ATOM   1231  H1   DG I  39     140.533 140.607 155.506  1.00 89.77           H  
ATOM   1232  H21  DG I  39     142.009 138.488 153.512  1.00 89.77           H  
ATOM   1233  H22  DG I  39     142.000 139.012 154.907  1.00 89.77           H  
ATOM   1234  P    DG I  40     139.543 139.459 145.888  1.00103.33           P  
ATOM   1235  OP1  DG I  40     140.035 139.267 144.509  1.00103.33           O  
ATOM   1236  OP2  DG I  40     138.128 139.831 146.096  1.00103.33           O  
ATOM   1237  O5'  DG I  40     139.829 138.125 146.734  1.00103.33           O  
ATOM   1238  C5'  DG I  40     141.063 138.011 147.437  1.00103.33           C  
ATOM   1239  C4'  DG I  40     141.287 136.627 148.060  1.00103.33           C  
ATOM   1240  O4'  DG I  40     141.090 136.709 149.496  1.00103.33           O  
ATOM   1241  C3'  DG I  40     140.378 135.494 147.595  1.00103.33           C  
ATOM   1242  O3'  DG I  40     141.105 134.253 147.615  1.00103.33           O  
ATOM   1243  C2'  DG I  40     139.225 135.530 148.601  1.00103.33           C  
ATOM   1244  C1'  DG I  40     139.862 136.106 149.874  1.00103.33           C  
ATOM   1245  N9   DG I  40     139.060 137.122 150.572  1.00103.33           N  
ATOM   1246  C8   DG I  40     138.410 138.194 150.019  1.00103.33           C  
ATOM   1247  N7   DG I  40     137.801 138.946 150.887  1.00103.33           N  
ATOM   1248  C5   DG I  40     138.070 138.343 152.101  1.00103.33           C  
ATOM   1249  C6   DG I  40     137.673 138.712 153.402  1.00103.33           C  
ATOM   1250  O6   DG I  40     136.976 139.675 153.747  1.00103.33           O  
ATOM   1251  N1   DG I  40     138.160 137.827 154.356  1.00103.33           N  
ATOM   1252  C2   DG I  40     138.936 136.728 154.084  1.00103.33           C  
ATOM   1253  N2   DG I  40     139.318 135.993 155.132  1.00103.33           N  
ATOM   1254  N3   DG I  40     139.319 136.373 152.867  1.00103.33           N  
ATOM   1255  C4   DG I  40     138.853 137.224 151.928  1.00103.33           C  
ATOM   1256  H5'  DG I  40     141.078 138.674 148.144  1.00103.33           H  
ATOM   1257 H5''  DG I  40     141.789 138.196 146.822  1.00103.33           H  
ATOM   1258  H4'  DG I  40     142.206 136.366 147.892  1.00103.33           H  
ATOM   1259  H3'  DG I  40     140.048 135.672 146.701  1.00103.33           H  
ATOM   1260  H2'  DG I  40     138.513 136.098 148.277  1.00103.33           H  
ATOM   1261 H2''  DG I  40     138.893 134.639 148.771  1.00103.33           H  
ATOM   1262  H1'  DG I  40     140.046 135.377 150.488  1.00103.33           H  
ATOM   1263  H8   DG I  40     138.400 138.365 149.106  1.00103.33           H  
ATOM   1264  H1   DG I  40     137.961 137.980 155.178  1.00103.33           H  
ATOM   1265  H21  DG I  40     139.846 135.324 155.018  1.00103.33           H  
ATOM   1266  H22  DG I  40     139.039 136.192 155.921  1.00103.33           H  
ATOM   1267  P    DA I  41     140.401 132.858 147.232  1.00104.23           P  
ATOM   1268  OP1  DA I  41     141.473 131.924 146.826  1.00104.23           O  
ATOM   1269  OP2  DA I  41     139.277 133.140 146.315  1.00104.23           O  
ATOM   1270  O5'  DA I  41     139.791 132.356 148.622  1.00104.23           O  
ATOM   1271  C5'  DA I  41     140.608 132.353 149.787  1.00104.23           C  
ATOM   1272  C4'  DA I  41     139.838 131.891 151.011  1.00104.23           C  
ATOM   1273  O4'  DA I  41     139.193 133.036 151.639  1.00104.23           O  
ATOM   1274  C3'  DA I  41     138.725 130.880 150.736  1.00104.23           C  
ATOM   1275  O3'  DA I  41     138.719 129.859 151.723  1.00104.23           O  
ATOM   1276  C2'  DA I  41     137.474 131.738 150.782  1.00104.23           C  
ATOM   1277  C1'  DA I  41     137.835 132.735 151.866  1.00104.23           C  
ATOM   1278  N9   DA I  41     137.063 133.975 151.850  1.00104.23           N  
ATOM   1279  C8   DA I  41     136.831 134.786 150.780  1.00104.23           C  
ATOM   1280  N7   DA I  41     136.112 135.843 151.059  1.00104.23           N  
ATOM   1281  C5   DA I  41     135.857 135.720 152.409  1.00104.23           C  
ATOM   1282  C6   DA I  41     135.145 136.525 153.309  1.00104.23           C  
ATOM   1283  N6   DA I  41     134.535 137.656 152.950  1.00104.23           N  
ATOM   1284  N1   DA I  41     135.077 136.122 154.594  1.00104.23           N  
ATOM   1285  C2   DA I  41     135.694 134.987 154.945  1.00104.23           C  
ATOM   1286  N3   DA I  41     136.392 134.145 154.185  1.00104.23           N  
ATOM   1287  C4   DA I  41     136.440 134.578 152.917  1.00104.23           C  
ATOM   1288  H5'  DA I  41     140.936 133.251 149.942  1.00104.23           H  
ATOM   1289 H5''  DA I  41     141.361 131.760 149.644  1.00104.23           H  
ATOM   1290  H4'  DA I  41     140.462 131.500 151.642  1.00104.23           H  
ATOM   1291  H3'  DA I  41     138.833 130.491 149.857  1.00104.23           H  
ATOM   1292  H2'  DA I  41     137.334 132.181 149.932  1.00104.23           H  
ATOM   1293 H2''  DA I  41     136.704 131.213 151.035  1.00104.23           H  
ATOM   1294  H1'  DA I  41     137.743 132.313 152.732  1.00104.23           H  
ATOM   1295  H8   DA I  41     137.149 134.602 149.932  1.00104.23           H  
ATOM   1296  H61  DA I  41     133.989 138.042 153.491  1.00104.23           H  
ATOM   1297  H62  DA I  41     134.686 137.998 152.175  1.00104.23           H  
ATOM   1298  H2   DA I  41     135.618 134.750 155.839  1.00104.23           H  
ATOM   1299  P    DA I  42     137.934 128.483 151.457  1.00101.87           P  
ATOM   1300  OP1  DA I  42     138.927 127.389 151.522  1.00101.87           O  
ATOM   1301  OP2  DA I  42     137.109 128.659 150.242  1.00101.87           O  
ATOM   1302  O5'  DA I  42     136.949 128.357 152.709  1.00101.87           O  
ATOM   1303  C5'  DA I  42     137.486 128.291 154.018  1.00101.87           C  
ATOM   1304  C4'  DA I  42     136.427 128.595 155.062  1.00101.87           C  
ATOM   1305  O4'  DA I  42     136.026 129.990 154.952  1.00101.87           O  
ATOM   1306  C3'  DA I  42     135.145 127.767 154.938  1.00101.87           C  
ATOM   1307  O3'  DA I  42     134.773 127.220 156.204  1.00101.87           O  
ATOM   1308  C2'  DA I  42     134.118 128.763 154.413  1.00101.87           C  
ATOM   1309  C1'  DA I  42     134.621 130.081 154.970  1.00101.87           C  
ATOM   1310  N9   DA I  42     134.212 131.245 154.195  1.00101.87           N  
ATOM   1311  C8   DA I  42     134.527 131.518 152.899  1.00101.87           C  
ATOM   1312  N7   DA I  42     134.018 132.634 152.453  1.00101.87           N  
ATOM   1313  C5   DA I  42     133.322 133.131 153.534  1.00101.87           C  
ATOM   1314  C6   DA I  42     132.565 134.296 153.710  1.00101.87           C  
ATOM   1315  N6   DA I  42     132.376 135.193 152.746  1.00101.87           N  
ATOM   1316  N1   DA I  42     131.999 134.500 154.915  1.00101.87           N  
ATOM   1317  C2   DA I  42     132.195 133.596 155.880  1.00101.87           C  
ATOM   1318  N3   DA I  42     132.885 132.459 155.829  1.00101.87           N  
ATOM   1319  C4   DA I  42     133.433 132.290 154.618  1.00101.87           C  
ATOM   1320  H5'  DA I  42     138.206 128.936 154.097  1.00101.87           H  
ATOM   1321 H5''  DA I  42     137.838 127.402 154.171  1.00101.87           H  
ATOM   1322  H4'  DA I  42     136.807 128.448 155.942  1.00101.87           H  
ATOM   1323  H3'  DA I  42     135.274 127.055 154.293  1.00101.87           H  
ATOM   1324  H2'  DA I  42     134.119 128.775 153.445  1.00101.87           H  
ATOM   1325 H2''  DA I  42     133.236 128.562 154.755  1.00101.87           H  
ATOM   1326  H1'  DA I  42     134.317 130.181 155.884  1.00101.87           H  
ATOM   1327  H8   DA I  42     135.050 130.958 152.378  1.00101.87           H  
ATOM   1328  H61  DA I  42     131.796 135.820 152.849  1.00101.87           H  
ATOM   1329  H62  DA I  42     132.835 135.147 152.021  1.00101.87           H  
ATOM   1330  H2   DA I  42     131.781 133.778 156.691  1.00101.87           H  
ATOM   1331  P    DA I  43     133.566 126.163 156.312  1.00109.81           P  
ATOM   1332  OP1  DA I  43     133.952 125.136 157.303  1.00109.81           O  
ATOM   1333  OP2  DA I  43     133.200 125.757 154.936  1.00109.81           O  
ATOM   1334  O5'  DA I  43     132.352 127.023 156.903  1.00109.81           O  
ATOM   1335  C5'  DA I  43     132.428 127.556 158.219  1.00109.81           C  
ATOM   1336  C4'  DA I  43     131.162 128.309 158.572  1.00109.81           C  
ATOM   1337  O4'  DA I  43     131.120 129.543 157.812  1.00109.81           O  
ATOM   1338  C3'  DA I  43     129.862 127.559 158.262  1.00109.81           C  
ATOM   1339  O3'  DA I  43     129.027 127.488 159.416  1.00109.81           O  
ATOM   1340  C2'  DA I  43     129.220 128.356 157.125  1.00109.81           C  
ATOM   1341  C1'  DA I  43     129.837 129.734 157.264  1.00109.81           C  
ATOM   1342  N9   DA I  43     129.974 130.450 155.996  1.00109.81           N  
ATOM   1343  C8   DA I  43     130.727 130.079 154.917  1.00109.81           C  
ATOM   1344  N7   DA I  43     130.663 130.916 153.913  1.00109.81           N  
ATOM   1345  C5   DA I  43     129.814 131.909 154.364  1.00109.81           C  
ATOM   1346  C6   DA I  43     129.343 133.093 153.769  1.00109.81           C  
ATOM   1347  N6   DA I  43     129.679 133.473 152.538  1.00109.81           N  
ATOM   1348  N1   DA I  43     128.505 133.869 154.489  1.00109.81           N  
ATOM   1349  C2   DA I  43     128.171 133.479 155.726  1.00109.81           C  
ATOM   1350  N3   DA I  43     128.551 132.387 156.391  1.00109.81           N  
ATOM   1351  C4   DA I  43     129.383 131.641 155.648  1.00109.81           C  
ATOM   1352  H5'  DA I  43     133.182 128.160 158.275  1.00109.81           H  
ATOM   1353 H5''  DA I  43     132.553 126.832 158.850  1.00109.81           H  
ATOM   1354  H4'  DA I  43     131.180 128.525 159.516  1.00109.81           H  
ATOM   1355  H3'  DA I  43     130.070 126.664 157.955  1.00109.81           H  
ATOM   1356  H2'  DA I  43     129.445 127.965 156.268  1.00109.81           H  
ATOM   1357 H2''  DA I  43     128.259 128.404 157.238  1.00109.81           H  
ATOM   1358  H1'  DA I  43     129.302 130.262 157.875  1.00109.81           H  
ATOM   1359  H8   DA I  43     131.231 129.302 154.895  1.00109.81           H  
ATOM   1360  H61  DA I  43     129.344 134.192 152.204  1.00109.81           H  
ATOM   1361  H62  DA I  43     130.227 132.999 152.076  1.00109.81           H  
ATOM   1362  H2   DA I  43     127.592 134.046 156.182  1.00109.81           H  
ATOM   1363  P    DC I  44     127.667 126.630 159.382  1.00105.06           P  
ATOM   1364  OP1  DC I  44     127.386 126.175 160.760  1.00105.06           O  
ATOM   1365  OP2  DC I  44     127.770 125.644 158.285  1.00105.06           O  
ATOM   1366  O5'  DC I  44     126.560 127.702 158.967  1.00105.06           O  
ATOM   1367  C5'  DC I  44     126.448 128.903 159.703  1.00105.06           C  
ATOM   1368  C4'  DC I  44     125.476 129.865 159.049  1.00105.06           C  
ATOM   1369  O4'  DC I  44     126.074 130.414 157.847  1.00105.06           O  
ATOM   1370  C3'  DC I  44     124.142 129.250 158.615  1.00105.06           C  
ATOM   1371  O3'  DC I  44     123.060 129.953 159.215  1.00105.06           O  
ATOM   1372  C2'  DC I  44     124.153 129.381 157.088  1.00105.06           C  
ATOM   1373  C1'  DC I  44     125.071 130.565 156.878  1.00105.06           C  
ATOM   1374  N1   DC I  44     125.730 130.653 155.514  1.00105.06           N  
ATOM   1375  C2   DC I  44     125.472 131.750 154.668  1.00105.06           C  
ATOM   1376  O2   DC I  44     124.679 132.625 155.034  1.00105.06           O  
ATOM   1377  N3   DC I  44     126.099 131.813 153.468  1.00105.06           N  
ATOM   1378  C4   DC I  44     126.941 130.849 153.105  1.00105.06           C  
ATOM   1379  N4   DC I  44     127.541 130.956 151.918  1.00105.06           N  
ATOM   1380  C5   DC I  44     127.224 129.741 153.951  1.00105.06           C  
ATOM   1381  C6   DC I  44     126.609 129.688 155.133  1.00105.06           C  
ATOM   1382  H5'  DC I  44     127.320 129.322 159.758  1.00105.06           H  
ATOM   1383 H5''  DC I  44     126.138 128.698 160.597  1.00105.06           H  
ATOM   1384  H4'  DC I  44     125.296 130.590 159.665  1.00105.06           H  
ATOM   1385  H3'  DC I  44     124.110 128.316 158.867  1.00105.06           H  
ATOM   1386  H2'  DC I  44     124.518 128.585 156.678  1.00105.06           H  
ATOM   1387 H2''  DC I  44     123.267 129.571 156.753  1.00105.06           H  
ATOM   1388  H1'  DC I  44     124.581 131.376 157.060  1.00105.06           H  
ATOM   1389  H41  DC I  44     128.068 130.333 151.646  1.00105.06           H  
ATOM   1390  H42  DC I  44     127.406 131.650 151.429  1.00105.06           H  
ATOM   1391  H5   DC I  44     127.820 129.080 153.691  1.00105.06           H  
ATOM   1392  H6   DC I  44     126.775 128.975 155.701  1.00105.06           H  
ATOM   1393  P    DT I  45     121.575 129.341 159.196  1.00101.19           P  
ATOM   1394  OP1  DT I  45     121.313 128.813 160.552  1.00101.19           O  
ATOM   1395  OP2  DT I  45     121.455 128.446 158.026  1.00101.19           O  
ATOM   1396  O5'  DT I  45     120.629 130.610 158.949  1.00101.19           O  
ATOM   1397  C5'  DT I  45     121.119 131.742 158.238  1.00101.19           C  
ATOM   1398  C4'  DT I  45     120.096 132.305 157.261  1.00101.19           C  
ATOM   1399  O4'  DT I  45     120.756 132.500 155.972  1.00101.19           O  
ATOM   1400  C3'  DT I  45     118.902 131.419 156.934  1.00101.19           C  
ATOM   1401  O3'  DT I  45     117.830 132.189 156.426  1.00101.19           O  
ATOM   1402  C2'  DT I  45     119.500 130.530 155.873  1.00101.19           C  
ATOM   1403  C1'  DT I  45     120.208 131.589 155.031  1.00101.19           C  
ATOM   1404  N1   DT I  45     121.305 131.110 154.083  1.00101.19           N  
ATOM   1405  C2   DT I  45     121.626 131.910 153.018  1.00101.19           C  
ATOM   1406  O2   DT I  45     121.087 132.978 152.802  1.00101.19           O  
ATOM   1407  N3   DT I  45     122.610 131.424 152.209  1.00101.19           N  
ATOM   1408  C4   DT I  45     123.295 130.238 152.348  1.00101.19           C  
ATOM   1409  O4   DT I  45     124.168 129.886 151.564  1.00101.19           O  
ATOM   1410  C5   DT I  45     122.916 129.441 153.474  1.00101.19           C  
ATOM   1411  C7   DT I  45     123.601 128.138 153.720  1.00101.19           C  
ATOM   1412  C6   DT I  45     121.952 129.902 154.280  1.00101.19           C  
ATOM   1413  H5'  DT I  45     121.908 131.484 157.742  1.00101.19           H  
ATOM   1414 H5''  DT I  45     121.357 132.432 158.875  1.00101.19           H  
ATOM   1415  H4'  DT I  45     119.777 133.158 157.590  1.00101.19           H  
ATOM   1416  H3'  DT I  45     118.621 130.906 157.702  1.00101.19           H  
ATOM   1417  H2'  DT I  45     120.119 129.906 156.273  1.00101.19           H  
ATOM   1418 H2''  DT I  45     118.812 130.078 155.363  1.00101.19           H  
ATOM   1419  H1'  DT I  45     119.538 132.054 154.509  1.00101.19           H  
ATOM   1420  H3   DT I  45     122.827 131.914 151.537  1.00101.19           H  
ATOM   1421  H71  DT I  45     123.577 127.936 154.665  1.00101.19           H  
ATOM   1422  H72  DT I  45     123.150 127.438 153.227  1.00101.19           H  
ATOM   1423  H73  DT I  45     124.523 128.199 153.426  1.00101.19           H  
ATOM   1424  H6   DT I  45     121.712 129.387 155.009  1.00101.19           H  
ATOM   1425  P    DG I  46     116.579 132.562 157.356  1.00 95.75           P  
ATOM   1426  OP1  DG I  46     117.066 133.495 158.396  1.00 95.75           O  
ATOM   1427  OP2  DG I  46     115.926 131.296 157.755  1.00 95.75           O  
ATOM   1428  O5'  DG I  46     115.591 133.340 156.363  1.00 95.75           O  
ATOM   1429  C5'  DG I  46     116.052 134.484 155.646  1.00 95.75           C  
ATOM   1430  C4'  DG I  46     115.857 134.309 154.157  1.00 95.75           C  
ATOM   1431  O4'  DG I  46     116.805 133.324 153.648  1.00 95.75           O  
ATOM   1432  C3'  DG I  46     114.477 133.789 153.742  1.00 95.75           C  
ATOM   1433  O3'  DG I  46     114.037 134.434 152.577  1.00 95.75           O  
ATOM   1434  C2'  DG I  46     114.751 132.324 153.483  1.00 95.75           C  
ATOM   1435  C1'  DG I  46     116.091 132.450 152.810  1.00 95.75           C  
ATOM   1436  N9   DG I  46     116.827 131.208 152.617  1.00 95.75           N  
ATOM   1437  C8   DG I  46     116.669 130.012 153.273  1.00 95.75           C  
ATOM   1438  N7   DG I  46     117.478 129.081 152.848  1.00 95.75           N  
ATOM   1439  C5   DG I  46     118.207 129.703 151.846  1.00 95.75           C  
ATOM   1440  C6   DG I  46     119.233 129.204 151.018  1.00 95.75           C  
ATOM   1441  O6   DG I  46     119.722 128.072 151.002  1.00 95.75           O  
ATOM   1442  N1   DG I  46     119.699 130.174 150.132  1.00 95.75           N  
ATOM   1443  C2   DG I  46     119.226 131.464 150.061  1.00 95.75           C  
ATOM   1444  N2   DG I  46     119.786 132.270 149.147  1.00 95.75           N  
ATOM   1445  N3   DG I  46     118.268 131.937 150.833  1.00 95.75           N  
ATOM   1446  C4   DG I  46     117.810 131.007 151.696  1.00 95.75           C  
ATOM   1447  H5'  DG I  46     116.993 134.618 155.829  1.00 95.75           H  
ATOM   1448 H5''  DG I  46     115.557 135.264 155.939  1.00 95.75           H  
ATOM   1449  H4'  DG I  46     116.018 135.157 153.718  1.00 95.75           H  
ATOM   1450  H3'  DG I  46     113.838 133.900 154.462  1.00 95.75           H  
ATOM   1451  H2'  DG I  46     114.815 131.829 154.313  1.00 95.75           H  
ATOM   1452 H2''  DG I  46     114.091 131.942 152.885  1.00 95.75           H  
ATOM   1453  H1'  DG I  46     115.969 132.876 151.952  1.00 95.75           H  
ATOM   1454  H8   DG I  46     116.052 129.881 153.954  1.00 95.75           H  
ATOM   1455  H1   DG I  46     120.327 129.949 149.589  1.00 95.75           H  
ATOM   1456  H21  DG I  46     119.534 133.092 149.084  1.00 95.75           H  
ATOM   1457  H22  DG I  46     120.396 131.967 148.621  1.00 95.75           H  
ATOM   1458  P  A DC I  47     113.220 135.763 152.674  0.50 96.28           P  
ATOM   1459  P  B DC I  47     113.261 135.778 152.660  0.50 96.28           P  
ATOM   1460  OP1A DC I  47     113.810 136.552 153.778  0.50 96.28           O  
ATOM   1461  OP1B DC I  47     113.875 136.572 153.747  0.50 96.28           O  
ATOM   1462  OP2A DC I  47     111.784 135.408 152.703  0.50 96.28           O  
ATOM   1463  OP2B DC I  47     111.816 135.459 152.702  0.50 96.28           O  
ATOM   1464  O5'A DC I  47     113.522 136.497 151.284  0.50 96.28           O  
ATOM   1465  O5'B DC I  47     113.573 136.476 151.253  0.50 96.28           O  
ATOM   1466  C5'A DC I  47     114.785 137.119 151.069  0.50 96.28           C  
ATOM   1467  C5'B DC I  47     114.852 137.064 151.019  0.50 96.28           C  
ATOM   1468  C4'A DC I  47     115.196 137.045 149.609  0.50 96.28           C  
ATOM   1469  C4'B DC I  47     115.282 136.916 149.567  0.50 96.28           C  
ATOM   1470  O4'A DC I  47     115.875 135.781 149.370  0.50 96.28           O  
ATOM   1471  O4'B DC I  47     115.927 135.626 149.390  0.50 96.28           O  
ATOM   1472  C3'A DC I  47     114.045 137.099 148.608  0.50 96.28           C  
ATOM   1473  C3'B DC I  47     114.151 136.984 148.544  0.50 96.28           C  
ATOM   1474  O3'A DC I  47     114.414 137.850 147.467  0.50 96.28           O  
ATOM   1475  O3'B DC I  47     114.503 137.837 147.475  0.50 96.28           O  
ATOM   1476  C2'A DC I  47     113.804 135.634 148.300  0.50 96.28           C  
ATOM   1477  C2'B DC I  47     113.963 135.537 148.110  0.50 96.28           C  
ATOM   1478  C1'A DC I  47     115.223 135.076 148.341  0.50 96.28           C  
ATOM   1479  C1'B DC I  47     115.355 134.932 148.306  0.50 96.28           C  
ATOM   1480  N1 A DC I  47     115.358 133.560 148.612  0.50 96.28           N  
ATOM   1481  N1 B DC I  47     115.404 133.414 148.625  0.50 96.28           N  
ATOM   1482  C2 A DC I  47     116.382 132.832 147.985  0.50 96.28           C  
ATOM   1483  C2 B DC I  47     116.393 132.590 148.041  0.50 96.28           C  
ATOM   1484  O2 A DC I  47     117.155 133.410 147.214  0.50 96.28           O  
ATOM   1485  O2 B DC I  47     117.210 133.070 147.248  0.50 96.28           O  
ATOM   1486  N3 A DC I  47     116.497 131.504 148.236  0.50 96.28           N  
ATOM   1487  N3 B DC I  47     116.415 131.268 148.357  0.50 96.28           N  
ATOM   1488  C4 A DC I  47     115.656 130.907 149.071  0.50 96.28           C  
ATOM   1489  C4 B DC I  47     115.529 130.770 149.210  0.50 96.28           C  
ATOM   1490  N4 A DC I  47     115.809 129.600 149.286  0.50 96.28           N  
ATOM   1491  N4 B DC I  47     115.589 129.467 149.489  0.50 96.28           N  
ATOM   1492  C5 A DC I  47     114.617 131.621 149.723  0.50 96.28           C  
ATOM   1493  C5 B DC I  47     114.536 131.580 149.816  0.50 96.28           C  
ATOM   1494  C6 A DC I  47     114.513 132.929 149.480  0.50 96.28           C  
ATOM   1495  C6 B DC I  47     114.519 132.877 149.514  0.50 96.28           C  
ATOM   1496  H5'A DC I  47     115.454 136.670 151.610  0.50 96.28           H  
ATOM   1497  H5'B DC I  47     115.507 136.630 151.589  0.50 96.28           H  
ATOM   1498 H5''A DC I  47     114.732 138.049 151.337  0.50 96.28           H  
ATOM   1499 H5''B DC I  47     114.813 138.007 151.243  0.50 96.28           H  
ATOM   1500  H4'A DC I  47     115.809 137.769 149.417  0.50 96.28           H  
ATOM   1501  H4'B DC I  47     115.923 137.612 149.361  0.50 96.28           H  
ATOM   1502  H3'A DC I  47     113.261 137.485 149.022  0.50 96.28           H  
ATOM   1503  H3'B DC I  47     113.344 137.307 148.965  0.50 96.28           H  
ATOM   1504  H2'A DC I  47     113.241 135.245 148.977  0.50 96.28           H  
ATOM   1505  H2'B DC I  47     113.305 135.115 148.670  0.50 96.28           H  
ATOM   1506 H2''A DC I  47     113.417 135.522 147.422  0.50 96.28           H  
ATOM   1507 H2''B DC I  47     113.701 135.489 147.182  0.50 96.28           H  
ATOM   1508  H1'A DC I  47     115.653 135.288 147.499  0.50 96.28           H  
ATOM   1509  H1'B DC I  47     115.880 135.108 147.511  0.50 96.28           H  
ATOM   1510  H41A DC I  47     115.426 129.228 149.959  0.50 96.28           H  
ATOM   1511  H41B DC I  47     115.125 129.146 150.136  0.50 96.28           H  
ATOM   1512  H42A DC I  47     116.293 129.130 148.753  0.50 96.28           H  
ATOM   1513  H42B DC I  47     116.096 128.952 149.025  0.50 96.28           H  
ATOM   1514  H5 A DC I  47     114.035 131.194 150.303  0.50 96.28           H  
ATOM   1515  H5 B DC I  47     113.924 131.219 150.409  0.50 96.28           H  
ATOM   1516  H6 A DC I  47     113.836 133.413 149.890  0.50 96.28           H  
ATOM   1517  H6 B DC I  47     113.872 133.423 149.895  0.50 96.28           H  
ATOM   1518  P  A DT I  48     113.365 138.116 146.305  0.50 95.17           P  
ATOM   1519  P  B DT I  48     113.449 138.172 146.336  0.50 95.17           P  
ATOM   1520  OP1A DT I  48     113.474 139.537 145.904  0.50 95.17           O  
ATOM   1521  OP1B DT I  48     113.590 139.603 145.983  0.50 95.17           O  
ATOM   1522  OP2A DT I  48     112.061 137.578 146.751  0.50 95.17           O  
ATOM   1523  OP2B DT I  48     112.136 137.651 146.776  0.50 95.17           O  
ATOM   1524  O5'A DT I  48     113.895 137.192 145.113  0.50 95.17           O  
ATOM   1525  O5'B DT I  48     113.941 137.275 145.110  0.50 95.17           O  
ATOM   1526  C5'A DT I  48     115.270 137.228 144.754  0.50 95.17           C  
ATOM   1527  C5'B DT I  48     115.314 137.281 144.741  0.50 95.17           C  
ATOM   1528  C4'A DT I  48     115.617 136.100 143.807  0.50 95.17           C  
ATOM   1529  C4'B DT I  48     115.636 136.128 143.820  0.50 95.17           C  
ATOM   1530  O4'A DT I  48     115.628 134.845 144.543  0.50 95.17           O  
ATOM   1531  O4'B DT I  48     115.620 134.889 144.578  0.50 95.17           O  
ATOM   1532  C3'A DT I  48     114.641 135.906 142.642  0.50 95.17           C  
ATOM   1533  C3'B DT I  48     114.659 135.934 142.655  0.50 95.17           C  
ATOM   1534  O3'A DT I  48     115.357 135.736 141.430  0.50 95.17           O  
ATOM   1535  O3'B DT I  48     115.376 135.881 141.429  0.50 95.17           O  
ATOM   1536  C2'A DT I  48     113.865 134.662 143.050  0.50 95.17           C  
ATOM   1537  C2'B DT I  48     113.952 134.622 142.995  0.50 95.17           C  
ATOM   1538  C1'A DT I  48     114.923 133.878 143.808  0.50 95.17           C  
ATOM   1539  C1'B DT I  48     115.011 133.892 143.804  0.50 95.17           C  
ATOM   1540  N1 A DT I  48     114.399 132.815 144.758  0.50 95.17           N  
ATOM   1541  N1 B DT I  48     114.497 132.801 144.727  0.50 95.17           N  
ATOM   1542  C2 A DT I  48     114.920 131.539 144.705  0.50 95.17           C  
ATOM   1543  C2 B DT I  48     115.045 131.537 144.660  0.50 95.17           C  
ATOM   1544  O2 A DT I  48     115.777 131.194 143.914  0.50 95.17           O  
ATOM   1545  O2 B DT I  48     115.911 131.219 143.866  0.50 95.17           O  
ATOM   1546  N3 A DT I  48     114.390 130.668 145.616  0.50 95.17           N  
ATOM   1547  N3 B DT I  48     114.519 130.640 145.547  0.50 95.17           N  
ATOM   1548  C4 A DT I  48     113.421 130.935 146.557  0.50 95.17           C  
ATOM   1549  C4 B DT I  48     113.539 130.873 146.485  0.50 95.17           C  
ATOM   1550  O4 A DT I  48     113.011 130.084 147.336  0.50 95.17           O  
ATOM   1551  O4 B DT I  48     113.136 130.003 147.245  0.50 95.17           O  
ATOM   1552  C5 A DT I  48     112.926 132.283 146.565  0.50 95.17           C  
ATOM   1553  C5 B DT I  48     113.022 132.210 146.514  0.50 95.17           C  
ATOM   1554  C7 A DT I  48     111.868 132.687 147.544  0.50 95.17           C  
ATOM   1555  C7 B DT I  48     111.948 132.574 147.489  0.50 95.17           C  
ATOM   1556  C6 A DT I  48     113.436 133.148 145.685  0.50 95.17           C  
ATOM   1557  C6 B DT I  48     113.521 133.100 145.652  0.50 95.17           C  
ATOM   1558  H5'A DT I  48     115.811 137.145 145.554  0.50 95.17           H  
ATOM   1559  H5'B DT I  48     115.859 137.207 145.539  0.50 95.17           H  
ATOM   1560 H5''A DT I  48     115.465 138.074 144.324  0.50 95.17           H  
ATOM   1561 H5''B DT I  48     115.519 138.114 144.291  0.50 95.17           H  
ATOM   1562  H4'A DT I  48     116.502 136.257 143.447  0.50 95.17           H  
ATOM   1563  H4'B DT I  48     116.525 136.258 143.458  0.50 95.17           H  
ATOM   1564  H3'A DT I  48     114.044 136.665 142.575  0.50 95.17           H  
ATOM   1565  H3'B DT I  48     114.018 136.659 142.633  0.50 95.17           H  
ATOM   1566  H2'A DT I  48     113.122 134.902 143.620  0.50 95.17           H  
ATOM   1567  H2'B DT I  48     113.160 134.794 143.523  0.50 95.17           H  
ATOM   1568 H2''A DT I  48     113.564 134.174 142.279  0.50 95.17           H  
ATOM   1569 H2''B DT I  48     113.734 134.131 142.198  0.50 95.17           H  
ATOM   1570  H1'A DT I  48     115.524 133.471 143.170  0.50 95.17           H  
ATOM   1571  H1'B DT I  48     115.667 133.522 143.199  0.50 95.17           H  
ATOM   1572  H3 A DT I  48     114.695 129.867 145.601  0.50 95.17           H  
ATOM   1573  H3 B DT I  48     114.837 129.844 145.521  0.50 95.17           H  
ATOM   1574  H71A DT I  48     111.943 133.635 147.727  0.50 95.17           H  
ATOM   1575  H71B DT I  48     111.997 133.520 147.684  0.50 95.17           H  
ATOM   1576  H72A DT I  48     110.994 132.498 147.168  0.50 95.17           H  
ATOM   1577  H72B DT I  48     111.082 132.368 147.105  0.50 95.17           H  
ATOM   1578  H73A DT I  48     111.981 132.187 148.366  0.50 95.17           H  
ATOM   1579  H73B DT I  48     112.068 132.067 148.306  0.50 95.17           H  
ATOM   1580  H6 A DT I  48     113.114 134.017 145.687  0.50 95.17           H  
ATOM   1581  H6 B DT I  48     113.185 133.963 145.669  0.50 95.17           H  
ATOM   1582  P  A DC I  49     114.603 135.611 140.027  0.50 91.66           P  
ATOM   1583  P  B DC I  49     114.627 135.756 140.025  0.50 91.66           P  
ATOM   1584  OP1A DC I  49     115.045 136.761 139.216  0.50 91.66           O  
ATOM   1585  OP1B DC I  49     115.010 136.938 139.226  0.50 91.66           O  
ATOM   1586  OP2A DC I  49     113.152 135.436 140.250  0.50 91.66           O  
ATOM   1587  OP2B DC I  49     113.190 135.494 140.250  0.50 91.66           O  
ATOM   1588  O5'A DC I  49     115.190 134.251 139.411  0.50 91.66           O  
ATOM   1589  O5'B DC I  49     115.288 134.448 139.380  0.50 91.66           O  
ATOM   1590  C5'A DC I  49     116.396 133.684 139.947  0.50 91.66           C  
ATOM   1591  C5'B DC I  49     116.467 133.881 139.973  0.50 91.66           C  
ATOM   1592  C4'A DC I  49     116.758 132.361 139.281  0.50 91.66           C  
ATOM   1593  C4'B DC I  49     116.931 132.620 139.249  0.50 91.66           C  
ATOM   1594  O4'A DC I  49     116.362 131.272 140.152  0.50 91.66           O  
ATOM   1595  O4'B DC I  49     116.621 131.469 140.073  0.50 91.66           O  
ATOM   1596  C3'A DC I  49     116.071 132.071 137.959  0.50 91.66           C  
ATOM   1597  C3'B DC I  49     116.258 132.330 137.919  0.50 91.66           C  
ATOM   1598  O3'A DC I  49     116.841 131.167 137.179  0.50 91.66           O  
ATOM   1599  O3'B DC I  49     117.068 131.481 137.108  0.50 91.66           O  
ATOM   1600  C2'A DC I  49     114.761 131.470 138.417  0.50 91.66           C  
ATOM   1601  C2'B DC I  49     114.989 131.654 138.372  0.50 91.66           C  
ATOM   1602  C1'A DC I  49     115.202 130.638 139.640  0.50 91.66           C  
ATOM   1603  C1'B DC I  49     115.501 130.788 139.537  0.50 91.66           C  
ATOM   1604  N1 A DC I  49     114.180 130.507 140.789  0.50 91.66           N  
ATOM   1605  N1 B DC I  49     114.501 130.523 140.678  0.50 91.66           N  
ATOM   1606  C2 A DC I  49     114.030 129.282 141.468  0.50 91.66           C  
ATOM   1607  C2 B DC I  49     114.409 129.242 141.254  0.50 91.66           C  
ATOM   1608  O2 A DC I  49     114.701 128.308 141.114  0.50 91.66           O  
ATOM   1609  O2 B DC I  49     115.111 128.323 140.820  0.50 91.66           O  
ATOM   1610  N3 A DC I  49     113.135 129.202 142.483  0.50 91.66           N  
ATOM   1611  N3 B DC I  49     113.523 129.038 142.258  0.50 91.66           N  
ATOM   1612  C4 A DC I  49     112.429 130.270 142.833  0.50 91.66           C  
ATOM   1613  C4 B DC I  49     112.775 130.041 142.701  0.50 91.66           C  
ATOM   1614  N4 A DC I  49     111.569 130.161 143.841  0.50 91.66           N  
ATOM   1615  N4 B DC I  49     111.933 129.800 143.698  0.50 91.66           N  
ATOM   1616  C5 A DC I  49     112.575 131.511 142.176  0.50 91.66           C  
ATOM   1617  C5 B DC I  49     112.861 131.339 142.150  0.50 91.66           C  
ATOM   1618  C6 A DC I  49     113.456 131.589 141.182  0.50 91.66           C  
ATOM   1619  C6 B DC I  49     113.732 131.538 141.162  0.50 91.66           C  
ATOM   1620  H5'A DC I  49     116.273 133.528 140.895  0.50 91.66           H  
ATOM   1621  H5'B DC I  49     116.274 133.654 140.895  0.50 91.66           H  
ATOM   1622 H5''A DC I  49     117.123 134.311 139.823  0.50 91.66           H  
ATOM   1623 H5''B DC I  49     117.178 134.539 139.952  0.50 91.66           H  
ATOM   1624  H4'A DC I  49     117.717 132.324 139.150  0.50 91.66           H  
ATOM   1625  H4'B DC I  49     117.888 132.662 139.116  0.50 91.66           H  
ATOM   1626  H3'A DC I  49     115.914 132.889 137.470  0.50 91.66           H  
ATOM   1627  H3'B DC I  49     116.056 133.149 137.451  0.50 91.66           H  
ATOM   1628  H2'A DC I  49     114.140 132.166 138.654  0.50 91.66           H  
ATOM   1629  H2'B DC I  49     114.345 132.308 138.661  0.50 91.66           H  
ATOM   1630 H2''A DC I  49     114.393 130.909 137.731  0.50 91.66           H  
ATOM   1631 H2''B DC I  49     114.629 131.111 137.668  0.50 91.66           H  
ATOM   1632  H1'A DC I  49     115.447 129.756 139.332  0.50 91.66           H  
ATOM   1633  H1'B DC I  49     115.799 129.945 139.175  0.50 91.66           H  
ATOM   1634  H41A DC I  49     111.236 130.867 144.199  0.50 91.66           H  
ATOM   1635  H41B DC I  49     111.652 130.449 144.188  0.50 91.66           H  
ATOM   1636  H42A DC I  49     111.363 129.387 144.146  0.50 91.66           H  
ATOM   1637  H42B DC I  49     111.678 128.999 143.859  0.50 91.66           H  
ATOM   1638  H5 A DC I  49     112.076 132.249 142.433  0.50 91.66           H  
ATOM   1639  H5 B DC I  49     112.335 132.031 142.474  0.50 91.66           H  
ATOM   1640  H6 A DC I  49     113.563 132.394 140.732  0.50 91.66           H  
ATOM   1641  H6 B DC I  49     113.803 132.382 140.781  0.50 91.66           H  
ATOM   1642  P  A DA I  50     116.413 130.817 135.682  0.50 91.29           P  
ATOM   1643  OP1A DA I  50     117.556 131.160 134.813  0.50 91.29           O  
ATOM   1644  OP2A DA I  50     115.092 131.419 135.406  0.50 91.29           O  
ATOM   1645  O5'A DA I  50     116.244 129.227 135.698  0.50 91.29           O  
ATOM   1646  C5'A DA I  50     117.327 128.409 136.134  0.50 91.29           C  
ATOM   1647  C4'A DA I  50     116.960 126.930 136.108  0.50 91.29           C  
ATOM   1648  O4'A DA I  50     116.125 126.619 137.253  0.50 91.29           O  
ATOM   1649  C3'A DA I  50     116.184 126.479 134.876  0.50 91.29           C  
ATOM   1650  O3'A DA I  50     116.617 125.196 134.449  0.50 91.29           O  
ATOM   1651  C2'A DA I  50     114.733 126.487 135.338  0.50 91.29           C  
ATOM   1652  C1'A DA I  50     114.828 126.229 136.845  0.50 91.29           C  
ATOM   1653  N9 A DA I  50     113.856 126.970 137.658  0.50 91.29           N  
ATOM   1654  C8 A DA I  50     113.571 128.302 137.590  0.50 91.29           C  
ATOM   1655  N7 A DA I  50     112.675 128.703 138.453  0.50 91.29           N  
ATOM   1656  C5 A DA I  50     112.351 127.560 139.145  0.50 91.29           C  
ATOM   1657  C6 A DA I  50     111.464 127.327 140.202  0.50 91.29           C  
ATOM   1658  N6 A DA I  50     110.707 128.284 140.744  0.50 91.29           N  
ATOM   1659  N1 A DA I  50     111.370 126.066 140.670  0.50 91.29           N  
ATOM   1660  C2 A DA I  50     112.134 125.115 140.119  0.50 91.29           C  
ATOM   1661  N3 A DA I  50     113.011 125.219 139.123  0.50 91.29           N  
ATOM   1662  C4 A DA I  50     113.075 126.480 138.678  0.50 91.29           C  
ATOM   1663  H5'A DA I  50     117.569 128.661 137.040  0.50 91.29           H  
ATOM   1664 H5''A DA I  50     118.087 128.556 135.552  0.50 91.29           H  
ATOM   1665  H4'A DA I  50     117.773 126.408 136.168  0.50 91.29           H  
ATOM   1666  H3'A DA I  50     116.304 127.119 134.160  0.50 91.29           H  
ATOM   1667  H2'A DA I  50     114.328 127.344 135.153  0.50 91.29           H  
ATOM   1668 H2''A DA I  50     114.238 125.780 134.908  0.50 91.29           H  
ATOM   1669  H1'A DA I  50     114.720 125.282 137.009  0.50 91.29           H  
ATOM   1670  H8 A DA I  50     113.973 128.873 136.976  0.50 91.29           H  
ATOM   1671  H62A DA I  50     110.974 129.103 140.726  0.50 91.29           H  
ATOM   1672  H2 A DA I  50     112.035 124.264 140.479  0.50 91.29           H  
ATOM   1673  P  B DC I  50     116.570 131.028 135.642  0.50 91.29           P  
ATOM   1674  OP1B DC I  50     117.697 131.216 134.711  0.50 91.29           O  
ATOM   1675  OP2B DC I  50     115.279 131.687 135.354  0.50 91.29           O  
ATOM   1676  O5'B DC I  50     116.287 129.463 135.801  0.50 91.29           O  
ATOM   1677  C5'B DC I  50     117.344 128.588 136.189  0.50 91.29           C  
ATOM   1678  C4'B DC I  50     116.857 127.149 136.310  0.50 91.29           C  
ATOM   1679  O4'B DC I  50     116.023 127.025 137.490  0.50 91.29           O  
ATOM   1680  C3'B DC I  50     116.039 126.651 135.122  0.50 91.29           C  
ATOM   1681  O3'B DC I  50     116.595 125.453 134.593  0.50 91.29           O  
ATOM   1682  C2'B DC I  50     114.628 126.442 135.666  0.50 91.29           C  
ATOM   1683  C1'B DC I  50     114.781 126.430 137.186  0.50 91.29           C  
ATOM   1684  N1 B DC I  50     113.703 127.206 137.939  0.50 91.29           N  
ATOM   1685  C2 B DC I  50     112.863 126.569 138.872  0.50 91.29           C  
ATOM   1686  O2 B DC I  50     112.957 125.355 139.058  0.50 91.29           O  
ATOM   1687  N3 B DC I  50     111.927 127.310 139.520  0.50 91.29           N  
ATOM   1688  C4 B DC I  50     111.830 128.616 139.294  0.50 91.29           C  
ATOM   1689  N4 B DC I  50     110.915 129.313 139.968  0.50 91.29           N  
ATOM   1690  C5 B DC I  50     112.677 129.276 138.378  0.50 91.29           C  
ATOM   1691  C6 B DC I  50     113.594 128.546 137.736  0.50 91.29           C  
ATOM   1692  H5'B DC I  50     117.697 128.879 137.045  0.50 91.29           H  
ATOM   1693 H5''B DC I  50     118.048 128.629 135.525  0.50 91.29           H  
ATOM   1694  H4'B DC I  50     117.627 126.570 136.416  0.50 91.29           H  
ATOM   1695  H3'B DC I  50     116.023 127.331 134.433  0.50 91.29           H  
ATOM   1696  H2'B DC I  50     114.049 127.164 135.383  0.50 91.29           H  
ATOM   1697 H2''B DC I  50     114.280 125.594 135.363  0.50 91.29           H  
ATOM   1698  H1'B DC I  50     114.792 125.514 137.493  0.50 91.29           H  
ATOM   1699  H41B DC I  50     110.733 130.119 139.736  0.50 91.29           H  
ATOM   1700  H42B DC I  50     110.516 128.959 140.640  0.50 91.29           H  
ATOM   1701  H5 B DC I  50     112.606 130.192 138.236  0.50 91.29           H  
ATOM   1702  H6 B DC I  50     114.162 128.962 137.128  0.50 91.29           H  
ATOM   1703  P  A DA I  51     116.010 124.544 133.136  0.50 95.29           P  
ATOM   1704  P  B DA I  51     116.012 124.821 133.243  0.50 95.29           P  
ATOM   1705  OP1A DA I  51     117.087 123.786 132.467  0.50 95.29           O  
ATOM   1706  OP1B DA I  51     117.102 124.055 132.606  0.50 95.29           O  
ATOM   1707  OP2A DA I  51     115.290 125.605 132.402  0.50 95.29           O  
ATOM   1708  OP2B DA I  51     115.327 125.890 132.490  0.50 95.29           O  
ATOM   1709  O5'A DA I  51     114.919 123.524 133.701  0.50 95.29           O  
ATOM   1710  O5'B DA I  51     114.899 123.797 133.758  0.50 95.29           O  
ATOM   1711  C5'A DA I  51     115.301 122.570 134.678  0.50 95.29           C  
ATOM   1712  C5'B DA I  51     115.258 122.811 134.706  0.50 95.29           C  
ATOM   1713  C4'A DA I  51     114.092 121.925 135.337  0.50 95.29           C  
ATOM   1714  C4'B DA I  51     114.036 122.154 135.332  0.50 95.29           C  
ATOM   1715  O4'A DA I  51     113.424 122.899 136.185  0.50 95.29           O  
ATOM   1716  O4'B DA I  51     113.342 123.108 136.181  0.50 95.29           O  
ATOM   1717  C3'A DA I  51     113.029 121.394 134.370  0.50 95.29           C  
ATOM   1718  C3'B DA I  51     112.991 121.626 134.345  0.50 95.29           C  
ATOM   1719  O3'A DA I  51     112.768 120.019 134.640  0.50 95.29           O  
ATOM   1720  O3'B DA I  51     112.754 120.246 134.609  0.50 95.29           O  
ATOM   1721  C2'A DA I  51     111.817 122.291 134.627  0.50 95.29           C  
ATOM   1722  C2'B DA I  51     111.763 122.513 134.601  0.50 95.29           C  
ATOM   1723  C1'A DA I  51     112.034 122.746 136.058  0.50 95.29           C  
ATOM   1724  C1'B DA I  51     111.955 122.913 136.048  0.50 95.29           C  
ATOM   1725  N9 A DA I  51     111.378 124.015 136.396  0.50 95.29           N  
ATOM   1726  N9 B DA I  51     111.268 124.143 136.464  0.50 95.29           N  
ATOM   1727  C8 A DA I  51     111.589 125.227 135.813  0.50 95.29           C  
ATOM   1728  C8 B DA I  51     111.526 125.413 136.042  0.50 95.29           C  
ATOM   1729  N7 A DA I  51     110.867 126.193 136.316  0.50 95.29           N  
ATOM   1730  N7 B DA I  51     110.778 126.325 136.607  0.50 95.29           N  
ATOM   1731  C5 A DA I  51     110.130 125.574 137.300  0.50 95.29           C  
ATOM   1732  C5 B DA I  51     109.980 125.607 137.469  0.50 95.29           C  
ATOM   1733  C6 A DA I  51     109.171 126.056 138.197  0.50 95.29           C  
ATOM   1734  C6 B DA I  51     108.971 125.996 138.361  0.50 95.29           C  
ATOM   1735  N6 A DA I  51     108.793 127.332 138.244  0.50 95.29           N  
ATOM   1736  N6 B DA I  51     108.592 127.264 138.529  0.50 95.29           N  
ATOM   1737  N1 A DA I  51     108.625 125.183 139.059  0.50 95.29           N  
ATOM   1738  N1 B DA I  51     108.362 125.032 139.076  0.50 95.29           N  
ATOM   1739  C2 A DA I  51     109.013 123.910 139.011  0.50 95.29           C  
ATOM   1740  C2 B DA I  51     108.746 123.767 138.903  0.50 95.29           C  
ATOM   1741  N3 A DA I  51     109.904 123.336 138.208  0.50 95.29           N  
ATOM   1742  N3 B DA I  51     109.684 123.280 138.096  0.50 95.29           N  
ATOM   1743  C4 A DA I  51     110.430 124.232 137.367  0.50 95.29           C  
ATOM   1744  C4 B DA I  51     110.269 124.262 137.401  0.50 95.29           C  
ATOM   1745  H5'A DA I  51     115.834 123.011 135.357  0.50 95.29           H  
ATOM   1746  H5'B DA I  51     115.787 123.225 135.404  0.50 95.29           H  
ATOM   1747 H5''A DA I  51     115.834 121.881 134.254  0.50 95.29           H  
ATOM   1748 H5''B DA I  51     115.790 122.132 134.266  0.50 95.29           H  
ATOM   1749  H4'A DA I  51     114.396 121.191 135.891  0.50 95.29           H  
ATOM   1750  H4'B DA I  51     114.334 121.414 135.883  0.50 95.29           H  
ATOM   1751  H3'A DA I  51     113.332 121.501 133.457  0.50 95.29           H  
ATOM   1752  H3'B DA I  51     113.304 121.744 133.436  0.50 95.29           H  
ATOM   1753  H2'A DA I  51     111.820 123.048 134.021  0.50 95.29           H  
ATOM   1754  H2'B DA I  51     111.775 123.292 134.024  0.50 95.29           H  
ATOM   1755 H2''A DA I  51     110.994 121.792 134.548  0.50 95.29           H  
ATOM   1756 H2''B DA I  51     110.944 122.013 134.490  0.50 95.29           H  
ATOM   1757  H1'A DA I  51     111.731 122.053 136.664  0.50 95.29           H  
ATOM   1758  H1'B DA I  51     111.680 122.182 136.622  0.50 95.29           H  
ATOM   1759  H8 A DA I  51     112.186 125.355 135.119  0.50 95.29           H  
ATOM   1760  H8 B DA I  51     112.169 125.612 135.410  0.50 95.29           H  
ATOM   1761  H61A DA I  51     108.128 127.566 138.734  0.50 95.29           H  
ATOM   1762  H61B DA I  51     107.939 127.452 139.054  0.50 95.29           H  
ATOM   1763  H62A DA I  51     109.219 127.922 137.787  0.50 95.29           H  
ATOM   1764  H62B DA I  51     109.005 127.893 138.113  0.50 95.29           H  
ATOM   1765  H2 A DA I  51     108.604 123.347 139.623  0.50 95.29           H  
ATOM   1766  H2 B DA I  51     108.296 123.140 139.419  0.50 95.29           H  
ATOM   1767  P  A DC I  52     111.813 119.150 133.678  0.50 97.23           P  
ATOM   1768  P  B DC I  52     111.819 119.358 133.669  0.50 97.23           P  
ATOM   1769  OP1A DC I  52     112.665 118.110 133.062  0.50 97.23           O  
ATOM   1770  OP1B DC I  52     112.693 118.347 133.037  0.50 97.23           O  
ATOM   1771  OP2A DC I  52     111.045 120.059 132.801  0.50 97.23           O  
ATOM   1772  OP2B DC I  52     111.001 120.237 132.806  0.50 97.23           O  
ATOM   1773  O5'A DC I  52     110.792 118.435 134.688  0.50 97.23           O  
ATOM   1774  O5'B DC I  52     110.850 118.609 134.704  0.50 97.23           O  
ATOM   1775  C5'A DC I  52     110.238 119.157 135.798  0.50 97.23           C  
ATOM   1776  C5'B DC I  52     110.271 119.328 135.803  0.50 97.23           C  
ATOM   1777  C4'A DC I  52     108.755 119.482 135.624  0.50 97.23           C  
ATOM   1778  C4'B DC I  52     108.768 119.541 135.646  0.50 97.23           C  
ATOM   1779  O4'A DC I  52     108.535 120.883 135.970  0.50 97.23           O  
ATOM   1780  O4'B DC I  52     108.432 120.900 136.081  0.50 97.23           O  
ATOM   1781  C3'A DC I  52     108.149 119.306 134.211  0.50 97.23           C  
ATOM   1782  C3'B DC I  52     108.189 119.413 134.220  0.50 97.23           C  
ATOM   1783  O3'A DC I  52     107.050 118.422 134.255  0.50 97.23           O  
ATOM   1784  O3'B DC I  52     107.037 118.608 134.228  0.50 97.23           O  
ATOM   1785  C2'A DC I  52     107.730 120.716 133.822  0.50 97.23           C  
ATOM   1786  C2'B DC I  52     107.875 120.847 133.848  0.50 97.23           C  
ATOM   1787  C1'A DC I  52     107.481 121.349 135.181  0.50 97.23           C  
ATOM   1788  C1'B DC I  52     107.466 121.409 135.200  0.50 97.23           C  
ATOM   1789  N1 A DC I  52     107.416 122.888 135.182  0.50 97.23           N  
ATOM   1790  N1 B DC I  52     107.377 122.946 135.291  0.50 97.23           N  
ATOM   1791  C2 A DC I  52     106.378 123.541 135.867  0.50 97.23           C  
ATOM   1792  C2 B DC I  52     106.399 123.536 136.111  0.50 97.23           C  
ATOM   1793  O2 A DC I  52     105.532 122.873 136.462  0.50 97.23           O  
ATOM   1794  O2 B DC I  52     105.631 122.814 136.751  0.50 97.23           O  
ATOM   1795  N3 A DC I  52     106.303 124.893 135.825  0.50 97.23           N  
ATOM   1796  N3 B DC I  52     106.298 124.890 136.155  0.50 97.23           N  
ATOM   1797  C4 A DC I  52     107.218 125.585 135.162  0.50 97.23           C  
ATOM   1798  C4 B DC I  52     107.130 125.638 135.441  0.50 97.23           C  
ATOM   1799  N4 A DC I  52     107.110 126.914 135.168  0.50 97.23           N  
ATOM   1800  N4 B DC I  52     107.004 126.963 135.530  0.50 97.23           N  
ATOM   1801  C5 A DC I  52     108.287 124.948 134.465  0.50 97.23           C  
ATOM   1802  C5 B DC I  52     108.133 125.064 134.608  0.50 97.23           C  
ATOM   1803  C6 A DC I  52     108.345 123.617 134.501  0.50 97.23           C  
ATOM   1804  C6 B DC I  52     108.216 123.735 134.561  0.50 97.23           C  
ATOM   1805  H5'A DC I  52     110.723 119.982 135.914  0.50 97.23           H  
ATOM   1806  H5'B DC I  52     110.699 120.189 135.879  0.50 97.23           H  
ATOM   1807 H5''A DC I  52     110.343 118.622 136.598  0.50 97.23           H  
ATOM   1808 H5''B DC I  52     110.429 118.829 136.617  0.50 97.23           H  
ATOM   1809  H4'A DC I  52     108.249 118.932 136.240  0.50 97.23           H  
ATOM   1810  H4'B DC I  52     108.307 118.912 136.220  0.50 97.23           H  
ATOM   1811  H3'A DC I  52     108.805 118.980 133.587  0.50 97.23           H  
ATOM   1812  H3'B DC I  52     108.837 119.051 133.608  0.50 97.23           H  
ATOM   1813  H2'A DC I  52     108.446 121.159 133.348  0.50 97.23           H  
ATOM   1814  H2'B DC I  52     108.664 121.281 133.500  0.50 97.23           H  
ATOM   1815 H2''A DC I  52     106.921 120.702 133.295  0.50 97.23           H  
ATOM   1816 H2''B DC I  52     107.146 120.887 133.217  0.50 97.23           H  
ATOM   1817  H1'A DC I  52     106.655 120.995 135.530  0.50 97.23           H  
ATOM   1818  H1'B DC I  52     106.608 121.033 135.436  0.50 97.23           H  
ATOM   1819  H41A DC I  52     107.475 127.378 134.540  0.50 97.23           H  
ATOM   1820  H41B DC I  52     107.125 127.455 134.833  0.50 97.23           H  
ATOM   1821  H42A DC I  52     106.689 127.308 135.801  0.50 97.23           H  
ATOM   1822  H42B DC I  52     106.816 127.327 136.282  0.50 97.23           H  
ATOM   1823  H5 A DC I  52     108.923 125.443 134.003  0.50 97.23           H  
ATOM   1824  H5 B DC I  52     108.710 125.597 134.113  0.50 97.23           H  
ATOM   1825  H6 A DC I  52     109.028 123.178 134.051  0.50 97.23           H  
ATOM   1826  H6 B DC I  52     108.859 123.340 134.023  0.50 97.23           H  
ATOM   1827  P  A DC I  53     106.505 117.732 132.920  0.50 98.47           P  
ATOM   1828  P  B DC I  53     106.659 117.738 132.961  0.50 98.47           P  
ATOM   1829  OP1A DC I  53     107.150 116.406 132.811  0.50 98.47           O  
ATOM   1830  OP1B DC I  53     107.519 116.536 132.966  0.50 98.47           O  
ATOM   1831  OP2A DC I  53     106.634 118.697 131.807  0.50 98.47           O  
ATOM   1832  OP2B DC I  53     106.659 118.632 131.782  0.50 98.47           O  
ATOM   1833  O5'A DC I  53     104.947 117.526 133.216  0.50 98.47           O  
ATOM   1834  O5'B DC I  53     105.148 117.300 133.245  0.50 98.47           O  
ATOM   1835  C5'A DC I  53     104.534 116.871 134.411  0.50 98.47           C  
ATOM   1836  C5'B DC I  53     104.789 116.755 134.513  0.50 98.47           C  
ATOM   1837  C4'A DC I  53     103.193 117.393 134.882  0.50 98.47           C  
ATOM   1838  C4'B DC I  53     103.486 117.348 135.004  0.50 98.47           C  
ATOM   1839  O4'A DC I  53     103.319 118.798 135.253  0.50 98.47           O  
ATOM   1840  O4'B DC I  53     103.680 118.761 135.323  0.50 98.47           O  
ATOM   1841  C3'A DC I  53     102.087 117.329 133.834  0.50 98.47           C  
ATOM   1842  C3'B DC I  53     102.349 117.295 133.985  0.50 98.47           C  
ATOM   1843  O3'A DC I  53     100.868 116.890 134.420  0.50 98.47           O  
ATOM   1844  O3'B DC I  53     101.135 116.861 134.595  0.50 98.47           O  
ATOM   1845  C2'A DC I  53     102.013 118.759 133.330  0.50 98.47           C  
ATOM   1846  C2'B DC I  53     102.270 118.725 133.485  0.50 98.47           C  
ATOM   1847  C1'A DC I  53     102.333 119.553 134.585  0.50 98.47           C  
ATOM   1848  C1'B DC I  53     102.654 119.515 134.723  0.50 98.47           C  
ATOM   1849  N1 A DC I  53     102.866 120.946 134.326  0.50 98.47           N  
ATOM   1850  N1 B DC I  53     103.155 120.926 134.439  0.50 98.47           N  
ATOM   1851  C2 A DC I  53     102.144 122.087 134.738  0.50 98.47           C  
ATOM   1852  C2 B DC I  53     102.446 122.051 134.910  0.50 98.47           C  
ATOM   1853  O2 A DC I  53     101.053 121.952 135.305  0.50 98.47           O  
ATOM   1854  O2 B DC I  53     101.406 121.894 135.557  0.50 98.47           O  
ATOM   1855  N3 A DC I  53     102.659 123.315 134.475  0.50 98.47           N  
ATOM   1856  N3 B DC I  53     102.921 123.290 134.624  0.50 98.47           N  
ATOM   1857  C4 A DC I  53     103.826 123.424 133.845  0.50 98.47           C  
ATOM   1858  C4 B DC I  53     104.032 123.428 133.909  0.50 98.47           C  
ATOM   1859  N4 A DC I  53     104.313 124.646 133.622  0.50 98.47           N  
ATOM   1860  N4 B DC I  53     104.481 124.661 133.667  0.50 98.47           N  
ATOM   1861  C5 A DC I  53     104.570 122.287 133.435  0.50 98.47           C  
ATOM   1862  C5 B DC I  53     104.765 122.311 133.439  0.50 98.47           C  
ATOM   1863  C6 A DC I  53     104.063 121.086 133.695  0.50 98.47           C  
ATOM   1864  C6 B DC I  53     104.297 121.094 133.720  0.50 98.47           C  
ATOM   1865  H5'A DC I  53     105.194 117.023 135.104  0.50 98.47           H  
ATOM   1866  H5'B DC I  53     105.488 116.946 135.156  0.50 98.47           H  
ATOM   1867 H5''A DC I  53     104.463 115.919 134.243  0.50 98.47           H  
ATOM   1868 H5''B DC I  53     104.689 115.794 134.429  0.50 98.47           H  
ATOM   1869  H4'A DC I  53     102.915 116.887 135.660  0.50 98.47           H  
ATOM   1870  H4'B DC I  53     103.209 116.881 135.807  0.50 98.47           H  
ATOM   1871  H3'A DC I  53     102.346 116.735 133.113  0.50 98.47           H  
ATOM   1872  H3'B DC I  53     102.587 116.702 133.256  0.50 98.47           H  
ATOM   1873  H2'A DC I  53     102.677 118.913 132.642  0.50 98.47           H  
ATOM   1874  H2'B DC I  53     102.903 118.871 132.768  0.50 98.47           H  
ATOM   1875 H2''A DC I  53     101.129 118.962 133.008  0.50 98.47           H  
ATOM   1876 H2''B DC I  53     101.377 118.934 133.205  0.50 98.47           H  
ATOM   1877  H1'A DC I  53     101.543 119.602 135.140  0.50 98.47           H  
ATOM   1878  H1'B DC I  53     101.897 119.551 135.323  0.50 98.47           H  
ATOM   1879  H41A DC I  53     105.141 124.745 133.412  0.50 98.47           H  
ATOM   1880  H41B DC I  53     105.285 124.777 133.386  0.50 98.47           H  
ATOM   1881  H42A DC I  53     103.803 125.332 133.698  0.50 98.47           H  
ATOM   1882  H42B DC I  53     103.972 125.339 133.803  0.50 98.47           H  
ATOM   1883  H5 A DC I  53     105.390 122.381 133.010  0.50 98.47           H  
ATOM   1884  H5 B DC I  53     105.547 122.424 132.953  0.50 98.47           H  
ATOM   1885  H6 A DC I  53     104.530 120.327 133.431  0.50 98.47           H  
ATOM   1886  H6 B DC I  53     104.757 120.348 133.414  0.50 98.47           H  
ATOM   1887  P  A DA I  54      99.643 116.426 133.505  0.50 98.72           P  
ATOM   1888  P  B DA I  54      99.891 116.373 133.684  0.50 98.72           P  
ATOM   1889  OP1A DA I  54      99.499 114.963 133.664  0.50 98.72           O  
ATOM   1890  OP1B DA I  54      99.752 114.911 133.864  0.50 98.72           O  
ATOM   1891  OP2A DA I  54      99.825 117.001 132.154  0.50 98.72           O  
ATOM   1892  OP2B DA I  54     100.075 116.933 132.327  0.50 98.72           O  
ATOM   1893  O5'A DA I  54      98.387 117.146 134.179  0.50 98.72           O  
ATOM   1894  O5'B DA I  54      98.629 117.100 134.345  0.50 98.72           O  
ATOM   1895  C5'A DA I  54      98.548 118.436 134.746  0.50 98.72           C  
ATOM   1896  C5'B DA I  54      98.802 118.371 134.943  0.50 98.72           C  
ATOM   1897  C4'A DA I  54      97.262 119.239 134.717  0.50 98.72           C  
ATOM   1898  C4'B DA I  54      97.506 119.159 135.019  0.50 98.72           C  
ATOM   1899  O4'A DA I  54      97.598 120.655 134.645  0.50 98.72           O  
ATOM   1900  O4'B DA I  54      97.835 120.573 134.986  0.50 98.72           O  
ATOM   1901  C3'A DA I  54      96.360 119.007 133.518  0.50 98.72           C  
ATOM   1902  C3'B DA I  54      96.532 118.969 133.864  0.50 98.72           C  
ATOM   1903  O3'A DA I  54      95.017 119.385 133.821  0.50 98.72           O  
ATOM   1904  O3'B DA I  54      95.198 119.325 134.252  0.50 98.72           O  
ATOM   1905  C2'A DA I  54      97.000 119.909 132.482  0.50 98.72           C  
ATOM   1906  C2'B DA I  54      97.104 119.913 132.828  0.50 98.72           C  
ATOM   1907  C1'A DA I  54      97.362 121.139 133.327  0.50 98.72           C  
ATOM   1908  C1'B DA I  54      97.560 121.098 133.694  0.50 98.72           C  
ATOM   1909  N9 A DA I  54      98.543 121.888 132.879  0.50 98.72           N  
ATOM   1910  N9 B DA I  54      98.742 121.803 133.193  0.50 98.72           N  
ATOM   1911  C8 A DA I  54      99.719 121.386 132.404  0.50 98.72           C  
ATOM   1912  C8 B DA I  54      99.877 121.260 132.668  0.50 98.72           C  
ATOM   1913  N7 A DA I  54     100.598 122.298 132.084  0.50 98.72           N  
ATOM   1914  N7 B DA I  54     100.764 122.139 132.290  0.50 98.72           N  
ATOM   1915  C5 A DA I  54      99.968 123.484 132.391  0.50 98.72           C  
ATOM   1916  C5 B DA I  54     100.178 123.346 132.598  0.50 98.72           C  
ATOM   1917  C6 A DA I  54     100.379 124.823 132.296  0.50 98.72           C  
ATOM   1918  C6 B DA I  54     100.614 124.668 132.452  0.50 98.72           C  
ATOM   1919  N6 A DA I  54     101.575 125.193 131.834  0.50 98.72           N  
ATOM   1920  N6 B DA I  54     101.798 124.997 131.931  0.50 98.72           N  
ATOM   1921  N1 A DA I  54      99.502 125.773 132.672  0.50 98.72           N  
ATOM   1922  N1 B DA I  54      99.782 125.643 132.853  0.50 98.72           N  
ATOM   1923  C2 A DA I  54      98.304 125.399 133.126  0.50 98.72           C  
ATOM   1924  C2 B DA I  54      98.599 125.310 133.372  0.50 98.72           C  
ATOM   1925  N3 A DA I  54      97.809 124.172 133.268  0.50 98.72           N  
ATOM   1926  N3 B DA I  54      98.082 124.104 133.563  0.50 98.72           N  
ATOM   1927  C4 A DA I  54      98.701 123.252 132.882  0.50 98.72           C  
ATOM   1928  C4 B DA I  54      98.929 123.158 133.150  0.50 98.72           C  
ATOM   1929  H5'A DA I  54      99.225 118.915 134.251  0.50 98.72           H  
ATOM   1930  H5'B DA I  54      99.442 118.877 134.423  0.50 98.72           H  
ATOM   1931 H5''A DA I  54      98.839 118.342 135.666  0.50 98.72           H  
ATOM   1932 H5''B DA I  54      99.150 118.252 135.839  0.50 98.72           H  
ATOM   1933  H4'A DA I  54      96.762 119.071 135.530  0.50 98.72           H  
ATOM   1934  H4'B DA I  54      97.056 118.954 135.853  0.50 98.72           H  
ATOM   1935  H3'A DA I  54      96.395 118.083 133.231  0.50 98.72           H  
ATOM   1936  H3'B DA I  54      96.558 118.057 133.539  0.50 98.72           H  
ATOM   1937  H2'A DA I  54      97.787 119.488 132.107  0.50 98.72           H  
ATOM   1938  H2'B DA I  54      97.847 119.497 132.369  0.50 98.72           H  
ATOM   1939 H2''A DA I  54      96.367 120.138 131.791  0.50 98.72           H  
ATOM   1940 H2''B DA I  54      96.424 120.190 132.200  0.50 98.72           H  
ATOM   1941  H1'A DA I  54      96.602 121.740 133.344  0.50 98.72           H  
ATOM   1942  H1'B DA I  54      96.829 121.730 133.764  0.50 98.72           H  
ATOM   1943  H8 A DA I  54      99.871 120.480 132.298  0.50 98.72           H  
ATOM   1944  H8 B DA I  54      99.998 120.349 132.574  0.50 98.72           H  
ATOM   1945  H61A DA I  54     101.798 126.024 131.834  0.50 98.72           H  
ATOM   1946  H61B DA I  54     102.030 125.824 131.880  0.50 98.72           H  
ATOM   1947  H62A DA I  54     102.123 124.602 131.538  0.50 98.72           H  
ATOM   1948  H62B DA I  54     102.329 124.384 131.649  0.50 98.72           H  
ATOM   1949  H2 A DA I  54      97.738 126.090 133.379  0.50 98.72           H  
ATOM   1950  H2 B DA I  54      98.064 126.021 133.636  0.50 98.72           H  
ATOM   1951  P  A DA I  55      93.828 119.077 132.794  0.50 97.08           P  
ATOM   1952  P  B DA I  55      93.956 119.155 133.211  0.50 97.08           P  
ATOM   1953  OP1A DA I  55      92.720 118.473 133.566  0.50 97.08           O  
ATOM   1954  OP1B DA I  55      92.770 118.749 133.995  0.50 97.08           O  
ATOM   1955  OP2A DA I  55      94.404 118.348 131.642  0.50 97.08           O  
ATOM   1956  OP2B DA I  55      94.425 118.306 132.093  0.50 97.08           O  
ATOM   1957  O5'A DA I  55      93.375 120.525 132.285  0.50 97.08           O  
ATOM   1958  O5'B DA I  55      93.713 120.635 132.638  0.50 97.08           O  
ATOM   1959  C5'A DA I  55      92.929 121.505 133.215  0.50 97.08           C  
ATOM   1960  C5'B DA I  55      92.913 121.563 133.369  0.50 97.08           C  
ATOM   1961  C4'A DA I  55      92.908 122.885 132.590  0.50 97.08           C  
ATOM   1962  C4'B DA I  55      92.918 122.929 132.713  0.50 97.08           C  
ATOM   1963  O4'A DA I  55      94.277 123.330 132.337  0.50 97.08           O  
ATOM   1964  O4'B DA I  55      94.299 123.364 132.512  0.50 97.08           O  
ATOM   1965  C3'A DA I  55      92.212 122.975 131.234  0.50 97.08           C  
ATOM   1966  C3'B DA I  55      92.277 122.984 131.321  0.50 97.08           C  
ATOM   1967  O3'A DA I  55      91.621 124.250 131.054  0.50 97.08           O  
ATOM   1968  O3'B DA I  55      91.664 124.250 131.080  0.50 97.08           O  
ATOM   1969  C2'A DA I  55      93.373 122.791 130.295  0.50 97.08           C  
ATOM   1970  C2'B DA I  55      93.483 122.801 130.442  0.50 97.08           C  
ATOM   1971  C1'A DA I  55      94.359 123.709 130.981  0.50 97.08           C  
ATOM   1972  C1'B DA I  55      94.434 123.730 131.161  0.50 97.08           C  
ATOM   1973  N9 A DA I  55      95.737 123.629 130.510  0.50 97.08           N  
ATOM   1974  N9 B DA I  55      95.827 123.656 130.729  0.50 97.08           N  
ATOM   1975  C8 A DA I  55      96.467 122.510 130.244  0.50 97.08           C  
ATOM   1976  C8 B DA I  55      96.584 122.541 130.520  0.50 97.08           C  
ATOM   1977  N7 A DA I  55      97.683 122.761 129.823  0.50 97.08           N  
ATOM   1978  N7 B DA I  55      97.802 122.801 130.106  0.50 97.08           N  
ATOM   1979  C5 A DA I  55      97.746 124.141 129.808  0.50 97.08           C  
ATOM   1980  C5 B DA I  55      97.836 124.182 130.034  0.50 97.08           C  
ATOM   1981  C6 A DA I  55      98.762 125.037 129.456  0.50 97.08           C  
ATOM   1982  C6 B DA I  55      98.840 125.087 129.658  0.50 97.08           C  
ATOM   1983  N6 A DA I  55      99.967 124.646 129.040  0.50 97.08           N  
ATOM   1984  N6 B DA I  55     100.058 124.708 129.275  0.50 97.08           N  
ATOM   1985  N1 A DA I  55      98.501 126.354 129.563  0.50 97.08           N  
ATOM   1986  N1 B DA I  55      98.545 126.403 129.700  0.50 97.08           N  
ATOM   1987  C2 A DA I  55      97.299 126.738 129.993  0.50 97.08           C  
ATOM   1988  C2 B DA I  55      97.326 126.773 130.088  0.50 97.08           C  
ATOM   1989  N3 A DA I  55      96.264 125.990 130.341  0.50 97.08           N  
ATOM   1990  N3 B DA I  55      96.305 126.018 130.458  0.50 97.08           N  
ATOM   1991  C4 A DA I  55      96.558 124.689 130.229  0.50 97.08           C  
ATOM   1992  C4 B DA I  55      96.629 124.720 130.409  0.50 97.08           C  
ATOM   1993  H5'A DA I  55      93.525 121.512 133.978  0.50 97.08           H  
ATOM   1994  H5'B DA I  55      93.263 121.643 134.268  0.50 97.08           H  
ATOM   1995 H5''A DA I  55      92.036 121.278 133.511  0.50 97.08           H  
ATOM   1996 H5''B DA I  55      92.004 121.235 133.409  0.50 97.08           H  
ATOM   1997  H4'A DA I  55      92.484 123.502 133.202  0.50 97.08           H  
ATOM   1998  H4'B DA I  55      92.468 123.559 133.291  0.50 97.08           H  
ATOM   1999  H3'A DA I  55      91.562 122.267 131.128  0.50 97.08           H  
ATOM   2000  H3'B DA I  55      91.648 122.261 131.201  0.50 97.08           H  
ATOM   2001  H2'A DA I  55      93.683 121.877 130.291  0.50 97.08           H  
ATOM   2002  H2'B DA I  55      93.797 121.885 130.464  0.50 97.08           H  
ATOM   2003 H2''A DA I  55      93.156 123.097 129.409  0.50 97.08           H  
ATOM   2004 H2''B DA I  55      93.307 123.098 129.540  0.50 97.08           H  
ATOM   2005  H1'A DA I  55      94.051 124.621 130.892  0.50 97.08           H  
ATOM   2006  H1'B DA I  55      94.121 124.639 131.052  0.50 97.08           H  
ATOM   2007  H8 A DA I  55      96.135 121.651 130.349  0.50 97.08           H  
ATOM   2008  H8 B DA I  55      96.268 121.680 130.659  0.50 97.08           H  
ATOM   2009  H61A DA I  55     100.541 125.229 128.779  0.50 97.08           H  
ATOM   2010  H61B DA I  55     100.620 125.293 128.990  0.50 97.08           H  
ATOM   2011  H62A DA I  55     100.169 123.810 129.034  0.50 97.08           H  
ATOM   2012  H62B DA I  55     100.282 123.879 129.315  0.50 97.08           H  
ATOM   2013  H2 A DA I  55      97.164 127.653 130.039  0.50 97.08           H  
ATOM   2014  H2 B DA I  55      97.170 127.686 130.099  0.50 97.08           H  
ATOM   2015  P    DA I  56      90.158 124.522 131.421  1.00 95.63           P  
ATOM   2016  OP1  DA I  56      90.042 124.521 132.895  1.00 95.63           O  
ATOM   2017  OP2  DA I  56      89.325 123.614 130.607  1.00 95.63           O  
ATOM   2018  O5'  DA I  56      89.926 126.017 130.887  1.00 95.63           O  
ATOM   2019  C5'  DA I  56      90.807 127.082 131.306  1.00 95.63           C  
ATOM   2020  C4'  DA I  56      91.145 128.045 130.164  1.00 95.63           C  
ATOM   2021  O4'  DA I  56      92.506 127.788 129.696  1.00 95.63           O  
ATOM   2022  C3'  DA I  56      90.264 127.931 128.905  1.00 95.63           C  
ATOM   2023  O3'  DA I  56      90.115 129.183 128.230  1.00 95.63           O  
ATOM   2024  C2'  DA I  56      91.081 126.970 128.069  1.00 95.63           C  
ATOM   2025  C1'  DA I  56      92.465 127.556 128.302  1.00 95.63           C  
ATOM   2026  N9   DA I  56      93.590 126.708 127.908  1.00 95.63           N  
ATOM   2027  C8   DA I  56      93.631 125.349 127.872  1.00 95.63           C  
ATOM   2028  N7   DA I  56      94.780 124.861 127.477  1.00 95.63           N  
ATOM   2029  C5   DA I  56      95.543 125.981 127.228  1.00 95.63           C  
ATOM   2030  C6   DA I  56      96.860 126.139 126.777  1.00 95.63           C  
ATOM   2031  N6   DA I  56      97.660 125.114 126.496  1.00 95.63           N  
ATOM   2032  N1   DA I  56      97.329 127.395 126.639  1.00 95.63           N  
ATOM   2033  C2   DA I  56      96.519 128.418 126.938  1.00 95.63           C  
ATOM   2034  N3   DA I  56      95.258 128.389 127.362  1.00 95.63           N  
ATOM   2035  C4   DA I  56      94.829 127.129 127.492  1.00 95.63           C  
ATOM   2036  H5'  DA I  56      91.628 126.694 131.641  1.00 95.63           H  
ATOM   2037 H5''  DA I  56      90.382 127.579 132.019  1.00 95.63           H  
ATOM   2038  H4'  DA I  56      91.107 128.950 130.502  1.00 95.63           H  
ATOM   2039  H3'  DA I  56      89.399 127.554 129.118  1.00 95.63           H  
ATOM   2040  H2'  DA I  56      91.012 126.065 128.416  1.00 95.63           H  
ATOM   2041 H2''  DA I  56      90.832 127.016 127.133  1.00 95.63           H  
ATOM   2042  H1'  DA I  56      92.531 128.405 127.837  1.00 95.63           H  
ATOM   2043  H8   DA I  56      92.911 124.814 128.115  1.00 95.63           H  
ATOM   2044  H61  DA I  56      98.419 125.253 126.117  1.00 95.63           H  
ATOM   2045  H62  DA I  56      97.418 124.315 126.697  1.00 95.63           H  
ATOM   2046  H2   DA I  56      96.879 129.264 126.815  1.00 95.63           H  
ATOM   2047  P    DA I  57      89.302 130.413 128.870  1.00 95.21           P  
ATOM   2048  OP1  DA I  57      89.021 130.149 130.296  1.00 95.21           O  
ATOM   2049  OP2  DA I  57      88.165 130.663 127.958  1.00 95.21           O  
ATOM   2050  O5'  DA I  57      90.305 131.665 128.732  1.00 95.21           O  
ATOM   2051  C5'  DA I  57      91.733 131.483 128.525  1.00 95.21           C  
ATOM   2052  C4'  DA I  57      92.182 131.874 127.105  1.00 95.21           C  
ATOM   2053  O4'  DA I  57      93.122 130.866 126.592  1.00 95.21           O  
ATOM   2054  C3'  DA I  57      91.088 131.984 126.021  1.00 95.21           C  
ATOM   2055  O3'  DA I  57      91.331 133.095 125.187  1.00 95.21           O  
ATOM   2056  C2'  DA I  57      91.243 130.679 125.262  1.00 95.21           C  
ATOM   2057  C1'  DA I  57      92.754 130.540 125.265  1.00 95.21           C  
ATOM   2058  N9   DA I  57      93.267 129.217 124.908  1.00 95.21           N  
ATOM   2059  C8   DA I  57      92.609 128.027 124.982  1.00 95.21           C  
ATOM   2060  N7   DA I  57      93.316 127.003 124.584  1.00 95.21           N  
ATOM   2061  C5   DA I  57      94.521 127.559 124.211  1.00 95.21           C  
ATOM   2062  C6   DA I  57      95.704 126.993 123.702  1.00 95.21           C  
ATOM   2063  N6   DA I  57      95.849 125.685 123.469  1.00 95.21           N  
ATOM   2064  N1   DA I  57      96.732 127.822 123.434  1.00 95.21           N  
ATOM   2065  C2   DA I  57      96.580 129.132 123.673  1.00 95.21           C  
ATOM   2066  N3   DA I  57      95.512 129.779 124.148  1.00 95.21           N  
ATOM   2067  C4   DA I  57      94.506 128.926 124.391  1.00 95.21           C  
ATOM   2068  H5'  DA I  57      91.973 130.562 128.691  1.00 95.21           H  
ATOM   2069 H5''  DA I  57      92.207 132.041 129.161  1.00 95.21           H  
ATOM   2070  H4'  DA I  57      92.643 132.727 127.157  1.00 95.21           H  
ATOM   2071  H3'  DA I  57      90.209 132.045 126.411  1.00 95.21           H  
ATOM   2072  H2'  DA I  57      90.817 129.953 125.742  1.00 95.21           H  
ATOM   2073 H2''  DA I  57      90.900 130.756 124.360  1.00 95.21           H  
ATOM   2074  H1'  DA I  57      93.133 131.196 124.662  1.00 95.21           H  
ATOM   2075  H8   DA I  57      91.739 127.951 125.290  1.00 95.21           H  
ATOM   2076  H61  DA I  57      96.580 125.388 123.120  1.00 95.21           H  
ATOM   2077  H62  DA I  57      95.212 125.140 123.664  1.00 95.21           H  
ATOM   2078  H2   DA I  57      97.313 129.665 123.470  1.00 95.21           H  
ATOM   2079  P    DG I  58      90.784 134.550 125.579  1.00 92.44           P  
ATOM   2080  OP1  DG I  58      90.897 134.682 127.048  1.00 92.44           O  
ATOM   2081  OP2  DG I  58      89.474 134.735 124.917  1.00 92.44           O  
ATOM   2082  O5'  DG I  58      91.838 135.533 124.886  1.00 92.44           O  
ATOM   2083  C5'  DG I  58      93.138 135.656 125.435  1.00 92.44           C  
ATOM   2084  C4'  DG I  58      94.216 135.524 124.368  1.00 92.44           C  
ATOM   2085  O4'  DG I  58      94.275 134.152 123.900  1.00 92.44           O  
ATOM   2086  C3'  DG I  58      94.033 136.392 123.126  1.00 92.44           C  
ATOM   2087  O3'  DG I  58      95.290 137.010 122.814  1.00 92.44           O  
ATOM   2088  C2'  DG I  58      93.528 135.398 122.068  1.00 92.44           C  
ATOM   2089  C1'  DG I  58      94.195 134.104 122.489  1.00 92.44           C  
ATOM   2090  N9   DG I  58      93.485 132.870 122.136  1.00 92.44           N  
ATOM   2091  C8   DG I  58      92.154 132.586 122.336  1.00 92.44           C  
ATOM   2092  N7   DG I  58      91.817 131.384 121.965  1.00 92.44           N  
ATOM   2093  C5   DG I  58      93.001 130.824 121.513  1.00 92.44           C  
ATOM   2094  C6   DG I  58      93.253 129.538 120.991  1.00 92.44           C  
ATOM   2095  O6   DG I  58      92.451 128.611 120.820  1.00 92.44           O  
ATOM   2096  N1   DG I  58      94.590 129.374 120.650  1.00 92.44           N  
ATOM   2097  C2   DG I  58      95.558 130.333 120.793  1.00 92.44           C  
ATOM   2098  N2   DG I  58      96.789 129.994 120.408  1.00 92.44           N  
ATOM   2099  N3   DG I  58      95.337 131.542 121.282  1.00 92.44           N  
ATOM   2100  C4   DG I  58      94.039 131.718 121.621  1.00 92.44           C  
ATOM   2101  H5'  DG I  58      93.264 134.960 126.099  1.00 92.44           H  
ATOM   2102 H5''  DG I  58      93.220 136.520 125.863  1.00 92.44           H  
ATOM   2103  H4'  DG I  58      95.070 135.747 124.769  1.00 92.44           H  
ATOM   2104  H3'  DG I  58      93.361 137.069 123.292  1.00 92.44           H  
ATOM   2105  H2'  DG I  58      92.564 135.320 122.110  1.00 92.44           H  
ATOM   2106 H2''  DG I  58      93.812 135.649 121.183  1.00 92.44           H  
ATOM   2107  H1'  DG I  58      95.090 134.075 122.121  1.00 92.44           H  
ATOM   2108  H8   DG I  58      91.550 133.199 122.686  1.00 92.44           H  
ATOM   2109  H1   DG I  58      94.828 128.616 120.324  1.00 92.44           H  
ATOM   2110  H21  DG I  58      97.422 130.572 120.441  1.00 92.44           H  
ATOM   2111  H22  DG I  58      96.944 129.202 120.119  1.00 92.44           H  
ATOM   2112  P    DG I  59      95.553 137.835 121.461  1.00 83.61           P  
ATOM   2113  OP1  DG I  59      96.272 139.068 121.849  1.00 83.61           O  
ATOM   2114  OP2  DG I  59      94.305 137.956 120.675  1.00 83.61           O  
ATOM   2115  O5'  DG I  59      96.590 136.898 120.691  1.00 83.61           O  
ATOM   2116  C5'  DG I  59      97.480 136.093 121.453  1.00 83.61           C  
ATOM   2117  C4'  DG I  59      98.519 135.401 120.585  1.00 83.61           C  
ATOM   2118  O4'  DG I  59      98.007 134.111 120.164  1.00 83.61           O  
ATOM   2119  C3'  DG I  59      98.893 136.112 119.303  1.00 83.61           C  
ATOM   2120  O3'  DG I  59     100.222 135.754 118.917  1.00 83.61           O  
ATOM   2121  C2'  DG I  59      97.837 135.599 118.339  1.00 83.61           C  
ATOM   2122  C1'  DG I  59      97.682 134.142 118.784  1.00 83.61           C  
ATOM   2123  N9   DG I  59      96.341 133.563 118.616  1.00 83.61           N  
ATOM   2124  C8   DG I  59      95.134 134.123 118.960  1.00 83.61           C  
ATOM   2125  N7   DG I  59      94.116 133.354 118.710  1.00 83.61           N  
ATOM   2126  C5   DG I  59      94.679 132.207 118.184  1.00 83.61           C  
ATOM   2127  C6   DG I  59      94.066 131.023 117.738  1.00 83.61           C  
ATOM   2128  O6   DG I  59      92.862 130.748 117.713  1.00 83.61           O  
ATOM   2129  N1   DG I  59      94.998 130.101 117.281  1.00 83.61           N  
ATOM   2130  C2   DG I  59      96.355 130.303 117.264  1.00 83.61           C  
ATOM   2131  N2   DG I  59      97.108 129.298 116.787  1.00 83.61           N  
ATOM   2132  N3   DG I  59      96.940 131.412 117.682  1.00 83.61           N  
ATOM   2133  C4   DG I  59      96.046 132.311 118.137  1.00 83.61           C  
ATOM   2134  H5'  DG I  59      96.969 135.419 121.923  1.00 83.61           H  
ATOM   2135 H5''  DG I  59      97.930 136.651 122.099  1.00 83.61           H  
ATOM   2136  H4'  DG I  59      99.321 135.264 121.107  1.00 83.61           H  
ATOM   2137  H3'  DG I  59      98.816 137.068 119.413  1.00 83.61           H  
ATOM   2138  H2'  DG I  59      97.012 136.088 118.443  1.00 83.61           H  
ATOM   2139 H2''  DG I  59      98.150 135.649 117.432  1.00 83.61           H  
ATOM   2140  H1'  DG I  59      98.320 133.600 118.299  1.00 83.61           H  
ATOM   2141  H8   DG I  59      95.052 134.976 119.320  1.00 83.61           H  
ATOM   2142  H1   DG I  59      94.703 129.349 116.988  1.00 83.61           H  
ATOM   2143  H21  DG I  59      97.946 129.423 116.638  1.00 83.61           H  
ATOM   2144  H22  DG I  59      96.753 128.529 116.633  1.00 83.61           H  
ATOM   2145  P    DC I  60     100.881 136.320 117.566  1.00 78.06           P  
ATOM   2146  OP1  DC I  60     102.239 136.779 117.920  1.00 78.06           O  
ATOM   2147  OP2  DC I  60      99.935 137.260 116.930  1.00 78.06           O  
ATOM   2148  O5'  DC I  60     101.013 135.022 116.637  1.00 78.06           O  
ATOM   2149  C5'  DC I  60     101.837 133.946 117.063  1.00 78.06           C  
ATOM   2150  C4'  DC I  60     101.739 132.744 116.129  1.00 78.06           C  
ATOM   2151  O4'  DC I  60     100.369 132.253 116.098  1.00 78.06           O  
ATOM   2152  C3'  DC I  60     102.122 133.005 114.680  1.00 78.06           C  
ATOM   2153  O3'  DC I  60     102.849 131.900 114.168  1.00 78.06           O  
ATOM   2154  C2'  DC I  60     100.771 133.200 113.991  1.00 78.06           C  
ATOM   2155  C1'  DC I  60      99.872 132.248 114.770  1.00 78.06           C  
ATOM   2156  N1   DC I  60      98.394 132.621 114.831  1.00 78.06           N  
ATOM   2157  C2   DC I  60      97.401 131.714 114.419  1.00 78.06           C  
ATOM   2158  O2   DC I  60      97.729 130.621 113.955  1.00 78.06           O  
ATOM   2159  N3   DC I  60      96.099 132.076 114.528  1.00 78.06           N  
ATOM   2160  C4   DC I  60      95.778 133.263 115.021  1.00 78.06           C  
ATOM   2161  N4   DC I  60      94.484 133.581 115.121  1.00 78.06           N  
ATOM   2162  C5   DC I  60      96.764 134.178 115.461  1.00 78.06           C  
ATOM   2163  C6   DC I  60      98.039 133.816 115.357  1.00 78.06           C  
ATOM   2164  H5'  DC I  60     101.564 133.678 117.952  1.00 78.06           H  
ATOM   2165 H5''  DC I  60     102.755 134.247 117.093  1.00 78.06           H  
ATOM   2166  H4'  DC I  60     102.311 132.041 116.473  1.00 78.06           H  
ATOM   2167  H3'  DC I  60     102.650 133.810 114.616  1.00 78.06           H  
ATOM   2168  H2'  DC I  60     100.471 134.117 114.079  1.00 78.06           H  
ATOM   2169 H2''  DC I  60     100.822 132.940 113.060  1.00 78.06           H  
ATOM   2170  H1'  DC I  60      99.967 131.360 114.403  1.00 78.06           H  
ATOM   2171  H41  DC I  60      94.253 134.355 115.419  1.00 78.06           H  
ATOM   2172  H42  DC I  60      93.882 133.009 114.899  1.00 78.06           H  
ATOM   2173  H5   DC I  60      96.527 135.002 115.812  1.00 78.06           H  
ATOM   2174  H6   DC I  60      98.701 134.403 115.635  1.00 78.06           H  
ATOM   2175  P    DA I  61     103.707 132.029 112.819  1.00 82.12           P  
ATOM   2176  OP1  DA I  61     105.132 132.095 113.198  1.00 82.12           O  
ATOM   2177  OP2  DA I  61     103.110 133.095 111.991  1.00 82.12           O  
ATOM   2178  O5'  DA I  61     103.430 130.640 112.091  1.00 82.12           O  
ATOM   2179  C5'  DA I  61     102.234 129.952 112.391  1.00 82.12           C  
ATOM   2180  C4'  DA I  61     101.906 128.863 111.372  1.00 82.12           C  
ATOM   2181  O4'  DA I  61     100.465 128.696 111.308  1.00 82.12           O  
ATOM   2182  C3'  DA I  61     102.330 129.119 109.935  1.00 82.12           C  
ATOM   2183  O3'  DA I  61     102.613 127.889 109.285  1.00 82.12           O  
ATOM   2184  C2'  DA I  61     101.126 129.844 109.334  1.00 82.12           C  
ATOM   2185  C1'  DA I  61      99.940 129.305 110.135  1.00 82.12           C  
ATOM   2186  N9   DA I  61      98.957 130.319 110.541  1.00 82.12           N  
ATOM   2187  C8   DA I  61      99.201 131.505 111.166  1.00 82.12           C  
ATOM   2188  N7   DA I  61      98.130 132.205 111.420  1.00 82.12           N  
ATOM   2189  C5   DA I  61      97.104 131.414 110.957  1.00 82.12           C  
ATOM   2190  C6   DA I  61      95.713 131.591 110.943  1.00 82.12           C  
ATOM   2191  N6   DA I  61      95.111 132.673 111.433  1.00 82.12           N  
ATOM   2192  N1   DA I  61      94.961 130.614 110.405  1.00 82.12           N  
ATOM   2193  C2   DA I  61      95.571 129.530 109.913  1.00 82.12           C  
ATOM   2194  N3   DA I  61      96.874 129.251 109.871  1.00 82.12           N  
ATOM   2195  C4   DA I  61      97.592 130.245 110.413  1.00 82.12           C  
ATOM   2196  H5'  DA I  61     101.511 130.588 112.417  1.00 82.12           H  
ATOM   2197 H5''  DA I  61     102.324 129.545 113.266  1.00 82.12           H  
ATOM   2198  H4'  DA I  61     102.303 128.029 111.668  1.00 82.12           H  
ATOM   2199  H3'  DA I  61     103.107 129.691 109.909  1.00 82.12           H  
ATOM   2200  H2'  DA I  61     101.216 130.798 109.447  1.00 82.12           H  
ATOM   2201 H2''  DA I  61     101.027 129.621 108.398  1.00 82.12           H  
ATOM   2202  H1'  DA I  61      99.490 128.631 109.605  1.00 82.12           H  
ATOM   2203  H8   DA I  61     100.056 131.802 111.364  1.00 82.12           H  
ATOM   2204  H61  DA I  61      94.262 132.772 111.339  1.00 82.12           H  
ATOM   2205  H62  DA I  61      95.571 133.269 111.845  1.00 82.12           H  
ATOM   2206  H2   DA I  61      95.009 128.882 109.554  1.00 82.12           H  
ATOM   2207  P    DT I  62     103.202 127.873 107.793  1.00 88.04           P  
ATOM   2208  OP1  DT I  62     104.045 126.666 107.663  1.00 88.04           O  
ATOM   2209  OP2  DT I  62     103.778 129.206 107.510  1.00 88.04           O  
ATOM   2210  O5'  DT I  62     101.900 127.696 106.887  1.00 88.04           O  
ATOM   2211  C5'  DT I  62     101.015 126.621 107.146  1.00 88.04           C  
ATOM   2212  C4'  DT I  62      99.758 126.722 106.304  1.00 88.04           C  
ATOM   2213  O4'  DT I  62      98.895 127.739 106.858  1.00 88.04           O  
ATOM   2214  C3'  DT I  62      99.984 127.099 104.837  1.00 88.04           C  
ATOM   2215  O3'  DT I  62      99.496 126.070 103.985  1.00 88.04           O  
ATOM   2216  C2'  DT I  62      99.228 128.422 104.653  1.00 88.04           C  
ATOM   2217  C1'  DT I  62      98.249 128.428 105.818  1.00 88.04           C  
ATOM   2218  N1   DT I  62      97.858 129.802 106.348  1.00 88.04           N  
ATOM   2219  C2   DT I  62      96.524 130.159 106.417  1.00 88.04           C  
ATOM   2220  O2   DT I  62      95.614 129.447 106.034  1.00 88.04           O  
ATOM   2221  N3   DT I  62      96.293 131.402 106.943  1.00 88.04           N  
ATOM   2222  C4   DT I  62      97.230 132.297 107.408  1.00 88.04           C  
ATOM   2223  O4   DT I  62      96.922 133.391 107.862  1.00 88.04           O  
ATOM   2224  C5   DT I  62      98.597 131.857 107.326  1.00 88.04           C  
ATOM   2225  C7   DT I  62      99.703 132.749 107.793  1.00 88.04           C  
ATOM   2226  C6   DT I  62      98.843 130.646 106.818  1.00 88.04           C  
ATOM   2227  H5'  DT I  62     100.770 126.633 108.083  1.00 88.04           H  
ATOM   2228 H5''  DT I  62     101.463 125.788 106.946  1.00 88.04           H  
ATOM   2229  H4'  DT I  62      99.296 125.873 106.337  1.00 88.04           H  
ATOM   2230  H3'  DT I  62     100.928 127.236 104.676  1.00 88.04           H  
ATOM   2231  H2'  DT I  62      99.840 129.170 104.706  1.00 88.04           H  
ATOM   2232 H2''  DT I  62      98.752 128.428 103.810  1.00 88.04           H  
ATOM   2233  H1'  DT I  62      97.453 127.939 105.562  1.00 88.04           H  
ATOM   2234  H3   DT I  62      95.474 131.652 106.987  1.00 88.04           H  
ATOM   2235  H71  DT I  62      99.430 133.675 107.704  1.00 88.04           H  
ATOM   2236  H72  DT I  62      99.902 132.559 108.717  1.00 88.04           H  
ATOM   2237  H73  DT I  62     100.493 132.592 107.254  1.00 88.04           H  
ATOM   2238  H6   DT I  62      99.726 130.366 106.762  1.00 88.04           H  
ATOM   2239  P    DG I  63      99.735 126.145 102.399  1.00 88.44           P  
ATOM   2240  OP1  DG I  63      99.825 124.758 101.890  1.00 88.44           O  
ATOM   2241  OP2  DG I  63     100.843 127.094 102.151  1.00 88.44           O  
ATOM   2242  O5'  DG I  63      98.390 126.810 101.850  1.00 88.44           O  
ATOM   2243  C5'  DG I  63      97.135 126.226 102.169  1.00 88.44           C  
ATOM   2244  C4'  DG I  63      95.998 127.188 101.887  1.00 88.44           C  
ATOM   2245  O4'  DG I  63      96.061 128.288 102.826  1.00 88.44           O  
ATOM   2246  C3'  DG I  63      96.014 127.819 100.489  1.00 88.44           C  
ATOM   2247  O3'  DG I  63      94.883 127.404  99.737  1.00 88.44           O  
ATOM   2248  C2'  DG I  63      96.020 129.330 100.747  1.00 88.44           C  
ATOM   2249  C1'  DG I  63      95.579 129.444 102.196  1.00 88.44           C  
ATOM   2250  N9   DG I  63      96.098 130.621 102.895  1.00 88.44           N  
ATOM   2251  C8   DG I  63      97.406 130.892 103.206  1.00 88.44           C  
ATOM   2252  N7   DG I  63      97.565 132.018 103.840  1.00 88.44           N  
ATOM   2253  C5   DG I  63      96.283 132.523 103.958  1.00 88.44           C  
ATOM   2254  C6   DG I  63      95.830 133.714 104.556  1.00 88.44           C  
ATOM   2255  O6   DG I  63      96.497 134.588 105.115  1.00 88.44           O  
ATOM   2256  N1   DG I  63      94.447 133.850 104.462  1.00 88.44           N  
ATOM   2257  C2   DG I  63      93.611 132.940 103.862  1.00 88.44           C  
ATOM   2258  N2   DG I  63      92.299 133.232 103.863  1.00 88.44           N  
ATOM   2259  N3   DG I  63      94.028 131.818 103.297  1.00 88.44           N  
ATOM   2260  C4   DG I  63      95.369 131.676 103.384  1.00 88.44           C  
ATOM   2261  H5'  DG I  63      97.125 125.989 103.110  1.00 88.44           H  
ATOM   2262 H5''  DG I  63      97.013 125.424 101.638  1.00 88.44           H  
ATOM   2263  H4'  DG I  63      95.157 126.722 102.009  1.00 88.44           H  
ATOM   2264  H3'  DG I  63      96.824 127.565 100.025  1.00 88.44           H  
ATOM   2265  H2'  DG I  63      96.911 129.688 100.634  1.00 88.44           H  
ATOM   2266 H2''  DG I  63      95.391 129.779 100.163  1.00 88.44           H  
ATOM   2267  H1'  DG I  63      94.611 129.449 102.235  1.00 88.44           H  
ATOM   2268  H8   DG I  63      98.109 130.330 102.983  1.00 88.44           H  
ATOM   2269  H1   DG I  63      94.092 134.555 104.804  1.00 88.44           H  
ATOM   2270  H21  DG I  63      91.756 132.773 103.378  1.00 88.44           H  
ATOM   2271  H22  DG I  63      92.002 133.878 104.348  1.00 88.44           H  
ATOM   2272  P    DT I  64      94.744 127.820  98.192  1.00 84.82           P  
ATOM   2273  OP1  DT I  64      94.034 126.729  97.496  1.00 84.82           O  
ATOM   2274  OP2  DT I  64      96.070 128.263  97.718  1.00 84.82           O  
ATOM   2275  O5'  DT I  64      93.791 129.095  98.235  1.00 84.82           O  
ATOM   2276  C5'  DT I  64      92.554 129.006  98.904  1.00 84.82           C  
ATOM   2277  C4'  DT I  64      91.840 130.346  98.929  1.00 84.82           C  
ATOM   2278  O4'  DT I  64      92.523 131.240  99.851  1.00 84.82           O  
ATOM   2279  C3'  DT I  64      91.791 131.074  97.581  1.00 84.82           C  
ATOM   2280  O3'  DT I  64      90.455 131.440  97.247  1.00 84.82           O  
ATOM   2281  C2'  DT I  64      92.690 132.290  97.789  1.00 84.82           C  
ATOM   2282  C1'  DT I  64      92.588 132.524  99.285  1.00 84.82           C  
ATOM   2283  N1   DT I  64      93.751 133.271  99.891  1.00 84.82           N  
ATOM   2284  C2   DT I  64      93.534 134.469 100.529  1.00 84.82           C  
ATOM   2285  O2   DT I  64      92.440 134.988 100.637  1.00 84.82           O  
ATOM   2286  N3   DT I  64      94.657 135.047 101.042  1.00 84.82           N  
ATOM   2287  C4   DT I  64      95.941 134.567 100.991  1.00 84.82           C  
ATOM   2288  O4   DT I  64      96.888 135.161 101.484  1.00 84.82           O  
ATOM   2289  C5   DT I  64      96.100 133.319 100.320  1.00 84.82           C  
ATOM   2290  C7   DT I  64      97.460 132.713 100.206  1.00 84.82           C  
ATOM   2291  C6   DT I  64      95.013 132.730  99.813  1.00 84.82           C  
ATOM   2292  H5'  DT I  64      92.709 128.712  99.814  1.00 84.82           H  
ATOM   2293 H5''  DT I  64      91.996 128.358  98.452  1.00 84.82           H  
ATOM   2294  H4'  DT I  64      90.932 130.209  99.240  1.00 84.82           H  
ATOM   2295  H3'  DT I  64      92.160 130.505  96.889  1.00 84.82           H  
ATOM   2296  H2'  DT I  64      93.598 132.083  97.531  1.00 84.82           H  
ATOM   2297 H2''  DT I  64      92.356 133.056  97.298  1.00 84.82           H  
ATOM   2298  H1'  DT I  64      91.765 132.994  99.474  1.00 84.82           H  
ATOM   2299  H3   DT I  64      94.549 135.795 101.444  1.00 84.82           H  
ATOM   2300  H71  DT I  64      97.384 131.803  99.889  1.00 84.82           H  
ATOM   2301  H72  DT I  64      97.993 133.230  99.582  1.00 84.82           H  
ATOM   2302  H73  DT I  64      97.887 132.718 101.077  1.00 84.82           H  
ATOM   2303  H6   DT I  64      95.117 131.923  99.371  1.00 84.82           H  
ATOM   2304  P    DT I  65      90.110 131.992  95.778  1.00 86.66           P  
ATOM   2305  OP1  DT I  65      88.749 131.525  95.441  1.00 86.66           O  
ATOM   2306  OP2  DT I  65      91.241 131.669  94.883  1.00 86.66           O  
ATOM   2307  O5'  DT I  65      90.070 133.579  95.961  1.00 86.66           O  
ATOM   2308  C5'  DT I  65      89.028 134.173  96.716  1.00 86.66           C  
ATOM   2309  C4'  DT I  65      89.250 135.663  96.889  1.00 86.66           C  
ATOM   2310  O4'  DT I  65      90.471 135.888  97.638  1.00 86.66           O  
ATOM   2311  C3'  DT I  65      89.397 136.446  95.585  1.00 86.66           C  
ATOM   2312  O3'  DT I  65      88.378 137.425  95.492  1.00 86.66           O  
ATOM   2313  C2'  DT I  65      90.801 137.062  95.657  1.00 86.66           C  
ATOM   2314  C1'  DT I  65      91.107 137.040  97.148  1.00 86.66           C  
ATOM   2315  N1   DT I  65      92.586 136.967  97.509  1.00 86.66           N  
ATOM   2316  C2   DT I  65      93.162 137.969  98.267  1.00 86.66           C  
ATOM   2317  O2   DT I  65      92.557 138.949  98.663  1.00 86.66           O  
ATOM   2318  N3   DT I  65      94.491 137.781  98.543  1.00 86.66           N  
ATOM   2319  C4   DT I  65      95.278 136.722  98.156  1.00 86.66           C  
ATOM   2320  O4   DT I  65      96.463 136.639  98.450  1.00 86.66           O  
ATOM   2321  C5   DT I  65      94.617 135.717  97.383  1.00 86.66           C  
ATOM   2322  C7   DT I  65      95.381 134.531  96.909  1.00 86.66           C  
ATOM   2323  C6   DT I  65      93.323 135.876  97.105  1.00 86.66           C  
ATOM   2324  H5'  DT I  65      88.990 133.753  97.588  1.00 86.66           H  
ATOM   2325 H5''  DT I  65      88.186 134.030  96.259  1.00 86.66           H  
ATOM   2326  H4'  DT I  65      88.506 136.033  97.387  1.00 86.66           H  
ATOM   2327  H3'  DT I  65      89.341 135.838  94.834  1.00 86.66           H  
ATOM   2328  H2'  DT I  65      91.435 136.521  95.164  1.00 86.66           H  
ATOM   2329 H2''  DT I  65      90.792 137.972  95.322  1.00 86.66           H  
ATOM   2330  H1'  DT I  65      90.710 137.820  97.562  1.00 86.66           H  
ATOM   2331  H3   DT I  65      94.875 138.392  99.007  1.00 86.66           H  
ATOM   2332  H71  DT I  65      94.766 133.829  96.666  1.00 86.66           H  
ATOM   2333  H72  DT I  65      95.911 134.778  96.136  1.00 86.66           H  
ATOM   2334  H73  DT I  65      95.965 134.222  97.616  1.00 86.66           H  
ATOM   2335  H6   DT I  65      92.900 135.223  96.601  1.00 86.66           H  
ATOM   2336  P    DC I  66      88.059 138.141  94.092  1.00 85.60           P  
ATOM   2337  OP1  DC I  66      86.636 138.538  94.115  1.00 85.60           O  
ATOM   2338  OP2  DC I  66      88.561 137.283  92.997  1.00 85.60           O  
ATOM   2339  O5'  DC I  66      88.963 139.455  94.128  1.00 85.60           O  
ATOM   2340  C5'  DC I  66      88.893 140.339  95.242  1.00 85.60           C  
ATOM   2341  C4'  DC I  66      89.963 141.408  95.141  1.00 85.60           C  
ATOM   2342  O4'  DC I  66      91.246 140.841  95.546  1.00 85.60           O  
ATOM   2343  C3'  DC I  66      90.172 141.958  93.722  1.00 85.60           C  
ATOM   2344  O3'  DC I  66      90.406 143.356  93.720  1.00 85.60           O  
ATOM   2345  C2'  DC I  66      91.392 141.187  93.263  1.00 85.60           C  
ATOM   2346  C1'  DC I  66      92.196 141.138  94.558  1.00 85.60           C  
ATOM   2347  N1   DC I  66      93.341 140.126  94.608  1.00 85.60           N  
ATOM   2348  C2   DC I  66      94.483 140.413  95.371  1.00 85.60           C  
ATOM   2349  O2   DC I  66      94.536 141.475  96.004  1.00 85.60           O  
ATOM   2350  N3   DC I  66      95.498 139.514  95.397  1.00 85.60           N  
ATOM   2351  C4   DC I  66      95.403 138.382  94.703  1.00 85.60           C  
ATOM   2352  N4   DC I  66      96.421 137.522  94.753  1.00 85.60           N  
ATOM   2353  C5   DC I  66      94.260 138.075  93.925  1.00 85.60           C  
ATOM   2354  C6   DC I  66      93.267 138.959  93.906  1.00 85.60           C  
ATOM   2355  H5'  DC I  66      89.022 139.831  96.059  1.00 85.60           H  
ATOM   2356 H5''  DC I  66      88.020 140.760  95.262  1.00 85.60           H  
ATOM   2357  H4'  DC I  66      89.742 142.138  95.736  1.00 85.60           H  
ATOM   2358  H3'  DC I  66      89.410 141.744  93.163  1.00 85.60           H  
ATOM   2359  H2'  DC I  66      91.134 140.308  92.962  1.00 85.60           H  
ATOM   2360 H2''  DC I  66      91.869 141.668  92.574  1.00 85.60           H  
ATOM   2361  H1'  DC I  66      92.552 142.023  94.727  1.00 85.60           H  
ATOM   2362  H41  DC I  66      96.350 136.751  94.379  1.00 85.60           H  
ATOM   2363  H42  DC I  66      97.145 137.736  95.163  1.00 85.60           H  
ATOM   2364  H5   DC I  66      94.207 137.283  93.445  1.00 85.60           H  
ATOM   2365  H6   DC I  66      92.513 138.779  93.403  1.00 85.60           H  
ATOM   2366  P    DA I  67      89.232 144.413  94.015  1.00 83.99           P  
ATOM   2367  OP1  DA I  67      88.177 143.785  94.834  1.00 83.99           O  
ATOM   2368  OP2  DA I  67      88.866 145.044  92.732  1.00 83.99           O  
ATOM   2369  O5'  DA I  67      89.971 145.524  94.887  1.00 83.99           O  
ATOM   2370  C5'  DA I  67      90.871 145.132  95.924  1.00 83.99           C  
ATOM   2371  C4'  DA I  67      91.778 146.276  96.357  1.00 83.99           C  
ATOM   2372  O4'  DA I  67      93.161 145.889  96.166  1.00 83.99           O  
ATOM   2373  C3'  DA I  67      91.657 147.568  95.575  1.00 83.99           C  
ATOM   2374  O3'  DA I  67      92.166 148.639  96.338  1.00 83.99           O  
ATOM   2375  C2'  DA I  67      92.499 147.268  94.341  1.00 83.99           C  
ATOM   2376  C1'  DA I  67      93.618 146.350  94.900  1.00 83.99           C  
ATOM   2377  N9   DA I  67      93.971 145.159  94.102  1.00 83.99           N  
ATOM   2378  C8   DA I  67      93.193 144.487  93.198  1.00 83.99           C  
ATOM   2379  N7   DA I  67      93.775 143.441  92.670  1.00 83.99           N  
ATOM   2380  C5   DA I  67      95.009 143.397  93.285  1.00 83.99           C  
ATOM   2381  C6   DA I  67      96.098 142.514  93.158  1.00 83.99           C  
ATOM   2382  N6   DA I  67      96.098 141.466  92.333  1.00 83.99           N  
ATOM   2383  N1   DA I  67      97.187 142.747  93.911  1.00 83.99           N  
ATOM   2384  C2   DA I  67      97.185 143.797  94.735  1.00 83.99           C  
ATOM   2385  N3   DA I  67      96.223 144.700  94.942  1.00 83.99           N  
ATOM   2386  C4   DA I  67      95.150 144.440  94.176  1.00 83.99           C  
ATOM   2387  H5'  DA I  67      91.425 144.403  95.609  1.00 83.99           H  
ATOM   2388 H5''  DA I  67      90.358 144.828  96.687  1.00 83.99           H  
ATOM   2389  H4'  DA I  67      91.628 146.461  97.298  1.00 83.99           H  
ATOM   2390  H3'  DA I  67      90.739 147.741  95.327  1.00 83.99           H  
ATOM   2391  H2'  DA I  67      91.963 146.822  93.674  1.00 83.99           H  
ATOM   2392 H2''  DA I  67      92.873 148.084  93.987  1.00 83.99           H  
ATOM   2393  H1'  DA I  67      94.418 146.882  95.032  1.00 83.99           H  
ATOM   2394  H8   DA I  67      92.338 144.763  92.963  1.00 83.99           H  
ATOM   2395  H61  DA I  67      96.816 141.003  92.227  1.00 83.99           H  
ATOM   2396  H62  DA I  67      95.380 141.251  91.909  1.00 83.99           H  
ATOM   2397  H2   DA I  67      97.958 143.913  95.234  1.00 83.99           H  
ATOM   2398  P    DG I  68      92.039 150.152  95.827  1.00 89.63           P  
ATOM   2399  OP1  DG I  68      91.326 150.917  96.869  1.00 89.63           O  
ATOM   2400  OP2  DG I  68      91.518 150.131  94.446  1.00 89.63           O  
ATOM   2401  O5'  DG I  68      93.552 150.651  95.772  1.00 89.63           O  
ATOM   2402  C5'  DG I  68      94.439 150.380  96.856  1.00 89.63           C  
ATOM   2403  C4'  DG I  68      95.862 150.269  96.358  1.00 89.63           C  
ATOM   2404  O4'  DG I  68      95.975 149.087  95.505  1.00 89.63           O  
ATOM   2405  C3'  DG I  68      96.321 151.454  95.489  1.00 89.63           C  
ATOM   2406  O3'  DG I  68      97.701 151.778  95.684  1.00 89.63           O  
ATOM   2407  C2'  DG I  68      96.095 150.906  94.093  1.00 89.63           C  
ATOM   2408  C1'  DG I  68      96.581 149.480  94.299  1.00 89.63           C  
ATOM   2409  N9   DG I  68      96.251 148.538  93.228  1.00 89.63           N  
ATOM   2410  C8   DG I  68      95.133 148.526  92.436  1.00 89.63           C  
ATOM   2411  N7   DG I  68      95.127 147.565  91.560  1.00 89.63           N  
ATOM   2412  C5   DG I  68      96.322 146.903  91.777  1.00 89.63           C  
ATOM   2413  C6   DG I  68      96.868 145.779  91.125  1.00 89.63           C  
ATOM   2414  O6   DG I  68      96.385 145.125  90.193  1.00 89.63           O  
ATOM   2415  N1   DG I  68      98.103 145.428  91.652  1.00 89.63           N  
ATOM   2416  C2   DG I  68      98.732 146.081  92.680  1.00 89.63           C  
ATOM   2417  N2   DG I  68      99.927 145.601  93.055  1.00 89.63           N  
ATOM   2418  N3   DG I  68      98.228 147.138  93.300  1.00 89.63           N  
ATOM   2419  C4   DG I  68      97.023 147.486  92.801  1.00 89.63           C  
ATOM   2420  H5'  DG I  68      94.187 149.550  97.282  1.00 89.63           H  
ATOM   2421 H5''  DG I  68      94.382 151.099  97.501  1.00 89.63           H  
ATOM   2422  H4'  DG I  68      96.457 150.168  97.112  1.00 89.63           H  
ATOM   2423  H3'  DG I  68      95.760 152.229  95.646  1.00 89.63           H  
ATOM   2424  H2'  DG I  68      95.154 150.930  93.859  1.00 89.63           H  
ATOM   2425 H2''  DG I  68      96.637 151.373  93.441  1.00 89.63           H  
ATOM   2426  H1'  DG I  68      97.538 149.488  94.427  1.00 89.63           H  
ATOM   2427  H8   DG I  68      94.440 149.138  92.526  1.00 89.63           H  
ATOM   2428  H1   DG I  68      98.504 144.750  91.307  1.00 89.63           H  
ATOM   2429  H21  DG I  68     100.367 145.984  93.687  1.00 89.63           H  
ATOM   2430  H22  DG I  68     100.259 144.914  92.656  1.00 89.63           H  
ATOM   2431  P    DC I  69      98.278 152.432  97.036  1.00 81.75           P  
ATOM   2432  OP1  DC I  69      97.454 152.067  98.204  1.00 81.75           O  
ATOM   2433  OP2  DC I  69      98.521 153.859  96.744  1.00 81.75           O  
ATOM   2434  O5'  DC I  69      99.714 151.741  97.177  1.00 81.75           O  
ATOM   2435  C5'  DC I  69      99.885 150.374  96.792  1.00 81.75           C  
ATOM   2436  C4'  DC I  69     101.346 149.978  96.660  1.00 81.75           C  
ATOM   2437  O4'  DC I  69     101.482 149.094  95.515  1.00 81.75           O  
ATOM   2438  C3'  DC I  69     102.336 151.093  96.394  1.00 81.75           C  
ATOM   2439  O3'  DC I  69     103.625 150.708  96.835  1.00 81.75           O  
ATOM   2440  C2'  DC I  69     102.240 151.256  94.882  1.00 81.75           C  
ATOM   2441  C1'  DC I  69     101.982 149.813  94.394  1.00 81.75           C  
ATOM   2442  N1   DC I  69     100.978 149.643  93.215  1.00 81.75           N  
ATOM   2443  C2   DC I  69     101.208 148.664  92.223  1.00 81.75           C  
ATOM   2444  O2   DC I  69     102.221 147.960  92.278  1.00 81.75           O  
ATOM   2445  N3   DC I  69     100.301 148.523  91.219  1.00 81.75           N  
ATOM   2446  C4   DC I  69      99.222 149.297  91.179  1.00 81.75           C  
ATOM   2447  N4   DC I  69      98.348 149.122  90.185  1.00 81.75           N  
ATOM   2448  C5   DC I  69      98.968 150.274  92.168  1.00 81.75           C  
ATOM   2449  C6   DC I  69      99.847 150.403  93.160  1.00 81.75           C  
ATOM   2450  H5'  DC I  69      99.455 150.223  95.945  1.00 81.75           H  
ATOM   2451 H5''  DC I  69      99.468 149.810  97.458  1.00 81.75           H  
ATOM   2452  H4'  DC I  69     101.618 149.506  97.455  1.00 81.75           H  
ATOM   2453  H3'  DC I  69     102.065 151.905  96.836  1.00 81.75           H  
ATOM   2454  H2'  DC I  69     101.514 151.848  94.663  1.00 81.75           H  
ATOM   2455 H2''  DC I  69     103.070 151.590  94.523  1.00 81.75           H  
ATOM   2456  H1'  DC I  69     102.831 149.427  94.137  1.00 81.75           H  
ATOM   2457  H41  DC I  69      97.561 149.464  90.240  1.00 81.75           H  
ATOM   2458  H42  DC I  69      98.566 148.652  89.498  1.00 81.75           H  
ATOM   2459  H5   DC I  69      98.205 150.798  92.133  1.00 81.75           H  
ATOM   2460  H6   DC I  69      99.699 151.045  93.815  1.00 81.75           H  
ATOM   2461  P    DT I  70     104.884 151.685  96.658  1.00 79.06           P  
ATOM   2462  OP1  DT I  70     105.669 151.637  97.906  1.00 79.06           O  
ATOM   2463  OP2  DT I  70     104.390 152.980  96.146  1.00 79.06           O  
ATOM   2464  O5'  DT I  70     105.719 150.987  95.496  1.00 79.06           O  
ATOM   2465  C5'  DT I  70     105.862 149.581  95.493  1.00 79.06           C  
ATOM   2466  C4'  DT I  70     106.613 149.107  94.267  1.00 79.06           C  
ATOM   2467  O4'  DT I  70     105.690 148.966  93.147  1.00 79.06           O  
ATOM   2468  C3'  DT I  70     107.694 150.051  93.786  1.00 79.06           C  
ATOM   2469  O3'  DT I  70     108.766 149.323  93.211  1.00 79.06           O  
ATOM   2470  C2'  DT I  70     106.944 150.894  92.770  1.00 79.06           C  
ATOM   2471  C1'  DT I  70     106.075 149.835  92.098  1.00 79.06           C  
ATOM   2472  N1   DT I  70     104.806 150.316  91.383  1.00 79.06           N  
ATOM   2473  C2   DT I  70     104.396 149.662  90.242  1.00 79.06           C  
ATOM   2474  O2   DT I  70     105.009 148.739  89.743  1.00 79.06           O  
ATOM   2475  N3   DT I  70     103.235 150.138  89.693  1.00 79.06           N  
ATOM   2476  C4   DT I  70     102.453 151.169  90.162  1.00 79.06           C  
ATOM   2477  O4   DT I  70     101.425 151.526  89.597  1.00 79.06           O  
ATOM   2478  C5   DT I  70     102.923 151.799  91.358  1.00 79.06           C  
ATOM   2479  C7   DT I  70     102.153 152.937  91.950  1.00 79.06           C  
ATOM   2480  C6   DT I  70     104.056 151.346  91.910  1.00 79.06           C  
ATOM   2481  H5'  DT I  70     104.986 149.174  95.503  1.00 79.06           H  
ATOM   2482 H5''  DT I  70     106.346 149.312  96.285  1.00 79.06           H  
ATOM   2483  H4'  DT I  70     107.012 148.246  94.456  1.00 79.06           H  
ATOM   2484  H3'  DT I  70     108.009 150.601  94.517  1.00 79.06           H  
ATOM   2485  H2'  DT I  70     106.416 151.565  93.215  1.00 79.06           H  
ATOM   2486 H2''  DT I  70     107.552 151.290  92.146  1.00 79.06           H  
ATOM   2487  H1'  DT I  70     106.621 149.343  91.472  1.00 79.06           H  
ATOM   2488  H3   DT I  70     102.966 149.751  88.978  1.00 79.06           H  
ATOM   2489  H71  DT I  70     101.832 153.511  91.239  1.00 79.06           H  
ATOM   2490  H72  DT I  70     101.403 152.595  92.449  1.00 79.06           H  
ATOM   2491  H73  DT I  70     102.730 153.445  92.539  1.00 79.06           H  
ATOM   2492  H6   DT I  70     104.358 151.754  92.683  1.00 79.06           H  
ATOM   2493  P    DG I  71     110.268 149.883  93.280  1.00 89.36           P  
ATOM   2494  OP1  DG I  71     111.021 148.998  94.193  1.00 89.36           O  
ATOM   2495  OP2  DG I  71     110.213 151.338  93.537  1.00 89.36           O  
ATOM   2496  O5'  DG I  71     110.811 149.662  91.796  1.00 89.36           O  
ATOM   2497  C5'  DG I  71     110.823 148.359  91.252  1.00 89.36           C  
ATOM   2498  C4'  DG I  71     110.614 148.383  89.748  1.00 89.36           C  
ATOM   2499  O4'  DG I  71     109.327 148.987  89.445  1.00 89.36           O  
ATOM   2500  C3'  DG I  71     111.650 149.182  88.965  1.00 89.36           C  
ATOM   2501  O3'  DG I  71     112.051 148.463  87.816  1.00 89.36           O  
ATOM   2502  C2'  DG I  71     110.915 150.468  88.625  1.00 89.36           C  
ATOM   2503  C1'  DG I  71     109.492 149.977  88.457  1.00 89.36           C  
ATOM   2504  N9   DG I  71     108.453 150.996  88.637  1.00 89.36           N  
ATOM   2505  C8   DG I  71     108.376 151.934  89.632  1.00 89.36           C  
ATOM   2506  N7   DG I  71     107.323 152.693  89.556  1.00 89.36           N  
ATOM   2507  C5   DG I  71     106.656 152.235  88.436  1.00 89.36           C  
ATOM   2508  C6   DG I  71     105.452 152.680  87.855  1.00 89.36           C  
ATOM   2509  O6   DG I  71     104.717 153.600  88.232  1.00 89.36           O  
ATOM   2510  N1   DG I  71     105.124 151.946  86.723  1.00 89.36           N  
ATOM   2511  C2   DG I  71     105.865 150.904  86.222  1.00 89.36           C  
ATOM   2512  N2   DG I  71     105.396 150.314  85.119  1.00 89.36           N  
ATOM   2513  N3   DG I  71     107.000 150.479  86.756  1.00 89.36           N  
ATOM   2514  C4   DG I  71     107.331 151.186  87.860  1.00 89.36           C  
ATOM   2515  H5'  DG I  71     110.117 147.840  91.663  1.00 89.36           H  
ATOM   2516 H5''  DG I  71     111.676 147.943  91.447  1.00 89.36           H  
ATOM   2517  H4'  DG I  71     110.614 147.474  89.419  1.00 89.36           H  
ATOM   2518  H3'  DG I  71     112.414 149.374  89.525  1.00 89.36           H  
ATOM   2519  H2'  DG I  71     110.985 151.099  89.353  1.00 89.36           H  
ATOM   2520 H2''  DG I  71     111.247 150.847  87.804  1.00 89.36           H  
ATOM   2521  H1'  DG I  71     109.398 149.572  87.584  1.00 89.36           H  
ATOM   2522  H8   DG I  71     109.012 152.012  90.305  1.00 89.36           H  
ATOM   2523  H1   DG I  71     104.401 152.156  86.309  1.00 89.36           H  
ATOM   2524  H21  DG I  71     105.879 149.738  84.702  1.00 89.36           H  
ATOM   2525  H22  DG I  71     104.616 150.516  84.822  1.00 89.36           H  
ATOM   2526  P    DG I  72     113.271 148.974  86.904  1.00 98.00           P  
ATOM   2527  OP1  DG I  72     114.320 147.933  86.947  1.00 98.00           O  
ATOM   2528  OP2  DG I  72     113.609 150.361  87.286  1.00 98.00           O  
ATOM   2529  O5'  DG I  72     112.642 148.999  85.436  1.00 98.00           O  
ATOM   2530  C5'  DG I  72     111.913 147.874  84.970  1.00 98.00           C  
ATOM   2531  C4'  DG I  72     111.236 148.176  83.656  1.00 98.00           C  
ATOM   2532  O4'  DG I  72     110.042 148.966  83.906  1.00 98.00           O  
ATOM   2533  C3'  DG I  72     112.084 148.980  82.685  1.00 98.00           C  
ATOM   2534  O3'  DG I  72     111.878 148.547  81.353  1.00 98.00           O  
ATOM   2535  C2'  DG I  72     111.612 150.403  82.919  1.00 98.00           C  
ATOM   2536  C1'  DG I  72     110.139 150.214  83.255  1.00 98.00           C  
ATOM   2537  N9   DG I  72     109.579 151.249  84.130  1.00 98.00           N  
ATOM   2538  C8   DG I  72     110.065 151.659  85.344  1.00 98.00           C  
ATOM   2539  N7   DG I  72     109.360 152.603  85.895  1.00 98.00           N  
ATOM   2540  C5   DG I  72     108.327 152.818  85.002  1.00 98.00           C  
ATOM   2541  C6   DG I  72     107.246 153.717  85.071  1.00 98.00           C  
ATOM   2542  O6   DG I  72     106.979 154.522  85.965  1.00 98.00           O  
ATOM   2543  N1   DG I  72     106.423 153.617  83.960  1.00 98.00           N  
ATOM   2544  C2   DG I  72     106.622 152.754  82.910  1.00 98.00           C  
ATOM   2545  N2   DG I  72     105.722 152.797  81.915  1.00 98.00           N  
ATOM   2546  N3   DG I  72     107.636 151.906  82.835  1.00 98.00           N  
ATOM   2547  C4   DG I  72     108.443 151.991  83.912  1.00 98.00           C  
ATOM   2548  H5'  DG I  72     111.241 147.637  85.624  1.00 98.00           H  
ATOM   2549 H5''  DG I  72     112.519 147.130  84.850  1.00 98.00           H  
ATOM   2550  H4'  DG I  72     110.980 147.344  83.235  1.00 98.00           H  
ATOM   2551  H3'  DG I  72     113.018 148.899  82.921  1.00 98.00           H  
ATOM   2552  H2'  DG I  72     112.091 150.796  83.661  1.00 98.00           H  
ATOM   2553 H2''  DG I  72     111.716 150.937  82.119  1.00 98.00           H  
ATOM   2554  H1'  DG I  72     109.630 150.183  82.433  1.00 98.00           H  
ATOM   2555  H8   DG I  72     110.842 151.317  85.722  1.00 98.00           H  
ATOM   2556  H1   DG I  72     105.737 154.133  83.927  1.00 98.00           H  
ATOM   2557  H21  DG I  72     105.768 152.231  81.267  1.00 98.00           H  
ATOM   2558  H22  DG I  72     105.097 153.388  81.925  1.00 98.00           H  
ATOM   2559  P    DT I  73     112.775 149.147  80.164  1.00104.93           P  
ATOM   2560  OP1  DT I  73     112.921 148.098  79.132  1.00104.93           O  
ATOM   2561  OP2  DT I  73     113.977 149.760  80.768  1.00104.93           O  
ATOM   2562  O5'  DT I  73     111.876 150.329  79.577  1.00104.93           O  
ATOM   2563  C5'  DT I  73     110.631 150.029  78.962  1.00104.93           C  
ATOM   2564  C4'  DT I  73     109.915 151.292  78.530  1.00104.93           C  
ATOM   2565  O4'  DT I  73     109.421 151.982  79.698  1.00104.93           O  
ATOM   2566  C3'  DT I  73     110.788 152.295  77.778  1.00104.93           C  
ATOM   2567  O3'  DT I  73     110.392 152.377  76.421  1.00104.93           O  
ATOM   2568  C2'  DT I  73     110.594 153.619  78.527  1.00104.93           C  
ATOM   2569  C1'  DT I  73     109.405 153.359  79.442  1.00104.93           C  
ATOM   2570  N1   DT I  73     109.450 154.095  80.771  1.00104.93           N  
ATOM   2571  C2   DT I  73     108.487 155.038  81.069  1.00104.93           C  
ATOM   2572  O2   DT I  73     107.585 155.343  80.313  1.00104.93           O  
ATOM   2573  N3   DT I  73     108.625 155.622  82.297  1.00104.93           N  
ATOM   2574  C4   DT I  73     109.592 155.368  83.236  1.00104.93           C  
ATOM   2575  O4   DT I  73     109.632 155.947  84.311  1.00104.93           O  
ATOM   2576  C5   DT I  73     110.559 154.377  82.870  1.00104.93           C  
ATOM   2577  C7   DT I  73     111.659 154.028  83.817  1.00104.93           C  
ATOM   2578  C6   DT I  73     110.442 153.787  81.676  1.00104.93           C  
ATOM   2579  H5'  DT I  73     110.074 149.549  79.592  1.00104.93           H  
ATOM   2580 H5''  DT I  73     110.786 149.472  78.185  1.00104.93           H  
ATOM   2581  H4'  DT I  73     109.165 151.050  77.967  1.00104.93           H  
ATOM   2582  H3'  DT I  73     111.714 152.026  77.830  1.00104.93           H  
ATOM   2583  H2'  DT I  73     111.381 153.827  79.042  1.00104.93           H  
ATOM   2584 H2''  DT I  73     110.394 154.333  77.907  1.00104.93           H  
ATOM   2585  H1'  DT I  73     108.590 153.584  78.972  1.00104.93           H  
ATOM   2586  H3   DT I  73     108.041 156.215  82.505  1.00104.93           H  
ATOM   2587  H71  DT I  73     111.929 153.112  83.672  1.00104.93           H  
ATOM   2588  H72  DT I  73     112.414 154.616  83.668  1.00104.93           H  
ATOM   2589  H73  DT I  73     111.344 154.133  84.727  1.00104.93           H  
ATOM   2590  H6   DT I  73     111.069 153.147  81.439  1.00104.93           H  
ATOM   2591  P    DT I  74     111.286 153.196  75.366  1.00109.95           P  
ATOM   2592  OP1  DT I  74     111.005 152.647  74.022  1.00109.95           O  
ATOM   2593  OP2  DT I  74     112.677 153.234  75.868  1.00109.95           O  
ATOM   2594  O5'  DT I  74     110.699 154.678  75.449  1.00109.95           O  
ATOM   2595  C5'  DT I  74     109.303 154.887  75.319  1.00109.95           C  
ATOM   2596  C4'  DT I  74     108.911 156.261  75.811  1.00109.95           C  
ATOM   2597  O4'  DT I  74     109.096 156.336  77.245  1.00109.95           O  
ATOM   2598  C3'  DT I  74     109.730 157.412  75.220  1.00109.95           C  
ATOM   2599  O3'  DT I  74     108.889 158.282  74.481  1.00109.95           O  
ATOM   2600  C2'  DT I  74     110.352 158.093  76.441  1.00109.95           C  
ATOM   2601  C1'  DT I  74     109.443 157.650  77.566  1.00109.95           C  
ATOM   2602  N1   DT I  74     110.071 157.686  78.941  1.00109.95           N  
ATOM   2603  C2   DT I  74     109.575 158.554  79.886  1.00109.95           C  
ATOM   2604  O2   DT I  74     108.646 159.312  79.684  1.00109.95           O  
ATOM   2605  N3   DT I  74     110.205 158.508  81.093  1.00109.95           N  
ATOM   2606  C4   DT I  74     111.261 157.705  81.455  1.00109.95           C  
ATOM   2607  O4   DT I  74     111.757 157.745  82.576  1.00109.95           O  
ATOM   2608  C5   DT I  74     111.739 156.815  80.429  1.00109.95           C  
ATOM   2609  C7   DT I  74     112.894 155.899  80.713  1.00109.95           C  
ATOM   2610  C6   DT I  74     111.128 156.846  79.231  1.00109.95           C  
ATOM   2611  H5'  DT I  74     108.831 154.219  75.838  1.00109.95           H  
ATOM   2612 H5''  DT I  74     109.055 154.801  74.387  1.00109.95           H  
ATOM   2613  H4'  DT I  74     107.976 156.411  75.609  1.00109.95           H  
ATOM   2614  H3'  DT I  74     110.427 157.060  74.648  1.00109.95           H  
ATOM   2615  H2'  DT I  74     111.256 157.779  76.584  1.00109.95           H  
ATOM   2616 H2''  DT I  74     110.332 159.053  76.344  1.00109.95           H  
ATOM   2617  H1'  DT I  74     108.644 158.194  77.556  1.00109.95           H  
ATOM   2618  H3   DT I  74     109.910 159.043  81.696  1.00109.95           H  
ATOM   2619  H71  DT I  74     112.860 155.138  80.120  1.00109.95           H  
ATOM   2620  H72  DT I  74     113.727 156.378  80.574  1.00109.95           H  
ATOM   2621  H73  DT I  74     112.848 155.596  81.630  1.00109.95           H  
ATOM   2622  H6   DT I  74     111.433 156.277  78.566  1.00109.95           H  
ATOM   2623  P    DC I  75     109.516 159.420  73.536  1.00104.99           P  
ATOM   2624  OP1  DC I  75     109.296 159.008  72.133  1.00104.99           O  
ATOM   2625  OP2  DC I  75     110.886 159.722  74.002  1.00104.99           O  
ATOM   2626  O5'  DC I  75     108.608 160.693  73.846  1.00104.99           O  
ATOM   2627  C5'  DC I  75     108.027 160.840  75.131  1.00104.99           C  
ATOM   2628  C4'  DC I  75     107.911 162.299  75.553  1.00104.99           C  
ATOM   2629  O4'  DC I  75     108.366 162.410  76.929  1.00104.99           O  
ATOM   2630  C3'  DC I  75     108.768 163.305  74.789  1.00104.99           C  
ATOM   2631  O3'  DC I  75     108.221 164.604  74.887  1.00104.99           O  
ATOM   2632  C2'  DC I  75     110.083 163.186  75.517  1.00104.99           C  
ATOM   2633  C1'  DC I  75     109.594 163.116  76.967  1.00104.99           C  
ATOM   2634  N1   DC I  75     110.529 162.436  77.978  1.00104.99           N  
ATOM   2635  C2   DC I  75     110.561 162.903  79.299  1.00104.99           C  
ATOM   2636  O2   DC I  75     109.847 163.860  79.616  1.00104.99           O  
ATOM   2637  N3   DC I  75     111.383 162.299  80.189  1.00104.99           N  
ATOM   2638  C4   DC I  75     112.140 161.271  79.808  1.00104.99           C  
ATOM   2639  N4   DC I  75     112.935 160.704  80.715  1.00104.99           N  
ATOM   2640  C5   DC I  75     112.119 160.776  78.481  1.00104.99           C  
ATOM   2641  C6   DC I  75     111.306 161.374  77.611  1.00104.99           C  
ATOM   2642  H5'  DC I  75     108.574 160.374  75.777  1.00104.99           H  
ATOM   2643 H5''  DC I  75     107.144 160.443  75.124  1.00104.99           H  
ATOM   2644  H4'  DC I  75     106.983 162.572  75.503  1.00104.99           H  
ATOM   2645  H3'  DC I  75     108.867 163.051  73.863  1.00104.99           H  
ATOM   2646  H2'  DC I  75     110.541 162.384  75.245  1.00104.99           H  
ATOM   2647 H2''  DC I  75     110.631 163.970  75.372  1.00104.99           H  
ATOM   2648  H1'  DC I  75     109.418 164.019  77.263  1.00104.99           H  
ATOM   2649  H41  DC I  75     113.471 160.074  80.480  1.00104.99           H  
ATOM   2650  H42  DC I  75     112.912 160.969  81.531  1.00104.99           H  
ATOM   2651  H5   DC I  75     112.651 160.058  78.228  1.00104.99           H  
ATOM   2652  H6   DC I  75     111.276 161.069  76.736  1.00104.99           H  
ATOM   2653  P    DA I  76     108.442 165.665  73.703  1.00103.17           P  
ATOM   2654  OP1  DA I  76     107.309 165.523  72.761  1.00103.17           O  
ATOM   2655  OP2  DA I  76     109.830 165.513  73.215  1.00103.17           O  
ATOM   2656  O5'  DA I  76     108.328 167.079  74.439  1.00103.17           O  
ATOM   2657  C5'  DA I  76     107.150 167.404  75.162  1.00103.17           C  
ATOM   2658  C4'  DA I  76     107.442 168.411  76.259  1.00103.17           C  
ATOM   2659  O4'  DA I  76     108.210 167.772  77.315  1.00103.17           O  
ATOM   2660  C3'  DA I  76     108.262 169.616  75.827  1.00103.17           C  
ATOM   2661  O3'  DA I  76     107.837 170.768  76.529  1.00103.17           O  
ATOM   2662  C2'  DA I  76     109.684 169.198  76.173  1.00103.17           C  
ATOM   2663  C1'  DA I  76     109.477 168.390  77.444  1.00103.17           C  
ATOM   2664  N9   DA I  76     110.474 167.340  77.686  1.00103.17           N  
ATOM   2665  C8   DA I  76     110.913 166.395  76.801  1.00103.17           C  
ATOM   2666  N7   DA I  76     111.793 165.566  77.304  1.00103.17           N  
ATOM   2667  C5   DA I  76     111.935 165.985  78.613  1.00103.17           C  
ATOM   2668  C6   DA I  76     112.725 165.512  79.676  1.00103.17           C  
ATOM   2669  N6   DA I  76     113.549 164.472  79.562  1.00103.17           N  
ATOM   2670  N1   DA I  76     112.637 166.154  80.863  1.00103.17           N  
ATOM   2671  C2   DA I  76     111.802 167.194  80.967  1.00103.17           C  
ATOM   2672  N3   DA I  76     111.011 167.730  80.036  1.00103.17           N  
ATOM   2673  C4   DA I  76     111.125 167.071  78.872  1.00103.17           C  
ATOM   2674  H5'  DA I  76     106.788 166.596  75.560  1.00103.17           H  
ATOM   2675 H5''  DA I  76     106.495 167.779  74.552  1.00103.17           H  
ATOM   2676  H4'  DA I  76     106.602 168.723  76.629  1.00103.17           H  
ATOM   2677  H3'  DA I  76     108.178 169.753  74.872  1.00103.17           H  
ATOM   2678  H2'  DA I  76     110.058 168.653  75.468  1.00103.17           H  
ATOM   2679 H2''  DA I  76     110.238 169.969  76.342  1.00103.17           H  
ATOM   2680  H1'  DA I  76     109.460 168.995  78.201  1.00103.17           H  
ATOM   2681  H8   DA I  76     110.621 166.350  75.920  1.00103.17           H  
ATOM   2682  H61  DA I  76     114.171 164.352  80.141  1.00103.17           H  
ATOM   2683  H62  DA I  76     113.457 163.921  78.908  1.00103.17           H  
ATOM   2684  H2   DA I  76     111.776 167.605  81.799  1.00103.17           H  
ATOM   2685  P    DG I  77     108.499 172.198  76.231  1.00 99.39           P  
ATOM   2686  OP1  DG I  77     107.415 173.204  76.311  1.00 99.39           O  
ATOM   2687  OP2  DG I  77     109.281 172.071  74.981  1.00 99.39           O  
ATOM   2688  O5'  DG I  77     109.546 172.363  77.430  1.00 99.39           O  
ATOM   2689  C5'  DG I  77     109.725 173.615  78.079  1.00 99.39           C  
ATOM   2690  C4'  DG I  77     109.798 173.426  79.578  1.00 99.39           C  
ATOM   2691  O4'  DG I  77     110.225 172.067  79.874  1.00 99.39           O  
ATOM   2692  C3'  DG I  77     110.807 174.297  80.287  1.00 99.39           C  
ATOM   2693  O3'  DG I  77     110.430 174.432  81.669  1.00 99.39           O  
ATOM   2694  C2'  DG I  77     112.077 173.491  80.051  1.00 99.39           C  
ATOM   2695  C1'  DG I  77     111.578 172.081  80.315  1.00 99.39           C  
ATOM   2696  N9   DG I  77     112.304 171.013  79.615  1.00 99.39           N  
ATOM   2697  C8   DG I  77     112.140 170.627  78.308  1.00 99.39           C  
ATOM   2698  N7   DG I  77     112.898 169.624  77.961  1.00 99.39           N  
ATOM   2699  C5   DG I  77     113.607 169.318  79.112  1.00 99.39           C  
ATOM   2700  C6   DG I  77     114.576 168.316  79.341  1.00 99.39           C  
ATOM   2701  O6   DG I  77     115.016 167.481  78.545  1.00 99.39           O  
ATOM   2702  N1   DG I  77     115.044 168.338  80.649  1.00 99.39           N  
ATOM   2703  C2   DG I  77     114.622 169.217  81.619  1.00 99.39           C  
ATOM   2704  N2   DG I  77     115.189 169.093  82.831  1.00 99.39           N  
ATOM   2705  N3   DG I  77     113.713 170.164  81.415  1.00 99.39           N  
ATOM   2706  C4   DG I  77     113.248 170.154  80.144  1.00 99.39           C  
ATOM   2707  H5'  DG I  77     108.983 174.198  77.869  1.00 99.39           H  
ATOM   2708 H5''  DG I  77     110.548 174.021  77.767  1.00 99.39           H  
ATOM   2709  H4'  DG I  77     108.923 173.575  79.963  1.00 99.39           H  
ATOM   2710  H3'  DG I  77     110.869 175.163  79.862  1.00 99.39           H  
ATOM   2711  H2'  DG I  77     112.374 173.583  79.135  1.00 99.39           H  
ATOM   2712 H2''  DG I  77     112.771 173.738  80.661  1.00 99.39           H  
ATOM   2713  H1'  DG I  77     111.603 171.911  81.269  1.00 99.39           H  
ATOM   2714  H8   DG I  77     111.548 171.044  77.724  1.00 99.39           H  
ATOM   2715  H1   DG I  77     115.640 167.759  80.868  1.00 99.39           H  
ATOM   2716  H21  DG I  77     114.926 169.590  83.482  1.00 99.39           H  
ATOM   2717  H22  DG I  77     115.815 168.516  82.956  1.00 99.39           H  
ATOM   2718  P    DC I  78     111.468 174.917  82.792  1.00 98.16           P  
ATOM   2719  OP1  DC I  78     110.677 175.255  83.995  1.00 98.16           O  
ATOM   2720  OP2  DC I  78     112.312 175.957  82.170  1.00 98.16           O  
ATOM   2721  O5'  DC I  78     112.371 173.611  83.032  1.00 98.16           O  
ATOM   2722  C5'  DC I  78     112.711 173.172  84.336  1.00 98.16           C  
ATOM   2723  C4'  DC I  78     114.193 173.332  84.595  1.00 98.16           C  
ATOM   2724  O4'  DC I  78     114.966 172.500  83.665  1.00 98.16           O  
ATOM   2725  C3'  DC I  78     114.719 174.745  84.398  1.00 98.16           C  
ATOM   2726  O3'  DC I  78     115.757 175.027  85.326  1.00 98.16           O  
ATOM   2727  C2'  DC I  78     115.209 174.700  82.959  1.00 98.16           C  
ATOM   2728  C1'  DC I  78     115.860 173.321  82.925  1.00 98.16           C  
ATOM   2729  N1   DC I  78     116.093 172.679  81.548  1.00 98.16           N  
ATOM   2730  C2   DC I  78     116.946 171.577  81.453  1.00 98.16           C  
ATOM   2731  O2   DC I  78     117.498 171.155  82.473  1.00 98.16           O  
ATOM   2732  N3   DC I  78     117.136 170.991  80.246  1.00 98.16           N  
ATOM   2733  C4   DC I  78     116.521 171.467  79.170  1.00 98.16           C  
ATOM   2734  N4   DC I  78     116.738 170.863  78.000  1.00 98.16           N  
ATOM   2735  C5   DC I  78     115.654 172.583  79.242  1.00 98.16           C  
ATOM   2736  C6   DC I  78     115.472 173.152  80.431  1.00 98.16           C  
ATOM   2737  H5'  DC I  78     112.473 172.237  84.429  1.00 98.16           H  
ATOM   2738 H5''  DC I  78     112.222 173.689  84.990  1.00 98.16           H  
ATOM   2739  H4'  DC I  78     114.376 173.050  85.499  1.00 98.16           H  
ATOM   2740  H3'  DC I  78     113.998 175.386  84.489  1.00 98.16           H  
ATOM   2741  H2'  DC I  78     114.461 174.759  82.354  1.00 98.16           H  
ATOM   2742 H2''  DC I  78     115.848 175.396  82.791  1.00 98.16           H  
ATOM   2743  H1'  DC I  78     116.707 173.366  83.394  1.00 98.16           H  
ATOM   2744  H41  DC I  78     116.366 171.164  77.285  1.00 98.16           H  
ATOM   2745  H42  DC I  78     117.246 170.170  77.961  1.00 98.16           H  
ATOM   2746  H5   DC I  78     115.229 172.908  78.485  1.00 98.16           H  
ATOM   2747  H6   DC I  78     114.907 173.878  80.499  1.00 98.16           H  
ATOM   2748  P    DT I  79     115.395 175.360  86.855  1.00 90.42           P  
ATOM   2749  OP1  DT I  79     113.937 175.170  87.004  1.00 90.42           O  
ATOM   2750  OP2  DT I  79     116.014 176.660  87.180  1.00 90.42           O  
ATOM   2751  O5'  DT I  79     116.134 174.236  87.729  1.00 90.42           O  
ATOM   2752  C5'  DT I  79     116.827 173.140  87.126  1.00 90.42           C  
ATOM   2753  C4'  DT I  79     118.319 173.401  86.946  1.00 90.42           C  
ATOM   2754  O4'  DT I  79     118.667 173.233  85.539  1.00 90.42           O  
ATOM   2755  C3'  DT I  79     118.840 174.801  87.330  1.00 90.42           C  
ATOM   2756  O3'  DT I  79     120.107 174.721  87.974  1.00 90.42           O  
ATOM   2757  C2'  DT I  79     118.933 175.484  85.976  1.00 90.42           C  
ATOM   2758  C1'  DT I  79     119.443 174.332  85.120  1.00 90.42           C  
ATOM   2759  N1   DT I  79     119.316 174.459  83.614  1.00 90.42           N  
ATOM   2760  C2   DT I  79     119.932 173.511  82.841  1.00 90.42           C  
ATOM   2761  O2   DT I  79     120.581 172.594  83.309  1.00 90.42           O  
ATOM   2762  N3   DT I  79     119.765 173.666  81.495  1.00 90.42           N  
ATOM   2763  C4   DT I  79     119.055 174.657  80.850  1.00 90.42           C  
ATOM   2764  O4   DT I  79     118.965 174.718  79.631  1.00 90.42           O  
ATOM   2765  C5   DT I  79     118.435 175.623  81.706  1.00 90.42           C  
ATOM   2766  C7   DT I  79     117.642 176.742  81.103  1.00 90.42           C  
ATOM   2767  C6   DT I  79     118.591 175.487  83.034  1.00 90.42           C  
ATOM   2768  H5'  DT I  79     116.446 172.951  86.268  1.00 90.42           H  
ATOM   2769 H5''  DT I  79     116.718 172.362  87.690  1.00 90.42           H  
ATOM   2770  H4'  DT I  79     118.798 172.738  87.452  1.00 90.42           H  
ATOM   2771  H3'  DT I  79     118.215 175.265  87.895  1.00 90.42           H  
ATOM   2772  H2'  DT I  79     118.061 175.781  85.693  1.00 90.42           H  
ATOM   2773 H2''  DT I  79     119.563 176.214  85.997  1.00 90.42           H  
ATOM   2774  H1'  DT I  79     120.364 174.157  85.337  1.00 90.42           H  
ATOM   2775  H3   DT I  79     120.146 173.082  80.993  1.00 90.42           H  
ATOM   2776  H71  DT I  79     117.060 177.127  81.775  1.00 90.42           H  
ATOM   2777  H72  DT I  79     118.246 177.422  80.768  1.00 90.42           H  
ATOM   2778  H73  DT I  79     117.107 176.397  80.370  1.00 90.42           H  
ATOM   2779  H6   DT I  79     118.180 176.106  83.588  1.00 90.42           H  
ATOM   2780  P    DG I  80     120.261 174.050  89.425  1.00 84.00           P  
ATOM   2781  OP1  DG I  80     118.936 174.116  90.080  1.00 84.00           O  
ATOM   2782  OP2  DG I  80     121.435 174.665  90.083  1.00 84.00           O  
ATOM   2783  O5'  DG I  80     120.574 172.516  89.086  1.00 84.00           O  
ATOM   2784  C5'  DG I  80     121.727 171.882  89.591  1.00 84.00           C  
ATOM   2785  C4'  DG I  80     122.880 171.962  88.601  1.00 84.00           C  
ATOM   2786  O4'  DG I  80     122.462 172.675  87.404  1.00 84.00           O  
ATOM   2787  C3'  DG I  80     124.135 172.696  89.090  1.00 84.00           C  
ATOM   2788  O3'  DG I  80     125.265 171.948  88.802  1.00 84.00           O  
ATOM   2789  C2'  DG I  80     124.104 173.989  88.304  1.00 84.00           C  
ATOM   2790  C1'  DG I  80     123.532 173.494  86.999  1.00 84.00           C  
ATOM   2791  N9   DG I  80     123.044 174.525  86.078  1.00 84.00           N  
ATOM   2792  C8   DG I  80     122.384 175.682  86.397  1.00 84.00           C  
ATOM   2793  N7   DG I  80     122.049 176.389  85.359  1.00 84.00           N  
ATOM   2794  C5   DG I  80     122.523 175.662  84.284  1.00 84.00           C  
ATOM   2795  C6   DG I  80     122.459 175.944  82.910  1.00 84.00           C  
ATOM   2796  O6   DG I  80     121.950 176.925  82.354  1.00 84.00           O  
ATOM   2797  N1   DG I  80     123.066 174.955  82.156  1.00 84.00           N  
ATOM   2798  C2   DG I  80     123.657 173.832  82.669  1.00 84.00           C  
ATOM   2799  N2   DG I  80     124.196 172.988  81.787  1.00 84.00           N  
ATOM   2800  N3   DG I  80     123.723 173.556  83.959  1.00 84.00           N  
ATOM   2801  C4   DG I  80     123.137 174.513  84.705  1.00 84.00           C  
ATOM   2802  H5'  DG I  80     121.523 170.951  89.756  1.00 84.00           H  
ATOM   2803 H5''  DG I  80     121.980 172.300  90.423  1.00 84.00           H  
ATOM   2804  H4'  DG I  80     123.133 171.063  88.351  1.00 84.00           H  
ATOM   2805  H3'  DG I  80     124.086 172.877  90.034  1.00 84.00           H  
ATOM   2806  H2'  DG I  80     123.518 174.631  88.724  1.00 84.00           H  
ATOM   2807 H2''  DG I  80     124.990 174.346  88.189  1.00 84.00           H  
ATOM   2808  H1'  DG I  80     124.185 172.947  86.551  1.00 84.00           H  
ATOM   2809  H8   DG I  80     122.173 175.925  87.268  1.00 84.00           H  
ATOM   2810  H1   DG I  80     123.071 175.051  81.305  1.00 84.00           H  
ATOM   2811  H21  DG I  80     124.685 172.336  82.061  1.00 84.00           H  
ATOM   2812  H22  DG I  80     124.060 173.101  80.946  1.00 84.00           H  
ATOM   2813  P    DA I  81     126.636 172.235  89.573  1.00 81.79           P  
ATOM   2814  OP1  DA I  81     126.643 171.404  90.796  1.00 81.79           O  
ATOM   2815  OP2  DA I  81     126.836 173.693  89.676  1.00 81.79           O  
ATOM   2816  O5'  DA I  81     127.732 171.654  88.580  1.00 81.79           O  
ATOM   2817  C5'  DA I  81     127.635 170.314  88.183  1.00 81.79           C  
ATOM   2818  C4'  DA I  81     128.150 170.115  86.788  1.00 81.79           C  
ATOM   2819  O4'  DA I  81     127.356 170.894  85.849  1.00 81.79           O  
ATOM   2820  C3'  DA I  81     129.566 170.568  86.605  1.00 81.79           C  
ATOM   2821  O3'  DA I  81     130.219 169.745  85.693  1.00 81.79           O  
ATOM   2822  C2'  DA I  81     129.389 171.983  86.115  1.00 81.79           C  
ATOM   2823  C1'  DA I  81     128.168 171.874  85.242  1.00 81.79           C  
ATOM   2824  N9   DA I  81     127.422 173.109  85.160  1.00 81.79           N  
ATOM   2825  C8   DA I  81     126.782 173.718  86.185  1.00 81.79           C  
ATOM   2826  N7   DA I  81     126.178 174.826  85.852  1.00 81.79           N  
ATOM   2827  C5   DA I  81     126.462 174.966  84.513  1.00 81.79           C  
ATOM   2828  C6   DA I  81     126.106 175.944  83.581  1.00 81.79           C  
ATOM   2829  N6   DA I  81     125.364 177.002  83.894  1.00 81.79           N  
ATOM   2830  N1   DA I  81     126.542 175.795  82.318  1.00 81.79           N  
ATOM   2831  C2   DA I  81     127.287 174.726  82.016  1.00 81.79           C  
ATOM   2832  N3   DA I  81     127.685 173.731  82.812  1.00 81.79           N  
ATOM   2833  C4   DA I  81     127.230 173.915  84.061  1.00 81.79           C  
ATOM   2834  H5'  DA I  81     126.718 170.047  88.215  1.00 81.79           H  
ATOM   2835 H5''  DA I  81     128.152 169.766  88.792  1.00 81.79           H  
ATOM   2836  H4'  DA I  81     128.087 169.179  86.556  1.00 81.79           H  
ATOM   2837  H3'  DA I  81     130.021 170.565  87.453  1.00 81.79           H  
ATOM   2838  H2'  DA I  81     129.231 172.578  86.854  1.00 81.79           H  
ATOM   2839 H2''  DA I  81     130.132 172.267  85.613  1.00 81.79           H  
ATOM   2840  H1'  DA I  81     128.423 171.584  84.356  1.00 81.79           H  
ATOM   2841  H8   DA I  81     126.756 173.364  87.046  1.00 81.79           H  
ATOM   2842  H61  DA I  81     125.310 177.665  83.351  1.00 81.79           H  
ATOM   2843  H62  DA I  81     124.937 177.020  84.640  1.00 81.79           H  
ATOM   2844  H2   DA I  81     127.564 174.668  81.131  1.00 81.79           H  
ATOM   2845  P    DA I  82     131.795 169.503  85.815  1.00 84.59           P  
ATOM   2846  OP1  DA I  82     132.059 168.054  85.797  1.00 84.59           O  
ATOM   2847  OP2  DA I  82     132.343 170.319  86.917  1.00 84.59           O  
ATOM   2848  O5'  DA I  82     132.330 170.093  84.453  1.00 84.59           O  
ATOM   2849  C5'  DA I  82     132.642 171.429  84.378  1.00 84.59           C  
ATOM   2850  C4'  DA I  82     133.272 171.752  83.076  1.00 84.59           C  
ATOM   2851  O4'  DA I  82     132.335 172.572  82.344  1.00 84.59           O  
ATOM   2852  C3'  DA I  82     134.573 172.549  83.130  1.00 84.59           C  
ATOM   2853  O3'  DA I  82     135.431 172.211  82.024  1.00 84.59           O  
ATOM   2854  C2'  DA I  82     134.110 173.974  83.061  1.00 84.59           C  
ATOM   2855  C1'  DA I  82     132.729 173.924  82.409  1.00 84.59           C  
ATOM   2856  N9   DA I  82     131.738 174.736  83.114  1.00 84.59           N  
ATOM   2857  C8   DA I  82     131.319 174.622  84.409  1.00 84.59           C  
ATOM   2858  N7   DA I  82     130.455 175.533  84.765  1.00 84.59           N  
ATOM   2859  C5   DA I  82     130.315 176.306  83.637  1.00 84.59           C  
ATOM   2860  C6   DA I  82     129.544 177.430  83.369  1.00 84.59           C  
ATOM   2861  N6   DA I  82     128.734 177.975  84.267  1.00 84.59           N  
ATOM   2862  N1   DA I  82     129.627 177.971  82.139  1.00 84.59           N  
ATOM   2863  C2   DA I  82     130.441 177.406  81.249  1.00 84.59           C  
ATOM   2864  N3   DA I  82     131.217 176.345  81.391  1.00 84.59           N  
ATOM   2865  C4   DA I  82     131.096 175.832  82.614  1.00 84.59           C  
ATOM   2866  H5'  DA I  82     133.231 171.672  85.099  1.00 84.59           H  
ATOM   2867 H5''  DA I  82     131.851 171.922  84.445  1.00 84.59           H  
ATOM   2868  H4'  DA I  82     133.424 170.931  82.595  1.00 84.59           H  
ATOM   2869  H3'  DA I  82     135.032 172.399  83.958  1.00 84.59           H  
ATOM   2870  H2'  DA I  82     134.061 174.357  83.947  1.00 84.59           H  
ATOM   2871 H2''  DA I  82     134.702 174.468  82.515  1.00 84.59           H  
ATOM   2872  H1'  DA I  82     132.801 174.265  81.521  1.00 84.59           H  
ATOM   2873  H8   DA I  82     131.610 173.950  84.980  1.00 84.59           H  
ATOM   2874  H61  DA I  82     128.287 178.680  84.070  1.00 84.59           H  
ATOM   2875  H62  DA I  82     128.647 177.612  85.041  1.00 84.59           H  
ATOM   2876  H2   DA I  82     130.468 177.810  80.417  1.00 84.59           H  
ATOM   2877  P    DC I  83     136.923 172.804  81.888  1.00 93.04           P  
ATOM   2878  OP1  DC I  83     137.613 171.996  80.860  1.00 93.04           O  
ATOM   2879  OP2  DC I  83     137.501 172.933  83.240  1.00 93.04           O  
ATOM   2880  O5'  DC I  83     136.720 174.285  81.311  1.00 93.04           O  
ATOM   2881  C5'  DC I  83     137.070 174.591  79.976  1.00 93.04           C  
ATOM   2882  C4'  DC I  83     136.415 175.896  79.522  1.00 93.04           C  
ATOM   2883  O4'  DC I  83     135.199 176.178  80.280  1.00 93.04           O  
ATOM   2884  C3'  DC I  83     137.300 177.106  79.716  1.00 93.04           C  
ATOM   2885  O3'  DC I  83     137.908 177.468  78.494  1.00 93.04           O  
ATOM   2886  C2'  DC I  83     136.377 178.195  80.273  1.00 93.04           C  
ATOM   2887  C1'  DC I  83     134.988 177.584  80.296  1.00 93.04           C  
ATOM   2888  N1   DC I  83     134.186 177.970  81.541  1.00 93.04           N  
ATOM   2889  C2   DC I  83     133.370 179.127  81.586  1.00 93.04           C  
ATOM   2890  O2   DC I  83     133.265 179.856  80.593  1.00 93.04           O  
ATOM   2891  N3   DC I  83     132.699 179.404  82.743  1.00 93.04           N  
ATOM   2892  C4   DC I  83     132.831 178.601  83.795  1.00 93.04           C  
ATOM   2893  N4   DC I  83     132.165 178.891  84.911  1.00 93.04           N  
ATOM   2894  C5   DC I  83     133.660 177.462  83.760  1.00 93.04           C  
ATOM   2895  C6   DC I  83     134.303 177.195  82.631  1.00 93.04           C  
ATOM   2896  H5'  DC I  83     136.784 173.872  79.398  1.00 93.04           H  
ATOM   2897 H5''  DC I  83     138.031 174.678  79.912  1.00 93.04           H  
ATOM   2898  H4'  DC I  83     136.189 175.823  78.582  1.00 93.04           H  
ATOM   2899  H3'  DC I  83     137.983 176.903  80.370  1.00 93.04           H  
ATOM   2900  H2'  DC I  83     136.649 178.417  81.172  1.00 93.04           H  
ATOM   2901 H2''  DC I  83     136.394 178.979  79.712  1.00 93.04           H  
ATOM   2902  H1'  DC I  83     134.502 177.851  79.501  1.00 93.04           H  
ATOM   2903  H41  DC I  83     132.066 178.291  85.518  1.00 93.04           H  
ATOM   2904  H42  DC I  83     131.830 179.672  85.021  1.00 93.04           H  
ATOM   2905  H5   DC I  83     133.734 176.905  84.497  1.00 93.04           H  
ATOM   2906  H6   DC I  83     134.844 176.458  82.591  1.00 93.04           H  
ATOM   2907  P    DA I  84     139.158 178.470  78.491  1.00 95.58           P  
ATOM   2908  OP1  DA I  84     139.892 178.269  77.225  1.00 95.58           O  
ATOM   2909  OP2  DA I  84     139.875 178.347  79.778  1.00 95.58           O  
ATOM   2910  O5'  DA I  84     138.460 179.896  78.472  1.00 95.58           O  
ATOM   2911  C5'  DA I  84     137.491 180.191  77.481  1.00 95.58           C  
ATOM   2912  C4'  DA I  84     136.989 181.604  77.644  1.00 95.58           C  
ATOM   2913  O4'  DA I  84     136.040 181.668  78.747  1.00 95.58           O  
ATOM   2914  C3'  DA I  84     138.089 182.603  77.960  1.00 95.58           C  
ATOM   2915  O3'  DA I  84     137.968 183.750  77.153  1.00 95.58           O  
ATOM   2916  C2'  DA I  84     137.903 182.896  79.445  1.00 95.58           C  
ATOM   2917  C1'  DA I  84     136.413 182.688  79.653  1.00 95.58           C  
ATOM   2918  N9   DA I  84     136.046 182.260  81.007  1.00 95.58           N  
ATOM   2919  C8   DA I  84     136.446 181.122  81.624  1.00 95.58           C  
ATOM   2920  N7   DA I  84     135.960 180.959  82.824  1.00 95.58           N  
ATOM   2921  C5   DA I  84     135.184 182.075  83.018  1.00 95.58           C  
ATOM   2922  C6   DA I  84     134.406 182.498  84.106  1.00 95.58           C  
ATOM   2923  N6   DA I  84     134.290 181.793  85.237  1.00 95.58           N  
ATOM   2924  N1   DA I  84     133.749 183.669  83.988  1.00 95.58           N  
ATOM   2925  C2   DA I  84     133.870 184.363  82.847  1.00 95.58           C  
ATOM   2926  N3   DA I  84     134.579 184.066  81.755  1.00 95.58           N  
ATOM   2927  C4   DA I  84     135.219 182.897  81.908  1.00 95.58           C  
ATOM   2928  H5'  DA I  84     136.749 179.576  77.562  1.00 95.58           H  
ATOM   2929 H5''  DA I  84     137.892 180.094  76.606  1.00 95.58           H  
ATOM   2930  H4'  DA I  84     136.544 181.875  76.829  1.00 95.58           H  
ATOM   2931  H3'  DA I  84     138.951 182.192  77.814  1.00 95.58           H  
ATOM   2932  H2'  DA I  84     138.413 182.270  79.978  1.00 95.58           H  
ATOM   2933 H2''  DA I  84     138.154 183.809  79.649  1.00 95.58           H  
ATOM   2934  H1'  DA I  84     135.939 183.503  79.433  1.00 95.58           H  
ATOM   2935  H8   DA I  84     137.010 180.508  81.223  1.00 95.58           H  
ATOM   2936  H61  DA I  84     133.922 182.148  85.930  1.00 95.58           H  
ATOM   2937  H62  DA I  84     134.579 180.982  85.271  1.00 95.58           H  
ATOM   2938  H2   DA I  84     133.399 185.164  82.814  1.00 95.58           H  
ATOM   2939  P    DT I  85     139.192 184.780  77.037  1.00 95.18           P  
ATOM   2940  OP1  DT I  85     139.132 185.387  75.691  1.00 95.18           O  
ATOM   2941  OP2  DT I  85     140.435 184.109  77.479  1.00 95.18           O  
ATOM   2942  O5'  DT I  85     138.838 185.884  78.128  1.00 95.18           O  
ATOM   2943  C5'  DT I  85     137.581 186.538  78.084  1.00 95.18           C  
ATOM   2944  C4'  DT I  85     137.316 187.322  79.356  1.00 95.18           C  
ATOM   2945  O4'  DT I  85     136.929 186.419  80.407  1.00 95.18           O  
ATOM   2946  C3'  DT I  85     138.513 188.102  79.913  1.00 95.18           C  
ATOM   2947  O3'  DT I  85     138.387 189.488  79.617  1.00 95.18           O  
ATOM   2948  C2'  DT I  85     138.484 187.823  81.425  1.00 95.18           C  
ATOM   2949  C1'  DT I  85     137.196 187.042  81.632  1.00 95.18           C  
ATOM   2950  N1   DT I  85     137.266 185.988  82.701  1.00 95.18           N  
ATOM   2951  C2   DT I  85     136.546 186.146  83.862  1.00 95.18           C  
ATOM   2952  O2   DT I  85     135.845 187.114  84.094  1.00 95.18           O  
ATOM   2953  N3   DT I  85     136.672 185.120  84.755  1.00 95.18           N  
ATOM   2954  C4   DT I  85     137.429 183.980  84.610  1.00 95.18           C  
ATOM   2955  O4   DT I  85     137.478 183.113  85.472  1.00 95.18           O  
ATOM   2956  C5   DT I  85     138.152 183.874  83.375  1.00 95.18           C  
ATOM   2957  C7   DT I  85     139.005 182.677  83.109  1.00 95.18           C  
ATOM   2958  C6   DT I  85     138.037 184.867  82.488  1.00 95.18           C  
ATOM   2959  H5'  DT I  85     136.883 185.874  77.971  1.00 95.18           H  
ATOM   2960 H5''  DT I  85     137.566 187.144  77.329  1.00 95.18           H  
ATOM   2961  H4'  DT I  85     136.589 187.940  79.195  1.00 95.18           H  
ATOM   2962  H3'  DT I  85     139.335 187.762  79.536  1.00 95.18           H  
ATOM   2963  H2'  DT I  85     139.251 187.292  81.688  1.00 95.18           H  
ATOM   2964 H2''  DT I  85     138.458 188.654  81.921  1.00 95.18           H  
ATOM   2965  H1'  DT I  85     136.481 187.661  81.832  1.00 95.18           H  
ATOM   2966  H3   DT I  85     136.235 185.195  85.488  1.00 95.18           H  
ATOM   2967  H71  DT I  85     139.090 182.548  82.155  1.00 95.18           H  
ATOM   2968  H72  DT I  85     139.883 182.813  83.496  1.00 95.18           H  
ATOM   2969  H73  DT I  85     138.594 181.894  83.506  1.00 95.18           H  
ATOM   2970  H6   DT I  85     138.506 184.801  81.692  1.00 95.18           H  
ATOM   2971  P    DG I  86     139.627 190.487  79.844  1.00100.70           P  
ATOM   2972  OP1  DG I  86     139.501 191.573  78.848  1.00100.70           O  
ATOM   2973  OP2  DG I  86     140.873 189.690  79.905  1.00100.70           O  
ATOM   2974  O5'  DG I  86     139.357 191.098  81.295  1.00100.70           O  
ATOM   2975  C5'  DG I  86     138.180 191.846  81.526  1.00100.70           C  
ATOM   2976  C4'  DG I  86     137.834 191.883  82.999  1.00100.70           C  
ATOM   2977  O4'  DG I  86     137.901 190.541  83.546  1.00100.70           O  
ATOM   2978  C3'  DG I  86     138.762 192.743  83.861  1.00100.70           C  
ATOM   2979  O3'  DG I  86     137.986 193.645  84.653  1.00100.70           O  
ATOM   2980  C2'  DG I  86     139.533 191.722  84.704  1.00100.70           C  
ATOM   2981  C1'  DG I  86     138.561 190.569  84.790  1.00100.70           C  
ATOM   2982  N9   DG I  86     139.162 189.260  85.017  1.00100.70           N  
ATOM   2983  C8   DG I  86     140.071 188.614  84.221  1.00100.70           C  
ATOM   2984  N7   DG I  86     140.397 187.432  84.660  1.00100.70           N  
ATOM   2985  C5   DG I  86     139.650 187.284  85.816  1.00100.70           C  
ATOM   2986  C6   DG I  86     139.585 186.208  86.726  1.00100.70           C  
ATOM   2987  O6   DG I  86     140.198 185.136  86.690  1.00100.70           O  
ATOM   2988  N1   DG I  86     138.700 186.466  87.765  1.00100.70           N  
ATOM   2989  C2   DG I  86     137.971 187.620  87.904  1.00100.70           C  
ATOM   2990  N2   DG I  86     137.163 187.697  88.968  1.00100.70           N  
ATOM   2991  N3   DG I  86     138.025 188.634  87.059  1.00100.70           N  
ATOM   2992  C4   DG I  86     138.881 188.398  86.044  1.00100.70           C  
ATOM   2993  H5'  DG I  86     137.446 191.442  81.039  1.00100.70           H  
ATOM   2994 H5''  DG I  86     138.311 192.751  81.208  1.00100.70           H  
ATOM   2995  H4'  DG I  86     136.928 192.213  83.096  1.00100.70           H  
ATOM   2996  H3'  DG I  86     139.374 193.237  83.295  1.00100.70           H  
ATOM   2997  H2'  DG I  86     140.350 191.452  84.259  1.00100.70           H  
ATOM   2998 H2''  DG I  86     139.716 192.074  85.580  1.00100.70           H  
ATOM   2999  H1'  DG I  86     137.918 190.750  85.488  1.00100.70           H  
ATOM   3000  H8   DG I  86     140.421 188.983  83.445  1.00100.70           H  
ATOM   3001  H1   DG I  86     138.602 185.857  88.365  1.00100.70           H  
ATOM   3002  H21  DG I  86     136.787 188.444  89.170  1.00100.70           H  
ATOM   3003  H22  DG I  86     137.017 186.996  89.448  1.00100.70           H  
ATOM   3004  P    DC I  87     138.677 194.799  85.535  1.00101.97           P  
ATOM   3005  OP1  DC I  87     138.330 196.086  84.895  1.00101.97           O  
ATOM   3006  OP2  DC I  87     140.097 194.472  85.772  1.00101.97           O  
ATOM   3007  O5'  DC I  87     137.917 194.710  86.940  1.00101.97           O  
ATOM   3008  C5'  DC I  87     137.254 193.508  87.325  1.00101.97           C  
ATOM   3009  C4'  DC I  87     137.325 193.270  88.823  1.00101.97           C  
ATOM   3010  O4'  DC I  87     137.872 191.937  89.051  1.00101.97           O  
ATOM   3011  C3'  DC I  87     138.258 194.180  89.602  1.00101.97           C  
ATOM   3012  O3'  DC I  87     137.960 194.144  90.995  1.00101.97           O  
ATOM   3013  C2'  DC I  87     139.575 193.515  89.295  1.00101.97           C  
ATOM   3014  C1'  DC I  87     139.180 192.066  89.586  1.00101.97           C  
ATOM   3015  N1   DC I  87     140.072 190.969  89.016  1.00101.97           N  
ATOM   3016  C2   DC I  87     140.092 189.717  89.645  1.00101.97           C  
ATOM   3017  O2   DC I  87     139.385 189.532  90.642  1.00101.97           O  
ATOM   3018  N3   DC I  87     140.881 188.742  89.140  1.00101.97           N  
ATOM   3019  C4   DC I  87     141.624 188.978  88.065  1.00101.97           C  
ATOM   3020  N4   DC I  87     142.391 187.989  87.603  1.00101.97           N  
ATOM   3021  C5   DC I  87     141.617 190.238  87.414  1.00101.97           C  
ATOM   3022  C6   DC I  87     140.842 191.191  87.919  1.00101.97           C  
ATOM   3023  H5'  DC I  87     137.671 192.761  86.876  1.00101.97           H  
ATOM   3024 H5''  DC I  87     136.325 193.560  87.058  1.00101.97           H  
ATOM   3025  H4'  DC I  87     136.437 193.321  89.200  1.00101.97           H  
ATOM   3026  H3'  DC I  87     138.235 195.084  89.266  1.00101.97           H  
ATOM   3027  H2'  DC I  87     139.814 193.652  88.369  1.00101.97           H  
ATOM   3028 H2''  DC I  87     140.268 193.819  89.892  1.00101.97           H  
ATOM   3029  H1'  DC I  87     139.133 191.956  90.546  1.00101.97           H  
ATOM   3030  H41  DC I  87     142.895 188.120  86.920  1.00101.97           H  
ATOM   3031  H42  DC I  87     142.381 187.220  87.990  1.00101.97           H  
ATOM   3032  H5   DC I  87     142.140 190.393  86.666  1.00101.97           H  
ATOM   3033  H6   DC I  87     140.818 192.019  87.508  1.00101.97           H  
ATOM   3034  P    DC I  88     136.824 195.085  91.629  1.00103.10           P  
ATOM   3035  OP1  DC I  88     135.562 194.875  90.892  1.00103.10           O  
ATOM   3036  OP2  DC I  88     137.393 196.443  91.750  1.00103.10           O  
ATOM   3037  O5'  DC I  88     136.645 194.510  93.108  1.00103.10           O  
ATOM   3038  C5'  DC I  88     136.404 193.117  93.315  1.00103.10           C  
ATOM   3039  C4'  DC I  88     137.292 192.550  94.423  1.00103.10           C  
ATOM   3040  O4'  DC I  88     138.424 191.812  93.833  1.00103.10           O  
ATOM   3041  C3'  DC I  88     137.944 193.594  95.327  1.00103.10           C  
ATOM   3042  O3'  DC I  88     138.189 193.068  96.633  1.00103.10           O  
ATOM   3043  C2'  DC I  88     139.227 193.838  94.564  1.00103.10           C  
ATOM   3044  C1'  DC I  88     139.626 192.395  94.310  1.00103.10           C  
ATOM   3045  N1   DC I  88     140.770 192.160  93.325  1.00103.10           N  
ATOM   3046  C2   DC I  88     141.373 190.890  93.260  1.00103.10           C  
ATOM   3047  O2   DC I  88     140.952 189.980  93.985  1.00103.10           O  
ATOM   3048  N3   DC I  88     142.397 190.692  92.394  1.00103.10           N  
ATOM   3049  C4   DC I  88     142.824 191.692  91.629  1.00103.10           C  
ATOM   3050  N4   DC I  88     143.835 191.454  90.794  1.00103.10           N  
ATOM   3051  C5   DC I  88     142.242 192.985  91.689  1.00103.10           C  
ATOM   3052  C6   DC I  88     141.235 193.177  92.540  1.00103.10           C  
ATOM   3053  H5'  DC I  88     136.582 192.642  92.490  1.00103.10           H  
ATOM   3054 H5''  DC I  88     135.475 192.993  93.558  1.00103.10           H  
ATOM   3055  H4'  DC I  88     136.768 191.943  94.968  1.00103.10           H  
ATOM   3056  H3'  DC I  88     137.409 194.398  95.376  1.00103.10           H  
ATOM   3057  H2'  DC I  88     139.045 194.309  93.737  1.00103.10           H  
ATOM   3058 H2''  DC I  88     139.875 194.298  95.095  1.00103.10           H  
ATOM   3059  H1'  DC I  88     139.859 191.984  95.155  1.00103.10           H  
ATOM   3060  H41  DC I  88     144.100 192.069  90.255  1.00103.10           H  
ATOM   3061  H42  DC I  88     144.224 190.689  90.798  1.00103.10           H  
ATOM   3062  H5   DC I  88     142.549 193.674  91.148  1.00103.10           H  
ATOM   3063  H6   DC I  88     140.839 194.013  92.590  1.00103.10           H  
ATOM   3064  P    DT I  89     137.017 192.988  97.729  1.00100.44           P  
ATOM   3065  OP1  DT I  89     135.725 192.927  97.011  1.00100.44           O  
ATOM   3066  OP2  DT I  89     137.253 194.049  98.731  1.00100.44           O  
ATOM   3067  O5'  DT I  89     137.272 191.579  98.437  1.00100.44           O  
ATOM   3068  C5'  DT I  89     137.130 190.400  97.679  1.00100.44           C  
ATOM   3069  C4'  DT I  89     137.843 189.217  98.318  1.00100.44           C  
ATOM   3070  O4'  DT I  89     139.180 189.096  97.767  1.00100.44           O  
ATOM   3071  C3'  DT I  89     138.043 189.278  99.819  1.00100.44           C  
ATOM   3072  O3'  DT I  89     138.059 187.952 100.329  1.00100.44           O  
ATOM   3073  C2'  DT I  89     139.379 190.008  99.943  1.00100.44           C  
ATOM   3074  C1'  DT I  89     140.156 189.492  98.721  1.00100.44           C  
ATOM   3075  N1   DT I  89     141.112 190.467  97.998  1.00100.44           N  
ATOM   3076  C2   DT I  89     142.182 189.940  97.307  1.00100.44           C  
ATOM   3077  O2   DT I  89     142.446 188.753  97.288  1.00100.44           O  
ATOM   3078  N3   DT I  89     142.953 190.858  96.653  1.00100.44           N  
ATOM   3079  C4   DT I  89     142.762 192.218  96.596  1.00100.44           C  
ATOM   3080  O4   DT I  89     143.516 192.958  95.978  1.00100.44           O  
ATOM   3081  C5   DT I  89     141.618 192.708  97.314  1.00100.44           C  
ATOM   3082  C7   DT I  89     141.315 194.174  97.338  1.00100.44           C  
ATOM   3083  C6   DT I  89     140.842 191.823  97.945  1.00100.44           C  
ATOM   3084  H5'  DT I  89     137.501 190.551  96.795  1.00100.44           H  
ATOM   3085 H5''  DT I  89     136.188 190.193  97.592  1.00100.44           H  
ATOM   3086  H4'  DT I  89     137.349 188.411  98.108  1.00100.44           H  
ATOM   3087  H3'  DT I  89     137.337 189.793 100.234  1.00100.44           H  
ATOM   3088  H2'  DT I  89     139.237 190.958  99.910  1.00100.44           H  
ATOM   3089 H2''  DT I  89     139.832 189.761 100.754  1.00100.44           H  
ATOM   3090  H1'  DT I  89     140.657 188.710  98.990  1.00100.44           H  
ATOM   3091  H3   DT I  89     143.633 190.551  96.228  1.00100.44           H  
ATOM   3092  H71  DT I  89     140.354 194.305  97.373  1.00100.44           H  
ATOM   3093  H72  DT I  89     141.724 194.577  98.119  1.00100.44           H  
ATOM   3094  H73  DT I  89     141.669 194.591  96.537  1.00100.44           H  
ATOM   3095  H6   DT I  89     140.113 192.143  98.420  1.00100.44           H  
ATOM   3096  P    DT I  90     138.405 187.619 101.857  1.00 93.49           P  
ATOM   3097  OP1  DT I  90     137.376 186.658 102.294  1.00 93.49           O  
ATOM   3098  OP2  DT I  90     138.589 188.869 102.622  1.00 93.49           O  
ATOM   3099  O5'  DT I  90     139.799 186.847 101.743  1.00 93.49           O  
ATOM   3100  C5'  DT I  90     139.917 185.755 100.832  1.00 93.49           C  
ATOM   3101  C4'  DT I  90     141.363 185.330 100.657  1.00 93.49           C  
ATOM   3102  O4'  DT I  90     142.087 186.385  99.981  1.00 93.49           O  
ATOM   3103  C3'  DT I  90     142.107 185.068 101.962  1.00 93.49           C  
ATOM   3104  O3'  DT I  90     142.979 183.941 101.866  1.00 93.49           O  
ATOM   3105  C2'  DT I  90     142.863 186.359 102.164  1.00 93.49           C  
ATOM   3106  C1'  DT I  90     143.215 186.736 100.738  1.00 93.49           C  
ATOM   3107  N1   DT I  90     143.522 188.211 100.483  1.00 93.49           N  
ATOM   3108  C2   DT I  90     144.627 188.550  99.730  1.00 93.49           C  
ATOM   3109  O2   DT I  90     145.417 187.737  99.291  1.00 93.49           O  
ATOM   3110  N3   DT I  90     144.800 189.889  99.541  1.00 93.49           N  
ATOM   3111  C4   DT I  90     143.989 190.906  99.990  1.00 93.49           C  
ATOM   3112  O4   DT I  90     144.227 192.082  99.760  1.00 93.49           O  
ATOM   3113  C5   DT I  90     142.840 190.492 100.740  1.00 93.49           C  
ATOM   3114  C7   DT I  90     141.904 191.517 101.301  1.00 93.49           C  
ATOM   3115  C6   DT I  90     142.650 189.183 100.936  1.00 93.49           C  
ATOM   3116  H5'  DT I  90     139.559 186.021  99.974  1.00 93.49           H  
ATOM   3117 H5''  DT I  90     139.407 185.007 101.170  1.00 93.49           H  
ATOM   3118  H4'  DT I  90     141.398 184.542 100.111  1.00 93.49           H  
ATOM   3119  H3'  DT I  90     141.475 184.939 102.678  1.00 93.49           H  
ATOM   3120  H2'  DT I  90     142.298 187.021 102.581  1.00 93.49           H  
ATOM   3121 H2''  DT I  90     143.659 186.204 102.680  1.00 93.49           H  
ATOM   3122  H1'  DT I  90     143.964 186.196 100.452  1.00 93.49           H  
ATOM   3123  H3   DT I  90     145.486 190.124  99.089  1.00 93.49           H  
ATOM   3124  H71  DT I  90     142.418 192.221 101.725  1.00 93.49           H  
ATOM   3125  H72  DT I  90     141.370 191.891 100.599  1.00 93.49           H  
ATOM   3126  H73  DT I  90     141.327 191.099 101.958  1.00 93.49           H  
ATOM   3127  H6   DT I  90     141.915 188.915 101.437  1.00 93.49           H  
ATOM   3128  P  A DT I  91     143.715 183.023 102.915  0.50 98.89           P  
ATOM   3129  P  B DT I  91     144.161 183.295 102.915  0.50 98.89           P  
ATOM   3130  OP1A DT I  91     143.220 181.695 103.334  0.50 98.89           O  
ATOM   3131  OP1B DT I  91     143.514 182.114 102.318  0.50 98.89           O  
ATOM   3132  OP2A DT I  91     143.956 184.076 103.922  0.50 98.89           O  
ATOM   3133  OP2B DT I  91     143.435 184.109 103.913  0.50 98.89           O  
ATOM   3134  O5'A DT I  91     145.061 182.830 102.074  0.50 98.89           O  
ATOM   3135  O5'B DT I  91     144.803 184.195 101.761  0.50 98.89           O  
ATOM   3136  C5'A DT I  91     145.690 183.956 101.497  0.50 98.89           C  
ATOM   3137  C5'B DT I  91     145.507 183.573 100.694  0.50 98.89           C  
ATOM   3138  C4'A DT I  91     147.143 183.663 101.152  0.50 98.89           C  
ATOM   3139  C4'B DT I  91     147.002 183.847 100.773  0.50 98.89           C  
ATOM   3140  O4'A DT I  91     147.781 184.875 100.673  0.50 98.89           O  
ATOM   3141  O4'B DT I  91     147.256 185.270 100.575  0.50 98.89           O  
ATOM   3142  C3'A DT I  91     148.001 183.226 102.315  0.50 98.89           C  
ATOM   3143  C3'B DT I  91     147.656 183.505 102.102  0.50 98.89           C  
ATOM   3144  O3'A DT I  91     149.135 182.501 101.863  0.50 98.89           O  
ATOM   3145  O3'B DT I  91     148.979 183.071 101.895  0.50 98.89           O  
ATOM   3146  C2'A DT I  91     148.368 184.557 102.943  0.50 98.89           C  
ATOM   3147  C2'B DT I  91     147.598 184.827 102.836  0.50 98.89           C  
ATOM   3148  C1'A DT I  91     148.543 185.467 101.717  0.50 98.89           C  
ATOM   3149  C1'B DT I  91     147.928 185.795 101.706  0.50 98.89           C  
ATOM   3150  N1 A DT I  91     148.084 186.938 101.862  0.50 98.89           N  
ATOM   3151  N1 B DT I  91     147.506 187.270 101.880  0.50 98.89           N  
ATOM   3152  C2 A DT I  91     148.842 187.939 101.284  0.50 98.89           C  
ATOM   3153  C2 B DT I  91     148.280 188.247 101.297  0.50 98.89           C  
ATOM   3154  O2 A DT I  91     149.887 187.735 100.694  0.50 98.89           O  
ATOM   3155  O2 B DT I  91     149.302 188.010 100.679  0.50 98.89           O  
ATOM   3156  N3 A DT I  91     148.331 189.205 101.440  0.50 98.89           N  
ATOM   3157  N3 B DT I  91     147.822 189.526 101.472  0.50 98.89           N  
ATOM   3158  C4 A DT I  91     147.170 189.564 102.074  0.50 98.89           C  
ATOM   3159  C4 B DT I  91     146.691 189.921 102.141  0.50 98.89           C  
ATOM   3160  O4 A DT I  91     146.790 190.724 102.165  0.50 98.89           O  
ATOM   3161  O4 B DT I  91     146.363 191.097 102.245  0.50 98.89           O  
ATOM   3162  C5 A DT I  91     146.426 188.494 102.633  0.50 98.89           C  
ATOM   3163  C5 B DT I  91     145.923 188.866 102.720  0.50 98.89           C  
ATOM   3164  C7 A DT I  91     145.164 188.807 103.349  0.50 98.89           C  
ATOM   3165  C7 B DT I  91     144.681 189.194 103.472  0.50 98.89           C  
ATOM   3166  C6 A DT I  91     146.890 187.243 102.492  0.50 98.89           C  
ATOM   3167  C6 B DT I  91     146.338 187.604 102.542  0.50 98.89           C  
ATOM   3168  H5'A DT I  91     145.654 184.691 102.125  0.50 98.89           H  
ATOM   3169  H5'B DT I  91     145.166 183.910  99.852  0.50 98.89           H  
ATOM   3170 H5''A DT I  91     145.213 184.205 100.691  0.50 98.89           H  
ATOM   3171 H5''B DT I  91     145.360 182.616 100.735  0.50 98.89           H  
ATOM   3172  H4'A DT I  91     147.180 182.986 100.459  0.50 98.89           H  
ATOM   3173  H4'B DT I  91     147.449 183.348 100.071  0.50 98.89           H  
ATOM   3174  H3'A DT I  91     147.481 182.694 102.933  0.50 98.89           H  
ATOM   3175  H3'B DT I  91     147.143 182.831 102.571  0.50 98.89           H  
ATOM   3176  H2'A DT I  91     147.658 184.860 103.513  0.50 98.89           H  
ATOM   3177  H2'B DT I  91     146.716 184.978 103.194  0.50 98.89           H  
ATOM   3178 H2''A DT I  91     149.195 184.478 103.432  0.50 98.89           H  
ATOM   3179 H2''B DT I  91     148.267 184.858 103.527  0.50 98.89           H  
ATOM   3180  H1'A DT I  91     149.476 185.455 101.464  0.50 98.89           H  
ATOM   3181  H1'B DT I  91     148.882 185.760 101.546  0.50 98.89           H  
ATOM   3182  H3 A DT I  91     148.789 189.843 101.097  0.50 98.89           H  
ATOM   3183  H3 B DT I  91     148.294 190.150 101.123  0.50 98.89           H  
ATOM   3184  H71A DT I  91     144.664 188.003 103.489  0.50 98.89           H  
ATOM   3185  H71B DT I  91     144.047 188.479 103.374  0.50 98.89           H  
ATOM   3186  H72A DT I  91     145.374 189.207 104.204  0.50 98.89           H  
ATOM   3187  H72B DT I  91     144.895 189.309 104.410  0.50 98.89           H  
ATOM   3188  H73A DT I  91     144.646 189.428 102.823  0.50 98.89           H  
ATOM   3189  H73B DT I  91     144.302 190.013 103.124  0.50 98.89           H  
ATOM   3190  H6 A DT I  91     146.405 186.551 102.869  0.50 98.89           H  
ATOM   3191  H6 B DT I  91     145.844 186.923 102.928  0.50 98.89           H  
ATOM   3192  P  A DT I  92     150.079 181.761 102.898  0.50102.80           P  
ATOM   3193  P  B DT I  92     149.570 181.891 102.712  0.50102.80           P  
ATOM   3194  OP1A DT I  92     150.602 180.553 102.226  0.50102.80           O  
ATOM   3195  OP1B DT I  92     149.525 180.691 101.851  0.50102.80           O  
ATOM   3196  OP2A DT I  92     149.353 181.630 104.178  0.50102.80           O  
ATOM   3197  OP2B DT I  92     148.924 181.873 104.041  0.50102.80           O  
ATOM   3198  O5'A DT I  92     151.281 182.791 103.122  0.50102.80           O  
ATOM   3199  O5'B DT I  92     151.093 182.318 102.918  0.50102.80           O  
ATOM   3200  C5'A DT I  92     152.134 183.123 102.037  0.50102.80           C  
ATOM   3201  C5'B DT I  92     151.881 182.700 101.795  0.50102.80           C  
ATOM   3202  C4'A DT I  92     153.061 184.271 102.395  0.50102.80           C  
ATOM   3203  C4'B DT I  92     152.789 183.871 102.134  0.50102.80           C  
ATOM   3204  O4'A DT I  92     152.297 185.509 102.451  0.50102.80           O  
ATOM   3205  O4'B DT I  92     152.004 185.089 102.203  0.50102.80           O  
ATOM   3206  C3'A DT I  92     153.756 184.142 103.755  0.50102.80           C  
ATOM   3207  C3'B DT I  92     153.513 183.755 103.479  0.50102.80           C  
ATOM   3208  O3'A DT I  92     155.140 184.450 103.644  0.50102.80           O  
ATOM   3209  O3'B DT I  92     154.923 183.768 103.296  0.50102.80           O  
ATOM   3210  C2'A DT I  92     153.008 185.141 104.621  0.50102.80           C  
ATOM   3211  C2'B DT I  92     153.030 184.962 104.275  0.50102.80           C  
ATOM   3212  C1'A DT I  92     152.668 186.218 103.605  0.50102.80           C  
ATOM   3213  C1'B DT I  92     152.553 185.918 103.190  0.50102.80           C  
ATOM   3214  N1 A DT I  92     151.541 187.184 103.991  0.50102.80           N  
ATOM   3215  N1 B DT I  92     151.498 186.952 103.622  0.50102.80           N  
ATOM   3216  C2 A DT I  92     151.690 188.528 103.729  0.50102.80           C  
ATOM   3217  C2 B DT I  92     151.688 188.290 103.321  0.50102.80           C  
ATOM   3218  O2 A DT I  92     152.682 189.009 103.213  0.50102.80           O  
ATOM   3219  O2 B DT I  92     152.679 188.720 102.760  0.50102.80           O  
ATOM   3220  N3 A DT I  92     150.631 189.304 104.103  0.50102.80           N  
ATOM   3221  N3 B DT I  92     150.687 189.121 103.752  0.50102.80           N  
ATOM   3222  C4 A DT I  92     149.457 188.891 104.691  0.50102.80           C  
ATOM   3223  C4 B DT I  92     149.529 188.764 104.410  0.50102.80           C  
ATOM   3224  O4 A DT I  92     148.563 189.672 104.989  0.50102.80           O  
ATOM   3225  O4 B DT I  92     148.684 189.584 104.745  0.50102.80           O  
ATOM   3226  C5 A DT I  92     149.355 187.482 104.932  0.50102.80           C  
ATOM   3227  C5 B DT I  92     149.374 187.361 104.669  0.50102.80           C  
ATOM   3228  C7 A DT I  92     148.127 186.924 105.582  0.50102.80           C  
ATOM   3229  C7 B DT I  92     148.166 186.870 105.409  0.50102.80           C  
ATOM   3230  C6 A DT I  92     150.385 186.703 104.575  0.50102.80           C  
ATOM   3231  C6 B DT I  92     150.351 186.531 104.270  0.50102.80           C  
ATOM   3232  H5'A DT I  92     151.592 183.378 101.275  0.50102.80           H  
ATOM   3233  H5'B DT I  92     151.295 182.953 101.067  0.50102.80           H  
ATOM   3234 H5''A DT I  92     152.666 182.347 101.802  0.50102.80           H  
ATOM   3235 H5''B DT I  92     152.425 181.947 101.517  0.50102.80           H  
ATOM   3236  H4'A DT I  92     153.739 184.353 101.708  0.50102.80           H  
ATOM   3237  H4'B DT I  92     153.451 183.967 101.433  0.50102.80           H  
ATOM   3238  H3'A DT I  92     153.639 183.247 104.103  0.50102.80           H  
ATOM   3239  H3'B DT I  92     153.245 182.942 103.925  0.50102.80           H  
ATOM   3240  H2'A DT I  92     152.214 184.734 104.992  0.50102.80           H  
ATOM   3241  H2'B DT I  92     152.310 184.710 104.867  0.50102.80           H  
ATOM   3242 H2''A DT I  92     153.577 185.489 105.316  0.50102.80           H  
ATOM   3243 H2''B DT I  92     153.760 185.344 104.766  0.50102.80           H  
ATOM   3244  H1'A DT I  92     153.471 186.723 103.414  0.50102.80           H  
ATOM   3245  H1'B DT I  92     153.321 186.377 102.822  0.50102.80           H  
ATOM   3246  H3 A DT I  92     150.705 190.146 103.953  0.50102.80           H  
ATOM   3247  H3 B DT I  92     150.791 189.957 103.591  0.50102.80           H  
ATOM   3248  H71A DT I  92     148.071 185.977 105.408  0.50102.80           H  
ATOM   3249  H71B DT I  92     147.862 187.559 106.018  0.50102.80           H  
ATOM   3250  H72A DT I  92     148.176 187.072 106.539  0.50102.80           H  
ATOM   3251  H72B DT I  92     147.468 186.661 104.798  0.50102.80           H  
ATOM   3252  H73A DT I  92     147.344 187.368 105.229  0.50102.80           H  
ATOM   3253  H73B DT I  92     148.399 186.076 105.913  0.50102.80           H  
ATOM   3254  H6 A DT I  92     150.319 185.791 104.733  0.50102.80           H  
ATOM   3255  H6 B DT I  92     150.253 185.623 104.442  0.50102.80           H  
ATOM   3256  P  A DG I  93     156.160 184.039 104.805  0.50107.38           P  
ATOM   3257  P  B DG I  93     155.878 182.804 104.175  0.50107.38           P  
ATOM   3258  OP1A DG I  93     157.530 184.211 104.280  0.50107.38           O  
ATOM   3259  OP1B DG I  93     156.556 181.885 103.236  0.50107.38           O  
ATOM   3260  OP2A DG I  93     155.740 182.727 105.344  0.50107.38           O  
ATOM   3261  OP2B DG I  93     155.113 182.253 105.316  0.50107.38           O  
ATOM   3262  O5'A DG I  93     155.907 185.129 105.943  0.50107.38           O  
ATOM   3263  O5'B DG I  93     156.961 183.802 104.788  0.50107.38           O  
ATOM   3264  C5'A DG I  93     157.001 185.753 106.585  0.50107.38           C  
ATOM   3265  C5'B DG I  93     156.570 184.764 105.753  0.50107.38           C  
ATOM   3266  C4'A DG I  93     157.530 186.905 105.758  0.50107.38           C  
ATOM   3267  C4'B DG I  93     156.917 186.172 105.284  0.50107.38           C  
ATOM   3268  O4'A DG I  93     156.414 187.604 105.137  0.50107.38           O  
ATOM   3269  O4'B DG I  93     155.696 186.873 104.918  0.50107.38           O  
ATOM   3270  C3'A DG I  93     158.283 187.953 106.560  0.50107.38           C  
ATOM   3271  C3'B DG I  93     157.637 187.053 106.311  0.50107.38           C  
ATOM   3272  O3'A DG I  93     159.337 188.537 105.804  0.50107.38           O  
ATOM   3273  O3'B DG I  93     158.874 187.512 105.786  0.50107.38           O  
ATOM   3274  C2'A DG I  93     157.198 188.953 106.907  0.50107.38           C  
ATOM   3275  C2'B DG I  93     156.667 188.195 106.594  0.50107.38           C  
ATOM   3276  C1'A DG I  93     156.266 188.895 105.704  0.50107.38           C  
ATOM   3277  C1'B DG I  93     155.730 188.201 105.398  0.50107.38           C  
ATOM   3278  N9 A DG I  93     154.868 189.103 106.067  0.50107.38           N  
ATOM   3279  N9 B DG I  93     154.367 188.609 105.744  0.50107.38           N  
ATOM   3280  C8 A DG I  93     153.955 188.142 106.414  0.50107.38           C  
ATOM   3281  C8 B DG I  93     153.340 187.779 106.111  0.50107.38           C  
ATOM   3282  N7 A DG I  93     152.783 188.625 106.714  0.50107.38           N  
ATOM   3283  N7 B DG I  93     152.235 188.402 106.381  0.50107.38           N  
ATOM   3284  C5 A DG I  93     152.932 189.994 106.568  0.50107.38           C  
ATOM   3285  C5 B DG I  93     152.545 189.738 106.208  0.50107.38           C  
ATOM   3286  C6 A DG I  93     151.996 191.033 106.755  0.50107.38           C  
ATOM   3287  C6 B DG I  93     151.725 190.870 106.353  0.50107.38           C  
ATOM   3288  O6 A DG I  93     150.811 190.942 107.101  0.50107.38           O  
ATOM   3289  O6 B DG I  93     150.538 190.905 106.699  0.50107.38           O  
ATOM   3290  N1 A DG I  93     152.554 192.283 106.503  0.50107.38           N  
ATOM   3291  N1 B DG I  93     152.415 192.048 106.092  0.50107.38           N  
ATOM   3292  C2 A DG I  93     153.854 192.496 106.112  0.50107.38           C  
ATOM   3293  C2 B DG I  93     153.733 192.117 105.706  0.50107.38           C  
ATOM   3294  N2 A DG I  93     154.219 193.770 105.915  0.50107.38           N  
ATOM   3295  N2 B DG I  93     154.224 193.347 105.494  0.50107.38           N  
ATOM   3296  N3 A DG I  93     154.742 191.527 105.934  0.50107.38           N  
ATOM   3297  N3 B DG I  93     154.520 191.050 105.557  0.50107.38           N  
ATOM   3298  C4 A DG I  93     154.211 190.307 106.176  0.50107.38           C  
ATOM   3299  C4 B DG I  93     153.853 189.894 105.810  0.50107.38           C  
ATOM   3300  H5'A DG I  93     157.708 185.103 106.713  0.50107.38           H  
ATOM   3301  H5'B DG I  93     157.024 184.573 106.586  0.50107.38           H  
ATOM   3302 H5''A DG I  93     156.715 186.088 107.448  0.50107.38           H  
ATOM   3303 H5''B DG I  93     155.616 184.702 105.894  0.50107.38           H  
ATOM   3304  H4'A DG I  93     158.111 186.558 105.066  0.50107.38           H  
ATOM   3305  H4'B DG I  93     157.477 186.101 104.497  0.50107.38           H  
ATOM   3306  H3'A DG I  93     158.636 187.557 107.371  0.50107.38           H  
ATOM   3307  H3'B DG I  93     157.793 186.558 107.126  0.50107.38           H  
ATOM   3308  H2'A DG I  93     156.732 188.678 107.711  0.50107.38           H  
ATOM   3309  H2'B DG I  93     156.172 188.021 107.410  0.50107.38           H  
ATOM   3310 H2''A DG I  93     157.570 189.841 107.009  0.50107.38           H  
ATOM   3311 H2''B DG I  93     157.142 189.036 106.657  0.50107.38           H  
ATOM   3312  H1'A DG I  93     156.534 189.565 105.055  0.50107.38           H  
ATOM   3313  H1'B DG I  93     156.082 188.787 104.711  0.50107.38           H  
ATOM   3314  H8 A DG I  93     154.151 187.235 106.427  0.50107.38           H  
ATOM   3315  H8 B DG I  93     153.420 186.857 106.140  0.50107.38           H  
ATOM   3316  H1 A DG I  93     152.048 192.971 106.594  0.50107.38           H  
ATOM   3317  H1 B DG I  93     151.983 192.788 106.167  0.50107.38           H  
ATOM   3318  H21A DG I  93     155.047 193.965 105.792  0.50107.38           H  
ATOM   3319  H21B DG I  93     155.073 193.462 105.415  0.50107.38           H  
ATOM   3320  H22A DG I  93     153.624 194.392 105.912  0.50107.38           H  
ATOM   3321  H22B DG I  93     153.691 194.019 105.437  0.50107.38           H  
ATOM   3322  P  A DA I  94     160.600 189.188 106.561  0.50109.38           P  
ATOM   3323  P  B DA I  94     159.963 188.165 106.745  0.50109.38           P  
ATOM   3324  OP1A DA I  94     161.518 189.720 105.531  0.50109.38           O  
ATOM   3325  OP1B DA I  94     161.281 188.020 106.089  0.50109.38           O  
ATOM   3326  OP2A DA I  94     161.091 188.196 107.543  0.50109.38           O  
ATOM   3327  OP2B DA I  94     159.767 187.641 108.115  0.50109.38           O  
ATOM   3328  O5'A DA I  94     159.974 190.413 107.383  0.50109.38           O  
ATOM   3329  O5'B DA I  94     159.567 189.710 106.767  0.50109.38           O  
ATOM   3330  C5'A DA I  94     159.996 191.725 106.829  0.50109.38           C  
ATOM   3331  C5'B DA I  94     160.182 190.572 107.696  0.50109.38           C  
ATOM   3332  C4'A DA I  94     159.228 192.706 107.695  0.50109.38           C  
ATOM   3333  C4'B DA I  94     159.326 191.798 107.956  0.50109.38           C  
ATOM   3334  O4'A DA I  94     157.823 192.396 107.655  0.50109.38           O  
ATOM   3335  O4'B DA I  94     157.943 191.503 107.685  0.50109.38           O  
ATOM   3336  C3'A DA I  94     159.596 192.691 109.176  0.50109.38           C  
ATOM   3337  C3'B DA I  94     159.334 192.294 109.389  0.50109.38           C  
ATOM   3338  O3'A DA I  94     160.510 193.735 109.476  0.50109.38           O  
ATOM   3339  O3'B DA I  94     160.357 193.262 109.581  0.50109.38           O  
ATOM   3340  C2'A DA I  94     158.253 192.863 109.903  0.50109.38           C  
ATOM   3341  C2'B DA I  94     157.936 192.882 109.584  0.50109.38           C  
ATOM   3342  C1'A DA I  94     157.229 192.988 108.779  0.50109.38           C  
ATOM   3343  C1'B DA I  94     157.157 192.472 108.339  0.50109.38           C  
ATOM   3344  N9 A DA I  94     155.948 192.331 109.062  0.50109.38           N  
ATOM   3345  N9 B DA I  94     155.819 191.911 108.606  0.50109.38           N  
ATOM   3346  C8 A DA I  94     155.697 190.988 109.124  0.50109.38           C  
ATOM   3347  C8 B DA I  94     155.465 190.590 108.613  0.50109.38           C  
ATOM   3348  N7 A DA I  94     154.449 190.693 109.401  0.50109.38           N  
ATOM   3349  N7 B DA I  94     154.194 190.380 108.861  0.50109.38           N  
ATOM   3350  C5 A DA I  94     153.843 191.925 109.536  0.50109.38           C  
ATOM   3351  C5 B DA I  94     153.673 191.646 109.026  0.50109.38           C  
ATOM   3352  C6 A DA I  94     152.524 192.303 109.833  0.50109.38           C  
ATOM   3353  C6 B DA I  94     152.375 192.103 109.317  0.50109.38           C  
ATOM   3354  N6 A DA I  94     151.541 191.430 110.051  0.50109.38           N  
ATOM   3355  N6 B DA I  94     151.331 191.287 109.483  0.50109.38           N  
ATOM   3356  N1 A DA I  94     152.251 193.620 109.890  0.50109.38           N  
ATOM   3357  N1 B DA I  94     152.185 193.431 109.412  0.50109.38           N  
ATOM   3358  C2 A DA I  94     153.235 194.493 109.667  0.50109.38           C  
ATOM   3359  C2 B DA I  94     153.226 194.247 109.225  0.50109.38           C  
ATOM   3360  N3 A DA I  94     154.510 194.259 109.383  0.50109.38           N  
ATOM   3361  N3 B DA I  94     154.498 193.936 108.961  0.50109.38           N  
ATOM   3362  C4 A DA I  94     154.752 192.944 109.333  0.50109.38           C  
ATOM   3363  C4 B DA I  94     154.655 192.606 108.870  0.50109.38           C  
ATOM   3364  H5'A DA I  94     159.596 191.703 105.946  0.50109.38           H  
ATOM   3365  H5'B DA I  94     161.041 190.855 107.347  0.50109.38           H  
ATOM   3366 H5''A DA I  94     160.915 192.022 106.754  0.50109.38           H  
ATOM   3367 H5''B DA I  94     160.321 190.093 108.526  0.50109.38           H  
ATOM   3368  H4'A DA I  94     159.361 193.601 107.350  0.50109.38           H  
ATOM   3369  H4'B DA I  94     159.615 192.517 107.374  0.50109.38           H  
ATOM   3370  H3'A DA I  94     159.986 191.837 109.409  0.50109.38           H  
ATOM   3371  H3'B DA I  94     159.461 191.553 109.997  0.50109.38           H  
ATOM   3372  H2'A DA I  94     158.064 192.086 110.450  0.50109.38           H  
ATOM   3373  H2'B DA I  94     157.525 192.507 110.375  0.50109.38           H  
ATOM   3374 H2''A DA I  94     158.258 193.664 110.442  0.50109.38           H  
ATOM   3375 H2''B DA I  94     157.986 193.847 109.648  0.50109.38           H  
ATOM   3376  H1'A DA I  94     157.073 193.928 108.596  0.50109.38           H  
ATOM   3377  H1'B DA I  94     157.065 193.244 107.759  0.50109.38           H  
ATOM   3378  H8 A DA I  94     156.349 190.345 108.981  0.50109.38           H  
ATOM   3379  H8 B DA I  94     156.067 189.904 108.455  0.50109.38           H  
ATOM   3380  H61A DA I  94     150.791 191.700 110.372  0.50109.38           H  
ATOM   3381  H61B DA I  94     150.577 191.602 109.749  0.50109.38           H  
ATOM   3382  H62A DA I  94     151.657 190.599 109.867  0.50109.38           H  
ATOM   3383  H62B DA I  94     151.417 190.446 109.331  0.50109.38           H  
ATOM   3384  H2 A DA I  94     152.994 195.389 109.718  0.50109.38           H  
ATOM   3385  H2 B DA I  94     153.046 195.153 109.319  0.50109.38           H  
ATOM   3386  P  A DT I  95     161.053 193.928 110.969  0.50110.70           P  
ATOM   3387  OP1A DT I  95     162.390 194.554 110.891  0.50110.70           O  
ATOM   3388  OP2A DT I  95     160.878 192.644 111.680  0.50110.70           O  
ATOM   3389  O5'A DT I  95     160.031 194.978 111.604  0.50110.70           O  
ATOM   3390  C5'A DT I  95     159.591 196.077 110.826  0.50110.70           C  
ATOM   3391  C4'A DT I  95     158.343 196.699 111.421  0.50110.70           C  
ATOM   3392  O4'A DT I  95     157.228 195.781 111.315  0.50110.70           O  
ATOM   3393  C3'A DT I  95     158.448 197.077 112.902  0.50110.70           C  
ATOM   3394  O3'A DT I  95     158.140 198.453 113.055  0.50110.70           O  
ATOM   3395  C2'A DT I  95     157.405 196.181 113.588  0.50110.70           C  
ATOM   3396  C1'A DT I  95     156.426 195.935 112.454  0.50110.70           C  
ATOM   3397  N1 A DT I  95     155.567 194.712 112.623  0.50110.70           N  
ATOM   3398  C2 A DT I  95     154.230 194.872 112.895  0.50110.70           C  
ATOM   3399  O2 A DT I  95     153.699 195.962 113.015  0.50110.70           O  
ATOM   3400  N3 A DT I  95     153.526 193.706 113.022  0.50110.70           N  
ATOM   3401  C4 A DT I  95     154.014 192.421 112.912  0.50110.70           C  
ATOM   3402  O4 A DT I  95     153.295 191.437 113.047  0.50110.70           O  
ATOM   3403  C5 A DT I  95     155.424 192.318 112.624  0.50110.70           C  
ATOM   3404  C7 A DT I  95     156.066 190.973 112.480  0.50110.70           C  
ATOM   3405  C6 A DT I  95     156.126 193.455 112.493  0.50110.70           C  
HETATM 3406  P  BT64 I  95     161.340 192.601 110.657  1.00110.70           P  
HETATM 3407  N1 BT64 I  95     156.259 193.328 113.242  1.00110.70           N  
HETATM 3408  C2 BT64 I  95     154.897 193.032 112.662  1.00110.70           C  
HETATM 3409  O2 BT64 I  95     154.568 193.564 111.684  1.00110.70           O  
HETATM 3410  N3 BT64 I  95     153.878 192.089 113.289  1.00110.70           N  
HETATM 3411  C4 BT64 I  95     154.176 191.387 114.543  1.00110.70           C  
HETATM 3412  O4 BT64 I  95     153.402 190.638 115.033  1.00110.70           O  
HETATM 3413  C5 BT64 I  95     155.561 191.602 115.121  1.00110.70           C  
HETATM 3414  C6 BT64 I  95     156.531 192.636 114.536  1.00110.70           C  
HETATM 3415  PB BT64 I  95     160.261 197.958 113.685  1.00110.70           P  
HETATM 3416  C1'BT64 I  95     157.179 194.295 112.475  1.00110.70           C  
HETATM 3417  C1RBT64 I  95     156.438 198.286 116.615  1.00110.70           C  
HETATM 3418  N1TBT64 I  95     156.479 196.965 116.137  1.00110.70           N  
HETATM 3419  C2'BT64 I  95     157.399 195.765 112.705  1.00110.70           C  
HETATM 3420  C2RBT64 I  95     156.816 198.208 118.045  1.00110.70           C  
HETATM 3421  C2TBT64 I  95     155.250 196.285 115.606  1.00110.70           C  
HETATM 3422  O2TBT64 I  95     154.217 196.861 115.549  1.00110.70           O  
HETATM 3423  C3'BT64 I  95     158.144 198.944 118.205  1.00110.70           C  
HETATM 3424  O3'BT64 I  95     158.164 199.968 119.209  1.00110.70           O  
HETATM 3425  C3RBT64 I  95     158.864 195.957 112.886  1.00110.70           C  
HETATM 3426  O3RBT64 I  95     159.340 197.217 112.473  1.00110.70           O  
HETATM 3427  N3TBT64 I  95     155.328 194.905 115.109  1.00110.70           N  
HETATM 3428  C4'BT64 I  95     158.462 199.490 116.803  1.00110.70           C  
HETATM 3429  O4'BT64 I  95     158.505 193.701 112.425  1.00110.70           O  
HETATM 3430  O4PBT64 I  95     161.218 196.946 114.275  1.00110.70           O  
HETATM 3431  C4RBT64 I  95     159.421 194.771 112.087  1.00110.70           C  
HETATM 3432  O4RBT64 I  95     157.359 199.187 115.975  1.00110.70           O  
HETATM 3433  C4TBT64 I  95     156.505 194.089 115.195  1.00110.70           C  
HETATM 3434  O4TBT64 I  95     154.969 192.486 116.028  1.00110.70           O  
HETATM 3435  C5'BT64 I  95     160.789 194.399 112.482  1.00110.70           C  
HETATM 3436  O5'BT64 I  95     160.973 193.043 112.201  1.00110.70           O  
HETATM 3437  C5ABT64 I  95     156.007 190.851 116.476  1.00110.70           C  
HETATM 3438  C5MBT64 I  95     159.044 193.854 115.694  1.00110.70           C  
HETATM 3439  O5PBT64 I  95     161.134 199.109 113.249  1.00110.70           O  
HETATM 3440  C5RBT64 I  95     159.635 198.881 116.051  1.00110.70           C  
HETATM 3441  O5RBT64 I  95     159.115 198.309 114.850  1.00110.70           O  
HETATM 3442  C5TBT64 I  95     157.744 194.663 115.675  1.00110.70           C  
HETATM 3443  C6TBT64 I  95     157.743 196.064 116.144  1.00110.70           C  
HETATM 3444  OP1BT64 I  95     162.324 193.574 110.057  1.00110.70           O  
HETATM 3445  OP2BT64 I  95     161.924 191.208 110.654  1.00110.70           O  
HETATM 3446  HN3BT64 I  95     153.120 191.976 112.902  1.00110.70           H  
HETATM 3447  H6 BT64 I  95     157.421 192.261 114.513  1.00110.70           H  
HETATM 3448  H1'BT64 I  95     156.840 194.303 111.579  1.00110.70           H  
HETATM 3449  H1RBT64 I  95     155.544 198.654 116.534  1.00110.70           H  
HETATM 3450  H2'BT64 I  95     156.920 196.126 113.454  1.00110.70           H  
HETATM 3451 H2'ABT64 I  95     157.132 196.245 111.905  1.00110.70           H  
HETATM 3452  H2RBT64 I  95     156.911 197.297 118.355  1.00110.70           H  
HETATM 3453 H2RABT64 I  95     156.031 198.560 118.455  1.00110.70           H  
HETATM 3454  H3'BT64 I  95     158.809 198.282 118.449  1.00110.70           H  
HETATM 3455  H3RBT64 I  95     159.119 195.864 113.794  1.00110.70           H  
HETATM 3456  H4'BT64 I  95     158.574 200.452 116.855  1.00110.70           H  
HETATM 3457  H4RBT64 I  95     159.384 194.964 111.138  1.00110.70           H  
HETATM 3458 HO4TBT64 I  95     154.309 192.136 116.432  1.00110.70           H  
HETATM 3459  H5'BT64 I  95     160.923 194.544 113.431  1.00110.70           H  
HETATM 3460 H5'ABT64 I  95     161.426 194.927 111.980  1.00110.70           H  
HETATM 3461  H5ABT64 I  95     156.773 190.293 116.278  1.00110.70           H  
HETATM 3462 H5AABT64 I  95     156.250 191.502 117.153  1.00110.70           H  
HETATM 3463 H5ABBT64 I  95     155.282 190.291 116.793  1.00110.70           H  
HETATM 3464  H5MBT64 I  95     159.766 194.406 116.034  1.00110.70           H  
HETATM 3465 H5MABT64 I  95     158.928 193.080 116.270  1.00110.70           H  
HETATM 3466 H5MBBT64 I  95     159.259 193.555 114.798  1.00110.70           H  
HETATM 3467  H5RBT64 I  95     160.275 199.576 115.831  1.00110.70           H  
HETATM 3468 H5RABT64 I  95     160.072 198.194 116.577  1.00110.70           H  
HETATM 3469  H6TBT64 I  95     158.535 196.412 116.472  1.00110.70           H  
ATOM   3470  P  A DG I  96     158.591 199.238 114.357  0.50108.70           P  
ATOM   3471  OP1A DG I  96     159.600 200.237 113.940  0.50108.70           O  
ATOM   3472  OP2A DG I  96     158.949 198.237 115.385  0.50108.70           O  
ATOM   3473  O5'A DG I  96     157.268 200.022 114.813  0.50108.70           O  
ATOM   3474  C5'A DG I  96     155.996 199.368 114.809  0.50108.70           C  
ATOM   3475  C4'A DG I  96     155.532 199.081 116.215  0.50108.70           C  
ATOM   3476  O4'A DG I  96     154.657 197.916 116.194  0.50108.70           O  
ATOM   3477  C3'A DG I  96     156.650 198.740 117.205  0.50108.70           C  
ATOM   3478  O3'A DG I  96     156.282 199.189 118.501  0.50108.70           O  
ATOM   3479  C2'A DG I  96     156.652 197.225 117.132  0.50108.70           C  
ATOM   3480  C1'A DG I  96     155.166 196.959 117.092  0.50108.70           C  
ATOM   3481  N9 A DG I  96     154.775 195.627 116.660  0.50108.70           N  
ATOM   3482  C8 A DG I  96     155.580 194.619 116.182  0.50108.70           C  
ATOM   3483  N7 A DG I  96     154.926 193.534 115.885  0.50108.70           N  
ATOM   3484  C5 A DG I  96     153.609 193.843 116.199  0.50108.70           C  
ATOM   3485  C6 A DG I  96     152.441 193.064 116.090  0.50108.70           C  
ATOM   3486  O6 A DG I  96     152.330 191.903 115.685  0.50108.70           O  
ATOM   3487  N1 A DG I  96     151.314 193.764 116.512  0.50108.70           N  
ATOM   3488  C2 A DG I  96     151.318 195.052 116.984  0.50108.70           C  
ATOM   3489  N2 A DG I  96     150.135 195.560 117.348  0.50108.70           N  
ATOM   3490  N3 A DG I  96     152.404 195.792 117.087  0.50108.70           N  
ATOM   3491  C4 A DG I  96     153.508 195.124 116.678  0.50108.70           C  
ATOM   3492  H5'A DG I  96     156.063 198.532 114.326  0.50108.70           H  
ATOM   3493 H5''A DG I  96     155.346 199.937 114.372  0.50108.70           H  
ATOM   3494  H4'A DG I  96     155.035 199.845 116.548  0.50108.70           H  
ATOM   3495  H2'A DG I  96     157.085 196.921 116.320  0.50108.70           H  
ATOM   3496 H2''A DG I  96     157.058 196.833 117.919  0.50108.70           H  
ATOM   3497  H1'A DG I  96     154.791 197.126 117.962  0.50108.70           H  
ATOM   3498  H8 A DG I  96     156.497 194.708 116.073  0.50108.70           H  
ATOM   3499  H21A DG I  96     150.076 196.043 118.056  0.50108.70           H  
ATOM   3500  P  A DG I  97     157.367 199.321 119.668  0.50103.83           P  
ATOM   3501  P  B DG I  97     156.884 200.720 119.807  0.50103.83           P  
ATOM   3502  OP1A DG I  97     158.187 200.515 119.375  0.50103.83           O  
ATOM   3503  OP1B DG I  97     156.459 201.564 118.673  0.50103.83           O  
ATOM   3504  OP2A DG I  97     158.026 198.013 119.870  0.50103.83           O  
ATOM   3505  OP2B DG I  97     156.193 199.634 120.506  0.50103.83           O  
ATOM   3506  O5'A DG I  97     156.476 199.621 120.959  0.50103.83           O  
ATOM   3507  O5'B DG I  97     155.702 201.408 120.674  0.50103.83           O  
ATOM   3508  C5'A DG I  97     155.636 200.761 120.974  0.50103.83           C  
ATOM   3509  C5'B DG I  97     154.269 201.418 120.176  0.50103.83           C  
ATOM   3510  C4'A DG I  97     154.173 200.374 120.800  0.50103.83           C  
ATOM   3511  C4'B DG I  97     153.374 200.336 120.794  0.50103.83           C  
ATOM   3512  O4'A DG I  97     154.085 199.075 120.145  0.50103.83           O  
ATOM   3513  O4'B DG I  97     153.700 199.017 120.258  0.50103.83           O  
ATOM   3514  C3'A DG I  97     153.378 200.216 122.090  0.50103.83           C  
ATOM   3515  C3'B DG I  97     153.438 200.178 122.324  0.50103.83           C  
ATOM   3516  O3'A DG I  97     152.010 200.586 121.875  0.50103.83           O  
ATOM   3517  O3'B DG I  97     152.133 200.173 122.876  0.50103.83           O  
ATOM   3518  C2'A DG I  97     153.539 198.734 122.379  0.50103.83           C  
ATOM   3519  C2'B DG I  97     154.084 198.811 122.499  0.50103.83           C  
ATOM   3520  C1'A DG I  97     153.394 198.165 120.989  0.50103.83           C  
ATOM   3521  C1'B DG I  97     153.497 198.103 121.303  0.50103.83           C  
ATOM   3522  N9 A DG I  97     153.949 196.827 120.788  0.50103.83           N  
ATOM   3523  N9 B DG I  97     154.087 196.804 120.996  0.50103.83           N  
ATOM   3524  C8 A DG I  97     155.268 196.503 120.592  0.50103.83           C  
ATOM   3525  C8 B DG I  97     155.414 196.504 120.830  0.50103.83           C  
ATOM   3526  N7 A DG I  97     155.467 195.232 120.390  0.50103.83           N  
ATOM   3527  N7 B DG I  97     155.632 195.242 120.580  0.50103.83           N  
ATOM   3528  C5 A DG I  97     154.199 194.675 120.455  0.50103.83           C  
ATOM   3529  C5 B DG I  97     154.366 194.672 120.589  0.50103.83           C  
ATOM   3530  C6 A DG I  97     153.795 193.331 120.320  0.50103.83           C  
ATOM   3531  C6 B DG I  97     153.970 193.333 120.381  0.50103.83           C  
ATOM   3532  O6 A DG I  97     154.504 192.342 120.111  0.50103.83           O  
ATOM   3533  O6 B DG I  97     154.686 192.356 120.140  0.50103.83           O  
ATOM   3534  N1 A DG I  97     152.414 193.186 120.453  0.50103.83           N  
ATOM   3535  N1 B DG I  97     152.585 193.178 120.476  0.50103.83           N  
ATOM   3536  C2 A DG I  97     151.534 194.219 120.685  0.50103.83           C  
ATOM   3537  C2 B DG I  97     151.698 194.197 120.734  0.50103.83           C  
ATOM   3538  N2 A DG I  97     150.233 193.890 120.784  0.50103.83           N  
ATOM   3539  N2 B DG I  97     150.395 193.866 120.794  0.50103.83           N  
ATOM   3540  N3 A DG I  97     151.906 195.490 120.816  0.50103.83           N  
ATOM   3541  N3 B DG I  97     152.063 195.456 120.935  0.50103.83           N  
ATOM   3542  C4 A DG I  97     153.250 195.642 120.690  0.50103.83           C  
ATOM   3543  C4 B DG I  97     153.407 195.618 120.847  0.50103.83           C  
ATOM   3544  H5'A DG I  97     155.894 201.351 120.251  0.50103.83           H  
ATOM   3545  H5'B DG I  97     154.249 201.295 119.220  0.50103.83           H  
ATOM   3546 H5''A DG I  97     155.749 201.226 121.817  0.50103.83           H  
ATOM   3547 H5''B DG I  97     153.883 202.282 120.379  0.50103.83           H  
ATOM   3548  H4'A DG I  97     153.737 201.037 120.241  0.50103.83           H  
ATOM   3549  H4'B DG I  97     152.460 200.534 120.550  0.50103.83           H  
ATOM   3550  H3'A DG I  97     153.768 200.745 122.800  0.50103.83           H  
ATOM   3551  H3'B DG I  97     153.984 200.873 122.721  0.50103.83           H  
ATOM   3552  H2'A DG I  97     154.415 198.540 122.746  0.50103.83           H  
ATOM   3553  H2'B DG I  97     155.044 198.862 122.445  0.50103.83           H  
ATOM   3554 H2''A DG I  97     152.839 198.422 122.956  0.50103.83           H  
ATOM   3555 H2''B DG I  97     153.804 198.398 123.323  0.50103.83           H  
ATOM   3556  H1'A DG I  97     152.457 198.159 120.749  0.50103.83           H  
ATOM   3557  H1'B DG I  97     152.546 197.991 121.445  0.50103.83           H  
ATOM   3558  H8 A DG I  97     155.952 197.131 120.592  0.50103.83           H  
ATOM   3559  H8 B DG I  97     156.091 197.138 120.885  0.50103.83           H  
ATOM   3560  H1 A DG I  97     152.087 192.391 120.383  0.50103.83           H  
ATOM   3561  H1 B DG I  97     152.262 192.387 120.362  0.50103.83           H  
ATOM   3562  H21A DG I  97     149.644 194.502 120.922  0.50103.83           H  
ATOM   3563  H21B DG I  97     149.802 194.475 120.928  0.50103.83           H  
ATOM   3564  H22A DG I  97     149.989 193.070 120.702  0.50103.83           H  
ATOM   3565  H22B DG I  97     150.153 193.047 120.689  0.50103.83           H  
ATOM   3566  P  A DA I  98     151.133 201.273 123.042  0.50102.51           P  
ATOM   3567  P  B DA I  98     151.291 201.486 123.065  0.50102.51           P  
ATOM   3568  OP1A DA I  98     150.672 202.580 122.528  0.50102.51           O  
ATOM   3569  OP1B DA I  98     151.105 202.147 121.755  0.50102.51           O  
ATOM   3570  OP2A DA I  98     151.881 201.204 124.316  0.50102.51           O  
ATOM   3571  OP2B DA I  98     151.884 202.239 124.191  0.50102.51           O  
ATOM   3572  O5'A DA I  98     149.871 200.303 123.183  0.50102.51           O  
ATOM   3573  O5'B DA I  98     149.873 200.919 123.541  0.50102.51           O  
ATOM   3574  C5'A DA I  98     150.085 198.916 123.332  0.50102.51           C  
ATOM   3575  C5'B DA I  98     149.804 200.032 124.659  0.50102.51           C  
ATOM   3576  C4'A DA I  98     148.803 198.185 123.700  0.50102.51           C  
ATOM   3577  C4'B DA I  98     148.756 198.951 124.448  0.50102.51           C  
ATOM   3578  O4'A DA I  98     148.970 196.770 123.442  0.50102.51           O  
ATOM   3579  O4'B DA I  98     149.339 197.837 123.714  0.50102.51           O  
ATOM   3580  C3'A DA I  98     148.414 198.236 125.157  0.50102.51           C  
ATOM   3581  C3'B DA I  98     148.199 198.348 125.724  0.50102.51           C  
ATOM   3582  O3'A DA I  98     147.028 197.930 125.307  0.50102.51           O  
ATOM   3583  O3'B DA I  98     146.832 198.023 125.564  0.50102.51           O  
ATOM   3584  C2'A DA I  98     149.330 197.172 125.754  0.50102.51           C  
ATOM   3585  C2'B DA I  98     149.068 197.120 125.938  0.50102.51           C  
ATOM   3586  C1'A DA I  98     149.386 196.116 124.637  0.50102.51           C  
ATOM   3587  C1'B DA I  98     149.369 196.666 124.520  0.50102.51           C  
ATOM   3588  N9 A DA I  98     150.708 195.516 124.387  0.50102.51           N  
ATOM   3589  N9 B DA I  98     150.680 196.020 124.331  0.50102.51           N  
ATOM   3590  C8 A DA I  98     151.903 196.162 124.243  0.50102.51           C  
ATOM   3591  C8 B DA I  98     151.883 196.654 124.230  0.50102.51           C  
ATOM   3592  N7 A DA I  98     152.913 195.368 123.988  0.50102.51           N  
ATOM   3593  N7 B DA I  98     152.897 195.851 124.021  0.50102.51           N  
ATOM   3594  C5 A DA I  98     152.343 194.113 123.949  0.50102.51           C  
ATOM   3595  C5 B DA I  98     152.328 194.594 123.976  0.50102.51           C  
ATOM   3596  C6 A DA I  98     152.881 192.837 123.706  0.50102.51           C  
ATOM   3597  C6 B DA I  98     152.882 193.315 123.770  0.50102.51           C  
ATOM   3598  N6 A DA I  98     154.176 192.616 123.479  0.50102.51           N  
ATOM   3599  N6 B DA I  98     154.185 193.102 123.590  0.50102.51           N  
ATOM   3600  N1 A DA I  98     152.038 191.789 123.742  0.50102.51           N  
ATOM   3601  N1 B DA I  98     152.046 192.259 123.773  0.50102.51           N  
ATOM   3602  C2 A DA I  98     150.741 192.012 123.980  0.50102.51           C  
ATOM   3603  C2 B DA I  98     150.734 192.479 123.954  0.50102.51           C  
ATOM   3604  N3 A DA I  98     150.118 193.164 124.212  0.50102.51           N  
ATOM   3605  N3 B DA I  98     150.094 193.638 124.157  0.50102.51           N  
ATOM   3606  C4 A DA I  98     150.981 194.186 124.172  0.50102.51           C  
ATOM   3607  C4 B DA I  98     150.957 194.670 124.149  0.50102.51           C  
ATOM   3608  H5'A DA I  98     150.742 198.777 124.026  0.50102.51           H  
ATOM   3609  H5'B DA I  98     149.581 200.543 125.451  0.50102.51           H  
ATOM   3610 H5''A DA I  98     150.427 198.559 122.499  0.50102.51           H  
ATOM   3611 H5''B DA I  98     150.668 199.613 124.787  0.50102.51           H  
ATOM   3612  H4'A DA I  98     148.073 198.525 123.163  0.50102.51           H  
ATOM   3613  H4'B DA I  98     148.025 199.317 123.932  0.50102.51           H  
ATOM   3614  H3'A DA I  98     148.614 199.105 125.531  0.50102.51           H  
ATOM   3615  H3'B DA I  98     148.310 198.964 126.460  0.50102.51           H  
ATOM   3616  H2'A DA I  98     150.205 197.541 125.932  0.50102.51           H  
ATOM   3617  H2'B DA I  98     149.883 197.352 126.407  0.50102.51           H  
ATOM   3618 H2''A DA I  98     148.946 196.802 126.555  0.50102.51           H  
ATOM   3619 H2''B DA I  98     148.574 196.444 126.413  0.50102.51           H  
ATOM   3620  H1'A DA I  98     148.757 195.409 124.844  0.50102.51           H  
ATOM   3621  H1'B DA I  98     148.671 196.062 124.227  0.50102.51           H  
ATOM   3622  H8 A DA I  98     151.994 197.079 124.331  0.50102.51           H  
ATOM   3623  H8 B DA I  98     151.977 197.576 124.307  0.50102.51           H  
ATOM   3624  H61A DA I  98     154.486 191.815 123.509  0.50102.51           H  
ATOM   3625  H61B DA I  98     154.500 192.304 123.642  0.50102.51           H  
ATOM   3626  H62A DA I  98     154.701 193.275 123.309  0.50102.51           H  
ATOM   3627  H62B DA I  98     154.709 193.762 123.425  0.50102.51           H  
ATOM   3628  H2 A DA I  98     150.200 191.258 123.987  0.50102.51           H  
ATOM   3629  H2 B DA I  98     150.198 191.722 123.953  0.50102.51           H  
ATOM   3630  P  A DG I  99     146.364 197.847 126.740  0.50100.62           P  
ATOM   3631  P  B DG I  99     145.928 197.740 126.824  0.50100.62           P  
ATOM   3632  OP1A DG I  99     144.936 198.195 126.597  0.50100.62           O  
ATOM   3633  OP1B DG I  99     144.521 197.847 126.389  0.50100.62           O  
ATOM   3634  OP2A DG I  99     147.222 198.617 127.664  0.50100.62           O  
ATOM   3635  OP2B DG I  99     146.408 198.570 127.950  0.50100.62           O  
ATOM   3636  O5'A DG I  99     146.486 196.297 127.126  0.50100.62           O  
ATOM   3637  O5'B DG I  99     146.239 196.216 127.179  0.50100.62           O  
ATOM   3638  C5'A DG I  99     145.968 195.296 126.241  0.50100.62           C  
ATOM   3639  C5'B DG I  99     145.977 195.190 126.222  0.50100.62           C  
ATOM   3640  C4'A DG I  99     145.948 193.916 126.899  0.50100.62           C  
ATOM   3641  C4'B DG I  99     145.960 193.808 126.873  0.50100.62           C  
ATOM   3642  O4'A DG I  99     147.207 193.218 126.647  0.50100.62           O  
ATOM   3643  O4'B DG I  99     147.229 193.127 126.626  0.50100.62           O  
ATOM   3644  C3'A DG I  99     145.796 193.930 128.409  0.50100.62           C  
ATOM   3645  C3'B DG I  99     145.808 193.807 128.385  0.50100.62           C  
ATOM   3646  O3'A DG I  99     145.084 192.781 128.855  0.50100.62           O  
ATOM   3647  O3'B DG I  99     145.190 192.612 128.828  0.50100.62           O  
ATOM   3648  C2'A DG I  99     147.239 193.935 128.878  0.50100.62           C  
ATOM   3649  C2'B DG I  99     147.250 193.905 128.834  0.50100.62           C  
ATOM   3650  C1'A DG I  99     147.890 192.982 127.872  0.50100.62           C  
ATOM   3651  C1'B DG I  99     147.920 192.939 127.855  0.50100.62           C  
ATOM   3652  N9 A DG I  99     149.330 193.172 127.628  0.50100.62           N  
ATOM   3653  N9 B DG I  99     149.356 193.146 127.609  0.50100.62           N  
ATOM   3654  C8 A DG I  99     150.004 194.361 127.546  0.50100.62           C  
ATOM   3655  C8 B DG I  99     150.025 194.339 127.539  0.50100.62           C  
ATOM   3656  N7 A DG I  99     151.268 194.230 127.282  0.50100.62           N  
ATOM   3657  N7 B DG I  99     151.289 194.216 127.269  0.50100.62           N  
ATOM   3658  C5 A DG I  99     151.452 192.866 127.161  0.50100.62           C  
ATOM   3659  C5 B DG I  99     151.477 192.855 127.142  0.50100.62           C  
ATOM   3660  C6 A DG I  99     152.626 192.139 126.879  0.50100.62           C  
ATOM   3661  C6 B DG I  99     152.650 192.131 126.854  0.50100.62           C  
ATOM   3662  O6 A DG I  99     153.758 192.579 126.665  0.50100.62           O  
ATOM   3663  O6 B DG I  99     153.782 192.572 126.645  0.50100.62           O  
ATOM   3664  N1 A DG I  99     152.394 190.774 126.831  0.50100.62           N  
ATOM   3665  N1 B DG I  99     152.419 190.765 126.802  0.50100.62           N  
ATOM   3666  C2 A DG I  99     151.176 190.181 127.042  0.50100.62           C  
ATOM   3667  C2 B DG I  99     151.202 190.170 127.011  0.50100.62           C  
ATOM   3668  N2 A DG I  99     151.146 188.840 126.962  0.50100.62           N  
ATOM   3669  N2 B DG I  99     151.170 188.830 126.924  0.50100.62           N  
ATOM   3670  N3 A DG I  99     150.057 190.856 127.312  0.50100.62           N  
ATOM   3671  N3 B DG I  99     150.086 190.841 127.284  0.50100.62           N  
ATOM   3672  C4 A DG I  99     150.272 192.194 127.353  0.50100.62           C  
ATOM   3673  C4 B DG I  99     150.299 192.178 127.331  0.50100.62           C  
ATOM   3674  H5'A DG I  99     146.521 195.262 125.447  0.50100.62           H  
ATOM   3675  H5'B DG I  99     146.667 195.212 125.541  0.50100.62           H  
ATOM   3676 H5''A DG I  99     145.065 195.539 125.985  0.50100.62           H  
ATOM   3677 H5''B DG I  99     145.117 195.357 125.808  0.50100.62           H  
ATOM   3678  H4'A DG I  99     145.221 193.398 126.519  0.50100.62           H  
ATOM   3679  H4'B DG I  99     145.241 193.286 126.485  0.50100.62           H  
ATOM   3680  H3'A DG I  99     145.345 194.738 128.696  0.50100.62           H  
ATOM   3681  H3'B DG I  99     145.303 194.577 128.682  0.50100.62           H  
ATOM   3682  H2'A DG I  99     147.614 194.824 128.818  0.50100.62           H  
ATOM   3683  H2'B DG I  99     147.582 194.806 128.727  0.50100.62           H  
ATOM   3684 H2''A DG I  99     147.296 193.596 129.773  0.50100.62           H  
ATOM   3685 H2''B DG I  99     147.336 193.609 129.740  0.50100.62           H  
ATOM   3686  H1'A DG I  99     147.732 192.068 128.152  0.50100.62           H  
ATOM   3687  H1'B DG I  99     147.779 192.031 128.159  0.50100.62           H  
ATOM   3688  H8 A DG I  99     149.600 195.179 127.685  0.50100.62           H  
ATOM   3689  H8 B DG I  99     149.617 195.156 127.681  0.50100.62           H  
ATOM   3690  H1 A DG I  99     153.063 190.263 126.661  0.50100.62           H  
ATOM   3691  H1 B DG I  99     153.089 190.255 126.629  0.50100.62           H  
ATOM   3692  H21A DG I  99     150.397 188.422 127.024  0.50100.62           H  
ATOM   3693  H21B DG I  99     150.418 188.414 126.965  0.50100.62           H  
ATOM   3694  H22A DG I  99     151.875 188.399 126.843  0.50100.62           H  
ATOM   3695  H22B DG I  99     151.900 188.387 126.822  0.50100.62           H  
ATOM   3696  P    DC I 100     143.868 191.757 128.709  1.00 97.06           P  
ATOM   3697  OP1  DC I 100     143.451 191.680 127.292  1.00 97.06           O  
ATOM   3698  OP2  DC I 100     142.873 192.067 129.759  1.00 97.06           O  
ATOM   3699  O5'  DC I 100     144.621 190.402 129.111  1.00 97.06           O  
ATOM   3700  C5'  DC I 100     145.315 189.658 128.120  1.00 97.06           C  
ATOM   3701  C4'  DC I 100     146.116 188.513 128.727  1.00 97.06           C  
ATOM   3702  O4'  DC I 100     147.508 188.917 128.889  1.00 97.06           O  
ATOM   3703  C3'  DC I 100     145.694 188.064 130.111  1.00 97.06           C  
ATOM   3704  O3'  DC I 100     146.062 186.721 130.295  1.00 97.06           O  
ATOM   3705  C2'  DC I 100     146.509 188.999 130.991  1.00 97.06           C  
ATOM   3706  C1'  DC I 100     147.856 188.906 130.271  1.00 97.06           C  
ATOM   3707  N1   DC I 100     148.871 190.012 130.481  1.00 97.06           N  
ATOM   3708  C2   DC I 100     150.225 189.749 130.239  1.00 97.06           C  
ATOM   3709  O2   DC I 100     150.573 188.610 129.931  1.00 97.06           O  
ATOM   3710  N3   DC I 100     151.119 190.758 130.347  1.00 97.06           N  
ATOM   3711  C4   DC I 100     150.716 191.972 130.672  1.00 97.06           C  
ATOM   3712  N4   DC I 100     151.626 192.940 130.776  1.00 97.06           N  
ATOM   3713  C5   DC I 100     149.361 192.256 130.917  1.00 97.06           C  
ATOM   3714  C6   DC I 100     148.477 191.268 130.792  1.00 97.06           C  
ATOM   3715  H5'  DC I 100     145.918 190.251 127.648  1.00 97.06           H  
ATOM   3716 H5''  DC I 100     144.674 189.295 127.491  1.00 97.06           H  
ATOM   3717  H4'  DC I 100     146.078 187.752 128.130  1.00 97.06           H  
ATOM   3718  H3'  DC I 100     144.745 188.191 130.245  1.00 97.06           H  
ATOM   3719  H2'  DC I 100     146.144 189.892 130.965  1.00 97.06           H  
ATOM   3720 H2''  DC I 100     146.564 188.667 131.895  1.00 97.06           H  
ATOM   3721  H1'  DC I 100     148.263 188.064 130.468  1.00 97.06           H  
ATOM   3722  H41  DC I 100     151.415 193.692 131.135  1.00 97.06           H  
ATOM   3723  H42  DC I 100     152.427 192.808 130.491  1.00 97.06           H  
ATOM   3724  H5   DC I 100     149.085 193.118 131.126  1.00 97.06           H  
ATOM   3725  H6   DC I 100     147.578 191.442 130.935  1.00 97.06           H  
ATOM   3726  P    DA I 101     144.975 185.563 130.506  1.00 87.18           P  
ATOM   3727  OP1  DA I 101     143.894 185.745 129.517  1.00 87.18           O  
ATOM   3728  OP2  DA I 101     144.641 185.545 131.947  1.00 87.18           O  
ATOM   3729  O5'  DA I 101     145.805 184.227 130.185  1.00 87.18           O  
ATOM   3730  C5'  DA I 101     146.581 184.136 128.990  1.00 87.18           C  
ATOM   3731  C4'  DA I 101     147.908 183.409 129.210  1.00 87.18           C  
ATOM   3732  O4'  DA I 101     148.895 184.332 129.730  1.00 87.18           O  
ATOM   3733  C3'  DA I 101     147.893 182.270 130.205  1.00 87.18           C  
ATOM   3734  O3'  DA I 101     148.912 181.338 129.889  1.00 87.18           O  
ATOM   3735  C2'  DA I 101     148.158 182.986 131.515  1.00 87.18           C  
ATOM   3736  C1'  DA I 101     149.187 184.028 131.089  1.00 87.18           C  
ATOM   3737  N9   DA I 101     149.177 185.297 131.818  1.00 87.18           N  
ATOM   3738  C8   DA I 101     148.093 185.995 132.256  1.00 87.18           C  
ATOM   3739  N7   DA I 101     148.390 187.130 132.838  1.00 87.18           N  
ATOM   3740  C5   DA I 101     149.761 187.195 132.757  1.00 87.18           C  
ATOM   3741  C6   DA I 101     150.686 188.154 133.192  1.00 87.18           C  
ATOM   3742  N6   DA I 101     150.336 189.277 133.817  1.00 87.18           N  
ATOM   3743  N1   DA I 101     151.991 187.904 132.977  1.00 87.18           N  
ATOM   3744  C2   DA I 101     152.336 186.771 132.356  1.00 87.18           C  
ATOM   3745  N3   DA I 101     151.555 185.800 131.895  1.00 87.18           N  
ATOM   3746  C4   DA I 101     150.266 186.080 132.122  1.00 87.18           C  
ATOM   3747  H5'  DA I 101     146.763 185.029 128.666  1.00 87.18           H  
ATOM   3748 H5''  DA I 101     146.070 183.659 128.323  1.00 87.18           H  
ATOM   3749  H4'  DA I 101     148.220 183.069 128.361  1.00 87.18           H  
ATOM   3750  H3'  DA I 101     147.027 181.840 130.218  1.00 87.18           H  
ATOM   3751  H2'  DA I 101     147.354 183.396 131.848  1.00 87.18           H  
ATOM   3752 H2''  DA I 101     148.530 182.383 132.164  1.00 87.18           H  
ATOM   3753  H1'  DA I 101     150.070 183.637 131.140  1.00 87.18           H  
ATOM   3754  H8   DA I 101     147.221 185.696 132.144  1.00 87.18           H  
ATOM   3755  H61  DA I 101     150.927 189.737 134.235  1.00 87.18           H  
ATOM   3756  H62  DA I 101     149.519 189.542 133.796  1.00 87.18           H  
ATOM   3757  H2   DA I 101     153.248 186.649 132.222  1.00 87.18           H  
ATOM   3758  P    DG I 102     148.827 179.824 130.409  1.00 95.70           P  
ATOM   3759  OP1  DG I 102     150.086 179.155 130.018  1.00 95.70           O  
ATOM   3760  OP2  DG I 102     147.532 179.276 129.953  1.00 95.70           O  
ATOM   3761  O5'  DG I 102     148.778 179.961 132.002  1.00 95.70           O  
ATOM   3762  C5'  DG I 102     149.802 179.381 132.812  1.00 95.70           C  
ATOM   3763  C4'  DG I 102     151.052 180.246 132.828  1.00 95.70           C  
ATOM   3764  O4'  DG I 102     150.684 181.627 133.033  1.00 95.70           O  
ATOM   3765  C3'  DG I 102     152.054 179.910 133.939  1.00 95.70           C  
ATOM   3766  O3'  DG I 102     153.277 179.500 133.383  1.00 95.70           O  
ATOM   3767  C2'  DG I 102     152.196 181.207 134.746  1.00 95.70           C  
ATOM   3768  C1'  DG I 102     151.688 182.259 133.784  1.00 95.70           C  
ATOM   3769  N9   DG I 102     151.121 183.461 134.396  1.00 95.70           N  
ATOM   3770  C8   DG I 102     149.797 183.812 134.438  1.00 95.70           C  
ATOM   3771  N7   DG I 102     149.581 184.965 135.002  1.00 95.70           N  
ATOM   3772  C5   DG I 102     150.842 185.408 135.359  1.00 95.70           C  
ATOM   3773  C6   DG I 102     151.232 186.595 136.011  1.00 95.70           C  
ATOM   3774  O6   DG I 102     150.515 187.520 136.415  1.00 95.70           O  
ATOM   3775  N1   DG I 102     152.607 186.656 136.185  1.00 95.70           N  
ATOM   3776  C2   DG I 102     153.492 185.691 135.775  1.00 95.70           C  
ATOM   3777  N2   DG I 102     154.785 185.919 136.028  1.00 95.70           N  
ATOM   3778  N3   DG I 102     153.137 184.572 135.162  1.00 95.70           N  
ATOM   3779  C4   DG I 102     151.803 184.502 134.982  1.00 95.70           C  
ATOM   3780  H5'  DG I 102     150.027 178.506 132.462  1.00 95.70           H  
ATOM   3781 H5''  DG I 102     149.473 179.284 133.719  1.00 95.70           H  
ATOM   3782  H4'  DG I 102     151.498 180.165 131.971  1.00 95.70           H  
ATOM   3783  H3'  DG I 102     151.697 179.208 134.504  1.00 95.70           H  
ATOM   3784  H2'  DG I 102     151.652 181.176 135.540  1.00 95.70           H  
ATOM   3785 H2''  DG I 102     153.126 181.371 134.970  1.00 95.70           H  
ATOM   3786  H1'  DG I 102     152.410 182.518 133.190  1.00 95.70           H  
ATOM   3787  H8   DG I 102     149.121 183.285 134.084  1.00 95.70           H  
ATOM   3788  H1   DG I 102     152.927 187.350 136.576  1.00 95.70           H  
ATOM   3789  H21  DG I 102     155.384 185.387 135.716  1.00 95.70           H  
ATOM   3790  H22  DG I 102     155.016 186.593 136.508  1.00 95.70           H  
ATOM   3791  P    DT I 103     154.271 178.568 134.226  1.00103.22           P  
ATOM   3792  OP1  DT I 103     155.506 178.477 133.422  1.00103.22           O  
ATOM   3793  OP2  DT I 103     153.539 177.354 134.652  1.00103.22           O  
ATOM   3794  O5'  DT I 103     154.618 179.438 135.518  1.00103.22           O  
ATOM   3795  C5'  DT I 103     155.773 180.251 135.507  1.00103.22           C  
ATOM   3796  C4'  DT I 103     155.916 181.044 136.791  1.00103.22           C  
ATOM   3797  O4'  DT I 103     154.923 182.084 136.834  1.00103.22           O  
ATOM   3798  C3'  DT I 103     155.717 180.254 138.088  1.00103.22           C  
ATOM   3799  O3'  DT I 103     156.980 179.911 138.662  1.00103.22           O  
ATOM   3800  C2'  DT I 103     154.890 181.200 138.983  1.00103.22           C  
ATOM   3801  C1'  DT I 103     154.807 182.484 138.169  1.00103.22           C  
ATOM   3802  N1   DT I 103     153.529 183.260 138.344  1.00103.22           N  
ATOM   3803  C2   DT I 103     153.567 184.500 138.938  1.00103.22           C  
ATOM   3804  O2   DT I 103     154.587 185.023 139.346  1.00103.22           O  
ATOM   3805  N3   DT I 103     152.358 185.119 139.039  1.00103.22           N  
ATOM   3806  C4   DT I 103     151.138 184.643 138.632  1.00103.22           C  
ATOM   3807  O4   DT I 103     150.106 185.291 138.767  1.00103.22           O  
ATOM   3808  C5   DT I 103     151.158 183.349 138.013  1.00103.22           C  
ATOM   3809  C7   DT I 103     149.880 182.739 137.524  1.00103.22           C  
ATOM   3810  C6   DT I 103     152.342 182.726 137.891  1.00103.22           C  
ATOM   3811  H5'  DT I 103     155.717 180.866 134.761  1.00103.22           H  
ATOM   3812 H5''  DT I 103     156.553 179.689 135.396  1.00103.22           H  
ATOM   3813  H4'  DT I 103     156.794 181.451 136.807  1.00103.22           H  
ATOM   3814  H3'  DT I 103     155.210 179.449 137.908  1.00103.22           H  
ATOM   3815  H2'  DT I 103     154.010 180.836 139.132  1.00103.22           H  
ATOM   3816 H2''  DT I 103     155.341 181.363 139.823  1.00103.22           H  
ATOM   3817  H1'  DT I 103     155.560 183.045 138.393  1.00103.22           H  
ATOM   3818  H3   DT I 103     152.359 185.893 139.407  1.00103.22           H  
ATOM   3819  H71  DT I 103     150.060 182.173 136.764  1.00103.22           H  
ATOM   3820  H72  DT I 103     149.482 182.211 138.233  1.00103.22           H  
ATOM   3821  H73  DT I 103     149.268 183.444 137.263  1.00103.22           H  
ATOM   3822  H6   DT I 103     152.359 181.884 137.503  1.00103.22           H  
ATOM   3823  P    DT I 104     157.059 179.086 140.039  1.00109.32           P  
ATOM   3824  OP1  DT I 104     158.345 178.356 140.053  1.00109.32           O  
ATOM   3825  OP2  DT I 104     155.791 178.345 140.207  1.00109.32           O  
ATOM   3826  O5'  DT I 104     157.110 180.226 141.155  1.00109.32           O  
ATOM   3827  C5'  DT I 104     158.007 181.319 141.003  1.00109.32           C  
ATOM   3828  C4'  DT I 104     157.762 182.382 142.058  1.00109.32           C  
ATOM   3829  O4'  DT I 104     156.516 183.064 141.771  1.00109.32           O  
ATOM   3830  C3'  DT I 104     157.645 181.849 143.486  1.00109.32           C  
ATOM   3831  O3'  DT I 104     158.602 182.472 144.323  1.00109.32           O  
ATOM   3832  C2'  DT I 104     156.207 182.170 143.898  1.00109.32           C  
ATOM   3833  C1'  DT I 104     155.830 183.313 142.971  1.00109.32           C  
ATOM   3834  N1   DT I 104     154.355 183.428 142.654  1.00109.32           N  
ATOM   3835  C2   DT I 104     153.674 184.584 142.976  1.00109.32           C  
ATOM   3836  O2   DT I 104     154.187 185.535 143.538  1.00109.32           O  
ATOM   3837  N3   DT I 104     152.353 184.588 142.622  1.00109.32           N  
ATOM   3838  C4   DT I 104     151.657 183.582 141.983  1.00109.32           C  
ATOM   3839  O4   DT I 104     150.465 183.682 141.708  1.00109.32           O  
ATOM   3840  C5   DT I 104     152.427 182.407 141.660  1.00109.32           C  
ATOM   3841  C7   DT I 104     151.773 181.240 140.980  1.00109.32           C  
ATOM   3842  C6   DT I 104     153.724 182.389 142.000  1.00109.32           C  
ATOM   3843  H5'  DT I 104     157.885 181.710 140.124  1.00109.32           H  
ATOM   3844 H5''  DT I 104     158.917 180.995 141.083  1.00109.32           H  
ATOM   3845  H4'  DT I 104     158.485 183.027 142.026  1.00109.32           H  
ATOM   3846  H3'  DT I 104     157.781 180.890 143.489  1.00109.32           H  
ATOM   3847  H2'  DT I 104     155.638 181.404 143.752  1.00109.32           H  
ATOM   3848 H2''  DT I 104     156.174 182.455 144.824  1.00109.32           H  
ATOM   3849  H1'  DT I 104     156.148 184.144 143.349  1.00109.32           H  
ATOM   3850  H3   DT I 104     151.907 185.297 142.818  1.00109.32           H  
ATOM   3851  H71  DT I 104     152.445 180.589 140.737  1.00109.32           H  
ATOM   3852  H72  DT I 104     151.135 180.832 141.586  1.00109.32           H  
ATOM   3853  H73  DT I 104     151.311 181.542 140.188  1.00109.32           H  
ATOM   3854  H6   DT I 104     154.220 181.630 141.799  1.00109.32           H  
ATOM   3855  P    DT I 105     158.878 181.904 145.798  1.00109.50           P  
ATOM   3856  OP1  DT I 105     160.318 182.083 146.079  1.00109.50           O  
ATOM   3857  OP2  DT I 105     158.266 180.562 145.906  1.00109.50           O  
ATOM   3858  O5'  DT I 105     158.042 182.886 146.733  1.00109.50           O  
ATOM   3859  C5'  DT I 105     158.203 184.284 146.601  1.00109.50           C  
ATOM   3860  C4'  DT I 105     157.249 185.021 147.511  1.00109.50           C  
ATOM   3861  O4'  DT I 105     155.943 185.108 146.872  1.00109.50           O  
ATOM   3862  C3'  DT I 105     157.011 184.346 148.858  1.00109.50           C  
ATOM   3863  O3'  DT I 105     156.945 185.304 149.894  1.00109.50           O  
ATOM   3864  C2'  DT I 105     155.691 183.635 148.643  1.00109.50           C  
ATOM   3865  C1'  DT I 105     154.962 184.646 147.771  1.00109.50           C  
ATOM   3866  N1   DT I 105     153.744 184.124 146.978  1.00109.50           N  
ATOM   3867  C2   DT I 105     152.615 184.913 146.888  1.00109.50           C  
ATOM   3868  O2   DT I 105     152.517 186.010 147.410  1.00109.50           O  
ATOM   3869  N3   DT I 105     151.592 184.371 146.160  1.00109.50           N  
ATOM   3870  C4   DT I 105     151.577 183.157 145.518  1.00109.50           C  
ATOM   3871  O4   DT I 105     150.604 182.757 144.893  1.00109.50           O  
ATOM   3872  C5   DT I 105     152.772 182.382 145.643  1.00109.50           C  
ATOM   3873  C7   DT I 105     152.848 181.043 144.994  1.00109.50           C  
ATOM   3874  C6   DT I 105     153.792 182.891 146.350  1.00109.50           C  
ATOM   3875  H5'  DT I 105     158.029 184.539 145.683  1.00109.50           H  
ATOM   3876 H5''  DT I 105     159.111 184.524 146.832  1.00109.50           H  
ATOM   3877  H4'  DT I 105     157.586 185.915 147.665  1.00109.50           H  
ATOM   3878  H3'  DT I 105     157.710 183.705 149.039  1.00109.50           H  
ATOM   3879  H2'  DT I 105     155.831 182.798 148.180  1.00109.50           H  
ATOM   3880 H2''  DT I 105     155.232 183.501 149.482  1.00109.50           H  
ATOM   3881  H1'  DT I 105     154.683 185.385 148.330  1.00109.50           H  
ATOM   3882  H3   DT I 105     150.879 184.844 146.093  1.00109.50           H  
ATOM   3883  H71  DT I 105     153.772 180.796 144.869  1.00109.50           H  
ATOM   3884  H72  DT I 105     152.412 180.388 145.560  1.00109.50           H  
ATOM   3885  H73  DT I 105     152.401 181.075 144.139  1.00109.50           H  
ATOM   3886  H6   DT I 105     154.567 182.386 146.429  1.00109.50           H  
ATOM   3887  P    DC I 106     157.055 184.837 151.426  1.00109.35           P  
ATOM   3888  OP1  DC I 106     158.195 185.558 152.032  1.00109.35           O  
ATOM   3889  OP2  DC I 106     157.023 183.358 151.444  1.00109.35           O  
ATOM   3890  O5'  DC I 106     155.698 185.366 152.085  1.00109.35           O  
ATOM   3891  C5'  DC I 106     155.413 186.757 152.094  1.00109.35           C  
ATOM   3892  C4'  DC I 106     153.924 187.009 152.244  1.00109.35           C  
ATOM   3893  O4'  DC I 106     153.213 186.363 151.156  1.00109.35           O  
ATOM   3894  C3'  DC I 106     153.305 186.473 153.537  1.00109.35           C  
ATOM   3895  O3'  DC I 106     152.560 187.498 154.177  1.00109.35           O  
ATOM   3896  C2'  DC I 106     152.430 185.306 153.070  1.00109.35           C  
ATOM   3897  C1'  DC I 106     152.066 185.723 151.659  1.00109.35           C  
ATOM   3898  N1   DC I 106     151.698 184.593 150.711  1.00109.35           N  
ATOM   3899  C2   DC I 106     150.479 184.618 150.017  1.00109.35           C  
ATOM   3900  O2   DC I 106     149.695 185.551 150.208  1.00109.35           O  
ATOM   3901  N3   DC I 106     150.194 183.611 149.157  1.00109.35           N  
ATOM   3902  C4   DC I 106     151.064 182.624 148.975  1.00109.35           C  
ATOM   3903  N4   DC I 106     150.744 181.652 148.117  1.00109.35           N  
ATOM   3904  C5   DC I 106     152.305 182.587 149.659  1.00109.35           C  
ATOM   3905  C6   DC I 106     152.580 183.582 150.499  1.00109.35           C  
ATOM   3906  H5'  DC I 106     155.719 187.150 151.263  1.00109.35           H  
ATOM   3907 H5''  DC I 106     155.881 187.173 152.835  1.00109.35           H  
ATOM   3908  H4'  DC I 106     153.764 187.964 152.198  1.00109.35           H  
ATOM   3909  H3'  DC I 106     154.002 186.149 154.128  1.00109.35           H  
ATOM   3910  H2'  DC I 106     152.935 184.480 153.073  1.00109.35           H  
ATOM   3911 H2''  DC I 106     151.638 185.228 153.618  1.00109.35           H  
ATOM   3912  H1'  DC I 106     151.346 186.364 151.700  1.00109.35           H  
ATOM   3913  H41  DC I 106     151.251 180.963 148.040  1.00109.35           H  
ATOM   3914  H42  DC I 106     150.040 181.723 147.630  1.00109.35           H  
ATOM   3915  H5   DC I 106     152.905 181.894 149.524  1.00109.35           H  
ATOM   3916  H6   DC I 106     153.385 183.579 150.959  1.00109.35           H  
ATOM   3917  P    DC I 107     152.055 187.326 155.692  1.00105.37           P  
ATOM   3918  OP1  DC I 107     152.878 188.219 156.537  1.00105.37           O  
ATOM   3919  OP2  DC I 107     151.986 185.883 156.007  1.00105.37           O  
ATOM   3920  O5'  DC I 107     150.562 187.894 155.649  1.00105.37           O  
ATOM   3921  C5'  DC I 107     149.751 187.658 154.505  1.00105.37           C  
ATOM   3922  C4'  DC I 107     148.342 187.223 154.869  1.00105.37           C  
ATOM   3923  O4'  DC I 107     147.958 186.130 153.985  1.00105.37           O  
ATOM   3924  C3'  DC I 107     148.137 186.668 156.278  1.00105.37           C  
ATOM   3925  O3'  DC I 107     146.814 186.879 156.698  1.00105.37           O  
ATOM   3926  C2'  DC I 107     148.439 185.210 156.070  1.00105.37           C  
ATOM   3927  C1'  DC I 107     147.698 184.976 154.760  1.00105.37           C  
ATOM   3928  N1   DC I 107     148.077 183.737 153.956  1.00105.37           N  
ATOM   3929  C2   DC I 107     147.224 183.332 152.927  1.00105.37           C  
ATOM   3930  O2   DC I 107     146.200 183.990 152.710  1.00105.37           O  
ATOM   3931  N3   DC I 107     147.543 182.239 152.201  1.00105.37           N  
ATOM   3932  C4   DC I 107     148.657 181.561 152.467  1.00105.37           C  
ATOM   3933  N4   DC I 107     148.929 180.488 151.722  1.00105.37           N  
ATOM   3934  C5   DC I 107     149.541 181.948 153.509  1.00105.37           C  
ATOM   3935  C6   DC I 107     149.219 183.027 154.222  1.00105.37           C  
ATOM   3936  H5'  DC I 107     150.158 186.966 153.967  1.00105.37           H  
ATOM   3937 H5''  DC I 107     149.701 188.472 153.982  1.00105.37           H  
ATOM   3938  H4'  DC I 107     147.738 187.964 154.733  1.00105.37           H  
ATOM   3939  H3'  DC I 107     148.754 187.056 156.906  1.00105.37           H  
ATOM   3940  H2'  DC I 107     149.390 185.079 155.979  1.00105.37           H  
ATOM   3941 H2''  DC I 107     148.071 184.671 156.783  1.00105.37           H  
ATOM   3942  H1'  DC I 107     146.754 184.945 154.944  1.00105.37           H  
ATOM   3943  H41  DC I 107     149.700 180.112 151.775  1.00105.37           H  
ATOM   3944  H42  DC I 107     148.331 180.175 151.184  1.00105.37           H  
ATOM   3945  H5   DC I 107     150.316 181.467 153.686  1.00105.37           H  
ATOM   3946  H6   DC I 107     149.780 183.301 154.906  1.00105.37           H  
ATOM   3947  P    DA I 108     146.454 186.915 158.260  1.00103.82           P  
ATOM   3948  OP1  DA I 108     146.829 188.251 158.774  1.00103.82           O  
ATOM   3949  OP2  DA I 108     147.024 185.701 158.884  1.00103.82           O  
ATOM   3950  O5'  DA I 108     144.860 186.787 158.268  1.00103.82           O  
ATOM   3951  C5'  DA I 108     144.080 187.814 157.683  1.00103.82           C  
ATOM   3952  C4'  DA I 108     143.117 187.262 156.649  1.00103.82           C  
ATOM   3953  O4'  DA I 108     143.775 186.236 155.860  1.00103.82           O  
ATOM   3954  C3'  DA I 108     141.872 186.606 157.212  1.00103.82           C  
ATOM   3955  O3'  DA I 108     140.768 186.869 156.364  1.00103.82           O  
ATOM   3956  C2'  DA I 108     142.250 185.133 157.257  1.00103.82           C  
ATOM   3957  C1'  DA I 108     143.125 184.988 156.030  1.00103.82           C  
ATOM   3958  N9   DA I 108     144.161 183.962 156.116  1.00103.82           N  
ATOM   3959  C8   DA I 108     145.207 183.928 156.989  1.00103.82           C  
ATOM   3960  N7   DA I 108     146.019 182.914 156.807  1.00103.82           N  
ATOM   3961  C5   DA I 108     145.473 182.239 155.731  1.00103.82           C  
ATOM   3962  C6   DA I 108     145.861 181.070 155.049  1.00103.82           C  
ATOM   3963  N6   DA I 108     146.946 180.359 155.375  1.00103.82           N  
ATOM   3964  N1   DA I 108     145.092 180.663 154.010  1.00103.82           N  
ATOM   3965  C2   DA I 108     144.014 181.388 153.692  1.00103.82           C  
ATOM   3966  N3   DA I 108     143.550 182.500 154.263  1.00103.82           N  
ATOM   3967  C4   DA I 108     144.332 182.876 155.284  1.00103.82           C  
ATOM   3968  H5'  DA I 108     144.669 188.453 157.256  1.00103.82           H  
ATOM   3969 H5''  DA I 108     143.576 188.263 158.378  1.00103.82           H  
ATOM   3970  H4'  DA I 108     142.847 187.981 156.060  1.00103.82           H  
ATOM   3971  H3'  DA I 108     141.696 186.934 158.105  1.00103.82           H  
ATOM   3972  H2'  DA I 108     142.749 184.929 158.061  1.00103.82           H  
ATOM   3973 H2''  DA I 108     141.464 184.580 157.185  1.00103.82           H  
ATOM   3974  H1'  DA I 108     142.565 184.814 155.261  1.00103.82           H  
ATOM   3975  H8   DA I 108     145.331 184.563 157.650  1.00103.82           H  
ATOM   3976  H61  DA I 108     147.028 179.549 155.104  1.00103.82           H  
ATOM   3977  H62  DA I 108     147.566 180.715 155.854  1.00103.82           H  
ATOM   3978  H2   DA I 108     143.517 181.070 152.975  1.00103.82           H  
ATOM   3979  P    DA I 109     139.277 186.494 156.819  1.00 92.90           P  
ATOM   3980  OP1  DA I 109     138.368 187.500 156.230  1.00 92.90           O  
ATOM   3981  OP2  DA I 109     139.281 186.273 158.281  1.00 92.90           O  
ATOM   3982  O5'  DA I 109     139.020 185.089 156.108  1.00 92.90           O  
ATOM   3983  C5'  DA I 109     139.347 184.921 154.734  1.00 92.90           C  
ATOM   3984  C4'  DA I 109     139.005 183.522 154.256  1.00 92.90           C  
ATOM   3985  O4'  DA I 109     140.165 182.646 154.422  1.00 92.90           O  
ATOM   3986  C3'  DA I 109     137.883 182.838 155.024  1.00 92.90           C  
ATOM   3987  O3'  DA I 109     137.175 181.959 154.172  1.00 92.90           O  
ATOM   3988  C2'  DA I 109     138.659 182.098 156.098  1.00 92.90           C  
ATOM   3989  C1'  DA I 109     139.806 181.563 155.262  1.00 92.90           C  
ATOM   3990  N9   DA I 109     140.984 181.116 156.004  1.00 92.90           N  
ATOM   3991  C8   DA I 109     141.581 181.726 157.065  1.00 92.90           C  
ATOM   3992  N7   DA I 109     142.636 181.094 157.515  1.00 92.90           N  
ATOM   3993  C5   DA I 109     142.741 179.996 156.684  1.00 92.90           C  
ATOM   3994  C6   DA I 109     143.654 178.929 156.634  1.00 92.90           C  
ATOM   3995  N6   DA I 109     144.676 178.800 157.476  1.00 92.90           N  
ATOM   3996  N1   DA I 109     143.477 177.997 155.680  1.00 92.90           N  
ATOM   3997  C2   DA I 109     142.454 178.130 154.835  1.00 92.90           C  
ATOM   3998  N3   DA I 109     141.531 179.087 154.784  1.00 92.90           N  
ATOM   3999  C4   DA I 109     141.733 179.996 155.747  1.00 92.90           C  
ATOM   4000  H5'  DA I 109     140.297 185.074 154.613  1.00 92.90           H  
ATOM   4001 H5''  DA I 109     138.852 185.566 154.207  1.00 92.90           H  
ATOM   4002  H4'  DA I 109     138.768 183.558 153.317  1.00 92.90           H  
ATOM   4003  H3'  DA I 109     137.285 183.492 155.416  1.00 92.90           H  
ATOM   4004  H2'  DA I 109     138.976 182.707 156.780  1.00 92.90           H  
ATOM   4005 H2''  DA I 109     138.135 181.385 156.479  1.00 92.90           H  
ATOM   4006  H1'  DA I 109     139.482 180.833 154.714  1.00 92.90           H  
ATOM   4007  H8   DA I 109     141.265 182.510 157.440  1.00 92.90           H  
ATOM   4008  H61  DA I 109     145.148 178.080 157.472  1.00 92.90           H  
ATOM   4009  H62  DA I 109     144.865 179.435 158.023  1.00 92.90           H  
ATOM   4010  H2   DA I 109     142.374 177.462 154.195  1.00 92.90           H  
ATOM   4011  P    DA I 110     135.573 181.900 154.192  1.00 87.70           P  
ATOM   4012  OP1  DA I 110     135.086 182.892 153.211  1.00 87.70           O  
ATOM   4013  OP2  DA I 110     135.118 181.961 155.597  1.00 87.70           O  
ATOM   4014  O5'  DA I 110     135.259 180.445 153.620  1.00 87.70           O  
ATOM   4015  C5'  DA I 110     135.758 180.083 152.353  1.00 87.70           C  
ATOM   4016  C4'  DA I 110     136.284 178.660 152.351  1.00 87.70           C  
ATOM   4017  O4'  DA I 110     137.481 178.568 153.169  1.00 87.70           O  
ATOM   4018  C3'  DA I 110     135.312 177.624 152.902  1.00 87.70           C  
ATOM   4019  O3'  DA I 110     135.125 176.589 151.967  1.00 87.70           O  
ATOM   4020  C2'  DA I 110     135.966 177.139 154.195  1.00 87.70           C  
ATOM   4021  C1'  DA I 110     137.431 177.398 153.955  1.00 87.70           C  
ATOM   4022  N9   DA I 110     138.205 177.629 155.168  1.00 87.70           N  
ATOM   4023  C8   DA I 110     138.052 178.661 156.037  1.00 87.70           C  
ATOM   4024  N7   DA I 110     138.896 178.646 157.038  1.00 87.70           N  
ATOM   4025  C5   DA I 110     139.660 177.522 156.808  1.00 87.70           C  
ATOM   4026  C6   DA I 110     140.732 176.951 157.513  1.00 87.70           C  
ATOM   4027  N6   DA I 110     141.223 177.467 158.633  1.00 87.70           N  
ATOM   4028  N1   DA I 110     141.281 175.828 157.020  1.00 87.70           N  
ATOM   4029  C2   DA I 110     140.785 175.314 155.888  1.00 87.70           C  
ATOM   4030  N3   DA I 110     139.776 175.761 155.134  1.00 87.70           N  
ATOM   4031  C4   DA I 110     139.255 176.882 155.654  1.00 87.70           C  
ATOM   4032  H5'  DA I 110     136.474 180.687 152.112  1.00 87.70           H  
ATOM   4033 H5''  DA I 110     135.047 180.159 151.701  1.00 87.70           H  
ATOM   4034  H4'  DA I 110     136.511 178.416 151.443  1.00 87.70           H  
ATOM   4035  H3'  DA I 110     134.464 178.047 153.100  1.00 87.70           H  
ATOM   4036  H2'  DA I 110     135.649 177.655 154.944  1.00 87.70           H  
ATOM   4037 H2''  DA I 110     135.808 176.195 154.333  1.00 87.70           H  
ATOM   4038  H1'  DA I 110     137.813 176.658 153.461  1.00 87.70           H  
ATOM   4039  H8   DA I 110     137.406 179.319 155.930  1.00 87.70           H  
ATOM   4040  H61  DA I 110     141.772 177.011 159.110  1.00 87.70           H  
ATOM   4041  H62  DA I 110     140.996 178.259 158.876  1.00 87.70           H  
ATOM   4042  H2   DA I 110     141.197 174.538 155.588  1.00 87.70           H  
ATOM   4043  P    DT I 111     134.052 175.432 152.244  1.00 83.62           P  
ATOM   4044  OP1  DT I 111     133.391 175.150 150.955  1.00 83.62           O  
ATOM   4045  OP2  DT I 111     133.224 175.851 153.397  1.00 83.62           O  
ATOM   4046  O5'  DT I 111     134.948 174.193 152.726  1.00 83.62           O  
ATOM   4047  C5'  DT I 111     136.206 173.924 152.103  1.00 83.62           C  
ATOM   4048  C4'  DT I 111     136.983 172.874 152.872  1.00 83.62           C  
ATOM   4049  O4'  DT I 111     137.676 173.509 153.992  1.00 83.62           O  
ATOM   4050  C3'  DT I 111     136.125 171.759 153.490  1.00 83.62           C  
ATOM   4051  O3'  DT I 111     136.717 170.470 153.300  1.00 83.62           O  
ATOM   4052  C2'  DT I 111     136.082 172.157 154.951  1.00 83.62           C  
ATOM   4053  C1'  DT I 111     137.479 172.713 155.133  1.00 83.62           C  
ATOM   4054  N1   DT I 111     137.685 173.528 156.395  1.00 83.62           N  
ATOM   4055  C2   DT I 111     138.645 173.138 157.308  1.00 83.62           C  
ATOM   4056  O2   DT I 111     139.365 172.172 157.157  1.00 83.62           O  
ATOM   4057  N3   DT I 111     138.741 173.931 158.411  1.00 83.62           N  
ATOM   4058  C4   DT I 111     137.997 175.046 158.702  1.00 83.62           C  
ATOM   4059  O4   DT I 111     138.164 175.692 159.730  1.00 83.62           O  
ATOM   4060  C5   DT I 111     137.008 175.400 157.717  1.00 83.62           C  
ATOM   4061  C7   DT I 111     136.135 176.598 157.928  1.00 83.62           C  
ATOM   4062  C6   DT I 111     136.902 174.634 156.623  1.00 83.62           C  
ATOM   4063  H5'  DT I 111     136.727 174.739 152.072  1.00 83.62           H  
ATOM   4064 H5''  DT I 111     136.054 173.610 151.200  1.00 83.62           H  
ATOM   4065  H4'  DT I 111     137.640 172.474 152.282  1.00 83.62           H  
ATOM   4066  H3'  DT I 111     135.235 171.774 153.114  1.00 83.62           H  
ATOM   4067  H2'  DT I 111     135.412 172.838 155.099  1.00 83.62           H  
ATOM   4068 H2''  DT I 111     135.932 171.390 155.513  1.00 83.62           H  
ATOM   4069  H1'  DT I 111     138.108 171.982 155.115  1.00 83.62           H  
ATOM   4070  H3   DT I 111     139.334 173.708 158.989  1.00 83.62           H  
ATOM   4071  H71  DT I 111     135.917 176.990 157.074  1.00 83.62           H  
ATOM   4072  H72  DT I 111     135.319 176.329 158.378  1.00 83.62           H  
ATOM   4073  H73  DT I 111     136.604 177.249 158.472  1.00 83.62           H  
ATOM   4074  H6   DT I 111     136.266 174.859 155.987  1.00 83.62           H  
ATOM   4075  P    DA I 112     135.834 169.144 153.513  1.00 83.50           P  
ATOM   4076  OP1  DA I 112     135.525 168.594 152.177  1.00 83.50           O  
ATOM   4077  OP2  DA I 112     134.736 169.476 154.441  1.00 83.50           O  
ATOM   4078  O5'  DA I 112     136.809 168.128 154.264  1.00 83.50           O  
ATOM   4079  C5'  DA I 112     137.660 167.300 153.521  1.00 83.50           C  
ATOM   4080  C4'  DA I 112     138.951 167.011 154.271  1.00 83.50           C  
ATOM   4081  O4'  DA I 112     139.253 168.117 155.166  1.00 83.50           O  
ATOM   4082  C3'  DA I 112     138.933 165.780 155.160  1.00 83.50           C  
ATOM   4083  O3'  DA I 112     140.232 165.205 155.238  1.00 83.50           O  
ATOM   4084  C2'  DA I 112     138.472 166.346 156.488  1.00 83.50           C  
ATOM   4085  C1'  DA I 112     139.182 167.684 156.518  1.00 83.50           C  
ATOM   4086  N9   DA I 112     138.511 168.729 157.291  1.00 83.50           N  
ATOM   4087  C8   DA I 112     137.519 169.547 156.849  1.00 83.50           C  
ATOM   4088  N7   DA I 112     137.114 170.420 157.731  1.00 83.50           N  
ATOM   4089  C5   DA I 112     137.900 170.169 158.830  1.00 83.50           C  
ATOM   4090  C6   DA I 112     137.954 170.767 160.091  1.00 83.50           C  
ATOM   4091  N6   DA I 112     137.162 171.778 160.443  1.00 83.50           N  
ATOM   4092  N1   DA I 112     138.852 170.291 160.975  1.00 83.50           N  
ATOM   4093  C2   DA I 112     139.646 169.280 160.599  1.00 83.50           C  
ATOM   4094  N3   DA I 112     139.686 168.634 159.431  1.00 83.50           N  
ATOM   4095  C4   DA I 112     138.783 169.139 158.580  1.00 83.50           C  
ATOM   4096  H5'  DA I 112     137.872 167.738 152.687  1.00 83.50           H  
ATOM   4097 H5''  DA I 112     137.205 166.468 153.336  1.00 83.50           H  
ATOM   4098  H4'  DA I 112     139.670 166.922 153.630  1.00 83.50           H  
ATOM   4099  H3'  DA I 112     138.296 165.132 154.830  1.00 83.50           H  
ATOM   4100  H2'  DA I 112     137.512 166.464 156.497  1.00 83.50           H  
ATOM   4101 H2''  DA I 112     138.764 165.785 157.218  1.00 83.50           H  
ATOM   4102  H1'  DA I 112     140.080 167.561 156.860  1.00 83.50           H  
ATOM   4103  H8   DA I 112     137.157 169.488 155.999  1.00 83.50           H  
ATOM   4104  H61  DA I 112     137.080 171.993 161.270  1.00 83.50           H  
ATOM   4105  H62  DA I 112     136.739 172.222 159.839  1.00 83.50           H  
ATOM   4106  H2   DA I 112     140.249 168.984 161.241  1.00 83.50           H  
ATOM   4107  P    DC I 113     140.428 163.697 155.749  1.00 87.57           P  
ATOM   4108  OP1  DC I 113     141.834 163.323 155.480  1.00 87.57           O  
ATOM   4109  OP2  DC I 113     139.329 162.877 155.197  1.00 87.57           O  
ATOM   4110  O5'  DC I 113     140.225 163.795 157.330  1.00 87.57           O  
ATOM   4111  C5'  DC I 113     141.273 164.290 158.149  1.00 87.57           C  
ATOM   4112  C4'  DC I 113     140.913 164.193 159.619  1.00 87.57           C  
ATOM   4113  O4'  DC I 113     140.152 165.375 160.020  1.00 87.57           O  
ATOM   4114  C3'  DC I 113     140.041 162.994 159.990  1.00 87.57           C  
ATOM   4115  O3'  DC I 113     140.487 162.408 161.194  1.00 87.57           O  
ATOM   4116  C2'  DC I 113     138.660 163.618 160.127  1.00 87.57           C  
ATOM   4117  C1'  DC I 113     139.022 164.955 160.750  1.00 87.57           C  
ATOM   4118  N1   DC I 113     137.936 166.051 160.703  1.00 87.57           N  
ATOM   4119  C2   DC I 113     137.703 166.856 161.833  1.00 87.57           C  
ATOM   4120  O2   DC I 113     138.359 166.658 162.859  1.00 87.57           O  
ATOM   4121  N3   DC I 113     136.747 167.814 161.772  1.00 87.57           N  
ATOM   4122  C4   DC I 113     136.056 167.994 160.652  1.00 87.57           C  
ATOM   4123  N4   DC I 113     135.127 168.950 160.631  1.00 87.57           N  
ATOM   4124  C5   DC I 113     136.277 167.199 159.500  1.00 87.57           C  
ATOM   4125  C6   DC I 113     137.220 166.258 159.565  1.00 87.57           C  
ATOM   4126  H5'  DC I 113     141.441 165.216 157.924  1.00 87.57           H  
ATOM   4127 H5''  DC I 113     142.074 163.772 157.986  1.00 87.57           H  
ATOM   4128  H4'  DC I 113     141.729 164.155 160.138  1.00 87.57           H  
ATOM   4129  H3'  DC I 113     140.048 162.339 159.279  1.00 87.57           H  
ATOM   4130  H2'  DC I 113     138.250 163.729 159.257  1.00 87.57           H  
ATOM   4131 H2''  DC I 113     138.100 163.096 160.716  1.00 87.57           H  
ATOM   4132  H1'  DC I 113     139.284 164.803 161.667  1.00 87.57           H  
ATOM   4133  H41  DC I 113     134.639 169.059 159.932  1.00 87.57           H  
ATOM   4134  H42  DC I 113     135.014 169.454 161.316  1.00 87.57           H  
ATOM   4135  H5   DC I 113     135.790 167.338 158.723  1.00 87.57           H  
ATOM   4136  H6   DC I 113     137.382 165.726 158.825  1.00 87.57           H  
ATOM   4137  P    DA I 114     140.345 160.826 161.417  1.00 92.24           P  
ATOM   4138  OP1  DA I 114     141.668 160.226 161.145  1.00 92.24           O  
ATOM   4139  OP2  DA I 114     139.164 160.371 160.652  1.00 92.24           O  
ATOM   4140  O5'  DA I 114     140.014 160.689 162.976  1.00 92.24           O  
ATOM   4141  C5'  DA I 114     140.956 161.136 163.940  1.00 92.24           C  
ATOM   4142  C4'  DA I 114     140.262 161.659 165.181  1.00 92.24           C  
ATOM   4143  O4'  DA I 114     139.561 162.878 164.848  1.00 92.24           O  
ATOM   4144  C3'  DA I 114     139.230 160.707 165.788  1.00 92.24           C  
ATOM   4145  O3'  DA I 114     139.594 160.354 167.116  1.00 92.24           O  
ATOM   4146  C2'  DA I 114     137.907 161.472 165.734  1.00 92.24           C  
ATOM   4147  C1'  DA I 114     138.320 162.915 165.504  1.00 92.24           C  
ATOM   4148  N9   DA I 114     137.384 163.661 164.673  1.00 92.24           N  
ATOM   4149  C8   DA I 114     137.138 163.467 163.347  1.00 92.24           C  
ATOM   4150  N7   DA I 114     136.245 164.279 162.850  1.00 92.24           N  
ATOM   4151  C5   DA I 114     135.883 165.063 163.923  1.00 92.24           C  
ATOM   4152  C6   DA I 114     134.976 166.121 164.045  1.00 92.24           C  
ATOM   4153  N6   DA I 114     134.247 166.575 163.026  1.00 92.24           N  
ATOM   4154  N1   DA I 114     134.842 166.693 165.255  1.00 92.24           N  
ATOM   4155  C2   DA I 114     135.580 166.230 166.269  1.00 92.24           C  
ATOM   4156  N3   DA I 114     136.469 165.241 166.272  1.00 92.24           N  
ATOM   4157  C4   DA I 114     136.575 164.698 165.055  1.00 92.24           C  
ATOM   4158  H5'  DA I 114     141.492 161.844 163.553  1.00 92.24           H  
ATOM   4159 H5''  DA I 114     141.532 160.398 164.186  1.00 92.24           H  
ATOM   4160  H4'  DA I 114     140.932 161.859 165.851  1.00 92.24           H  
ATOM   4161  H3'  DA I 114     139.167 159.908 165.244  1.00 92.24           H  
ATOM   4162  H2'  DA I 114     137.363 161.154 165.000  1.00 92.24           H  
ATOM   4163 H2''  DA I 114     137.431 161.388 166.572  1.00 92.24           H  
ATOM   4164  H1'  DA I 114     138.421 163.361 166.357  1.00 92.24           H  
ATOM   4165  H8   DA I 114     137.565 162.815 162.843  1.00 92.24           H  
ATOM   4166  H61  DA I 114     133.623 167.148 163.165  1.00 92.24           H  
ATOM   4167  H62  DA I 114     134.408 166.299 162.227  1.00 92.24           H  
ATOM   4168  H2   DA I 114     135.455 166.656 167.083  1.00 92.24           H  
ATOM   4169  P    DC I 115     138.792 159.203 167.900  1.00 95.18           P  
ATOM   4170  OP1  DC I 115     139.687 158.666 168.947  1.00 95.18           O  
ATOM   4171  OP2  DC I 115     138.198 158.292 166.898  1.00 95.18           O  
ATOM   4172  O5'  DC I 115     137.597 159.989 168.609  1.00 95.18           O  
ATOM   4173  C5'  DC I 115     137.884 161.102 169.440  1.00 95.18           C  
ATOM   4174  C4'  DC I 115     136.621 161.871 169.787  1.00 95.18           C  
ATOM   4175  O4'  DC I 115     136.141 162.570 168.612  1.00 95.18           O  
ATOM   4176  C3'  DC I 115     135.444 161.008 170.269  1.00 95.18           C  
ATOM   4177  O3'  DC I 115     135.126 161.298 171.629  1.00 95.18           O  
ATOM   4178  C2'  DC I 115     134.297 161.363 169.314  1.00 95.18           C  
ATOM   4179  C1'  DC I 115     134.749 162.679 168.713  1.00 95.18           C  
ATOM   4180  N1   DC I 115     134.169 162.968 167.352  1.00 95.18           N  
ATOM   4181  C2   DC I 115     133.203 163.975 167.192  1.00 95.18           C  
ATOM   4182  O2   DC I 115     132.840 164.627 168.176  1.00 95.18           O  
ATOM   4183  N3   DC I 115     132.699 164.207 165.960  1.00 95.18           N  
ATOM   4184  C4   DC I 115     133.113 163.481 164.927  1.00 95.18           C  
ATOM   4185  N4   DC I 115     132.591 163.745 163.726  1.00 95.18           N  
ATOM   4186  C5   DC I 115     134.087 162.457 165.071  1.00 95.18           C  
ATOM   4187  C6   DC I 115     134.584 162.240 166.285  1.00 95.18           C  
ATOM   4188  H5'  DC I 115     138.497 161.693 168.976  1.00 95.18           H  
ATOM   4189 H5''  DC I 115     138.301 160.790 170.257  1.00 95.18           H  
ATOM   4190  H4'  DC I 115     136.831 162.522 170.475  1.00 95.18           H  
ATOM   4191  H3'  DC I 115     135.667 160.069 170.178  1.00 95.18           H  
ATOM   4192  H2'  DC I 115     134.204 160.686 168.627  1.00 95.18           H  
ATOM   4193 H2''  DC I 115     133.467 161.478 169.801  1.00 95.18           H  
ATOM   4194  H1'  DC I 115     134.534 163.397 169.323  1.00 95.18           H  
ATOM   4195  H41  DC I 115     132.898 163.350 163.028  1.00 95.18           H  
ATOM   4196  H42  DC I 115     131.946 164.309 163.653  1.00 95.18           H  
ATOM   4197  H5   DC I 115     134.373 161.961 164.342  1.00 95.18           H  
ATOM   4198  H6   DC I 115     135.217 161.575 166.406  1.00 95.18           H  
ATOM   4199  P    DT I 116     134.009 160.439 172.403  1.00 94.78           P  
ATOM   4200  OP1  DT I 116     134.400 160.378 173.827  1.00 94.78           O  
ATOM   4201  OP2  DT I 116     133.786 159.188 171.646  1.00 94.78           O  
ATOM   4202  O5'  DT I 116     132.692 161.332 172.274  1.00 94.78           O  
ATOM   4203  C5'  DT I 116     132.714 162.659 172.740  1.00 94.78           C  
ATOM   4204  C4'  DT I 116     131.420 163.372 172.432  1.00 94.78           C  
ATOM   4205  O4'  DT I 116     131.267 163.500 170.996  1.00 94.78           O  
ATOM   4206  C3'  DT I 116     130.164 162.665 172.930  1.00 94.78           C  
ATOM   4207  O3'  DT I 116     129.324 163.596 173.602  1.00 94.78           O  
ATOM   4208  C2'  DT I 116     129.535 162.111 171.655  1.00 94.78           C  
ATOM   4209  C1'  DT I 116     129.953 163.146 170.634  1.00 94.78           C  
ATOM   4210  N1   DT I 116     129.968 162.686 169.184  1.00 94.78           N  
ATOM   4211  C2   DT I 116     129.225 163.370 168.241  1.00 94.78           C  
ATOM   4212  O2   DT I 116     128.508 164.320 168.504  1.00 94.78           O  
ATOM   4213  N3   DT I 116     129.341 162.892 166.965  1.00 94.78           N  
ATOM   4214  C4   DT I 116     130.111 161.836 166.536  1.00 94.78           C  
ATOM   4215  O4   DT I 116     130.146 161.485 165.362  1.00 94.78           O  
ATOM   4216  C5   DT I 116     130.873 161.175 167.558  1.00 94.78           C  
ATOM   4217  C7   DT I 116     131.742 160.014 167.202  1.00 94.78           C  
ATOM   4218  C6   DT I 116     130.775 161.627 168.817  1.00 94.78           C  
ATOM   4219  H5'  DT I 116     133.445 163.131 172.316  1.00 94.78           H  
ATOM   4220 H5''  DT I 116     132.852 162.655 173.697  1.00 94.78           H  
ATOM   4221  H4'  DT I 116     131.452 164.256 172.822  1.00 94.78           H  
ATOM   4222  H3'  DT I 116     130.407 161.941 173.524  1.00 94.78           H  
ATOM   4223  H2'  DT I 116     129.903 161.241 171.443  1.00 94.78           H  
ATOM   4224 H2''  DT I 116     128.570 162.073 171.734  1.00 94.78           H  
ATOM   4225  H1'  DT I 116     129.383 163.923 170.725  1.00 94.78           H  
ATOM   4226  H3   DT I 116     128.882 163.297 166.363  1.00 94.78           H  
ATOM   4227  H71  DT I 116     131.348 159.534 166.458  1.00 94.78           H  
ATOM   4228  H72  DT I 116     132.620 160.333 166.952  1.00 94.78           H  
ATOM   4229  H73  DT I 116     131.817 159.421 167.965  1.00 94.78           H  
ATOM   4230  H6   DT I 116     131.267 161.199 169.478  1.00 94.78           H  
ATOM   4231  P    DT I 117     128.006 163.105 174.375  1.00 97.61           P  
ATOM   4232  OP1  DT I 117     127.825 163.987 175.550  1.00 97.61           O  
ATOM   4233  OP2  DT I 117     128.094 161.639 174.553  1.00 97.61           O  
ATOM   4234  O5'  DT I 117     126.834 163.412 173.339  1.00 97.61           O  
ATOM   4235  C5'  DT I 117     126.608 164.742 172.916  1.00 97.61           C  
ATOM   4236  C4'  DT I 117     125.331 164.840 172.110  1.00 97.61           C  
ATOM   4237  O4'  DT I 117     125.592 164.443 170.730  1.00 97.61           O  
ATOM   4238  C3'  DT I 117     124.202 163.933 172.598  1.00 97.61           C  
ATOM   4239  O3'  DT I 117     122.942 164.596 172.502  1.00 97.61           O  
ATOM   4240  C2'  DT I 117     124.314 162.738 171.661  1.00 97.61           C  
ATOM   4241  C1'  DT I 117     124.682 163.430 170.355  1.00 97.61           C  
ATOM   4242  N1   DT I 117     125.320 162.562 169.267  1.00 97.61           N  
ATOM   4243  C2   DT I 117     124.992 162.802 167.949  1.00 97.61           C  
ATOM   4244  O2   DT I 117     124.203 163.662 167.601  1.00 97.61           O  
ATOM   4245  N3   DT I 117     125.622 161.988 167.042  1.00 97.61           N  
ATOM   4246  C4   DT I 117     126.531 160.987 167.309  1.00 97.61           C  
ATOM   4247  O4   DT I 117     127.044 160.308 166.425  1.00 97.61           O  
ATOM   4248  C5   DT I 117     126.837 160.790 168.695  1.00 97.61           C  
ATOM   4249  C7   DT I 117     127.816 159.733 169.092  1.00 97.61           C  
ATOM   4250  C6   DT I 117     126.237 161.581 169.599  1.00 97.61           C  
ATOM   4251  H5'  DT I 117     127.353 165.033 172.370  1.00 97.61           H  
ATOM   4252 H5''  DT I 117     126.539 165.315 173.694  1.00 97.61           H  
ATOM   4253  H4'  DT I 117     125.023 165.758 172.121  1.00 97.61           H  
ATOM   4254  H3'  DT I 117     124.366 163.659 173.513  1.00 97.61           H  
ATOM   4255  H2'  DT I 117     125.013 162.142 171.960  1.00 97.61           H  
ATOM   4256 H2''  DT I 117     123.468 162.278 171.585  1.00 97.61           H  
ATOM   4257  H1'  DT I 117     123.886 163.843 169.997  1.00 97.61           H  
ATOM   4258  H3   DT I 117     125.429 162.118 166.216  1.00 97.61           H  
ATOM   4259  H71  DT I 117     128.239 159.981 169.927  1.00 97.61           H  
ATOM   4260  H72  DT I 117     127.354 158.889 169.200  1.00 97.61           H  
ATOM   4261  H73  DT I 117     128.492 159.647 168.401  1.00 97.61           H  
ATOM   4262  H6   DT I 117     126.432 161.450 170.496  1.00 97.61           H  
ATOM   4263  P    DT I 118     121.675 164.065 173.336  1.00 97.35           P  
ATOM   4264  OP1  DT I 118     121.178 165.191 174.154  1.00 97.35           O  
ATOM   4265  OP2  DT I 118     122.061 162.804 174.002  1.00 97.35           O  
ATOM   4266  O5'  DT I 118     120.601 163.705 172.206  1.00 97.35           O  
ATOM   4267  C5'  DT I 118     119.829 164.733 171.605  1.00 97.35           C  
ATOM   4268  C4'  DT I 118     120.012 164.759 170.091  1.00 97.35           C  
ATOM   4269  O4'  DT I 118     121.089 163.861 169.704  1.00 97.35           O  
ATOM   4270  C3'  DT I 118     118.798 164.325 169.248  1.00 97.35           C  
ATOM   4271  O3'  DT I 118     118.478 165.343 168.312  1.00 97.35           O  
ATOM   4272  C2'  DT I 118     119.272 163.043 168.559  1.00 97.35           C  
ATOM   4273  C1'  DT I 118     120.753 163.295 168.461  1.00 97.35           C  
ATOM   4274  N1   DT I 118     121.604 162.092 168.212  1.00 97.35           N  
ATOM   4275  C2   DT I 118     121.902 161.736 166.920  1.00 97.35           C  
ATOM   4276  O2   DT I 118     121.477 162.332 165.949  1.00 97.35           O  
ATOM   4277  N3   DT I 118     122.716 160.642 166.801  1.00 97.35           N  
ATOM   4278  C4   DT I 118     123.257 159.893 167.825  1.00 97.35           C  
ATOM   4279  O4   DT I 118     123.979 158.924 167.621  1.00 97.35           O  
ATOM   4280  C5   DT I 118     122.913 160.331 169.151  1.00 97.35           C  
ATOM   4281  C7   DT I 118     123.434 159.596 170.344  1.00 97.35           C  
ATOM   4282  C6   DT I 118     122.117 161.398 169.278  1.00 97.35           C  
ATOM   4283  H5'  DT I 118     120.107 165.587 171.968  1.00 97.35           H  
ATOM   4284 H5''  DT I 118     118.896 164.592 171.817  1.00 97.35           H  
ATOM   4285  H4'  DT I 118     120.255 165.660 169.831  1.00 97.35           H  
ATOM   4286  H3'  DT I 118     118.038 164.138 169.814  1.00 97.35           H  
ATOM   4287  H2'  DT I 118     119.087 162.265 169.103  1.00 97.35           H  
ATOM   4288 H2''  DT I 118     118.881 162.959 167.682  1.00 97.35           H  
ATOM   4289  H1'  DT I 118     120.916 163.946 167.765  1.00 97.35           H  
ATOM   4290  H3   DT I 118     122.912 160.396 166.004  1.00 97.35           H  
ATOM   4291  H71  DT I 118     123.758 158.725 170.071  1.00 97.35           H  
ATOM   4292  H72  DT I 118     124.158 160.098 170.742  1.00 97.35           H  
ATOM   4293  H73  DT I 118     122.722 159.488 170.992  1.00 97.35           H  
ATOM   4294  H6   DT I 118     121.896 161.681 170.131  1.00 97.35           H  
ATOM   4295  P    DT I 119     116.953 165.725 167.989  1.00 92.45           P  
ATOM   4296  OP1  DT I 119     116.769 167.076 168.546  1.00 92.45           O  
ATOM   4297  OP2  DT I 119     116.068 164.628 168.430  1.00 92.45           O  
ATOM   4298  O5'  DT I 119     116.886 165.856 166.388  1.00 92.45           O  
ATOM   4299  C5'  DT I 119     117.799 165.145 165.547  1.00 92.45           C  
ATOM   4300  C4'  DT I 119     117.090 164.359 164.459  1.00 92.45           C  
ATOM   4301  O4'  DT I 119     117.666 163.018 164.418  1.00 92.45           O  
ATOM   4302  C3'  DT I 119     115.603 164.117 164.658  1.00 92.45           C  
ATOM   4303  O3'  DT I 119     114.979 163.813 163.433  1.00 92.45           O  
ATOM   4304  C2'  DT I 119     115.639 162.921 165.576  1.00 92.45           C  
ATOM   4305  C1'  DT I 119     116.698 162.082 164.868  1.00 92.45           C  
ATOM   4306  N1   DT I 119     117.391 160.987 165.688  1.00 92.45           N  
ATOM   4307  C2   DT I 119     118.211 160.109 165.026  1.00 92.45           C  
ATOM   4308  O2   DT I 119     118.415 160.166 163.829  1.00 92.45           O  
ATOM   4309  N3   DT I 119     118.794 159.158 165.812  1.00 92.45           N  
ATOM   4310  C4   DT I 119     118.644 158.990 167.167  1.00 92.45           C  
ATOM   4311  O4   DT I 119     119.214 158.097 167.782  1.00 92.45           O  
ATOM   4312  C5   DT I 119     117.768 159.934 167.808  1.00 92.45           C  
ATOM   4313  C7   DT I 119     117.525 159.851 169.284  1.00 92.45           C  
ATOM   4314  C6   DT I 119     117.183 160.868 167.050  1.00 92.45           C  
ATOM   4315  H5'  DT I 119     118.311 164.528 166.080  1.00 92.45           H  
ATOM   4316 H5''  DT I 119     118.401 165.779 165.132  1.00 92.45           H  
ATOM   4317  H4'  DT I 119     117.231 164.794 163.607  1.00 92.45           H  
ATOM   4318  H3'  DT I 119     115.175 164.870 165.082  1.00 92.45           H  
ATOM   4319  H2'  DT I 119     115.920 163.188 166.457  1.00 92.45           H  
ATOM   4320 H2''  DT I 119     114.785 162.466 165.595  1.00 92.45           H  
ATOM   4321  H1'  DT I 119     116.294 161.674 164.097  1.00 92.45           H  
ATOM   4322  H3   DT I 119     119.312 158.601 165.415  1.00 92.45           H  
ATOM   4323  H71  DT I 119     117.376 160.743 169.636  1.00 92.45           H  
ATOM   4324  H72  DT I 119     116.743 159.302 169.452  1.00 92.45           H  
ATOM   4325  H73  DT I 119     118.297 159.456 169.717  1.00 92.45           H  
ATOM   4326  H6   DT I 119     116.627 161.479 167.467  1.00 92.45           H  
ATOM   4327  P    DG I 120     114.423 164.972 162.474  1.00 87.24           P  
ATOM   4328  OP1  DG I 120     115.269 166.166 162.683  1.00 87.24           O  
ATOM   4329  OP2  DG I 120     112.959 165.060 162.665  1.00 87.24           O  
ATOM   4330  O5'  DG I 120     114.691 164.397 161.006  1.00 87.24           O  
ATOM   4331  C5'  DG I 120     116.000 164.438 160.476  1.00 87.24           C  
ATOM   4332  C4'  DG I 120     116.183 163.470 159.317  1.00 87.24           C  
ATOM   4333  O4'  DG I 120     116.343 162.116 159.800  1.00 87.24           O  
ATOM   4334  C3'  DG I 120     115.047 163.386 158.337  1.00 87.24           C  
ATOM   4335  O3'  DG I 120     115.587 163.021 157.095  1.00 87.24           O  
ATOM   4336  C2'  DG I 120     114.132 162.324 158.965  1.00 87.24           C  
ATOM   4337  C1'  DG I 120     115.135 161.377 159.644  1.00 87.24           C  
ATOM   4338  N9   DG I 120     114.805 160.871 160.983  1.00 87.24           N  
ATOM   4339  C8   DG I 120     114.034 161.461 161.955  1.00 87.24           C  
ATOM   4340  N7   DG I 120     114.009 160.793 163.075  1.00 87.24           N  
ATOM   4341  C5   DG I 120     114.834 159.705 162.838  1.00 87.24           C  
ATOM   4342  C6   DG I 120     115.201 158.638 163.687  1.00 87.24           C  
ATOM   4343  O6   DG I 120     114.847 158.429 164.853  1.00 87.24           O  
ATOM   4344  N1   DG I 120     116.067 157.751 163.056  1.00 87.24           N  
ATOM   4345  C2   DG I 120     116.524 157.887 161.767  1.00 87.24           C  
ATOM   4346  N2   DG I 120     117.355 156.935 161.319  1.00 87.24           N  
ATOM   4347  N3   DG I 120     116.189 158.884 160.968  1.00 87.24           N  
ATOM   4348  C4   DG I 120     115.351 159.754 161.569  1.00 87.24           C  
ATOM   4349  H5'  DG I 120     116.628 164.212 161.176  1.00 87.24           H  
ATOM   4350 H5''  DG I 120     116.183 165.336 160.165  1.00 87.24           H  
ATOM   4351  H4'  DG I 120     116.982 163.719 158.832  1.00 87.24           H  
ATOM   4352  H3'  DG I 120     114.591 164.235 158.274  1.00 87.24           H  
ATOM   4353  H2'  DG I 120     113.537 162.732 159.606  1.00 87.24           H  
ATOM   4354 H2''  DG I 120     113.631 161.856 158.286  1.00 87.24           H  
ATOM   4355  H1'  DG I 120     115.301 160.626 159.058  1.00 87.24           H  
ATOM   4356  H8   DG I 120     113.563 162.252 161.821  1.00 87.24           H  
ATOM   4357  H1   DG I 120     116.336 157.070 163.505  1.00 87.24           H  
ATOM   4358  H21  DG I 120     117.690 156.996 160.528  1.00 87.24           H  
ATOM   4359  H22  DG I 120     117.551 156.264 161.819  1.00 87.24           H  
ATOM   4360  P    DG I 121     114.676 162.722 155.818  1.00 81.60           P  
ATOM   4361  OP1  DG I 121     115.364 163.435 154.728  1.00 81.60           O  
ATOM   4362  OP2  DG I 121     113.254 162.994 156.122  1.00 81.60           O  
ATOM   4363  O5'  DG I 121     114.880 161.155 155.610  1.00 81.60           O  
ATOM   4364  C5'  DG I 121     116.121 160.576 155.981  1.00 81.60           C  
ATOM   4365  C4'  DG I 121     116.195 159.105 155.609  1.00 81.60           C  
ATOM   4366  O4'  DG I 121     115.898 158.295 156.775  1.00 81.60           O  
ATOM   4367  C3'  DG I 121     115.218 158.643 154.549  1.00 81.60           C  
ATOM   4368  O3'  DG I 121     115.765 157.553 153.844  1.00 81.60           O  
ATOM   4369  C2'  DG I 121     113.990 158.276 155.373  1.00 81.60           C  
ATOM   4370  C1'  DG I 121     114.611 157.707 156.658  1.00 81.60           C  
ATOM   4371  N9   DG I 121     113.879 157.971 157.916  1.00 81.60           N  
ATOM   4372  C8   DG I 121     113.061 159.036 158.214  1.00 81.60           C  
ATOM   4373  N7   DG I 121     112.583 159.004 159.423  1.00 81.60           N  
ATOM   4374  C5   DG I 121     113.126 157.859 159.972  1.00 81.60           C  
ATOM   4375  C6   DG I 121     112.969 157.316 161.258  1.00 81.60           C  
ATOM   4376  O6   DG I 121     112.290 157.753 162.195  1.00 81.60           O  
ATOM   4377  N1   DG I 121     113.691 156.147 161.413  1.00 81.60           N  
ATOM   4378  C2   DG I 121     114.471 155.576 160.445  1.00 81.60           C  
ATOM   4379  N2   DG I 121     115.094 154.441 160.772  1.00 81.60           N  
ATOM   4380  N3   DG I 121     114.630 156.077 159.234  1.00 81.60           N  
ATOM   4381  C4   DG I 121     113.932 157.217 159.068  1.00 81.60           C  
ATOM   4382  H5'  DG I 121     116.234 160.663 156.936  1.00 81.60           H  
ATOM   4383 H5''  DG I 121     116.837 161.054 155.537  1.00 81.60           H  
ATOM   4384  H4'  DG I 121     117.094 158.902 155.312  1.00 81.60           H  
ATOM   4385  H3'  DG I 121     115.012 159.365 153.941  1.00 81.60           H  
ATOM   4386  H2'  DG I 121     113.461 159.064 155.548  1.00 81.60           H  
ATOM   4387 H2''  DG I 121     113.464 157.603 154.923  1.00 81.60           H  
ATOM   4388  H1'  DG I 121     114.715 156.750 156.552  1.00 81.60           H  
ATOM   4389  H8   DG I 121     112.856 159.706 157.603  1.00 81.60           H  
ATOM   4390  H1   DG I 121     113.647 155.751 162.169  1.00 81.60           H  
ATOM   4391  H21  DG I 121     115.450 153.960 160.162  1.00 81.60           H  
ATOM   4392  H22  DG I 121     115.120 154.186 161.589  1.00 81.60           H  
ATOM   4393  P    DT I 122     114.991 156.889 152.608  1.00 87.72           P  
ATOM   4394  OP1  DT I 122     115.919 156.870 151.456  1.00 87.72           O  
ATOM   4395  OP2  DT I 122     113.677 157.550 152.469  1.00 87.72           O  
ATOM   4396  O5'  DT I 122     114.760 155.389 153.099  1.00 87.72           O  
ATOM   4397  C5'  DT I 122     115.839 154.669 153.667  1.00 87.72           C  
ATOM   4398  C4'  DT I 122     115.347 153.469 154.432  1.00 87.72           C  
ATOM   4399  O4'  DT I 122     114.654 153.911 155.637  1.00 87.72           O  
ATOM   4400  C3'  DT I 122     114.346 152.598 153.684  1.00 87.72           C  
ATOM   4401  O3'  DT I 122     114.537 151.231 154.021  1.00 87.72           O  
ATOM   4402  C2'  DT I 122     113.028 153.140 154.192  1.00 87.72           C  
ATOM   4403  C1'  DT I 122     113.372 153.325 155.658  1.00 87.72           C  
ATOM   4404  N1   DT I 122     112.426 154.197 156.476  1.00 87.72           N  
ATOM   4405  C2   DT I 122     112.088 153.805 157.751  1.00 87.72           C  
ATOM   4406  O2   DT I 122     112.479 152.774 158.263  1.00 87.72           O  
ATOM   4407  N3   DT I 122     111.246 154.652 158.407  1.00 87.72           N  
ATOM   4408  C4   DT I 122     110.725 155.834 157.942  1.00 87.72           C  
ATOM   4409  O4   DT I 122     109.973 156.530 158.614  1.00 87.72           O  
ATOM   4410  C5   DT I 122     111.124 156.199 156.614  1.00 87.72           C  
ATOM   4411  C7   DT I 122     110.616 157.464 156.006  1.00 87.72           C  
ATOM   4412  C6   DT I 122     111.949 155.378 155.952  1.00 87.72           C  
ATOM   4413  H5'  DT I 122     116.329 155.245 154.269  1.00 87.72           H  
ATOM   4414 H5''  DT I 122     116.429 154.373 152.960  1.00 87.72           H  
ATOM   4415  H4'  DT I 122     116.106 152.927 154.688  1.00 87.72           H  
ATOM   4416  H3'  DT I 122     114.425 152.734 152.729  1.00 87.72           H  
ATOM   4417  H2'  DT I 122     112.819 153.979 153.764  1.00 87.72           H  
ATOM   4418 H2''  DT I 122     112.319 152.499 154.073  1.00 87.72           H  
ATOM   4419  H1'  DT I 122     113.436 152.454 156.069  1.00 87.72           H  
ATOM   4420  H3   DT I 122     111.014 154.419 159.196  1.00 87.72           H  
ATOM   4421  H71  DT I 122     109.735 157.660 156.361  1.00 87.72           H  
ATOM   4422  H72  DT I 122     111.218 158.191 156.218  1.00 87.72           H  
ATOM   4423  H73  DT I 122     110.559 157.359 155.045  1.00 87.72           H  
ATOM   4424  H6   DT I 122     112.206 155.613 155.094  1.00 87.72           H  
ATOM   4425  P    DA I 123     114.254 150.066 152.954  1.00 93.49           P  
ATOM   4426  OP1  DA I 123     115.534 149.746 152.284  1.00 93.49           O  
ATOM   4427  OP2  DA I 123     113.082 150.469 152.147  1.00 93.49           O  
ATOM   4428  O5'  DA I 123     113.823 148.822 153.866  1.00 93.49           O  
ATOM   4429  C5'  DA I 123     114.672 148.382 154.929  1.00 93.49           C  
ATOM   4430  C4'  DA I 123     113.899 147.553 155.942  1.00 93.49           C  
ATOM   4431  O4'  DA I 123     113.187 148.444 156.842  1.00 93.49           O  
ATOM   4432  C3'  DA I 123     112.844 146.638 155.336  1.00 93.49           C  
ATOM   4433  O3'  DA I 123     112.697 145.434 156.072  1.00 93.49           O  
ATOM   4434  C2'  DA I 123     111.597 147.483 155.398  1.00 93.49           C  
ATOM   4435  C1'  DA I 123     111.794 148.272 156.691  1.00 93.49           C  
ATOM   4436  N9   DA I 123     111.151 149.588 156.695  1.00 93.49           N  
ATOM   4437  C8   DA I 123     111.263 150.557 155.742  1.00 93.49           C  
ATOM   4438  N7   DA I 123     110.578 151.638 155.998  1.00 93.49           N  
ATOM   4439  C5   DA I 123     109.971 151.366 157.204  1.00 93.49           C  
ATOM   4440  C6   DA I 123     109.123 152.129 158.015  1.00 93.49           C  
ATOM   4441  N6   DA I 123     108.722 153.356 157.687  1.00 93.49           N  
ATOM   4442  N1   DA I 123     108.688 151.576 159.167  1.00 93.49           N  
ATOM   4443  C2   DA I 123     109.101 150.340 159.477  1.00 93.49           C  
ATOM   4444  N3   DA I 123     109.910 149.528 158.792  1.00 93.49           N  
ATOM   4445  C4   DA I 123     110.316 150.110 157.656  1.00 93.49           C  
ATOM   4446  H5'  DA I 123     115.050 149.155 155.374  1.00 93.49           H  
ATOM   4447 H5''  DA I 123     115.389 147.846 154.560  1.00 93.49           H  
ATOM   4448  H4'  DA I 123     114.520 147.019 156.455  1.00 93.49           H  
ATOM   4449  H3'  DA I 123     113.067 146.442 154.415  1.00 93.49           H  
ATOM   4450  H2'  DA I 123     111.548 148.069 154.630  1.00 93.49           H  
ATOM   4451 H2''  DA I 123     110.817 146.923 155.454  1.00 93.49           H  
ATOM   4452  H1'  DA I 123     111.458 147.752 157.434  1.00 93.49           H  
ATOM   4453  H8   DA I 123     111.775 150.453 154.973  1.00 93.49           H  
ATOM   4454  H61  DA I 123     108.036 153.701 158.069  1.00 93.49           H  
ATOM   4455  H62  DA I 123     109.158 153.805 157.093  1.00 93.49           H  
ATOM   4456  H2   DA I 123     108.780 150.000 160.279  1.00 93.49           H  
ATOM   4457  P    DG I 124     111.848 144.217 155.451  1.00 95.69           P  
ATOM   4458  OP1  DG I 124     112.547 142.958 155.774  1.00 95.69           O  
ATOM   4459  OP2  DG I 124     111.531 144.534 154.043  1.00 95.69           O  
ATOM   4460  O5'  DG I 124     110.486 144.242 156.278  1.00 95.69           O  
ATOM   4461  C5'  DG I 124     110.435 143.614 157.541  1.00 95.69           C  
ATOM   4462  C4'  DG I 124     109.238 144.092 158.344  1.00 95.69           C  
ATOM   4463  O4'  DG I 124     109.129 145.542 158.238  1.00 95.69           O  
ATOM   4464  C3'  DG I 124     107.887 143.526 157.884  1.00 95.69           C  
ATOM   4465  O3'  DG I 124     107.198 142.892 158.968  1.00 95.69           O  
ATOM   4466  C2'  DG I 124     107.139 144.747 157.360  1.00 95.69           C  
ATOM   4467  C1'  DG I 124     107.771 145.886 158.128  1.00 95.69           C  
ATOM   4468  N9   DG I 124     107.636 147.180 157.462  1.00 95.69           N  
ATOM   4469  C8   DG I 124     108.205 147.558 156.276  1.00 95.69           C  
ATOM   4470  N7   DG I 124     107.897 148.770 155.913  1.00 95.69           N  
ATOM   4471  C5   DG I 124     107.061 149.221 156.919  1.00 95.69           C  
ATOM   4472  C6   DG I 124     106.411 150.464 157.068  1.00 95.69           C  
ATOM   4473  O6   DG I 124     106.453 151.444 156.315  1.00 95.69           O  
ATOM   4474  N1   DG I 124     105.655 150.515 158.233  1.00 95.69           N  
ATOM   4475  C2   DG I 124     105.543 149.489 159.141  1.00 95.69           C  
ATOM   4476  N2   DG I 124     104.765 149.714 160.207  1.00 95.69           N  
ATOM   4477  N3   DG I 124     106.144 148.314 159.007  1.00 95.69           N  
ATOM   4478  C4   DG I 124     106.885 148.253 157.878  1.00 95.69           C  
ATOM   4479  H5'  DG I 124     111.248 143.815 158.027  1.00 95.69           H  
ATOM   4480 H5''  DG I 124     110.370 142.655 157.414  1.00 95.69           H  
ATOM   4481  H4'  DG I 124     109.374 143.856 159.275  1.00 95.69           H  
ATOM   4482  H3'  DG I 124     108.024 142.891 157.164  1.00 95.69           H  
ATOM   4483  H2'  DG I 124     107.282 144.854 156.408  1.00 95.69           H  
ATOM   4484 H2''  DG I 124     106.204 144.683 157.561  1.00 95.69           H  
ATOM   4485  H1'  DG I 124     107.377 145.935 159.011  1.00 95.69           H  
ATOM   4486  H8   DG I 124     108.758 147.006 155.783  1.00 95.69           H  
ATOM   4487  H1   DG I 124     105.227 151.241 158.399  1.00 95.69           H  
ATOM   4488  H21  DG I 124     104.717 149.128 160.835  1.00 95.69           H  
ATOM   4489  H22  DG I 124     104.314 150.444 160.264  1.00 95.69           H  
ATOM   4490  P    DA I 125     105.792 142.151 158.718  1.00100.81           P  
ATOM   4491  OP1  DA I 125     105.758 140.953 159.584  1.00100.81           O  
ATOM   4492  OP2  DA I 125     105.617 142.003 157.257  1.00100.81           O  
ATOM   4493  O5'  DA I 125     104.702 143.204 159.242  1.00100.81           O  
ATOM   4494  C5'  DA I 125     104.696 143.585 160.612  1.00100.81           C  
ATOM   4495  C4'  DA I 125     103.592 144.589 160.917  1.00100.81           C  
ATOM   4496  O4'  DA I 125     103.838 145.822 160.183  1.00100.81           O  
ATOM   4497  C3'  DA I 125     102.173 144.150 160.537  1.00100.81           C  
ATOM   4498  O3'  DA I 125     101.243 144.527 161.569  1.00100.81           O  
ATOM   4499  C2'  DA I 125     101.927 144.883 159.221  1.00100.81           C  
ATOM   4500  C1'  DA I 125     102.693 146.176 159.431  1.00100.81           C  
ATOM   4501  N9   DA I 125     103.138 146.831 158.206  1.00100.81           N  
ATOM   4502  C8   DA I 125     103.964 146.313 157.257  1.00100.81           C  
ATOM   4503  N7   DA I 125     104.222 147.131 156.271  1.00100.81           N  
ATOM   4504  C5   DA I 125     103.522 148.273 156.600  1.00100.81           C  
ATOM   4505  C6   DA I 125     103.384 149.513 155.957  1.00100.81           C  
ATOM   4506  N6   DA I 125     103.977 149.806 154.798  1.00100.81           N  
ATOM   4507  N1   DA I 125     102.614 150.444 156.552  1.00100.81           N  
ATOM   4508  C2   DA I 125     102.031 150.149 157.719  1.00100.81           C  
ATOM   4509  N3   DA I 125     102.077 149.013 158.414  1.00100.81           N  
ATOM   4510  C4   DA I 125     102.849 148.109 157.793  1.00100.81           C  
ATOM   4511  H5'  DA I 125     105.552 143.983 160.831  1.00100.81           H  
ATOM   4512 H5''  DA I 125     104.565 142.796 161.158  1.00100.81           H  
ATOM   4513  H4'  DA I 125     103.611 144.785 161.866  1.00100.81           H  
ATOM   4514  H3'  DA I 125     102.147 143.191 160.396  1.00100.81           H  
ATOM   4515  H2'  DA I 125     102.292 144.383 158.475  1.00100.81           H  
ATOM   4516 H2''  DA I 125     100.984 145.058 159.093  1.00100.81           H  
ATOM   4517  H1'  DA I 125     102.148 146.791 159.944  1.00100.81           H  
ATOM   4518  H8   DA I 125     104.303 145.455 157.303  1.00100.81           H  
ATOM   4519  H61  DA I 125     103.866 150.581 154.443  1.00100.81           H  
ATOM   4520  H62  DA I 125     104.468 149.219 154.406  1.00100.81           H  
ATOM   4521  H2   DA I 125     101.503 150.820 158.084  1.00100.81           H  
ATOM   4522  P    DA I 126      99.718 144.014 161.556  1.00 97.22           P  
ATOM   4523  OP1  DA I 126      99.532 143.152 162.740  1.00 97.22           O  
ATOM   4524  OP2  DA I 126      99.402 143.491 160.211  1.00 97.22           O  
ATOM   4525  O5'  DA I 126      98.880 145.354 161.772  1.00 97.22           O  
ATOM   4526  C5'  DA I 126      99.428 146.569 161.322  1.00 97.22           C  
ATOM   4527  C4'  DA I 126      98.429 147.715 161.357  1.00 97.22           C  
ATOM   4528  O4'  DA I 126      98.754 148.646 160.289  1.00 97.22           O  
ATOM   4529  C3'  DA I 126      96.977 147.364 161.100  1.00 97.22           C  
ATOM   4530  O3'  DA I 126      96.127 148.395 161.643  1.00 97.22           O  
ATOM   4531  C2'  DA I 126      96.954 147.284 159.574  1.00 97.22           C  
ATOM   4532  C1'  DA I 126      97.885 148.431 159.178  1.00 97.22           C  
ATOM   4533  N9   DA I 126      98.706 148.192 157.983  1.00 97.22           N  
ATOM   4534  C8   DA I 126      99.443 147.080 157.678  1.00 97.22           C  
ATOM   4535  N7   DA I 126     100.093 147.168 156.545  1.00 97.22           N  
ATOM   4536  C5   DA I 126      99.773 148.427 156.080  1.00 97.22           C  
ATOM   4537  C6   DA I 126     100.156 149.139 154.929  1.00 97.22           C  
ATOM   4538  N6   DA I 126     100.973 148.643 153.998  1.00 97.22           N  
ATOM   4539  N1   DA I 126      99.665 150.386 154.770  1.00 97.22           N  
ATOM   4540  C2   DA I 126      98.855 150.879 155.710  1.00 97.22           C  
ATOM   4541  N3   DA I 126      98.426 150.306 156.831  1.00 97.22           N  
ATOM   4542  C4   DA I 126      98.932 149.075 156.960  1.00 97.22           C  
ATOM   4543  H5'  DA I 126      99.738 146.454 160.417  1.00 97.22           H  
ATOM   4544 H5''  DA I 126     100.181 146.796 161.885  1.00 97.22           H  
ATOM   4545  H4'  DA I 126      98.500 148.170 162.210  1.00 97.22           H  
ATOM   4546  H3'  DA I 126      96.759 146.505 161.489  1.00 97.22           H  
ATOM   4547  H2'  DA I 126      97.303 146.433 159.277  1.00 97.22           H  
ATOM   4548 H2''  DA I 126      96.064 147.431 159.225  1.00 97.22           H  
ATOM   4549  H1'  DA I 126      97.353 149.229 159.034  1.00 97.22           H  
ATOM   4550  H8   DA I 126      99.463 146.324 158.215  1.00 97.22           H  
ATOM   4551  H61  DA I 126     101.152 149.103 153.295  1.00 97.22           H  
ATOM   4552  H62  DA I 126     101.328 147.868 154.108  1.00 97.22           H  
ATOM   4553  H2   DA I 126      98.539 151.739 155.555  1.00 97.22           H  
ATOM   4554  P    DT I 127      94.552 148.453 161.326  1.00100.91           P  
ATOM   4555  OP1  DT I 127      93.907 149.218 162.414  1.00100.91           O  
ATOM   4556  OP2  DT I 127      94.098 147.080 161.017  1.00100.91           O  
ATOM   4557  O5'  DT I 127      94.477 149.313 159.980  1.00100.91           O  
ATOM   4558  C5'  DT I 127      93.260 149.933 159.590  1.00100.91           C  
ATOM   4559  C4'  DT I 127      93.531 151.151 158.730  1.00100.91           C  
ATOM   4560  O4'  DT I 127      94.713 150.912 157.905  1.00100.91           O  
ATOM   4561  C3'  DT I 127      92.426 151.510 157.742  1.00100.91           C  
ATOM   4562  O3'  DT I 127      92.380 152.928 157.542  1.00100.91           O  
ATOM   4563  C2'  DT I 127      92.870 150.760 156.501  1.00100.91           C  
ATOM   4564  C1'  DT I 127      94.358 151.022 156.537  1.00100.91           C  
ATOM   4565  N1   DT I 127      95.194 150.069 155.739  1.00100.91           N  
ATOM   4566  C2   DT I 127      95.764 150.486 154.555  1.00100.91           C  
ATOM   4567  O2   DT I 127      95.617 151.603 154.094  1.00100.91           O  
ATOM   4568  N3   DT I 127      96.523 149.539 153.925  1.00100.91           N  
ATOM   4569  C4   DT I 127      96.767 148.254 154.346  1.00100.91           C  
ATOM   4570  O4   DT I 127      97.461 147.473 153.707  1.00100.91           O  
ATOM   4571  C5   DT I 127      96.143 147.884 155.585  1.00100.91           C  
ATOM   4572  C7   DT I 127      96.341 146.511 156.135  1.00100.91           C  
ATOM   4573  C6   DT I 127      95.403 148.800 156.221  1.00100.91           C  
ATOM   4574  H5'  DT I 127      92.773 150.205 160.382  1.00100.91           H  
ATOM   4575 H5''  DT I 127      92.726 149.301 159.087  1.00100.91           H  
ATOM   4576  H4'  DT I 127      93.697 151.912 159.307  1.00100.91           H  
ATOM   4577  H3'  DT I 127      91.570 151.178 158.053  1.00100.91           H  
ATOM   4578  H2'  DT I 127      92.683 149.813 156.581  1.00100.91           H  
ATOM   4579 H2''  DT I 127      92.470 151.130 155.712  1.00100.91           H  
ATOM   4580  H1'  DT I 127      94.526 151.926 156.238  1.00100.91           H  
ATOM   4581  H3   DT I 127      96.887 149.772 153.185  1.00100.91           H  
ATOM   4582  H71  DT I 127      96.064 146.493 157.062  1.00100.91           H  
ATOM   4583  H72  DT I 127      95.810 145.879 155.626  1.00100.91           H  
ATOM   4584  H73  DT I 127      97.277 146.272 156.071  1.00100.91           H  
ATOM   4585  H6   DT I 127      95.002 148.562 157.023  1.00100.91           H  
ATOM   4586  P    DC I 128      91.192 153.619 156.707  1.00106.37           P  
ATOM   4587  OP1  DC I 128      90.412 154.438 157.659  1.00106.37           O  
ATOM   4588  OP2  DC I 128      90.509 152.590 155.897  1.00106.37           O  
ATOM   4589  O5'  DC I 128      91.955 154.605 155.704  1.00106.37           O  
ATOM   4590  C5'  DC I 128      93.056 154.127 154.943  1.00106.37           C  
ATOM   4591  C4'  DC I 128      93.015 154.628 153.509  1.00106.37           C  
ATOM   4592  O4'  DC I 128      93.666 153.649 152.650  1.00106.37           O  
ATOM   4593  C3'  DC I 128      91.637 154.768 152.900  1.00106.37           C  
ATOM   4594  O3'  DC I 128      91.689 155.561 151.727  1.00106.37           O  
ATOM   4595  C2'  DC I 128      91.336 153.327 152.583  1.00106.37           C  
ATOM   4596  C1'  DC I 128      92.671 152.914 151.941  1.00106.37           C  
ATOM   4597  N1   DC I 128      93.053 151.424 151.977  1.00106.37           N  
ATOM   4598  C2   DC I 128      93.893 150.913 150.976  1.00106.37           C  
ATOM   4599  O2   DC I 128      94.282 151.667 150.077  1.00106.37           O  
ATOM   4600  N3   DC I 128      94.249 149.606 151.018  1.00106.37           N  
ATOM   4601  C4   DC I 128      93.811 148.831 152.004  1.00106.37           C  
ATOM   4602  N4   DC I 128      94.182 147.552 152.010  1.00106.37           N  
ATOM   4603  C5   DC I 128      92.971 149.328 153.030  1.00106.37           C  
ATOM   4604  C6   DC I 128      92.627 150.614 152.983  1.00106.37           C  
ATOM   4605  H5'  DC I 128      93.037 153.162 154.935  1.00106.37           H  
ATOM   4606 H5''  DC I 128      93.880 154.423 155.359  1.00106.37           H  
ATOM   4607  H4'  DC I 128      93.483 155.475 153.447  1.00106.37           H  
ATOM   4608  H3'  DC I 128      91.002 155.125 153.536  1.00106.37           H  
ATOM   4609  H2'  DC I 128      91.146 152.836 153.392  1.00106.37           H  
ATOM   4610 H2''  DC I 128      90.613 153.266 151.956  1.00106.37           H  
ATOM   4611  H1'  DC I 128      92.665 153.210 151.019  1.00106.37           H  
ATOM   4612  H41  DC I 128      93.903 147.028 152.630  1.00106.37           H  
ATOM   4613  H42  DC I 128      94.698 147.253 151.394  1.00106.37           H  
ATOM   4614  H5   DC I 128      92.673 148.777 153.713  1.00106.37           H  
ATOM   4615  H6   DC I 128      92.079 150.959 153.643  1.00106.37           H  
ATOM   4616  P    DT I 129      90.927 156.968 151.646  1.00110.15           P  
ATOM   4617  OP1  DT I 129      91.834 157.989 152.213  1.00110.15           O  
ATOM   4618  OP2  DT I 129      89.572 156.785 152.207  1.00110.15           O  
ATOM   4619  O5'  DT I 129      90.787 157.220 150.073  1.00110.15           O  
ATOM   4620  C5'  DT I 129      91.952 157.267 149.255  1.00110.15           C  
ATOM   4621  C4'  DT I 129      91.752 156.493 147.960  1.00110.15           C  
ATOM   4622  O4'  DT I 129      92.010 155.067 148.178  1.00110.15           O  
ATOM   4623  C3'  DT I 129      90.339 156.567 147.369  1.00110.15           C  
ATOM   4624  O3'  DT I 129      90.395 156.738 145.965  1.00110.15           O  
ATOM   4625  C2'  DT I 129      89.747 155.209 147.750  1.00110.15           C  
ATOM   4626  C1'  DT I 129      90.973 154.325 147.568  1.00110.15           C  
ATOM   4627  N1   DT I 129      90.925 152.916 148.170  1.00110.15           N  
ATOM   4628  C2   DT I 129      91.696 151.929 147.592  1.00110.15           C  
ATOM   4629  O2   DT I 129      92.408 152.120 146.624  1.00110.15           O  
ATOM   4630  N3   DT I 129      91.605 150.701 148.192  1.00110.15           N  
ATOM   4631  C4   DT I 129      90.843 150.361 149.286  1.00110.15           C  
ATOM   4632  O4   DT I 129      90.828 149.227 149.752  1.00110.15           O  
ATOM   4633  C5   DT I 129      90.060 151.429 149.845  1.00110.15           C  
ATOM   4634  C7   DT I 129      89.187 151.163 151.037  1.00110.15           C  
ATOM   4635  C6   DT I 129      90.135 152.642 149.270  1.00110.15           C  
ATOM   4636  H5'  DT I 129      92.697 156.886 149.742  1.00110.15           H  
ATOM   4637 H5''  DT I 129      92.153 158.191 149.042  1.00110.15           H  
ATOM   4638  H4'  DT I 129      92.382 156.825 147.303  1.00110.15           H  
ATOM   4639  H3'  DT I 129      89.836 157.286 147.780  1.00110.15           H  
ATOM   4640  H2'  DT I 129      89.442 155.218 148.668  1.00110.15           H  
ATOM   4641 H2''  DT I 129      89.037 154.952 147.143  1.00110.15           H  
ATOM   4642  H1'  DT I 129      91.159 154.250 146.620  1.00110.15           H  
ATOM   4643  H3   DT I 129      92.077 150.072 147.846  1.00110.15           H  
ATOM   4644  H71  DT I 129      88.677 150.351 150.891  1.00110.15           H  
ATOM   4645  H72  DT I 129      89.742 151.058 151.826  1.00110.15           H  
ATOM   4646  H73  DT I 129      88.580 151.908 151.165  1.00110.15           H  
ATOM   4647  H6   DT I 129      89.633 153.331 149.634  1.00110.15           H  
ATOM   4648  P    DG I 130      90.720 158.160 145.291  1.00105.41           P  
ATOM   4649  OP1  DG I 130      91.660 158.890 146.169  1.00105.41           O  
ATOM   4650  OP2  DG I 130      89.428 158.775 144.923  1.00105.41           O  
ATOM   4651  O5'  DG I 130      91.472 157.764 143.930  1.00105.41           O  
ATOM   4652  C5'  DG I 130      92.718 157.079 143.994  1.00105.41           C  
ATOM   4653  C4'  DG I 130      93.139 156.501 142.643  1.00105.41           C  
ATOM   4654  O4'  DG I 130      92.775 155.103 142.569  1.00105.41           O  
ATOM   4655  C3'  DG I 130      92.499 157.113 141.416  1.00105.41           C  
ATOM   4656  O3'  DG I 130      93.372 156.917 140.279  1.00105.41           O  
ATOM   4657  C2'  DG I 130      91.176 156.352 141.328  1.00105.41           C  
ATOM   4658  C1'  DG I 130      91.519 154.963 141.925  1.00105.41           C  
ATOM   4659  N9   DG I 130      90.594 154.416 142.930  1.00105.41           N  
ATOM   4660  C8   DG I 130      89.673 155.091 143.694  1.00105.41           C  
ATOM   4661  N7   DG I 130      89.043 154.339 144.542  1.00105.41           N  
ATOM   4662  C5   DG I 130      89.582 153.082 144.345  1.00105.41           C  
ATOM   4663  C6   DG I 130      89.281 151.863 144.982  1.00105.41           C  
ATOM   4664  O6   DG I 130      88.450 151.654 145.874  1.00105.41           O  
ATOM   4665  N1   DG I 130      90.053 150.822 144.489  1.00105.41           N  
ATOM   4666  C2   DG I 130      90.997 150.945 143.502  1.00105.41           C  
ATOM   4667  N2   DG I 130      91.641 149.827 143.161  1.00105.41           N  
ATOM   4668  N3   DG I 130      91.291 152.085 142.894  1.00105.41           N  
ATOM   4669  C4   DG I 130      90.545 153.109 143.365  1.00105.41           C  
ATOM   4670  H5'  DG I 130      92.643 156.356 144.634  1.00105.41           H  
ATOM   4671 H5''  DG I 130      93.400 157.697 144.298  1.00105.41           H  
ATOM   4672  H4'  DG I 130      94.103 156.574 142.560  1.00105.41           H  
ATOM   4673  H3'  DG I 130      92.334 158.057 141.559  1.00105.41           H  
ATOM   4674  H2'  DG I 130      90.502 156.809 141.838  1.00105.41           H  
ATOM   4675 H2''  DG I 130      90.898 156.264 140.418  1.00105.41           H  
ATOM   4676  H1'  DG I 130      91.611 154.324 141.204  1.00105.41           H  
ATOM   4677  H8   DG I 130      89.518 156.005 143.611  1.00105.41           H  
ATOM   4678  H1   DG I 130      89.928 150.041 144.825  1.00105.41           H  
ATOM   4679  H21  DG I 130      92.287 149.859 142.595  1.00105.41           H  
ATOM   4680  H22  DG I 130      91.410 149.076 143.508  1.00105.41           H  
ATOM   4681  P    DC I 131      92.927 157.239 138.765  1.00111.89           P  
ATOM   4682  OP1  DC I 131      94.055 157.943 138.110  1.00111.89           O  
ATOM   4683  OP2  DC I 131      91.601 157.893 138.768  1.00111.89           O  
ATOM   4684  O5'  DC I 131      92.785 155.778 138.116  1.00111.89           O  
ATOM   4685  C5'  DC I 131      93.873 154.841 138.207  1.00111.89           C  
ATOM   4686  C4'  DC I 131      93.393 153.408 138.054  1.00111.89           C  
ATOM   4687  O4'  DC I 131      92.403 153.102 139.088  1.00111.89           O  
ATOM   4688  C3'  DC I 131      92.697 153.095 136.737  1.00111.89           C  
ATOM   4689  O3'  DC I 131      92.940 151.745 136.359  1.00111.89           O  
ATOM   4690  C2'  DC I 131      91.248 153.334 137.107  1.00111.89           C  
ATOM   4691  C1'  DC I 131      91.226 152.639 138.458  1.00111.89           C  
ATOM   4692  N1   DC I 131      90.026 152.914 139.362  1.00111.89           N  
ATOM   4693  C2   DC I 131      89.501 151.884 140.161  1.00111.89           C  
ATOM   4694  O2   DC I 131      89.996 150.756 140.095  1.00111.89           O  
ATOM   4695  N3   DC I 131      88.442 152.150 140.964  1.00111.89           N  
ATOM   4696  C4   DC I 131      87.926 153.377 141.005  1.00111.89           C  
ATOM   4697  N4   DC I 131      86.884 153.598 141.816  1.00111.89           N  
ATOM   4698  C5   DC I 131      88.452 154.434 140.217  1.00111.89           C  
ATOM   4699  C6   DC I 131      89.482 154.159 139.415  1.00111.89           C  
ATOM   4700  H5'  DC I 131      94.306 154.939 139.070  1.00111.89           H  
ATOM   4701 H5''  DC I 131      94.516 155.033 137.507  1.00111.89           H  
ATOM   4702  H4'  DC I 131      94.149 152.811 138.156  1.00111.89           H  
ATOM   4703  H3'  DC I 131      92.982 153.707 136.044  1.00111.89           H  
ATOM   4704  H2'  DC I 131      91.069 154.279 137.187  1.00111.89           H  
ATOM   4705 H2''  DC I 131      90.655 152.918 136.478  1.00111.89           H  
ATOM   4706  H1'  DC I 131      91.307 151.689 138.316  1.00111.89           H  
ATOM   4707  H41  DC I 131      86.575 154.396 141.911  1.00111.89           H  
ATOM   4708  H42  DC I 131      86.522 152.944 142.241  1.00111.89           H  
ATOM   4709  H5   DC I 131      88.085 155.287 140.252  1.00111.89           H  
ATOM   4710  H6   DC I 131      89.852 154.837 138.901  1.00111.89           H  
ATOM   4711  P    DA I 132      93.708 151.385 134.995  1.00128.07           P  
ATOM   4712  OP1  DA I 132      95.117 151.803 135.158  1.00128.07           O  
ATOM   4713  OP2  DA I 132      92.904 151.923 133.876  1.00128.07           O  
ATOM   4714  O5'  DA I 132      93.636 149.779 134.929  1.00128.07           O  
ATOM   4715  C5'  DA I 132      94.327 148.994 135.906  1.00128.07           C  
ATOM   4716  C4'  DA I 132      93.815 147.555 135.958  1.00128.07           C  
ATOM   4717  O4'  DA I 132      92.640 147.479 136.804  1.00128.07           O  
ATOM   4718  C3'  DA I 132      93.387 146.951 134.631  1.00128.07           C  
ATOM   4719  O3'  DA I 132      93.607 145.534 134.640  1.00128.07           O  
ATOM   4720  C2'  DA I 132      91.907 147.322 134.546  1.00128.07           C  
ATOM   4721  C1'  DA I 132      91.464 147.351 136.017  1.00128.07           C  
ATOM   4722  N9   DA I 132      90.573 148.458 136.378  1.00128.07           N  
ATOM   4723  C8   DA I 132      90.737 149.773 136.065  1.00128.07           C  
ATOM   4724  N7   DA I 132      89.807 150.549 136.536  1.00128.07           N  
ATOM   4725  C5   DA I 132      88.990 149.708 137.238  1.00128.07           C  
ATOM   4726  C6   DA I 132      87.836 149.947 137.978  1.00128.07           C  
ATOM   4727  N6   DA I 132      87.303 151.159 138.107  1.00128.07           N  
ATOM   4728  N1   DA I 132      87.232 148.896 138.551  1.00128.07           N  
ATOM   4729  C2   DA I 132      87.772 147.680 138.404  1.00128.07           C  
ATOM   4730  N3   DA I 132      88.871 147.330 137.732  1.00128.07           N  
ATOM   4731  C4   DA I 132      89.440 148.408 137.168  1.00128.07           C  
ATOM   4732  H5'  DA I 132      94.207 149.402 136.778  1.00128.07           H  
ATOM   4733 H5''  DA I 132      95.272 148.984 135.690  1.00128.07           H  
ATOM   4734  H4'  DA I 132      94.508 146.995 136.342  1.00128.07           H  
ATOM   4735  H3'  DA I 132      93.877 147.363 133.903  1.00128.07           H  
ATOM   4736  H2'  DA I 132      91.802 148.188 134.128  1.00128.07           H  
ATOM   4737 H2''  DA I 132      91.413 146.650 134.059  1.00128.07           H  
ATOM   4738  H1'  DA I 132      91.029 146.510 136.232  1.00128.07           H  
ATOM   4739  H8   DA I 132      91.432 150.083 135.540  1.00128.07           H  
ATOM   4740  H61  DA I 132      86.495 151.245 138.386  1.00128.07           H  
ATOM   4741  H62  DA I 132      87.769 151.856 137.916  1.00128.07           H  
ATOM   4742  H2   DA I 132      87.322 146.987 138.827  1.00128.07           H  
ATOM   4743  P    DG I 133      93.255 144.633 133.356  1.00139.47           P  
ATOM   4744  OP1  DG I 133      94.084 143.409 133.425  1.00139.47           O  
ATOM   4745  OP2  DG I 133      93.318 145.504 132.161  1.00139.47           O  
ATOM   4746  O5'  DG I 133      91.724 144.230 133.589  1.00139.47           O  
ATOM   4747  C5'  DG I 133      91.345 143.527 134.771  1.00139.47           C  
ATOM   4748  C4'  DG I 133      89.836 143.357 134.856  1.00139.47           C  
ATOM   4749  O4'  DG I 133      89.241 144.593 135.318  1.00139.47           O  
ATOM   4750  C3'  DG I 133      89.144 143.013 133.533  1.00139.47           C  
ATOM   4751  O3'  DG I 133      88.412 141.805 133.654  1.00139.47           O  
ATOM   4752  C2'  DG I 133      88.241 144.214 133.250  1.00139.47           C  
ATOM   4753  C1'  DG I 133      88.044 144.826 134.623  1.00139.47           C  
ATOM   4754  N9   DG I 133      87.788 146.267 134.623  1.00139.47           N  
ATOM   4755  C8   DG I 133      88.586 147.256 134.099  1.00139.47           C  
ATOM   4756  N7   DG I 133      88.107 148.455 134.270  1.00139.47           N  
ATOM   4757  C5   DG I 133      86.923 148.250 134.959  1.00139.47           C  
ATOM   4758  C6   DG I 133      85.974 149.179 135.425  1.00139.47           C  
ATOM   4759  O6   DG I 133      85.988 150.409 135.312  1.00139.47           O  
ATOM   4760  N1   DG I 133      84.918 148.555 136.075  1.00139.47           N  
ATOM   4761  C2   DG I 133      84.802 147.201 136.256  1.00139.47           C  
ATOM   4762  N2   DG I 133      83.713 146.775 136.904  1.00139.47           N  
ATOM   4763  N3   DG I 133      85.685 146.320 135.825  1.00139.47           N  
ATOM   4764  C4   DG I 133      86.718 146.912 135.192  1.00139.47           C  
ATOM   4765  H5'  DG I 133      91.652 144.024 135.546  1.00139.47           H  
ATOM   4766 H5''  DG I 133      91.764 142.653 134.769  1.00139.47           H  
ATOM   4767  H4'  DG I 133      89.638 142.660 135.499  1.00139.47           H  
ATOM   4768  H3'  DG I 133      89.803 142.926 132.830  1.00139.47           H  
ATOM   4769  H2'  DG I 133      88.681 144.837 132.655  1.00139.47           H  
ATOM   4770 H2''  DG I 133      87.394 143.923 132.882  1.00139.47           H  
ATOM   4771  H1'  DG I 133      87.318 144.368 135.072  1.00139.47           H  
ATOM   4772  H8   DG I 133      89.382 147.085 133.657  1.00139.47           H  
ATOM   4773  H1   DG I 133      84.295 149.053 136.387  1.00139.47           H  
ATOM   4774  H21  DG I 133      83.624 145.940 137.091  1.00139.47           H  
ATOM   4775  H22  DG I 133      83.100 147.334 137.127  1.00139.47           H  
ATOM   4776  P    DG I 134      87.812 141.087 132.349  1.00148.06           P  
ATOM   4777  OP1  DG I 134      87.878 139.627 132.571  1.00148.06           O  
ATOM   4778  OP2  DG I 134      88.451 141.678 131.153  1.00148.06           O  
ATOM   4779  O5'  DG I 134      86.282 141.538 132.351  1.00148.06           O  
ATOM   4780  C5'  DG I 134      85.466 141.239 133.469  1.00148.06           C  
ATOM   4781  C4'  DG I 134      84.200 142.067 133.455  1.00148.06           C  
ATOM   4782  O4'  DG I 134      84.535 143.448 133.708  1.00148.06           O  
ATOM   4783  C3'  DG I 134      83.436 142.063 132.125  1.00148.06           C  
ATOM   4784  O3'  DG I 134      82.262 141.253 132.210  1.00148.06           O  
ATOM   4785  C2'  DG I 134      83.105 143.539 131.868  1.00148.06           C  
ATOM   4786  C1'  DG I 134      83.541 144.250 133.136  1.00148.06           C  
ATOM   4787  N9   DG I 134      84.078 145.575 132.887  1.00148.06           N  
ATOM   4788  C8   DG I 134      85.285 145.879 132.322  1.00148.06           C  
ATOM   4789  N7   DG I 134      85.494 147.159 132.204  1.00148.06           N  
ATOM   4790  C5   DG I 134      84.346 147.738 132.725  1.00148.06           C  
ATOM   4791  C6   DG I 134      83.990 149.097 132.855  1.00148.06           C  
ATOM   4792  O6   DG I 134      84.654 150.092 132.545  1.00148.06           O  
ATOM   4793  N1   DG I 134      82.739 149.249 133.438  1.00148.06           N  
ATOM   4794  C2   DG I 134      81.926 148.216 133.828  1.00148.06           C  
ATOM   4795  N2   DG I 134      80.747 148.552 134.363  1.00148.06           N  
ATOM   4796  N3   DG I 134      82.242 146.937 133.701  1.00148.06           N  
ATOM   4797  C4   DG I 134      83.462 146.774 133.143  1.00148.06           C  
ATOM   4798  H5'  DG I 134      85.960 141.428 134.281  1.00148.06           H  
ATOM   4799 H5''  DG I 134      85.232 140.299 133.449  1.00148.06           H  
ATOM   4800  H4'  DG I 134      83.611 141.752 134.157  1.00148.06           H  
ATOM   4801  H3'  DG I 134      84.010 141.731 131.419  1.00148.06           H  
ATOM   4802  H2'  DG I 134      83.606 143.868 131.109  1.00148.06           H  
ATOM   4803 H2''  DG I 134      82.156 143.658 131.725  1.00148.06           H  
ATOM   4804  H1'  DG I 134      82.790 144.316 133.744  1.00148.06           H  
ATOM   4805  H8   DG I 134      85.895 145.234 132.048  1.00148.06           H  
ATOM   4806  H1   DG I 134      82.451 150.050 133.558  1.00148.06           H  
ATOM   4807  H21  DG I 134      80.198 147.940 134.613  1.00148.06           H  
ATOM   4808  H22  DG I 134      80.540 149.382 134.459  1.00148.06           H  
ATOM   4809  P    DT I 135      81.367 140.978 130.900  1.00152.17           P  
ATOM   4810  OP1  DT I 135      80.592 139.741 131.138  1.00152.17           O  
ATOM   4811  OP2  DT I 135      82.251 141.073 129.717  1.00152.17           O  
ATOM   4812  O5'  DT I 135      80.356 142.219 130.854  1.00152.17           O  
ATOM   4813  C5'  DT I 135      79.602 142.559 132.010  1.00152.17           C  
ATOM   4814  C4'  DT I 135      78.939 143.911 131.857  1.00152.17           C  
ATOM   4815  O4'  DT I 135      79.944 144.956 131.811  1.00152.17           O  
ATOM   4816  C3'  DT I 135      78.104 144.079 130.584  1.00152.17           C  
ATOM   4817  O3'  DT I 135      76.754 144.372 130.921  1.00152.17           O  
ATOM   4818  C2'  DT I 135      78.785 145.233 129.848  1.00152.17           C  
ATOM   4819  C1'  DT I 135      79.462 145.972 130.974  1.00152.17           C  
ATOM   4820  N1   DT I 135      80.603 146.875 130.558  1.00152.17           N  
ATOM   4821  C2   DT I 135      80.442 148.244 130.623  1.00152.17           C  
ATOM   4822  O2   DT I 135      79.414 148.783 130.990  1.00152.17           O  
ATOM   4823  N3   DT I 135      81.537 148.971 130.238  1.00152.17           N  
ATOM   4824  C4   DT I 135      82.751 148.485 129.802  1.00152.17           C  
ATOM   4825  O4   DT I 135      83.676 149.224 129.478  1.00152.17           O  
ATOM   4826  C5   DT I 135      82.861 147.047 129.758  1.00152.17           C  
ATOM   4827  C7   DT I 135      84.139 146.411 129.297  1.00152.17           C  
ATOM   4828  C6   DT I 135      81.795 146.317 130.136  1.00152.17           C  
ATOM   4829  H5'  DT I 135      80.190 142.580 132.779  1.00152.17           H  
ATOM   4830 H5''  DT I 135      78.919 141.887 132.151  1.00152.17           H  
ATOM   4831  H4'  DT I 135      78.368 144.065 132.624  1.00152.17           H  
ATOM   4832  H3'  DT I 135      78.148 143.273 130.051  1.00152.17           H  
ATOM   4833  H2'  DT I 135      79.434 144.902 129.212  1.00152.17           H  
ATOM   4834 H2''  DT I 135      78.133 145.791 129.418  1.00152.17           H  
ATOM   4835  H1'  DT I 135      78.801 146.486 131.456  1.00152.17           H  
ATOM   4836  H3   DT I 135      81.458 149.825 130.269  1.00152.17           H  
ATOM   4837  H71  DT I 135      84.219 145.528 129.682  1.00152.17           H  
ATOM   4838  H72  DT I 135      84.135 146.341 128.329  1.00152.17           H  
ATOM   4839  H73  DT I 135      84.890 146.955 129.577  1.00152.17           H  
ATOM   4840  H6   DT I 135      81.863 145.391 130.109  1.00152.17           H  
ATOM   4841  P    DG I 136      75.581 144.253 129.829  1.00153.06           P  
ATOM   4842  OP1  DG I 136      74.956 142.922 129.985  1.00153.06           O  
ATOM   4843  OP2  DG I 136      76.116 144.661 128.512  1.00153.06           O  
ATOM   4844  O5'  DG I 136      74.536 145.368 130.292  1.00153.06           O  
ATOM   4845  C5'  DG I 136      75.015 146.620 130.764  1.00153.06           C  
ATOM   4846  C4'  DG I 136      74.215 147.798 130.219  1.00153.06           C  
ATOM   4847  O4'  DG I 136      75.136 148.898 129.990  1.00153.06           O  
ATOM   4848  C3'  DG I 136      73.506 147.582 128.878  1.00153.06           C  
ATOM   4849  O3'  DG I 136      72.339 148.396 128.770  1.00153.06           O  
ATOM   4850  C2'  DG I 136      74.575 147.972 127.877  1.00153.06           C  
ATOM   4851  C1'  DG I 136      75.305 149.115 128.598  1.00153.06           C  
ATOM   4852  N9   DG I 136      76.743 149.220 128.292  1.00153.06           N  
ATOM   4853  C8   DG I 136      77.641 148.196 128.098  1.00153.06           C  
ATOM   4854  N7   DG I 136      78.845 148.600 127.829  1.00153.06           N  
ATOM   4855  C5   DG I 136      78.748 149.978 127.847  1.00153.06           C  
ATOM   4856  C6   DG I 136      79.736 150.953 127.633  1.00153.06           C  
ATOM   4857  O6   DG I 136      80.931 150.781 127.367  1.00153.06           O  
ATOM   4858  N1   DG I 136      79.221 152.236 127.738  1.00153.06           N  
ATOM   4859  C2   DG I 136      77.916 152.538 128.029  1.00153.06           C  
ATOM   4860  N2   DG I 136      77.601 153.833 128.090  1.00153.06           N  
ATOM   4861  N3   DG I 136      76.977 151.631 128.233  1.00153.06           N  
ATOM   4862  C4   DG I 136      77.463 150.377 128.128  1.00153.06           C  
ATOM   4863  H5'  DG I 136      75.942 146.721 130.497  1.00153.06           H  
ATOM   4864 H5''  DG I 136      74.965 146.630 131.732  1.00153.06           H  
ATOM   4865  H4'  DG I 136      73.562 148.068 130.881  1.00153.06           H  
ATOM   4866  H3'  DG I 136      73.268 146.653 128.762  1.00153.06           H  
ATOM   4867  H2'  DG I 136      75.159 147.221 127.709  1.00153.06           H  
ATOM   4868 H2''  DG I 136      74.177 148.289 127.052  1.00153.06           H  
ATOM   4869  H1'  DG I 136      74.877 149.952 128.362  1.00153.06           H  
ATOM   4870  H8   DG I 136      77.406 147.300 128.145  1.00153.06           H  
ATOM   4871  H1   DG I 136      79.762 152.892 127.619  1.00153.06           H  
ATOM   4872  H21  DG I 136      76.815 154.073 128.341  1.00153.06           H  
ATOM   4873  H22  DG I 136      78.183 154.426 127.875  1.00153.06           H  
ATOM   4874  P    DG I 137      71.366 148.240 127.497  1.00146.55           P  
ATOM   4875  OP1  DG I 137      69.977 148.450 127.962  1.00146.55           O  
ATOM   4876  OP2  DG I 137      71.721 146.980 126.807  1.00146.55           O  
ATOM   4877  O5'  DG I 137      71.794 149.450 126.539  1.00146.55           O  
ATOM   4878  C5'  DG I 137      71.166 150.714 126.680  1.00146.55           C  
ATOM   4879  C4'  DG I 137      72.154 151.855 126.461  1.00146.55           C  
ATOM   4880  O4'  DG I 137      73.517 151.341 126.495  1.00146.55           O  
ATOM   4881  C3'  DG I 137      72.026 152.606 125.121  1.00146.55           C  
ATOM   4882  O3'  DG I 137      71.839 154.008 125.346  1.00146.55           O  
ATOM   4883  C2'  DG I 137      73.345 152.309 124.414  1.00146.55           C  
ATOM   4884  C1'  DG I 137      74.281 152.081 125.577  1.00146.55           C  
ATOM   4885  N9   DG I 137      75.510 151.355 125.248  1.00146.55           N  
ATOM   4886  C8   DG I 137      75.677 149.996 125.171  1.00146.55           C  
ATOM   4887  N7   DG I 137      76.895 149.639 124.867  1.00146.55           N  
ATOM   4888  C5   DG I 137      77.580 150.839 124.737  1.00146.55           C  
ATOM   4889  C6   DG I 137      78.936 151.084 124.414  1.00146.55           C  
ATOM   4890  O6   DG I 137      79.828 150.259 124.178  1.00146.55           O  
ATOM   4891  N1   DG I 137      79.224 152.448 124.389  1.00146.55           N  
ATOM   4892  C2   DG I 137      78.317 153.442 124.646  1.00146.55           C  
ATOM   4893  N2   DG I 137      78.772 154.699 124.563  1.00146.55           N  
ATOM   4894  N3   DG I 137      77.041 153.226 124.938  1.00146.55           N  
ATOM   4895  C4   DG I 137      76.745 151.904 124.967  1.00146.55           C  
ATOM   4896  H5'  DG I 137      70.798 150.786 127.574  1.00146.55           H  
ATOM   4897 H5''  DG I 137      70.444 150.781 126.038  1.00146.55           H  
ATOM   4898  H4'  DG I 137      72.048 152.494 127.181  1.00146.55           H  
ATOM   4899  H3'  DG I 137      71.290 152.253 124.602  1.00146.55           H  
ATOM   4900  H2'  DG I 137      73.274 151.511 123.868  1.00146.55           H  
ATOM   4901 H2''  DG I 137      73.626 153.064 123.892  1.00146.55           H  
ATOM   4902  H1'  DG I 137      74.512 152.935 125.971  1.00146.55           H  
ATOM   4903  H8   DG I 137      74.990 149.389 125.318  1.00146.55           H  
ATOM   4904  H1   DG I 137      80.028 152.682 124.203  1.00146.55           H  
ATOM   4905  H21  DG I 137      78.234 155.358 124.674  1.00146.55           H  
ATOM   4906  H22  DG I 137      79.600 154.845 124.389  1.00146.55           H  
ATOM   4907  P    DA I 138      71.332 154.970 124.160  1.00142.77           P  
ATOM   4908  OP1  DA I 138      69.923 155.318 124.445  1.00142.77           O  
ATOM   4909  OP2  DA I 138      71.686 154.334 122.873  1.00142.77           O  
ATOM   4910  O5'  DA I 138      72.230 156.286 124.317  1.00142.77           O  
ATOM   4911  C5'  DA I 138      73.585 156.163 124.711  1.00142.77           C  
ATOM   4912  C4'  DA I 138      74.470 157.255 124.121  1.00142.77           C  
ATOM   4913  O4'  DA I 138      75.730 156.656 123.707  1.00142.77           O  
ATOM   4914  C3'  DA I 138      73.963 157.941 122.866  1.00142.77           C  
ATOM   4915  O3'  DA I 138      74.599 159.197 122.692  1.00142.77           O  
ATOM   4916  C2'  DA I 138      74.359 156.944 121.797  1.00142.77           C  
ATOM   4917  C1'  DA I 138      75.745 156.493 122.291  1.00142.77           C  
ATOM   4918  N9   DA I 138      76.119 155.100 121.981  1.00142.77           N  
ATOM   4919  C8   DA I 138      75.303 154.006 121.939  1.00142.77           C  
ATOM   4920  N7   DA I 138      75.918 152.889 121.654  1.00142.77           N  
ATOM   4921  C5   DA I 138      77.232 153.268 121.497  1.00142.77           C  
ATOM   4922  C6   DA I 138      78.389 152.539 121.186  1.00142.77           C  
ATOM   4923  N6   DA I 138      78.385 151.223 120.965  1.00142.77           N  
ATOM   4924  N1   DA I 138      79.551 153.213 121.105  1.00142.77           N  
ATOM   4925  C2   DA I 138      79.548 154.531 121.329  1.00142.77           C  
ATOM   4926  N3   DA I 138      78.521 155.326 121.629  1.00142.77           N  
ATOM   4927  C4   DA I 138      77.379 154.626 121.695  1.00142.77           C  
ATOM   4928  H5'  DA I 138      73.917 155.301 124.421  1.00142.77           H  
ATOM   4929 H5''  DA I 138      73.634 156.208 125.677  1.00142.77           H  
ATOM   4930  H4'  DA I 138      74.643 157.925 124.799  1.00142.77           H  
ATOM   4931  H3'  DA I 138      73.003 158.050 122.894  1.00142.77           H  
ATOM   4932  H2'  DA I 138      73.730 156.211 121.774  1.00142.77           H  
ATOM   4933 H2''  DA I 138      74.423 157.374 120.933  1.00142.77           H  
ATOM   4934  H1'  DA I 138      76.416 157.083 121.918  1.00142.77           H  
ATOM   4935  H8   DA I 138      74.389 154.051 122.099  1.00142.77           H  
ATOM   4936  H61  DA I 138      79.085 150.839 120.644  1.00142.77           H  
ATOM   4937  H62  DA I 138      77.682 150.760 121.141  1.00142.77           H  
ATOM   4938  H2   DA I 138      80.373 154.951 121.260  1.00142.77           H  
ATOM   4939  P    DT I 139      73.913 160.335 121.792  1.00132.99           P  
ATOM   4940  OP1  DT I 139      74.783 161.530 121.848  1.00132.99           O  
ATOM   4941  OP2  DT I 139      72.499 160.434 122.212  1.00132.99           O  
ATOM   4942  O5'  DT I 139      73.946 159.733 120.310  1.00132.99           O  
ATOM   4943  C5'  DT I 139      74.850 160.256 119.337  1.00132.99           C  
ATOM   4944  C4'  DT I 139      76.286 159.891 119.669  1.00132.99           C  
ATOM   4945  O4'  DT I 139      76.397 158.451 119.840  1.00132.99           O  
ATOM   4946  C3'  DT I 139      77.310 160.262 118.593  1.00132.99           C  
ATOM   4947  O3'  DT I 139      78.460 160.864 119.192  1.00132.99           O  
ATOM   4948  C2'  DT I 139      77.631 158.922 117.938  1.00132.99           C  
ATOM   4949  C1'  DT I 139      77.510 157.982 119.111  1.00132.99           C  
ATOM   4950  N1   DT I 139      77.298 156.555 118.759  1.00132.99           N  
ATOM   4951  C2   DT I 139      78.383 155.778 118.444  1.00132.99           C  
ATOM   4952  O2   DT I 139      79.520 156.204 118.413  1.00132.99           O  
ATOM   4953  N3   DT I 139      78.090 154.475 118.163  1.00132.99           N  
ATOM   4954  C4   DT I 139      76.844 153.884 118.169  1.00132.99           C  
ATOM   4955  O4   DT I 139      76.678 152.700 117.897  1.00132.99           O  
ATOM   4956  C5   DT I 139      75.751 154.755 118.515  1.00132.99           C  
ATOM   4957  C7   DT I 139      74.350 154.227 118.555  1.00132.99           C  
ATOM   4958  C6   DT I 139      76.029 156.032 118.795  1.00132.99           C  
ATOM   4959  H5'  DT I 139      74.766 161.221 119.313  1.00132.99           H  
ATOM   4960 H5''  DT I 139      74.625 159.895 118.466  1.00132.99           H  
ATOM   4961  H4'  DT I 139      76.535 160.325 120.499  1.00132.99           H  
ATOM   4962  H3'  DT I 139      76.910 160.863 117.948  1.00132.99           H  
ATOM   4963  H2'  DT I 139      76.981 158.705 117.252  1.00132.99           H  
ATOM   4964 H2''  DT I 139      78.532 158.918 117.583  1.00132.99           H  
ATOM   4965  H1'  DT I 139      78.303 158.057 119.661  1.00132.99           H  
ATOM   4966  H3   DT I 139      78.753 153.969 117.958  1.00132.99           H  
ATOM   4967  H71  DT I 139      73.853 154.681 119.252  1.00132.99           H  
ATOM   4968  H72  DT I 139      73.922 154.383 117.699  1.00132.99           H  
ATOM   4969  H73  DT I 139      74.367 153.275 118.738  1.00132.99           H  
ATOM   4970  H6   DT I 139      75.327 156.594 119.017  1.00132.99           H  
ATOM   4971  P    DA I 140      79.447 161.798 118.334  1.00130.09           P  
ATOM   4972  OP1  DA I 140      80.136 162.689 119.291  1.00130.09           O  
ATOM   4973  OP2  DA I 140      78.693 162.384 117.205  1.00130.09           O  
ATOM   4974  O5'  DA I 140      80.519 160.780 117.724  1.00130.09           O  
ATOM   4975  C5'  DA I 140      81.368 161.217 116.677  1.00130.09           C  
ATOM   4976  C4'  DA I 140      82.497 160.239 116.423  1.00130.09           C  
ATOM   4977  O4'  DA I 140      81.996 158.874 116.508  1.00130.09           O  
ATOM   4978  C3'  DA I 140      83.108 160.340 115.036  1.00130.09           C  
ATOM   4979  O3'  DA I 140      84.467 159.893 115.043  1.00130.09           O  
ATOM   4980  C2'  DA I 140      82.194 159.422 114.255  1.00130.09           C  
ATOM   4981  C1'  DA I 140      82.070 158.269 115.226  1.00130.09           C  
ATOM   4982  N9   DA I 140      80.897 157.423 115.042  1.00130.09           N  
ATOM   4983  C8   DA I 140      79.597 157.778 115.227  1.00130.09           C  
ATOM   4984  N7   DA I 140      78.747 156.802 115.018  1.00130.09           N  
ATOM   4985  C5   DA I 140      79.550 155.727 114.685  1.00130.09           C  
ATOM   4986  C6   DA I 140      79.257 154.389 114.351  1.00130.09           C  
ATOM   4987  N6   DA I 140      78.017 153.903 114.294  1.00130.09           N  
ATOM   4988  N1   DA I 140      80.292 153.569 114.074  1.00130.09           N  
ATOM   4989  C2   DA I 140      81.536 154.061 114.126  1.00130.09           C  
ATOM   4990  N3   DA I 140      81.934 155.298 114.432  1.00130.09           N  
ATOM   4991  C4   DA I 140      80.881 156.088 114.704  1.00130.09           C  
ATOM   4992  H5'  DA I 140      81.744 162.078 116.915  1.00130.09           H  
ATOM   4993 H5''  DA I 140      80.845 161.313 115.867  1.00130.09           H  
ATOM   4994  H4'  DA I 140      83.189 160.368 117.088  1.00130.09           H  
ATOM   4995  H3'  DA I 140      83.046 161.247 114.703  1.00130.09           H  
ATOM   4996  H2'  DA I 140      81.333 159.838 114.102  1.00130.09           H  
ATOM   4997 H2''  DA I 140      82.600 159.143 113.427  1.00130.09           H  
ATOM   4998  H1'  DA I 140      82.868 157.724 115.176  1.00130.09           H  
ATOM   4999  H8   DA I 140      79.337 158.636 115.468  1.00130.09           H  
ATOM   5000  H61  DA I 140      77.888 153.078 114.081  1.00130.09           H  
ATOM   5001  H62  DA I 140      77.346 154.413 114.465  1.00130.09           H  
ATOM   5002  H2   DA I 140      82.216 153.457 113.931  1.00130.09           H  
ATOM   5003  P    DT I 141      85.460 160.266 113.835  1.00123.53           P  
ATOM   5004  OP1  DT I 141      86.554 161.088 114.398  1.00123.53           O  
ATOM   5005  OP2  DT I 141      84.638 160.796 112.725  1.00123.53           O  
ATOM   5006  O5'  DT I 141      86.062 158.853 113.377  1.00123.53           O  
ATOM   5007  C5'  DT I 141      85.194 157.743 113.194  1.00123.53           C  
ATOM   5008  C4'  DT I 141      85.855 156.641 112.396  1.00123.53           C  
ATOM   5009  O4'  DT I 141      84.897 155.572 112.185  1.00123.53           O  
ATOM   5010  C3'  DT I 141      86.294 157.033 111.002  1.00123.53           C  
ATOM   5011  O3'  DT I 141      87.310 156.154 110.535  1.00123.53           O  
ATOM   5012  C2'  DT I 141      84.995 156.895 110.225  1.00123.53           C  
ATOM   5013  C1'  DT I 141      84.389 155.635 110.858  1.00123.53           C  
ATOM   5014  N1   DT I 141      82.854 155.570 110.928  1.00123.53           N  
ATOM   5015  C2   DT I 141      82.222 154.371 110.657  1.00123.53           C  
ATOM   5016  O2   DT I 141      82.814 153.355 110.332  1.00123.53           O  
ATOM   5017  N3   DT I 141      80.856 154.403 110.771  1.00123.53           N  
ATOM   5018  C4   DT I 141      80.074 155.476 111.130  1.00123.53           C  
ATOM   5019  O4   DT I 141      78.855 155.405 111.205  1.00123.53           O  
ATOM   5020  C5   DT I 141      80.785 156.688 111.410  1.00123.53           C  
ATOM   5021  C7   DT I 141      80.029 157.909 111.805  1.00123.53           C  
ATOM   5022  C6   DT I 141      82.122 156.681 111.317  1.00123.53           C  
ATOM   5023  H5'  DT I 141      84.406 158.036 112.721  1.00123.53           H  
ATOM   5024 H5''  DT I 141      84.935 157.396 114.061  1.00123.53           H  
ATOM   5025  H4'  DT I 141      86.615 156.299 112.889  1.00123.53           H  
ATOM   5026  H3'  DT I 141      86.601 157.952 110.990  1.00123.53           H  
ATOM   5027  H2'  DT I 141      84.440 157.671 110.361  1.00123.53           H  
ATOM   5028 H2''  DT I 141      85.169 156.756 109.284  1.00123.53           H  
ATOM   5029  H1'  DT I 141      84.712 154.865 110.369  1.00123.53           H  
ATOM   5030  H3   DT I 141      80.440 153.670 110.599  1.00123.53           H  
ATOM   5031  H71  DT I 141      80.628 158.539 112.217  1.00123.53           H  
ATOM   5032  H72  DT I 141      79.631 158.309 111.017  1.00123.53           H  
ATOM   5033  H73  DT I 141      79.332 157.665 112.430  1.00123.53           H  
ATOM   5034  H6   DT I 141      82.579 157.470 111.492  1.00123.53           H  
ATOM   5035  P    DT I 142      88.388 156.641 109.448  1.00108.09           P  
ATOM   5036  OP1  DT I 142      89.724 156.577 110.079  1.00108.09           O  
ATOM   5037  OP2  DT I 142      87.911 157.913 108.860  1.00108.09           O  
ATOM   5038  O5'  DT I 142      88.305 155.519 108.313  1.00108.09           O  
ATOM   5039  C5'  DT I 142      87.321 155.615 107.298  1.00108.09           C  
ATOM   5040  C4'  DT I 142      86.777 154.250 106.928  1.00108.09           C  
ATOM   5041  O4'  DT I 142      85.467 154.071 107.549  1.00108.09           O  
ATOM   5042  C3'  DT I 142      86.535 154.039 105.441  1.00108.09           C  
ATOM   5043  O3'  DT I 142      86.665 152.690 105.094  1.00108.09           O  
ATOM   5044  C2'  DT I 142      85.118 154.509 105.301  1.00108.09           C  
ATOM   5045  C1'  DT I 142      84.507 153.878 106.530  1.00108.09           C  
ATOM   5046  N1   DT I 142      83.196 154.476 106.946  1.00108.09           N  
ATOM   5047  C2   DT I 142      82.045 153.718 106.873  1.00108.09           C  
ATOM   5048  O2   DT I 142      82.022 152.562 106.493  1.00108.09           O  
ATOM   5049  N3   DT I 142      80.909 154.363 107.270  1.00108.09           N  
ATOM   5050  C4   DT I 142      80.802 155.660 107.719  1.00108.09           C  
ATOM   5051  O4   DT I 142      79.730 156.149 108.054  1.00108.09           O  
ATOM   5052  C5   DT I 142      82.038 156.401 107.767  1.00108.09           C  
ATOM   5053  C7   DT I 142      82.044 157.822 108.237  1.00108.09           C  
ATOM   5054  C6   DT I 142      83.163 155.781 107.383  1.00108.09           C  
ATOM   5055  H5'  DT I 142      87.715 156.028 106.517  1.00108.09           H  
ATOM   5056 H5''  DT I 142      86.593 156.167 107.612  1.00108.09           H  
ATOM   5057  H4'  DT I 142      87.379 153.566 107.252  1.00108.09           H  
ATOM   5058  H3'  DT I 142      87.129 154.586 104.913  1.00108.09           H  
ATOM   5059  H2'  DT I 142      85.069 155.474 105.339  1.00108.09           H  
ATOM   5060 H2''  DT I 142      84.722 154.166 104.496  1.00108.09           H  
ATOM   5061  H1'  DT I 142      84.400 152.930 106.377  1.00108.09           H  
ATOM   5062  H3   DT I 142      80.180 153.910 107.236  1.00108.09           H  
ATOM   5063  H71  DT I 142      82.886 158.014 108.675  1.00108.09           H  
ATOM   5064  H72  DT I 142      81.932 158.414 107.478  1.00108.09           H  
ATOM   5065  H73  DT I 142      81.315 157.959 108.863  1.00108.09           H  
ATOM   5066  H6   DT I 142      83.961 156.255 107.412  1.00108.09           H  
ATOM   5067  P    DG I 143      86.847 152.278 103.556  1.00105.82           P  
ATOM   5068  OP1  DG I 143      88.016 151.379 103.563  1.00105.82           O  
ATOM   5069  OP2  DG I 143      86.849 153.495 102.716  1.00105.82           O  
ATOM   5070  O5'  DG I 143      85.531 151.436 103.206  1.00105.82           O  
ATOM   5071  C5'  DG I 143      85.546 150.045 103.407  1.00105.82           C  
ATOM   5072  C4'  DG I 143      84.395 149.350 102.728  1.00105.82           C  
ATOM   5073  O4'  DG I 143      83.154 149.914 103.167  1.00105.82           O  
ATOM   5074  C3'  DG I 143      84.417 149.462 101.219  1.00105.82           C  
ATOM   5075  O3'  DG I 143      83.919 148.275 100.607  1.00105.82           O  
ATOM   5076  C2'  DG I 143      83.538 150.665 100.971  1.00105.82           C  
ATOM   5077  C1'  DG I 143      82.518 150.567 102.107  1.00105.82           C  
ATOM   5078  N9   DG I 143      82.035 151.827 102.642  1.00105.82           N  
ATOM   5079  C8   DG I 143      82.775 152.927 102.980  1.00105.82           C  
ATOM   5080  N7   DG I 143      82.067 153.892 103.486  1.00105.82           N  
ATOM   5081  C5   DG I 143      80.785 153.384 103.511  1.00105.82           C  
ATOM   5082  C6   DG I 143      79.596 153.966 103.962  1.00105.82           C  
ATOM   5083  O6   DG I 143      79.434 155.094 104.433  1.00105.82           O  
ATOM   5084  N1   DG I 143      78.511 153.108 103.808  1.00105.82           N  
ATOM   5085  C2   DG I 143      78.583 151.837 103.291  1.00105.82           C  
ATOM   5086  N2   DG I 143      77.437 151.143 103.221  1.00105.82           N  
ATOM   5087  N3   DG I 143      79.700 151.281 102.871  1.00105.82           N  
ATOM   5088  C4   DG I 143      80.756 152.107 103.015  1.00105.82           C  
ATOM   5089  H5'  DG I 143      85.513 149.861 104.356  1.00105.82           H  
ATOM   5090 H5''  DG I 143      86.366 149.693 103.043  1.00105.82           H  
ATOM   5091  H4'  DG I 143      84.395 148.432 102.972  1.00105.82           H  
ATOM   5092  H3'  DG I 143      85.318 149.641 100.916  1.00105.82           H  
ATOM   5093  H2'  DG I 143      84.055 151.479 101.029  1.00105.82           H  
ATOM   5094 H2''  DG I 143      83.109 150.590 100.116  1.00105.82           H  
ATOM   5095  H1'  DG I 143      81.766 150.034 101.813  1.00105.82           H  
ATOM   5096  H8   DG I 143      83.691 152.986 102.841  1.00105.82           H  
ATOM   5097  H1   DG I 143      77.741 153.391 104.058  1.00105.82           H  
ATOM   5098  H21  DG I 143      77.428 150.362 102.857  1.00105.82           H  
ATOM   5099  H22  DG I 143      76.712 151.475 103.543  1.00105.82           H  
ATOM   5100  P    DA I 144      83.988 148.097  99.010  1.00114.89           P  
ATOM   5101  OP1  DA I 144      84.405 146.705  98.724  1.00114.89           O  
ATOM   5102  OP2  DA I 144      84.775 149.223  98.462  1.00114.89           O  
ATOM   5103  O5'  DA I 144      82.470 148.285  98.547  1.00114.89           O  
ATOM   5104  C5'  DA I 144      81.483 147.374  99.003  1.00114.89           C  
ATOM   5105  C4'  DA I 144      80.088 147.888  98.720  1.00114.89           C  
ATOM   5106  O4'  DA I 144      79.829 149.051  99.542  1.00114.89           O  
ATOM   5107  C3'  DA I 144      79.852 148.309  97.274  1.00114.89           C  
ATOM   5108  O3'  DA I 144      78.796 147.545  96.705  1.00114.89           O  
ATOM   5109  C2'  DA I 144      79.526 149.800  97.349  1.00114.89           C  
ATOM   5110  C1'  DA I 144      79.131 150.018  98.799  1.00114.89           C  
ATOM   5111  N9   DA I 144      79.490 151.334  99.320  1.00114.89           N  
ATOM   5112  C8   DA I 144      80.745 151.850  99.403  1.00114.89           C  
ATOM   5113  N7   DA I 144      80.799 153.047  99.921  1.00114.89           N  
ATOM   5114  C5   DA I 144      79.483 153.341 100.208  1.00114.89           C  
ATOM   5115  C6   DA I 144      78.883 154.472 100.769  1.00114.89           C  
ATOM   5116  N6   DA I 144      79.581 155.537 101.163  1.00114.89           N  
ATOM   5117  N1   DA I 144      77.545 154.462 100.930  1.00114.89           N  
ATOM   5118  C2   DA I 144      76.859 153.376 100.541  1.00114.89           C  
ATOM   5119  N3   DA I 144      77.319 152.248  99.988  1.00114.89           N  
ATOM   5120  C4   DA I 144      78.654 152.297  99.850  1.00114.89           C  
ATOM   5121  H5'  DA I 144      81.586 147.246  99.957  1.00114.89           H  
ATOM   5122 H5''  DA I 144      81.604 146.524  98.553  1.00114.89           H  
ATOM   5123  H4'  DA I 144      79.451 147.197  98.950  1.00114.89           H  
ATOM   5124  H3'  DA I 144      80.664 148.180  96.762  1.00114.89           H  
ATOM   5125  H2'  DA I 144      80.307 150.323  97.124  1.00114.89           H  
ATOM   5126 H2''  DA I 144      78.790 150.019  96.763  1.00114.89           H  
ATOM   5127  H1'  DA I 144      78.178 149.877  98.900  1.00114.89           H  
ATOM   5128  H8   DA I 144      81.495 151.394  99.106  1.00114.89           H  
ATOM   5129  H61  DA I 144      79.277 156.329 101.017  1.00114.89           H  
ATOM   5130  H62  DA I 144      80.337 155.431 101.563  1.00114.89           H  
ATOM   5131  H2   DA I 144      75.939 153.415 100.668  1.00114.89           H  
ATOM   5132  P    DT I 145      78.450 147.665  95.140  1.00122.31           P  
ATOM   5133  OP1  DT I 145      77.802 146.400  94.727  1.00122.31           O  
ATOM   5134  OP2  DT I 145      79.666 148.131  94.437  1.00122.31           O  
ATOM   5135  O5'  DT I 145      77.369 148.841  95.084  1.00122.31           O  
ATOM   5136  C5'  DT I 145      76.224 148.789  95.927  1.00122.31           C  
ATOM   5137  C4'  DT I 145      75.578 150.156  96.063  1.00122.31           C  
ATOM   5138  O4'  DT I 145      76.457 151.047  96.781  1.00122.31           O  
ATOM   5139  C3'  DT I 145      75.281 150.872  94.743  1.00122.31           C  
ATOM   5140  O3'  DT I 145      73.909 150.732  94.393  1.00122.31           O  
ATOM   5141  C2'  DT I 145      75.667 152.338  95.009  1.00122.31           C  
ATOM   5142  C1'  DT I 145      76.050 152.355  96.486  1.00122.31           C  
ATOM   5143  N1   DT I 145      77.155 153.320  96.818  1.00122.31           N  
ATOM   5144  C2   DT I 145      76.840 154.530  97.392  1.00122.31           C  
ATOM   5145  O2   DT I 145      75.703 154.867  97.668  1.00122.31           O  
ATOM   5146  N3   DT I 145      77.905 155.338  97.647  1.00122.31           N  
ATOM   5147  C4   DT I 145      79.230 155.082  97.384  1.00122.31           C  
ATOM   5148  O4   DT I 145      80.114 155.884  97.655  1.00122.31           O  
ATOM   5149  C5   DT I 145      79.502 153.802  96.778  1.00122.31           C  
ATOM   5150  C7   DT I 145      80.913 153.412  96.446  1.00122.31           C  
ATOM   5151  C6   DT I 145      78.462 152.991  96.522  1.00122.31           C  
ATOM   5152  H5'  DT I 145      76.488 148.476  96.805  1.00122.31           H  
ATOM   5153 H5''  DT I 145      75.580 148.170  95.549  1.00122.31           H  
ATOM   5154  H4'  DT I 145      74.751 150.063  96.561  1.00122.31           H  
ATOM   5155  H3'  DT I 145      75.838 150.509  94.038  1.00122.31           H  
ATOM   5156  H2'  DT I 145      76.423 152.595  94.459  1.00122.31           H  
ATOM   5157 H2''  DT I 145      74.911 152.924  94.847  1.00122.31           H  
ATOM   5158  H1'  DT I 145      75.266 152.566  97.015  1.00122.31           H  
ATOM   5159  H3   DT I 145      77.730 156.097  98.009  1.00122.31           H  
ATOM   5160  H71  DT I 145      81.030 152.461  96.591  1.00122.31           H  
ATOM   5161  H72  DT I 145      81.096 153.621  95.516  1.00122.31           H  
ATOM   5162  H73  DT I 145      81.528 153.904  97.013  1.00122.31           H  
ATOM   5163  H6   DT I 145      78.631 152.165  96.130  1.00122.31           H  
TER    5164       DT I 145                                                      
ATOM   5165  O5'  DA J   1      74.976 164.532  98.282  1.00129.03           O  
ATOM   5166  C5'  DA J   1      74.657 164.669  99.662  1.00129.03           C  
ATOM   5167  C4'  DA J   1      73.623 163.641 100.079  1.00129.03           C  
ATOM   5168  O4'  DA J   1      74.060 162.327  99.652  1.00129.03           O  
ATOM   5169  C3'  DA J   1      73.398 163.520 101.578  1.00129.03           C  
ATOM   5170  O3'  DA J   1      72.067 163.081 101.850  1.00129.03           O  
ATOM   5171  C2'  DA J   1      74.458 162.503 101.990  1.00129.03           C  
ATOM   5172  C1'  DA J   1      74.541 161.583 100.760  1.00129.03           C  
ATOM   5173  N9   DA J   1      75.884 161.080 100.426  1.00129.03           N  
ATOM   5174  C8   DA J   1      77.089 161.727 100.547  1.00129.03           C  
ATOM   5175  N7   DA J   1      78.116 161.013 100.152  1.00129.03           N  
ATOM   5176  C5   DA J   1      77.548 159.827  99.722  1.00129.03           C  
ATOM   5177  C6   DA J   1      78.100 158.652  99.176  1.00129.03           C  
ATOM   5178  N6   DA J   1      79.407 158.477  98.967  1.00129.03           N  
ATOM   5179  N1   DA J   1      77.251 157.658  98.854  1.00129.03           N  
ATOM   5180  C2   DA J   1      75.943 157.829  99.062  1.00129.03           C  
ATOM   5181  N3   DA J   1      75.308 158.882  99.566  1.00129.03           N  
ATOM   5182  C4   DA J   1      76.175 159.858  99.873  1.00129.03           C  
ATOM   5183  H5'  DA J   1      74.305 165.558  99.822  1.00129.03           H  
ATOM   5184 H5''  DA J   1      75.461 164.544 100.189  1.00129.03           H  
ATOM   5185  H4'  DA J   1      72.779 163.849  99.649  1.00129.03           H  
ATOM   5186  H3'  DA J   1      73.566 164.371 102.011  1.00129.03           H  
ATOM   5187  H2'  DA J   1      75.298 162.949 102.161  1.00129.03           H  
ATOM   5188 H2''  DA J   1      74.172 162.003 102.769  1.00129.03           H  
ATOM   5189  H1'  DA J   1      73.955 160.824 100.903  1.00129.03           H  
ATOM   5190  H8   DA J   1      77.172 162.583 100.902  1.00129.03           H  
ATOM   5191  H61  DA J   1      79.690 157.754  98.595  1.00129.03           H  
ATOM   5192  H62  DA J   1      79.967 159.084  99.208  1.00129.03           H  
ATOM   5193  H2   DA J   1      75.402 157.114  98.821  1.00129.03           H  
ATOM   5194 HO5'  DA J   1      74.761 163.832  97.869  1.00129.03           H  
ATOM   5195  P    DT J   2      71.542 162.928 103.362  1.00126.22           P  
ATOM   5196  OP1  DT J   2      70.216 163.579 103.444  1.00126.22           O  
ATOM   5197  OP2  DT J   2      72.629 163.358 104.269  1.00126.22           O  
ATOM   5198  O5'  DT J   2      71.350 161.349 103.529  1.00126.22           O  
ATOM   5199  C5'  DT J   2      70.553 160.635 102.592  1.00126.22           C  
ATOM   5200  C4'  DT J   2      70.780 159.139 102.702  1.00126.22           C  
ATOM   5201  O4'  DT J   2      72.099 158.799 102.179  1.00126.22           O  
ATOM   5202  C3'  DT J   2      70.734 158.581 104.132  1.00126.22           C  
ATOM   5203  O3'  DT J   2      69.826 157.479 104.208  1.00126.22           O  
ATOM   5204  C2'  DT J   2      72.179 158.172 104.399  1.00126.22           C  
ATOM   5205  C1'  DT J   2      72.660 157.810 103.003  1.00126.22           C  
ATOM   5206  N1   DT J   2      74.171 157.784 102.816  1.00126.22           N  
ATOM   5207  C2   DT J   2      74.775 156.662 102.276  1.00126.22           C  
ATOM   5208  O2   DT J   2      74.167 155.661 101.944  1.00126.22           O  
ATOM   5209  N3   DT J   2      76.135 156.750 102.154  1.00126.22           N  
ATOM   5210  C4   DT J   2      76.935 157.821 102.498  1.00126.22           C  
ATOM   5211  O4   DT J   2      78.150 157.810 102.349  1.00126.22           O  
ATOM   5212  C5   DT J   2      76.245 158.955 103.052  1.00126.22           C  
ATOM   5213  C7   DT J   2      77.013 160.173 103.459  1.00126.22           C  
ATOM   5214  C6   DT J   2      74.916 158.889 103.173  1.00126.22           C  
ATOM   5215  H5'  DT J   2      70.780 160.925 101.695  1.00126.22           H  
ATOM   5216 H5''  DT J   2      69.617 160.827 102.760  1.00126.22           H  
ATOM   5217  H4'  DT J   2      70.109 158.683 102.170  1.00126.22           H  
ATOM   5218  H3'  DT J   2      70.466 159.277 104.752  1.00126.22           H  
ATOM   5219  H2'  DT J   2      72.680 158.916 104.765  1.00126.22           H  
ATOM   5220 H2''  DT J   2      72.216 157.411 104.986  1.00126.22           H  
ATOM   5221  H1'  DT J   2      72.291 156.949 102.758  1.00126.22           H  
ATOM   5222  H3   DT J   2      76.533 156.066 101.826  1.00126.22           H  
ATOM   5223  H71  DT J   2      76.467 160.961 103.319  1.00126.22           H  
ATOM   5224  H72  DT J   2      77.252 160.106 104.397  1.00126.22           H  
ATOM   5225  H73  DT J   2      77.820 160.240 102.925  1.00126.22           H  
ATOM   5226  H6   DT J   2      74.471 159.621 103.531  1.00126.22           H  
ATOM   5227  P    DC J   3      69.490 156.775 105.615  1.00119.43           P  
ATOM   5228  OP1  DC J   3      68.022 156.819 105.790  1.00119.43           O  
ATOM   5229  OP2  DC J   3      70.365 157.360 106.655  1.00119.43           O  
ATOM   5230  O5'  DC J   3      69.931 155.253 105.387  1.00119.43           O  
ATOM   5231  C5'  DC J   3      69.417 154.529 104.271  1.00119.43           C  
ATOM   5232  C4'  DC J   3      70.140 153.205 104.089  1.00119.43           C  
ATOM   5233  O4'  DC J   3      71.536 153.452 103.740  1.00119.43           O  
ATOM   5234  C3'  DC J   3      70.179 152.312 105.326  1.00119.43           C  
ATOM   5235  O3'  DC J   3      70.100 150.934 104.946  1.00119.43           O  
ATOM   5236  C2'  DC J   3      71.518 152.677 105.944  1.00119.43           C  
ATOM   5237  C1'  DC J   3      72.383 152.846 104.700  1.00119.43           C  
ATOM   5238  N1   DC J   3      73.618 153.719 104.875  1.00119.43           N  
ATOM   5239  C2   DC J   3      74.894 153.235 104.537  1.00119.43           C  
ATOM   5240  O2   DC J   3      75.020 152.080 104.120  1.00119.43           O  
ATOM   5241  N3   DC J   3      75.963 154.053 104.699  1.00119.43           N  
ATOM   5242  C4   DC J   3      75.794 155.290 105.154  1.00119.43           C  
ATOM   5243  N4   DC J   3      76.870 156.067 105.295  1.00119.43           N  
ATOM   5244  C5   DC J   3      74.518 155.794 105.489  1.00119.43           C  
ATOM   5245  C6   DC J   3      73.473 154.990 105.329  1.00119.43           C  
ATOM   5246  H5'  DC J   3      69.528 155.063 103.469  1.00119.43           H  
ATOM   5247 H5''  DC J   3      68.473 154.358 104.411  1.00119.43           H  
ATOM   5248  H4'  DC J   3      69.719 152.717 103.364  1.00119.43           H  
ATOM   5249  H3'  DC J   3      69.455 152.540 105.929  1.00119.43           H  
ATOM   5250  H2'  DC J   3      71.447 153.505 106.442  1.00119.43           H  
ATOM   5251 H2''  DC J   3      71.846 151.965 106.503  1.00119.43           H  
ATOM   5252  H1'  DC J   3      72.644 151.970 104.379  1.00119.43           H  
ATOM   5253  H41  DC J   3      76.776 156.899 105.489  1.00119.43           H  
ATOM   5254  H42  DC J   3      77.656 155.736 105.189  1.00119.43           H  
ATOM   5255  H5   DC J   3      74.413 156.661 105.803  1.00119.43           H  
ATOM   5256  H6   DC J   3      72.625 155.301 105.542  1.00119.43           H  
ATOM   5257  P    DA J   4      69.919 149.774 106.045  1.00115.63           P  
ATOM   5258  OP1  DA J   4      68.608 149.133 105.797  1.00115.63           O  
ATOM   5259  OP2  DA J   4      70.215 150.336 107.381  1.00115.63           O  
ATOM   5260  O5'  DA J   4      71.076 148.734 105.676  1.00115.63           O  
ATOM   5261  C5'  DA J   4      72.321 149.224 105.220  1.00115.63           C  
ATOM   5262  C4'  DA J   4      73.416 148.181 105.307  1.00115.63           C  
ATOM   5263  O4'  DA J   4      74.694 148.863 105.326  1.00115.63           O  
ATOM   5264  C3'  DA J   4      73.414 147.322 106.557  1.00115.63           C  
ATOM   5265  O3'  DA J   4      74.038 146.071 106.312  1.00115.63           O  
ATOM   5266  C2'  DA J   4      74.188 148.175 107.547  1.00115.63           C  
ATOM   5267  C1'  DA J   4      75.189 148.933 106.655  1.00115.63           C  
ATOM   5268  N9   DA J   4      75.399 150.350 107.014  1.00115.63           N  
ATOM   5269  C8   DA J   4      74.454 151.270 107.379  1.00115.63           C  
ATOM   5270  N7   DA J   4      74.936 152.457 107.642  1.00115.63           N  
ATOM   5271  C5   DA J   4      76.289 152.316 107.432  1.00115.63           C  
ATOM   5272  C6   DA J   4      77.354 153.221 107.534  1.00115.63           C  
ATOM   5273  N6   DA J   4      77.199 154.493 107.903  1.00115.63           N  
ATOM   5274  N1   DA J   4      78.588 152.768 107.254  1.00115.63           N  
ATOM   5275  C2   DA J   4      78.737 151.491 106.888  1.00115.63           C  
ATOM   5276  N3   DA J   4      77.811 150.545 106.752  1.00115.63           N  
ATOM   5277  C4   DA J   4      76.596 151.028 107.040  1.00115.63           C  
ATOM   5278  H5'  DA J   4      72.573 149.979 105.756  1.00115.63           H  
ATOM   5279 H5''  DA J   4      72.230 149.508 104.299  1.00115.63           H  
ATOM   5280  H4'  DA J   4      73.372 147.609 104.529  1.00115.63           H  
ATOM   5281  H3'  DA J   4      72.512 147.187 106.872  1.00115.63           H  
ATOM   5282  H2'  DA J   4      73.590 148.779 108.003  1.00115.63           H  
ATOM   5283 H2''  DA J   4      74.657 147.617 108.181  1.00115.63           H  
ATOM   5284  H1'  DA J   4      76.043 148.476 106.692  1.00115.63           H  
ATOM   5285  H8   DA J   4      73.551 151.066 107.446  1.00115.63           H  
ATOM   5286  H61  DA J   4      77.883 154.959 108.135  1.00115.63           H  
ATOM   5287  H62  DA J   4      76.413 154.844 107.913  1.00115.63           H  
ATOM   5288  H2   DA J   4      79.607 151.227 106.704  1.00115.63           H  
ATOM   5289  P    DA J   5      74.061 144.943 107.455  1.00113.13           P  
ATOM   5290  OP1  DA J   5      73.952 143.626 106.793  1.00113.13           O  
ATOM   5291  OP2  DA J   5      73.085 145.337 108.492  1.00113.13           O  
ATOM   5292  O5'  DA J   5      75.522 145.079 108.087  1.00113.13           O  
ATOM   5293  C5'  DA J   5      76.655 144.840 107.274  1.00113.13           C  
ATOM   5294  C4'  DA J   5      77.930 145.315 107.947  1.00113.13           C  
ATOM   5295  O4'  DA J   5      77.906 146.765 108.082  1.00113.13           O  
ATOM   5296  C3'  DA J   5      78.160 144.767 109.356  1.00113.13           C  
ATOM   5297  O3'  DA J   5      79.483 144.295 109.485  1.00113.13           O  
ATOM   5298  C2'  DA J   5      77.886 145.969 110.246  1.00113.13           C  
ATOM   5299  C1'  DA J   5      78.363 147.101 109.367  1.00113.13           C  
ATOM   5300  N9   DA J   5      77.856 148.422 109.734  1.00113.13           N  
ATOM   5301  C8   DA J   5      76.557 148.782 109.960  1.00113.13           C  
ATOM   5302  N7   DA J   5      76.403 150.046 110.270  1.00113.13           N  
ATOM   5303  C5   DA J   5      77.690 150.553 110.242  1.00113.13           C  
ATOM   5304  C6   DA J   5      78.209 151.839 110.482  1.00113.13           C  
ATOM   5305  N6   DA J   5      77.453 152.887 110.809  1.00113.13           N  
ATOM   5306  N1   DA J   5      79.541 152.007 110.369  1.00113.13           N  
ATOM   5307  C2   DA J   5      80.301 150.957 110.041  1.00113.13           C  
ATOM   5308  N3   DA J   5      79.929 149.702 109.793  1.00113.13           N  
ATOM   5309  C4   DA J   5      78.597 149.566 109.912  1.00113.13           C  
ATOM   5310  H5'  DA J   5      76.545 145.310 106.433  1.00113.13           H  
ATOM   5311 H5''  DA J   5      76.724 143.890 107.099  1.00113.13           H  
ATOM   5312  H4'  DA J   5      78.684 145.066 107.394  1.00113.13           H  
ATOM   5313  H3'  DA J   5      77.530 144.059 109.546  1.00113.13           H  
ATOM   5314  H2'  DA J   5      76.942 146.048 110.434  1.00113.13           H  
ATOM   5315 H2''  DA J   5      78.400 145.925 111.058  1.00113.13           H  
ATOM   5316  H1'  DA J   5      79.331 147.117 109.369  1.00113.13           H  
ATOM   5317  H8   DA J   5      75.849 148.183 109.904  1.00113.13           H  
ATOM   5318  H61  DA J   5      77.824 153.628 111.038  1.00113.13           H  
ATOM   5319  H62  DA J   5      76.597 152.820 110.792  1.00113.13           H  
ATOM   5320  H2   DA J   5      81.214 151.125 109.977  1.00113.13           H  
ATOM   5321  P    DT J   6      79.804 143.018 110.399  1.00114.33           P  
ATOM   5322  OP1  DT J   6      80.141 141.891 109.505  1.00114.33           O  
ATOM   5323  OP2  DT J   6      78.710 142.880 111.383  1.00114.33           O  
ATOM   5324  O5'  DT J   6      81.106 143.463 111.204  1.00114.33           O  
ATOM   5325  C5'  DT J   6      81.008 144.516 112.139  1.00114.33           C  
ATOM   5326  C4'  DT J   6      82.136 145.517 111.969  1.00114.33           C  
ATOM   5327  O4'  DT J   6      81.565 146.837 111.714  1.00114.33           O  
ATOM   5328  C3'  DT J   6      83.028 145.693 113.190  1.00114.33           C  
ATOM   5329  O3'  DT J   6      84.355 146.014 112.813  1.00114.33           O  
ATOM   5330  C2'  DT J   6      82.338 146.827 113.912  1.00114.33           C  
ATOM   5331  C1'  DT J   6      81.938 147.721 112.753  1.00114.33           C  
ATOM   5332  N1   DT J   6      80.789 148.649 113.062  1.00114.33           N  
ATOM   5333  C2   DT J   6      81.029 149.992 113.295  1.00114.33           C  
ATOM   5334  O2   DT J   6      82.139 150.493 113.258  1.00114.33           O  
ATOM   5335  N3   DT J   6      79.910 150.735 113.571  1.00114.33           N  
ATOM   5336  C4   DT J   6      78.608 150.283 113.638  1.00114.33           C  
ATOM   5337  O4   DT J   6      77.669 151.026 113.892  1.00114.33           O  
ATOM   5338  C5   DT J   6      78.429 148.874 113.389  1.00114.33           C  
ATOM   5339  C7   DT J   6      77.059 148.272 113.434  1.00114.33           C  
ATOM   5340  C6   DT J   6      79.513 148.134 113.118  1.00114.33           C  
ATOM   5341  H5'  DT J   6      81.035 144.147 113.033  1.00114.33           H  
ATOM   5342 H5''  DT J   6      80.168 144.968 112.013  1.00114.33           H  
ATOM   5343  H4'  DT J   6      82.683 145.257 111.214  1.00114.33           H  
ATOM   5344  H3'  DT J   6      83.020 144.896 113.734  1.00114.33           H  
ATOM   5345  H2'  DT J   6      81.556 146.508 114.385  1.00114.33           H  
ATOM   5346 H2''  DT J   6      82.944 147.273 114.508  1.00114.33           H  
ATOM   5347  H1'  DT J   6      82.702 148.235 112.466  1.00114.33           H  
ATOM   5348  H3   DT J   6      80.031 151.573 113.717  1.00114.33           H  
ATOM   5349  H71  DT J   6      76.990 147.579 112.760  1.00114.33           H  
ATOM   5350  H72  DT J   6      76.903 147.888 114.310  1.00114.33           H  
ATOM   5351  H73  DT J   6      76.398 148.959 113.259  1.00114.33           H  
ATOM   5352  H6   DT J   6      79.398 147.226 112.957  1.00114.33           H  
ATOM   5353  P    DA J   7      85.545 145.906 113.886  1.00121.55           P  
ATOM   5354  OP1  DA J   7      86.810 145.854 113.124  1.00121.55           O  
ATOM   5355  OP2  DA J   7      85.222 144.832 114.848  1.00121.55           O  
ATOM   5356  O5'  DA J   7      85.480 147.299 114.660  1.00121.55           O  
ATOM   5357  C5'  DA J   7      85.398 148.481 113.907  1.00121.55           C  
ATOM   5358  C4'  DA J   7      86.090 149.661 114.567  1.00121.55           C  
ATOM   5359  O4'  DA J   7      85.101 150.659 114.927  1.00121.55           O  
ATOM   5360  C3'  DA J   7      86.879 149.396 115.838  1.00121.55           C  
ATOM   5361  O3'  DA J   7      88.006 150.260 115.880  1.00121.55           O  
ATOM   5362  C2'  DA J   7      85.867 149.672 116.951  1.00121.55           C  
ATOM   5363  C1'  DA J   7      84.903 150.692 116.329  1.00121.55           C  
ATOM   5364  N9   DA J   7      83.471 150.449 116.585  1.00121.55           N  
ATOM   5365  C8   DA J   7      82.803 149.255 116.513  1.00121.55           C  
ATOM   5366  N7   DA J   7      81.520 149.344 116.767  1.00121.55           N  
ATOM   5367  C5   DA J   7      81.320 150.691 117.001  1.00121.55           C  
ATOM   5368  C6   DA J   7      80.169 151.431 117.324  1.00121.55           C  
ATOM   5369  N6   DA J   7      78.963 150.881 117.464  1.00121.55           N  
ATOM   5370  N1   DA J   7      80.305 152.760 117.496  1.00121.55           N  
ATOM   5371  C2   DA J   7      81.517 153.307 117.354  1.00121.55           C  
ATOM   5372  N3   DA J   7      82.675 152.715 117.052  1.00121.55           N  
ATOM   5373  C4   DA J   7      82.506 151.393 116.888  1.00121.55           C  
ATOM   5374  H5'  DA J   7      84.474 148.707 113.775  1.00121.55           H  
ATOM   5375 H5''  DA J   7      85.806 148.324 113.043  1.00121.55           H  
ATOM   5376  H4'  DA J   7      86.684 150.043 113.923  1.00121.55           H  
ATOM   5377  H3'  DA J   7      87.170 148.477 115.872  1.00121.55           H  
ATOM   5378  H2'  DA J   7      85.409 148.858 117.192  1.00121.55           H  
ATOM   5379 H2''  DA J   7      86.303 150.054 117.723  1.00121.55           H  
ATOM   5380  H1'  DA J   7      85.133 151.575 116.654  1.00121.55           H  
ATOM   5381  H8   DA J   7      83.225 148.449 116.321  1.00121.55           H  
ATOM   5382  H61  DA J   7      78.292 151.368 117.691  1.00121.55           H  
ATOM   5383  H62  DA J   7      78.855 150.041 117.321  1.00121.55           H  
ATOM   5384  H2   DA J   7      81.559 154.225 117.481  1.00121.55           H  
ATOM   5385  P    DT J   8      89.037 150.217 117.109  1.00131.15           P  
ATOM   5386  OP1  DT J   8      90.369 150.614 116.597  1.00131.15           O  
ATOM   5387  OP2  DT J   8      88.866 148.921 117.800  1.00131.15           O  
ATOM   5388  O5'  DT J   8      88.493 151.367 118.073  1.00131.15           O  
ATOM   5389  C5'  DT J   8      88.213 152.654 117.539  1.00131.15           C  
ATOM   5390  C4'  DT J   8      87.404 153.485 118.513  1.00131.15           C  
ATOM   5391  O4'  DT J   8      86.014 153.035 118.507  1.00131.15           O  
ATOM   5392  C3'  DT J   8      87.868 153.406 119.979  1.00131.15           C  
ATOM   5393  O3'  DT J   8      88.051 154.716 120.518  1.00131.15           O  
ATOM   5394  C2'  DT J   8      86.734 152.644 120.657  1.00131.15           C  
ATOM   5395  C1'  DT J   8      85.542 153.088 119.827  1.00131.15           C  
ATOM   5396  N1   DT J   8      84.287 152.239 119.984  1.00131.15           N  
ATOM   5397  C2   DT J   8      83.080 152.857 120.247  1.00131.15           C  
ATOM   5398  O2   DT J   8      82.946 154.061 120.346  1.00131.15           O  
ATOM   5399  N3   DT J   8      82.022 152.010 120.384  1.00131.15           N  
ATOM   5400  C4   DT J   8      82.037 150.634 120.296  1.00131.15           C  
ATOM   5401  O4   DT J   8      81.025 149.958 120.435  1.00131.15           O  
ATOM   5402  C5   DT J   8      83.323 150.047 120.025  1.00131.15           C  
ATOM   5403  C7   DT J   8      83.460 148.557 119.905  1.00131.15           C  
ATOM   5404  C6   DT J   8      84.373 150.865 119.883  1.00131.15           C  
ATOM   5405  H5'  DT J   8      87.711 152.555 116.715  1.00131.15           H  
ATOM   5406 H5''  DT J   8      89.048 153.109 117.350  1.00131.15           H  
ATOM   5407  H4'  DT J   8      87.432 154.412 118.228  1.00131.15           H  
ATOM   5408  H3'  DT J   8      88.693 152.900 120.042  1.00131.15           H  
ATOM   5409  H2'  DT J   8      86.881 151.689 120.588  1.00131.15           H  
ATOM   5410 H2''  DT J   8      86.634 152.912 121.576  1.00131.15           H  
ATOM   5411  H1'  DT J   8      85.336 154.007 120.048  1.00131.15           H  
ATOM   5412  H3   DT J   8      81.263 152.373 120.544  1.00131.15           H  
ATOM   5413  H71  DT J   8      84.155 148.348 119.262  1.00131.15           H  
ATOM   5414  H72  DT J   8      83.695 148.183 120.768  1.00131.15           H  
ATOM   5415  H73  DT J   8      82.619 148.178 119.606  1.00131.15           H  
ATOM   5416  H6   DT J   8      85.204 150.488 119.712  1.00131.15           H  
ATOM   5417  P    DC J   9      88.625 154.936 122.005  1.00147.02           P  
ATOM   5418  OP1  DC J   9      89.881 155.705 121.869  1.00147.02           O  
ATOM   5419  OP2  DC J   9      88.646 153.651 122.736  1.00147.02           O  
ATOM   5420  O5'  DC J   9      87.534 155.889 122.677  1.00147.02           O  
ATOM   5421  C5'  DC J   9      87.288 157.158 122.103  1.00147.02           C  
ATOM   5422  C4'  DC J   9      85.831 157.558 122.234  1.00147.02           C  
ATOM   5423  O4'  DC J   9      84.986 156.389 122.053  1.00147.02           O  
ATOM   5424  C3'  DC J   9      85.448 158.159 123.584  1.00147.02           C  
ATOM   5425  O3'  DC J   9      84.727 159.383 123.397  1.00147.02           O  
ATOM   5426  C2'  DC J   9      84.592 157.084 124.239  1.00147.02           C  
ATOM   5427  C1'  DC J   9      83.995 156.352 123.057  1.00147.02           C  
ATOM   5428  N1   DC J   9      83.635 154.908 123.303  1.00147.02           N  
ATOM   5429  C2   DC J   9      82.317 154.535 123.645  1.00147.02           C  
ATOM   5430  O2   DC J   9      81.452 155.407 123.790  1.00147.02           O  
ATOM   5431  N3   DC J   9      82.038 153.216 123.828  1.00147.02           N  
ATOM   5432  C4   DC J   9      82.997 152.303 123.665  1.00147.02           C  
ATOM   5433  N4   DC J   9      82.684 151.014 123.855  1.00147.02           N  
ATOM   5434  C5   DC J   9      84.326 152.666 123.310  1.00147.02           C  
ATOM   5435  C6   DC J   9      84.592 153.962 123.133  1.00147.02           C  
ATOM   5436  H5'  DC J   9      87.524 157.129 121.164  1.00147.02           H  
ATOM   5437 H5''  DC J   9      87.841 157.818 122.547  1.00147.02           H  
ATOM   5438  H4'  DC J   9      85.624 158.201 121.539  1.00147.02           H  
ATOM   5439  H3'  DC J   9      86.243 158.317 124.114  1.00147.02           H  
ATOM   5440  H2'  DC J   9      85.135 156.488 124.780  1.00147.02           H  
ATOM   5441 H2''  DC J   9      83.903 157.496 124.760  1.00147.02           H  
ATOM   5442  H1'  DC J   9      83.211 156.831 122.748  1.00147.02           H  
ATOM   5443  H41  DC J   9      83.271 150.402 123.708  1.00147.02           H  
ATOM   5444  H42  DC J   9      81.898 150.798 124.129  1.00147.02           H  
ATOM   5445  H5   DC J   9      84.985 152.021 123.195  1.00147.02           H  
ATOM   5446  H6   DC J   9      85.452 154.223 122.896  1.00147.02           H  
ATOM   5447  P    DC J  10      84.602 160.459 124.586  1.00149.03           P  
ATOM   5448  OP1  DC J  10      84.256 161.751 123.955  1.00149.03           O  
ATOM   5449  OP2  DC J  10      85.804 160.364 125.441  1.00149.03           O  
ATOM   5450  O5'  DC J  10      83.343 159.957 125.439  1.00149.03           O  
ATOM   5451  C5'  DC J  10      82.039 160.003 124.869  1.00149.03           C  
ATOM   5452  C4'  DC J  10      80.953 159.965 125.938  1.00149.03           C  
ATOM   5453  O4'  DC J  10      80.523 158.592 126.137  1.00149.03           O  
ATOM   5454  C3'  DC J  10      81.361 160.470 127.317  1.00149.03           C  
ATOM   5455  O3'  DC J  10      80.258 161.090 127.965  1.00149.03           O  
ATOM   5456  C2'  DC J  10      81.825 159.197 128.015  1.00149.03           C  
ATOM   5457  C1'  DC J  10      80.872 158.144 127.435  1.00149.03           C  
ATOM   5458  N1   DC J  10      81.419 156.706 127.305  1.00149.03           N  
ATOM   5459  C2   DC J  10      80.559 155.616 127.499  1.00149.03           C  
ATOM   5460  O2   DC J  10      79.385 155.826 127.823  1.00149.03           O  
ATOM   5461  N3   DC J  10      81.054 154.360 127.364  1.00149.03           N  
ATOM   5462  C4   DC J  10      82.330 154.177 127.022  1.00149.03           C  
ATOM   5463  N4   DC J  10      82.778 152.928 126.892  1.00149.03           N  
ATOM   5464  C5   DC J  10      83.205 155.264 126.802  1.00149.03           C  
ATOM   5465  C6   DC J  10      82.715 156.488 126.949  1.00149.03           C  
ATOM   5466  H5'  DC J  10      81.928 159.241 124.278  1.00149.03           H  
ATOM   5467 H5''  DC J  10      81.948 160.818 124.352  1.00149.03           H  
ATOM   5468  H4'  DC J  10      80.196 160.485 125.630  1.00149.03           H  
ATOM   5469  H3'  DC J  10      82.096 161.095 127.241  1.00149.03           H  
ATOM   5470  H2'  DC J  10      82.744 159.020 127.793  1.00149.03           H  
ATOM   5471 H2''  DC J  10      81.713 159.264 128.972  1.00149.03           H  
ATOM   5472  H1'  DC J  10      80.073 158.129 127.980  1.00149.03           H  
ATOM   5473  H41  DC J  10      83.599 152.787 126.678  1.00149.03           H  
ATOM   5474  H42  DC J  10      82.246 152.265 127.018  1.00149.03           H  
ATOM   5475  H5   DC J  10      84.092 155.126 126.562  1.00149.03           H  
ATOM   5476  H6   DC J  10      83.270 157.215 126.800  1.00149.03           H  
ATOM   5477  P    DA J  11      80.417 161.700 129.441  1.00144.77           P  
ATOM   5478  OP1  DA J  11      79.442 162.802 129.589  1.00144.77           O  
ATOM   5479  OP2  DA J  11      81.857 161.948 129.669  1.00144.77           O  
ATOM   5480  O5'  DA J  11      79.976 160.489 130.382  1.00144.77           O  
ATOM   5481  C5'  DA J  11      78.715 159.874 130.177  1.00144.77           C  
ATOM   5482  C4'  DA J  11      78.575 158.590 130.981  1.00144.77           C  
ATOM   5483  O4'  DA J  11      79.344 157.543 130.357  1.00144.77           O  
ATOM   5484  C3'  DA J  11      79.076 158.651 132.431  1.00144.77           C  
ATOM   5485  O3'  DA J  11      77.976 158.751 133.331  1.00144.77           O  
ATOM   5486  C2'  DA J  11      79.870 157.343 132.620  1.00144.77           C  
ATOM   5487  C1'  DA J  11      79.613 156.571 131.332  1.00144.77           C  
ATOM   5488  N9   DA J  11      80.732 155.748 130.885  1.00144.77           N  
ATOM   5489  C8   DA J  11      81.937 156.175 130.405  1.00144.77           C  
ATOM   5490  N7   DA J  11      82.743 155.201 130.060  1.00144.77           N  
ATOM   5491  C5   DA J  11      82.023 154.057 130.353  1.00144.77           C  
ATOM   5492  C6   DA J  11      82.317 152.687 130.214  1.00144.77           C  
ATOM   5493  N6   DA J  11      83.482 152.227 129.746  1.00144.77           N  
ATOM   5494  N1   DA J  11      81.374 151.802 130.599  1.00144.77           N  
ATOM   5495  C2   DA J  11      80.212 152.267 131.073  1.00144.77           C  
ATOM   5496  N3   DA J  11      79.821 153.527 131.240  1.00144.77           N  
ATOM   5497  C4   DA J  11      80.773 154.379 130.839  1.00144.77           C  
ATOM   5498  H5'  DA J  11      78.615 159.668 129.234  1.00144.77           H  
ATOM   5499 H5''  DA J  11      78.015 160.491 130.441  1.00144.77           H  
ATOM   5500  H4'  DA J  11      77.641 158.329 130.987  1.00144.77           H  
ATOM   5501  H3'  DA J  11      79.665 159.410 132.548  1.00144.77           H  
ATOM   5502  H2'  DA J  11      80.816 157.531 132.721  1.00144.77           H  
ATOM   5503 H2''  DA J  11      79.535 156.849 133.383  1.00144.77           H  
ATOM   5504  H1'  DA J  11      78.831 156.010 131.448  1.00144.77           H  
ATOM   5505  H8   DA J  11      82.154 157.072 130.309  1.00144.77           H  
ATOM   5506  H61  DA J  11      83.666 151.387 129.799  1.00144.77           H  
ATOM   5507  H62  DA J  11      84.049 152.770 129.397  1.00144.77           H  
ATOM   5508  H2   DA J  11      79.593 151.621 131.320  1.00144.77           H  
ATOM   5509  P    DC J  12      78.229 158.930 134.908  1.00137.96           P  
ATOM   5510  OP1  DC J  12      77.090 159.695 135.460  1.00137.96           O  
ATOM   5511  OP2  DC J  12      79.610 159.423 135.094  1.00137.96           O  
ATOM   5512  O5'  DC J  12      78.162 157.438 135.472  1.00137.96           O  
ATOM   5513  C5'  DC J  12      77.009 156.646 135.233  1.00137.96           C  
ATOM   5514  C4'  DC J  12      77.236 155.204 135.657  1.00137.96           C  
ATOM   5515  O4'  DC J  12      78.190 154.590 134.763  1.00137.96           O  
ATOM   5516  C3'  DC J  12      77.806 155.023 137.071  1.00137.96           C  
ATOM   5517  O3'  DC J  12      76.831 154.463 137.948  1.00137.96           O  
ATOM   5518  C2'  DC J  12      79.009 154.092 136.890  1.00137.96           C  
ATOM   5519  C1'  DC J  12      78.889 153.594 135.461  1.00137.96           C  
ATOM   5520  N1   DC J  12      80.205 153.374 134.789  1.00137.96           N  
ATOM   5521  C2   DC J  12      80.704 152.077 134.606  1.00137.96           C  
ATOM   5522  O2   DC J  12      80.048 151.112 135.007  1.00137.96           O  
ATOM   5523  N3   DC J  12      81.899 151.921 133.995  1.00137.96           N  
ATOM   5524  C4   DC J  12      82.579 152.985 133.580  1.00137.96           C  
ATOM   5525  N4   DC J  12      83.753 152.787 132.982  1.00137.96           N  
ATOM   5526  C5   DC J  12      82.097 154.304 133.772  1.00137.96           C  
ATOM   5527  C6   DC J  12      80.913 154.449 134.358  1.00137.96           C  
ATOM   5528  H5'  DC J  12      76.800 156.669 134.286  1.00137.96           H  
ATOM   5529 H5''  DC J  12      76.263 157.011 135.731  1.00137.96           H  
ATOM   5530  H4'  DC J  12      76.395 154.725 135.595  1.00137.96           H  
ATOM   5531  H3'  DC J  12      78.104 155.878 137.416  1.00137.96           H  
ATOM   5532  H2'  DC J  12      79.838 154.579 137.014  1.00137.96           H  
ATOM   5533 H2''  DC J  12      78.954 153.355 137.503  1.00137.96           H  
ATOM   5534  H1'  DC J  12      78.373 152.777 135.449  1.00137.96           H  
ATOM   5535  H41  DC J  12      84.221 153.459 132.721  1.00137.96           H  
ATOM   5536  H42  DC J  12      84.037 151.986 132.848  1.00137.96           H  
ATOM   5537  H5   DC J  12      82.573 155.038 133.461  1.00137.96           H  
ATOM   5538  H6   DC J  12      80.571 155.301 134.489  1.00137.96           H  
ATOM   5539  P    DC J  13      77.163 154.268 139.510  1.00134.75           P  
ATOM   5540  OP1  DC J  13      75.882 154.300 140.248  1.00134.75           O  
ATOM   5541  OP2  DC J  13      78.242 155.216 139.860  1.00134.75           O  
ATOM   5542  O5'  DC J  13      77.773 152.790 139.596  1.00134.75           O  
ATOM   5543  C5'  DC J  13      77.113 151.717 138.941  1.00134.75           C  
ATOM   5544  C4'  DC J  13      77.543 150.360 139.492  1.00134.75           C  
ATOM   5545  O4'  DC J  13      78.656 149.851 138.710  1.00134.75           O  
ATOM   5546  C3'  DC J  13      78.002 150.349 140.945  1.00134.75           C  
ATOM   5547  O3'  DC J  13      77.529 149.187 141.602  1.00134.75           O  
ATOM   5548  C2'  DC J  13      79.528 150.403 140.849  1.00134.75           C  
ATOM   5549  C1'  DC J  13      79.836 149.765 139.487  1.00134.75           C  
ATOM   5550  N1   DC J  13      80.976 150.426 138.681  1.00134.75           N  
ATOM   5551  C2   DC J  13      81.982 149.637 138.092  1.00134.75           C  
ATOM   5552  O2   DC J  13      81.969 148.413 138.256  1.00134.75           O  
ATOM   5553  N3   DC J  13      82.956 150.250 137.365  1.00134.75           N  
ATOM   5554  C4   DC J  13      82.942 151.574 137.206  1.00134.75           C  
ATOM   5555  N4   DC J  13      83.916 152.137 136.484  1.00134.75           N  
ATOM   5556  C5   DC J  13      81.930 152.384 137.778  1.00134.75           C  
ATOM   5557  C6   DC J  13      80.975 151.779 138.487  1.00134.75           C  
ATOM   5558  H5'  DC J  13      77.319 151.753 137.994  1.00134.75           H  
ATOM   5559 H5''  DC J  13      76.157 151.817 139.059  1.00134.75           H  
ATOM   5560  H4'  DC J  13      76.800 149.745 139.403  1.00134.75           H  
ATOM   5561  H3'  DC J  13      77.673 151.136 141.401  1.00134.75           H  
ATOM   5562  H2'  DC J  13      79.827 151.317 140.887  1.00134.75           H  
ATOM   5563 H2''  DC J  13      79.935 149.886 141.558  1.00134.75           H  
ATOM   5564  H1'  DC J  13      80.046 148.831 139.630  1.00134.75           H  
ATOM   5565  H41  DC J  13      83.938 152.992 136.386  1.00134.75           H  
ATOM   5566  H42  DC J  13      84.518 151.646 136.116  1.00134.75           H  
ATOM   5567  H5   DC J  13      81.930 153.306 137.660  1.00134.75           H  
ATOM   5568  H6   DC J  13      80.302 152.293 138.872  1.00134.75           H  
ATOM   5569  P    DT J  14      77.830 148.959 143.162  1.00128.18           P  
ATOM   5570  OP1  DT J  14      76.700 148.199 143.737  1.00128.18           O  
ATOM   5571  OP2  DT J  14      78.213 150.266 143.737  1.00128.18           O  
ATOM   5572  O5'  DT J  14      79.132 148.035 143.146  1.00128.18           O  
ATOM   5573  C5'  DT J  14      79.201 146.944 142.235  1.00128.18           C  
ATOM   5574  C4'  DT J  14      80.531 146.210 142.333  1.00128.18           C  
ATOM   5575  O4'  DT J  14      81.491 146.837 141.439  1.00128.18           O  
ATOM   5576  C3'  DT J  14      81.185 146.202 143.719  1.00128.18           C  
ATOM   5577  O3'  DT J  14      81.689 144.912 144.011  1.00128.18           O  
ATOM   5578  C2'  DT J  14      82.291 147.249 143.592  1.00128.18           C  
ATOM   5579  C1'  DT J  14      82.691 147.104 142.132  1.00128.18           C  
ATOM   5580  N1   DT J  14      83.354 148.316 141.480  1.00128.18           N  
ATOM   5581  C2   DT J  14      84.425 148.118 140.642  1.00128.18           C  
ATOM   5582  O2   DT J  14      84.911 147.025 140.415  1.00128.18           O  
ATOM   5583  N3   DT J  14      84.925 149.252 140.078  1.00128.18           N  
ATOM   5584  C4   DT J  14      84.469 150.537 140.248  1.00128.18           C  
ATOM   5585  O4   DT J  14      84.984 151.496 139.698  1.00128.18           O  
ATOM   5586  C5   DT J  14      83.346 150.679 141.115  1.00128.18           C  
ATOM   5587  C7   DT J  14      82.781 152.033 141.370  1.00128.18           C  
ATOM   5588  C6   DT J  14      82.836 149.580 141.675  1.00128.18           C  
ATOM   5589  H5'  DT J  14      79.094 147.281 141.331  1.00128.18           H  
ATOM   5590 H5''  DT J  14      78.482 146.324 142.429  1.00128.18           H  
ATOM   5591  H4'  DT J  14      80.399 145.291 142.050  1.00128.18           H  
ATOM   5592  H3'  DT J  14      80.546 146.471 144.396  1.00128.18           H  
ATOM   5593  H2'  DT J  14      81.946 148.130 143.786  1.00128.18           H  
ATOM   5594 H2''  DT J  14      83.031 147.033 144.164  1.00128.18           H  
ATOM   5595  H1'  DT J  14      83.277 146.337 142.051  1.00128.18           H  
ATOM   5596  H3   DT J  14      85.599 149.153 139.557  1.00128.18           H  
ATOM   5597  H71  DT J  14      81.874 151.950 141.691  1.00128.18           H  
ATOM   5598  H72  DT J  14      83.320 152.485 142.037  1.00128.18           H  
ATOM   5599  H73  DT J  14      82.791 152.545 140.548  1.00128.18           H  
ATOM   5600  H6   DT J  14      82.109 149.675 142.241  1.00128.18           H  
ATOM   5601  P    DG J  15      82.153 144.524 145.499  1.00121.92           P  
ATOM   5602  OP1  DG J  15      81.007 143.829 146.120  1.00121.92           O  
ATOM   5603  OP2  DG J  15      82.708 145.717 146.170  1.00121.92           O  
ATOM   5604  O5'  DG J  15      83.336 143.452 145.299  1.00121.92           O  
ATOM   5605  C5'  DG J  15      84.074 143.328 144.054  1.00121.92           C  
ATOM   5606  C4'  DG J  15      85.564 143.534 144.262  1.00121.92           C  
ATOM   5607  O4'  DG J  15      85.909 144.890 143.854  1.00121.92           O  
ATOM   5608  C3'  DG J  15      86.056 143.403 145.705  1.00121.92           C  
ATOM   5609  O3'  DG J  15      87.364 142.884 145.746  1.00121.92           O  
ATOM   5610  C2'  DG J  15      86.001 144.840 146.184  1.00121.92           C  
ATOM   5611  C1'  DG J  15      86.498 145.573 144.940  1.00121.92           C  
ATOM   5612  N9   DG J  15      86.154 146.998 144.848  1.00121.92           N  
ATOM   5613  C8   DG J  15      85.264 147.707 145.618  1.00121.92           C  
ATOM   5614  N7   DG J  15      85.173 148.962 145.284  1.00121.92           N  
ATOM   5615  C5   DG J  15      86.068 149.098 144.235  1.00121.92           C  
ATOM   5616  C6   DG J  15      86.407 150.235 143.470  1.00121.92           C  
ATOM   5617  O6   DG J  15      85.969 151.389 143.571  1.00121.92           O  
ATOM   5618  N1   DG J  15      87.362 149.938 142.503  1.00121.92           N  
ATOM   5619  C2   DG J  15      87.918 148.698 142.305  1.00121.92           C  
ATOM   5620  N2   DG J  15      88.823 148.596 141.320  1.00121.92           N  
ATOM   5621  N3   DG J  15      87.606 147.627 143.016  1.00121.92           N  
ATOM   5622  C4   DG J  15      86.678 147.900 143.958  1.00121.92           C  
ATOM   5623  H5'  DG J  15      83.762 143.985 143.420  1.00121.92           H  
ATOM   5624 H5''  DG J  15      83.928 142.443 143.688  1.00121.92           H  
ATOM   5625  H4'  DG J  15      86.049 142.907 143.706  1.00121.92           H  
ATOM   5626  H3'  DG J  15      85.460 142.846 146.224  1.00121.92           H  
ATOM   5627  H2'  DG J  15      85.092 145.088 146.405  1.00121.92           H  
ATOM   5628 H2''  DG J  15      86.595 144.978 146.934  1.00121.92           H  
ATOM   5629  H1'  DG J  15      87.457 145.480 144.878  1.00121.92           H  
ATOM   5630  H8   DG J  15      84.761 147.323 146.299  1.00121.92           H  
ATOM   5631  H1   DG J  15      87.625 150.579 141.994  1.00121.92           H  
ATOM   5632  H21  DG J  15      89.172 147.832 141.133  1.00121.92           H  
ATOM   5633  H22  DG J  15      89.054 149.296 140.873  1.00121.92           H  
ATOM   5634  P    DC J  16      87.620 141.308 145.599  1.00111.85           P  
ATOM   5635  OP1  DC J  16      86.575 140.736 144.724  1.00111.85           O  
ATOM   5636  OP2  DC J  16      87.816 140.757 146.956  1.00111.85           O  
ATOM   5637  O5'  DC J  16      89.019 141.243 144.838  1.00111.85           O  
ATOM   5638  C5'  DC J  16      89.223 142.026 143.669  1.00111.85           C  
ATOM   5639  C4'  DC J  16      90.502 142.859 143.748  1.00111.85           C  
ATOM   5640  O4'  DC J  16      90.151 144.267 143.942  1.00111.85           O  
ATOM   5641  C3'  DC J  16      91.463 142.525 144.895  1.00111.85           C  
ATOM   5642  O3'  DC J  16      92.798 142.708 144.492  1.00111.85           O  
ATOM   5643  C2'  DC J  16      91.047 143.531 145.947  1.00111.85           C  
ATOM   5644  C1'  DC J  16      90.846 144.760 145.069  1.00111.85           C  
ATOM   5645  N1   DC J  16      90.068 145.929 145.669  1.00111.85           N  
ATOM   5646  C2   DC J  16      90.100 147.167 145.016  1.00111.85           C  
ATOM   5647  O2   DC J  16      90.755 147.286 143.979  1.00111.85           O  
ATOM   5648  N3   DC J  16      89.416 148.205 145.539  1.00111.85           N  
ATOM   5649  C4   DC J  16      88.723 148.047 146.659  1.00111.85           C  
ATOM   5650  N4   DC J  16      88.059 149.096 147.137  1.00111.85           N  
ATOM   5651  C5   DC J  16      88.676 146.806 147.342  1.00111.85           C  
ATOM   5652  C6   DC J  16      89.360 145.788 146.827  1.00111.85           C  
ATOM   5653  H5'  DC J  16      88.466 142.622 143.553  1.00111.85           H  
ATOM   5654 H5''  DC J  16      89.277 141.437 142.903  1.00111.85           H  
ATOM   5655  H4'  DC J  16      90.981 142.772 142.911  1.00111.85           H  
ATOM   5656  H3'  DC J  16      91.332 141.621 145.210  1.00111.85           H  
ATOM   5657  H2'  DC J  16      90.223 143.250 146.370  1.00111.85           H  
ATOM   5658 H2''  DC J  16      91.751 143.672 146.597  1.00111.85           H  
ATOM   5659  H1'  DC J  16      91.713 145.080 144.783  1.00111.85           H  
ATOM   5660  H41  DC J  16      87.583 149.016 147.848  1.00111.85           H  
ATOM   5661  H42  DC J  16      88.101 149.851 146.729  1.00111.85           H  
ATOM   5662  H5   DC J  16      88.185 146.708 148.123  1.00111.85           H  
ATOM   5663  H6   DC J  16      89.334 144.966 147.250  1.00111.85           H  
ATOM   5664  P    DA J  17      93.590 141.527 143.753  1.00105.06           P  
ATOM   5665  OP1  DA J  17      92.668 140.915 142.773  1.00105.06           O  
ATOM   5666  OP2  DA J  17      94.205 140.679 144.798  1.00105.06           O  
ATOM   5667  O5'  DA J  17      94.752 142.297 142.971  1.00105.06           O  
ATOM   5668  C5'  DA J  17      94.414 143.263 141.986  1.00105.06           C  
ATOM   5669  C4'  DA J  17      95.394 144.422 141.986  1.00105.06           C  
ATOM   5670  O4'  DA J  17      94.982 145.406 142.971  1.00105.06           O  
ATOM   5671  C3'  DA J  17      96.822 144.058 142.341  1.00105.06           C  
ATOM   5672  O3'  DA J  17      97.737 144.878 141.630  1.00105.06           O  
ATOM   5673  C2'  DA J  17      96.870 144.294 143.842  1.00105.06           C  
ATOM   5674  C1'  DA J  17      95.939 145.500 144.012  1.00105.06           C  
ATOM   5675  N9   DA J  17      95.202 145.597 145.286  1.00105.06           N  
ATOM   5676  C8   DA J  17      94.984 144.621 146.222  1.00105.06           C  
ATOM   5677  N7   DA J  17      94.259 145.015 147.241  1.00105.06           N  
ATOM   5678  C5   DA J  17      93.968 146.333 146.950  1.00105.06           C  
ATOM   5679  C6   DA J  17      93.232 147.314 147.637  1.00105.06           C  
ATOM   5680  N6   DA J  17      92.634 147.096 148.805  1.00105.06           N  
ATOM   5681  N1   DA J  17      93.135 148.534 147.074  1.00105.06           N  
ATOM   5682  C2   DA J  17      93.735 148.749 145.901  1.00105.06           C  
ATOM   5683  N3   DA J  17      94.458 147.909 145.165  1.00105.06           N  
ATOM   5684  C4   DA J  17      94.536 146.706 145.751  1.00105.06           C  
ATOM   5685  H5'  DA J  17      93.525 143.601 142.169  1.00105.06           H  
ATOM   5686 H5''  DA J  17      94.422 142.843 141.114  1.00105.06           H  
ATOM   5687  H4'  DA J  17      95.387 144.834 141.111  1.00105.06           H  
ATOM   5688  H3'  DA J  17      96.984 143.126 142.145  1.00105.06           H  
ATOM   5689  H2'  DA J  17      96.541 143.517 144.309  1.00105.06           H  
ATOM   5690 H2''  DA J  17      97.770 144.512 144.121  1.00105.06           H  
ATOM   5691  H1'  DA J  17      96.451 146.308 143.890  1.00105.06           H  
ATOM   5692  H8   DA J  17      95.326 143.760 146.147  1.00105.06           H  
ATOM   5693  H61  DA J  17      92.365 147.760 149.281  1.00105.06           H  
ATOM   5694  H62  DA J  17      92.523 146.292 149.086  1.00105.06           H  
ATOM   5695  H2   DA J  17      93.642 149.606 145.555  1.00105.06           H  
ATOM   5696  P    DG J  18      99.242 144.383 141.377  1.00 98.27           P  
ATOM   5697  OP1  DG J  18      99.831 145.273 140.354  1.00 98.27           O  
ATOM   5698  OP2  DG J  18      99.229 142.922 141.148  1.00 98.27           O  
ATOM   5699  O5'  DG J  18      99.968 144.650 142.773  1.00 98.27           O  
ATOM   5700  C5'  DG J  18     100.794 145.793 142.938  1.00 98.27           C  
ATOM   5701  C4'  DG J  18      99.983 147.073 142.871  1.00 98.27           C  
ATOM   5702  O4'  DG J  18      98.799 146.927 143.699  1.00 98.27           O  
ATOM   5703  C3'  DG J  18     100.705 148.308 143.396  1.00 98.27           C  
ATOM   5704  O3'  DG J  18     100.353 149.472 142.660  1.00 98.27           O  
ATOM   5705  C2'  DG J  18     100.237 148.383 144.831  1.00 98.27           C  
ATOM   5706  C1'  DG J  18      98.805 147.902 144.722  1.00 98.27           C  
ATOM   5707  N9   DG J  18      98.277 147.310 145.951  1.00 98.27           N  
ATOM   5708  C8   DG J  18      98.463 146.028 146.406  1.00 98.27           C  
ATOM   5709  N7   DG J  18      97.860 145.786 147.538  1.00 98.27           N  
ATOM   5710  C5   DG J  18      97.237 146.985 147.851  1.00 98.27           C  
ATOM   5711  C6   DG J  18      96.439 147.334 148.961  1.00 98.27           C  
ATOM   5712  O6   DG J  18      96.107 146.628 149.920  1.00 98.27           O  
ATOM   5713  N1   DG J  18      96.007 148.649 148.887  1.00 98.27           N  
ATOM   5714  C2   DG J  18      96.305 149.515 147.867  1.00 98.27           C  
ATOM   5715  N2   DG J  18      95.811 150.752 147.965  1.00 98.27           N  
ATOM   5716  N3   DG J  18      97.058 149.203 146.830  1.00 98.27           N  
ATOM   5717  C4   DG J  18      97.485 147.929 146.885  1.00 98.27           C  
ATOM   5718  H5'  DG J  18     101.464 145.805 142.238  1.00 98.27           H  
ATOM   5719 H5''  DG J  18     101.235 145.743 143.800  1.00 98.27           H  
ATOM   5720  H4'  DG J  18      99.711 147.231 141.955  1.00 98.27           H  
ATOM   5721  H3'  DG J  18     101.662 148.169 143.365  1.00 98.27           H  
ATOM   5722  H2'  DG J  18     100.759 147.794 145.396  1.00 98.27           H  
ATOM   5723 H2''  DG J  18     100.269 149.292 145.149  1.00 98.27           H  
ATOM   5724  H1'  DG J  18      98.241 148.643 144.456  1.00 98.27           H  
ATOM   5725  H8   DG J  18      98.968 145.393 145.951  1.00 98.27           H  
ATOM   5726  H1   DG J  18      95.513 148.941 149.523  1.00 98.27           H  
ATOM   5727  H21  DG J  18      95.931 151.314 147.326  1.00 98.27           H  
ATOM   5728  H22  DG J  18      95.380 150.987 148.669  1.00 98.27           H  
ATOM   5729  P    DA J  19     101.167 150.840 142.885  1.00 93.96           P  
ATOM   5730  OP1  DA J  19     101.058 151.621 141.635  1.00 93.96           O  
ATOM   5731  OP2  DA J  19     102.503 150.500 143.418  1.00 93.96           O  
ATOM   5732  O5'  DA J  19     100.371 151.592 144.056  1.00 93.96           O  
ATOM   5733  C5'  DA J  19      99.576 152.735 143.753  1.00 93.96           C  
ATOM   5734  C4'  DA J  19      99.177 153.488 145.006  1.00 93.96           C  
ATOM   5735  O4'  DA J  19      98.701 152.545 146.007  1.00 93.96           O  
ATOM   5736  C3'  DA J  19     100.298 154.281 145.675  1.00 93.96           C  
ATOM   5737  O3'  DA J  19      99.836 155.564 146.045  1.00 93.96           O  
ATOM   5738  C2'  DA J  19     100.667 153.424 146.874  1.00 93.96           C  
ATOM   5739  C1'  DA J  19      99.332 152.812 147.241  1.00 93.96           C  
ATOM   5740  N9   DA J  19      99.402 151.566 148.020  1.00 93.96           N  
ATOM   5741  C8   DA J  19     100.091 150.429 147.708  1.00 93.96           C  
ATOM   5742  N7   DA J  19      99.956 149.469 148.588  1.00 93.96           N  
ATOM   5743  C5   DA J  19      99.110 150.004 149.533  1.00 93.96           C  
ATOM   5744  C6   DA J  19      98.567 149.481 150.716  1.00 93.96           C  
ATOM   5745  N6   DA J  19      98.826 148.252 151.158  1.00 93.96           N  
ATOM   5746  N1   DA J  19      97.749 150.273 151.432  1.00 93.96           N  
ATOM   5747  C2   DA J  19      97.490 151.502 150.980  1.00 93.96           C  
ATOM   5748  N3   DA J  19      97.941 152.102 149.884  1.00 93.96           N  
ATOM   5749  C4   DA J  19      98.754 151.292 149.199  1.00 93.96           C  
ATOM   5750  H5'  DA J  19      98.776 152.450 143.287  1.00 93.96           H  
ATOM   5751 H5''  DA J  19     100.081 153.327 143.180  1.00 93.96           H  
ATOM   5752  H4'  DA J  19      98.458 154.097 144.785  1.00 93.96           H  
ATOM   5753  H3'  DA J  19     101.053 154.358 145.079  1.00 93.96           H  
ATOM   5754  H2'  DA J  19     101.306 152.742 146.622  1.00 93.96           H  
ATOM   5755 H2''  DA J  19     101.007 153.969 147.597  1.00 93.96           H  
ATOM   5756  H1'  DA J  19      98.810 153.465 147.729  1.00 93.96           H  
ATOM   5757  H8   DA J  19     100.627 150.353 146.955  1.00 93.96           H  
ATOM   5758  H61  DA J  19      98.613 148.030 151.962  1.00 93.96           H  
ATOM   5759  H62  DA J  19      99.199 147.678 150.638  1.00 93.96           H  
ATOM   5760  H2   DA J  19      96.923 152.011 151.509  1.00 93.96           H  
ATOM   5761  P    DT J  20     100.845 156.644 146.666  1.00 90.58           P  
ATOM   5762  OP1  DT J  20     100.652 157.909 145.930  1.00 90.58           O  
ATOM   5763  OP2  DT J  20     102.183 156.022 146.733  1.00 90.58           O  
ATOM   5764  O5'  DT J  20     100.312 156.840 148.156  1.00 90.58           O  
ATOM   5765  C5'  DT J  20      98.965 157.219 148.367  1.00 90.58           C  
ATOM   5766  C4'  DT J  20      98.579 157.094 149.830  1.00 90.58           C  
ATOM   5767  O4'  DT J  20      98.662 155.698 150.235  1.00 90.58           O  
ATOM   5768  C3'  DT J  20      99.473 157.871 150.795  1.00 90.58           C  
ATOM   5769  O3'  DT J  20      98.696 158.618 151.713  1.00 90.58           O  
ATOM   5770  C2'  DT J  20     100.290 156.783 151.475  1.00 90.58           C  
ATOM   5771  C1'  DT J  20      99.327 155.613 151.471  1.00 90.58           C  
ATOM   5772  N1   DT J  20      99.977 154.244 151.595  1.00 90.58           N  
ATOM   5773  C2   DT J  20      99.642 153.418 152.649  1.00 90.58           C  
ATOM   5774  O2   DT J  20      98.841 153.720 153.514  1.00 90.58           O  
ATOM   5775  N3   DT J  20     100.281 152.208 152.651  1.00 90.58           N  
ATOM   5776  C4   DT J  20     101.195 151.747 151.737  1.00 90.58           C  
ATOM   5777  O4   DT J  20     101.716 150.642 151.832  1.00 90.58           O  
ATOM   5778  C5   DT J  20     101.499 152.652 150.664  1.00 90.58           C  
ATOM   5779  C7   DT J  20     102.493 152.265 149.617  1.00 90.58           C  
ATOM   5780  C6   DT J  20     100.880 153.838 150.639  1.00 90.58           C  
ATOM   5781  H5'  DT J  20      98.390 156.649 147.836  1.00 90.58           H  
ATOM   5782 H5''  DT J  20      98.848 158.138 148.086  1.00 90.58           H  
ATOM   5783  H4'  DT J  20      97.667 157.398 149.940  1.00 90.58           H  
ATOM   5784  H3'  DT J  20     100.056 158.460 150.298  1.00 90.58           H  
ATOM   5785  H2'  DT J  20     101.080 156.583 150.959  1.00 90.58           H  
ATOM   5786 H2''  DT J  20     100.520 157.037 152.380  1.00 90.58           H  
ATOM   5787  H1'  DT J  20      98.684 155.734 152.182  1.00 90.58           H  
ATOM   5788  H3   DT J  20     100.090 151.678 153.296  1.00 90.58           H  
ATOM   5789  H71  DT J  20     103.014 151.510 149.927  1.00 90.58           H  
ATOM   5790  H72  DT J  20     102.033 152.026 148.810  1.00 90.58           H  
ATOM   5791  H73  DT J  20     103.083 153.013 149.443  1.00 90.58           H  
ATOM   5792  H6   DT J  20     101.082 154.424 149.951  1.00 90.58           H  
ATOM   5793  P    DT J  21      99.406 159.676 152.690  1.00 95.56           P  
ATOM   5794  OP1  DT J  21      98.493 160.830 152.830  1.00 95.56           O  
ATOM   5795  OP2  DT J  21     100.788 159.885 152.211  1.00 95.56           O  
ATOM   5796  O5'  DT J  21      99.488 158.909 154.091  1.00 95.56           O  
ATOM   5797  C5'  DT J  21      98.300 158.669 154.830  1.00 95.56           C  
ATOM   5798  C4'  DT J  21      98.528 157.650 155.939  1.00 95.56           C  
ATOM   5799  O4'  DT J  21      99.135 156.449 155.387  1.00 95.56           O  
ATOM   5800  C3'  DT J  21      99.464 158.110 157.069  1.00 95.56           C  
ATOM   5801  O3'  DT J  21      98.806 158.009 158.333  1.00 95.56           O  
ATOM   5802  C2'  DT J  21     100.659 157.166 156.961  1.00 95.56           C  
ATOM   5803  C1'  DT J  21     100.036 155.939 156.335  1.00 95.56           C  
ATOM   5804  N1   DT J  21     101.014 155.007 155.655  1.00 95.56           N  
ATOM   5805  C2   DT J  21     101.216 153.741 156.168  1.00 95.56           C  
ATOM   5806  O2   DT J  21     100.669 153.327 157.173  1.00 95.56           O  
ATOM   5807  N3   DT J  21     102.126 152.987 155.487  1.00 95.56           N  
ATOM   5808  C4   DT J  21     102.820 153.341 154.352  1.00 95.56           C  
ATOM   5809  O4   DT J  21     103.610 152.582 153.805  1.00 95.56           O  
ATOM   5810  C5   DT J  21     102.556 154.667 153.854  1.00 95.56           C  
ATOM   5811  C7   DT J  21     103.265 155.160 152.630  1.00 95.56           C  
ATOM   5812  C6   DT J  21     101.675 155.429 154.519  1.00 95.56           C  
ATOM   5813  H5'  DT J  21      97.615 158.336 154.228  1.00 95.56           H  
ATOM   5814 H5''  DT J  21      97.997 159.503 155.223  1.00 95.56           H  
ATOM   5815  H4'  DT J  21      97.671 157.415 156.325  1.00 95.56           H  
ATOM   5816  H3'  DT J  21      99.748 159.022 156.915  1.00 95.56           H  
ATOM   5817  H2'  DT J  21     101.342 157.540 156.386  1.00 95.56           H  
ATOM   5818 H2''  DT J  21     101.013 156.964 157.831  1.00 95.56           H  
ATOM   5819  H1'  DT J  21      99.541 155.457 157.012  1.00 95.56           H  
ATOM   5820  H3   DT J  21     102.275 152.199 155.794  1.00 95.56           H  
ATOM   5821  H71  DT J  21     102.807 155.935 152.282  1.00 95.56           H  
ATOM   5822  H72  DT J  21     104.176 155.402 152.861  1.00 95.56           H  
ATOM   5823  H73  DT J  21     103.279 154.462 151.960  1.00 95.56           H  
ATOM   5824  H6   DT J  21     101.503 156.285 154.201  1.00 95.56           H  
ATOM   5825  P    DC J  22      99.528 158.523 159.673  1.00 92.50           P  
ATOM   5826  OP1  DC J  22      98.507 159.206 160.496  1.00 92.50           O  
ATOM   5827  OP2  DC J  22     100.759 159.237 159.274  1.00 92.50           O  
ATOM   5828  O5'  DC J  22      99.959 157.174 160.416  1.00 92.50           O  
ATOM   5829  C5'  DC J  22      98.959 156.274 160.856  1.00 92.50           C  
ATOM   5830  C4'  DC J  22      99.551 155.141 161.678  1.00 92.50           C  
ATOM   5831  O4'  DC J  22     100.341 154.276 160.815  1.00 92.50           O  
ATOM   5832  C3'  DC J  22     100.487 155.575 162.798  1.00 92.50           C  
ATOM   5833  O3'  DC J  22     100.323 154.738 163.939  1.00 92.50           O  
ATOM   5834  C2'  DC J  22     101.862 155.436 162.164  1.00 92.50           C  
ATOM   5835  C1'  DC J  22     101.676 154.213 161.276  1.00 92.50           C  
ATOM   5836  N1   DC J  22     102.581 154.138 160.064  1.00 92.50           N  
ATOM   5837  C2   DC J  22     103.340 152.979 159.805  1.00 92.50           C  
ATOM   5838  O2   DC J  22     103.294 152.030 160.598  1.00 92.50           O  
ATOM   5839  N3   DC J  22     104.116 152.942 158.691  1.00 92.50           N  
ATOM   5840  C4   DC J  22     104.140 153.985 157.861  1.00 92.50           C  
ATOM   5841  N4   DC J  22     104.912 153.909 156.774  1.00 92.50           N  
ATOM   5842  C5   DC J  22     103.378 155.158 158.109  1.00 92.50           C  
ATOM   5843  C6   DC J  22     102.604 155.176 159.191  1.00 92.50           C  
ATOM   5844  H5'  DC J  22      98.507 155.904 160.083  1.00 92.50           H  
ATOM   5845 H5''  DC J  22      98.316 156.756 161.397  1.00 92.50           H  
ATOM   5846  H4'  DC J  22      98.827 154.623 162.061  1.00 92.50           H  
ATOM   5847  H3'  DC J  22     100.319 156.500 163.032  1.00 92.50           H  
ATOM   5848  H2'  DC J  22     102.074 156.223 161.645  1.00 92.50           H  
ATOM   5849 H2''  DC J  22     102.538 155.271 162.838  1.00 92.50           H  
ATOM   5850  H1'  DC J  22     101.784 153.420 161.814  1.00 92.50           H  
ATOM   5851  H41  DC J  22     104.957 154.576 156.233  1.00 92.50           H  
ATOM   5852  H42  DC J  22     105.354 153.192 156.610  1.00 92.50           H  
ATOM   5853  H5   DC J  22     103.390 155.872 157.516  1.00 92.50           H  
ATOM   5854  H6   DC J  22     102.096 155.932 159.374  1.00 92.50           H  
ATOM   5855  P    DT J  23     100.966 155.147 165.353  1.00 91.65           P  
ATOM   5856  OP1  DT J  23      99.988 154.774 166.396  1.00 91.65           O  
ATOM   5857  OP2  DT J  23     101.453 156.540 165.259  1.00 91.65           O  
ATOM   5858  O5'  DT J  23     102.236 154.186 165.487  1.00 91.65           O  
ATOM   5859  C5'  DT J  23     102.047 152.788 165.589  1.00 91.65           C  
ATOM   5860  C4'  DT J  23     103.374 152.059 165.649  1.00 91.65           C  
ATOM   5861  O4'  DT J  23     104.004 152.069 164.332  1.00 91.65           O  
ATOM   5862  C3'  DT J  23     104.396 152.667 166.609  1.00 91.65           C  
ATOM   5863  O3'  DT J  23     105.030 151.641 167.371  1.00 91.65           O  
ATOM   5864  C2'  DT J  23     105.362 153.392 165.674  1.00 91.65           C  
ATOM   5865  C1'  DT J  23     105.351 152.473 164.459  1.00 91.65           C  
ATOM   5866  N1   DT J  23     105.808 153.088 163.131  1.00 91.65           N  
ATOM   5867  C2   DT J  23     106.654 152.371 162.304  1.00 91.65           C  
ATOM   5868  O2   DT J  23     107.093 151.271 162.582  1.00 91.65           O  
ATOM   5869  N3   DT J  23     106.978 152.999 161.133  1.00 91.65           N  
ATOM   5870  C4   DT J  23     106.541 154.230 160.701  1.00 91.65           C  
ATOM   5871  O4   DT J  23     106.894 154.717 159.633  1.00 91.65           O  
ATOM   5872  C5   DT J  23     105.663 154.922 161.601  1.00 91.65           C  
ATOM   5873  C7   DT J  23     105.143 156.276 161.237  1.00 91.65           C  
ATOM   5874  C6   DT J  23     105.332 154.324 162.750  1.00 91.65           C  
ATOM   5875  H5'  DT J  23     101.547 152.478 164.819  1.00 91.65           H  
ATOM   5876 H5''  DT J  23     101.542 152.596 166.393  1.00 91.65           H  
ATOM   5877  H4'  DT J  23     103.212 151.140 165.910  1.00 91.65           H  
ATOM   5878  H3'  DT J  23     103.960 153.302 167.198  1.00 91.65           H  
ATOM   5879  H2'  DT J  23     105.025 154.273 165.458  1.00 91.65           H  
ATOM   5880 H2''  DT J  23     106.244 153.443 166.062  1.00 91.65           H  
ATOM   5881  H1'  DT J  23     105.895 151.696 164.654  1.00 91.65           H  
ATOM   5882  H3   DT J  23     107.506 152.576 160.607  1.00 91.65           H  
ATOM   5883  H71  DT J  23     104.365 156.478 161.772  1.00 91.65           H  
ATOM   5884  H72  DT J  23     105.830 156.939 161.405  1.00 91.65           H  
ATOM   5885  H73  DT J  23     104.906 156.290 160.300  1.00 91.65           H  
ATOM   5886  H6   DT J  23     104.762 154.772 163.329  1.00 91.65           H  
ATOM   5887  P    DA J  24     106.055 152.009 168.552  1.00 95.23           P  
ATOM   5888  OP1  DA J  24     105.688 151.194 169.730  1.00 95.23           O  
ATOM   5889  OP2  DA J  24     106.112 153.483 168.662  1.00 95.23           O  
ATOM   5890  O5'  DA J  24     107.464 151.495 168.001  1.00 95.23           O  
ATOM   5891  C5'  DA J  24     107.598 150.152 167.571  1.00 95.23           C  
ATOM   5892  C4'  DA J  24     108.948 149.916 166.925  1.00 95.23           C  
ATOM   5893  O4'  DA J  24     108.985 150.581 165.634  1.00 95.23           O  
ATOM   5894  C3'  DA J  24     110.139 150.443 167.716  1.00 95.23           C  
ATOM   5895  O3'  DA J  24     111.190 149.501 167.709  1.00 95.23           O  
ATOM   5896  C2'  DA J  24     110.506 151.735 166.997  1.00 95.23           C  
ATOM   5897  C1'  DA J  24     110.097 151.448 165.560  1.00 95.23           C  
ATOM   5898  N9   DA J  24     109.709 152.625 164.772  1.00 95.23           N  
ATOM   5899  C8   DA J  24     108.872 153.640 165.142  1.00 95.23           C  
ATOM   5900  N7   DA J  24     108.690 154.544 164.216  1.00 95.23           N  
ATOM   5901  C5   DA J  24     109.448 154.089 163.162  1.00 95.23           C  
ATOM   5902  C6   DA J  24     109.679 154.602 161.878  1.00 95.23           C  
ATOM   5903  N6   DA J  24     109.135 155.739 161.439  1.00 95.23           N  
ATOM   5904  N1   DA J  24     110.492 153.902 161.060  1.00 95.23           N  
ATOM   5905  C2   DA J  24     111.033 152.765 161.511  1.00 95.23           C  
ATOM   5906  N3   DA J  24     110.889 152.186 162.699  1.00 95.23           N  
ATOM   5907  C4   DA J  24     110.078 152.905 163.483  1.00 95.23           C  
ATOM   5908  H5'  DA J  24     106.900 149.953 166.930  1.00 95.23           H  
ATOM   5909 H5''  DA J  24     107.505 149.565 168.335  1.00 95.23           H  
ATOM   5910  H4'  DA J  24     109.065 148.965 166.787  1.00 95.23           H  
ATOM   5911  H3'  DA J  24     109.872 150.636 168.626  1.00 95.23           H  
ATOM   5912  H2'  DA J  24     110.007 152.477 167.363  1.00 95.23           H  
ATOM   5913 H2''  DA J  24     111.458 151.899 167.051  1.00 95.23           H  
ATOM   5914  H1'  DA J  24     110.825 150.992 165.111  1.00 95.23           H  
ATOM   5915  H8   DA J  24     108.476 153.688 165.979  1.00 95.23           H  
ATOM   5916  H61  DA J  24     109.413 156.095 160.708  1.00 95.23           H  
ATOM   5917  H62  DA J  24     108.503 156.112 161.887  1.00 95.23           H  
ATOM   5918  H2   DA J  24     111.585 152.318 160.912  1.00 95.23           H  
ATOM   5919  P    DC J  25     112.426 149.653 168.723  1.00 91.08           P  
ATOM   5920  OP1  DC J  25     112.196 148.690 169.820  1.00 91.08           O  
ATOM   5921  OP2  DC J  25     112.610 151.083 169.048  1.00 91.08           O  
ATOM   5922  O5'  DC J  25     113.697 149.167 167.876  1.00 91.08           O  
ATOM   5923  C5'  DC J  25     113.678 149.165 166.438  1.00 91.08           C  
ATOM   5924  C4'  DC J  25     114.991 149.658 165.850  1.00 91.08           C  
ATOM   5925  O4'  DC J  25     114.718 150.845 165.047  1.00 91.08           O  
ATOM   5926  C3'  DC J  25     116.045 150.114 166.849  1.00 91.08           C  
ATOM   5927  O3'  DC J  25     117.324 150.070 166.278  1.00 91.08           O  
ATOM   5928  C2'  DC J  25     115.585 151.525 167.108  1.00 91.08           C  
ATOM   5929  C1'  DC J  25     115.304 151.974 165.674  1.00 91.08           C  
ATOM   5930  N1   DC J  25     114.394 153.182 165.487  1.00 91.08           N  
ATOM   5931  C2   DC J  25     114.289 153.742 164.213  1.00 91.08           C  
ATOM   5932  O2   DC J  25     114.927 153.232 163.286  1.00 91.08           O  
ATOM   5933  N3   DC J  25     113.488 154.819 164.028  1.00 91.08           N  
ATOM   5934  C4   DC J  25     112.819 155.333 165.058  1.00 91.08           C  
ATOM   5935  N4   DC J  25     112.041 156.392 164.837  1.00 91.08           N  
ATOM   5936  C5   DC J  25     112.914 154.786 166.361  1.00 91.08           C  
ATOM   5937  C6   DC J  25     113.705 153.727 166.532  1.00 91.08           C  
ATOM   5938  H5'  DC J  25     112.967 149.743 166.126  1.00 91.08           H  
ATOM   5939 H5''  DC J  25     113.512 148.263 166.126  1.00 91.08           H  
ATOM   5940  H4'  DC J  25     115.370 148.968 165.283  1.00 91.08           H  
ATOM   5941  H3'  DC J  25     116.018 149.585 167.656  1.00 91.08           H  
ATOM   5942  H2'  DC J  25     114.786 151.519 167.651  1.00 91.08           H  
ATOM   5943 H2''  DC J  25     116.286 152.053 167.511  1.00 91.08           H  
ATOM   5944  H1'  DC J  25     116.147 152.159 165.241  1.00 91.08           H  
ATOM   5945  H41  DC J  25     111.718 156.833 165.501  1.00 91.08           H  
ATOM   5946  H42  DC J  25     111.859 156.631 164.034  1.00 91.08           H  
ATOM   5947  H5   DC J  25     112.443 155.154 167.070  1.00 91.08           H  
ATOM   5948  H6   DC J  25     113.780 153.352 167.374  1.00 91.08           H  
ATOM   5949  P    DC J  26     118.225 148.756 166.432  1.00 90.17           P  
ATOM   5950  OP1  DC J  26     117.416 147.610 165.964  1.00 90.17           O  
ATOM   5951  OP2  DC J  26     118.801 148.746 167.793  1.00 90.17           O  
ATOM   5952  O5'  DC J  26     119.402 149.002 165.391  1.00 90.17           O  
ATOM   5953  C5'  DC J  26     119.091 149.149 164.026  1.00 90.17           C  
ATOM   5954  C4'  DC J  26     119.693 150.418 163.447  1.00 90.17           C  
ATOM   5955  O4'  DC J  26     118.764 151.543 163.624  1.00 90.17           O  
ATOM   5956  C3'  DC J  26     121.004 150.865 164.094  1.00 90.17           C  
ATOM   5957  O3'  DC J  26     121.903 151.341 163.117  1.00 90.17           O  
ATOM   5958  C2'  DC J  26     120.534 151.967 165.027  1.00 90.17           C  
ATOM   5959  C1'  DC J  26     119.491 152.636 164.144  1.00 90.17           C  
ATOM   5960  N1   DC J  26     118.541 153.639 164.821  1.00 90.17           N  
ATOM   5961  C2   DC J  26     117.891 154.608 164.042  1.00 90.17           C  
ATOM   5962  O2   DC J  26     118.080 154.634 162.826  1.00 90.17           O  
ATOM   5963  N3   DC J  26     117.061 155.491 164.646  1.00 90.17           N  
ATOM   5964  C4   DC J  26     116.876 155.439 165.955  1.00 90.17           C  
ATOM   5965  N4   DC J  26     116.049 156.327 166.510  1.00 90.17           N  
ATOM   5966  C5   DC J  26     117.528 154.477 166.764  1.00 90.17           C  
ATOM   5967  C6   DC J  26     118.345 153.611 166.167  1.00 90.17           C  
ATOM   5968  H5'  DC J  26     118.128 149.179 163.927  1.00 90.17           H  
ATOM   5969 H5''  DC J  26     119.437 148.386 163.541  1.00 90.17           H  
ATOM   5970  H4'  DC J  26     119.846 150.285 162.501  1.00 90.17           H  
ATOM   5971  H3'  DC J  26     121.403 150.138 164.594  1.00 90.17           H  
ATOM   5972  H2'  DC J  26     120.138 151.583 165.823  1.00 90.17           H  
ATOM   5973 H2''  DC J  26     121.252 152.573 165.245  1.00 90.17           H  
ATOM   5974  H1'  DC J  26     119.945 153.085 163.416  1.00 90.17           H  
ATOM   5975  H41  DC J  26     115.877 156.286 167.351  1.00 90.17           H  
ATOM   5976  H42  DC J  26     115.684 156.935 166.025  1.00 90.17           H  
ATOM   5977  H5   DC J  26     117.389 154.450 167.680  1.00 90.17           H  
ATOM   5978  H6   DC J  26     118.775 152.971 166.677  1.00 90.17           H  
ATOM   5979  P    DA J  27     122.844 150.322 162.315  1.00 89.10           P  
ATOM   5980  OP1  DA J  27     122.038 149.120 162.016  1.00 89.10           O  
ATOM   5981  OP2  DA J  27     124.104 150.183 163.075  1.00 89.10           O  
ATOM   5982  O5'  DA J  27     123.164 151.100 160.952  1.00 89.10           O  
ATOM   5983  C5'  DA J  27     122.121 151.348 160.013  1.00 89.10           C  
ATOM   5984  C4'  DA J  27     122.214 152.751 159.435  1.00 89.10           C  
ATOM   5985  O4'  DA J  27     121.706 153.709 160.398  1.00 89.10           O  
ATOM   5986  C3'  DA J  27     123.616 153.222 159.087  1.00 89.10           C  
ATOM   5987  O3'  DA J  27     123.576 154.064 157.956  1.00 89.10           O  
ATOM   5988  C2'  DA J  27     124.046 153.953 160.350  1.00 89.10           C  
ATOM   5989  C1'  DA J  27     122.735 154.589 160.811  1.00 89.10           C  
ATOM   5990  N9   DA J  27     122.580 154.795 162.257  1.00 89.10           N  
ATOM   5991  C8   DA J  27     123.152 154.092 163.279  1.00 89.10           C  
ATOM   5992  N7   DA J  27     122.792 154.498 164.469  1.00 89.10           N  
ATOM   5993  C5   DA J  27     121.902 155.517 164.212  1.00 89.10           C  
ATOM   5994  C6   DA J  27     121.161 156.355 165.054  1.00 89.10           C  
ATOM   5995  N6   DA J  27     121.205 156.280 166.381  1.00 89.10           N  
ATOM   5996  N1   DA J  27     120.366 157.275 164.480  1.00 89.10           N  
ATOM   5997  C2   DA J  27     120.326 157.345 163.148  1.00 89.10           C  
ATOM   5998  N3   DA J  27     120.977 156.612 162.254  1.00 89.10           N  
ATOM   5999  C4   DA J  27     121.755 155.709 162.858  1.00 89.10           C  
ATOM   6000  H5'  DA J  27     121.266 151.245 160.457  1.00 89.10           H  
ATOM   6001 H5''  DA J  27     122.182 150.704 159.292  1.00 89.10           H  
ATOM   6002  H4'  DA J  27     121.672 152.797 158.641  1.00 89.10           H  
ATOM   6003  H3'  DA J  27     124.193 152.463 158.923  1.00 89.10           H  
ATOM   6004  H2'  DA J  27     124.389 153.325 160.999  1.00 89.10           H  
ATOM   6005 H2''  DA J  27     124.702 154.634 160.146  1.00 89.10           H  
ATOM   6006  H1'  DA J  27     122.622 155.437 160.359  1.00 89.10           H  
ATOM   6007  H8   DA J  27     123.757 153.401 163.142  1.00 89.10           H  
ATOM   6008  H61  DA J  27     120.620 156.694 166.853  1.00 89.10           H  
ATOM   6009  H62  DA J  27     121.814 155.810 166.763  1.00 89.10           H  
ATOM   6010  H2   DA J  27     119.765 157.997 162.799  1.00 89.10           H  
ATOM   6011  P    DA J  28     124.924 154.533 157.223  1.00 84.00           P  
ATOM   6012  OP1  DA J  28     124.934 153.898 155.888  1.00 84.00           O  
ATOM   6013  OP2  DA J  28     126.072 154.340 158.132  1.00 84.00           O  
ATOM   6014  O5'  DA J  28     124.697 156.096 157.028  1.00 84.00           O  
ATOM   6015  C5'  DA J  28     123.532 156.542 156.368  1.00 84.00           C  
ATOM   6016  C4'  DA J  28     123.078 157.877 156.905  1.00 84.00           C  
ATOM   6017  O4'  DA J  28     122.905 157.793 158.354  1.00 84.00           O  
ATOM   6018  C3'  DA J  28     124.055 159.016 156.667  1.00 84.00           C  
ATOM   6019  O3'  DA J  28     123.357 160.188 156.327  1.00 84.00           O  
ATOM   6020  C2'  DA J  28     124.765 159.126 158.001  1.00 84.00           C  
ATOM   6021  C1'  DA J  28     123.628 158.841 158.965  1.00 84.00           C  
ATOM   6022  N9   DA J  28     124.050 158.431 160.315  1.00 84.00           N  
ATOM   6023  C8   DA J  28     124.932 157.439 160.637  1.00 84.00           C  
ATOM   6024  N7   DA J  28     125.124 157.296 161.925  1.00 84.00           N  
ATOM   6025  C5   DA J  28     124.311 158.256 162.492  1.00 84.00           C  
ATOM   6026  C6   DA J  28     124.065 158.610 163.826  1.00 84.00           C  
ATOM   6027  N6   DA J  28     124.648 158.003 164.860  1.00 84.00           N  
ATOM   6028  N1   DA J  28     123.199 159.614 164.061  1.00 84.00           N  
ATOM   6029  C2   DA J  28     122.608 160.209 163.019  1.00 84.00           C  
ATOM   6030  N3   DA J  28     122.767 159.967 161.717  1.00 84.00           N  
ATOM   6031  C4   DA J  28     123.639 158.966 161.520  1.00 84.00           C  
ATOM   6032  H5'  DA J  28     122.827 155.893 156.494  1.00 84.00           H  
ATOM   6033 H5''  DA J  28     123.718 156.630 155.423  1.00 84.00           H  
ATOM   6034  H4'  DA J  28     122.228 158.106 156.500  1.00 84.00           H  
ATOM   6035  H3'  DA J  28     124.683 158.781 155.970  1.00 84.00           H  
ATOM   6036  H2'  DA J  28     125.461 158.456 158.072  1.00 84.00           H  
ATOM   6037 H2''  DA J  28     125.119 160.011 158.130  1.00 84.00           H  
ATOM   6038  H1'  DA J  28     123.062 159.626 159.029  1.00 84.00           H  
ATOM   6039  H8   DA J  28     125.361 156.916 160.000  1.00 84.00           H  
ATOM   6040  H61  DA J  28     124.484 158.267 165.662  1.00 84.00           H  
ATOM   6041  H62  DA J  28     125.186 157.349 164.724  1.00 84.00           H  
ATOM   6042  H2   DA J  28     122.027 160.902 163.229  1.00 84.00           H  
ATOM   6043  P    DA J  29     124.136 161.483 155.794  1.00 81.64           P  
ATOM   6044  OP1  DA J  29     123.717 161.686 154.391  1.00 81.64           O  
ATOM   6045  OP2  DA J  29     125.573 161.342 156.111  1.00 81.64           O  
ATOM   6046  O5'  DA J  29     123.528 162.661 156.683  1.00 81.64           O  
ATOM   6047  C5'  DA J  29     122.123 162.774 156.811  1.00 81.64           C  
ATOM   6048  C4'  DA J  29     121.749 163.834 157.815  1.00 81.64           C  
ATOM   6049  O4'  DA J  29     121.991 163.326 159.148  1.00 81.64           O  
ATOM   6050  C3'  DA J  29     122.541 165.118 157.702  1.00 81.64           C  
ATOM   6051  O3'  DA J  29     121.740 166.226 158.022  1.00 81.64           O  
ATOM   6052  C2'  DA J  29     123.671 164.905 158.685  1.00 81.64           C  
ATOM   6053  C1'  DA J  29     123.021 164.060 159.771  1.00 81.64           C  
ATOM   6054  N9   DA J  29     123.936 163.117 160.427  1.00 81.64           N  
ATOM   6055  C8   DA J  29     124.692 162.155 159.826  1.00 81.64           C  
ATOM   6056  N7   DA J  29     125.419 161.451 160.660  1.00 81.64           N  
ATOM   6057  C5   DA J  29     125.123 161.993 161.895  1.00 81.64           C  
ATOM   6058  C6   DA J  29     125.555 161.676 163.189  1.00 81.64           C  
ATOM   6059  N6   DA J  29     126.423 160.704 163.445  1.00 81.64           N  
ATOM   6060  N1   DA J  29     125.055 162.397 164.213  1.00 81.64           N  
ATOM   6061  C2   DA J  29     124.166 163.355 163.944  1.00 81.64           C  
ATOM   6062  N3   DA J  29     123.688 163.747 162.769  1.00 81.64           N  
ATOM   6063  C4   DA J  29     124.195 163.004 161.777  1.00 81.64           C  
ATOM   6064  H5'  DA J  29     121.763 161.924 157.102  1.00 81.64           H  
ATOM   6065 H5''  DA J  29     121.743 163.004 155.952  1.00 81.64           H  
ATOM   6066  H4'  DA J  29     120.811 164.039 157.723  1.00 81.64           H  
ATOM   6067  H3'  DA J  29     122.895 165.209 156.810  1.00 81.64           H  
ATOM   6068  H2'  DA J  29     124.394 164.429 158.261  1.00 81.64           H  
ATOM   6069 H2''  DA J  29     123.978 165.745 159.047  1.00 81.64           H  
ATOM   6070  H1'  DA J  29     122.633 164.645 160.435  1.00 81.64           H  
ATOM   6071  H8   DA J  29     124.696 162.015 158.905  1.00 81.64           H  
ATOM   6072  H61  DA J  29     126.919 160.745 164.143  1.00 81.64           H  
ATOM   6073  H62  DA J  29     126.481 160.031 162.912  1.00 81.64           H  
ATOM   6074  H2   DA J  29     123.860 163.831 164.677  1.00 81.64           H  
ATOM   6075  P    DA J  30     122.349 167.705 157.916  1.00 83.23           P  
ATOM   6076  OP1  DA J  30     121.271 168.623 157.496  1.00 83.23           O  
ATOM   6077  OP2  DA J  30     123.577 167.609 157.099  1.00 83.23           O  
ATOM   6078  O5'  DA J  30     122.813 168.014 159.415  1.00 83.23           O  
ATOM   6079  C5'  DA J  30     121.941 167.726 160.504  1.00 83.23           C  
ATOM   6080  C4'  DA J  30     122.564 168.126 161.835  1.00 83.23           C  
ATOM   6081  O4'  DA J  30     123.350 167.017 162.351  1.00 83.23           O  
ATOM   6082  C3'  DA J  30     123.512 169.326 161.780  1.00 83.23           C  
ATOM   6083  O3'  DA J  30     123.289 170.193 162.865  1.00 83.23           O  
ATOM   6084  C2'  DA J  30     124.885 168.683 161.829  1.00 83.23           C  
ATOM   6085  C1'  DA J  30     124.632 167.476 162.707  1.00 83.23           C  
ATOM   6086  N9   DA J  30     125.583 166.383 162.538  1.00 83.23           N  
ATOM   6087  C8   DA J  30     125.926 165.762 161.378  1.00 83.23           C  
ATOM   6088  N7   DA J  30     126.798 164.800 161.531  1.00 83.23           N  
ATOM   6089  C5   DA J  30     127.043 164.793 162.886  1.00 83.23           C  
ATOM   6090  C6   DA J  30     127.884 164.011 163.690  1.00 83.23           C  
ATOM   6091  N6   DA J  30     128.659 163.038 163.211  1.00 83.23           N  
ATOM   6092  N1   DA J  30     127.896 164.262 165.012  1.00 83.23           N  
ATOM   6093  C2   DA J  30     127.112 165.228 165.487  1.00 83.23           C  
ATOM   6094  N3   DA J  30     126.292 166.037 164.827  1.00 83.23           N  
ATOM   6095  C4   DA J  30     126.307 165.766 163.519  1.00 83.23           C  
ATOM   6096  H5'  DA J  30     121.754 166.775 160.515  1.00 83.23           H  
ATOM   6097 H5''  DA J  30     121.111 168.211 160.383  1.00 83.23           H  
ATOM   6098  H4'  DA J  30     121.855 168.322 162.465  1.00 83.23           H  
ATOM   6099  H3'  DA J  30     123.401 169.806 160.951  1.00 83.23           H  
ATOM   6100  H2'  DA J  30     125.168 168.415 160.944  1.00 83.23           H  
ATOM   6101 H2''  DA J  30     125.527 169.276 162.235  1.00 83.23           H  
ATOM   6102  H1'  DA J  30     124.626 167.753 163.632  1.00 83.23           H  
ATOM   6103  H8   DA J  30     125.567 165.995 160.557  1.00 83.23           H  
ATOM   6104  H61  DA J  30     129.260 162.680 163.711  1.00 83.23           H  
ATOM   6105  H62  DA J  30     128.559 162.771 162.400  1.00 83.23           H  
ATOM   6106  H2   DA J  30     127.165 165.371 166.402  1.00 83.23           H  
ATOM   6107  P    DG J  31     124.003 171.628 162.900  1.00 90.06           P  
ATOM   6108  OP1  DG J  31     122.945 172.649 163.035  1.00 90.06           O  
ATOM   6109  OP2  DG J  31     124.946 171.693 161.766  1.00 90.06           O  
ATOM   6110  O5'  DG J  31     124.851 171.584 164.248  1.00 90.06           O  
ATOM   6111  C5'  DG J  31     124.194 171.289 165.461  1.00 90.06           C  
ATOM   6112  C4'  DG J  31     125.183 171.013 166.580  1.00 90.06           C  
ATOM   6113  O4'  DG J  31     125.886 169.773 166.306  1.00 90.06           O  
ATOM   6114  C3'  DG J  31     126.260 172.079 166.772  1.00 90.06           C  
ATOM   6115  O3'  DG J  31     126.439 172.362 168.151  1.00 90.06           O  
ATOM   6116  C2'  DG J  31     127.494 171.455 166.138  1.00 90.06           C  
ATOM   6117  C1'  DG J  31     127.277 169.979 166.395  1.00 90.06           C  
ATOM   6118  N9   DG J  31     127.934 169.087 165.443  1.00 90.06           N  
ATOM   6119  C8   DG J  31     127.695 168.993 164.097  1.00 90.06           C  
ATOM   6120  N7   DG J  31     128.422 168.091 163.502  1.00 90.06           N  
ATOM   6121  C5   DG J  31     129.186 167.547 164.522  1.00 90.06           C  
ATOM   6122  C6   DG J  31     130.146 166.513 164.489  1.00 90.06           C  
ATOM   6123  O6   DG J  31     130.540 165.862 163.514  1.00 90.06           O  
ATOM   6124  N1   DG J  31     130.674 166.262 165.751  1.00 90.06           N  
ATOM   6125  C2   DG J  31     130.312 166.922 166.897  1.00 90.06           C  
ATOM   6126  N2   DG J  31     130.924 166.548 168.023  1.00 90.06           N  
ATOM   6127  N3   DG J  31     129.408 167.884 166.941  1.00 90.06           N  
ATOM   6128  C4   DG J  31     128.884 168.140 165.723  1.00 90.06           C  
ATOM   6129  H5'  DG J  31     123.634 170.508 165.333  1.00 90.06           H  
ATOM   6130 H5''  DG J  31     123.636 172.041 165.708  1.00 90.06           H  
ATOM   6131  H4'  DG J  31     124.695 170.915 167.411  1.00 90.06           H  
ATOM   6132  H3'  DG J  31     126.015 172.886 166.296  1.00 90.06           H  
ATOM   6133  H2'  DG J  31     127.521 171.639 165.189  1.00 90.06           H  
ATOM   6134 H2''  DG J  31     128.301 171.763 166.576  1.00 90.06           H  
ATOM   6135  H1'  DG J  31     127.571 169.765 167.290  1.00 90.06           H  
ATOM   6136  H8   DG J  31     127.086 169.531 163.651  1.00 90.06           H  
ATOM   6137  H1   DG J  31     131.272 165.649 165.818  1.00 90.06           H  
ATOM   6138  H21  DG J  31     130.673 166.873 168.778  1.00 90.06           H  
ATOM   6139  H22  DG J  31     131.562 165.973 167.994  1.00 90.06           H  
ATOM   6140  P    DT J  32     127.388 173.570 168.615  1.00 91.25           P  
ATOM   6141  OP1  DT J  32     126.948 173.988 169.963  1.00 91.25           O  
ATOM   6142  OP2  DT J  32     127.437 174.561 167.519  1.00 91.25           O  
ATOM   6143  O5'  DT J  32     128.827 172.889 168.727  1.00 91.25           O  
ATOM   6144  C5'  DT J  32     128.961 171.654 169.400  1.00 91.25           C  
ATOM   6145  C4'  DT J  32     130.319 171.507 170.073  1.00 91.25           C  
ATOM   6146  O4'  DT J  32     131.077 170.489 169.371  1.00 91.25           O  
ATOM   6147  C3'  DT J  32     131.211 172.742 170.065  1.00 91.25           C  
ATOM   6148  O3'  DT J  32     132.090 172.741 171.175  1.00 91.25           O  
ATOM   6149  C2'  DT J  32     131.944 172.596 168.744  1.00 91.25           C  
ATOM   6150  C1'  DT J  32     132.164 171.079 168.677  1.00 91.25           C  
ATOM   6151  N1   DT J  32     132.236 170.449 167.274  1.00 91.25           N  
ATOM   6152  C2   DT J  32     133.126 169.420 167.051  1.00 91.25           C  
ATOM   6153  O2   DT J  32     133.891 168.999 167.897  1.00 91.25           O  
ATOM   6154  N3   DT J  32     133.106 168.908 165.784  1.00 91.25           N  
ATOM   6155  C4   DT J  32     132.295 169.292 164.743  1.00 91.25           C  
ATOM   6156  O4   DT J  32     132.351 168.768 163.638  1.00 91.25           O  
ATOM   6157  C5   DT J  32     131.380 170.355 165.036  1.00 91.25           C  
ATOM   6158  C7   DT J  32     130.451 170.851 163.973  1.00 91.25           C  
ATOM   6159  C6   DT J  32     131.381 170.869 166.272  1.00 91.25           C  
ATOM   6160  H5'  DT J  32     128.852 170.939 168.761  1.00 91.25           H  
ATOM   6161 H5''  DT J  32     128.268 171.583 170.070  1.00 91.25           H  
ATOM   6162  H4'  DT J  32     130.187 171.223 170.988  1.00 91.25           H  
ATOM   6163  H3'  DT J  32     130.679 173.548 170.068  1.00 91.25           H  
ATOM   6164  H2'  DT J  32     131.392 172.914 168.020  1.00 91.25           H  
ATOM   6165 H2''  DT J  32     132.791 173.065 168.768  1.00 91.25           H  
ATOM   6166  H1'  DT J  32     132.980 170.873 169.153  1.00 91.25           H  
ATOM   6167  H3   DT J  32     133.658 168.275 165.621  1.00 91.25           H  
ATOM   6168  H71  DT J  32     129.638 171.176 164.380  1.00 91.25           H  
ATOM   6169  H72  DT J  32     130.877 171.570 163.482  1.00 91.25           H  
ATOM   6170  H73  DT J  32     130.240 170.126 163.365  1.00 91.25           H  
ATOM   6171  H6   DT J  32     130.790 171.558 166.461  1.00 91.25           H  
ATOM   6172  P    DG J  33     132.973 174.042 171.502  1.00 97.03           P  
ATOM   6173  OP1  DG J  33     132.902 174.275 172.959  1.00 97.03           O  
ATOM   6174  OP2  DG J  33     132.584 175.115 170.564  1.00 97.03           O  
ATOM   6175  O5'  DG J  33     134.455 173.592 171.128  1.00 97.03           O  
ATOM   6176  C5'  DG J  33     135.015 172.461 171.758  1.00 97.03           C  
ATOM   6177  C4'  DG J  33     136.181 171.912 170.961  1.00 97.03           C  
ATOM   6178  O4'  DG J  33     135.697 171.393 169.690  1.00 97.03           O  
ATOM   6179  C3'  DG J  33     137.266 172.940 170.616  1.00 97.03           C  
ATOM   6180  O3'  DG J  33     138.548 172.481 171.042  1.00 97.03           O  
ATOM   6181  C2'  DG J  33     137.170 173.077 169.094  1.00 97.03           C  
ATOM   6182  C1'  DG J  33     136.623 171.725 168.685  1.00 97.03           C  
ATOM   6183  N9   DG J  33     135.960 171.693 167.373  1.00 97.03           N  
ATOM   6184  C8   DG J  33     134.942 172.500 166.924  1.00 97.03           C  
ATOM   6185  N7   DG J  33     134.555 172.222 165.710  1.00 97.03           N  
ATOM   6186  C5   DG J  33     135.368 171.166 165.329  1.00 97.03           C  
ATOM   6187  C6   DG J  33     135.410 170.436 164.118  1.00 97.03           C  
ATOM   6188  O6   DG J  33     134.717 170.588 163.104  1.00 97.03           O  
ATOM   6189  N1   DG J  33     136.381 169.438 164.152  1.00 97.03           N  
ATOM   6190  C2   DG J  33     137.202 169.181 165.221  1.00 97.03           C  
ATOM   6191  N2   DG J  33     138.078 168.182 165.078  1.00 97.03           N  
ATOM   6192  N3   DG J  33     137.170 169.856 166.356  1.00 97.03           N  
ATOM   6193  C4   DG J  33     136.232 170.827 166.342  1.00 97.03           C  
ATOM   6194  H5'  DG J  33     134.335 171.776 171.842  1.00 97.03           H  
ATOM   6195 H5''  DG J  33     135.324 172.711 172.641  1.00 97.03           H  
ATOM   6196  H4'  DG J  33     136.588 171.187 171.460  1.00 97.03           H  
ATOM   6197  H3'  DG J  33     137.061 173.787 171.038  1.00 97.03           H  
ATOM   6198  H2'  DG J  33     136.557 173.787 168.851  1.00 97.03           H  
ATOM   6199 H2''  DG J  33     138.045 173.225 168.705  1.00 97.03           H  
ATOM   6200  H1'  DG J  33     137.344 171.077 168.694  1.00 97.03           H  
ATOM   6201  H8   DG J  33     134.569 173.180 167.434  1.00 97.03           H  
ATOM   6202  H1   DG J  33     136.473 168.947 163.451  1.00 97.03           H  
ATOM   6203  H21  DG J  33     138.737 168.107 165.625  1.00 97.03           H  
ATOM   6204  H22  DG J  33     137.982 167.613 164.439  1.00 97.03           H  
ATOM   6205  P    DT J  34     139.826 173.454 170.962  1.00102.61           P  
ATOM   6206  OP1  DT J  34     140.508 173.398 172.273  1.00102.61           O  
ATOM   6207  OP2  DT J  34     139.368 174.757 170.431  1.00102.61           O  
ATOM   6208  O5'  DT J  34     140.765 172.770 169.858  1.00102.61           O  
ATOM   6209  C5'  DT J  34     141.431 171.547 170.154  1.00102.61           C  
ATOM   6210  C4'  DT J  34     141.884 170.842 168.888  1.00102.61           C  
ATOM   6211  O4'  DT J  34     140.803 170.833 167.925  1.00102.61           O  
ATOM   6212  C3'  DT J  34     143.076 171.489 168.180  1.00102.61           C  
ATOM   6213  O3'  DT J  34     144.178 170.598 168.157  1.00102.61           O  
ATOM   6214  C2'  DT J  34     142.559 171.811 166.775  1.00102.61           C  
ATOM   6215  C1'  DT J  34     141.353 170.907 166.638  1.00102.61           C  
ATOM   6216  N1   DT J  34     140.301 171.410 165.686  1.00102.61           N  
ATOM   6217  C2   DT J  34     140.104 170.769 164.481  1.00102.61           C  
ATOM   6218  O2   DT J  34     140.743 169.798 164.122  1.00102.61           O  
ATOM   6219  N3   DT J  34     139.118 171.309 163.704  1.00102.61           N  
ATOM   6220  C4   DT J  34     138.327 172.400 164.001  1.00102.61           C  
ATOM   6221  O4   DT J  34     137.464 172.815 163.236  1.00102.61           O  
ATOM   6222  C5   DT J  34     138.585 173.021 165.270  1.00102.61           C  
ATOM   6223  C7   DT J  34     137.787 174.211 165.693  1.00102.61           C  
ATOM   6224  C6   DT J  34     139.543 172.504 166.043  1.00102.61           C  
ATOM   6225  H5'  DT J  34     140.826 170.967 170.641  1.00102.61           H  
ATOM   6226 H5''  DT J  34     142.205 171.734 170.705  1.00102.61           H  
ATOM   6227  H4'  DT J  34     142.114 169.927 169.107  1.00102.61           H  
ATOM   6228  H3'  DT J  34     143.322 172.305 168.636  1.00102.61           H  
ATOM   6229  H2'  DT J  34     142.299 172.741 166.714  1.00102.61           H  
ATOM   6230 H2''  DT J  34     143.225 171.595 166.107  1.00102.61           H  
ATOM   6231  H1'  DT J  34     141.645 170.027 166.367  1.00102.61           H  
ATOM   6232  H3   DT J  34     138.976 170.928 162.949  1.00102.61           H  
ATOM   6233  H71  DT J  34     137.801 174.281 166.655  1.00102.61           H  
ATOM   6234  H72  DT J  34     138.172 175.011 165.306  1.00102.61           H  
ATOM   6235  H73  DT J  34     136.873 174.110 165.390  1.00102.61           H  
ATOM   6236  H6   DT J  34     139.709 172.905 166.862  1.00102.61           H  
ATOM   6237  P    DA J  35     145.614 171.097 167.638  1.00 97.80           P  
ATOM   6238  OP1  DA J  35     146.642 170.290 168.330  1.00 97.80           O  
ATOM   6239  OP2  DA J  35     145.646 172.572 167.732  1.00 97.80           O  
ATOM   6240  O5'  DA J  35     145.613 170.705 166.090  1.00 97.80           O  
ATOM   6241  C5'  DA J  35     145.353 169.365 165.710  1.00 97.80           C  
ATOM   6242  C4'  DA J  35     145.356 169.210 164.200  1.00 97.80           C  
ATOM   6243  O4'  DA J  35     144.211 169.913 163.638  1.00 97.80           O  
ATOM   6244  C3'  DA J  35     146.590 169.765 163.493  1.00 97.80           C  
ATOM   6245  O3'  DA J  35     147.040 168.837 162.519  1.00 97.80           O  
ATOM   6246  C2'  DA J  35     146.097 171.087 162.893  1.00 97.80           C  
ATOM   6247  C1'  DA J  35     144.629 170.795 162.617  1.00 97.80           C  
ATOM   6248  N9   DA J  35     143.736 171.959 162.630  1.00 97.80           N  
ATOM   6249  C8   DA J  35     143.674 172.951 163.566  1.00 97.80           C  
ATOM   6250  N7   DA J  35     142.751 173.851 163.326  1.00 97.80           N  
ATOM   6251  C5   DA J  35     142.153 173.408 162.163  1.00 97.80           C  
ATOM   6252  C6   DA J  35     141.098 173.919 161.383  1.00 97.80           C  
ATOM   6253  N6   DA J  35     140.439 175.036 161.682  1.00 97.80           N  
ATOM   6254  N1   DA J  35     140.746 173.234 160.278  1.00 97.80           N  
ATOM   6255  C2   DA J  35     141.410 172.114 159.980  1.00 97.80           C  
ATOM   6256  N3   DA J  35     142.416 171.537 160.634  1.00 97.80           N  
ATOM   6257  C4   DA J  35     142.742 172.240 161.726  1.00 97.80           C  
ATOM   6258  H5'  DA J  35     144.485 169.102 166.055  1.00 97.80           H  
ATOM   6259 H5''  DA J  35     146.033 168.789 166.089  1.00 97.80           H  
ATOM   6260  H4'  DA J  35     145.278 168.267 163.985  1.00 97.80           H  
ATOM   6261  H3'  DA J  35     147.293 169.934 164.136  1.00 97.80           H  
ATOM   6262  H2'  DA J  35     146.195 171.806 163.533  1.00 97.80           H  
ATOM   6263 H2''  DA J  35     146.566 171.292 162.071  1.00 97.80           H  
ATOM   6264  H1'  DA J  35     144.551 170.350 161.760  1.00 97.80           H  
ATOM   6265  H8   DA J  35     144.246 172.993 164.296  1.00 97.80           H  
ATOM   6266  H61  DA J  35     139.894 175.378 161.112  1.00 97.80           H  
ATOM   6267  H62  DA J  35     140.559 175.415 162.444  1.00 97.80           H  
ATOM   6268  H2   DA J  35     141.129 171.677 159.210  1.00 97.80           H  
ATOM   6269  P    DT J  36     148.354 169.132 161.653  1.00 97.30           P  
ATOM   6270  OP1  DT J  36     149.062 167.849 161.466  1.00 97.30           O  
ATOM   6271  OP2  DT J  36     149.047 170.283 162.266  1.00 97.30           O  
ATOM   6272  O5'  DT J  36     147.760 169.595 160.247  1.00 97.30           O  
ATOM   6273  C5'  DT J  36     146.742 168.816 159.630  1.00 97.30           C  
ATOM   6274  C4'  DT J  36     146.323 169.408 158.293  1.00 97.30           C  
ATOM   6275  O4'  DT J  36     145.389 170.507 158.510  1.00 97.30           O  
ATOM   6276  C3'  DT J  36     147.471 169.987 157.461  1.00 97.30           C  
ATOM   6277  O3'  DT J  36     147.418 169.513 156.131  1.00 97.30           O  
ATOM   6278  C2'  DT J  36     147.248 171.488 157.548  1.00 97.30           C  
ATOM   6279  C1'  DT J  36     145.734 171.567 157.655  1.00 97.30           C  
ATOM   6280  N1   DT J  36     145.160 172.867 158.214  1.00 97.30           N  
ATOM   6281  C2   DT J  36     144.031 173.415 157.630  1.00 97.30           C  
ATOM   6282  O2   DT J  36     143.463 172.923 156.673  1.00 97.30           O  
ATOM   6283  N3   DT J  36     143.588 174.575 158.212  1.00 97.30           N  
ATOM   6284  C4   DT J  36     144.142 175.227 159.295  1.00 97.30           C  
ATOM   6285  O4   DT J  36     143.672 176.266 159.745  1.00 97.30           O  
ATOM   6286  C5   DT J  36     145.312 174.600 159.861  1.00 97.30           C  
ATOM   6287  C7   DT J  36     146.002 175.216 161.042  1.00 97.30           C  
ATOM   6288  C6   DT J  36     145.752 173.463 159.307  1.00 97.30           C  
ATOM   6289  H5'  DT J  36     145.971 168.781 160.216  1.00 97.30           H  
ATOM   6290 H5''  DT J  36     147.074 167.916 159.489  1.00 97.30           H  
ATOM   6291  H4'  DT J  36     145.879 168.720 157.773  1.00 97.30           H  
ATOM   6292  H3'  DT J  36     148.323 169.755 157.859  1.00 97.30           H  
ATOM   6293  H2'  DT J  36     147.683 171.846 158.331  1.00 97.30           H  
ATOM   6294 H2''  DT J  36     147.562 171.920 156.752  1.00 97.30           H  
ATOM   6295  H1'  DT J  36     145.356 171.403 156.780  1.00 97.30           H  
ATOM   6296  H3   DT J  36     142.888 174.937 157.864  1.00 97.30           H  
ATOM   6297  H71  DT J  36     145.820 176.168 161.065  1.00 97.30           H  
ATOM   6298  H72  DT J  36     145.676 174.804 161.858  1.00 97.30           H  
ATOM   6299  H73  DT J  36     146.958 175.072 160.968  1.00 97.30           H  
ATOM   6300  H6   DT J  36     146.507 173.063 159.668  1.00 97.30           H  
ATOM   6301  P    DT J  37     148.706 169.641 155.184  1.00 88.01           P  
ATOM   6302  OP1  DT J  37     149.181 168.272 154.890  1.00 88.01           O  
ATOM   6303  OP2  DT J  37     149.623 170.630 155.787  1.00 88.01           O  
ATOM   6304  O5'  DT J  37     148.114 170.269 153.848  1.00 88.01           O  
ATOM   6305  C5'  DT J  37     147.091 169.588 153.181  1.00 88.01           C  
ATOM   6306  C4'  DT J  37     145.987 170.535 152.752  1.00 88.01           C  
ATOM   6307  O4'  DT J  37     145.763 171.532 153.786  1.00 88.01           O  
ATOM   6308  C3'  DT J  37     146.260 171.320 151.460  1.00 88.01           C  
ATOM   6309  O3'  DT J  37     145.194 171.109 150.528  1.00 88.01           O  
ATOM   6310  C2'  DT J  37     146.359 172.776 151.933  1.00 88.01           C  
ATOM   6311  C1'  DT J  37     145.486 172.766 153.167  1.00 88.01           C  
ATOM   6312  N1   DT J  37     145.761 173.857 154.141  1.00 88.01           N  
ATOM   6313  C2   DT J  37     144.870 174.897 154.291  1.00 88.01           C  
ATOM   6314  O2   DT J  37     143.845 175.004 153.645  1.00 88.01           O  
ATOM   6315  N3   DT J  37     145.231 175.822 155.233  1.00 88.01           N  
ATOM   6316  C4   DT J  37     146.359 175.808 156.020  1.00 88.01           C  
ATOM   6317  O4   DT J  37     146.600 176.685 156.840  1.00 88.01           O  
ATOM   6318  C5   DT J  37     147.237 174.691 155.813  1.00 88.01           C  
ATOM   6319  C7   DT J  37     148.497 174.569 156.611  1.00 88.01           C  
ATOM   6320  C6   DT J  37     146.899 173.785 154.892  1.00 88.01           C  
ATOM   6321  H5'  DT J  37     146.721 168.918 153.774  1.00 88.01           H  
ATOM   6322 H5''  DT J  37     147.458 169.151 152.400  1.00 88.01           H  
ATOM   6323  H4'  DT J  37     145.173 170.023 152.637  1.00 88.01           H  
ATOM   6324  H3'  DT J  37     147.102 171.039 151.072  1.00 88.01           H  
ATOM   6325  H2'  DT J  37     147.272 173.000 152.164  1.00 88.01           H  
ATOM   6326 H2''  DT J  37     146.013 173.384 151.268  1.00 88.01           H  
ATOM   6327  H1'  DT J  37     144.556 172.790 152.904  1.00 88.01           H  
ATOM   6328  H3   DT J  37     144.695 176.483 155.345  1.00 88.01           H  
ATOM   6329  H71  DT J  37     148.840 175.455 156.810  1.00 88.01           H  
ATOM   6330  H72  DT J  37     148.310 174.101 157.439  1.00 88.01           H  
ATOM   6331  H73  DT J  37     149.156 174.075 156.100  1.00 88.01           H  
ATOM   6332  H6   DT J  37     147.461 173.057 154.764  1.00 88.01           H  
ATOM   6333  P    DT J  38     145.322 171.562 148.991  1.00 84.81           P  
ATOM   6334  OP1  DT J  38     145.457 170.344 148.167  1.00 84.81           O  
ATOM   6335  OP2  DT J  38     146.322 172.644 148.895  1.00 84.81           O  
ATOM   6336  O5'  DT J  38     143.907 172.220 148.689  1.00 84.81           O  
ATOM   6337  C5'  DT J  38     143.336 173.060 149.659  1.00 84.81           C  
ATOM   6338  C4'  DT J  38     142.820 174.367 149.091  1.00 84.81           C  
ATOM   6339  O4'  DT J  38     143.103 175.430 150.048  1.00 84.81           O  
ATOM   6340  C3'  DT J  38     143.386 174.829 147.757  1.00 84.81           C  
ATOM   6341  O3'  DT J  38     142.271 175.317 146.988  1.00 84.81           O  
ATOM   6342  C2'  DT J  38     144.447 175.864 148.170  1.00 84.81           C  
ATOM   6343  C1'  DT J  38     143.886 176.449 149.465  1.00 84.81           C  
ATOM   6344  N1   DT J  38     144.921 176.936 150.537  1.00 84.81           N  
ATOM   6345  C2   DT J  38     144.624 178.062 151.283  1.00 84.81           C  
ATOM   6346  O2   DT J  38     143.613 178.718 151.127  1.00 84.81           O  
ATOM   6347  N3   DT J  38     145.569 178.402 152.219  1.00 84.81           N  
ATOM   6348  C4   DT J  38     146.746 177.747 152.496  1.00 84.81           C  
ATOM   6349  O4   DT J  38     147.531 178.134 153.359  1.00 84.81           O  
ATOM   6350  C5   DT J  38     147.001 176.578 151.706  1.00 84.81           C  
ATOM   6351  C7   DT J  38     148.258 175.796 151.933  1.00 84.81           C  
ATOM   6352  C6   DT J  38     146.088 176.219 150.783  1.00 84.81           C  
ATOM   6353  H5'  DT J  38     143.996 173.256 150.328  1.00 84.81           H  
ATOM   6354 H5''  DT J  38     142.601 172.599 150.075  1.00 84.81           H  
ATOM   6355  H4'  DT J  38     141.862 174.296 148.994  1.00 84.81           H  
ATOM   6356  H3'  DT J  38     143.807 174.098 147.291  1.00 84.81           H  
ATOM   6357  H2'  DT J  38     145.292 175.422 148.320  1.00 84.81           H  
ATOM   6358 H2''  DT J  38     144.541 176.551 147.512  1.00 84.81           H  
ATOM   6359  H1'  DT J  38     143.307 177.188 149.234  1.00 84.81           H  
ATOM   6360  H3   DT J  38     145.405 179.103 152.685  1.00 84.81           H  
ATOM   6361  H71  DT J  38     148.975 176.403 152.175  1.00 84.81           H  
ATOM   6362  H72  DT J  38     148.116 175.162 152.652  1.00 84.81           H  
ATOM   6363  H73  DT J  38     148.496 175.322 151.123  1.00 84.81           H  
ATOM   6364  H6   DT J  38     146.257 175.464 150.272  1.00 84.81           H  
ATOM   6365  P    DG J  39     142.379 176.295 145.724  1.00 93.29           P  
ATOM   6366  OP1  DG J  39     141.403 175.815 144.731  1.00 93.29           O  
ATOM   6367  OP2  DG J  39     143.768 176.519 145.280  1.00 93.29           O  
ATOM   6368  O5'  DG J  39     141.798 177.649 146.305  1.00 93.29           O  
ATOM   6369  C5'  DG J  39     140.453 177.762 146.693  1.00 93.29           C  
ATOM   6370  C4'  DG J  39     140.060 179.227 146.765  1.00 93.29           C  
ATOM   6371  O4'  DG J  39     140.978 179.942 147.637  1.00 93.29           O  
ATOM   6372  C3'  DG J  39     140.128 179.954 145.441  1.00 93.29           C  
ATOM   6373  O3'  DG J  39     139.175 181.008 145.415  1.00 93.29           O  
ATOM   6374  C2'  DG J  39     141.587 180.428 145.392  1.00 93.29           C  
ATOM   6375  C1'  DG J  39     141.924 180.682 146.872  1.00 93.29           C  
ATOM   6376  N9   DG J  39     143.286 180.285 147.319  1.00 93.29           N  
ATOM   6377  C8   DG J  39     144.076 179.260 146.840  1.00 93.29           C  
ATOM   6378  N7   DG J  39     145.206 179.131 147.458  1.00 93.29           N  
ATOM   6379  C5   DG J  39     145.188 180.128 148.408  1.00 93.29           C  
ATOM   6380  C6   DG J  39     146.160 180.467 149.363  1.00 93.29           C  
ATOM   6381  O6   DG J  39     147.257 179.933 149.548  1.00 93.29           O  
ATOM   6382  N1   DG J  39     145.764 181.544 150.138  1.00 93.29           N  
ATOM   6383  C2   DG J  39     144.570 182.211 150.012  1.00 93.29           C  
ATOM   6384  N2   DG J  39     144.364 183.226 150.860  1.00 93.29           N  
ATOM   6385  N3   DG J  39     143.640 181.901 149.116  1.00 93.29           N  
ATOM   6386  C4   DG J  39     144.015 180.848 148.350  1.00 93.29           C  
ATOM   6387  H5'  DG J  39     140.331 177.349 147.564  1.00 93.29           H  
ATOM   6388 H5''  DG J  39     139.895 177.313 146.043  1.00 93.29           H  
ATOM   6389  H4'  DG J  39     139.160 179.302 147.121  1.00 93.29           H  
ATOM   6390  H3'  DG J  39     139.957 179.335 144.717  1.00 93.29           H  
ATOM   6391  H2'  DG J  39     142.147 179.739 145.013  1.00 93.29           H  
ATOM   6392 H2''  DG J  39     141.665 181.241 144.884  1.00 93.29           H  
ATOM   6393  H1'  DG J  39     141.801 181.623 147.057  1.00 93.29           H  
ATOM   6394  H8   DG J  39     143.814 178.702 146.147  1.00 93.29           H  
ATOM   6395  H1   DG J  39     146.306 181.814 150.748  1.00 93.29           H  
ATOM   6396  H21  DG J  39     143.625 183.666 150.834  1.00 93.29           H  
ATOM   6397  H22  DG J  39     144.970 183.436 151.433  1.00 93.29           H  
ATOM   6398  P    DG J  40     139.081 182.012 144.166  1.00 97.12           P  
ATOM   6399  OP1  DG J  40     137.659 182.367 143.968  1.00 97.12           O  
ATOM   6400  OP2  DG J  40     139.856 181.420 143.053  1.00 97.12           O  
ATOM   6401  O5'  DG J  40     139.859 183.303 144.692  1.00 97.12           O  
ATOM   6402  C5'  DG J  40     139.545 183.829 145.975  1.00 97.12           C  
ATOM   6403  C4'  DG J  40     140.598 184.809 146.443  1.00 97.12           C  
ATOM   6404  O4'  DG J  40     141.808 184.094 146.840  1.00 97.12           O  
ATOM   6405  C3'  DG J  40     141.046 185.820 145.397  1.00 97.12           C  
ATOM   6406  O3'  DG J  40     141.164 187.082 145.997  1.00 97.12           O  
ATOM   6407  C2'  DG J  40     142.389 185.262 144.942  1.00 97.12           C  
ATOM   6408  C1'  DG J  40     142.919 184.739 146.259  1.00 97.12           C  
ATOM   6409  N9   DG J  40     144.049 183.798 146.181  1.00 97.12           N  
ATOM   6410  C8   DG J  40     144.134 182.636 145.455  1.00 97.12           C  
ATOM   6411  N7   DG J  40     145.262 182.003 145.616  1.00 97.12           N  
ATOM   6412  C5   DG J  40     145.974 182.800 146.498  1.00 97.12           C  
ATOM   6413  C6   DG J  40     147.263 182.626 147.051  1.00 97.12           C  
ATOM   6414  O6   DG J  40     148.073 181.714 146.843  1.00 97.12           O  
ATOM   6415  N1   DG J  40     147.602 183.671 147.904  1.00 97.12           N  
ATOM   6416  C2   DG J  40     146.787 184.731 148.205  1.00 97.12           C  
ATOM   6417  N2   DG J  40     147.275 185.648 149.049  1.00 97.12           N  
ATOM   6418  N3   DG J  40     145.580 184.899 147.699  1.00 97.12           N  
ATOM   6419  C4   DG J  40     145.237 183.898 146.862  1.00 97.12           C  
ATOM   6420  H5'  DG J  40     139.485 183.102 146.614  1.00 97.12           H  
ATOM   6421 H5''  DG J  40     138.690 184.283 145.930  1.00 97.12           H  
ATOM   6422  H4'  DG J  40     140.256 185.292 147.210  1.00 97.12           H  
ATOM   6423  H3'  DG J  40     140.419 185.847 144.660  1.00 97.12           H  
ATOM   6424  H2'  DG J  40     142.270 184.544 144.302  1.00 97.12           H  
ATOM   6425 H2''  DG J  40     142.953 185.961 144.587  1.00 97.12           H  
ATOM   6426  H1'  DG J  40     143.171 185.492 146.813  1.00 97.12           H  
ATOM   6427  H8   DG J  40     143.453 182.325 144.913  1.00 97.12           H  
ATOM   6428  H1   DG J  40     148.375 183.644 148.277  1.00 97.12           H  
ATOM   6429  H21  DG J  40     146.845 186.380 149.184  1.00 97.12           H  
ATOM   6430  H22  DG J  40     148.019 185.505 149.455  1.00 97.12           H  
ATOM   6431  P    DA J  41     141.052 188.421 145.128  1.00104.28           P  
ATOM   6432  OP1  DA J  41     139.744 189.037 145.442  1.00104.28           O  
ATOM   6433  OP2  DA J  41     141.397 188.088 143.730  1.00104.28           O  
ATOM   6434  O5'  DA J  41     142.214 189.337 145.730  1.00104.28           O  
ATOM   6435  C5'  DA J  41     142.681 189.100 147.055  1.00104.28           C  
ATOM   6436  C4'  DA J  41     143.726 190.122 147.478  1.00104.28           C  
ATOM   6437  O4'  DA J  41     144.991 189.446 147.633  1.00104.28           O  
ATOM   6438  C3'  DA J  41     144.014 191.230 146.480  1.00104.28           C  
ATOM   6439  O3'  DA J  41     144.624 192.355 147.115  1.00104.28           O  
ATOM   6440  C2'  DA J  41     144.954 190.530 145.518  1.00104.28           C  
ATOM   6441  C1'  DA J  41     145.761 189.613 146.455  1.00104.28           C  
ATOM   6442  N9   DA J  41     146.066 188.292 145.910  1.00104.28           N  
ATOM   6443  C8   DA J  41     145.221 187.451 145.244  1.00104.28           C  
ATOM   6444  N7   DA J  41     145.775 186.325 144.874  1.00104.28           N  
ATOM   6445  C5   DA J  41     147.071 186.427 145.341  1.00104.28           C  
ATOM   6446  C6   DA J  41     148.164 185.550 145.290  1.00104.28           C  
ATOM   6447  N6   DA J  41     148.122 184.364 144.687  1.00104.28           N  
ATOM   6448  N1   DA J  41     149.319 185.958 145.851  1.00104.28           N  
ATOM   6449  C2   DA J  41     149.361 187.155 146.443  1.00104.28           C  
ATOM   6450  N3   DA J  41     148.397 188.060 146.563  1.00104.28           N  
ATOM   6451  C4   DA J  41     147.264 187.627 145.993  1.00104.28           C  
ATOM   6452  H5'  DA J  41     143.077 188.217 147.095  1.00104.28           H  
ATOM   6453 H5''  DA J  41     141.933 189.138 147.667  1.00104.28           H  
ATOM   6454  H4'  DA J  41     143.468 190.512 148.325  1.00104.28           H  
ATOM   6455  H3'  DA J  41     143.204 191.502 146.026  1.00104.28           H  
ATOM   6456  H2'  DA J  41     144.451 190.021 144.869  1.00104.28           H  
ATOM   6457 H2''  DA J  41     145.533 191.165 145.080  1.00104.28           H  
ATOM   6458  H1'  DA J  41     146.591 190.055 146.684  1.00104.28           H  
ATOM   6459  H8   DA J  41     144.336 187.669 145.054  1.00104.28           H  
ATOM   6460  H61  DA J  41     148.848 183.926 144.548  1.00104.28           H  
ATOM   6461  H62  DA J  41     147.367 184.032 144.443  1.00104.28           H  
ATOM   6462  H2   DA J  41     150.177 187.387 146.818  1.00104.28           H  
ATOM   6463  P    DA J  42     144.968 193.677 146.264  1.00107.48           P  
ATOM   6464  OP1  DA J  42     144.807 194.845 147.158  1.00107.48           O  
ATOM   6465  OP2  DA J  42     144.193 193.605 145.005  1.00107.48           O  
ATOM   6466  O5'  DA J  42     146.519 193.507 145.889  1.00107.48           O  
ATOM   6467  C5'  DA J  42     147.518 193.676 146.892  1.00107.48           C  
ATOM   6468  C4'  DA J  42     148.882 193.229 146.399  1.00107.48           C  
ATOM   6469  O4'  DA J  42     148.839 191.814 146.053  1.00107.48           O  
ATOM   6470  C3'  DA J  42     149.386 193.951 145.144  1.00107.48           C  
ATOM   6471  O3'  DA J  42     150.743 194.362 145.310  1.00107.48           O  
ATOM   6472  C2'  DA J  42     149.231 192.896 144.064  1.00107.48           C  
ATOM   6473  C1'  DA J  42     149.530 191.640 144.842  1.00107.48           C  
ATOM   6474  N9   DA J  42     149.106 190.401 144.189  1.00107.48           N  
ATOM   6475  C8   DA J  42     147.861 190.093 143.719  1.00107.48           C  
ATOM   6476  N7   DA J  42     147.781 188.906 143.168  1.00107.48           N  
ATOM   6477  C5   DA J  42     149.063 188.401 143.282  1.00107.48           C  
ATOM   6478  C6   DA J  42     149.637 187.181 142.894  1.00107.48           C  
ATOM   6479  N6   DA J  42     148.954 186.214 142.284  1.00107.48           N  
ATOM   6480  N1   DA J  42     150.942 186.989 143.157  1.00107.48           N  
ATOM   6481  C2   DA J  42     151.622 187.958 143.770  1.00107.48           C  
ATOM   6482  N3   DA J  42     151.194 189.149 144.180  1.00107.48           N  
ATOM   6483  C4   DA J  42     149.891 189.307 143.907  1.00107.48           C  
ATOM   6484  H5'  DA J  42     147.277 193.154 147.671  1.00107.48           H  
ATOM   6485 H5''  DA J  42     147.564 194.612 147.139  1.00107.48           H  
ATOM   6486  H4'  DA J  42     149.527 193.356 147.110  1.00107.48           H  
ATOM   6487  H3'  DA J  42     148.823 194.714 144.949  1.00107.48           H  
ATOM   6488  H2'  DA J  42     148.325 192.886 143.720  1.00107.48           H  
ATOM   6489 H2''  DA J  42     149.872 193.024 143.357  1.00107.48           H  
ATOM   6490  H1'  DA J  42     150.480 191.599 145.023  1.00107.48           H  
ATOM   6491  H8   DA J  42     147.139 190.671 143.782  1.00107.48           H  
ATOM   6492  H61  DA J  42     149.339 185.470 142.095  1.00107.48           H  
ATOM   6493  H62  DA J  42     148.130 186.336 142.077  1.00107.48           H  
ATOM   6494  H2   DA J  42     152.520 187.781 143.925  1.00107.48           H  
ATOM   6495  P    DA J  43     151.427 195.391 144.278  1.00106.64           P  
ATOM   6496  OP1  DA J  43     151.380 196.725 144.911  1.00106.64           O  
ATOM   6497  OP2  DA J  43     150.833 195.212 142.937  1.00106.64           O  
ATOM   6498  O5'  DA J  43     152.961 194.921 144.177  1.00106.64           O  
ATOM   6499  C5'  DA J  43     153.442 193.760 144.875  1.00106.64           C  
ATOM   6500  C4'  DA J  43     154.659 193.143 144.191  1.00106.64           C  
ATOM   6501  O4'  DA J  43     154.284 191.831 143.694  1.00106.64           O  
ATOM   6502  C3'  DA J  43     155.207 193.887 142.971  1.00106.64           C  
ATOM   6503  O3'  DA J  43     156.593 193.642 142.790  1.00106.64           O  
ATOM   6504  C2'  DA J  43     154.374 193.300 141.856  1.00106.64           C  
ATOM   6505  C1'  DA J  43     154.275 191.840 142.280  1.00106.64           C  
ATOM   6506  N9   DA J  43     153.076 191.146 141.796  1.00106.64           N  
ATOM   6507  C8   DA J  43     151.786 191.599 141.801  1.00106.64           C  
ATOM   6508  N7   DA J  43     150.924 190.756 141.288  1.00106.64           N  
ATOM   6509  C5   DA J  43     151.700 189.677 140.928  1.00106.64           C  
ATOM   6510  C6   DA J  43     151.388 188.446 140.339  1.00106.64           C  
ATOM   6511  N6   DA J  43     150.152 188.094 139.992  1.00106.64           N  
ATOM   6512  N1   DA J  43     152.399 187.585 140.116  1.00106.64           N  
ATOM   6513  C2   DA J  43     153.635 187.942 140.465  1.00106.64           C  
ATOM   6514  N3   DA J  43     154.051 189.069 141.026  1.00106.64           N  
ATOM   6515  C4   DA J  43     153.024 189.897 141.241  1.00106.64           C  
ATOM   6516  H5'  DA J  43     152.741 193.094 144.907  1.00106.64           H  
ATOM   6517 H5''  DA J  43     153.681 194.010 145.780  1.00106.64           H  
ATOM   6518  H4'  DA J  43     155.369 193.041 144.841  1.00106.64           H  
ATOM   6519  H3'  DA J  43     155.049 194.836 143.047  1.00106.64           H  
ATOM   6520  H2'  DA J  43     153.505 193.721 141.831  1.00106.64           H  
ATOM   6521 H2''  DA J  43     154.823 193.379 141.004  1.00106.64           H  
ATOM   6522  H1'  DA J  43     155.060 191.371 141.961  1.00106.64           H  
ATOM   6523  H8   DA J  43     151.545 192.434 142.128  1.00106.64           H  
ATOM   6524  H61  DA J  43     150.004 187.317 139.661  1.00106.64           H  
ATOM   6525  H62  DA J  43     149.502 188.643 140.109  1.00106.64           H  
ATOM   6526  H2   DA J  43     154.298 187.313 140.288  1.00106.64           H  
ATOM   6527  P    DC J  44     157.385 194.363 141.591  1.00103.58           P  
ATOM   6528  OP1  DC J  44     158.653 194.888 142.139  1.00103.58           O  
ATOM   6529  OP2  DC J  44     156.446 195.280 140.912  1.00103.58           O  
ATOM   6530  O5'  DC J  44     157.707 193.166 140.585  1.00103.58           O  
ATOM   6531  C5'  DC J  44     158.388 192.035 141.073  1.00103.58           C  
ATOM   6532  C4'  DC J  44     158.602 190.996 139.993  1.00103.58           C  
ATOM   6533  O4'  DC J  44     157.346 190.327 139.710  1.00103.58           O  
ATOM   6534  C3'  DC J  44     159.095 191.534 138.654  1.00103.58           C  
ATOM   6535  O3'  DC J  44     160.050 190.630 138.096  1.00103.58           O  
ATOM   6536  C2'  DC J  44     157.809 191.616 137.844  1.00103.58           C  
ATOM   6537  C1'  DC J  44     157.102 190.365 138.322  1.00103.58           C  
ATOM   6538  N1   DC J  44     155.590 190.303 138.104  1.00103.58           N  
ATOM   6539  C2   DC J  44     155.003 189.127 137.597  1.00103.58           C  
ATOM   6540  O2   DC J  44     155.729 188.170 137.295  1.00103.58           O  
ATOM   6541  N3   DC J  44     153.657 189.078 137.447  1.00103.58           N  
ATOM   6542  C4   DC J  44     152.911 190.127 137.789  1.00103.58           C  
ATOM   6543  N4   DC J  44     151.596 190.038 137.629  1.00103.58           N  
ATOM   6544  C5   DC J  44     153.478 191.317 138.309  1.00103.58           C  
ATOM   6545  C6   DC J  44     154.803 191.359 138.466  1.00103.58           C  
ATOM   6546  H5'  DC J  44     157.869 191.643 141.789  1.00103.58           H  
ATOM   6547 H5''  DC J  44     159.248 192.311 141.420  1.00103.58           H  
ATOM   6548  H4'  DC J  44     159.236 190.338 140.315  1.00103.58           H  
ATOM   6549  H3'  DC J  44     159.481 192.415 138.766  1.00103.58           H  
ATOM   6550  H2'  DC J  44     157.313 192.416 138.073  1.00103.58           H  
ATOM   6551 H2''  DC J  44     157.990 191.572 136.894  1.00103.58           H  
ATOM   6552  H1'  DC J  44     157.525 189.597 137.915  1.00103.58           H  
ATOM   6553  H41  DC J  44     151.072 190.487 138.139  1.00103.58           H  
ATOM   6554  H42  DC J  44     151.273 189.529 137.021  1.00103.58           H  
ATOM   6555  H5   DC J  44     152.943 192.035 138.549  1.00103.58           H  
ATOM   6556  H6   DC J  44     155.200 192.128 138.806  1.00103.58           H  
ATOM   6557  P    DT J  45     160.976 191.048 136.850  1.00109.27           P  
ATOM   6558  OP1  DT J  45     162.302 191.406 137.398  1.00109.27           O  
ATOM   6559  OP2  DT J  45     160.249 192.027 136.014  1.00109.27           O  
ATOM   6560  O5'  DT J  45     161.127 189.686 136.017  1.00109.27           O  
ATOM   6561  C5'  DT J  45     160.004 188.811 135.863  1.00109.27           C  
ATOM   6562  C4'  DT J  45     159.662 188.544 134.396  1.00109.27           C  
ATOM   6563  O4'  DT J  45     158.207 188.482 134.258  1.00109.27           O  
ATOM   6564  C3'  DT J  45     160.105 189.608 133.377  1.00109.27           C  
ATOM   6565  O3'  DT J  45     160.399 189.006 132.120  1.00109.27           O  
ATOM   6566  C2'  DT J  45     158.881 190.503 133.312  1.00109.27           C  
ATOM   6567  C1'  DT J  45     157.782 189.453 133.318  1.00109.27           C  
ATOM   6568  N1   DT J  45     156.391 189.917 133.672  1.00109.27           N  
ATOM   6569  C2   DT J  45     155.370 189.026 133.511  1.00109.27           C  
ATOM   6570  O2   DT J  45     155.540 187.891 133.113  1.00109.27           O  
ATOM   6571  N3   DT J  45     154.133 189.498 133.838  1.00109.27           N  
ATOM   6572  C4   DT J  45     153.817 190.755 134.300  1.00109.27           C  
ATOM   6573  O4   DT J  45     152.666 191.085 134.567  1.00109.27           O  
ATOM   6574  C5   DT J  45     154.933 191.654 134.440  1.00109.27           C  
ATOM   6575  C7   DT J  45     154.715 193.052 134.936  1.00109.27           C  
ATOM   6576  C6   DT J  45     156.151 191.201 134.120  1.00109.27           C  
ATOM   6577  H5'  DT J  45     159.234 189.207 136.295  1.00109.27           H  
ATOM   6578 H5''  DT J  45     160.205 187.967 136.297  1.00109.27           H  
ATOM   6579  H4'  DT J  45     160.036 187.687 134.139  1.00109.27           H  
ATOM   6580  H3'  DT J  45     160.870 190.104 133.698  1.00109.27           H  
ATOM   6581  H2'  DT J  45     158.843 191.072 134.092  1.00109.27           H  
ATOM   6582 H2''  DT J  45     158.863 191.020 132.493  1.00109.27           H  
ATOM   6583  H1'  DT J  45     157.749 189.043 132.443  1.00109.27           H  
ATOM   6584  H3   DT J  45     153.479 188.950 133.747  1.00109.27           H  
ATOM   6585  H71  DT J  45     155.491 193.338 135.443  1.00109.27           H  
ATOM   6586  H72  DT J  45     154.583 193.647 134.182  1.00109.27           H  
ATOM   6587  H73  DT J  45     153.930 193.074 135.507  1.00109.27           H  
ATOM   6588  H6   DT J  45     156.867 191.776 134.213  1.00109.27           H  
ATOM   6589  P    DG J  46     161.857 188.397 131.827  1.00103.57           P  
ATOM   6590  OP1  DG J  46     162.275 187.620 133.014  1.00103.57           O  
ATOM   6591  OP2  DG J  46     162.715 189.496 131.331  1.00103.57           O  
ATOM   6592  O5'  DG J  46     161.606 187.389 130.614  1.00103.57           O  
ATOM   6593  C5'  DG J  46     160.611 186.382 130.720  1.00103.57           C  
ATOM   6594  C4'  DG J  46     159.570 186.531 129.636  1.00103.57           C  
ATOM   6595  O4'  DG J  46     158.606 187.553 130.020  1.00103.57           O  
ATOM   6596  C3'  DG J  46     160.103 186.980 128.260  1.00103.57           C  
ATOM   6597  O3'  DG J  46     159.522 186.213 127.225  1.00103.57           O  
ATOM   6598  C2'  DG J  46     159.634 188.422 128.184  1.00103.57           C  
ATOM   6599  C1'  DG J  46     158.301 188.261 128.852  1.00103.57           C  
ATOM   6600  N9   DG J  46     157.588 189.486 129.152  1.00103.57           N  
ATOM   6601  C8   DG J  46     158.086 190.759 129.245  1.00103.57           C  
ATOM   6602  N7   DG J  46     157.170 191.650 129.503  1.00103.57           N  
ATOM   6603  C5   DG J  46     155.996 190.911 129.570  1.00103.57           C  
ATOM   6604  C6   DG J  46     154.671 191.319 129.818  1.00103.57           C  
ATOM   6605  O6   DG J  46     154.252 192.457 130.038  1.00103.57           O  
ATOM   6606  N1   DG J  46     153.786 190.242 129.795  1.00103.57           N  
ATOM   6607  C2   DG J  46     154.144 188.938 129.561  1.00103.57           C  
ATOM   6608  N2   DG J  46     153.162 188.026 129.575  1.00103.57           N  
ATOM   6609  N3   DG J  46     155.380 188.549 129.327  1.00103.57           N  
ATOM   6610  C4   DG J  46     156.247 189.583 129.351  1.00103.57           C  
ATOM   6611  H5'  DG J  46     160.179 186.449 131.585  1.00103.57           H  
ATOM   6612 H5''  DG J  46     161.027 185.512 130.640  1.00103.57           H  
ATOM   6613  H4'  DG J  46     159.107 185.687 129.532  1.00103.57           H  
ATOM   6614  H3'  DG J  46     161.069 186.928 128.230  1.00103.57           H  
ATOM   6615  H2'  DG J  46     160.216 189.009 128.690  1.00103.57           H  
ATOM   6616 H2''  DG J  46     159.535 188.717 127.266  1.00103.57           H  
ATOM   6617  H1'  DG J  46     157.742 187.708 128.304  1.00103.57           H  
ATOM   6618  H8   DG J  46     158.985 190.965 129.142  1.00103.57           H  
ATOM   6619  H1   DG J  46     152.953 190.408 129.939  1.00103.57           H  
ATOM   6620  H21  DG J  46     153.349 187.191 129.486  1.00103.57           H  
ATOM   6621  H22  DG J  46     152.345 188.276 129.675  1.00103.57           H  
ATOM   6622  P  A DC J  47     160.228 184.932 126.671  0.50102.48           P  
ATOM   6623  P  B DC J  47     160.308 184.995 126.588  0.50102.48           P  
ATOM   6624  OP1A DC J  47     160.818 184.218 127.824  0.50102.48           O  
ATOM   6625  OP1B DC J  47     160.991 184.289 127.694  0.50102.48           O  
ATOM   6626  OP2A DC J  47     161.083 185.331 125.530  0.50102.48           O  
ATOM   6627  OP2B DC J  47     161.091 185.499 125.437  0.50102.48           O  
ATOM   6628  O5'A DC J  47     159.011 184.072 126.094  0.50102.48           O  
ATOM   6629  O5'B DC J  47     159.146 184.059 126.020  0.50102.48           O  
ATOM   6630  C5'A DC J  47     158.119 183.440 126.993  0.50102.48           C  
ATOM   6631  C5'B DC J  47     158.263 183.420 126.921  0.50102.48           C  
ATOM   6632  C4'A DC J  47     156.686 183.521 126.514  0.50102.48           C  
ATOM   6633  C4'B DC J  47     156.831 183.512 126.446  0.50102.48           C  
ATOM   6634  O4'A DC J  47     156.146 184.827 126.844  0.50102.48           O  
ATOM   6635  O4'B DC J  47     156.300 184.820 126.789  0.50102.48           O  
ATOM   6636  C3'A DC J  47     156.508 183.333 125.015  0.50102.48           C  
ATOM   6637  C3'B DC J  47     156.648 183.356 124.941  0.50102.48           C  
ATOM   6638  O3'A DC J  47     155.523 182.356 124.749  0.50102.48           O  
ATOM   6639  O3'B DC J  47     155.557 182.504 124.658  0.50102.48           O  
ATOM   6640  C2'A DC J  47     156.115 184.714 124.505  0.50102.48           C  
ATOM   6641  C2'B DC J  47     156.418 184.784 124.468  0.50102.48           C  
ATOM   6642  C1'A DC J  47     155.491 185.383 125.731  0.50102.48           C  
ATOM   6643  C1'B DC J  47     155.689 185.388 125.658  0.50102.48           C  
ATOM   6644  N1 A DC J  47     155.643 186.915 125.809  0.50102.48           N  
ATOM   6645  N1 B DC J  47     155.757 186.915 125.777  0.50102.48           N  
ATOM   6646  C2 A DC J  47     154.525 187.746 126.081  0.50102.48           C  
ATOM   6647  C2 B DC J  47     154.588 187.659 126.031  0.50102.48           C  
ATOM   6648  O2 A DC J  47     153.403 187.243 126.229  0.50102.48           O  
ATOM   6649  O2 B DC J  47     153.501 187.079 126.140  0.50102.48           O  
ATOM   6650  N3 A DC J  47     154.718 189.090 126.160  0.50102.48           N  
ATOM   6651  N3 B DC J  47     154.680 189.004 126.145  0.50102.48           N  
ATOM   6652  C4 A DC J  47     155.936 189.598 125.996  0.50102.48           C  
ATOM   6653  C4 B DC J  47     155.858 189.604 126.025  0.50102.48           C  
ATOM   6654  N4 A DC J  47     156.087 190.919 126.083  0.50102.48           N  
ATOM   6655  N4 B DC J  47     155.893 190.931 126.147  0.50102.48           N  
ATOM   6656  C5 A DC J  47     157.065 188.780 125.738  0.50102.48           C  
ATOM   6657  C5 B DC J  47     157.051 188.875 125.779  0.50102.48           C  
ATOM   6658  C6 A DC J  47     156.879 187.467 125.662  0.50102.48           C  
ATOM   6659  C6 B DC J  47     156.957 187.551 125.669  0.50102.48           C  
ATOM   6660  H5'A DC J  47     158.186 183.872 127.856  0.50102.48           H  
ATOM   6661  H5'B DC J  47     158.335 183.845 127.788  0.50102.48           H  
ATOM   6662 H5''A DC J  47     158.368 182.510 127.082  0.50102.48           H  
ATOM   6663 H5''B DC J  47     158.510 182.488 127.001  0.50102.48           H  
ATOM   6664  H4'A DC J  47     156.166 182.846 126.972  0.50102.48           H  
ATOM   6665  H4'B DC J  47     156.307 182.834 126.895  0.50102.48           H  
ATOM   6666  H3'A DC J  47     157.347 183.064 124.619  0.50102.48           H  
ATOM   6667  H3'B DC J  47     157.457 183.002 124.546  0.50102.48           H  
ATOM   6668  H2'A DC J  47     156.898 185.190 124.202  0.50102.48           H  
ATOM   6669  H2'B DC J  47     157.263 185.224 124.307  0.50102.48           H  
ATOM   6670 H2''A DC J  47     155.467 184.636 123.796  0.50102.48           H  
ATOM   6671 H2''B DC J  47     155.860 184.803 123.678  0.50102.48           H  
ATOM   6672  H1'A DC J  47     154.553 185.148 125.770  0.50102.48           H  
ATOM   6673  H1'B DC J  47     154.766 185.105 125.628  0.50102.48           H  
ATOM   6674  H41A DC J  47     156.867 191.254 126.212  0.50102.48           H  
ATOM   6675  H41B DC J  47     156.638 191.328 126.305  0.50102.48           H  
ATOM   6676  H42A DC J  47     155.402 191.434 126.014  0.50102.48           H  
ATOM   6677  H42B DC J  47     155.168 191.388 126.071  0.50102.48           H  
ATOM   6678  H5 A DC J  47     157.909 189.150 125.628  0.50102.48           H  
ATOM   6679  H5 B DC J  47     157.868 189.306 125.699  0.50102.48           H  
ATOM   6680  H6 A DC J  47     157.604 186.915 125.491  0.50102.48           H  
ATOM   6681  H6 B DC J  47     157.722 187.053 125.505  0.50102.48           H  
ATOM   6682  P  A DT J  48     155.310 181.827 123.267  0.50102.15           P  
ATOM   6683  P  B DT J  48     155.258 182.064 123.168  0.50102.15           P  
ATOM   6684  OP1A DT J  48     155.015 180.380 123.347  0.50102.15           O  
ATOM   6685  OP1B DT J  48     154.958 180.616 123.180  0.50102.15           O  
ATOM   6686  OP2A DT J  48     156.435 182.306 122.435  0.50102.15           O  
ATOM   6687  OP2B DT J  48     156.347 182.587 122.314  0.50102.15           O  
ATOM   6688  O5'A DT J  48     153.995 182.592 122.790  0.50102.15           O  
ATOM   6689  O5'B DT J  48     153.925 182.862 122.807  0.50102.15           O  
ATOM   6690  C5'A DT J  48     152.817 182.451 123.542  0.50102.15           C  
ATOM   6691  C5'B DT J  48     152.797 182.714 123.634  0.50102.15           C  
ATOM   6692  C4'A DT J  48     151.855 183.584 123.275  0.50102.15           C  
ATOM   6693  C4'B DT J  48     151.748 183.761 123.332  0.50102.15           C  
ATOM   6694  O4'A DT J  48     152.482 184.854 123.611  0.50102.15           O  
ATOM   6695  O4'B DT J  48     152.245 185.082 123.702  0.50102.15           O  
ATOM   6696  C3'A DT J  48     151.389 183.719 121.821  0.50102.15           C  
ATOM   6697  C3'B DT J  48     151.339 183.868 121.861  0.50102.15           C  
ATOM   6698  O3'A DT J  48     149.965 183.768 121.782  0.50102.15           O  
ATOM   6699  O3'B DT J  48     149.917 183.928 121.761  0.50102.15           O  
ATOM   6700  C2'A DT J  48     152.045 185.020 121.366  0.50102.15           C  
ATOM   6701  C2'B DT J  48     152.019 185.154 121.416  0.50102.15           C  
ATOM   6702  C1'A DT J  48     152.068 185.799 122.662  0.50102.15           C  
ATOM   6703  C1'B DT J  48     151.899 185.983 122.680  0.50102.15           C  
ATOM   6704  N1 A DT J  48     152.998 187.003 122.693  0.50102.15           N  
ATOM   6705  N1 B DT J  48     152.795 187.219 122.757  0.50102.15           N  
ATOM   6706  C2 A DT J  48     152.483 188.258 122.959  0.50102.15           C  
ATOM   6707  C2 B DT J  48     152.232 188.461 123.021  0.50102.15           C  
ATOM   6708  O2 A DT J  48     151.302 188.472 123.163  0.50102.15           O  
ATOM   6709  O2 B DT J  48     151.039 188.638 123.185  0.50102.15           O  
ATOM   6710  N3 A DT J  48     153.406 189.267 122.971  0.50102.15           N  
ATOM   6711  N3 B DT J  48     153.129 189.499 123.079  0.50102.15           N  
ATOM   6712  C4 A DT J  48     154.762 189.159 122.758  0.50102.15           C  
ATOM   6713  C4 B DT J  48     154.497 189.424 122.911  0.50102.15           C  
ATOM   6714  O4 A DT J  48     155.509 190.129 122.791  0.50102.15           O  
ATOM   6715  O4 B DT J  48     155.222 190.408 122.982  0.50102.15           O  
ATOM   6716  C5 A DT J  48     155.240 187.827 122.490  0.50102.15           C  
ATOM   6717  C5 B DT J  48     155.020 188.105 122.646  0.50102.15           C  
ATOM   6718  C7 A DT J  48     156.700 187.594 122.244  0.50102.15           C  
ATOM   6719  C7 B DT J  48     156.492 187.908 122.445  0.50102.15           C  
ATOM   6720  C6 A DT J  48     154.347 186.824 122.472  0.50102.15           C  
ATOM   6721  C6 B DT J  48     154.157 187.078 122.587  0.50102.15           C  
ATOM   6722  H5'A DT J  48     153.041 182.442 124.484  0.50102.15           H  
ATOM   6723  H5'B DT J  48     153.070 182.797 124.560  0.50102.15           H  
ATOM   6724 H5''A DT J  48     152.391 181.614 123.309  0.50102.15           H  
ATOM   6725 H5''B DT J  48     152.416 181.835 123.493  0.50102.15           H  
ATOM   6726  H4'A DT J  48     151.076 183.465 123.837  0.50102.15           H  
ATOM   6727  H4'B DT J  48     150.959 183.567 123.858  0.50102.15           H  
ATOM   6728  H3'A DT J  48     151.716 182.977 121.294  0.50102.15           H  
ATOM   6729  H3'B DT J  48     151.683 183.115 121.359  0.50102.15           H  
ATOM   6730  H2'A DT J  48     152.943 184.855 121.041  0.50102.15           H  
ATOM   6731  H2'B DT J  48     152.946 184.990 121.189  0.50102.15           H  
ATOM   6732 H2''A DT J  48     151.510 185.466 120.700  0.50102.15           H  
ATOM   6733 H2''B DT J  48     151.545 185.561 120.684  0.50102.15           H  
ATOM   6734  H1'A DT J  48     151.166 186.080 122.872  0.50102.15           H  
ATOM   6735  H1'B DT J  48     150.975 186.247 122.793  0.50102.15           H  
ATOM   6736  H3 A DT J  48     153.107 190.056 123.132  0.50102.15           H  
ATOM   6737  H3 B DT J  48     152.805 190.278 123.238  0.50102.15           H  
ATOM   6738  H71A DT J  48     156.912 186.664 122.411  0.50102.15           H  
ATOM   6739  H71B DT J  48     156.749 187.033 122.772  0.50102.15           H  
ATOM   6740  H72A DT J  48     156.912 187.814 121.323  0.50102.15           H  
ATOM   6741  H72B DT J  48     156.703 187.976 121.501  0.50102.15           H  
ATOM   6742  H73A DT J  48     157.221 188.156 122.839  0.50102.15           H  
ATOM   6743  H73B DT J  48     156.978 188.589 122.933  0.50102.15           H  
ATOM   6744  H6 A DT J  48     154.654 185.964 122.301  0.50102.15           H  
ATOM   6745  H6 B DT J  48     154.493 186.229 122.414  0.50102.15           H  
ATOM   6746  P  A DC J  49     149.182 183.833 120.425  0.50 98.49           P  
ATOM   6747  P  B DC J  49     149.195 183.937 120.367  0.50 98.49           P  
ATOM   6748  OP1A DC J  49     148.168 182.759 120.443  0.50 98.49           O  
ATOM   6749  OP1B DC J  49     148.182 182.862 120.389  0.50 98.49           O  
ATOM   6750  OP2A DC J  49     150.161 183.886 119.320  0.50 98.49           O  
ATOM   6751  OP2B DC J  49     150.228 183.939 119.310  0.50 98.49           O  
ATOM   6752  O5'A DC J  49     148.427 185.239 120.506  0.50 98.49           O  
ATOM   6753  O5'B DC J  49     148.439 185.346 120.348  0.50 98.49           O  
ATOM   6754  C5'A DC J  49     147.815 185.652 121.727  0.50 98.49           C  
ATOM   6755  C5'B DC J  49     147.658 185.752 121.467  0.50 98.49           C  
ATOM   6756  C4'A DC J  49     147.006 186.925 121.536  0.50 98.49           C  
ATOM   6757  C4'B DC J  49     146.968 187.085 121.216  0.50 98.49           C  
ATOM   6758  O4'A DC J  49     147.887 188.078 121.618  0.50 98.49           O  
ATOM   6759  O4'B DC J  49     147.932 188.163 121.354  0.50 98.49           O  
ATOM   6760  C3'A DC J  49     146.308 187.044 120.192  0.50 98.49           C  
ATOM   6761  C3'B DC J  49     146.368 187.261 119.827  0.50 98.49           C  
ATOM   6762  O3'A DC J  49     145.103 187.815 120.290  0.50 98.49           O  
ATOM   6763  O3'B DC J  49     145.233 188.129 119.866  0.50 98.49           O  
ATOM   6764  C2'A DC J  49     147.351 187.729 119.340  0.50 98.49           C  
ATOM   6765  C2'B DC J  49     147.523 187.861 119.049  0.50 98.49           C  
ATOM   6766  C1'A DC J  49     148.027 188.683 120.341  0.50 98.49           C  
ATOM   6767  C1'B DC J  49     148.159 188.786 120.097  0.50 98.49           C  
ATOM   6768  N1 A DC J  49     149.526 188.969 120.113  0.50 98.49           N  
ATOM   6769  N1 B DC J  49     149.668 189.039 119.964  0.50 98.49           N  
ATOM   6770  C2 A DC J  49     150.030 190.283 120.217  0.50 98.49           C  
ATOM   6771  C2 B DC J  49     150.192 190.330 120.155  0.50 98.49           C  
ATOM   6772  O2 A DC J  49     149.260 191.219 120.459  0.50 98.49           O  
ATOM   6773  O2 B DC J  49     149.427 191.272 120.386  0.50 98.49           O  
ATOM   6774  N3 A DC J  49     151.356 190.487 120.034  0.50 98.49           N  
ATOM   6775  N3 B DC J  49     151.529 190.511 120.056  0.50 98.49           N  
ATOM   6776  C4 A DC J  49     152.157 189.462 119.777  0.50 98.49           C  
ATOM   6777  C4 B DC J  49     152.321 189.480 119.802  0.50 98.49           C  
ATOM   6778  N4 A DC J  49     153.448 189.699 119.607  0.50 98.49           N  
ATOM   6779  N4 B DC J  49     153.626 189.692 119.719  0.50 98.49           N  
ATOM   6780  C5 A DC J  49     151.677 188.141 119.682  0.50 98.49           C  
ATOM   6781  C5 B DC J  49     151.819 188.176 119.627  0.50 98.49           C  
ATOM   6782  C6 A DC J  49     150.378 187.937 119.868  0.50 98.49           C  
ATOM   6783  C6 B DC J  49     150.509 187.999 119.727  0.50 98.49           C  
ATOM   6784  H5'A DC J  49     148.502 185.810 122.388  0.50 98.49           H  
ATOM   6785  H5'B DC J  49     148.234 185.836 122.241  0.50 98.49           H  
ATOM   6786 H5''A DC J  49     147.231 184.950 122.041  0.50 98.49           H  
ATOM   6787 H5''B DC J  49     146.990 185.079 121.646  0.50 98.49           H  
ATOM   6788  H4'A DC J  49     146.346 186.985 122.241  0.50 98.49           H  
ATOM   6789  H4'B DC J  49     146.271 187.204 121.875  0.50 98.49           H  
ATOM   6790  H3'A DC J  49     146.116 186.166 119.838  0.50 98.49           H  
ATOM   6791  H3'B DC J  49     146.124 186.403 119.456  0.50 98.49           H  
ATOM   6792  H2'A DC J  49     147.969 187.086 118.979  0.50 98.49           H  
ATOM   6793  H2'B DC J  49     148.127 187.172 118.759  0.50 98.49           H  
ATOM   6794 H2''A DC J  49     146.924 188.215 118.642  0.50 98.49           H  
ATOM   6795 H2''B DC J  49     147.196 188.363 118.300  0.50 98.49           H  
ATOM   6796  H1'A DC J  49     147.544 189.519 120.336  0.50 98.49           H  
ATOM   6797  H1'B DC J  49     147.693 189.632 120.080  0.50 98.49           H  
ATOM   6798  H41A DC J  49     153.970 189.065 119.360  0.50 98.49           H  
ATOM   6799  H41B DC J  49     154.150 189.052 119.492  0.50 98.49           H  
ATOM   6800  H42A DC J  49     153.761 190.483 119.751  0.50 98.49           H  
ATOM   6801  H42B DC J  49     153.946 190.466 119.900  0.50 98.49           H  
ATOM   6802  H5 A DC J  49     152.252 187.437 119.504  0.50 98.49           H  
ATOM   6803  H5 B DC J  49     152.388 187.466 119.453  0.50 98.49           H  
ATOM   6804  H6 A DC J  49     150.041 187.075 119.807  0.50 98.49           H  
ATOM   6805  H6 B DC J  49     150.157 187.149 119.612  0.50 98.49           H  
ATOM   6806  P  A DC J  50     144.116 187.974 118.993  0.50 99.76           P  
ATOM   6807  OP1A DC J  50     142.760 187.572 119.420  0.50 99.76           O  
ATOM   6808  OP2A DC J  50     144.754 187.291 117.849  0.50 99.76           O  
ATOM   6809  O5'A DC J  50     144.127 189.545 118.674  0.50 99.76           O  
ATOM   6810  C5'A DC J  50     143.216 190.413 119.343  0.50 99.76           C  
ATOM   6811  C4'A DC J  50     143.525 191.877 119.068  0.50 99.76           C  
ATOM   6812  O4'A DC J  50     144.960 192.070 119.090  0.50 99.76           O  
ATOM   6813  C3'A DC J  50     143.029 192.402 117.725  0.50 99.76           C  
ATOM   6814  O3'A DC J  50     142.349 193.634 117.893  0.50 99.76           O  
ATOM   6815  C2'A DC J  50     144.289 192.544 116.882  0.50 99.76           C  
ATOM   6816  C1'A DC J  50     145.404 192.695 117.909  0.50 99.76           C  
ATOM   6817  N1 A DC J  50     146.721 192.047 117.510  0.50 99.76           N  
ATOM   6818  C2 A DC J  50     147.893 192.814 117.362  0.50 99.76           C  
ATOM   6819  O2 A DC J  50     147.849 194.038 117.517  0.50 99.76           O  
ATOM   6820  N3 A DC J  50     149.043 192.182 117.012  0.50 99.76           N  
ATOM   6821  C4 A DC J  50     149.059 190.865 116.841  0.50 99.76           C  
ATOM   6822  N4 A DC J  50     150.212 190.280 116.512  0.50 99.76           N  
ATOM   6823  C5 A DC J  50     147.897 190.083 116.993  0.50 99.76           C  
ATOM   6824  C6 A DC J  50     146.768 190.698 117.341  0.50 99.76           C  
ATOM   6825  H5'A DC J  50     143.276 190.254 120.294  0.50 99.76           H  
ATOM   6826 H5''A DC J  50     142.316 190.216 119.045  0.50 99.76           H  
ATOM   6827  H4'A DC J  50     143.130 192.413 119.769  0.50 99.76           H  
ATOM   6828  H3'A DC J  50     142.436 191.755 117.320  0.50 99.76           H  
ATOM   6829  H2'A DC J  50     144.421 191.755 116.339  0.50 99.76           H  
ATOM   6830 H2''A DC J  50     144.234 193.333 116.328  0.50 99.76           H  
ATOM   6831  H1'A DC J  50     145.541 193.635 118.085  0.50 99.76           H  
ATOM   6832  H41A DC J  50     150.234 189.437 116.348  0.50 99.76           H  
ATOM   6833  H42A DC J  50     150.933 190.744 116.475  0.50 99.76           H  
ATOM   6834  H5 A DC J  50     147.924 189.161 116.883  0.50 99.76           H  
ATOM   6835  H6 A DC J  50     145.992 190.198 117.451  0.50 99.76           H  
ATOM   6836  P  B DA J  50     144.260 188.259 118.593  0.50 99.76           P  
ATOM   6837  OP1B DA J  50     142.953 187.690 118.985  0.50 99.76           O  
ATOM   6838  OP2B DA J  50     144.966 187.715 117.415  0.50 99.76           O  
ATOM   6839  O5'B DA J  50     144.096 189.840 118.380  0.50 99.76           O  
ATOM   6840  C5'B DA J  50     143.259 190.593 119.250  0.50 99.76           C  
ATOM   6841  C4'B DA J  50     143.386 192.089 118.999  0.50 99.76           C  
ATOM   6842  O4'B DA J  50     144.780 192.479 119.085  0.50 99.76           O  
ATOM   6843  C3'B DA J  50     142.904 192.559 117.639  0.50 99.76           C  
ATOM   6844  O3'B DA J  50     142.297 193.834 117.738  0.50 99.76           O  
ATOM   6845  C2'B DA J  50     144.174 192.578 116.802  0.50 99.76           C  
ATOM   6846  C1'B DA J  50     145.263 192.902 117.823  0.50 99.76           C  
ATOM   6847  N9 B DA J  50     146.552 192.235 117.589  0.50 99.76           N  
ATOM   6848  C8 B DA J  50     146.760 190.906 117.357  0.50 99.76           C  
ATOM   6849  N7 B DA J  50     148.019 190.580 117.210  0.50 99.76           N  
ATOM   6850  C5 B DA J  50     148.693 191.769 117.371  0.50 99.76           C  
ATOM   6851  C6 B DA J  50     150.060 192.087 117.330  0.50 99.76           C  
ATOM   6852  N6 B DA J  50     151.013 191.175 117.113  0.50 99.76           N  
ATOM   6853  N1 B DA J  50     150.412 193.376 117.531  0.50 99.76           N  
ATOM   6854  C2 B DA J  50     149.449 194.279 117.755  0.50 99.76           C  
ATOM   6855  N3 B DA J  50     148.126 194.098 117.816  0.50 99.76           N  
ATOM   6856  C4 B DA J  50     147.811 192.806 117.612  0.50 99.76           C  
ATOM   6857  H5'B DA J  50     143.506 190.405 120.167  0.50 99.76           H  
ATOM   6858 H5''B DA J  50     142.338 190.328 119.109  0.50 99.76           H  
ATOM   6859  H4'B DA J  50     142.889 192.563 119.681  0.50 99.76           H  
ATOM   6860  H3'B DA J  50     142.277 191.921 117.274  0.50 99.76           H  
ATOM   6861  H2'B DA J  50     144.321 191.715 116.395  0.50 99.76           H  
ATOM   6862 H2''B DA J  50     144.126 193.270 116.128  0.50 99.76           H  
ATOM   6863  H1'B DA J  50     145.399 193.860 117.843  0.50 99.76           H  
ATOM   6864  H8 B DA J  50     146.069 190.289 117.297  0.50 99.76           H  
ATOM   6865  H62B DA J  50     150.952 190.395 117.476  0.50 99.76           H  
ATOM   6866  H2 B DA J  50     149.742 195.153 117.888  0.50 99.76           H  
ATOM   6867  P  A DA J  51     141.566 194.289 116.675  0.50103.95           P  
ATOM   6868  P  B DA J  51     141.563 194.467 116.488  0.50103.95           P  
ATOM   6869  OP1A DA J  51     140.479 195.116 117.240  0.50103.95           O  
ATOM   6870  OP1B DA J  51     140.430 195.269 116.994  0.50103.95           O  
ATOM   6871  OP2A DA J  51     141.247 193.225 115.700  0.50103.95           O  
ATOM   6872  OP2B DA J  51     141.319 193.391 115.503  0.50103.95           O  
ATOM   6873  O5'A DA J  51     142.652 195.251 116.007  0.50103.95           O  
ATOM   6874  O5'B DA J  51     142.660 195.451 115.871  0.50103.95           O  
ATOM   6875  C5'A DA J  51     143.315 196.223 116.804  0.50103.95           C  
ATOM   6876  C5'B DA J  51     143.250 196.452 116.693  0.50103.95           C  
ATOM   6877  C4'A DA J  51     144.448 196.895 116.041  0.50103.95           C  
ATOM   6878  C4'B DA J  51     144.422 197.122 115.993  0.50103.95           C  
ATOM   6879  O4'A DA J  51     145.591 196.004 115.987  0.50103.95           O  
ATOM   6880  O4'B DA J  51     145.552 196.216 115.985  0.50103.95           O  
ATOM   6881  C3'A DA J  51     144.127 197.269 114.589  0.50103.95           C  
ATOM   6882  C3'B DA J  51     144.167 197.514 114.534  0.50103.95           C  
ATOM   6883  O3'A DA J  51     144.340 198.658 114.377  0.50103.95           O  
ATOM   6884  O3'B DA J  51     144.396 198.903 114.342  0.50103.95           O  
ATOM   6885  C2'A DA J  51     145.074 196.399 113.757  0.50103.95           C  
ATOM   6886  C2'B DA J  51     145.139 196.650 113.729  0.50103.95           C  
ATOM   6887  C1'A DA J  51     146.203 196.113 114.727  0.50103.95           C  
ATOM   6888  C1'B DA J  51     146.210 196.291 114.748  0.50103.95           C  
ATOM   6889  N9 A DA J  51     146.950 194.880 114.467  0.50103.95           N  
ATOM   6890  N9 B DA J  51     146.885 195.013 114.507  0.50103.95           N  
ATOM   6891  C8 A DA J  51     146.477 193.601 114.512  0.50103.95           C  
ATOM   6892  C8 B DA J  51     146.306 193.789 114.344  0.50103.95           C  
ATOM   6893  N7 A DA J  51     147.385 192.691 114.257  0.50103.95           N  
ATOM   6894  N7 B DA J  51     147.161 192.817 114.161  0.50103.95           N  
ATOM   6895  C5 A DA J  51     148.534 193.424 114.038  0.50103.95           C  
ATOM   6896  C5 B DA J  51     148.386 193.443 114.220  0.50103.95           C  
ATOM   6897  C6 A DA J  51     149.852 193.050 113.719  0.50103.95           C  
ATOM   6898  C6 B DA J  51     149.696 192.963 114.100  0.50103.95           C  
ATOM   6899  N6 A DA J  51     150.237 191.785 113.559  0.50103.95           N  
ATOM   6900  N6 B DA J  51     149.985 191.683 113.890  0.50103.95           N  
ATOM   6901  N1 A DA J  51     150.761 194.032 113.562  0.50103.95           N  
ATOM   6902  N1 B DA J  51     150.701 193.850 114.209  0.50103.95           N  
ATOM   6903  C2 A DA J  51     150.371 195.299 113.721  0.50103.95           C  
ATOM   6904  C2 B DA J  51     150.405 195.133 114.422  0.50103.95           C  
ATOM   6905  N3 A DA J  51     149.166 195.771 114.022  0.50103.95           N  
ATOM   6906  N3 B DA J  51     149.212 195.704 114.551  0.50103.95           N  
ATOM   6907  C4 A DA J  51     148.286 194.773 114.172  0.50103.95           C  
ATOM   6908  C4 B DA J  51     148.237 194.795 114.438  0.50103.95           C  
ATOM   6909  H5'A DA J  51     143.676 195.789 117.593  0.50103.95           H  
ATOM   6910  H5'B DA J  51     143.563 196.041 117.514  0.50103.95           H  
ATOM   6911 H5''A DA J  51     142.674 196.897 117.079  0.50103.95           H  
ATOM   6912 H5''B DA J  51     142.582 197.122 116.907  0.50103.95           H  
ATOM   6913  H4'A DA J  51     144.706 197.700 116.515  0.50103.95           H  
ATOM   6914  H4'B DA J  51     144.666 197.919 116.489  0.50103.95           H  
ATOM   6915  H3'A DA J  51     143.208 197.042 114.387  0.50103.95           H  
ATOM   6916  H3'B DA J  51     143.256 197.295 114.291  0.50103.95           H  
ATOM   6917  H2'A DA J  51     144.636 195.579 113.488  0.50103.95           H  
ATOM   6918  H2'B DA J  51     144.694 195.857 113.399  0.50103.95           H  
ATOM   6919 H2''A DA J  51     145.399 196.888 112.986  0.50103.95           H  
ATOM   6920 H2''B DA J  51     145.521 197.159 112.998  0.50103.95           H  
ATOM   6921  H1'A DA J  51     146.815 196.863 114.735  0.50103.95           H  
ATOM   6922  H1'B DA J  51     146.869 196.999 114.780  0.50103.95           H  
ATOM   6923  H8 A DA J  51     145.596 193.395 114.703  0.50103.95           H  
ATOM   6924  H8 B DA J  51     145.389 193.659 114.351  0.50103.95           H  
ATOM   6925  H61A DA J  51     151.026 191.610 113.268  0.50103.95           H  
ATOM   6926  H61B DA J  51     150.776 191.456 113.645  0.50103.95           H  
ATOM   6927  H62A DA J  51     149.694 191.145 113.744  0.50103.95           H  
ATOM   6928  H62B DA J  51     149.379 191.084 113.996  0.50103.95           H  
ATOM   6929  H2 A DA J  51     151.034 195.938 113.606  0.50103.95           H  
ATOM   6930  H2 B DA J  51     151.132 195.705 114.490  0.50103.95           H  
ATOM   6931  P  A DT J  52     143.761 199.378 113.081  0.50106.44           P  
ATOM   6932  P  B DT J  52     143.914 199.622 113.001  0.50106.44           P  
ATOM   6933  OP1A DT J  52     143.417 200.762 113.472  0.50106.44           O  
ATOM   6934  OP1B DT J  52     143.696 201.048 113.327  0.50106.44           O  
ATOM   6935  OP2A DT J  52     142.730 198.512 112.470  0.50106.44           O  
ATOM   6936  OP2B DT J  52     142.815 198.831 112.408  0.50106.44           O  
ATOM   6937  O5'A DT J  52     145.009 199.426 112.085  0.50106.44           O  
ATOM   6938  O5'B DT J  52     145.179 199.507 112.029  0.50106.44           O  
ATOM   6939  C5'A DT J  52     146.110 200.272 112.374  0.50106.44           C  
ATOM   6940  C5'B DT J  52     146.333 200.294 112.277  0.50106.44           C  
ATOM   6941  C4'A DT J  52     147.285 199.975 111.462  0.50106.44           C  
ATOM   6942  C4'B DT J  52     147.460 199.936 111.329  0.50106.44           C  
ATOM   6943  O4'A DT J  52     147.797 198.663 111.748  0.50106.44           O  
ATOM   6944  O4'B DT J  52     147.896 198.587 111.582  0.50106.44           O  
ATOM   6945  C3'A DT J  52     146.963 199.952 109.969  0.50106.44           C  
ATOM   6946  C3'B DT J  52     147.100 199.958 109.843  0.50106.44           C  
ATOM   6947  O3'A DT J  52     147.284 201.197 109.358  0.50106.44           O  
ATOM   6948  O3'B DT J  52     147.509 201.182 109.235  0.50106.44           O  
ATOM   6949  C2'A DT J  52     147.814 198.800 109.417  0.50106.44           C  
ATOM   6950  C2'B DT J  52     147.838 198.742 109.259  0.50106.44           C  
ATOM   6951  C1'A DT J  52     148.539 198.247 110.635  0.50106.44           C  
ATOM   6952  C1'B DT J  52     148.587 198.156 110.445  0.50106.44           C  
ATOM   6953  N1 A DT J  52     148.648 196.756 110.640  0.50106.44           N  
ATOM   6954  N1 B DT J  52     148.650 196.663 110.430  0.50106.44           N  
ATOM   6955  C2 A DT J  52     149.859 196.164 110.363  0.50106.44           C  
ATOM   6956  C2 B DT J  52     149.838 196.038 110.121  0.50106.44           C  
ATOM   6957  O2 A DT J  52     150.870 196.790 110.099  0.50106.44           O  
ATOM   6958  O2 B DT J  52     150.862 196.636 109.844  0.50106.44           O  
ATOM   6959  N3 A DT J  52     149.845 194.798 110.381  0.50106.44           N  
ATOM   6960  N3 B DT J  52     149.783 194.674 110.115  0.50106.44           N  
ATOM   6961  C4 A DT J  52     148.772 193.976 110.653  0.50106.44           C  
ATOM   6962  C4 B DT J  52     148.688 193.881 110.398  0.50106.44           C  
ATOM   6963  O4 A DT J  52     148.870 192.752 110.652  0.50106.44           O  
ATOM   6964  O4 B DT J  52     148.746 192.655 110.375  0.50106.44           O  
ATOM   6965  C5 A DT J  52     147.532 194.655 110.936  0.50106.44           C  
ATOM   6966  C5 B DT J  52     147.474 194.596 110.718  0.50106.44           C  
ATOM   6967  C7 A DT J  52     146.298 193.864 111.247  0.50106.44           C  
ATOM   6968  C7 B DT J  52     146.217 193.845 111.041  0.50106.44           C  
ATOM   6969  C6 A DT J  52     147.528 195.998 110.917  0.50106.44           C  
ATOM   6970  C6 B DT J  52     147.513 195.937 110.717  0.50106.44           C  
ATOM   6971  H5'A DT J  52     146.381 200.135 113.295  0.50106.44           H  
ATOM   6972  H5'B DT J  52     146.627 200.146 113.189  0.50106.44           H  
ATOM   6973 H5''A DT J  52     145.841 201.195 112.256  0.50106.44           H  
ATOM   6974 H5''B DT J  52     146.109 201.230 112.164  0.50106.44           H  
ATOM   6975  H4'A DT J  52     147.983 200.627 111.623  0.50106.44           H  
ATOM   6976  H4'B DT J  52     148.203 200.539 111.480  0.50106.44           H  
ATOM   6977  H3'A DT J  52     146.024 199.756 109.839  0.50106.44           H  
ATOM   6978  H3'B DT J  52     146.145 199.843 109.736  0.50106.44           H  
ATOM   6979  H2'A DT J  52     147.249 198.119 109.023  0.50106.44           H  
ATOM   6980  H2'B DT J  52     147.205 198.099 108.906  0.50106.44           H  
ATOM   6981 H2''A DT J  52     148.452 199.128 108.771  0.50106.44           H  
ATOM   6982 H2''B DT J  52     148.461 199.016 108.575  0.50106.44           H  
ATOM   6983  H1'A DT J  52     149.421 198.638 110.684  0.50106.44           H  
ATOM   6984  H1'B DT J  52     149.482 198.519 110.466  0.50106.44           H  
ATOM   6985  H3 A DT J  52     150.590 194.407 110.209  0.50106.44           H  
ATOM   6986  H3 B DT J  52     150.512 194.262 109.923  0.50106.44           H  
ATOM   6987  H71A DT J  52     145.728 194.377 111.838  0.50106.44           H  
ATOM   6988  H71B DT J  52     145.648 194.394 111.603  0.50106.44           H  
ATOM   6989  H72A DT J  52     145.821 193.672 110.424  0.50106.44           H  
ATOM   6990  H72B DT J  52     145.748 193.630 110.219  0.50106.44           H  
ATOM   6991  H73A DT J  52     146.548 193.032 111.679  0.50106.44           H  
ATOM   6992  H73B DT J  52     146.440 193.026 111.510  0.50106.44           H  
ATOM   6993  H6 A DT J  52     146.731 196.439 111.101  0.50106.44           H  
ATOM   6994  H6 B DT J  52     146.735 196.402 110.922  0.50106.44           H  
ATOM   6995  P  A DC J  53     146.997 201.427 107.784  0.50107.21           P  
ATOM   6996  P  B DC J  53     147.264 201.434 107.648  0.50107.21           P  
ATOM   6997  OP1A DC J  53     146.874 202.884 107.563  0.50107.21           O  
ATOM   6998  OP1B DC J  53     147.195 202.895 107.436  0.50107.21           O  
ATOM   6999  OP2A DC J  53     145.890 200.530 107.389  0.50107.21           O  
ATOM   7000  OP2B DC J  53     146.136 200.577 107.225  0.50107.21           O  
ATOM   7001  O5'A DC J  53     148.332 200.908 107.068  0.50107.21           O  
ATOM   7002  O5'B DC J  53     148.597 200.873 106.958  0.50107.21           O  
ATOM   7003  C5'A DC J  53     149.590 201.385 107.513  0.50107.21           C  
ATOM   7004  C5'B DC J  53     149.860 201.220 107.502  0.50107.21           C  
ATOM   7005  C4'A DC J  53     150.735 200.591 106.912  0.50107.21           C  
ATOM   7006  C4'B DC J  53     150.997 200.494 106.804  0.50107.21           C  
ATOM   7007  O4'A DC J  53     150.685 199.211 107.376  0.50107.21           O  
ATOM   7008  O4'B DC J  53     151.013 199.090 107.193  0.50107.21           O  
ATOM   7009  C3'A DC J  53     150.745 200.519 105.387  0.50107.21           C  
ATOM   7010  C3'B DC J  53     150.939 200.510 105.281  0.50107.21           C  
ATOM   7011  O3'A DC J  53     152.029 200.881 104.898  0.50107.21           O  
ATOM   7012  O3'B DC J  53     152.204 200.901 104.772  0.50107.21           O  
ATOM   7013  C2'A DC J  53     150.398 199.064 105.094  0.50107.21           C  
ATOM   7014  C2'B DC J  53     150.570 199.072 104.920  0.50107.21           C  
ATOM   7015  C1'A DC J  53     150.995 198.361 106.296  0.50107.21           C  
ATOM   7016  C1'B DC J  53     151.213 198.287 106.049  0.50107.21           C  
ATOM   7017  N1 A DC J  53     150.450 196.969 106.592  0.50107.21           N  
ATOM   7018  N1 B DC J  53     150.615 196.916 106.320  0.50107.21           N  
ATOM   7019  C2 A DC J  53     151.254 195.827 106.399  0.50107.21           C  
ATOM   7020  C2 B DC J  53     151.369 195.732 106.121  0.50107.21           C  
ATOM   7021  O2 A DC J  53     152.402 195.954 105.958  0.50107.21           O  
ATOM   7022  O2 B DC J  53     152.527 195.798 105.685  0.50107.21           O  
ATOM   7023  N3 A DC J  53     150.739 194.606 106.694  0.50107.21           N  
ATOM   7024  N3 B DC J  53     150.786 194.537 106.400  0.50107.21           N  
ATOM   7025  C4 A DC J  53     149.497 194.504 107.167  0.50107.21           C  
ATOM   7026  C4 B DC J  53     149.537 194.498 106.866  0.50107.21           C  
ATOM   7027  N4 A DC J  53     149.026 193.285 107.446  0.50107.21           N  
ATOM   7028  N4 B DC J  53     148.997 193.308 107.133  0.50107.21           N  
ATOM   7029  C5 A DC J  53     148.674 195.644 107.368  0.50107.21           C  
ATOM   7030  C5 B DC J  53     148.773 195.674 107.073  0.50107.21           C  
ATOM   7031  C6 A DC J  53     149.188 196.841 107.085  0.50107.21           C  
ATOM   7032  C6 B DC J  53     149.348 196.844 106.808  0.50107.21           C  
ATOM   7033  H5'A DC J  53     149.631 201.316 108.478  0.50107.21           H  
ATOM   7034  H5'B DC J  53     149.872 200.993 108.443  0.50107.21           H  
ATOM   7035 H5''A DC J  53     149.684 202.314 107.257  0.50107.21           H  
ATOM   7036 H5''B DC J  53     149.991 202.175 107.407  0.50107.21           H  
ATOM   7037  H4'A DC J  53     151.569 200.985 107.205  0.50107.21           H  
ATOM   7038  H4'B DC J  53     151.832 200.899 107.080  0.50107.21           H  
ATOM   7039  H3'A DC J  53     150.066 201.104 105.020  0.50107.21           H  
ATOM   7040  H3'B DC J  53     150.250 201.119 104.979  0.50107.21           H  
ATOM   7041  H2'A DC J  53     149.438 198.939 105.059  0.50107.21           H  
ATOM   7042  H2'B DC J  53     149.608 198.957 104.920  0.50107.21           H  
ATOM   7043 H2''A DC J  53     150.819 198.773 104.279  0.50107.21           H  
ATOM   7044 H2''B DC J  53     150.948 198.826 104.068  0.50107.21           H  
ATOM   7045  H1'A DC J  53     151.956 198.320 106.194  0.50107.21           H  
ATOM   7046  H1'B DC J  53     152.163 198.203 105.880  0.50107.21           H  
ATOM   7047  H41A DC J  53     148.272 193.198 107.850  0.50107.21           H  
ATOM   7048  H41B DC J  53     148.251 193.260 107.558  0.50107.21           H  
ATOM   7049  H42A DC J  53     149.476 192.588 107.221  0.50107.21           H  
ATOM   7050  H42B DC J  53     149.394 192.590 106.879  0.50107.21           H  
ATOM   7051  H5 A DC J  53     147.814 195.559 107.708  0.50107.21           H  
ATOM   7052  H5 B DC J  53     147.909 195.631 107.409  0.50107.21           H  
ATOM   7053  H6 A DC J  53     148.671 197.600 107.214  0.50107.21           H  
ATOM   7054  H6 B DC J  53     148.867 197.626 106.941  0.50107.21           H  
ATOM   7055  P  A DA J  54     152.251 201.218 103.371  0.50106.77           P  
ATOM   7056  P  B DA J  54     152.398 201.271 103.260  0.50106.77           P  
ATOM   7057  OP1A DA J  54     152.469 202.678 103.274  0.50106.77           O  
ATOM   7058  OP1B DA J  54     152.651 202.728 103.199  0.50106.77           O  
ATOM   7059  OP2A DA J  54     151.151 200.598 102.602  0.50106.77           O  
ATOM   7060  OP2B DA J  54     151.272 200.706 102.488  0.50106.77           O  
ATOM   7061  O5'A DA J  54     153.627 200.475 103.011  0.50106.77           O  
ATOM   7062  O5'B DA J  54     153.751 200.508 102.864  0.50106.77           O  
ATOM   7063  C5'A DA J  54     153.862 199.138 103.462  0.50106.77           C  
ATOM   7064  C5'B DA J  54     153.977 199.162 103.306  0.50106.77           C  
ATOM   7065  C4'A DA J  54     154.112 198.171 102.308  0.50106.77           C  
ATOM   7066  C4'B DA J  54     154.159 198.197 102.142  0.50106.77           C  
ATOM   7067  O4'A DA J  54     153.582 196.861 102.684  0.50106.77           O  
ATOM   7068  O4'B DA J  54     153.612 196.892 102.522  0.50106.77           O  
ATOM   7069  C3'A DA J  54     153.426 198.511 100.980  0.50106.77           C  
ATOM   7070  C3'B DA J  54     153.431 198.562 100.846  0.50106.77           C  
ATOM   7071  O3'A DA J  54     154.166 198.021  99.870  0.50106.77           O  
ATOM   7072  O3'B DA J  54     154.116 198.051  99.724  0.50106.77           O  
ATOM   7073  C2'A DA J  54     152.102 197.809 101.132  0.50106.77           C  
ATOM   7074  C2'B DA J  54     152.101 197.888 101.051  0.50106.77           C  
ATOM   7075  C1'A DA J  54     152.538 196.503 101.796  0.50106.77           C  
ATOM   7076  C1'B DA J  54     152.557 196.556 101.638  0.50106.77           C  
ATOM   7077  N9 A DA J  54     151.478 195.782 102.527  0.50106.77           N  
ATOM   7078  N9 B DA J  54     151.520 195.791 102.355  0.50106.77           N  
ATOM   7079  C8 A DA J  54     150.328 196.295 103.070  0.50106.77           C  
ATOM   7080  C8 B DA J  54     150.376 196.267 102.939  0.50106.77           C  
ATOM   7081  N7 A DA J  54     149.569 195.406 103.649  0.50106.77           N  
ATOM   7082  N7 B DA J  54     149.638 195.343 103.495  0.50106.77           N  
ATOM   7083  C5 A DA J  54     150.253 194.226 103.472  0.50106.77           C  
ATOM   7084  C5 B DA J  54     150.334 194.178 103.258  0.50106.77           C  
ATOM   7085  C6 A DA J  54     149.971 192.911 103.858  0.50106.77           C  
ATOM   7086  C6 B DA J  54     150.074 192.843 103.598  0.50106.77           C  
ATOM   7087  N6 A DA J  54     148.872 192.568 104.534  0.50106.77           N  
ATOM   7088  N6 B DA J  54     148.994 192.462 104.279  0.50106.77           N  
ATOM   7089  N1 A DA J  54     150.861 191.958 103.526  0.50106.77           N  
ATOM   7090  N1 B DA J  54     150.969 191.911 103.212  0.50106.77           N  
ATOM   7091  C2 A DA J  54     151.959 192.308 102.852  0.50106.77           C  
ATOM   7092  C2 B DA J  54     152.050 192.302 102.531  0.50106.77           C  
ATOM   7093  N3 A DA J  54     152.333 193.512 102.433  0.50106.77           N  
ATOM   7094  N3 B DA J  54     152.402 193.530 102.154  0.50106.77           N  
ATOM   7095  C4 A DA J  54     151.428 194.435 102.778  0.50106.77           C  
ATOM   7096  C4 B DA J  54     151.493 194.430 102.554  0.50106.77           C  
ATOM   7097  H5'A DA J  54     153.093 198.835 103.963  0.50106.77           H  
ATOM   7098  H5'B DA J  54     153.223 198.872 103.837  0.50106.77           H  
ATOM   7099 H5''A DA J  54     154.636 199.135 104.045  0.50106.77           H  
ATOM   7100 H5''B DA J  54     154.774 199.142 103.857  0.50106.77           H  
ATOM   7101  H4'A DA J  54     155.066 198.093 102.160  0.50106.77           H  
ATOM   7102  H4'B DA J  54     155.104 198.100 101.955  0.50106.77           H  
ATOM   7103  H3'A DA J  54     153.291 199.463 100.893  0.50106.77           H  
ATOM   7104  H3'B DA J  54     153.316 199.516 100.762  0.50106.77           H  
ATOM   7105  H2'A DA J  54     151.515 198.322 101.702  0.50106.77           H  
ATOM   7106  H2'B DA J  54     151.562 198.388 101.678  0.50106.77           H  
ATOM   7107 H2''A DA J  54     151.699 197.649 100.270  0.50106.77           H  
ATOM   7108 H2''B DA J  54     151.643 197.771 100.212  0.50106.77           H  
ATOM   7109  H1'A DA J  54     152.899 195.914 101.115  0.50106.77           H  
ATOM   7110  H1'B DA J  54     152.912 196.006 100.923  0.50106.77           H  
ATOM   7111  H8 A DA J  54     150.111 197.196 103.034  0.50106.77           H  
ATOM   7112  H8 B DA J  54     150.148 197.166 102.945  0.50106.77           H  
ATOM   7113  H61A DA J  54     148.727 191.742 104.728  0.50106.77           H  
ATOM   7114  H61B DA J  54     148.870 191.630 104.460  0.50106.77           H  
ATOM   7115  H62A DA J  54     148.313 193.174 104.780  0.50106.77           H  
ATOM   7116  H62B DA J  54     148.424 193.050 104.543  0.50106.77           H  
ATOM   7117  H2 A DA J  54     152.541 191.613 102.648  0.50106.77           H  
ATOM   7118  H2 B DA J  54     152.636 191.624 102.288  0.50106.77           H  
ATOM   7119  P  A DA J  55     153.797 198.516  98.379  0.50105.24           P  
ATOM   7120  P  B DA J  55     153.780 198.586  98.269  0.50105.24           P  
ATOM   7121  OP1A DA J  55     153.788 199.994  98.409  0.50105.24           O  
ATOM   7122  OP1B DA J  55     153.875 200.061  98.319  0.50105.24           O  
ATOM   7123  OP2A DA J  55     152.596 197.798  97.915  0.50105.24           O  
ATOM   7124  OP2B DA J  55     152.527 197.962  97.806  0.50105.24           O  
ATOM   7125  O5'A DA J  55     155.019 198.021  97.474  0.50105.24           O  
ATOM   7126  O5'B DA J  55     154.967 198.019  97.358  0.50105.24           O  
ATOM   7127  C5'A DA J  55     155.666 196.769  97.729  0.50105.24           C  
ATOM   7128  C5'B DA J  55     155.606 196.766  97.661  0.50105.24           C  
ATOM   7129  C4'A DA J  55     154.822 195.577  97.295  0.50105.24           C  
ATOM   7130  C4'B DA J  55     154.753 195.566  97.268  0.50105.24           C  
ATOM   7131  O4'A DA J  55     153.817 195.293  98.284  0.50105.24           O  
ATOM   7132  O4'B DA J  55     153.748 195.311  98.264  0.50105.24           O  
ATOM   7133  C3'A DA J  55     154.038 195.731  95.986  0.50105.24           C  
ATOM   7134  C3'B DA J  55     153.971 195.694  95.963  0.50105.24           C  
ATOM   7135  O3'A DA J  55     154.788 195.181  94.893  0.50105.24           O  
ATOM   7136  O3'B DA J  55     154.752 195.179  94.877  0.50105.24           O  
ATOM   7137  C2'A DA J  55     152.715 194.976  96.259  0.50105.24           C  
ATOM   7138  C2'B DA J  55     152.675 194.889  96.231  0.50105.24           C  
ATOM   7139  C1'A DA J  55     152.894 194.433  97.674  0.50105.24           C  
ATOM   7140  C1'B DA J  55     152.818 194.430  97.684  0.50105.24           C  
ATOM   7141  N9 A DA J  55     151.663 194.381  98.467  0.50105.24           N  
ATOM   7142  N9 B DA J  55     151.574 194.451  98.465  0.50105.24           N  
ATOM   7143  C8 A DA J  55     150.866 195.425  98.840  0.50105.24           C  
ATOM   7144  C8 B DA J  55     150.841 195.544  98.823  0.50105.24           C  
ATOM   7145  N7 A DA J  55     149.831 195.072  99.554  0.50105.24           N  
ATOM   7146  N7 B DA J  55     149.783 195.265  99.539  0.50105.24           N  
ATOM   7147  C5 A DA J  55     149.952 193.705  99.651  0.50105.24           C  
ATOM   7148  C5 B DA J  55     149.817 193.896  99.656  0.50105.24           C  
ATOM   7149  C6 A DA J  55     149.168 192.742 100.279  0.50105.24           C  
ATOM   7150  C6 B DA J  55     148.970 192.992 100.298  0.50105.24           C  
ATOM   7151  N6 A DA J  55     148.063 193.045 100.950  0.50105.24           N  
ATOM   7152  N6 B DA J  55     147.879 193.370 100.961  0.50105.24           N  
ATOM   7153  N1 A DA J  55     149.560 191.453 100.190  0.50105.24           N  
ATOM   7154  N1 B DA J  55     149.280 191.681 100.228  0.50105.24           N  
ATOM   7155  C2 A DA J  55     150.673 191.171  99.513  0.50105.24           C  
ATOM   7156  C2 B DA J  55     150.380 191.320  99.563  0.50105.24           C  
ATOM   7157  N3 A DA J  55     151.494 191.996  98.879  0.50105.24           N  
ATOM   7158  N3 B DA J  55     151.254 192.083  98.917  0.50105.24           N  
ATOM   7159  C4 A DA J  55     151.072 193.261  98.988  0.50105.24           C  
ATOM   7160  C4 B DA J  55     150.913 193.373  99.005  0.50105.24           C  
ATOM   7161  H5'A DA J  55     155.850 196.694  98.677  0.50105.24           H  
ATOM   7162  H5'B DA J  55     155.792 196.722  98.610  0.50105.24           H  
ATOM   7163 H5''A DA J  55     156.505 196.747  97.245  0.50105.24           H  
ATOM   7164 H5''B DA J  55     156.445 196.720  97.178  0.50105.24           H  
ATOM   7165  H4'A DA J  55     155.402 194.803  97.216  0.50105.24           H  
ATOM   7166  H4'B DA J  55     155.329 194.788  97.205  0.50105.24           H  
ATOM   7167  H3'A DA J  55     153.851 196.666  95.818  0.50105.24           H  
ATOM   7168  H3'B DA J  55     153.749 196.621  95.796  0.50105.24           H  
ATOM   7169  H2'A DA J  55     151.962 195.586  96.220  0.50105.24           H  
ATOM   7170  H2'B DA J  55     151.895 195.459  96.129  0.50105.24           H  
ATOM   7171 H2''A DA J  55     152.595 194.246  95.638  0.50105.24           H  
ATOM   7172 H2''B DA J  55     152.616 194.123  95.646  0.50105.24           H  
ATOM   7173  H1'A DA J  55     153.279 193.543  97.624  0.50105.24           H  
ATOM   7174  H1'B DA J  55     153.185 193.531  97.696  0.50105.24           H  
ATOM   7175  H8 A DA J  55     151.045 196.304  98.615  0.50105.24           H  
ATOM   7176  H8 B DA J  55     151.075 196.407  98.588  0.50105.24           H  
ATOM   7177  H61A DA J  55     147.495 192.432 101.143  0.50105.24           H  
ATOM   7178  H61B DA J  55     147.280 192.791 101.168  0.50105.24           H  
ATOM   7179  H62A DA J  55     147.917 193.860 101.188  0.50105.24           H  
ATOM   7180  H62B DA J  55     147.776 194.196 101.182  0.50105.24           H  
ATOM   7181  H2 A DA J  55     150.904 190.273  99.480  0.50105.24           H  
ATOM   7182  H2 B DA J  55     150.553 190.410  99.542  0.50105.24           H  
ATOM   7183  P    DA J  56     154.114 194.958  93.423  1.00103.67           P  
ATOM   7184  OP1  DA J  56     155.199 195.048  92.420  1.00103.67           O  
ATOM   7185  OP2  DA J  56     152.938 195.851  93.315  1.00103.67           O  
ATOM   7186  O5'  DA J  56     153.572 193.446  93.476  1.00103.67           O  
ATOM   7187  C5'  DA J  56     154.361 192.409  94.095  1.00103.67           C  
ATOM   7188  C4'  DA J  56     153.524 191.182  94.383  1.00103.67           C  
ATOM   7189  O4'  DA J  56     152.532 191.498  95.391  1.00103.67           O  
ATOM   7190  C3'  DA J  56     152.759 190.636  93.181  1.00103.67           C  
ATOM   7191  O3'  DA J  56     153.128 189.295  92.944  1.00103.67           O  
ATOM   7192  C2'  DA J  56     151.285 190.782  93.567  1.00103.67           C  
ATOM   7193  C1'  DA J  56     151.329 190.845  95.078  1.00103.67           C  
ATOM   7194  N9   DA J  56     150.226 191.586  95.685  1.00103.67           N  
ATOM   7195  C8   DA J  56     150.003 192.929  95.616  1.00103.67           C  
ATOM   7196  N7   DA J  56     148.941 193.325  96.271  1.00103.67           N  
ATOM   7197  C5   DA J  56     148.435 192.161  96.811  1.00103.67           C  
ATOM   7198  C6   DA J  56     147.310 191.905  97.608  1.00103.67           C  
ATOM   7199  N6   DA J  56     146.472 192.857  98.019  1.00103.67           N  
ATOM   7200  N1   DA J  56     147.084 190.634  97.979  1.00103.67           N  
ATOM   7201  C2   DA J  56     147.928 189.683  97.566  1.00103.67           C  
ATOM   7202  N3   DA J  56     149.016 189.802  96.810  1.00103.67           N  
ATOM   7203  C4   DA J  56     149.211 191.078  96.458  1.00103.67           C  
ATOM   7204  H5'  DA J  56     154.730 192.735  94.928  1.00103.67           H  
ATOM   7205 H5''  DA J  56     155.086 192.164  93.501  1.00103.67           H  
ATOM   7206  H4'  DA J  56     154.102 190.484  94.725  1.00103.67           H  
ATOM   7207  H3'  DA J  56     152.949 191.174  92.399  1.00103.67           H  
ATOM   7208  H2'  DA J  56     150.916 191.600  93.201  1.00103.67           H  
ATOM   7209 H2''  DA J  56     150.776 190.013  93.274  1.00103.67           H  
ATOM   7210  H1'  DA J  56     151.348 189.947  95.435  1.00103.67           H  
ATOM   7211  H8   DA J  56     150.553 193.510  95.144  1.00103.67           H  
ATOM   7212  H61  DA J  56     145.696 192.645  98.325  1.00103.67           H  
ATOM   7213  H62  DA J  56     146.707 193.683  97.977  1.00103.67           H  
ATOM   7214  H2   DA J  56     147.729 188.821  97.846  1.00103.67           H  
ATOM   7215  P    DA J  57     152.705 188.564  91.579  1.00106.62           P  
ATOM   7216  OP1  DA J  57     153.913 188.522  90.730  1.00106.62           O  
ATOM   7217  OP2  DA J  57     151.478 189.200  91.055  1.00106.62           O  
ATOM   7218  O5'  DA J  57     152.350 187.065  92.023  1.00106.62           O  
ATOM   7219  C5'  DA J  57     151.908 186.760  93.360  1.00106.62           C  
ATOM   7220  C4'  DA J  57     150.632 185.933  93.360  1.00106.62           C  
ATOM   7221  O4'  DA J  57     149.528 186.771  93.824  1.00106.62           O  
ATOM   7222  C3'  DA J  57     150.177 185.405  91.998  1.00106.62           C  
ATOM   7223  O3'  DA J  57     149.434 184.209  92.143  1.00106.62           O  
ATOM   7224  C2'  DA J  57     149.321 186.552  91.511  1.00106.62           C  
ATOM   7225  C1'  DA J  57     148.565 186.885  92.793  1.00106.62           C  
ATOM   7226  N9   DA J  57     147.951 188.211  92.845  1.00106.62           N  
ATOM   7227  C8   DA J  57     148.229 189.295  92.063  1.00106.62           C  
ATOM   7228  N7   DA J  57     147.503 190.350  92.341  1.00106.62           N  
ATOM   7229  C5   DA J  57     146.692 189.928  93.376  1.00106.62           C  
ATOM   7230  C6   DA J  57     145.693 190.577  94.123  1.00106.62           C  
ATOM   7231  N6   DA J  57     145.331 191.845  93.922  1.00106.62           N  
ATOM   7232  N1   DA J  57     145.074 189.870  95.086  1.00106.62           N  
ATOM   7233  C2   DA J  57     145.440 188.602  95.289  1.00106.62           C  
ATOM   7234  N3   DA J  57     146.357 187.882  94.646  1.00106.62           N  
ATOM   7235  C4   DA J  57     146.954 188.612  93.696  1.00106.62           C  
ATOM   7236  H5'  DA J  57     151.741 187.582  93.839  1.00106.62           H  
ATOM   7237 H5''  DA J  57     152.604 186.263  93.817  1.00106.62           H  
ATOM   7238  H4'  DA J  57     150.740 185.185  93.971  1.00106.62           H  
ATOM   7239  H3'  DA J  57     150.930 185.263  91.408  1.00106.62           H  
ATOM   7240  H2'  DA J  57     149.876 187.289  91.222  1.00106.62           H  
ATOM   7241 H2''  DA J  57     148.721 186.268  90.811  1.00106.62           H  
ATOM   7242  H1'  DA J  57     147.878 186.221  92.934  1.00106.62           H  
ATOM   7243  H8   DA J  57     148.874 189.285  91.396  1.00106.62           H  
ATOM   7244  H61  DA J  57     144.719 192.200  94.411  1.00106.62           H  
ATOM   7245  H62  DA J  57     145.705 192.305  93.299  1.00106.62           H  
ATOM   7246  H2   DA J  57     144.978 188.156  95.959  1.00106.62           H  
ATOM   7247  P    DG J  58     150.179 182.787  92.195  1.00 99.67           P  
ATOM   7248  OP1  DG J  58     151.359 182.923  93.078  1.00 99.67           O  
ATOM   7249  OP2  DG J  58     150.341 182.303  90.806  1.00 99.67           O  
ATOM   7250  O5'  DG J  58     149.119 181.846  92.922  1.00 99.67           O  
ATOM   7251  C5'  DG J  58     148.714 182.143  94.245  1.00 99.67           C  
ATOM   7252  C4'  DG J  58     147.200 182.179  94.367  1.00 99.67           C  
ATOM   7253  O4'  DG J  58     146.693 183.493  93.983  1.00 99.67           O  
ATOM   7254  C3'  DG J  58     146.455 181.171  93.501  1.00 99.67           C  
ATOM   7255  O3'  DG J  58     145.485 180.544  94.275  1.00 99.67           O  
ATOM   7256  C2'  DG J  58     145.867 182.027  92.375  1.00 99.67           C  
ATOM   7257  C1'  DG J  58     145.612 183.352  93.079  1.00 99.67           C  
ATOM   7258  N9   DG J  58     145.579 184.549  92.224  1.00 99.67           N  
ATOM   7259  C8   DG J  58     146.345 184.797  91.112  1.00 99.67           C  
ATOM   7260  N7   DG J  58     146.127 185.962  90.578  1.00 99.67           N  
ATOM   7261  C5   DG J  58     145.164 186.537  91.388  1.00 99.67           C  
ATOM   7262  C6   DG J  58     144.538 187.798  91.292  1.00 99.67           C  
ATOM   7263  O6   DG J  58     144.721 188.681  90.445  1.00 99.67           O  
ATOM   7264  N1   DG J  58     143.617 187.996  92.307  1.00 99.67           N  
ATOM   7265  C2   DG J  58     143.328 187.087  93.291  1.00 99.67           C  
ATOM   7266  N2   DG J  58     142.409 187.464  94.189  1.00 99.67           N  
ATOM   7267  N3   DG J  58     143.912 185.896  93.399  1.00 99.67           N  
ATOM   7268  C4   DG J  58     144.817 185.689  92.412  1.00 99.67           C  
ATOM   7269  H5'  DG J  58     149.076 183.005  94.500  1.00 99.67           H  
ATOM   7270 H5''  DG J  58     149.064 181.465  94.842  1.00 99.67           H  
ATOM   7271  H4'  DG J  58     146.963 182.015  95.292  1.00 99.67           H  
ATOM   7272  H3'  DG J  58     147.069 180.517  93.142  1.00 99.67           H  
ATOM   7273  H2'  DG J  58     146.511 182.125  91.660  1.00 99.67           H  
ATOM   7274 H2''  DG J  58     145.042 181.651  92.048  1.00 99.67           H  
ATOM   7275  H1'  DG J  58     144.784 183.294  93.578  1.00 99.67           H  
ATOM   7276  H8   DG J  58     146.960 184.189  90.773  1.00 99.67           H  
ATOM   7277  H1   DG J  58     143.193 188.742  92.319  1.00 99.67           H  
ATOM   7278  H21  DG J  58     142.163 186.919  94.807  1.00 99.67           H  
ATOM   7279  H22  DG J  58     142.063 188.249  94.145  1.00 99.67           H  
ATOM   7280  P    DG J  59     144.621 179.320  93.711  1.00 94.84           P  
ATOM   7281  OP1  DG J  59     144.988 178.146  94.529  1.00 94.84           O  
ATOM   7282  OP2  DG J  59     144.730 179.243  92.239  1.00 94.84           O  
ATOM   7283  O5'  DG J  59     143.146 179.751  94.115  1.00 94.84           O  
ATOM   7284  C5'  DG J  59     142.884 180.029  95.468  1.00 94.84           C  
ATOM   7285  C4'  DG J  59     141.779 181.048  95.638  1.00 94.84           C  
ATOM   7286  O4'  DG J  59     142.019 182.187  94.777  1.00 94.84           O  
ATOM   7287  C3'  DG J  59     140.397 180.536  95.291  1.00 94.84           C  
ATOM   7288  O3'  DG J  59     139.450 181.011  96.231  1.00 94.84           O  
ATOM   7289  C2'  DG J  59     140.159 181.086  93.900  1.00 94.84           C  
ATOM   7290  C1'  DG J  59     140.902 182.409  93.946  1.00 94.84           C  
ATOM   7291  N9   DG J  59     141.410 182.904  92.668  1.00 94.84           N  
ATOM   7292  C8   DG J  59     142.268 182.257  91.816  1.00 94.84           C  
ATOM   7293  N7   DG J  59     142.593 182.962  90.771  1.00 94.84           N  
ATOM   7294  C5   DG J  59     141.929 184.165  90.953  1.00 94.84           C  
ATOM   7295  C6   DG J  59     141.903 185.316  90.140  1.00 94.84           C  
ATOM   7296  O6   DG J  59     142.482 185.504  89.064  1.00 94.84           O  
ATOM   7297  N1   DG J  59     141.106 186.312  90.685  1.00 94.84           N  
ATOM   7298  C2   DG J  59     140.415 186.207  91.869  1.00 94.84           C  
ATOM   7299  N2   DG J  59     139.696 187.275  92.242  1.00 94.84           N  
ATOM   7300  N3   DG J  59     140.432 185.131  92.641  1.00 94.84           N  
ATOM   7301  C4   DG J  59     141.208 184.153  92.123  1.00 94.84           C  
ATOM   7302  H5'  DG J  59     143.688 180.367  95.887  1.00 94.84           H  
ATOM   7303 H5''  DG J  59     142.625 179.209  95.906  1.00 94.84           H  
ATOM   7304  H4'  DG J  59     141.773 181.356  96.551  1.00 94.84           H  
ATOM   7305  H3'  DG J  59     140.396 179.570  95.272  1.00 94.84           H  
ATOM   7306  H2'  DG J  59     140.531 180.499  93.226  1.00 94.84           H  
ATOM   7307 H2''  DG J  59     139.224 181.221  93.764  1.00 94.84           H  
ATOM   7308  H1'  DG J  59     140.331 183.080  94.347  1.00 94.84           H  
ATOM   7309  H8   DG J  59     142.575 181.393  91.963  1.00 94.84           H  
ATOM   7310  H1   DG J  59     141.037 187.049  90.249  1.00 94.84           H  
ATOM   7311  H21  DG J  59     139.178 187.227  92.928  1.00 94.84           H  
ATOM   7312  H22  DG J  59     139.754 188.009  91.798  1.00 94.84           H  
ATOM   7313  P    DC J  60     137.955 180.432  96.238  1.00 85.77           P  
ATOM   7314  OP1  DC J  60     137.556 180.250  97.650  1.00 85.77           O  
ATOM   7315  OP2  DC J  60     137.904 179.293  95.296  1.00 85.77           O  
ATOM   7316  O5'  DC J  60     137.093 181.615  95.609  1.00 85.77           O  
ATOM   7317  C5'  DC J  60     137.133 182.898  96.191  1.00 85.77           C  
ATOM   7318  C4'  DC J  60     136.447 183.920  95.311  1.00 85.77           C  
ATOM   7319  O4'  DC J  60     137.290 184.223  94.148  1.00 85.77           O  
ATOM   7320  C3'  DC J  60     135.116 183.468  94.723  1.00 85.77           C  
ATOM   7321  O3'  DC J  60     134.245 184.566  94.567  1.00 85.77           O  
ATOM   7322  C2'  DC J  60     135.558 182.923  93.385  1.00 85.77           C  
ATOM   7323  C1'  DC J  60     136.509 184.036  92.985  1.00 85.77           C  
ATOM   7324  N1   DC J  60     137.396 183.755  91.785  1.00 85.77           N  
ATOM   7325  C2   DC J  60     137.531 184.708  90.763  1.00 85.77           C  
ATOM   7326  O2   DC J  60     136.924 185.777  90.847  1.00 85.77           O  
ATOM   7327  N3   DC J  60     138.321 184.421  89.701  1.00 85.77           N  
ATOM   7328  C4   DC J  60     138.959 183.257  89.641  1.00 85.77           C  
ATOM   7329  N4   DC J  60     139.733 183.016  88.578  1.00 85.77           N  
ATOM   7330  C5   DC J  60     138.833 182.285  90.667  1.00 85.77           C  
ATOM   7331  C6   DC J  60     138.050 182.577  91.702  1.00 85.77           C  
ATOM   7332  H5'  DC J  60     138.056 183.157  96.319  1.00 85.77           H  
ATOM   7333 H5''  DC J  60     136.689 182.871  97.050  1.00 85.77           H  
ATOM   7334  H4'  DC J  60     136.303 184.729  95.820  1.00 85.77           H  
ATOM   7335  H3'  DC J  60     134.715 182.778  95.267  1.00 85.77           H  
ATOM   7336  H2'  DC J  60     136.018 182.080  93.488  1.00 85.77           H  
ATOM   7337 H2''  DC J  60     134.817 182.847  92.777  1.00 85.77           H  
ATOM   7338  H1'  DC J  60     135.996 184.836  92.824  1.00 85.77           H  
ATOM   7339  H41  DC J  60     140.167 182.275  88.520  1.00 85.77           H  
ATOM   7340  H42  DC J  60     139.800 183.604  87.953  1.00 85.77           H  
ATOM   7341  H5   DC J  60     139.284 181.473  90.619  1.00 85.77           H  
ATOM   7342  H6   DC J  60     137.947 181.961  92.380  1.00 85.77           H  
ATOM   7343  P    DA J  61     132.959 184.752  95.500  1.00 87.32           P  
ATOM   7344  OP1  DA J  61     133.447 185.238  96.806  1.00 87.32           O  
ATOM   7345  OP2  DA J  61     132.142 183.527  95.422  1.00 87.32           O  
ATOM   7346  O5'  DA J  61     132.164 185.932  94.774  1.00 87.32           O  
ATOM   7347  C5'  DA J  61     132.811 187.180  94.572  1.00 87.32           C  
ATOM   7348  C4'  DA J  61     132.250 187.938  93.369  1.00 87.32           C  
ATOM   7349  O4'  DA J  61     133.098 187.696  92.209  1.00 87.32           O  
ATOM   7350  C3'  DA J  61     130.839 187.552  92.934  1.00 87.32           C  
ATOM   7351  O3'  DA J  61     130.138 188.680  92.432  1.00 87.32           O  
ATOM   7352  C2'  DA J  61     131.094 186.507  91.863  1.00 87.32           C  
ATOM   7353  C1'  DA J  61     132.374 187.014  91.201  1.00 87.32           C  
ATOM   7354  N9   DA J  61     133.232 185.967  90.642  1.00 87.32           N  
ATOM   7355  C8   DA J  61     133.630 184.822  91.256  1.00 87.32           C  
ATOM   7356  N7   DA J  61     134.404 184.067  90.525  1.00 87.32           N  
ATOM   7357  C5   DA J  61     134.540 184.769  89.354  1.00 87.32           C  
ATOM   7358  C6   DA J  61     135.259 184.502  88.183  1.00 87.32           C  
ATOM   7359  N6   DA J  61     135.988 183.402  88.013  1.00 87.32           N  
ATOM   7360  N1   DA J  61     135.201 185.408  87.193  1.00 87.32           N  
ATOM   7361  C2   DA J  61     134.471 186.515  87.376  1.00 87.32           C  
ATOM   7362  N3   DA J  61     133.753 186.878  88.441  1.00 87.32           N  
ATOM   7363  C4   DA J  61     133.847 185.958  89.411  1.00 87.32           C  
ATOM   7364  H5'  DA J  61     133.756 187.019  94.428  1.00 87.32           H  
ATOM   7365 H5''  DA J  61     132.704 187.722  95.366  1.00 87.32           H  
ATOM   7366  H4'  DA J  61     132.261 188.886  93.568  1.00 87.32           H  
ATOM   7367  H3'  DA J  61     130.354 187.162  93.674  1.00 87.32           H  
ATOM   7368  H2'  DA J  61     131.227 185.639  92.267  1.00 87.32           H  
ATOM   7369 H2''  DA J  61     130.368 186.482  91.224  1.00 87.32           H  
ATOM   7370  H1'  DA J  61     132.139 187.638  90.499  1.00 87.32           H  
ATOM   7371  H8   DA J  61     133.354 184.586  92.111  1.00 87.32           H  
ATOM   7372  H61  DA J  61     136.447 183.298  87.294  1.00 87.32           H  
ATOM   7373  H62  DA J  61     136.009 182.803  88.627  1.00 87.32           H  
ATOM   7374  H2   DA J  61     134.461 187.112  86.664  1.00 87.32           H  
ATOM   7375  P    DT J  62     128.592 188.549  92.020  1.00 90.40           P  
ATOM   7376  OP1  DT J  62     127.900 189.768  92.490  1.00 90.40           O  
ATOM   7377  OP2  DT J  62     128.127 187.220  92.470  1.00 90.40           O  
ATOM   7378  O5'  DT J  62     128.621 188.541  90.420  1.00 90.40           O  
ATOM   7379  C5'  DT J  62     128.975 189.722  89.714  1.00 90.40           C  
ATOM   7380  C4'  DT J  62     129.249 189.431  88.252  1.00 90.40           C  
ATOM   7381  O4'  DT J  62     130.259 188.407  88.146  1.00 90.40           O  
ATOM   7382  C3'  DT J  62     128.049 188.911  87.463  1.00 90.40           C  
ATOM   7383  O3'  DT J  62     127.565 189.905  86.575  1.00 90.40           O  
ATOM   7384  C2'  DT J  62     128.577 187.678  86.720  1.00 90.40           C  
ATOM   7385  C1'  DT J  62     130.079 187.741  86.926  1.00 90.40           C  
ATOM   7386  N1   DT J  62     130.754 186.391  86.997  1.00 90.40           N  
ATOM   7387  C2   DT J  62     131.470 185.926  85.912  1.00 90.40           C  
ATOM   7388  O2   DT J  62     131.587 186.542  84.869  1.00 90.40           O  
ATOM   7389  N3   DT J  62     132.039 184.694  86.091  1.00 90.40           N  
ATOM   7390  C4   DT J  62     131.975 183.904  87.217  1.00 90.40           C  
ATOM   7391  O4   DT J  62     132.520 182.812  87.287  1.00 90.40           O  
ATOM   7392  C5   DT J  62     131.210 184.440  88.301  1.00 90.40           C  
ATOM   7393  C7   DT J  62     131.085 183.663  89.566  1.00 90.40           C  
ATOM   7394  C6   DT J  62     130.652 185.647  88.153  1.00 90.40           C  
ATOM   7395  H5'  DT J  62     129.768 190.105  90.116  1.00 90.40           H  
ATOM   7396 H5''  DT J  62     128.247 190.359  89.778  1.00 90.40           H  
ATOM   7397  H4'  DT J  62     129.574 190.238  87.827  1.00 90.40           H  
ATOM   7398  H3'  DT J  62     127.347 188.650  88.075  1.00 90.40           H  
ATOM   7399  H2'  DT J  62     128.214 186.868  87.107  1.00 90.40           H  
ATOM   7400 H2''  DT J  62     128.365 187.731  85.779  1.00 90.40           H  
ATOM   7401  H1'  DT J  62     130.475 188.267  86.217  1.00 90.40           H  
ATOM   7402  H3   DT J  62     132.487 184.381  85.431  1.00 90.40           H  
ATOM   7403  H71  DT J  62     130.952 184.269  90.304  1.00 90.40           H  
ATOM   7404  H72  DT J  62     130.329 183.059  89.502  1.00 90.40           H  
ATOM   7405  H73  DT J  62     131.897 183.152  89.710  1.00 90.40           H  
ATOM   7406  H6   DT J  62     130.163 185.997  88.860  1.00 90.40           H  
ATOM   7407  P    DG J  63     126.209 189.659  85.750  1.00 95.21           P  
ATOM   7408  OP1  DG J  63     125.656 190.981  85.386  1.00 95.21           O  
ATOM   7409  OP2  DG J  63     125.380 188.700  86.510  1.00 95.21           O  
ATOM   7410  O5'  DG J  63     126.701 188.926  84.421  1.00 95.21           O  
ATOM   7411  C5'  DG J  63     127.784 189.462  83.689  1.00 95.21           C  
ATOM   7412  C4'  DG J  63     128.146 188.577  82.512  1.00 95.21           C  
ATOM   7413  O4'  DG J  63     128.985 187.481  82.974  1.00 95.21           O  
ATOM   7414  C3'  DG J  63     126.954 187.931  81.793  1.00 95.21           C  
ATOM   7415  O3'  DG J  63     127.074 188.068  80.376  1.00 95.21           O  
ATOM   7416  C2'  DG J  63     127.021 186.479  82.243  1.00 95.21           C  
ATOM   7417  C1'  DG J  63     128.513 186.271  82.428  1.00 95.21           C  
ATOM   7418  N9   DG J  63     128.875 185.168  83.325  1.00 95.21           N  
ATOM   7419  C8   DG J  63     128.539 185.035  84.646  1.00 95.21           C  
ATOM   7420  N7   DG J  63     129.014 183.957  85.197  1.00 95.21           N  
ATOM   7421  C5   DG J  63     129.711 183.333  84.177  1.00 95.21           C  
ATOM   7422  C6   DG J  63     130.436 182.125  84.185  1.00 95.21           C  
ATOM   7423  O6   DG J  63     130.607 181.346  85.127  1.00 95.21           O  
ATOM   7424  N1   DG J  63     130.997 181.847  82.942  1.00 95.21           N  
ATOM   7425  C2   DG J  63     130.871 182.641  81.833  1.00 95.21           C  
ATOM   7426  N2   DG J  63     131.482 182.211  80.717  1.00 95.21           N  
ATOM   7427  N3   DG J  63     130.190 183.780  81.814  1.00 95.21           N  
ATOM   7428  C4   DG J  63     129.647 184.067  83.021  1.00 95.21           C  
ATOM   7429  H5'  DG J  63     128.552 189.541  84.275  1.00 95.21           H  
ATOM   7430 H5''  DG J  63     127.543 190.340  83.363  1.00 95.21           H  
ATOM   7431  H4'  DG J  63     128.647 189.102  81.872  1.00 95.21           H  
ATOM   7432  H3'  DG J  63     126.127 188.333  82.095  1.00 95.21           H  
ATOM   7433  H2'  DG J  63     126.548 186.358  83.080  1.00 95.21           H  
ATOM   7434 H2''  DG J  63     126.673 185.889  81.557  1.00 95.21           H  
ATOM   7435  H1'  DG J  63     128.927 186.130  81.564  1.00 95.21           H  
ATOM   7436  H8   DG J  63     128.023 185.654  85.104  1.00 95.21           H  
ATOM   7437  H1   DG J  63     131.456 181.126  82.865  1.00 95.21           H  
ATOM   7438  H21  DG J  63     131.333 182.604  79.968  1.00 95.21           H  
ATOM   7439  H22  DG J  63     132.017 181.539  80.751  1.00 95.21           H  
ATOM   7440  P    DT J  64     125.869 187.621  79.410  1.00 94.07           P  
ATOM   7441  OP1  DT J  64     125.776 188.616  78.323  1.00 94.07           O  
ATOM   7442  OP2  DT J  64     124.688 187.345  80.253  1.00 94.07           O  
ATOM   7443  O5'  DT J  64     126.366 186.233  78.789  1.00 94.07           O  
ATOM   7444  C5'  DT J  64     127.497 186.216  77.932  1.00 94.07           C  
ATOM   7445  C4'  DT J  64     127.797 184.812  77.428  1.00 94.07           C  
ATOM   7446  O4'  DT J  64     128.302 183.998  78.524  1.00 94.07           O  
ATOM   7447  C3'  DT J  64     126.592 184.058  76.855  1.00 94.07           C  
ATOM   7448  O3'  DT J  64     126.893 183.533  75.561  1.00 94.07           O  
ATOM   7449  C2'  DT J  64     126.328 182.961  77.885  1.00 94.07           C  
ATOM   7450  C1'  DT J  64     127.711 182.722  78.466  1.00 94.07           C  
ATOM   7451  N1   DT J  64     127.735 182.103  79.856  1.00 94.07           N  
ATOM   7452  C2   DT J  64     128.421 180.924  80.075  1.00 94.07           C  
ATOM   7453  O2   DT J  64     129.016 180.318  79.204  1.00 94.07           O  
ATOM   7454  N3   DT J  64     128.381 180.480  81.371  1.00 94.07           N  
ATOM   7455  C4   DT J  64     127.749 181.070  82.435  1.00 94.07           C  
ATOM   7456  O4   DT J  64     127.767 180.597  83.562  1.00 94.07           O  
ATOM   7457  C5   DT J  64     127.059 182.279  82.142  1.00 94.07           C  
ATOM   7458  C7   DT J  64     126.351 182.996  83.236  1.00 94.07           C  
ATOM   7459  C6   DT J  64     127.094 182.746  80.891  1.00 94.07           C  
ATOM   7460  H5'  DT J  64     128.266 186.549  78.417  1.00 94.07           H  
ATOM   7461 H5''  DT J  64     127.327 186.794  77.174  1.00 94.07           H  
ATOM   7462  H4'  DT J  64     128.480 184.868  76.743  1.00 94.07           H  
ATOM   7463  H3'  DT J  64     125.829 184.653  76.802  1.00 94.07           H  
ATOM   7464  H2'  DT J  64     125.715 183.277  78.563  1.00 94.07           H  
ATOM   7465 H2''  DT J  64     125.991 182.160  77.458  1.00 94.07           H  
ATOM   7466  H1'  DT J  64     128.216 182.168  77.856  1.00 94.07           H  
ATOM   7467  H3   DT J  64     128.795 179.749  81.534  1.00 94.07           H  
ATOM   7468  H71  DT J  64     126.340 183.941  83.047  1.00 94.07           H  
ATOM   7469  H72  DT J  64     125.443 182.667  83.304  1.00 94.07           H  
ATOM   7470  H73  DT J  64     126.816 182.841  84.072  1.00 94.07           H  
ATOM   7471  H6   DT J  64     126.642 183.532  80.704  1.00 94.07           H  
ATOM   7472  P    DT J  65     125.728 182.924  74.635  1.00 93.42           P  
ATOM   7473  OP1  DT J  65     126.049 183.280  73.239  1.00 93.42           O  
ATOM   7474  OP2  DT J  65     124.423 183.318  75.206  1.00 93.42           O  
ATOM   7475  O5'  DT J  65     125.886 181.341  74.806  1.00 93.42           O  
ATOM   7476  C5'  DT J  65     127.041 180.689  74.292  1.00 93.42           C  
ATOM   7477  C4'  DT J  65     127.114 179.239  74.748  1.00 93.42           C  
ATOM   7478  O4'  DT J  65     127.191 179.186  76.194  1.00 93.42           O  
ATOM   7479  C3'  DT J  65     125.913 178.374  74.356  1.00 93.42           C  
ATOM   7480  O3'  DT J  65     126.346 177.229  73.634  1.00 93.42           O  
ATOM   7481  C2'  DT J  65     125.262 178.006  75.691  1.00 93.42           C  
ATOM   7482  C1'  DT J  65     126.431 178.097  76.651  1.00 93.42           C  
ATOM   7483  N1   DT J  65     126.073 178.339  78.098  1.00 93.42           N  
ATOM   7484  C2   DT J  65     126.501 177.453  79.064  1.00 93.42           C  
ATOM   7485  O2   DT J  65     127.140 176.447  78.823  1.00 93.42           O  
ATOM   7486  N3   DT J  65     126.144 177.785  80.337  1.00 93.42           N  
ATOM   7487  C4   DT J  65     125.428 178.891  80.741  1.00 93.42           C  
ATOM   7488  O4   DT J  65     125.155 179.104  81.915  1.00 93.42           O  
ATOM   7489  C5   DT J  65     125.021 179.777  79.691  1.00 93.42           C  
ATOM   7490  C7   DT J  65     124.235 181.007  80.017  1.00 93.42           C  
ATOM   7491  C6   DT J  65     125.365 179.470  78.437  1.00 93.42           C  
ATOM   7492  H5'  DT J  65     127.831 181.158  74.600  1.00 93.42           H  
ATOM   7493 H5''  DT J  65     127.014 180.715  73.325  1.00 93.42           H  
ATOM   7494  H4'  DT J  65     127.915 178.838  74.380  1.00 93.42           H  
ATOM   7495  H3'  DT J  65     125.298 178.894  73.821  1.00 93.42           H  
ATOM   7496  H2'  DT J  65     124.570 178.642  75.921  1.00 93.42           H  
ATOM   7497 H2''  DT J  65     124.910 177.104  75.664  1.00 93.42           H  
ATOM   7498  H1'  DT J  65     126.960 177.294  76.577  1.00 93.42           H  
ATOM   7499  H3   DT J  65     126.394 177.246  80.956  1.00 93.42           H  
ATOM   7500  H71  DT J  65     124.289 181.629  79.280  1.00 93.42           H  
ATOM   7501  H72  DT J  65     123.309 180.767  80.170  1.00 93.42           H  
ATOM   7502  H73  DT J  65     124.598 181.418  80.816  1.00 93.42           H  
ATOM   7503  H6   DT J  65     125.100 180.040  77.758  1.00 93.42           H  
ATOM   7504  P    DC J  66     125.334 176.435  72.672  1.00 95.86           P  
ATOM   7505  OP1  DC J  66     126.082 176.105  71.442  1.00 95.86           O  
ATOM   7506  OP2  DC J  66     124.059 177.177  72.584  1.00 95.86           O  
ATOM   7507  O5'  DC J  66     125.051 175.079  73.457  1.00 95.86           O  
ATOM   7508  C5'  DC J  66     126.095 174.156  73.642  1.00 95.86           C  
ATOM   7509  C4'  DC J  66     125.698 173.079  74.626  1.00 95.86           C  
ATOM   7510  O4'  DC J  66     125.319 173.697  75.894  1.00 95.86           O  
ATOM   7511  C3'  DC J  66     124.493 172.241  74.207  1.00 95.86           C  
ATOM   7512  O3'  DC J  66     124.619 170.903  74.670  1.00 95.86           O  
ATOM   7513  C2'  DC J  66     123.353 172.973  74.889  1.00 95.86           C  
ATOM   7514  C1'  DC J  66     124.006 173.296  76.230  1.00 95.86           C  
ATOM   7515  N1   DC J  66     123.344 174.385  77.086  1.00 95.86           N  
ATOM   7516  C2   DC J  66     123.520 174.359  78.478  1.00 95.86           C  
ATOM   7517  O2   DC J  66     124.202 173.459  78.984  1.00 95.86           O  
ATOM   7518  N3   DC J  66     122.939 175.323  79.234  1.00 95.86           N  
ATOM   7519  C4   DC J  66     122.212 176.276  78.652  1.00 95.86           C  
ATOM   7520  N4   DC J  66     121.654 177.205  79.427  1.00 95.86           N  
ATOM   7521  C5   DC J  66     122.022 176.323  77.249  1.00 95.86           C  
ATOM   7522  C6   DC J  66     122.598 175.375  76.511  1.00 95.86           C  
ATOM   7523  H5'  DC J  66     126.873 174.622  73.975  1.00 95.86           H  
ATOM   7524 H5''  DC J  66     126.309 173.746  72.793  1.00 95.86           H  
ATOM   7525  H4'  DC J  66     126.453 172.493  74.773  1.00 95.86           H  
ATOM   7526  H3'  DC J  66     124.386 172.262  73.244  1.00 95.86           H  
ATOM   7527  H2'  DC J  66     123.125 173.770  74.393  1.00 95.86           H  
ATOM   7528 H2''  DC J  66     122.584 172.394  75.003  1.00 95.86           H  
ATOM   7529  H1'  DC J  66     124.053 172.478  76.750  1.00 95.86           H  
ATOM   7530  H41  DC J  66     121.084 177.755  79.095  1.00 95.86           H  
ATOM   7531  H42  DC J  66     121.864 177.253  80.257  1.00 95.86           H  
ATOM   7532  H5   DC J  66     121.513 176.992  76.858  1.00 95.86           H  
ATOM   7533  H6   DC J  66     122.486 175.386  75.592  1.00 95.86           H  
ATOM   7534  P    DA J  67     125.447 169.812  73.832  1.00 91.95           P  
ATOM   7535  OP1  DA J  67     126.751 170.402  73.463  1.00 91.95           O  
ATOM   7536  OP2  DA J  67     124.556 169.291  72.774  1.00 91.95           O  
ATOM   7537  O5'  DA J  67     125.686 168.635  74.889  1.00 91.95           O  
ATOM   7538  C5'  DA J  67     126.365 168.903  76.114  1.00 91.95           C  
ATOM   7539  C4'  DA J  67     126.034 167.876  77.193  1.00 91.95           C  
ATOM   7540  O4'  DA J  67     125.091 168.469  78.120  1.00 91.95           O  
ATOM   7541  C3'  DA J  67     125.384 166.584  76.707  1.00 91.95           C  
ATOM   7542  O3'  DA J  67     125.764 165.474  77.489  1.00 91.95           O  
ATOM   7543  C2'  DA J  67     123.896 166.874  76.815  1.00 91.95           C  
ATOM   7544  C1'  DA J  67     123.790 167.946  77.918  1.00 91.95           C  
ATOM   7545  N9   DA J  67     122.863 169.066  77.643  1.00 91.95           N  
ATOM   7546  C8   DA J  67     122.323 169.448  76.442  1.00 91.95           C  
ATOM   7547  N7   DA J  67     121.530 170.472  76.516  1.00 91.95           N  
ATOM   7548  C5   DA J  67     121.546 170.801  77.845  1.00 91.95           C  
ATOM   7549  C6   DA J  67     120.904 171.809  78.554  1.00 91.95           C  
ATOM   7550  N6   DA J  67     120.096 172.695  77.977  1.00 91.95           N  
ATOM   7551  N1   DA J  67     121.121 171.878  79.874  1.00 91.95           N  
ATOM   7552  C2   DA J  67     121.936 170.987  80.440  1.00 91.95           C  
ATOM   7553  N3   DA J  67     122.598 169.985  79.872  1.00 91.95           N  
ATOM   7554  C4   DA J  67     122.357 169.949  78.560  1.00 91.95           C  
ATOM   7555  H5'  DA J  67     126.104 169.781  76.430  1.00 91.95           H  
ATOM   7556 H5''  DA J  67     127.320 168.897  75.955  1.00 91.95           H  
ATOM   7557  H4'  DA J  67     126.845 167.653  77.671  1.00 91.95           H  
ATOM   7558  H3'  DA J  67     125.622 166.421  75.786  1.00 91.95           H  
ATOM   7559  H2'  DA J  67     123.569 167.180  75.969  1.00 91.95           H  
ATOM   7560 H2''  DA J  67     123.421 166.087  77.088  1.00 91.95           H  
ATOM   7561  H1'  DA J  67     123.505 167.512  78.737  1.00 91.95           H  
ATOM   7562  H8   DA J  67     122.501 169.006  75.647  1.00 91.95           H  
ATOM   7563  H61  DA J  67     119.653 173.251  78.460  1.00 91.95           H  
ATOM   7564  H62  DA J  67     120.024 172.714  77.120  1.00 91.95           H  
ATOM   7565  H2   DA J  67     122.052 171.076  81.355  1.00 91.95           H  
ATOM   7566  P    DG J  68     125.288 163.996  77.060  1.00 93.76           P  
ATOM   7567  OP1  DG J  68     126.480 163.242  76.679  1.00 93.76           O  
ATOM   7568  OP2  DG J  68     124.213 164.068  76.049  1.00 93.76           O  
ATOM   7569  O5'  DG J  68     124.660 163.403  78.401  1.00 93.76           O  
ATOM   7570  C5'  DG J  68     125.396 163.469  79.603  1.00 93.76           C  
ATOM   7571  C4'  DG J  68     124.572 164.080  80.717  1.00 93.76           C  
ATOM   7572  O4'  DG J  68     123.748 165.133  80.177  1.00 93.76           O  
ATOM   7573  C3'  DG J  68     123.630 163.113  81.426  1.00 93.76           C  
ATOM   7574  O3'  DG J  68     124.037 162.959  82.772  1.00 93.76           O  
ATOM   7575  C2'  DG J  68     122.234 163.744  81.292  1.00 93.76           C  
ATOM   7576  C1'  DG J  68     122.518 165.170  80.856  1.00 93.76           C  
ATOM   7577  N9   DG J  68     121.535 165.754  79.946  1.00 93.76           N  
ATOM   7578  C8   DG J  68     121.271 165.363  78.660  1.00 93.76           C  
ATOM   7579  N7   DG J  68     120.371 166.093  78.069  1.00 93.76           N  
ATOM   7580  C5   DG J  68     120.023 167.035  79.020  1.00 93.76           C  
ATOM   7581  C6   DG J  68     119.090 168.086  78.951  1.00 93.76           C  
ATOM   7582  O6   DG J  68     118.362 168.405  78.005  1.00 93.76           O  
ATOM   7583  N1   DG J  68     119.041 168.804  80.131  1.00 93.76           N  
ATOM   7584  C2   DG J  68     119.800 168.542  81.240  1.00 93.76           C  
ATOM   7585  N2   DG J  68     119.611 169.342  82.294  1.00 93.76           N  
ATOM   7586  N3   DG J  68     120.676 167.557  81.320  1.00 93.76           N  
ATOM   7587  C4   DG J  68     120.736 166.848  80.176  1.00 93.76           C  
ATOM   7588  H5'  DG J  68     126.186 164.011  79.459  1.00 93.76           H  
ATOM   7589 H5''  DG J  68     125.666 162.576  79.860  1.00 93.76           H  
ATOM   7590  H4'  DG J  68     125.171 164.461  81.374  1.00 93.76           H  
ATOM   7591  H3'  DG J  68     123.645 162.256  80.979  1.00 93.76           H  
ATOM   7592  H2'  DG J  68     121.714 163.280  80.621  1.00 93.76           H  
ATOM   7593 H2''  DG J  68     121.777 163.738  82.143  1.00 93.76           H  
ATOM   7594  H1'  DG J  68     122.602 165.731  81.639  1.00 93.76           H  
ATOM   7595  H8   DG J  68     121.695 164.646  78.249  1.00 93.76           H  
ATOM   7596  H1   DG J  68     118.496 169.462  80.171  1.00 93.76           H  
ATOM   7597  H21  DG J  68     120.078 169.231  83.008  1.00 93.76           H  
ATOM   7598  H22  DG J  68     119.019 169.963  82.261  1.00 93.76           H  
ATOM   7599  P    DC J  69     123.293 161.916  83.733  1.00 94.09           P  
ATOM   7600  OP1  DC J  69     124.253 161.518  84.784  1.00 94.09           O  
ATOM   7601  OP2  DC J  69     122.648 160.893  82.884  1.00 94.09           O  
ATOM   7602  O5'  DC J  69     122.152 162.795  84.409  1.00 94.09           O  
ATOM   7603  C5'  DC J  69     122.498 164.013  85.036  1.00 94.09           C  
ATOM   7604  C4'  DC J  69     121.267 164.845  85.349  1.00 94.09           C  
ATOM   7605  O4'  DC J  69     120.699 165.343  84.124  1.00 94.09           O  
ATOM   7606  C3'  DC J  69     120.143 164.090  86.044  1.00 94.09           C  
ATOM   7607  O3'  DC J  69     120.113 164.400  87.420  1.00 94.09           O  
ATOM   7608  C2'  DC J  69     118.869 164.532  85.323  1.00 94.09           C  
ATOM   7609  C1'  DC J  69     119.331 165.578  84.321  1.00 94.09           C  
ATOM   7610  N1   DC J  69     118.645 165.506  82.975  1.00 94.09           N  
ATOM   7611  C2   DC J  69     117.658 166.447  82.611  1.00 94.09           C  
ATOM   7612  O2   DC J  69     117.338 167.339  83.406  1.00 94.09           O  
ATOM   7613  N3   DC J  69     117.090 166.356  81.381  1.00 94.09           N  
ATOM   7614  C4   DC J  69     117.462 165.388  80.545  1.00 94.09           C  
ATOM   7615  N4   DC J  69     116.869 165.329  79.347  1.00 94.09           N  
ATOM   7616  C5   DC J  69     118.456 164.431  80.898  1.00 94.09           C  
ATOM   7617  C6   DC J  69     119.015 164.530  82.105  1.00 94.09           C  
ATOM   7618  H5'  DC J  69     123.080 164.515  84.448  1.00 94.09           H  
ATOM   7619 H5''  DC J  69     122.970 163.821  85.859  1.00 94.09           H  
ATOM   7620  H4'  DC J  69     121.526 165.595  85.903  1.00 94.09           H  
ATOM   7621  H3'  DC J  69     120.266 163.140  85.928  1.00 94.09           H  
ATOM   7622  H2'  DC J  69     118.479 163.788  84.867  1.00 94.09           H  
ATOM   7623 H2''  DC J  69     118.243 164.916  85.949  1.00 94.09           H  
ATOM   7624  H1'  DC J  69     119.213 166.458  84.702  1.00 94.09           H  
ATOM   7625  H41  DC J  69     117.113 164.735  78.775  1.00 94.09           H  
ATOM   7626  H42  DC J  69     116.237 165.881  79.153  1.00 94.09           H  
ATOM   7627  H5   DC J  69     118.708 163.760  80.307  1.00 94.09           H  
ATOM   7628  H6   DC J  69     119.664 163.918  82.359  1.00 94.09           H  
ATOM   7629  P    DT J  70     119.102 163.624  88.394  1.00 89.45           P  
ATOM   7630  OP1  DT J  70     119.678 163.651  89.756  1.00 89.45           O  
ATOM   7631  OP2  DT J  70     118.761 162.333  87.758  1.00 89.45           O  
ATOM   7632  O5'  DT J  70     117.793 164.529  88.363  1.00 89.45           O  
ATOM   7633  C5'  DT J  70     117.913 165.925  88.519  1.00 89.45           C  
ATOM   7634  C4'  DT J  70     116.566 166.601  88.398  1.00 89.45           C  
ATOM   7635  O4'  DT J  70     116.174 166.628  87.000  1.00 89.45           O  
ATOM   7636  C3'  DT J  70     115.444 165.906  89.163  1.00 89.45           C  
ATOM   7637  O3'  DT J  70     114.754 166.820  90.015  1.00 89.45           O  
ATOM   7638  C2'  DT J  70     114.538 165.338  88.080  1.00 89.45           C  
ATOM   7639  C1'  DT J  70     114.852 166.168  86.840  1.00 89.45           C  
ATOM   7640  N1   DT J  70     114.770 165.422  85.494  1.00 89.45           N  
ATOM   7641  C2   DT J  70     113.968 165.917  84.479  1.00 89.45           C  
ATOM   7642  O2   DT J  70     113.272 166.907  84.595  1.00 89.45           O  
ATOM   7643  N3   DT J  70     114.004 165.188  83.315  1.00 89.45           N  
ATOM   7644  C4   DT J  70     114.750 164.063  83.059  1.00 89.45           C  
ATOM   7645  O4   DT J  70     114.714 163.475  81.986  1.00 89.45           O  
ATOM   7646  C5   DT J  70     115.566 163.605  84.139  1.00 89.45           C  
ATOM   7647  C7   DT J  70     116.406 162.376  83.952  1.00 89.45           C  
ATOM   7648  C6   DT J  70     115.550 164.300  85.290  1.00 89.45           C  
ATOM   7649  H5'  DT J  70     118.504 166.269  87.833  1.00 89.45           H  
ATOM   7650 H5''  DT J  70     118.289 166.115  89.388  1.00 89.45           H  
ATOM   7651  H4'  DT J  70     116.643 167.512  88.719  1.00 89.45           H  
ATOM   7652  H3'  DT J  70     115.812 165.184  89.692  1.00 89.45           H  
ATOM   7653  H2'  DT J  70     114.733 164.402  87.931  1.00 89.45           H  
ATOM   7654 H2''  DT J  70     113.618 165.460  88.336  1.00 89.45           H  
ATOM   7655  H1'  DT J  70     114.257 166.930  86.818  1.00 89.45           H  
ATOM   7656  H3   DT J  70     113.510 165.470  82.675  1.00 89.45           H  
ATOM   7657  H71  DT J  70     115.856 161.660  83.597  1.00 89.45           H  
ATOM   7658  H72  DT J  70     117.126 162.569  83.330  1.00 89.45           H  
ATOM   7659  H73  DT J  70     116.779 162.106  84.804  1.00 89.45           H  
ATOM   7660  H6   DT J  70     116.084 164.004  85.990  1.00 89.45           H  
ATOM   7661  P    DG J  71     113.751 166.269  91.145  1.00 90.31           P  
ATOM   7662  OP1  DG J  71     113.591 167.343  92.145  1.00 90.31           O  
ATOM   7663  OP2  DG J  71     114.225 164.942  91.584  1.00 90.31           O  
ATOM   7664  O5'  DG J  71     112.359 166.079  90.376  1.00 90.31           O  
ATOM   7665  C5'  DG J  71     111.452 167.168  90.292  1.00 90.31           C  
ATOM   7666  C4'  DG J  71     110.541 167.058  89.076  1.00 90.31           C  
ATOM   7667  O4'  DG J  71     111.226 166.349  88.018  1.00 90.31           O  
ATOM   7668  C3'  DG J  71     109.226 166.308  89.307  1.00 90.31           C  
ATOM   7669  O3'  DG J  71     108.116 167.176  89.082  1.00 90.31           O  
ATOM   7670  C2'  DG J  71     109.263 165.151  88.309  1.00 90.31           C  
ATOM   7671  C1'  DG J  71     110.288 165.600  87.290  1.00 90.31           C  
ATOM   7672  N9   DG J  71     110.998 164.519  86.596  1.00 90.31           N  
ATOM   7673  C8   DG J  71     111.950 163.691  87.123  1.00 90.31           C  
ATOM   7674  N7   DG J  71     112.451 162.853  86.269  1.00 90.31           N  
ATOM   7675  C5   DG J  71     111.777 163.125  85.100  1.00 90.31           C  
ATOM   7676  C6   DG J  71     111.894 162.523  83.837  1.00 90.31           C  
ATOM   7677  O6   DG J  71     112.634 161.589  83.502  1.00 90.31           O  
ATOM   7678  N1   DG J  71     111.022 163.089  82.916  1.00 90.31           N  
ATOM   7679  C2   DG J  71     110.158 164.121  83.183  1.00 90.31           C  
ATOM   7680  N2   DG J  71     109.398 164.539  82.166  1.00 90.31           N  
ATOM   7681  N3   DG J  71     110.042 164.700  84.370  1.00 90.31           N  
ATOM   7682  C4   DG J  71     110.882 164.154  85.276  1.00 90.31           C  
ATOM   7683  H5'  DG J  71     111.957 167.991  90.233  1.00 90.31           H  
ATOM   7684 H5''  DG J  71     110.909 167.188  91.094  1.00 90.31           H  
ATOM   7685  H4'  DG J  71     110.333 167.950  88.765  1.00 90.31           H  
ATOM   7686  H3'  DG J  71     109.196 165.962  90.209  1.00 90.31           H  
ATOM   7687  H2'  DG J  71     109.546 164.333  88.743  1.00 90.31           H  
ATOM   7688 H2''  DG J  71     108.401 165.042  87.894  1.00 90.31           H  
ATOM   7689  H1'  DG J  71     109.859 166.172  86.639  1.00 90.31           H  
ATOM   7690  H8   DG J  71     112.238 163.748  88.003  1.00 90.31           H  
ATOM   7691  H1   DG J  71     111.029 162.775  82.115  1.00 90.31           H  
ATOM   7692  H21  DG J  71     108.926 165.252  82.246  1.00 90.31           H  
ATOM   7693  H22  DG J  71     109.382 164.092  81.430  1.00 90.31           H  
ATOM   7694  P    DA J  72     106.620 166.705  89.437  1.00102.04           P  
ATOM   7695  OP1  DA J  72     105.822 167.919  89.717  1.00102.04           O  
ATOM   7696  OP2  DA J  72     106.711 165.637  90.457  1.00102.04           O  
ATOM   7697  O5'  DA J  72     106.087 166.039  88.079  1.00102.04           O  
ATOM   7698  C5'  DA J  72     106.217 166.732  86.839  1.00102.04           C  
ATOM   7699  C4'  DA J  72     105.633 165.929  85.688  1.00102.04           C  
ATOM   7700  O4'  DA J  72     106.646 165.027  85.144  1.00102.04           O  
ATOM   7701  C3'  DA J  72     104.468 165.024  86.054  1.00102.04           C  
ATOM   7702  O3'  DA J  72     103.596 164.873  84.943  1.00102.04           O  
ATOM   7703  C2'  DA J  72     105.185 163.735  86.380  1.00102.04           C  
ATOM   7704  C1'  DA J  72     106.165 163.697  85.230  1.00102.04           C  
ATOM   7705  N9   DA J  72     107.296 162.781  85.383  1.00102.04           N  
ATOM   7706  C8   DA J  72     108.107 162.631  86.469  1.00102.04           C  
ATOM   7707  N7   DA J  72     109.056 161.742  86.308  1.00102.04           N  
ATOM   7708  C5   DA J  72     108.857 161.278  85.023  1.00102.04           C  
ATOM   7709  C6   DA J  72     109.525 160.310  84.248  1.00102.04           C  
ATOM   7710  N6   DA J  72     110.592 159.626  84.680  1.00102.04           N  
ATOM   7711  N1   DA J  72     109.072 160.093  82.999  1.00102.04           N  
ATOM   7712  C2   DA J  72     108.015 160.785  82.566  1.00102.04           C  
ATOM   7713  N3   DA J  72     107.302 161.709  83.202  1.00102.04           N  
ATOM   7714  C4   DA J  72     107.779 161.911  84.437  1.00102.04           C  
ATOM   7715  H5'  DA J  72     107.156 166.896  86.665  1.00102.04           H  
ATOM   7716 H5''  DA J  72     105.752 167.581  86.899  1.00102.04           H  
ATOM   7717  H4'  DA J  72     105.347 166.538  84.993  1.00102.04           H  
ATOM   7718  H3'  DA J  72     103.997 165.361  86.828  1.00102.04           H  
ATOM   7719  H2'  DA J  72     105.640 163.792  87.229  1.00102.04           H  
ATOM   7720 H2''  DA J  72     104.584 162.993  86.355  1.00102.04           H  
ATOM   7721  H1'  DA J  72     105.687 163.480  84.418  1.00102.04           H  
ATOM   7722  H8   DA J  72     107.994 163.109  87.251  1.00102.04           H  
ATOM   7723  H61  DA J  72     110.911 158.982  84.208  1.00102.04           H  
ATOM   7724  H62  DA J  72     110.964 159.835  85.428  1.00102.04           H  
ATOM   7725  H2   DA J  72     107.740 160.593  81.700  1.00102.04           H  
ATOM   7726  P    DA J  73     102.117 165.497  84.948  1.00109.05           P  
ATOM   7727  OP1  DA J  73     101.758 165.759  83.537  1.00109.05           O  
ATOM   7728  OP2  DA J  73     102.081 166.603  85.928  1.00109.05           O  
ATOM   7729  O5'  DA J  73     101.188 164.312  85.494  1.00109.05           O  
ATOM   7730  C5'  DA J  73     101.543 162.945  85.278  1.00109.05           C  
ATOM   7731  C4'  DA J  73     101.379 162.544  83.818  1.00109.05           C  
ATOM   7732  O4'  DA J  73     102.654 162.072  83.304  1.00109.05           O  
ATOM   7733  C3'  DA J  73     100.426 161.386  83.569  1.00109.05           C  
ATOM   7734  O3'  DA J  73      99.925 161.405  82.233  1.00109.05           O  
ATOM   7735  C2'  DA J  73     101.323 160.193  83.825  1.00109.05           C  
ATOM   7736  C1'  DA J  73     102.642 160.650  83.219  1.00109.05           C  
ATOM   7737  N9   DA J  73     103.820 160.137  83.904  1.00109.05           N  
ATOM   7738  C8   DA J  73     104.297 160.536  85.111  1.00109.05           C  
ATOM   7739  N7   DA J  73     105.384 159.916  85.487  1.00109.05           N  
ATOM   7740  C5   DA J  73     105.637 159.047  84.450  1.00109.05           C  
ATOM   7741  C6   DA J  73     106.650 158.106  84.240  1.00109.05           C  
ATOM   7742  N6   DA J  73     107.627 157.885  85.110  1.00109.05           N  
ATOM   7743  N1   DA J  73     106.618 157.396  83.099  1.00109.05           N  
ATOM   7744  C2   DA J  73     105.632 157.621  82.229  1.00109.05           C  
ATOM   7745  N3   DA J  73     104.621 158.482  82.317  1.00109.05           N  
ATOM   7746  C4   DA J  73     104.686 159.172  83.462  1.00109.05           C  
ATOM   7747  H5'  DA J  73     100.976 162.384  85.827  1.00109.05           H  
ATOM   7748 H5''  DA J  73     102.462 162.811  85.539  1.00109.05           H  
ATOM   7749  H4'  DA J  73     101.092 163.312  83.304  1.00109.05           H  
ATOM   7750  H3'  DA J  73      99.695 161.404  84.206  1.00109.05           H  
ATOM   7751  H2'  DA J  73     101.418 160.030  84.776  1.00109.05           H  
ATOM   7752 H2''  DA J  73     100.990 159.413  83.371  1.00109.05           H  
ATOM   7753  H1'  DA J  73     102.673 160.385  82.287  1.00109.05           H  
ATOM   7754  H8   DA J  73     103.888 161.188  85.621  1.00109.05           H  
ATOM   7755  H61  DA J  73     108.245 157.318  84.926  1.00109.05           H  
ATOM   7756  H62  DA J  73     107.639 158.308  85.857  1.00109.05           H  
ATOM   7757  H2   DA J  73     105.655 157.107  81.457  1.00109.05           H  
ATOM   7758  P    DC J  74      98.671 160.487  81.818  1.00107.48           P  
ATOM   7759  OP1  DC J  74      98.216 160.945  80.489  1.00107.48           O  
ATOM   7760  OP2  DC J  74      97.723 160.471  82.953  1.00107.48           O  
ATOM   7761  O5'  DC J  74      99.285 159.015  81.666  1.00107.48           O  
ATOM   7762  C5'  DC J  74     100.293 158.762  80.694  1.00107.48           C  
ATOM   7763  C4'  DC J  74     100.255 157.322  80.184  1.00107.48           C  
ATOM   7764  O4'  DC J  74     101.416 156.610  80.687  1.00107.48           O  
ATOM   7765  C3'  DC J  74      99.064 156.478  80.618  1.00107.48           C  
ATOM   7766  O3'  DC J  74      98.803 155.463  79.659  1.00107.48           O  
ATOM   7767  C2'  DC J  74      99.536 155.922  81.954  1.00107.48           C  
ATOM   7768  C1'  DC J  74     101.030 155.670  81.681  1.00107.48           C  
ATOM   7769  N1   DC J  74     102.001 155.822  82.876  1.00107.48           N  
ATOM   7770  C2   DC J  74     103.143 155.005  82.949  1.00107.48           C  
ATOM   7771  O2   DC J  74     103.335 154.152  82.078  1.00107.48           O  
ATOM   7772  N3   DC J  74     104.000 155.168  83.986  1.00107.48           N  
ATOM   7773  C4   DC J  74     103.772 156.102  84.900  1.00107.48           C  
ATOM   7774  N4   DC J  74     104.636 156.222  85.904  1.00107.48           N  
ATOM   7775  C5   DC J  74     102.631 156.939  84.844  1.00107.48           C  
ATOM   7776  C6   DC J  74     101.795 156.781  83.822  1.00107.48           C  
ATOM   7777  H5'  DC J  74     101.161 158.932  81.091  1.00107.48           H  
ATOM   7778 H5''  DC J  74     100.167 159.365  79.946  1.00107.48           H  
ATOM   7779  H4'  DC J  74     100.291 157.333  79.216  1.00107.48           H  
ATOM   7780  H3'  DC J  74      98.279 157.029  80.739  1.00107.48           H  
ATOM   7781  H2'  DC J  74      99.395 156.573  82.650  1.00107.48           H  
ATOM   7782 H2''  DC J  74      99.083 155.092  82.163  1.00107.48           H  
ATOM   7783  H1'  DC J  74     101.121 154.780  81.314  1.00107.48           H  
ATOM   7784  H41  DC J  74     104.600 156.907  86.421  1.00107.48           H  
ATOM   7785  H42  DC J  74     105.232 155.616  86.032  1.00107.48           H  
ATOM   7786  H5   DC J  74     102.481 157.586  85.491  1.00107.48           H  
ATOM   7787  H6   DC J  74     101.044 157.321  83.765  1.00107.48           H  
ATOM   7788  P    DC J  75      97.583 154.441  79.865  1.00 97.37           P  
ATOM   7789  OP1  DC J  75      96.951 154.223  78.546  1.00 97.37           O  
ATOM   7790  OP2  DC J  75      96.773 154.935  80.999  1.00 97.37           O  
ATOM   7791  O5'  DC J  75      98.302 153.091  80.326  1.00 97.37           O  
ATOM   7792  C5'  DC J  75      99.366 152.567  79.548  1.00 97.37           C  
ATOM   7793  C4'  DC J  75     100.067 151.427  80.263  1.00 97.37           C  
ATOM   7794  O4'  DC J  75     100.932 151.966  81.312  1.00 97.37           O  
ATOM   7795  C3'  DC J  75      99.142 150.440  80.974  1.00 97.37           C  
ATOM   7796  O3'  DC J  75      99.675 149.131  80.917  1.00 97.37           O  
ATOM   7797  C2'  DC J  75      99.148 150.981  82.383  1.00 97.37           C  
ATOM   7798  C1'  DC J  75     100.628 151.293  82.512  1.00 97.37           C  
ATOM   7799  N1   DC J  75     101.045 152.138  83.720  1.00 97.37           N  
ATOM   7800  C2   DC J  75     102.260 151.862  84.373  1.00 97.37           C  
ATOM   7801  O2   DC J  75     102.978 150.947  83.953  1.00 97.37           O  
ATOM   7802  N3   DC J  75     102.614 152.611  85.441  1.00 97.37           N  
ATOM   7803  C4   DC J  75     101.815 153.583  85.864  1.00 97.37           C  
ATOM   7804  N4   DC J  75     102.201 154.296  86.915  1.00 97.37           N  
ATOM   7805  C5   DC J  75     100.588 153.880  85.223  1.00 97.37           C  
ATOM   7806  C6   DC J  75     100.243 153.144  84.168  1.00 97.37           C  
ATOM   7807  H5'  DC J  75     100.007 153.274  79.374  1.00 97.37           H  
ATOM   7808 H5''  DC J  75      99.013 152.245  78.707  1.00 97.37           H  
ATOM   7809  H4'  DC J  75     100.610 150.940  79.625  1.00 97.37           H  
ATOM   7810  H3'  DC J  75      98.252 150.469  80.596  1.00 97.37           H  
ATOM   7811  H2'  DC J  75      98.602 151.778  82.445  1.00 97.37           H  
ATOM   7812 H2''  DC J  75      98.870 150.308  83.018  1.00 97.37           H  
ATOM   7813  H1'  DC J  75     101.113 150.456  82.528  1.00 97.37           H  
ATOM   7814  H41  DC J  75     101.636 154.795  87.325  1.00 97.37           H  
ATOM   7815  H42  DC J  75     103.018 154.267  87.175  1.00 97.37           H  
ATOM   7816  H5   DC J  75     100.043 154.565  85.529  1.00 97.37           H  
ATOM   7817  H6   DC J  75      99.442 153.317  83.733  1.00 97.37           H  
ATOM   7818  P    DA J  76      99.087 148.048  79.894  1.00 91.11           P  
ATOM   7819  OP1  DA J  76      99.297 148.578  78.531  1.00 91.11           O  
ATOM   7820  OP2  DA J  76      97.727 147.695  80.350  1.00 91.11           O  
ATOM   7821  O5'  DA J  76     100.033 146.776  80.111  1.00 91.11           O  
ATOM   7822  C5'  DA J  76     101.439 146.901  79.935  1.00 91.11           C  
ATOM   7823  C4'  DA J  76     102.208 145.929  80.822  1.00 91.11           C  
ATOM   7824  O4'  DA J  76     102.438 146.534  82.121  1.00 91.11           O  
ATOM   7825  C3'  DA J  76     101.505 144.619  81.113  1.00 91.11           C  
ATOM   7826  O3'  DA J  76     102.447 143.581  81.318  1.00 91.11           O  
ATOM   7827  C2'  DA J  76     100.713 144.944  82.369  1.00 91.11           C  
ATOM   7828  C1'  DA J  76     101.671 145.872  83.118  1.00 91.11           C  
ATOM   7829  N9   DA J  76     101.050 146.905  83.973  1.00 91.11           N  
ATOM   7830  C8   DA J  76      99.856 147.553  83.788  1.00 91.11           C  
ATOM   7831  N7   DA J  76      99.589 148.446  84.709  1.00 91.11           N  
ATOM   7832  C5   DA J  76     100.686 148.402  85.542  1.00 91.11           C  
ATOM   7833  C6   DA J  76     101.015 149.116  86.701  1.00 91.11           C  
ATOM   7834  N6   DA J  76     100.225 150.044  87.231  1.00 91.11           N  
ATOM   7835  N1   DA J  76     102.188 148.831  87.302  1.00 91.11           N  
ATOM   7836  C2   DA J  76     102.975 147.900  86.757  1.00 91.11           C  
ATOM   7837  N3   DA J  76     102.771 147.163  85.671  1.00 91.11           N  
ATOM   7838  C4   DA J  76     101.599 147.469  85.102  1.00 91.11           C  
ATOM   7839  H5'  DA J  76     101.703 147.807  80.155  1.00 91.11           H  
ATOM   7840 H5''  DA J  76     101.658 146.725  79.010  1.00 91.11           H  
ATOM   7841  H4'  DA J  76     103.063 145.736  80.411  1.00 91.11           H  
ATOM   7842  H3'  DA J  76     100.907 144.394  80.388  1.00 91.11           H  
ATOM   7843  H2'  DA J  76      99.887 145.389  82.140  1.00 91.11           H  
ATOM   7844 H2''  DA J  76     100.542 144.144  82.881  1.00 91.11           H  
ATOM   7845  H1'  DA J  76     102.267 145.332  83.661  1.00 91.11           H  
ATOM   7846  H8   DA J  76      99.279 147.363  83.084  1.00 91.11           H  
ATOM   7847  H61  DA J  76     100.442 150.423  87.968  1.00 91.11           H  
ATOM   7848  H62  DA J  76      99.497 150.265  86.832  1.00 91.11           H  
ATOM   7849  H2   DA J  76     103.771 147.737  87.205  1.00 91.11           H  
ATOM   7850  P    DG J  77     101.993 142.047  81.201  1.00 89.01           P  
ATOM   7851  OP1  DG J  77     103.211 141.214  81.250  1.00 89.01           O  
ATOM   7852  OP2  DG J  77     101.091 141.936  80.036  1.00 89.01           O  
ATOM   7853  O5'  DG J  77     101.106 141.808  82.511  1.00 89.01           O  
ATOM   7854  C5'  DG J  77     101.517 140.881  83.510  1.00 89.01           C  
ATOM   7855  C4'  DG J  77     102.735 141.383  84.263  1.00 89.01           C  
ATOM   7856  O4'  DG J  77     102.531 142.768  84.663  1.00 89.01           O  
ATOM   7857  C3'  DG J  77     103.039 140.650  85.554  1.00 89.01           C  
ATOM   7858  O3'  DG J  77     104.446 140.704  85.809  1.00 89.01           O  
ATOM   7859  C2'  DG J  77     102.193 141.433  86.550  1.00 89.01           C  
ATOM   7860  C1'  DG J  77     102.422 142.847  86.077  1.00 89.01           C  
ATOM   7861  N9   DG J  77     101.354 143.780  86.398  1.00 89.01           N  
ATOM   7862  C8   DG J  77     100.180 143.944  85.714  1.00 89.01           C  
ATOM   7863  N7   DG J  77      99.416 144.877  86.207  1.00 89.01           N  
ATOM   7864  C5   DG J  77     100.136 145.370  87.283  1.00 89.01           C  
ATOM   7865  C6   DG J  77      99.810 146.392  88.197  1.00 89.01           C  
ATOM   7866  O6   DG J  77      98.789 147.084  88.231  1.00 89.01           O  
ATOM   7867  N1   DG J  77     100.816 146.586  89.140  1.00 89.01           N  
ATOM   7868  C2   DG J  77     101.989 145.872  89.196  1.00 89.01           C  
ATOM   7869  N2   DG J  77     102.842 146.197  90.181  1.00 89.01           N  
ATOM   7870  N3   DG J  77     102.309 144.908  88.337  1.00 89.01           N  
ATOM   7871  C4   DG J  77     101.337 144.712  87.412  1.00 89.01           C  
ATOM   7872  H5'  DG J  77     101.730 140.035  83.088  1.00 89.01           H  
ATOM   7873 H5''  DG J  77     100.790 140.750  84.138  1.00 89.01           H  
ATOM   7874  H4'  DG J  77     103.508 141.334  83.685  1.00 89.01           H  
ATOM   7875  H3'  DG J  77     102.738 139.731  85.501  1.00 89.01           H  
ATOM   7876  H2'  DG J  77     101.258 141.196  86.470  1.00 89.01           H  
ATOM   7877 H2''  DG J  77     102.502 141.316  87.451  1.00 89.01           H  
ATOM   7878  H1'  DG J  77     103.254 143.173  86.445  1.00 89.01           H  
ATOM   7879  H8   DG J  77      99.948 143.434  84.974  1.00 89.01           H  
ATOM   7880  H1   DG J  77     100.692 147.194  89.735  1.00 89.01           H  
ATOM   7881  H21  DG J  77     103.629 145.852  90.200  1.00 89.01           H  
ATOM   7882  H22  DG J  77     102.597 146.743  90.799  1.00 89.01           H  
ATOM   7883  P    DC J  78     105.065 140.222  87.206  1.00 91.78           P  
ATOM   7884  OP1  DC J  78     106.519 140.048  86.999  1.00 91.78           O  
ATOM   7885  OP2  DC J  78     104.252 139.082  87.678  1.00 91.78           O  
ATOM   7886  O5'  DC J  78     104.798 141.474  88.166  1.00 91.78           O  
ATOM   7887  C5'  DC J  78     105.676 141.773  89.229  1.00 91.78           C  
ATOM   7888  C4'  DC J  78     104.972 141.646  90.556  1.00 91.78           C  
ATOM   7889  O4'  DC J  78     103.657 142.274  90.475  1.00 91.78           O  
ATOM   7890  C3'  DC J  78     104.722 140.206  90.999  1.00 91.78           C  
ATOM   7891  O3'  DC J  78     105.024 140.045  92.371  1.00 91.78           O  
ATOM   7892  C2'  DC J  78     103.249 140.012  90.695  1.00 91.78           C  
ATOM   7893  C1'  DC J  78     102.704 141.393  91.019  1.00 91.78           C  
ATOM   7894  N1   DC J  78     101.309 141.733  90.470  1.00 91.78           N  
ATOM   7895  C2   DC J  78     100.660 142.878  90.947  1.00 91.78           C  
ATOM   7896  O2   DC J  78     101.234 143.587  91.780  1.00 91.78           O  
ATOM   7897  N3   DC J  78      99.425 143.183  90.473  1.00 91.78           N  
ATOM   7898  C4   DC J  78      98.840 142.394  89.573  1.00 91.78           C  
ATOM   7899  N4   DC J  78      97.625 142.733  89.133  1.00 91.78           N  
ATOM   7900  C5   DC J  78      99.475 141.224  89.078  1.00 91.78           C  
ATOM   7901  C6   DC J  78     100.688 140.928  89.551  1.00 91.78           C  
ATOM   7902  H5'  DC J  78     106.001 142.679  89.128  1.00 91.78           H  
ATOM   7903 H5''  DC J  78     106.426 141.161  89.207  1.00 91.78           H  
ATOM   7904  H4'  DC J  78     105.495 142.096  91.232  1.00 91.78           H  
ATOM   7905  H3'  DC J  78     105.255 139.599  90.466  1.00 91.78           H  
ATOM   7906  H2'  DC J  78     103.133 139.791  89.762  1.00 91.78           H  
ATOM   7907 H2''  DC J  78     102.860 139.338  91.268  1.00 91.78           H  
ATOM   7908  H1'  DC J  78     102.695 141.503  91.982  1.00 91.78           H  
ATOM   7909  H41  DC J  78      97.185 142.195  88.629  1.00 91.78           H  
ATOM   7910  H42  DC J  78      97.286 143.492  89.352  1.00 91.78           H  
ATOM   7911  H5   DC J  78      99.058 140.681  88.450  1.00 91.78           H  
ATOM   7912  H6   DC J  78     101.122 140.171  89.237  1.00 91.78           H  
ATOM   7913  P    DT J  79     106.545 139.826  92.829  1.00 85.65           P  
ATOM   7914  OP1  DT J  79     107.417 140.510  91.853  1.00 85.65           O  
ATOM   7915  OP2  DT J  79     106.731 138.387  93.112  1.00 85.65           O  
ATOM   7916  O5'  DT J  79     106.636 140.601  94.213  1.00 85.65           O  
ATOM   7917  C5'  DT J  79     106.074 141.894  94.340  1.00 85.65           C  
ATOM   7918  C4'  DT J  79     104.970 141.932  95.384  1.00 85.65           C  
ATOM   7919  O4'  DT J  79     103.662 141.934  94.718  1.00 85.65           O  
ATOM   7920  C3'  DT J  79     104.924 140.729  96.353  1.00 85.65           C  
ATOM   7921  O3'  DT J  79     104.573 141.127  97.672  1.00 85.65           O  
ATOM   7922  C2'  DT J  79     103.836 139.892  95.715  1.00 85.65           C  
ATOM   7923  C1'  DT J  79     102.855 141.004  95.394  1.00 85.65           C  
ATOM   7924  N1   DT J  79     101.635 140.637  94.567  1.00 85.65           N  
ATOM   7925  C2   DT J  79     100.533 141.462  94.623  1.00 85.65           C  
ATOM   7926  O2   DT J  79     100.495 142.481  95.286  1.00 85.65           O  
ATOM   7927  N3   DT J  79      99.473 141.059  93.865  1.00 85.65           N  
ATOM   7928  C4   DT J  79      99.397 139.931  93.077  1.00 85.65           C  
ATOM   7929  O4   DT J  79      98.398 139.651  92.428  1.00 85.65           O  
ATOM   7930  C5   DT J  79     100.574 139.103  93.068  1.00 85.65           C  
ATOM   7931  C7   DT J  79     100.602 137.852  92.247  1.00 85.65           C  
ATOM   7932  C6   DT J  79     101.622 139.484  93.810  1.00 85.65           C  
ATOM   7933  H5'  DT J  79     105.709 142.163  93.488  1.00 85.65           H  
ATOM   7934 H5''  DT J  79     106.770 142.515  94.596  1.00 85.65           H  
ATOM   7935  H4'  DT J  79     105.055 142.747  95.894  1.00 85.65           H  
ATOM   7936  H3'  DT J  79     105.762 140.252  96.363  1.00 85.65           H  
ATOM   7937  H2'  DT J  79     104.164 139.463  94.910  1.00 85.65           H  
ATOM   7938 H2''  DT J  79     103.469 139.254  96.336  1.00 85.65           H  
ATOM   7939  H1'  DT J  79     102.557 141.406  96.218  1.00 85.65           H  
ATOM   7940  H3   DT J  79      98.777 141.564  93.880  1.00 85.65           H  
ATOM   7941  H71  DT J  79      99.715 137.463  92.222  1.00 85.65           H  
ATOM   7942  H72  DT J  79     100.888 138.064  91.345  1.00 85.65           H  
ATOM   7943  H73  DT J  79     101.222 137.220  92.642  1.00 85.65           H  
ATOM   7944  H6   DT J  79     102.380 138.951  93.801  1.00 85.65           H  
ATOM   7945  P    DG J  80     105.553 142.047  98.545  1.00 74.59           P  
ATOM   7946  OP1  DG J  80     106.877 142.013  97.888  1.00 74.59           O  
ATOM   7947  OP2  DG J  80     105.425 141.633  99.957  1.00 74.59           O  
ATOM   7948  O5'  DG J  80     104.928 143.507  98.364  1.00 74.59           O  
ATOM   7949  C5'  DG J  80     104.569 144.281  99.493  1.00 74.59           C  
ATOM   7950  C4'  DG J  80     103.134 144.009  99.915  1.00 74.59           C  
ATOM   7951  O4'  DG J  80     102.502 143.134  98.943  1.00 74.59           O  
ATOM   7952  C3'  DG J  80     102.938 143.311 101.281  1.00 74.59           C  
ATOM   7953  O3'  DG J  80     102.039 144.044 102.094  1.00 74.59           O  
ATOM   7954  C2'  DG J  80     102.376 141.955 100.900  1.00 74.59           C  
ATOM   7955  C1'  DG J  80     101.616 142.310  99.648  1.00 74.59           C  
ATOM   7956  N9   DG J  80     101.207 141.176  98.823  1.00 74.59           N  
ATOM   7957  C8   DG J  80     101.936 140.057  98.526  1.00 74.59           C  
ATOM   7958  N7   DG J  80     101.303 139.216  97.758  1.00 74.59           N  
ATOM   7959  C5   DG J  80     100.071 139.808  97.551  1.00 74.59           C  
ATOM   7960  C6   DG J  80      98.964 139.358  96.808  1.00 74.59           C  
ATOM   7961  O6   DG J  80      98.852 138.308  96.165  1.00 74.59           O  
ATOM   7962  N1   DG J  80      97.910 140.260  96.863  1.00 74.59           N  
ATOM   7963  C2   DG J  80      97.935 141.454  97.538  1.00 74.59           C  
ATOM   7964  N2   DG J  80      96.827 142.192  97.493  1.00 74.59           N  
ATOM   7965  N3   DG J  80      98.964 141.879  98.243  1.00 74.59           N  
ATOM   7966  C4   DG J  80      99.994 141.010  98.203  1.00 74.59           C  
ATOM   7967  H5'  DG J  80     104.656 145.219  99.270  1.00 74.59           H  
ATOM   7968 H5''  DG J  80     105.168 144.074 100.221  1.00 74.59           H  
ATOM   7969  H4'  DG J  80     102.655 144.848  99.930  1.00 74.59           H  
ATOM   7970  H3'  DG J  80     103.782 143.203 101.735  1.00 74.59           H  
ATOM   7971  H2'  DG J  80     103.087 141.330 100.714  1.00 74.59           H  
ATOM   7972 H2''  DG J  80     101.783 141.619 101.582  1.00 74.59           H  
ATOM   7973  H1'  DG J  80     100.837 142.825  99.887  1.00 74.59           H  
ATOM   7974  H8   DG J  80     102.809 139.926  98.815  1.00 74.59           H  
ATOM   7975  H1   DG J  80      97.195 140.061  96.436  1.00 74.59           H  
ATOM   7976  H21  DG J  80      96.565 142.616  98.195  1.00 74.59           H  
ATOM   7977  H22  DG J  80      96.375 142.244  96.764  1.00 74.59           H  
ATOM   7978  P    DA J  81     101.911 143.723 103.662  1.00 70.88           P  
ATOM   7979  OP1  DA J  81     102.797 144.671 104.367  1.00 70.88           O  
ATOM   7980  OP2  DA J  81     102.058 142.275 103.902  1.00 70.88           O  
ATOM   7981  O5'  DA J  81     100.411 144.131 104.003  1.00 70.88           O  
ATOM   7982  C5'  DA J  81     100.084 145.483 104.035  1.00 70.88           C  
ATOM   7983  C4'  DA J  81      98.657 145.731 103.636  1.00 70.88           C  
ATOM   7984  O4'  DA J  81      98.343 144.982 102.434  1.00 70.88           O  
ATOM   7985  C3'  DA J  81      97.657 145.281 104.657  1.00 70.88           C  
ATOM   7986  O3'  DA J  81      96.491 146.054 104.574  1.00 70.88           O  
ATOM   7987  C2'  DA J  81      97.437 143.850 104.252  1.00 70.88           C  
ATOM   7988  C1'  DA J  81      97.409 143.969 102.747  1.00 70.88           C  
ATOM   7989  N9   DA J  81      97.797 142.752 102.065  1.00 70.88           N  
ATOM   7990  C8   DA J  81      99.058 142.269 101.946  1.00 70.88           C  
ATOM   7991  N7   DA J  81      99.133 141.147 101.279  1.00 70.88           N  
ATOM   7992  C5   DA J  81      97.824 140.871 100.950  1.00 70.88           C  
ATOM   7993  C6   DA J  81      97.244 139.813 100.253  1.00 70.88           C  
ATOM   7994  N6   DA J  81      97.959 138.821  99.736  1.00 70.88           N  
ATOM   7995  N1   DA J  81      95.909 139.828 100.080  1.00 70.88           N  
ATOM   7996  C2   DA J  81      95.209 140.844 100.597  1.00 70.88           C  
ATOM   7997  N3   DA J  81      95.649 141.897 101.283  1.00 70.88           N  
ATOM   7998  C4   DA J  81      96.981 141.848 101.423  1.00 70.88           C  
ATOM   7999  H5'  DA J  81     100.656 145.945 103.431  1.00 70.88           H  
ATOM   8000 H5''  DA J  81     100.223 145.820 104.929  1.00 70.88           H  
ATOM   8001  H4'  DA J  81      98.532 146.673 103.466  1.00 70.88           H  
ATOM   8002  H3'  DA J  81      98.040 145.328 105.539  1.00 70.88           H  
ATOM   8003  H2'  DA J  81      98.174 143.296 104.540  1.00 70.88           H  
ATOM   8004 H2''  DA J  81      96.609 143.521 104.587  1.00 70.88           H  
ATOM   8005  H1'  DA J  81      96.527 144.241 102.458  1.00 70.88           H  
ATOM   8006  H8   DA J  81      99.802 142.704 102.295  1.00 70.88           H  
ATOM   8007  H61  DA J  81      97.566 138.130  99.416  1.00 70.88           H  
ATOM   8008  H62  DA J  81      98.816 138.878  99.715  1.00 70.88           H  
ATOM   8009  H2   DA J  81      94.292 140.808 100.463  1.00 70.88           H  
ATOM   8010  P    DA J  82      95.613 146.320 105.885  1.00 78.15           P  
ATOM   8011  OP1  DA J  82      95.480 147.778 106.055  1.00 78.15           O  
ATOM   8012  OP2  DA J  82      96.126 145.508 107.008  1.00 78.15           O  
ATOM   8013  O5'  DA J  82      94.197 145.697 105.521  1.00 78.15           O  
ATOM   8014  C5'  DA J  82      94.117 144.330 105.203  1.00 78.15           C  
ATOM   8015  C4'  DA J  82      92.710 143.832 105.287  1.00 78.15           C  
ATOM   8016  O4'  DA J  82      92.543 142.768 104.330  1.00 78.15           O  
ATOM   8017  C3'  DA J  82      92.299 143.256 106.645  1.00 78.15           C  
ATOM   8018  O3'  DA J  82      90.873 143.538 106.924  1.00 78.15           O  
ATOM   8019  C2'  DA J  82      92.650 141.778 106.493  1.00 78.15           C  
ATOM   8020  C1'  DA J  82      92.640 141.523 104.975  1.00 78.15           C  
ATOM   8021  N9   DA J  82      93.811 140.806 104.499  1.00 78.15           N  
ATOM   8022  C8   DA J  82      95.120 141.122 104.708  1.00 78.15           C  
ATOM   8023  N7   DA J  82      95.958 140.268 104.190  1.00 78.15           N  
ATOM   8024  C5   DA J  82      95.141 139.328 103.604  1.00 78.15           C  
ATOM   8025  C6   DA J  82      95.420 138.171 102.884  1.00 78.15           C  
ATOM   8026  N6   DA J  82      96.656 137.761 102.633  1.00 78.15           N  
ATOM   8027  N1   DA J  82      94.381 137.449 102.429  1.00 78.15           N  
ATOM   8028  C2   DA J  82      93.143 137.873 102.686  1.00 78.15           C  
ATOM   8029  N3   DA J  82      92.757 138.951 103.354  1.00 78.15           N  
ATOM   8030  C4   DA J  82      93.818 139.647 103.778  1.00 78.15           C  
ATOM   8031  H5'  DA J  82      94.667 143.827 105.818  1.00 78.15           H  
ATOM   8032 H5''  DA J  82      94.441 144.195 104.300  1.00 78.15           H  
ATOM   8033  H4'  DA J  82      92.132 144.550 105.055  1.00 78.15           H  
ATOM   8034  H3'  DA J  82      92.845 143.645 107.337  1.00 78.15           H  
ATOM   8035  H2'  DA J  82      93.524 141.609 106.863  1.00 78.15           H  
ATOM   8036 H2''  DA J  82      92.009 141.227 106.920  1.00 78.15           H  
ATOM   8037  H1'  DA J  82      91.858 141.002 104.757  1.00 78.15           H  
ATOM   8038  H8   DA J  82      95.389 141.871 105.184  1.00 78.15           H  
ATOM   8039  H61  DA J  82      96.789 137.000 102.259  1.00 78.15           H  
ATOM   8040  H62  DA J  82      97.324 138.259 102.845  1.00 78.15           H  
ATOM   8041  H2   DA J  82      92.459 137.343 102.352  1.00 78.15           H  
ATOM   8042  P    DC J  83      89.930 142.652 107.895  1.00 82.19           P  
ATOM   8043  OP1  DC J  83      88.677 143.406 108.107  1.00 82.19           O  
ATOM   8044  OP2  DC J  83      90.729 142.186 109.048  1.00 82.19           O  
ATOM   8045  O5'  DC J  83      89.595 141.370 106.985  1.00 82.19           O  
ATOM   8046  C5'  DC J  83      88.251 140.919 106.794  1.00 82.19           C  
ATOM   8047  C4'  DC J  83      88.230 139.439 106.438  1.00 82.19           C  
ATOM   8048  O4'  DC J  83      89.501 139.047 105.844  1.00 82.19           O  
ATOM   8049  C3'  DC J  83      88.016 138.512 107.628  1.00 82.19           C  
ATOM   8050  O3'  DC J  83      86.767 137.845 107.506  1.00 82.19           O  
ATOM   8051  C2'  DC J  83      89.214 137.558 107.602  1.00 82.19           C  
ATOM   8052  C1'  DC J  83      89.804 137.721 106.220  1.00 82.19           C  
ATOM   8053  N1   DC J  83      91.311 137.520 106.173  1.00 82.19           N  
ATOM   8054  C2   DC J  83      91.884 136.387 105.562  1.00 82.19           C  
ATOM   8055  O2   DC J  83      91.160 135.533 105.047  1.00 82.19           O  
ATOM   8056  N3   DC J  83      93.237 136.271 105.551  1.00 82.19           N  
ATOM   8057  C4   DC J  83      93.989 137.207 106.116  1.00 82.19           C  
ATOM   8058  N4   DC J  83      95.310 137.065 106.081  1.00 82.19           N  
ATOM   8059  C5   DC J  83      93.427 138.339 106.743  1.00 82.19           C  
ATOM   8060  C6   DC J  83      92.105 138.455 106.742  1.00 82.19           C  
ATOM   8061  H5'  DC J  83      87.843 141.420 106.074  1.00 82.19           H  
ATOM   8062 H5''  DC J  83      87.744 141.067 107.604  1.00 82.19           H  
ATOM   8063  H4'  DC J  83      87.524 139.282 105.791  1.00 82.19           H  
ATOM   8064  H3'  DC J  83      88.031 139.021 108.450  1.00 82.19           H  
ATOM   8065  H2'  DC J  83      89.858 137.807 108.279  1.00 82.19           H  
ATOM   8066 H2''  DC J  83      88.930 136.668 107.729  1.00 82.19           H  
ATOM   8067  H1'  DC J  83      89.369 137.106 105.610  1.00 82.19           H  
ATOM   8068  H41  DC J  83      95.817 137.734 106.264  1.00 82.19           H  
ATOM   8069  H42  DC J  83      95.655 136.313 105.856  1.00 82.19           H  
ATOM   8070  H5   DC J  83      93.965 138.991 107.123  1.00 82.19           H  
ATOM   8071  H6   DC J  83      91.715 139.189 107.145  1.00 82.19           H  
ATOM   8072  P    DA J  84      86.279 136.818 108.639  1.00 89.60           P  
ATOM   8073  OP1  DA J  84      84.803 136.740 108.592  1.00 89.60           O  
ATOM   8074  OP2  DA J  84      86.965 137.173 109.901  1.00 89.60           O  
ATOM   8075  O5'  DA J  84      86.880 135.438 108.127  1.00 89.60           O  
ATOM   8076  C5'  DA J  84      86.838 135.142 106.741  1.00 89.60           C  
ATOM   8077  C4'  DA J  84      86.620 133.666 106.507  1.00 89.60           C  
ATOM   8078  O4'  DA J  84      87.893 133.023 106.249  1.00 89.60           O  
ATOM   8079  C3'  DA J  84      86.019 132.913 107.678  1.00 89.60           C  
ATOM   8080  O3'  DA J  84      85.222 131.842 107.215  1.00 89.60           O  
ATOM   8081  C2'  DA J  84      87.254 132.463 108.473  1.00 89.60           C  
ATOM   8082  C1'  DA J  84      88.374 132.382 107.419  1.00 89.60           C  
ATOM   8083  N9   DA J  84      89.646 133.022 107.797  1.00 89.60           N  
ATOM   8084  C8   DA J  84      89.815 134.225 108.414  1.00 89.60           C  
ATOM   8085  N7   DA J  84      91.064 134.564 108.601  1.00 89.60           N  
ATOM   8086  C5   DA J  84      91.774 133.514 108.065  1.00 89.60           C  
ATOM   8087  C6   DA J  84      93.153 133.269 107.957  1.00 89.60           C  
ATOM   8088  N6   DA J  84      94.083 134.115 108.407  1.00 89.60           N  
ATOM   8089  N1   DA J  84      93.540 132.121 107.366  1.00 89.60           N  
ATOM   8090  C2   DA J  84      92.599 131.280 106.916  1.00 89.60           C  
ATOM   8091  N3   DA J  84      91.271 131.403 106.962  1.00 89.60           N  
ATOM   8092  C4   DA J  84      90.921 132.553 107.556  1.00 89.60           C  
ATOM   8093  H5'  DA J  84      87.674 135.407 106.331  1.00 89.60           H  
ATOM   8094 H5''  DA J  84      86.114 135.638 106.333  1.00 89.60           H  
ATOM   8095  H4'  DA J  84      86.048 133.552 105.734  1.00 89.60           H  
ATOM   8096  H3'  DA J  84      85.478 133.509 108.216  1.00 89.60           H  
ATOM   8097  H2'  DA J  84      87.461 133.112 109.154  1.00 89.60           H  
ATOM   8098 H2''  DA J  84      87.108 131.595 108.870  1.00 89.60           H  
ATOM   8099  H1'  DA J  84      88.543 131.451 107.217  1.00 89.60           H  
ATOM   8100  H8   DA J  84      89.101 134.760 108.679  1.00 89.60           H  
ATOM   8101  H61  DA J  84      94.909 133.881 108.413  1.00 89.60           H  
ATOM   8102  H62  DA J  84      93.854 134.896 108.684  1.00 89.60           H  
ATOM   8103  H2   DA J  84      92.914 130.503 106.516  1.00 89.60           H  
ATOM   8104  P    DT J  85      84.436 130.910 108.257  1.00 91.92           P  
ATOM   8105  OP1  DT J  85      83.272 130.324 107.561  1.00 91.92           O  
ATOM   8106  OP2  DT J  85      84.245 131.682 109.504  1.00 91.92           O  
ATOM   8107  O5'  DT J  85      85.490 129.757 108.557  1.00 91.92           O  
ATOM   8108  C5'  DT J  85      86.155 129.124 107.479  1.00 91.92           C  
ATOM   8109  C4'  DT J  85      87.342 128.318 107.958  1.00 91.92           C  
ATOM   8110  O4'  DT J  85      88.443 129.204 108.251  1.00 91.92           O  
ATOM   8111  C3'  DT J  85      87.103 127.502 109.229  1.00 91.92           C  
ATOM   8112  O3'  DT J  85      87.130 126.125 108.914  1.00 91.92           O  
ATOM   8113  C2'  DT J  85      88.232 127.942 110.187  1.00 91.92           C  
ATOM   8114  C1'  DT J  85      89.225 128.628 109.261  1.00 91.92           C  
ATOM   8115  N1   DT J  85      90.069 129.730 109.895  1.00 91.92           N  
ATOM   8116  C2   DT J  85      91.450 129.645 109.860  1.00 91.92           C  
ATOM   8117  O2   DT J  85      92.057 128.707 109.371  1.00 91.92           O  
ATOM   8118  N3   DT J  85      92.103 130.703 110.437  1.00 91.92           N  
ATOM   8119  C4   DT J  85      91.533 131.816 111.020  1.00 91.92           C  
ATOM   8120  O4   DT J  85      92.203 132.714 111.513  1.00 91.92           O  
ATOM   8121  C5   DT J  85      90.095 131.849 111.013  1.00 91.92           C  
ATOM   8122  C7   DT J  85      89.372 133.006 111.625  1.00 91.92           C  
ATOM   8123  C6   DT J  85      89.439 130.827 110.452  1.00 91.92           C  
ATOM   8124  H5'  DT J  85      86.465 129.796 106.856  1.00 91.92           H  
ATOM   8125 H5''  DT J  85      85.534 128.536 107.027  1.00 91.92           H  
ATOM   8126  H4'  DT J  85      87.611 127.714 107.251  1.00 91.92           H  
ATOM   8127  H3'  DT J  85      86.246 127.728 109.612  1.00 91.92           H  
ATOM   8128  H2'  DT J  85      87.890 128.561 110.847  1.00 91.92           H  
ATOM   8129 H2''  DT J  85      88.639 127.182 110.616  1.00 91.92           H  
ATOM   8130  H1'  DT J  85      89.804 127.957 108.869  1.00 91.92           H  
ATOM   8131  H3   DT J  85      92.962 130.672 110.436  1.00 91.92           H  
ATOM   8132  H71  DT J  85      88.528 133.134 111.173  1.00 91.92           H  
ATOM   8133  H72  DT J  85      89.211 132.823 112.563  1.00 91.92           H  
ATOM   8134  H73  DT J  85      89.911 133.806 111.539  1.00 91.92           H  
ATOM   8135  H6   DT J  85      88.511 130.849 110.450  1.00 91.92           H  
ATOM   8136  P    DG J  86      86.873 125.019 110.044  1.00 90.45           P  
ATOM   8137  OP1  DG J  86      86.384 123.795 109.375  1.00 90.45           O  
ATOM   8138  OP2  DG J  86      86.072 125.648 111.117  1.00 90.45           O  
ATOM   8139  O5'  DG J  86      88.334 124.748 110.620  1.00 90.45           O  
ATOM   8140  C5'  DG J  86      89.453 124.726 109.738  1.00 90.45           C  
ATOM   8141  C4'  DG J  86      90.744 124.715 110.515  1.00 90.45           C  
ATOM   8142  O4'  DG J  86      91.110 126.081 110.878  1.00 90.45           O  
ATOM   8143  C3'  DG J  86      90.694 123.940 111.835  1.00 90.45           C  
ATOM   8144  O3'  DG J  86      91.876 123.199 112.001  1.00 90.45           O  
ATOM   8145  C2'  DG J  86      90.567 125.052 112.862  1.00 90.45           C  
ATOM   8146  C1'  DG J  86      91.477 126.086 112.237  1.00 90.45           C  
ATOM   8147  N9   DG J  86      91.379 127.440 112.780  1.00 90.45           N  
ATOM   8148  C8   DG J  86      90.249 128.131 113.137  1.00 90.45           C  
ATOM   8149  N7   DG J  86      90.498 129.330 113.590  1.00 90.45           N  
ATOM   8150  C5   DG J  86      91.879 129.434 113.526  1.00 90.45           C  
ATOM   8151  C6   DG J  86      92.731 130.501 113.879  1.00 90.45           C  
ATOM   8152  O6   DG J  86      92.427 131.608 114.335  1.00 90.45           O  
ATOM   8153  N1   DG J  86      94.068 130.189 113.651  1.00 90.45           N  
ATOM   8154  C2   DG J  86      94.517 128.997 113.146  1.00 90.45           C  
ATOM   8155  N2   DG J  86      95.842 128.865 112.992  1.00 90.45           N  
ATOM   8156  N3   DG J  86      93.728 127.994 112.818  1.00 90.45           N  
ATOM   8157  C4   DG J  86      92.429 128.282 113.028  1.00 90.45           C  
ATOM   8158  H5'  DG J  86      89.436 125.513 109.173  1.00 90.45           H  
ATOM   8159 H5''  DG J  86      89.407 123.935 109.183  1.00 90.45           H  
ATOM   8160  H4'  DG J  86      91.442 124.342 109.958  1.00 90.45           H  
ATOM   8161  H3'  DG J  86      89.920 123.357 111.864  1.00 90.45           H  
ATOM   8162  H2'  DG J  86      89.654 125.371 112.916  1.00 90.45           H  
ATOM   8163 H2''  DG J  86      90.896 124.768 113.726  1.00 90.45           H  
ATOM   8164  H1'  DG J  86      92.393 125.783 112.316  1.00 90.45           H  
ATOM   8165  H8   DG J  86      89.392 127.780 113.067  1.00 90.45           H  
ATOM   8166  H1   DG J  86      94.654 130.788 113.840  1.00 90.45           H  
ATOM   8167  H21  DG J  86      96.196 128.081 112.966  1.00 90.45           H  
ATOM   8168  H22  DG J  86      96.339 129.566 112.917  1.00 90.45           H  
ATOM   8169  P    DC J  87      91.854 121.752 112.690  1.00 92.07           P  
ATOM   8170  OP1  DC J  87      91.691 120.755 111.610  1.00 92.07           O  
ATOM   8171  OP2  DC J  87      90.893 121.791 113.813  1.00 92.07           O  
ATOM   8172  O5'  DC J  87      93.328 121.619 113.288  1.00 92.07           O  
ATOM   8173  C5'  DC J  87      94.446 121.869 112.450  1.00 92.07           C  
ATOM   8174  C4'  DC J  87      95.493 122.698 113.164  1.00 92.07           C  
ATOM   8175  O4'  DC J  87      94.956 124.006 113.485  1.00 92.07           O  
ATOM   8176  C3'  DC J  87      95.986 122.106 114.477  1.00 92.07           C  
ATOM   8177  O3'  DC J  87      97.388 121.995 114.435  1.00 92.07           O  
ATOM   8178  C2'  DC J  87      95.496 123.089 115.545  1.00 92.07           C  
ATOM   8179  C1'  DC J  87      95.400 124.390 114.764  1.00 92.07           C  
ATOM   8180  N1   DC J  87      94.426 125.435 115.306  1.00 92.07           N  
ATOM   8181  C2   DC J  87      94.855 126.752 115.571  1.00 92.07           C  
ATOM   8182  O2   DC J  87      96.037 127.062 115.406  1.00 92.07           O  
ATOM   8183  N3   DC J  87      93.950 127.658 116.013  1.00 92.07           N  
ATOM   8184  C4   DC J  87      92.686 127.303 116.188  1.00 92.07           C  
ATOM   8185  N4   DC J  87      91.831 128.226 116.617  1.00 92.07           N  
ATOM   8186  C5   DC J  87      92.231 125.993 115.911  1.00 92.07           C  
ATOM   8187  C6   DC J  87      93.120 125.104 115.470  1.00 92.07           C  
ATOM   8188  H5'  DC J  87      94.152 122.343 111.659  1.00 92.07           H  
ATOM   8189 H5''  DC J  87      94.838 121.025 112.186  1.00 92.07           H  
ATOM   8190  H4'  DC J  87      96.253 122.811 112.574  1.00 92.07           H  
ATOM   8191  H3'  DC J  87      95.587 121.237 114.617  1.00 92.07           H  
ATOM   8192  H2'  DC J  87      94.631 122.818 115.884  1.00 92.07           H  
ATOM   8193 H2''  DC J  87      96.140 123.163 116.262  1.00 92.07           H  
ATOM   8194  H1'  DC J  87      96.283 124.776 114.688  1.00 92.07           H  
ATOM   8195  H41  DC J  87      91.036 128.000 116.848  1.00 92.07           H  
ATOM   8196  H42  DC J  87      92.070 129.049 116.651  1.00 92.07           H  
ATOM   8197  H5   DC J  87      91.343 125.761 116.034  1.00 92.07           H  
ATOM   8198  H6   DC J  87      92.844 124.238 115.286  1.00 92.07           H  
ATOM   8199  P    DC J  88      98.174 121.066 115.476  1.00 94.72           P  
ATOM   8200  OP1  DC J  88      99.144 120.261 114.703  1.00 94.72           O  
ATOM   8201  OP2  DC J  88      97.177 120.402 116.344  1.00 94.72           O  
ATOM   8202  O5'  DC J  88      98.980 122.113 116.368  1.00 94.72           O  
ATOM   8203  C5'  DC J  88      99.720 123.159 115.749  1.00 94.72           C  
ATOM   8204  C4'  DC J  88      99.915 124.301 116.716  1.00 94.72           C  
ATOM   8205  O4'  DC J  88      98.629 124.959 116.966  1.00 94.72           O  
ATOM   8206  C3'  DC J  88     100.439 123.861 118.082  1.00 94.72           C  
ATOM   8207  O3'  DC J  88     101.522 124.669 118.508  1.00 94.72           O  
ATOM   8208  C2'  DC J  88      99.218 123.998 118.968  1.00 94.72           C  
ATOM   8209  C1'  DC J  88      98.525 125.191 118.345  1.00 94.72           C  
ATOM   8210  N1   DC J  88      97.060 125.387 118.772  1.00 94.72           N  
ATOM   8211  C2   DC J  88      96.581 126.675 119.079  1.00 94.72           C  
ATOM   8212  O2   DC J  88      97.331 127.650 118.975  1.00 94.72           O  
ATOM   8213  N3   DC J  88      95.292 126.819 119.477  1.00 94.72           N  
ATOM   8214  C4   DC J  88      94.502 125.754 119.582  1.00 94.72           C  
ATOM   8215  N4   DC J  88      93.243 125.942 119.978  1.00 94.72           N  
ATOM   8216  C5   DC J  88      94.965 124.446 119.289  1.00 94.72           C  
ATOM   8217  C6   DC J  88      96.231 124.308 118.895  1.00 94.72           C  
ATOM   8218  H5'  DC J  88      99.243 123.477 114.970  1.00 94.72           H  
ATOM   8219 H5''  DC J  88     100.586 122.819 115.478  1.00 94.72           H  
ATOM   8220  H4'  DC J  88     100.532 124.941 116.332  1.00 94.72           H  
ATOM   8221  H3'  DC J  88     100.714 122.934 118.044  1.00 94.72           H  
ATOM   8222  H2'  DC J  88      98.682 123.199 118.915  1.00 94.72           H  
ATOM   8223 H2''  DC J  88      99.464 124.186 119.866  1.00 94.72           H  
ATOM   8224  H1'  DC J  88      99.030 125.985 118.565  1.00 94.72           H  
ATOM   8225  H41  DC J  88      92.685 125.290 119.957  1.00 94.72           H  
ATOM   8226  H42  DC J  88      92.992 126.714 120.257  1.00 94.72           H  
ATOM   8227  H5   DC J  88      94.403 123.711 119.368  1.00 94.72           H  
ATOM   8228  H6   DC J  88      96.558 123.461 118.702  1.00 94.72           H  
ATOM   8229  P    DT J  89     102.946 123.992 118.819  1.00 94.93           P  
ATOM   8230  OP1  DT J  89     103.526 123.581 117.523  1.00 94.93           O  
ATOM   8231  OP2  DT J  89     102.770 123.002 119.902  1.00 94.93           O  
ATOM   8232  O5'  DT J  89     103.822 125.189 119.392  1.00 94.93           O  
ATOM   8233  C5'  DT J  89     104.192 126.233 118.535  1.00 94.93           C  
ATOM   8234  C4'  DT J  89     103.950 127.577 119.183  1.00 94.93           C  
ATOM   8235  O4'  DT J  89     102.592 127.636 119.708  1.00 94.93           O  
ATOM   8236  C3'  DT J  89     104.857 127.893 120.353  1.00 94.93           C  
ATOM   8237  O3'  DT J  89     105.163 129.240 120.345  1.00 94.93           O  
ATOM   8238  C2'  DT J  89     104.030 127.480 121.563  1.00 94.93           C  
ATOM   8239  C1'  DT J  89     102.608 127.818 121.116  1.00 94.93           C  
ATOM   8240  N1   DT J  89     101.475 126.959 121.711  1.00 94.93           N  
ATOM   8241  C2   DT J  89     100.312 127.569 122.154  1.00 94.93           C  
ATOM   8242  O2   DT J  89     100.143 128.773 122.153  1.00 94.93           O  
ATOM   8243  N3   DT J  89      99.360 126.708 122.630  1.00 94.93           N  
ATOM   8244  C4   DT J  89      99.432 125.336 122.688  1.00 94.93           C  
ATOM   8245  O4   DT J  89      98.523 124.652 123.131  1.00 94.93           O  
ATOM   8246  C5   DT J  89     100.657 124.761 122.205  1.00 94.93           C  
ATOM   8247  C7   DT J  89     100.841 123.272 122.212  1.00 94.93           C  
ATOM   8248  C6   DT J  89     101.593 125.583 121.715  1.00 94.93           C  
ATOM   8249  H5'  DT J  89     103.672 126.173 117.720  1.00 94.93           H  
ATOM   8250 H5''  DT J  89     105.131 126.149 118.319  1.00 94.93           H  
ATOM   8251  H4'  DT J  89     104.057 128.269 118.514  1.00 94.93           H  
ATOM   8252  H3'  DT J  89     105.666 127.364 120.303  1.00 94.93           H  
ATOM   8253  H2'  DT J  89     104.137 126.535 121.732  1.00 94.93           H  
ATOM   8254 H2''  DT J  89     104.277 128.001 122.342  1.00 94.93           H  
ATOM   8255  H1'  DT J  89     102.437 128.752 121.313  1.00 94.93           H  
ATOM   8256  H3   DT J  89      98.639 127.062 122.924  1.00 94.93           H  
ATOM   8257  H71  DT J  89     100.234 122.873 122.853  1.00 94.93           H  
ATOM   8258  H72  DT J  89     100.655 122.918 121.330  1.00 94.93           H  
ATOM   8259  H73  DT J  89     101.756 123.060 122.458  1.00 94.93           H  
ATOM   8260  H6   DT J  89     102.386 125.209 121.404  1.00 94.93           H  
ATOM   8261  P    DT J  90     106.221 129.836 121.379  1.00 88.82           P  
ATOM   8262  OP1  DT J  90     107.029 130.758 120.560  1.00 88.82           O  
ATOM   8263  OP2  DT J  90     106.853 128.722 122.119  1.00 88.82           O  
ATOM   8264  O5'  DT J  90     105.308 130.650 122.400  1.00 88.82           O  
ATOM   8265  C5'  DT J  90     104.319 131.514 121.892  1.00 88.82           C  
ATOM   8266  C4'  DT J  90     103.379 131.987 122.981  1.00 88.82           C  
ATOM   8267  O4'  DT J  90     102.395 130.955 123.250  1.00 88.82           O  
ATOM   8268  C3'  DT J  90     104.047 132.309 124.323  1.00 88.82           C  
ATOM   8269  O3'  DT J  90     103.657 133.590 124.803  1.00 88.82           O  
ATOM   8270  C2'  DT J  90     103.569 131.190 125.228  1.00 88.82           C  
ATOM   8271  C1'  DT J  90     102.213 130.844 124.638  1.00 88.82           C  
ATOM   8272  N1   DT J  90     101.689 129.443 124.947  1.00 88.82           N  
ATOM   8273  C2   DT J  90     100.406 129.279 125.433  1.00 88.82           C  
ATOM   8274  O2   DT J  90      99.650 130.204 125.666  1.00 88.82           O  
ATOM   8275  N3   DT J  90     100.041 127.977 125.646  1.00 88.82           N  
ATOM   8276  C4   DT J  90     100.801 126.854 125.424  1.00 88.82           C  
ATOM   8277  O4   DT J  90     100.388 125.725 125.645  1.00 88.82           O  
ATOM   8278  C5   DT J  90     102.114 127.093 124.911  1.00 88.82           C  
ATOM   8279  C7   DT J  90     103.026 125.940 124.645  1.00 88.82           C  
ATOM   8280  C6   DT J  90     102.481 128.353 124.670  1.00 88.82           C  
ATOM   8281  H5'  DT J  90     103.807 131.047 121.220  1.00 88.82           H  
ATOM   8282 H5''  DT J  90     104.747 132.280 121.488  1.00 88.82           H  
ATOM   8283  H4'  DT J  90     102.918 132.768 122.668  1.00 88.82           H  
ATOM   8284  H3'  DT J  90     105.009 132.269 124.232  1.00 88.82           H  
ATOM   8285  H2'  DT J  90     104.177 130.440 125.179  1.00 88.82           H  
ATOM   8286 H2''  DT J  90     103.476 131.502 126.139  1.00 88.82           H  
ATOM   8287  H1'  DT J  90     101.566 131.505 124.927  1.00 88.82           H  
ATOM   8288  H3   DT J  90      99.254 127.848 125.954  1.00 88.82           H  
ATOM   8289  H71  DT J  90     103.661 126.180 123.961  1.00 88.82           H  
ATOM   8290  H72  DT J  90     103.502 125.713 125.459  1.00 88.82           H  
ATOM   8291  H73  DT J  90     102.506 125.177 124.354  1.00 88.82           H  
ATOM   8292  H6   DT J  90     103.342 128.507 124.359  1.00 88.82           H  
ATOM   8293  P  A DT J  91     103.972 134.372 126.169  0.50 91.91           P  
ATOM   8294  P  B DT J  91     104.078 134.354 126.171  0.50 91.91           P  
ATOM   8295  OP1A DT J  91     104.181 135.830 126.310  0.50 91.91           O  
ATOM   8296  OP1B DT J  91     104.413 135.796 126.160  0.50 91.91           O  
ATOM   8297  OP2A DT J  91     105.071 133.447 126.525  0.50 91.91           O  
ATOM   8298  OP2B DT J  91     105.130 133.379 126.537  0.50 91.91           O  
ATOM   8299  O5'A DT J  91     102.665 133.939 126.988  0.50 91.91           O  
ATOM   8300  O5'B DT J  91     102.813 134.111 127.125  0.50 91.91           O  
ATOM   8301  C5'A DT J  91     101.387 134.465 126.630  0.50 91.91           C  
ATOM   8302  C5'B DT J  91     101.551 134.697 126.805  0.50 91.91           C  
ATOM   8303  C4'A DT J  91     100.344 134.121 127.674  0.50 91.91           C  
ATOM   8304  C4'B DT J  91     100.476 134.271 127.795  0.50 91.91           C  
ATOM   8305  O4'A DT J  91     100.074 132.688 127.645  0.50 91.91           O  
ATOM   8306  O4'B DT J  91     100.268 132.831 127.702  0.50 91.91           O  
ATOM   8307  C3'A DT J  91     100.763 134.438 129.103  0.50 91.91           C  
ATOM   8308  C3'B DT J  91     100.805 134.553 129.261  0.50 91.91           C  
ATOM   8309  O3'A DT J  91      99.671 134.950 129.849  0.50 91.91           O  
ATOM   8310  O3'B DT J  91      99.686 135.117 129.931  0.50 91.91           O  
ATOM   8311  C2'A DT J  91     101.233 133.095 129.616  0.50 91.91           C  
ATOM   8312  C2'B DT J  91     101.175 133.184 129.804  0.50 91.91           C  
ATOM   8313  C1'A DT J  91     100.256 132.151 128.937  0.50 91.91           C  
ATOM   8314  C1'B DT J  91     100.273 132.275 128.997  0.50 91.91           C  
ATOM   8315  N1 A DT J  91     100.697 130.682 128.809  0.50 91.91           N  
ATOM   8316  N1 B DT J  91     100.710 130.809 128.906  0.50 91.91           N  
ATOM   8317  C2 A DT J  91      99.797 129.687 129.114  0.50 91.91           C  
ATOM   8318  C2 B DT J  91      99.831 129.817 129.285  0.50 91.91           C  
ATOM   8319  O2 A DT J  91      98.666 129.900 129.509  0.50 91.91           O  
ATOM   8320  O2 B DT J  91      98.717 130.034 129.721  0.50 91.91           O  
ATOM   8321  N3 A DT J  91     100.268 128.417 128.948  0.50 91.91           N  
ATOM   8322  N3 B DT J  91     100.309 128.544 129.141  0.50 91.91           N  
ATOM   8323  C4 A DT J  91     101.512 128.040 128.511  0.50 91.91           C  
ATOM   8324  C4 B DT J  91     101.535 128.163 128.662  0.50 91.91           C  
ATOM   8325  O4 A DT J  91     101.840 126.866 128.395  0.50 91.91           O  
ATOM   8326  O4 B DT J  91     101.871 126.988 128.572  0.50 91.91           O  
ATOM   8327  C5 A DT J  91     102.402 129.111 128.195  0.50 91.91           C  
ATOM   8328  C5 B DT J  91     102.400 129.230 128.271  0.50 91.91           C  
ATOM   8329  C7 A DT J  91     103.787 128.803 127.730  0.50 91.91           C  
ATOM   8330  C7 B DT J  91     103.768 128.911 127.765  0.50 91.91           C  
ATOM   8331  C6 A DT J  91     101.958 130.368 128.335  0.50 91.91           C  
ATOM   8332  C6 B DT J  91     101.956 130.491 128.400  0.50 91.91           C  
ATOM   8333  H5'A DT J  91     101.118 134.097 125.775  0.50 91.91           H  
ATOM   8334  H5'B DT J  91     101.289 134.420 125.913  0.50 91.91           H  
ATOM   8335 H5''A DT J  91     101.451 135.427 126.557  0.50 91.91           H  
ATOM   8336 H5''B DT J  91     101.635 135.662 126.825  0.50 91.91           H  
ATOM   8337  H4'A DT J  91      99.526 134.600 127.473  0.50 91.91           H  
ATOM   8338  H4'B DT J  91      99.648 134.721 127.570  0.50 91.91           H  
ATOM   8339  H3'A DT J  91     101.496 135.069 129.099  0.50 91.91           H  
ATOM   8340  H3'B DT J  91     101.565 135.150 129.320  0.50 91.91           H  
ATOM   8341  H2'A DT J  91     102.142 132.925 129.335  0.50 91.91           H  
ATOM   8342  H2'B DT J  91     102.105 132.993 129.631  0.50 91.91           H  
ATOM   8343 H2''A DT J  91     101.151 133.047 130.577  0.50 91.91           H  
ATOM   8344 H2''B DT J  91     100.973 133.120 130.749  0.50 91.91           H  
ATOM   8345  H1'A DT J  91      99.414 132.191 129.411  0.50 91.91           H  
ATOM   8346  H1'B DT J  91      99.379 132.324 129.361  0.50 91.91           H  
ATOM   8347  H3 A DT J  91      99.724 127.782 129.139  0.50 91.91           H  
ATOM   8348  H3 B DT J  91      99.781 127.911 129.375  0.50 91.91           H  
ATOM   8349  H71A DT J  91     104.173 129.584 127.322  0.50 91.91           H  
ATOM   8350  H71B DT J  91     104.169 129.699 127.391  0.50 91.91           H  
ATOM   8351  H72A DT J  91     104.327 128.540 128.490  0.50 91.91           H  
ATOM   8352  H72B DT J  91     104.313 128.597 128.503  0.50 91.91           H  
ATOM   8353  H73A DT J  91     103.760 128.079 127.092  0.50 91.91           H  
ATOM   8354  H73B DT J  91     103.714 128.221 127.096  0.50 91.91           H  
ATOM   8355  H6 A DT J  91     102.541 131.062 128.149  0.50 91.91           H  
ATOM   8356  H6 B DT J  91     102.521 131.183 128.156  0.50 91.91           H  
ATOM   8357  P  A DT J  92      99.910 136.031 130.994  0.50 96.32           P  
ATOM   8358  P  B DT J  92      99.858 135.779 131.375  0.50 96.32           P  
ATOM   8359  OP1A DT J  92      99.191 137.260 130.594  0.50 96.32           O  
ATOM   8360  OP1B DT J  92      98.998 136.981 131.417  0.50 96.32           O  
ATOM   8361  OP2A DT J  92     101.354 136.090 131.313  0.50 96.32           O  
ATOM   8362  OP2B DT J  92     101.302 135.894 131.670  0.50 96.32           O  
ATOM   8363  O5'A DT J  92      99.187 135.397 132.265  0.50 96.32           O  
ATOM   8364  O5'B DT J  92      99.254 134.687 132.371  0.50 96.32           O  
ATOM   8365  C5'A DT J  92      97.815 135.044 132.200  0.50 96.32           C  
ATOM   8366  C5'B DT J  92      97.868 134.394 132.341  0.50 96.32           C  
ATOM   8367  C4'A DT J  92      97.521 133.845 133.080  0.50 96.32           C  
ATOM   8368  C4'B DT J  92      97.516 133.346 133.376  0.50 96.32           C  
ATOM   8369  O4'A DT J  92      98.101 132.664 132.490  0.50 96.32           O  
ATOM   8370  O4'B DT J  92      98.001 132.052 132.931  0.50 96.32           O  
ATOM   8371  C3'A DT J  92      98.097 133.921 134.496  0.50 96.32           C  
ATOM   8372  C3'B DT J  92      98.124 133.581 134.759  0.50 96.32           C  
ATOM   8373  O3'A DT J  92      97.073 134.211 135.437  0.50 96.32           O  
ATOM   8374  O3'B DT J  92      97.130 133.452 135.760  0.50 96.32           O  
ATOM   8375  C2'A DT J  92      98.730 132.542 134.730  0.50 96.32           C  
ATOM   8376  C2'B DT J  92      99.212 132.513 134.864  0.50 96.32           C  
ATOM   8377  C1'A DT J  92      98.316 131.729 133.509  0.50 96.32           C  
ATOM   8378  C1'B DT J  92      98.648 131.401 133.996  0.50 96.32           C  
ATOM   8379  N1 A DT J  92      99.345 130.711 133.035  0.50 96.32           N  
ATOM   8380  N1 B DT J  92      99.661 130.419 133.414  0.50 96.32           N  
ATOM   8381  C2 A DT J  92      99.035 129.366 133.053  0.50 96.32           C  
ATOM   8382  C2 B DT J  92      99.408 129.070 133.497  0.50 96.32           C  
ATOM   8383  O2 A DT J  92      97.985 128.923 133.482  0.50 96.32           O  
ATOM   8384  O2 B DT J  92      98.429 128.600 134.049  0.50 96.32           O  
ATOM   8385  N3 A DT J  92     100.034 128.544 132.609  0.50 96.32           N  
ATOM   8386  N3 B DT J  92     100.361 128.273 132.934  0.50 96.32           N  
ATOM   8387  C4 A DT J  92     101.269 128.914 132.125  0.50 96.32           C  
ATOM   8388  C4 B DT J  92     101.506 128.669 132.287  0.50 96.32           C  
ATOM   8389  O4 A DT J  92     102.092 128.095 131.736  0.50 96.32           O  
ATOM   8390  O4 B DT J  92     102.299 127.868 131.809  0.50 96.32           O  
ATOM   8391  C5 A DT J  92     101.523 130.327 132.101  0.50 96.32           C  
ATOM   8392  C5 B DT J  92     101.710 130.081 132.212  0.50 96.32           C  
ATOM   8393  C7 A DT J  92     102.847 130.837 131.620  0.50 96.32           C  
ATOM   8394  C7 B DT J  92     102.936 130.608 131.545  0.50 96.32           C  
ATOM   8395  C6 A DT J  92     100.563 131.150 132.552  0.50 96.32           C  
ATOM   8396  C6 B DT J  92     100.789 130.887 132.762  0.50 96.32           C  
ATOM   8397  H5'A DT J  92      97.586 134.829 131.283  0.50 96.32           H  
ATOM   8398  H5'B DT J  92      97.632 134.064 131.461  0.50 96.32           H  
ATOM   8399 H5''A DT J  92      97.278 135.795 132.495  0.50 96.32           H  
ATOM   8400 H5''B DT J  92      97.367 135.203 132.525  0.50 96.32           H  
ATOM   8401  H4'A DT J  92      96.561 133.726 133.139  0.50 96.32           H  
ATOM   8402  H4'B DT J  92      96.551 133.305 133.463  0.50 96.32           H  
ATOM   8403  H3'A DT J  92      98.780 134.604 134.538  0.50 96.32           H  
ATOM   8404  H3'B DT J  92      98.521 134.463 134.798  0.50 96.32           H  
ATOM   8405  H2'A DT J  92      99.694 132.617 134.781  0.50 96.32           H  
ATOM   8406  H2'B DT J  92     100.049 132.847 134.514  0.50 96.32           H  
ATOM   8407 H2''A DT J  92      98.377 132.141 135.536  0.50 96.32           H  
ATOM   8408 H2''B DT J  92      99.314 132.215 135.779  0.50 96.32           H  
ATOM   8409  H1'A DT J  92      97.482 131.279 133.702  0.50 96.32           H  
ATOM   8410  H1'B DT J  92      97.989 130.916 134.510  0.50 96.32           H  
ATOM   8411  H3 A DT J  92      99.872 127.702 132.631  0.50 96.32           H  
ATOM   8412  H3 B DT J  92     100.228 127.427 132.984  0.50 96.32           H  
ATOM   8413  H71A DT J  92     103.480 130.106 131.577  0.50 96.32           H  
ATOM   8414  H71B DT J  92     102.749 131.461 131.156  0.50 96.32           H  
ATOM   8415  H72A DT J  92     102.755 131.224 130.761  0.50 96.32           H  
ATOM   8416  H72B DT J  92     103.642 130.702 132.202  0.50 96.32           H  
ATOM   8417  H73A DT J  92     103.174 131.507 132.240  0.50 96.32           H  
ATOM   8418  H73B DT J  92     103.219 129.991 130.857  0.50 96.32           H  
ATOM   8419  H6 A DT J  92     100.727 132.064 132.539  0.50 96.32           H  
ATOM   8420  H6 B DT J  92     100.923 131.803 132.717  0.50 96.32           H  
ATOM   8421  P  A DG J  93      97.440 134.468 136.974  0.50 98.65           P  
ATOM   8422  P  B DG J  93      97.450 133.822 137.255  0.50 98.65           P  
ATOM   8423  OP1A DG J  93      96.375 135.313 137.556  0.50 98.65           O  
ATOM   8424  OP1B DG J  93      96.325 134.628 137.777  0.50 98.65           O  
ATOM   8425  OP2A DG J  93      98.850 134.910 137.042  0.50 98.65           O  
ATOM   8426  OP2B DG J  93      98.829 134.353 137.312  0.50 98.65           O  
ATOM   8427  O5'A DG J  93      97.355 133.015 137.626  0.50 98.65           O  
ATOM   8428  O5'B DG J  93      97.446 132.410 137.989  0.50 98.65           O  
ATOM   8429  C5'A DG J  93      96.173 132.248 137.474  0.50 98.65           C  
ATOM   8430  C5'B DG J  93      96.326 131.552 137.857  0.50 98.65           C  
ATOM   8431  C4'A DG J  93      96.416 130.790 137.815  0.50 98.65           C  
ATOM   8432  C4'B DG J  93      96.609 130.198 138.474  0.50 98.65           C  
ATOM   8433  O4'A DG J  93      97.277 130.198 136.822  0.50 98.65           O  
ATOM   8434  O4'B DG J  93      97.428 129.422 137.558  0.50 98.65           O  
ATOM   8435  C3'A DG J  93      97.103 130.550 139.159  0.50 98.65           C  
ATOM   8436  C3'B DG J  93      97.370 130.253 139.803  0.50 98.65           C  
ATOM   8437  O3'A DG J  93      96.160 130.067 140.115  0.50 98.65           O  
ATOM   8438  O3'B DG J  93      96.722 129.459 140.795  0.50 98.65           O  
ATOM   8439  C2'A DG J  93      98.214 129.530 138.857  0.50 98.65           C  
ATOM   8440  C2'B DG J  93      98.759 129.732 139.455  0.50 98.65           C  
ATOM   8441  C1'A DG J  93      97.969 129.125 137.407  0.50 98.65           C  
ATOM   8442  C1'B DG J  93      98.496 128.831 138.257  0.50 98.65           C  
ATOM   8443  N9 A DG J  93      99.189 128.882 136.631  0.50 98.65           N  
ATOM   8444  N9 B DG J  93      99.636 128.679 137.342  0.50 98.65           N  
ATOM   8445  C8 A DG J  93     100.021 129.832 136.091  0.50 98.65           C  
ATOM   8446  C8 B DG J  93     100.356 129.679 136.730  0.50 98.65           C  
ATOM   8447  N7 A DG J  93     101.023 129.331 135.426  0.50 98.65           N  
ATOM   8448  N7 B DG J  93     101.314 129.237 135.962  0.50 98.65           N  
ATOM   8449  C5 A DG J  93     100.862 127.959 135.548  0.50 98.65           C  
ATOM   8450  C5 B DG J  93     101.221 127.856 136.065  0.50 98.65           C  
ATOM   8451  C6 A DG J  93     101.645 126.904 135.025  0.50 98.65           C  
ATOM   8452  C6 B DG J  93     101.991 126.842 135.448  0.50 98.65           C  
ATOM   8453  O6 A DG J  93     102.685 126.983 134.359  0.50 98.65           O  
ATOM   8454  O6 B DG J  93     102.942 126.969 134.668  0.50 98.65           O  
ATOM   8455  N1 A DG J  93     101.144 125.656 135.388  0.50 98.65           N  
ATOM   8456  N1 B DG J  93     101.566 125.568 135.822  0.50 98.65           N  
ATOM   8457  C2 A DG J  93     100.009 125.453 136.136  0.50 98.65           C  
ATOM   8458  C2 B DG J  93     100.524 125.308 136.680  0.50 98.65           C  
ATOM   8459  N2 A DG J  93      99.670 124.175 136.372  0.50 98.65           N  
ATOM   8460  N2 B DG J  93     100.254 124.015 136.926  0.50 98.65           N  
ATOM   8461  N3 A DG J  93      99.253 126.437 136.620  0.50 98.65           N  
ATOM   8462  N3 B DG J  93      99.793 126.251 137.262  0.50 98.65           N  
ATOM   8463  C4 A DG J  93      99.737 127.661 136.284  0.50 98.65           C  
ATOM   8464  C4 B DG J  93     100.195 127.496 136.909  0.50 98.65           C  
ATOM   8465  H5'A DG J  93      95.869 132.312 136.556  0.50 98.65           H  
ATOM   8466  H5'B DG J  93      96.122 131.437 136.917  0.50 98.65           H  
ATOM   8467 H5''A DG J  93      95.488 132.601 138.061  0.50 98.65           H  
ATOM   8468 H5''B DG J  93      95.563 131.952 138.302  0.50 98.65           H  
ATOM   8469  H4'A DG J  93      95.566 130.324 137.812  0.50 98.65           H  
ATOM   8470  H4'B DG J  93      95.769 129.734 138.613  0.50 98.65           H  
ATOM   8471  H3'A DG J  93      97.496 131.376 139.477  0.50 98.65           H  
ATOM   8472  H3'B DG J  93      97.430 131.170 140.106  0.50 98.65           H  
ATOM   8473  H2'A DG J  93      99.086 129.944 138.949  0.50 98.65           H  
ATOM   8474  H2'B DG J  93      99.347 130.464 139.216  0.50 98.65           H  
ATOM   8475 H2''A DG J  93      98.138 128.761 139.443  0.50 98.65           H  
ATOM   8476 H2''B DG J  93      99.122 129.224 140.193  0.50 98.65           H  
ATOM   8477  H1'A DG J  93      97.411 128.333 137.386  0.50 98.65           H  
ATOM   8478  H1'B DG J  93      98.222 127.956 138.574  0.50 98.65           H  
ATOM   8479  H8 A DG J  93      99.866 130.741 136.164  0.50 98.65           H  
ATOM   8480  H8 B DG J  93     100.182 130.581 136.856  0.50 98.65           H  
ATOM   8481  H1 A DG J  93     101.572 124.960 135.116  0.50 98.65           H  
ATOM   8482  H1 B DG J  93     101.987 124.894 135.491  0.50 98.65           H  
ATOM   8483  H21A DG J  93      99.069 123.990 136.958  0.50 98.65           H  
ATOM   8484  H21B DG J  93      99.691 123.803 137.541  0.50 98.65           H  
ATOM   8485  H22A DG J  93     100.047 123.541 135.927  0.50 98.65           H  
ATOM   8486  H22B DG J  93     100.640 123.400 136.465  0.50 98.65           H  
ATOM   8487  P  A DA J  94      96.563 129.919 141.652  0.50 97.57           P  
ATOM   8488  P  B DA J  94      97.010 129.715 142.370  0.50 97.57           P  
ATOM   8489  OP1A DA J  94      95.337 130.121 142.456  0.50 97.57           O  
ATOM   8490  OP1B DA J  94      95.748 129.452 143.095  0.50 97.57           O  
ATOM   8491  OP2A DA J  94      97.739 130.780 141.905  0.50 97.57           O  
ATOM   8492  OP2B DA J  94      97.690 131.017 142.540  0.50 97.57           O  
ATOM   8493  O5'A DA J  94      96.997 128.386 141.772  0.50 97.57           O  
ATOM   8494  O5'B DA J  94      98.063 128.580 142.751  0.50 97.57           O  
ATOM   8495  C5'A DA J  94      98.224 128.036 142.379  0.50 97.57           C  
ATOM   8496  C5'B DA J  94      97.669 127.221 142.732  0.50 97.57           C  
ATOM   8497  C4'A DA J  94      98.624 126.625 142.010  0.50 97.57           C  
ATOM   8498  C4'B DA J  94      98.870 126.310 142.615  0.50 97.57           C  
ATOM   8499  O4'A DA J  94      99.068 126.616 140.635  0.50 97.57           O  
ATOM   8500  O4'B DA J  94      99.529 126.540 141.356  0.50 97.57           O  
ATOM   8501  C3'A DA J  94      99.756 126.063 142.854  0.50 97.57           C  
ATOM   8502  C3'B DA J  94      99.944 126.530 143.671  0.50 97.57           C  
ATOM   8503  O3'A DA J  94      99.271 125.040 143.721  0.50 97.57           O  
ATOM   8504  O3'B DA J  94      99.747 125.651 144.776  0.50 97.57           O  
ATOM   8505  C2'A DA J  94     100.790 125.531 141.856  0.50 97.57           C  
ATOM   8506  C2'B DA J  94     101.263 126.259 142.928  0.50 97.57           C  
ATOM   8507  C1'A DA J  94     100.240 125.848 140.476  0.50 97.57           C  
ATOM   8508  C1'B DA J  94     100.854 126.080 141.458  0.50 97.57           C  
ATOM   8509  N9 A DA J  94     101.163 126.601 139.611  0.50 97.57           N  
ATOM   8510  N9 B DA J  94     101.697 126.823 140.509  0.50 97.57           N  
ATOM   8511  C8 A DA J  94     101.121 127.939 139.341  0.50 97.57           C  
ATOM   8512  C8 B DA J  94     101.723 128.174 140.312  0.50 97.57           C  
ATOM   8513  N7 A DA J  94     102.045 128.343 138.505  0.50 97.57           N  
ATOM   8514  N7 B DA J  94     102.576 128.561 139.396  0.50 97.57           N  
ATOM   8515  C5 A DA J  94     102.746 127.194 138.203  0.50 97.57           C  
ATOM   8516  C5 B DA J  94     103.155 127.386 138.965  0.50 97.57           C  
ATOM   8517  C6 A DA J  94     103.860 126.956 137.376  0.50 97.57           C  
ATOM   8518  C6 B DA J  94     104.146 127.116 138.004  0.50 97.57           C  
ATOM   8519  N6 A DA J  94     104.452 127.905 136.663  0.50 97.57           N  
ATOM   8520  N6 B DA J  94     104.734 128.056 137.277  0.50 97.57           N  
ATOM   8521  N1 A DA J  94     104.311 125.696 137.273  0.50 97.57           N  
ATOM   8522  N1 B DA J  94     104.501 125.837 137.808  0.50 97.57           N  
ATOM   8523  C2 A DA J  94     103.694 124.740 137.981  0.50 97.57           C  
ATOM   8524  C2 B DA J  94     103.901 124.889 138.537  0.50 97.57           C  
ATOM   8525  N3 A DA J  94     102.647 124.843 138.801  0.50 97.57           N  
ATOM   8526  N3 B DA J  94     102.960 125.019 139.472  0.50 97.57           N  
ATOM   8527  C4 A DA J  94     102.214 126.108 138.866  0.50 97.57           C  
ATOM   8528  C4 B DA J  94     102.629 126.305 139.639  0.50 97.57           C  
ATOM   8529  H5'A DA J  94      98.137 128.103 143.341  0.50 97.57           H  
ATOM   8530  H5'B DA J  94      97.081 127.070 141.977  0.50 97.57           H  
ATOM   8531 H5''A DA J  94      98.914 128.645 142.079  0.50 97.57           H  
ATOM   8532 H5''B DA J  94      97.194 127.016 143.552  0.50 97.57           H  
ATOM   8533  H4'A DA J  94      97.851 126.045 142.094  0.50 97.57           H  
ATOM   8534  H4'B DA J  94      98.573 125.387 142.653  0.50 97.57           H  
ATOM   8535  H3'A DA J  94     100.150 126.775 143.381  0.50 97.57           H  
ATOM   8536  H3'B DA J  94      99.921 127.450 143.976  0.50 97.57           H  
ATOM   8537  H2'A DA J  94     101.642 125.973 141.987  0.50 97.57           H  
ATOM   8538  H2'B DA J  94     101.863 127.014 143.023  0.50 97.57           H  
ATOM   8539 H2''A DA J  94     100.886 124.575 141.957  0.50 97.57           H  
ATOM   8540 H2''B DA J  94     101.679 125.450 143.265  0.50 97.57           H  
ATOM   8541  H1'A DA J  94     100.007 125.014 140.034  0.50 97.57           H  
ATOM   8542  H1'B DA J  94     100.879 125.137 141.234  0.50 97.57           H  
ATOM   8543  H8 A DA J  94     100.494 128.509 139.716  0.50 97.57           H  
ATOM   8544  H8 B DA J  94     101.180 128.765 140.780  0.50 97.57           H  
ATOM   8545  H61A DA J  94     104.787 127.719 135.897  0.50 97.57           H  
ATOM   8546  H61B DA J  94     104.885 127.920 136.444  0.50 97.57           H  
ATOM   8547  H62A DA J  94     104.478 128.710 136.960  0.50 97.57           H  
ATOM   8548  H62B DA J  94     104.942 128.807 137.636  0.50 97.57           H  
ATOM   8549  H2 A DA J  94     104.045 123.887 137.888  0.50 97.57           H  
ATOM   8550  H2 B DA J  94     104.179 124.020 138.369  0.50 97.57           H  
HETATM 8551  P  AT64 J  95      99.761 124.658 145.208  0.50 95.50           P  
HETATM 8552  N1 AT64 J  95     104.809 125.271 142.761  0.50 95.50           N  
HETATM 8553  C2 AT64 J  95     105.187 126.196 141.629  0.50 95.50           C  
HETATM 8554  O2 AT64 J  95     104.717 126.044 140.556  0.50 95.50           O  
HETATM 8555  N3 AT64 J  95     106.189 127.338 141.812  0.50 95.50           N  
HETATM 8556  C4 AT64 J  95     106.837 127.600 143.109  0.50 95.50           C  
HETATM 8557  O4 AT64 J  95     107.603 128.490 143.257  0.50 95.50           O  
HETATM 8558  C5 AT64 J  95     106.408 126.732 144.272  0.50 95.50           C  
HETATM 8559  C6 AT64 J  95     105.479 125.522 144.057  0.50 95.50           C  
HETATM 8560  PB AT64 J  95     103.500 119.695 144.470  0.50 95.50           P  
HETATM 8561  C1'AT64 J  95     103.780 124.190 142.525  0.50 95.50           C  
HETATM 8562  C1RAT64 J  95     108.398 120.211 143.834  0.50 95.50           C  
HETATM 8563  N1TAT64 J  95     107.713 121.448 143.922  0.50 95.50           N  
HETATM 8564  C2'AT64 J  95     104.045 122.734 142.378  0.50 95.50           C  
HETATM 8565  C2RAT64 J  95     109.111 119.909 145.107  0.50 95.50           C  
HETATM 8566  C2TAT64 J  95     107.762 122.476 142.816  0.50 95.50           C  
HETATM 8567  O2TAT64 J  95     108.393 122.256 141.837  0.50 95.50           O  
HETATM 8568  C3'AT64 J  95     108.215 118.989 145.877  0.50 95.50           C  
HETATM 8569  O3'AT64 J  95     108.990 117.927 146.368  0.50 95.50           O  
HETATM 8570  C3RAT64 J  95     103.423 122.069 143.545  0.50 95.50           C  
HETATM 8571  O3RAT64 J  95     103.001 120.760 143.266  0.50 95.50           O  
HETATM 8572  N3TAT64 J  95     107.036 123.759 142.913  0.50 95.50           N  
HETATM 8573  C4'AT64 J  95     107.166 118.505 144.879  0.50 95.50           C  
HETATM 8574  O4'AT64 J  95     102.830 124.318 143.613  0.50 95.50           O  
HETATM 8575  O4PAT64 J  95     103.286 120.326 145.825  0.50 95.50           O  
HETATM 8576  C4RAT64 J  95     102.257 123.011 143.847  0.50 95.50           C  
HETATM 8577  O4RAT64 J  95     107.460 119.136 143.649  0.50 95.50           O  
HETATM 8578  C4TAT64 J  95     106.282 124.133 144.072  0.50 95.50           C  
HETATM 8579  O4TAT64 J  95     107.609 126.043 144.058  0.50 95.50           O  
HETATM 8580  C5'AT64 J  95     101.757 122.945 145.230  0.50 95.50           C  
HETATM 8581  O5'AT64 J  95     101.306 124.221 145.586  0.50 95.50           O  
HETATM 8582  C5AAT64 J  95     107.040 126.950 145.747  0.50 95.50           C  
HETATM 8583  C5MAT64 J  95     105.308 123.539 146.413  0.50 95.50           C  
HETATM 8584  O5PAT64 J  95     102.787 118.366 144.531  0.50 95.50           O  
HETATM 8585  C5RAT64 J  95     105.728 118.829 145.235  0.50 95.50           C  
HETATM 8586  O5RAT64 J  95     105.144 119.633 144.226  0.50 95.50           O  
HETATM 8587  C5TAT64 J  95     106.158 123.208 145.186  0.50 95.50           C  
HETATM 8588  C6TAT64 J  95     106.841 121.897 145.128  0.50 95.50           C  
HETATM 8589  OP1AT64 J  95      98.795 123.672 145.821  0.50 95.50           O  
HETATM 8590  OP2AT64 J  95      99.483 126.045 145.742  0.50 95.50           O  
HETATM 8591  HN3AT64 J  95     106.383 127.835 141.140  0.50 95.50           H  
HETATM 8592  H6 AT64 J  95     104.806 125.516 144.749  0.50 95.50           H  
HETATM 8593  H1'AT64 J  95     103.320 124.431 141.713  0.50 95.50           H  
HETATM 8594  H1RAT64 J  95     109.035 120.216 143.104  0.50 95.50           H  
HETATM 8595  H2'AT64 J  95     104.970 122.503 142.316  0.50 95.50           H  
HETATM 8596 H2'AAT64 J  95     103.596 122.426 141.578  0.50 95.50           H  
HETATM 8597  H2RAT64 J  95     109.929 119.460 144.878  0.50 95.50           H  
HETATM 8598 H2RAAT64 J  95     109.297 120.716 145.611  0.50 95.50           H  
HETATM 8599  H3'AT64 J  95     107.820 119.466 146.620  0.50 95.50           H  
HETATM 8600  H3RAT64 J  95     104.019 122.038 144.283  0.50 95.50           H  
HETATM 8601  H4'AT64 J  95     107.261 117.547 144.769  0.50 95.50           H  
HETATM 8602  H4RAT64 J  95     101.536 122.827 143.228  0.50 95.50           H  
HETATM 8603 HO4TAT64 J  95     108.288 126.554 144.105  0.50 95.50           H  
HETATM 8604  H5'AT64 J  95     102.465 122.674 145.833  0.50 95.50           H  
HETATM 8605 H5'AAT64 J  95     101.024 122.313 145.282  0.50 95.50           H  
HETATM 8606  H5AAT64 J  95     107.639 127.713 145.739  0.50 95.50           H  
HETATM 8607 H5AAAT64 J  95     107.519 126.156 146.032  0.50 95.50           H  
HETATM 8608 H5ABAT64 J  95     106.319 127.130 146.370  0.50 95.50           H  
HETATM 8609  H5MAT64 J  95     105.195 122.738 146.949  0.50 95.50           H  
HETATM 8610 H5MAAT64 J  95     105.744 124.225 146.941  0.50 95.50           H  
HETATM 8611 H5MBAT64 J  95     104.437 123.851 146.125  0.50 95.50           H  
HETATM 8612  H5RAT64 J  95     105.664 119.298 146.079  0.50 95.50           H  
HETATM 8613 H5RAAT64 J  95     105.229 118.001 145.299  0.50 95.50           H  
HETATM 8614  H6TAT64 J  95     106.749 121.337 145.858  0.50 95.50           H  
ATOM   8615  P  B DT J  95     100.686 125.750 146.071  0.50 95.50           P  
ATOM   8616  OP1B DT J  95      99.913 125.245 147.227  0.50 95.50           O  
ATOM   8617  OP2B DT J  95     101.263 127.111 146.113  0.50 95.50           O  
ATOM   8618  O5'B DT J  95     101.867 124.718 145.762  0.50 95.50           O  
ATOM   8619  C5'B DT J  95     101.557 123.382 145.374  0.50 95.50           C  
ATOM   8620  C4'B DT J  95     102.766 122.704 144.758  0.50 95.50           C  
ATOM   8621  O4'B DT J  95     103.181 123.435 143.588  0.50 95.50           O  
ATOM   8622  C3'B DT J  95     103.989 122.628 145.670  0.50 95.50           C  
ATOM   8623  O3'B DT J  95     104.243 121.282 146.022  0.50 95.50           O  
ATOM   8624  C2'B DT J  95     105.137 123.228 144.843  0.50 95.50           C  
ATOM   8625  C1'B DT J  95     104.564 123.298 143.435  0.50 95.50           C  
ATOM   8626  N1 B DT J  95     105.062 124.463 142.663  0.50 95.50           N  
ATOM   8627  C2 B DT J  95     106.015 124.268 141.700  0.50 95.50           C  
ATOM   8628  O2 B DT J  95     106.479 123.177 141.433  0.50 95.50           O  
ATOM   8629  N3 B DT J  95     106.409 125.401 141.050  0.50 95.50           N  
ATOM   8630  C4 B DT J  95     105.956 126.685 141.263  0.50 95.50           C  
ATOM   8631  O4 B DT J  95     106.376 127.643 140.622  0.50 95.50           O  
ATOM   8632  C5 B DT J  95     104.957 126.822 142.290  0.50 95.50           C  
ATOM   8633  C7 B DT J  95     104.390 128.170 142.611  0.50 95.50           C  
ATOM   8634  C6 B DT J  95     104.564 125.717 142.934  0.50 95.50           C  
ATOM   8635  P  B DG J  96     104.727 119.917 146.666  0.50 95.63           P  
ATOM   8636  OP1B DG J  96     103.825 118.870 146.141  0.50 95.63           O  
ATOM   8637  OP2B DG J  96     104.690 120.288 148.098  0.50 95.63           O  
ATOM   8638  O5'B DG J  96     106.232 119.536 146.294  0.50 95.63           O  
ATOM   8639  C5'B DG J  96     106.852 120.140 145.177  0.50 95.63           C  
ATOM   8640  C4'B DG J  96     107.993 121.051 145.603  0.50 95.63           C  
ATOM   8641  O4'B DG J  96     108.020 122.215 144.758  0.50 95.63           O  
ATOM   8642  C3'B DG J  96     107.918 121.622 147.031  0.50 95.63           C  
ATOM   8643  O3'B DG J  96     108.738 120.867 147.922  0.50 95.63           O  
ATOM   8644  C2'B DG J  96     108.407 123.080 146.880  0.50 95.63           C  
ATOM   8645  C1'B DG J  96     108.826 123.153 145.407  0.50 95.63           C  
ATOM   8646  N9 B DG J  96     108.691 124.454 144.748  0.50 95.63           N  
ATOM   8647  C8 B DG J  96     107.812 125.478 145.027  0.50 95.63           C  
ATOM   8648  N7 B DG J  96     107.947 126.503 144.240  0.50 95.63           N  
ATOM   8649  C5 B DG J  96     108.972 126.134 143.384  0.50 95.63           C  
ATOM   8650  C6 B DG J  96     109.561 126.836 142.313  0.50 95.63           C  
ATOM   8651  O6 B DG J  96     109.286 127.966 141.894  0.50 95.63           O  
ATOM   8652  N1 B DG J  96     110.572 126.094 141.704  0.50 95.63           N  
ATOM   8653  C2 B DG J  96     110.959 124.831 142.084  0.50 95.63           C  
ATOM   8654  N2 B DG J  96     111.954 124.267 141.380  0.50 95.63           N  
ATOM   8655  N3 B DG J  96     110.416 124.169 143.088  0.50 95.63           N  
ATOM   8656  C4 B DG J  96     109.433 124.878 143.687  0.50 95.63           C  
ATOM   8657  H5'B DG J  96     106.197 120.656 144.688  0.50 95.63           H  
ATOM   8658 H5''B DG J  96     107.203 119.446 144.598  0.50 95.63           H  
ATOM   8659  H4'B DG J  96     108.829 120.571 145.501  0.50 95.63           H  
ATOM   8660  H3'B DG J  96     107.000 121.617 147.342  0.50 95.63           H  
ATOM   8661  H2'B DG J  96     107.688 123.696 147.075  0.50 95.63           H  
ATOM   8662 H2''B DG J  96     109.166 123.248 147.459  0.50 95.63           H  
ATOM   8663  H1'B DG J  96     109.740 122.865 145.327  0.50 95.63           H  
ATOM   8664  H8 B DG J  96     107.191 125.443 145.715  0.50 95.63           H  
ATOM   8665  H21B DG J  96     112.355 123.570 141.686  0.50 95.63           H  
ATOM   8666  P  A DG J  97     110.093 118.189 147.497  0.50 95.18           P  
ATOM   8667  P  B DG J  97     109.853 119.917 148.586  0.50 95.18           P  
ATOM   8668  OP1A DG J  97     110.704 116.875 147.784  0.50 95.18           O  
ATOM   8669  OP1B DG J  97     109.381 118.529 148.388  0.50 95.18           O  
ATOM   8670  OP2A DG J  97     109.360 118.897 148.569  0.50 95.18           O  
ATOM   8671  OP2B DG J  97     110.165 120.398 149.950  0.50 95.18           O  
ATOM   8672  O5'A DG J  97     111.246 119.179 146.995  0.50 95.18           O  
ATOM   8673  O5'B DG J  97     111.143 120.157 147.671  0.50 95.18           O  
ATOM   8674  C5'A DG J  97     112.266 118.712 146.112  0.50 95.18           C  
ATOM   8675  C5'B DG J  97     111.435 119.257 146.610  0.50 95.18           C  
ATOM   8676  C4'A DG J  97     113.239 119.820 145.783  0.50 95.18           C  
ATOM   8677  C4'B DG J  97     112.654 119.707 145.828  0.50 95.18           C  
ATOM   8678  O4'A DG J  97     112.514 121.044 145.430  0.50 95.18           O  
ATOM   8679  O4'B DG J  97     112.404 121.022 145.258  0.50 95.18           O  
ATOM   8680  C3'A DG J  97     114.163 120.208 146.954  0.50 95.18           C  
ATOM   8681  C3'B DG J  97     113.929 119.837 146.654  0.50 95.18           C  
ATOM   8682  O3'A DG J  97     115.520 120.283 146.558  0.50 95.18           O  
ATOM   8683  O3'B DG J  97     115.047 119.346 145.921  0.50 95.18           O  
ATOM   8684  C2'A DG J  97     113.639 121.574 147.334  0.50 95.18           C  
ATOM   8685  C2'B DG J  97     114.010 121.331 146.930  0.50 95.18           C  
ATOM   8686  C1'A DG J  97     113.264 122.092 145.965  0.50 95.18           C  
ATOM   8687  C1'B DG J  97     113.408 121.926 145.668  0.50 95.18           C  
ATOM   8688  N9 A DG J  97     112.545 123.364 145.981  0.50 95.18           N  
ATOM   8689  N9 B DG J  97     112.798 123.249 145.839  0.50 95.18           N  
ATOM   8690  C8 A DG J  97     111.567 123.766 146.858  0.50 95.18           C  
ATOM   8691  C8 B DG J  97     111.876 123.623 146.784  0.50 95.18           C  
ATOM   8692  N7 A DG J  97     111.168 124.990 146.664  0.50 95.18           N  
ATOM   8693  N7 B DG J  97     111.489 124.862 146.676  0.50 95.18           N  
ATOM   8694  C5 A DG J  97     111.948 125.437 145.609  0.50 95.18           C  
ATOM   8695  C5 B DG J  97     112.213 125.349 145.602  0.50 95.18           C  
ATOM   8696  C6 A DG J  97     111.965 126.686 144.961  0.50 95.18           C  
ATOM   8697  C6 B DG J  97     112.222 126.635 145.026  0.50 95.18           C  
ATOM   8698  O6 A DG J  97     111.269 127.674 145.201  0.50 95.18           O  
ATOM   8699  O6 B DG J  97     111.571 127.630 145.366  0.50 95.18           O  
ATOM   8700  N1 A DG J  97     112.909 126.729 143.937  0.50 95.18           N  
ATOM   8701  N1 B DG J  97     113.099 126.712 143.949  0.50 95.18           N  
ATOM   8702  C2 A DG J  97     113.733 125.690 143.587  0.50 95.18           C  
ATOM   8703  C2 B DG J  97     113.872 125.673 143.491  0.50 95.18           C  
ATOM   8704  N2 A DG J  97     114.583 125.912 142.570  0.50 95.18           N  
ATOM   8705  N2 B DG J  97     114.654 125.927 142.436  0.50 95.18           N  
ATOM   8706  N3 A DG J  97     113.726 124.511 144.190  0.50 95.18           N  
ATOM   8707  N3 B DG J  97     113.868 124.459 144.022  0.50 95.18           N  
ATOM   8708  C4 A DG J  97     112.810 124.457 145.188  0.50 95.18           C  
ATOM   8709  C4 B DG J  97     113.019 124.370 145.070  0.50 95.18           C  
ATOM   8710  H5'A DG J  97     111.864 118.388 145.295  0.50 95.18           H  
ATOM   8711  H5'B DG J  97     110.674 119.212 146.012  0.50 95.18           H  
ATOM   8712 H5''A DG J  97     112.747 117.986 146.539  0.50 95.18           H  
ATOM   8713 H5''B DG J  97     111.602 118.375 146.979  0.50 95.18           H  
ATOM   8714  H4'A DG J  97     113.780 119.553 145.027  0.50 95.18           H  
ATOM   8715  H4'B DG J  97     112.814 119.081 145.108  0.50 95.18           H  
ATOM   8716  H3'A DG J  97     114.056 119.587 147.690  0.50 95.18           H  
ATOM   8717  H3'B DG J  97     113.836 119.350 147.486  0.50 95.18           H  
ATOM   8718  H2'A DG J  97     112.863 121.500 147.909  0.50 95.18           H  
ATOM   8719  H2'B DG J  97     113.485 121.561 147.710  0.50 95.18           H  
ATOM   8720 H2''A DG J  97     114.331 122.114 147.741  0.50 95.18           H  
ATOM   8721 H2''B DG J  97     114.925 121.610 147.038  0.50 95.18           H  
ATOM   8722  H1'A DG J  97     114.072 122.194 145.440  0.50 95.18           H  
ATOM   8723  H1'B DG J  97     114.090 121.973 144.983  0.50 95.18           H  
ATOM   8724  H8 A DG J  97     111.215 123.214 147.516  0.50 95.18           H  
ATOM   8725  H8 B DG J  97     111.538 123.040 147.422  0.50 95.18           H  
ATOM   8726  H1 A DG J  97     112.979 127.461 143.491  0.50 95.18           H  
ATOM   8727  H1 B DG J  97     113.162 127.465 143.541  0.50 95.18           H  
ATOM   8728  H21A DG J  97     115.168 125.318 142.361  0.50 95.18           H  
ATOM   8729  H21B DG J  97     115.206 125.330 142.155  0.50 95.18           H  
ATOM   8730  H22A DG J  97     114.542 126.648 142.128  0.50 95.18           H  
ATOM   8731  H22B DG J  97     114.601 126.683 142.034  0.50 95.18           H  
ATOM   8732  P  A DA J  98     116.381 118.989 146.209  0.50 95.97           P  
ATOM   8733  P  B DA J  98     116.501 119.284 146.588  0.50 95.97           P  
ATOM   8734  OP1A DA J  98     115.523 117.950 145.601  0.50 95.97           O  
ATOM   8735  OP1B DA J  98     117.049 117.933 146.339  0.50 95.97           O  
ATOM   8736  OP2A DA J  98     117.175 118.653 147.411  0.50 95.97           O  
ATOM   8737  OP2B DA J  98     116.392 119.784 147.977  0.50 95.97           O  
ATOM   8738  O5'A DA J  98     117.398 119.540 145.104  0.50 95.97           O  
ATOM   8739  O5'B DA J  98     117.338 120.348 145.736  0.50 95.97           O  
ATOM   8740  C5'A DA J  98     116.906 120.315 144.002  0.50 95.97           C  
ATOM   8741  C5'B DA J  98     117.121 120.439 144.337  0.50 95.97           C  
ATOM   8742  C4'A DA J  98     117.862 121.440 143.591  0.50 95.97           C  
ATOM   8743  C4'B DA J  98     118.062 121.438 143.684  0.50 95.97           C  
ATOM   8744  O4'A DA J  98     117.208 122.724 143.802  0.50 95.97           O  
ATOM   8745  O4'B DA J  98     117.470 122.761 143.727  0.50 95.97           O  
ATOM   8746  C3'A DA J  98     119.199 121.538 144.326  0.50 95.97           C  
ATOM   8747  C3'B DA J  98     119.429 121.575 144.331  0.50 95.97           C  
ATOM   8748  O3'A DA J  98     120.204 121.914 143.406  0.50 95.97           O  
ATOM   8749  O3'B DA J  98     120.409 121.806 143.324  0.50 95.97           O  
ATOM   8750  C2'A DA J  98     118.932 122.598 145.394  0.50 95.97           C  
ATOM   8751  C2'B DA J  98     119.245 122.750 145.290  0.50 95.97           C  
ATOM   8752  C1'A DA J  98     117.962 123.535 144.689  0.50 95.97           C  
ATOM   8753  C1'B DA J  98     118.208 123.618 144.580  0.50 95.97           C  
ATOM   8754  N9 A DA J  98     117.013 124.249 145.560  0.50 95.97           N  
ATOM   8755  N9 B DA J  98     117.251 124.307 145.457  0.50 95.97           N  
ATOM   8756  C8 A DA J  98     116.298 123.737 146.607  0.50 95.97           C  
ATOM   8757  C8 B DA J  98     116.564 123.780 146.514  0.50 95.97           C  
ATOM   8758  N7 A DA J  98     115.498 124.602 147.179  0.50 95.97           N  
ATOM   8759  N7 B DA J  98     115.751 124.625 147.095  0.50 95.97           N  
ATOM   8760  C5 A DA J  98     115.681 125.759 146.450  0.50 95.97           C  
ATOM   8761  C5 B DA J  98     115.898 125.783 146.362  0.50 95.97           C  
ATOM   8762  C6 A DA J  98     115.115 127.042 146.555  0.50 95.97           C  
ATOM   8763  C6 B DA J  98     115.305 127.049 146.472  0.50 95.97           C  
ATOM   8764  N6 A DA J  98     114.215 127.371 147.480  0.50 95.97           N  
ATOM   8765  N6 B DA J  98     114.410 127.355 147.407  0.50 95.97           N  
ATOM   8766  N1 A DA J  98     115.511 127.976 145.672  0.50 95.97           N  
ATOM   8767  N1 B DA J  98     115.667 127.991 145.583  0.50 95.97           N  
ATOM   8768  C2 A DA J  98     116.415 127.641 144.745  0.50 95.97           C  
ATOM   8769  C2 B DA J  98     116.566 127.678 144.645  0.50 95.97           C  
ATOM   8770  N3 A DA J  98     117.018 126.469 144.547  0.50 95.97           N  
ATOM   8771  N3 B DA J  98     117.193 126.521 144.440  0.50 95.97           N  
ATOM   8772  C4 A DA J  98     116.603 125.562 145.442  0.50 95.97           C  
ATOM   8773  C4 B DA J  98     116.811 125.607 145.343  0.50 95.97           C  
ATOM   8774  H5'A DA J  98     116.054 120.705 144.245  0.50 95.97           H  
ATOM   8775  H5'B DA J  98     116.207 120.718 144.178  0.50 95.97           H  
ATOM   8776 H5''A DA J  98     116.773 119.727 143.244  0.50 95.97           H  
ATOM   8777 H5''B DA J  98     117.259 119.567 143.938  0.50 95.97           H  
ATOM   8778  H4'A DA J  98     118.047 121.347 142.645  0.50 95.97           H  
ATOM   8779  H4'B DA J  98     118.186 121.185 142.758  0.50 95.97           H  
ATOM   8780  H3'A DA J  98     119.429 120.698 144.738  0.50 95.97           H  
ATOM   8781  H3'B DA J  98     119.644 120.772 144.826  0.50 95.97           H  
ATOM   8782  H2'A DA J  98     118.529 122.198 146.175  0.50 95.97           H  
ATOM   8783  H2'B DA J  98     118.916 122.439 146.142  0.50 95.97           H  
ATOM   8784 H2''A DA J  98     119.743 123.065 145.627  0.50 95.97           H  
ATOM   8785 H2''B DA J  98     120.069 123.237 145.403  0.50 95.97           H  
ATOM   8786  H1'A DA J  98     118.467 124.181 144.175  0.50 95.97           H  
ATOM   8787  H1'B DA J  98     118.669 124.275 144.042  0.50 95.97           H  
ATOM   8788  H8 A DA J  98     116.384 122.859 146.896  0.50 95.97           H  
ATOM   8789  H8 B DA J  98     116.675 122.905 146.803  0.50 95.97           H  
ATOM   8790  H61A DA J  98     113.909 128.172 147.515  0.50 95.97           H  
ATOM   8791  H61B DA J  98     114.100 128.154 147.460  0.50 95.97           H  
ATOM   8792  H62A DA J  98     113.944 126.782 148.043  0.50 95.97           H  
ATOM   8793  H62B DA J  98     114.141 126.753 147.957  0.50 95.97           H  
ATOM   8794  H2 A DA J  98     116.657 128.319 144.159  0.50 95.97           H  
ATOM   8795  H2 B DA J  98     116.784 128.360 144.054  0.50 95.97           H  
ATOM   8796  P  A DG J  99     121.716 122.028 143.828  0.50 95.85           P  
ATOM   8797  P  B DG J  99     121.930 122.046 143.688  0.50 95.85           P  
ATOM   8798  OP1A DG J  99     122.488 121.144 142.928  0.50 95.85           O  
ATOM   8799  OP1B DG J  99     122.750 121.271 142.731  0.50 95.85           O  
ATOM   8800  OP2A DG J  99     121.836 121.845 145.291  0.50 95.85           O  
ATOM   8801  OP2B DG J  99     122.104 121.826 145.140  0.50 95.85           O  
ATOM   8802  O5'A DG J  99     122.062 123.544 143.467  0.50 95.85           O  
ATOM   8803  O5'B DG J  99     122.117 123.604 143.391  0.50 95.85           O  
ATOM   8804  C5'A DG J  99     121.284 124.220 142.477  0.50 95.85           C  
ATOM   8805  C5'B DG J  99     121.364 124.214 142.340  0.50 95.85           C  
ATOM   8806  C4'A DG J  99     121.824 125.614 142.181  0.50 95.85           C  
ATOM   8807  C4'B DG J  99     121.805 125.651 142.095  0.50 95.85           C  
ATOM   8808  O4'A DG J  99     121.047 126.599 142.903  0.50 95.85           O  
ATOM   8809  O4'B DG J  99     120.964 126.567 142.848  0.50 95.85           O  
ATOM   8810  C3'A DG J  99     123.252 125.872 142.611  0.50 95.85           C  
ATOM   8811  C3'B DG J  99     123.218 125.972 142.528  0.50 95.85           C  
ATOM   8812  O3'A DG J  99     123.817 126.924 141.846  0.50 95.85           O  
ATOM   8813  O3'B DG J  99     123.750 127.011 141.737  0.50 95.85           O  
ATOM   8814  C2'A DG J  99     123.084 126.254 144.072  0.50 95.85           C  
ATOM   8815  C2'B DG J  99     123.030 126.386 143.978  0.50 95.85           C  
ATOM   8816  C1'A DG J  99     121.759 127.038 144.052  0.50 95.85           C  
ATOM   8817  C1'B DG J  99     121.694 127.139 143.929  0.50 95.85           C  
ATOM   8818  N9 A DG J  99     120.874 126.861 145.215  0.50 95.85           N  
ATOM   8819  N9 B DG J  99     120.840 127.052 145.128  0.50 95.85           N  
ATOM   8820  C8 A DG J  99     120.662 125.720 145.952  0.50 95.85           C  
ATOM   8821  C8 B DG J  99     120.628 125.952 145.921  0.50 95.85           C  
ATOM   8822  N7 A DG J  99     119.781 125.868 146.900  0.50 95.85           N  
ATOM   8823  N7 B DG J  99     119.778 126.159 146.885  0.50 95.85           N  
ATOM   8824  C5 A DG J  99     119.364 127.182 146.774  0.50 95.85           C  
ATOM   8825  C5 B DG J  99     119.376 127.472 146.713  0.50 95.85           C  
ATOM   8826  C6 A DG J  99     118.418 127.910 147.525  0.50 95.85           C  
ATOM   8827  C6 B DG J  99     118.464 128.244 147.463  0.50 95.85           C  
ATOM   8828  O6 A DG J  99     117.740 127.524 148.483  0.50 95.85           O  
ATOM   8829  O6 B DG J  99     117.814 127.905 148.456  0.50 95.85           O  
ATOM   8830  N1 A DG J  99     118.291 129.214 147.068  0.50 95.85           N  
ATOM   8831  N1 B DG J  99     118.335 129.532 146.962  0.50 95.85           N  
ATOM   8832  C2 A DG J  99     118.989 129.749 146.015  0.50 95.85           C  
ATOM   8833  C2 B DG J  99     119.004 130.020 145.866  0.50 95.85           C  
ATOM   8834  N2 A DG J  99     118.729 131.033 145.715  0.50 95.85           N  
ATOM   8835  N2 B DG J  99     118.744 131.300 145.528  0.50 95.85           N  
ATOM   8836  N3 A DG J  99     119.880 129.075 145.302  0.50 95.85           N  
ATOM   8837  N3 B DG J  99     119.869 129.302 145.148  0.50 95.85           N  
ATOM   8838  C4 A DG J  99     120.017 127.803 145.738  0.50 95.85           C  
ATOM   8839  C4 B DG J  99     120.006 128.039 145.631  0.50 95.85           C  
ATOM   8840  H5'A DG J  99     120.371 124.298 142.795  0.50 95.85           H  
ATOM   8841  H5'B DG J  99     120.426 124.206 142.579  0.50 95.85           H  
ATOM   8842 H5''A DG J  99     121.289 123.698 141.661  0.50 95.85           H  
ATOM   8843 H5''B DG J  99     121.486 123.701 141.526  0.50 95.85           H  
ATOM   8844  H4'A DG J  99     121.747 125.788 141.231  0.50 95.85           H  
ATOM   8845  H4'B DG J  99     121.716 125.849 141.150  0.50 95.85           H  
ATOM   8846  H3'A DG J  99     123.783 125.068 142.528  0.50 95.85           H  
ATOM   8847  H3'B DG J  99     123.778 125.184 142.470  0.50 95.85           H  
ATOM   8848  H2'A DG J  99     123.026 125.467 144.627  0.50 95.85           H  
ATOM   8849  H2'B DG J  99     122.981 125.610 144.552  0.50 95.85           H  
ATOM   8850 H2''A DG J  99     123.814 126.818 144.352  0.50 95.85           H  
ATOM   8851 H2''B DG J  99     123.746 126.968 144.247  0.50 95.85           H  
ATOM   8852  H1'A DG J  99     121.959 127.980 143.954  0.50 95.85           H  
ATOM   8853  H1'B DG J  99     121.866 128.070 143.734  0.50 95.85           H  
ATOM   8854  H8 A DG J  99     121.116 124.923 145.799  0.50 95.85           H  
ATOM   8855  H8 B DG J  99     121.062 125.142 145.792  0.50 95.85           H  
ATOM   8856  H1 A DG J  99     117.733 129.724 147.475  0.50 95.85           H  
ATOM   8857  H1 B DG J  99     117.795 130.062 147.367  0.50 95.85           H  
ATOM   8858  H21A DG J  99     118.983 131.359 144.960  0.50 95.85           H  
ATOM   8859  H21B DG J  99     118.975 131.597 144.753  0.50 95.85           H  
ATOM   8860  H22A DG J  99     118.299 131.526 146.273  0.50 95.85           H  
ATOM   8861  H22B DG J  99     118.336 131.817 146.081  0.50 95.85           H  
ATOM   8862  P    DC J 100     125.097 127.742 141.419  1.00 93.14           P  
ATOM   8863  OP1  DC J 100     124.930 128.143 140.005  1.00 93.14           O  
ATOM   8864  OP2  DC J 100     126.428 127.365 141.944  1.00 93.14           O  
ATOM   8865  O5'  DC J 100     124.490 128.876 142.373  1.00 93.14           O  
ATOM   8866  C5'  DC J 100     123.432 129.707 141.916  1.00 93.14           C  
ATOM   8867  C4'  DC J 100     123.245 130.920 142.820  1.00 93.14           C  
ATOM   8868  O4'  DC J 100     122.539 130.543 144.045  1.00 93.14           O  
ATOM   8869  C3'  DC J 100     124.525 131.578 143.308  1.00 93.14           C  
ATOM   8870  O3'  DC J 100     124.298 132.945 143.500  1.00 93.14           O  
ATOM   8871  C2'  DC J 100     124.757 130.860 144.627  1.00 93.14           C  
ATOM   8872  C1'  DC J 100     123.337 130.888 145.173  1.00 93.14           C  
ATOM   8873  N1   DC J 100     122.992 129.929 146.312  1.00 93.14           N  
ATOM   8874  C2   DC J 100     122.041 130.300 147.272  1.00 93.14           C  
ATOM   8875  O2   DC J 100     121.525 131.417 147.212  1.00 93.14           O  
ATOM   8876  N3   DC J 100     121.711 129.416 148.242  1.00 93.14           N  
ATOM   8877  C4   DC J 100     122.279 128.221 148.275  1.00 93.14           C  
ATOM   8878  N4   DC J 100     121.932 127.383 149.253  1.00 93.14           N  
ATOM   8879  C5   DC J 100     123.231 127.824 147.308  1.00 93.14           C  
ATOM   8880  C6   DC J 100     123.551 128.699 146.361  1.00 93.14           C  
ATOM   8881  H5'  DC J 100     122.615 129.197 141.899  1.00 93.14           H  
ATOM   8882 H5''  DC J 100     123.631 130.009 141.019  1.00 93.14           H  
ATOM   8883  H4'  DC J 100     122.717 131.581 142.347  1.00 93.14           H  
ATOM   8884  H3'  DC J 100     125.254 131.425 142.692  1.00 93.14           H  
ATOM   8885  H2'  DC J 100     125.068 129.961 144.476  1.00 93.14           H  
ATOM   8886 H2''  DC J 100     125.364 131.350 145.188  1.00 93.14           H  
ATOM   8887  H1'  DC J 100     123.127 131.791 145.441  1.00 93.14           H  
ATOM   8888  H41  DC J 100     122.313 126.614 149.316  1.00 93.14           H  
ATOM   8889  H42  DC J 100     121.327 127.612 149.820  1.00 93.14           H  
ATOM   8890  H5   DC J 100     123.625 126.984 147.339  1.00 93.14           H  
ATOM   8891  H6   DC J 100     124.166 128.458 145.714  1.00 93.14           H  
ATOM   8892  P    DA J 101     124.917 134.061 142.532  1.00 92.40           P  
ATOM   8893  OP1  DA J 101     124.572 133.708 141.138  1.00 92.40           O  
ATOM   8894  OP2  DA J 101     126.332 134.237 142.925  1.00 92.40           O  
ATOM   8895  O5'  DA J 101     124.112 135.385 142.954  1.00 92.40           O  
ATOM   8896  C5'  DA J 101     122.680 135.377 142.949  1.00 92.40           C  
ATOM   8897  C4'  DA J 101     122.096 136.458 143.852  1.00 92.40           C  
ATOM   8898  O4'  DA J 101     121.875 135.922 145.178  1.00 92.40           O  
ATOM   8899  C3'  DA J 101     122.960 137.682 144.066  1.00 92.40           C  
ATOM   8900  O3'  DA J 101     122.132 138.819 144.311  1.00 92.40           O  
ATOM   8901  C2'  DA J 101     123.824 137.281 145.267  1.00 92.40           C  
ATOM   8902  C1'  DA J 101     122.907 136.338 146.061  1.00 92.40           C  
ATOM   8903  N9   DA J 101     123.540 135.121 146.597  1.00 92.40           N  
ATOM   8904  C8   DA J 101     124.497 134.351 146.003  1.00 92.40           C  
ATOM   8905  N7   DA J 101     124.846 133.305 146.696  1.00 92.40           N  
ATOM   8906  C5   DA J 101     124.051 133.363 147.811  1.00 92.40           C  
ATOM   8907  C6   DA J 101     123.947 132.529 148.924  1.00 92.40           C  
ATOM   8908  N6   DA J 101     124.687 131.436 149.079  1.00 92.40           N  
ATOM   8909  N1   DA J 101     123.072 132.874 149.885  1.00 92.40           N  
ATOM   8910  C2   DA J 101     122.339 133.980 149.722  1.00 92.40           C  
ATOM   8911  N3   DA J 101     122.341 134.842 148.707  1.00 92.40           N  
ATOM   8912  C4   DA J 101     123.230 134.471 147.774  1.00 92.40           C  
ATOM   8913  H5'  DA J 101     122.368 134.512 143.254  1.00 92.40           H  
ATOM   8914 H5''  DA J 101     122.367 135.522 142.045  1.00 92.40           H  
ATOM   8915  H4'  DA J 101     121.245 136.741 143.487  1.00 92.40           H  
ATOM   8916  H3'  DA J 101     123.517 137.835 143.290  1.00 92.40           H  
ATOM   8917  H2'  DA J 101     124.621 136.830 144.964  1.00 92.40           H  
ATOM   8918 H2''  DA J 101     124.056 138.048 145.803  1.00 92.40           H  
ATOM   8919  H1'  DA J 101     122.510 136.830 146.789  1.00 92.40           H  
ATOM   8920  H8   DA J 101     124.873 134.558 145.180  1.00 92.40           H  
ATOM   8921  H61  DA J 101     124.857 131.141 149.866  1.00 92.40           H  
ATOM   8922  H62  DA J 101     124.995 131.026 148.388  1.00 92.40           H  
ATOM   8923  H2   DA J 101     121.739 134.167 150.407  1.00 92.40           H  
ATOM   8924  P    DG J 102     122.769 140.240 144.702  1.00 90.60           P  
ATOM   8925  OP1  DG J 102     121.806 141.295 144.322  1.00 90.60           O  
ATOM   8926  OP2  DG J 102     124.151 140.272 144.178  1.00 90.60           O  
ATOM   8927  O5'  DG J 102     122.860 140.164 146.294  1.00 90.60           O  
ATOM   8928  C5'  DG J 102     121.735 139.722 147.039  1.00 90.60           C  
ATOM   8929  C4'  DG J 102     122.062 139.579 148.515  1.00 90.60           C  
ATOM   8930  O4'  DG J 102     122.626 138.262 148.765  1.00 90.60           O  
ATOM   8931  C3'  DG J 102     123.081 140.585 149.065  1.00 90.60           C  
ATOM   8932  O3'  DG J 102     122.595 141.179 150.256  1.00 90.60           O  
ATOM   8933  C2'  DG J 102     124.324 139.735 149.304  1.00 90.60           C  
ATOM   8934  C1'  DG J 102     123.714 138.391 149.647  1.00 90.60           C  
ATOM   8935  N9   DG J 102     124.611 137.234 149.495  1.00 90.60           N  
ATOM   8936  C8   DG J 102     125.394 136.911 148.411  1.00 90.60           C  
ATOM   8937  N7   DG J 102     126.077 135.810 148.574  1.00 90.60           N  
ATOM   8938  C5   DG J 102     125.727 135.376 149.846  1.00 90.60           C  
ATOM   8939  C6   DG J 102     126.153 134.238 150.574  1.00 90.60           C  
ATOM   8940  O6   DG J 102     126.940 133.350 150.224  1.00 90.60           O  
ATOM   8941  N1   DG J 102     125.543 134.166 151.817  1.00 90.60           N  
ATOM   8942  C2   DG J 102     124.649 135.083 152.303  1.00 90.60           C  
ATOM   8943  N2   DG J 102     124.168 134.860 153.528  1.00 90.60           N  
ATOM   8944  N3   DG J 102     124.249 136.152 151.638  1.00 90.60           N  
ATOM   8945  C4   DG J 102     124.817 136.230 150.417  1.00 90.60           C  
ATOM   8946  H5'  DG J 102     121.445 138.865 146.695  1.00 90.60           H  
ATOM   8947 H5''  DG J 102     121.018 140.362 146.935  1.00 90.60           H  
ATOM   8948  H4'  DG J 102     121.241 139.665 149.021  1.00 90.60           H  
ATOM   8949  H3'  DG J 102     123.267 141.269 148.409  1.00 90.60           H  
ATOM   8950  H2'  DG J 102     124.861 139.678 148.500  1.00 90.60           H  
ATOM   8951 H2''  DG J 102     124.841 140.078 150.047  1.00 90.60           H  
ATOM   8952  H1'  DG J 102     123.381 138.419 150.556  1.00 90.60           H  
ATOM   8953  H8   DG J 102     125.435 137.427 147.640  1.00 90.60           H  
ATOM   8954  H1   DG J 102     125.746 133.502 152.320  1.00 90.60           H  
ATOM   8955  H21  DG J 102     123.599 135.404 153.871  1.00 90.60           H  
ATOM   8956  H22  DG J 102     124.424 134.170 153.969  1.00 90.60           H  
ATOM   8957  P    DT J 103     123.387 142.397 150.937  1.00 96.24           P  
ATOM   8958  OP1  DT J 103     122.424 143.501 151.131  1.00 96.24           O  
ATOM   8959  OP2  DT J 103     124.626 142.623 150.163  1.00 96.24           O  
ATOM   8960  O5'  DT J 103     123.791 141.827 152.369  1.00 96.24           O  
ATOM   8961  C5'  DT J 103     122.788 141.312 153.216  1.00 96.24           C  
ATOM   8962  C4'  DT J 103     123.391 140.584 154.394  1.00 96.24           C  
ATOM   8963  O4'  DT J 103     124.018 139.351 153.937  1.00 96.24           O  
ATOM   8964  C3'  DT J 103     124.474 141.370 155.136  1.00 96.24           C  
ATOM   8965  O3'  DT J 103     124.173 141.460 156.524  1.00 96.24           O  
ATOM   8966  C2'  DT J 103     125.752 140.579 154.860  1.00 96.24           C  
ATOM   8967  C1'  DT J 103     125.228 139.172 154.631  1.00 96.24           C  
ATOM   8968  N1   DT J 103     126.150 138.277 153.822  1.00 96.24           N  
ATOM   8969  C2   DT J 103     126.652 137.116 154.381  1.00 96.24           C  
ATOM   8970  O2   DT J 103     126.403 136.751 155.513  1.00 96.24           O  
ATOM   8971  N3   DT J 103     127.472 136.397 153.557  1.00 96.24           N  
ATOM   8972  C4   DT J 103     127.831 136.703 152.264  1.00 96.24           C  
ATOM   8973  O4   DT J 103     128.575 135.991 151.602  1.00 96.24           O  
ATOM   8974  C5   DT J 103     127.279 137.925 151.743  1.00 96.24           C  
ATOM   8975  C7   DT J 103     127.603 138.361 150.344  1.00 96.24           C  
ATOM   8976  C6   DT J 103     126.465 138.635 152.529  1.00 96.24           C  
ATOM   8977  H5'  DT J 103     122.232 140.700 152.713  1.00 96.24           H  
ATOM   8978 H5''  DT J 103     122.244 142.042 153.540  1.00 96.24           H  
ATOM   8979  H4'  DT J 103     122.684 140.363 155.017  1.00 96.24           H  
ATOM   8980  H3'  DT J 103     124.548 142.259 154.756  1.00 96.24           H  
ATOM   8981  H2'  DT J 103     126.190 140.920 154.069  1.00 96.24           H  
ATOM   8982 H2''  DT J 103     126.348 140.601 155.621  1.00 96.24           H  
ATOM   8983  H1'  DT J 103     125.044 138.760 155.486  1.00 96.24           H  
ATOM   8984  H3   DT J 103     127.797 135.673 153.882  1.00 96.24           H  
ATOM   8985  H71  DT J 103     126.847 138.834 149.970  1.00 96.24           H  
ATOM   8986  H72  DT J 103     128.375 138.947 150.359  1.00 96.24           H  
ATOM   8987  H73  DT J 103     127.798 137.583 149.800  1.00 96.24           H  
ATOM   8988  H6   DT J 103     126.113 139.426 152.195  1.00 96.24           H  
ATOM   8989  P    DT J 104     125.123 142.303 157.509  1.00104.70           P  
ATOM   8990  OP1  DT J 104     124.274 142.882 158.573  1.00104.70           O  
ATOM   8991  OP2  DT J 104     125.954 143.192 156.666  1.00104.70           O  
ATOM   8992  O5'  DT J 104     126.089 141.194 158.147  1.00104.70           O  
ATOM   8993  C5'  DT J 104     125.528 140.031 158.753  1.00104.70           C  
ATOM   8994  C4'  DT J 104     126.604 139.116 159.314  1.00104.70           C  
ATOM   8995  O4'  DT J 104     127.186 138.340 158.235  1.00104.70           O  
ATOM   8996  C3'  DT J 104     127.765 139.828 160.007  1.00104.70           C  
ATOM   8997  O3'  DT J 104     127.983 139.291 161.300  1.00104.70           O  
ATOM   8998  C2'  DT J 104     128.949 139.594 159.078  1.00104.70           C  
ATOM   8999  C1'  DT J 104     128.580 138.289 158.397  1.00104.70           C  
ATOM   9000  N1   DT J 104     129.211 138.060 157.032  1.00104.70           N  
ATOM   9001  C2   DT J 104     129.957 136.921 156.800  1.00104.70           C  
ATOM   9002  O2   DT J 104     130.173 136.073 157.645  1.00104.70           O  
ATOM   9003  N3   DT J 104     130.453 136.815 155.531  1.00104.70           N  
ATOM   9004  C4   DT J 104     130.280 137.698 154.492  1.00104.70           C  
ATOM   9005  O4   DT J 104     130.770 137.515 153.386  1.00104.70           O  
ATOM   9006  C5   DT J 104     129.489 138.854 154.794  1.00104.70           C  
ATOM   9007  C7   DT J 104     129.247 139.889 153.742  1.00104.70           C  
ATOM   9008  C6   DT J 104     128.989 138.974 156.028  1.00104.70           C  
ATOM   9009  H5'  DT J 104     125.017 139.545 158.088  1.00104.70           H  
ATOM   9010 H5''  DT J 104     124.937 140.302 159.471  1.00104.70           H  
ATOM   9011  H4'  DT J 104     126.194 138.509 159.946  1.00104.70           H  
ATOM   9012  H3'  DT J 104     127.579 140.774 160.071  1.00104.70           H  
ATOM   9013  H2'  DT J 104     129.018 140.313 158.440  1.00104.70           H  
ATOM   9014 H2''  DT J 104     129.768 139.498 159.584  1.00104.70           H  
ATOM   9015  H1'  DT J 104     128.802 137.555 158.985  1.00104.70           H  
ATOM   9016  H3   DT J 104     130.925 136.119 155.363  1.00104.70           H  
ATOM   9017  H71  DT J 104     128.362 140.258 153.850  1.00104.70           H  
ATOM   9018  H72  DT J 104     129.904 140.598 153.830  1.00104.70           H  
ATOM   9019  H73  DT J 104     129.325 139.486 152.866  1.00104.70           H  
ATOM   9020  H6   DT J 104     128.481 139.724 156.224  1.00104.70           H  
ATOM   9021  P    DT J 105     128.951 140.046 162.335  1.00110.11           P  
ATOM   9022  OP1  DT J 105     128.427 139.789 163.694  1.00110.11           O  
ATOM   9023  OP2  DT J 105     129.139 141.437 161.871  1.00110.11           O  
ATOM   9024  O5'  DT J 105     130.347 139.288 162.176  1.00110.11           O  
ATOM   9025  C5'  DT J 105     130.478 137.959 162.639  1.00110.11           C  
ATOM   9026  C4'  DT J 105     131.788 137.349 162.186  1.00110.11           C  
ATOM   9027  O4'  DT J 105     131.813 137.287 160.746  1.00110.11           O  
ATOM   9028  C3'  DT J 105     133.039 138.127 162.596  1.00110.11           C  
ATOM   9029  O3'  DT J 105     133.783 137.387 163.553  1.00110.11           O  
ATOM   9030  C2'  DT J 105     133.816 138.342 161.286  1.00110.11           C  
ATOM   9031  C1'  DT J 105     133.142 137.391 160.311  1.00110.11           C  
ATOM   9032  N1   DT J 105     133.134 137.843 158.857  1.00110.11           N  
ATOM   9033  C2   DT J 105     133.747 137.064 157.896  1.00110.11           C  
ATOM   9034  O2   DT J 105     134.334 136.026 158.144  1.00110.11           O  
ATOM   9035  N3   DT J 105     133.656 137.554 156.619  1.00110.11           N  
ATOM   9036  C4   DT J 105     133.025 138.709 156.210  1.00110.11           C  
ATOM   9037  O4   DT J 105     132.999 139.065 155.038  1.00110.11           O  
ATOM   9038  C5   DT J 105     132.397 139.470 157.252  1.00110.11           C  
ATOM   9039  C7   DT J 105     131.692 140.746 156.916  1.00110.11           C  
ATOM   9040  C6   DT J 105     132.471 139.007 158.511  1.00110.11           C  
ATOM   9041  H5'  DT J 105     129.744 137.430 162.293  1.00110.11           H  
ATOM   9042 H5''  DT J 105     130.444 137.955 163.606  1.00110.11           H  
ATOM   9043  H4'  DT J 105     131.852 136.451 162.540  1.00110.11           H  
ATOM   9044  H3'  DT J 105     132.782 138.982 162.970  1.00110.11           H  
ATOM   9045  H2'  DT J 105     133.732 139.259 160.989  1.00110.11           H  
ATOM   9046 H2''  DT J 105     134.747 138.103 161.399  1.00110.11           H  
ATOM   9047  H1'  DT J 105     133.565 136.523 160.380  1.00110.11           H  
ATOM   9048  H3   DT J 105     134.036 137.090 156.004  1.00110.11           H  
ATOM   9049  H71  DT J 105     131.020 140.930 157.584  1.00110.11           H  
ATOM   9050  H72  DT J 105     132.334 141.473 156.897  1.00110.11           H  
ATOM   9051  H73  DT J 105     131.274 140.665 156.047  1.00110.11           H  
ATOM   9052  H6   DT J 105     132.067 139.501 159.185  1.00110.11           H  
ATOM   9053  P    DC J 106     135.085 138.025 164.244  1.00104.36           P  
ATOM   9054  OP1  DC J 106     135.153 137.515 165.632  1.00104.36           O  
ATOM   9055  OP2  DC J 106     135.057 139.484 164.000  1.00104.36           O  
ATOM   9056  O5'  DC J 106     136.297 137.404 163.405  1.00104.36           O  
ATOM   9057  C5'  DC J 106     136.361 136.000 163.193  1.00104.36           C  
ATOM   9058  C4'  DC J 106     137.525 135.637 162.296  1.00104.36           C  
ATOM   9059  O4'  DC J 106     137.209 136.021 160.934  1.00104.36           O  
ATOM   9060  C3'  DC J 106     138.848 136.328 162.638  1.00104.36           C  
ATOM   9061  O3'  DC J 106     139.929 135.400 162.579  1.00104.36           O  
ATOM   9062  C2'  DC J 106     138.961 137.422 161.583  1.00104.36           C  
ATOM   9063  C1'  DC J 106     138.270 136.772 160.393  1.00104.36           C  
ATOM   9064  N1   DC J 106     137.694 137.718 159.344  1.00104.36           N  
ATOM   9065  C2   DC J 106     137.872 137.436 157.982  1.00104.36           C  
ATOM   9066  O2   DC J 106     138.520 136.437 157.652  1.00104.36           O  
ATOM   9067  N3   DC J 106     137.330 138.269 157.065  1.00104.36           N  
ATOM   9068  C4   DC J 106     136.631 139.333 157.460  1.00104.36           C  
ATOM   9069  N4   DC J 106     136.118 140.130 156.524  1.00104.36           N  
ATOM   9070  C5   DC J 106     136.429 139.631 158.831  1.00104.36           C  
ATOM   9071  C6   DC J 106     136.959 138.802 159.727  1.00104.36           C  
ATOM   9072  H5'  DC J 106     135.537 135.704 162.777  1.00104.36           H  
ATOM   9073 H5''  DC J 106     136.466 135.554 164.045  1.00104.36           H  
ATOM   9074  H4'  DC J 106     137.655 134.679 162.327  1.00104.36           H  
ATOM   9075  H3'  DC J 106     138.796 136.722 163.521  1.00104.36           H  
ATOM   9076  H2'  DC J 106     138.501 138.218 161.876  1.00104.36           H  
ATOM   9077 H2''  DC J 106     139.890 137.611 161.380  1.00104.36           H  
ATOM   9078  H1'  DC J 106     138.894 136.168 159.974  1.00104.36           H  
ATOM   9079  H41  DC J 106     135.649 140.814 156.753  1.00104.36           H  
ATOM   9080  H42  DC J 106     136.256 139.961 155.693  1.00104.36           H  
ATOM   9081  H5   DC J 106     135.941 140.376 159.093  1.00104.36           H  
ATOM   9082  H6   DC J 106     136.844 138.976 160.630  1.00104.36           H  
ATOM   9083  P    DC J 107     141.379 135.799 163.147  1.00 96.63           P  
ATOM   9084  OP1  DC J 107     141.931 134.608 163.827  1.00 96.63           O  
ATOM   9085  OP2  DC J 107     141.249 137.074 163.885  1.00 96.63           O  
ATOM   9086  O5'  DC J 107     142.244 136.079 161.831  1.00 96.63           O  
ATOM   9087  C5'  DC J 107     142.498 135.026 160.910  1.00 96.63           C  
ATOM   9088  C4'  DC J 107     143.340 135.512 159.745  1.00 96.63           C  
ATOM   9089  O4'  DC J 107     142.602 136.530 159.007  1.00 96.63           O  
ATOM   9090  C3'  DC J 107     144.664 136.168 160.137  1.00 96.63           C  
ATOM   9091  O3'  DC J 107     145.689 135.832 159.210  1.00 96.63           O  
ATOM   9092  C2'  DC J 107     144.314 137.644 160.109  1.00 96.63           C  
ATOM   9093  C1'  DC J 107     143.401 137.686 158.894  1.00 96.63           C  
ATOM   9094  N1   DC J 107     142.489 138.905 158.742  1.00 96.63           N  
ATOM   9095  C2   DC J 107     142.019 139.223 157.471  1.00 96.63           C  
ATOM   9096  O2   DC J 107     142.362 138.517 156.524  1.00 96.63           O  
ATOM   9097  N3   DC J 107     141.209 140.292 157.314  1.00 96.63           N  
ATOM   9098  C4   DC J 107     140.861 141.024 158.364  1.00 96.63           C  
ATOM   9099  N4   DC J 107     140.056 142.075 158.158  1.00 96.63           N  
ATOM   9100  C5   DC J 107     141.324 140.718 159.671  1.00 96.63           C  
ATOM   9101  C6   DC J 107     142.123 139.661 159.814  1.00 96.63           C  
ATOM   9102  H5'  DC J 107     141.654 134.688 160.574  1.00 96.63           H  
ATOM   9103 H5''  DC J 107     142.968 134.311 161.366  1.00 96.63           H  
ATOM   9104  H4'  DC J 107     143.522 134.766 159.155  1.00 96.63           H  
ATOM   9105  H3'  DC J 107     144.919 135.900 161.032  1.00 96.63           H  
ATOM   9106  H2'  DC J 107     143.852 137.892 160.918  1.00 96.63           H  
ATOM   9107 H2''  DC J 107     145.103 138.184 159.972  1.00 96.63           H  
ATOM   9108  H1'  DC J 107     143.950 137.607 158.102  1.00 96.63           H  
ATOM   9109  H41  DC J 107     139.688 142.472 158.826  1.00 96.63           H  
ATOM   9110  H42  DC J 107     139.910 142.355 157.356  1.00 96.63           H  
ATOM   9111  H5   DC J 107     141.078 141.235 160.400  1.00 96.63           H  
ATOM   9112  H6   DC J 107     142.437 139.442 160.654  1.00 96.63           H  
ATOM   9113  P    DA J 108     147.204 135.656 159.710  1.00 95.65           P  
ATOM   9114  OP1  DA J 108     147.288 134.400 160.484  1.00 95.65           O  
ATOM   9115  OP2  DA J 108     147.599 136.937 160.333  1.00 95.65           O  
ATOM   9116  O5'  DA J 108     148.042 135.498 158.354  1.00 95.65           O  
ATOM   9117  C5'  DA J 108     147.842 134.367 157.528  1.00 95.65           C  
ATOM   9118  C4'  DA J 108     147.892 134.733 156.051  1.00 95.65           C  
ATOM   9119  O4'  DA J 108     146.895 135.752 155.772  1.00 95.65           O  
ATOM   9120  C3'  DA J 108     149.224 135.289 155.555  1.00 95.65           C  
ATOM   9121  O3'  DA J 108     149.533 134.763 154.258  1.00 95.65           O  
ATOM   9122  C2'  DA J 108     149.012 136.803 155.560  1.00 95.65           C  
ATOM   9123  C1'  DA J 108     147.501 136.971 155.384  1.00 95.65           C  
ATOM   9124  N9   DA J 108     146.910 138.041 156.193  1.00 95.65           N  
ATOM   9125  C8   DA J 108     147.083 138.243 157.531  1.00 95.65           C  
ATOM   9126  N7   DA J 108     146.433 139.260 158.006  1.00 95.65           N  
ATOM   9127  C5   DA J 108     145.761 139.760 156.920  1.00 95.65           C  
ATOM   9128  C6   DA J 108     144.895 140.840 156.790  1.00 95.65           C  
ATOM   9129  N6   DA J 108     144.555 141.613 157.813  1.00 95.65           N  
ATOM   9130  N1   DA J 108     144.382 141.090 155.580  1.00 95.65           N  
ATOM   9131  C2   DA J 108     144.724 140.301 154.552  1.00 95.65           C  
ATOM   9132  N3   DA J 108     145.542 139.241 154.551  1.00 95.65           N  
ATOM   9133  C4   DA J 108     146.033 139.024 155.784  1.00 95.65           C  
ATOM   9134  H5'  DA J 108     146.977 133.981 157.729  1.00 95.65           H  
ATOM   9135 H5''  DA J 108     148.532 133.714 157.716  1.00 95.65           H  
ATOM   9136  H4'  DA J 108     147.679 133.943 155.532  1.00 95.65           H  
ATOM   9137  H3'  DA J 108     149.927 135.056 156.179  1.00 95.65           H  
ATOM   9138  H2'  DA J 108     149.310 137.175 156.399  1.00 95.65           H  
ATOM   9139 H2''  DA J 108     149.477 137.218 154.828  1.00 95.65           H  
ATOM   9140  H1'  DA J 108     147.308 137.138 154.448  1.00 95.65           H  
ATOM   9141  H8   DA J 108     147.636 137.716 158.050  1.00 95.65           H  
ATOM   9142  H61  DA J 108     143.903 142.168 157.732  1.00 95.65           H  
ATOM   9143  H62  DA J 108     144.972 141.547 158.559  1.00 95.65           H  
ATOM   9144  H2   DA J 108     144.342 140.517 153.733  1.00 95.65           H  
ATOM   9145  P    DA J 109     150.820 135.271 153.440  1.00 93.83           P  
ATOM   9146  OP1  DA J 109     151.270 134.172 152.559  1.00 93.83           O  
ATOM   9147  OP2  DA J 109     151.753 135.872 154.417  1.00 93.83           O  
ATOM   9148  O5'  DA J 109     150.233 136.457 152.541  1.00 93.83           O  
ATOM   9149  C5'  DA J 109     149.000 136.268 151.866  1.00 93.83           C  
ATOM   9150  C4'  DA J 109     148.535 137.537 151.183  1.00 93.83           C  
ATOM   9151  O4'  DA J 109     147.998 138.456 152.177  1.00 93.83           O  
ATOM   9152  C3'  DA J 109     149.620 138.305 150.438  1.00 93.83           C  
ATOM   9153  O3'  DA J 109     149.117 138.775 149.194  1.00 93.83           O  
ATOM   9154  C2'  DA J 109     149.964 139.429 151.402  1.00 93.83           C  
ATOM   9155  C1'  DA J 109     148.613 139.718 152.038  1.00 93.83           C  
ATOM   9156  N9   DA J 109     148.666 140.362 153.356  1.00 93.83           N  
ATOM   9157  C8   DA J 109     149.421 139.982 154.425  1.00 93.83           C  
ATOM   9158  N7   DA J 109     149.258 140.729 155.484  1.00 93.83           N  
ATOM   9159  C5   DA J 109     148.323 141.663 155.090  1.00 93.83           C  
ATOM   9160  C6   DA J 109     147.730 142.735 155.767  1.00 93.83           C  
ATOM   9161  N6   DA J 109     148.016 143.040 157.029  1.00 93.83           N  
ATOM   9162  N1   DA J 109     146.832 143.483 155.098  1.00 93.83           N  
ATOM   9163  C2   DA J 109     146.551 143.161 153.832  1.00 93.83           C  
ATOM   9164  N3   DA J 109     147.052 142.175 153.086  1.00 93.83           N  
ATOM   9165  C4   DA J 109     147.938 141.453 153.785  1.00 93.83           C  
ATOM   9166  H5'  DA J 109     148.329 135.995 152.506  1.00 93.83           H  
ATOM   9167 H5''  DA J 109     149.107 135.573 151.202  1.00 93.83           H  
ATOM   9168  H4'  DA J 109     147.833 137.311 150.556  1.00 93.83           H  
ATOM   9169  H3'  DA J 109     150.391 137.738 150.296  1.00 93.83           H  
ATOM   9170  H2'  DA J 109     150.604 139.125 152.062  1.00 93.83           H  
ATOM   9171 H2''  DA J 109     150.296 140.201 150.927  1.00 93.83           H  
ATOM   9172  H1'  DA J 109     148.088 140.265 151.435  1.00 93.83           H  
ATOM   9173  H8   DA J 109     150.006 139.259 154.399  1.00 93.83           H  
ATOM   9174  H61  DA J 109     147.682 143.745 157.387  1.00 93.83           H  
ATOM   9175  H62  DA J 109     148.532 142.528 157.487  1.00 93.83           H  
ATOM   9176  H2   DA J 109     145.930 143.704 153.410  1.00 93.83           H  
ATOM   9177  P    DA J 110     150.077 139.512 148.140  1.00 83.24           P  
ATOM   9178  OP1  DA J 110     149.937 138.808 146.848  1.00 83.24           O  
ATOM   9179  OP2  DA J 110     151.413 139.673 148.751  1.00 83.24           O  
ATOM   9180  O5'  DA J 110     149.420 140.958 147.992  1.00 83.24           O  
ATOM   9181  C5'  DA J 110     148.048 141.068 147.663  1.00 83.24           C  
ATOM   9182  C4'  DA J 110     147.528 142.465 147.942  1.00 83.24           C  
ATOM   9183  O4'  DA J 110     147.578 142.724 149.369  1.00 83.24           O  
ATOM   9184  C3'  DA J 110     148.312 143.582 147.267  1.00 83.24           C  
ATOM   9185  O3'  DA J 110     147.444 144.412 146.558  1.00 83.24           O  
ATOM   9186  C2'  DA J 110     149.008 144.310 148.415  1.00 83.24           C  
ATOM   9187  C1'  DA J 110     148.134 143.994 149.615  1.00 83.24           C  
ATOM   9188  N9   DA J 110     148.854 143.941 150.892  1.00 83.24           N  
ATOM   9189  C8   DA J 110     149.761 143.003 151.281  1.00 83.24           C  
ATOM   9190  N7   DA J 110     150.242 143.194 152.483  1.00 83.24           N  
ATOM   9191  C5   DA J 110     149.600 144.331 152.918  1.00 83.24           C  
ATOM   9192  C6   DA J 110     149.670 145.055 154.119  1.00 83.24           C  
ATOM   9193  N6   DA J 110     150.460 144.716 155.140  1.00 83.24           N  
ATOM   9194  N1   DA J 110     148.898 146.149 154.233  1.00 83.24           N  
ATOM   9195  C2   DA J 110     148.105 146.486 153.211  1.00 83.24           C  
ATOM   9196  N3   DA J 110     147.957 145.886 152.033  1.00 83.24           N  
ATOM   9197  C4   DA J 110     148.739 144.806 151.950  1.00 83.24           C  
ATOM   9198  H5'  DA J 110     147.544 140.430 148.189  1.00 83.24           H  
ATOM   9199 H5''  DA J 110     147.931 140.868 146.724  1.00 83.24           H  
ATOM   9200  H4'  DA J 110     146.607 142.517 147.648  1.00 83.24           H  
ATOM   9201  H3'  DA J 110     148.969 143.206 146.668  1.00 83.24           H  
ATOM   9202  H2'  DA J 110     149.902 143.963 148.542  1.00 83.24           H  
ATOM   9203 H2''  DA J 110     149.030 145.263 148.251  1.00 83.24           H  
ATOM   9204  H1'  DA J 110     147.423 144.650 149.673  1.00 83.24           H  
ATOM   9205  H8   DA J 110     150.021 142.299 150.740  1.00 83.24           H  
ATOM   9206  H61  DA J 110     150.576 145.263 155.795  1.00 83.24           H  
ATOM   9207  H62  DA J 110     150.853 143.953 155.142  1.00 83.24           H  
ATOM   9208  H2   DA J 110     147.593 147.250 153.337  1.00 83.24           H  
ATOM   9209  P    DT J 111     148.025 145.549 145.594  1.00 77.77           P  
ATOM   9210  OP1  DT J 111     146.974 145.759 144.580  1.00 77.77           O  
ATOM   9211  OP2  DT J 111     149.394 145.170 145.188  1.00 77.77           O  
ATOM   9212  O5'  DT J 111     148.132 146.829 146.547  1.00 77.77           O  
ATOM   9213  C5'  DT J 111     147.054 147.132 147.410  1.00 77.77           C  
ATOM   9214  C4'  DT J 111     147.358 148.311 148.326  1.00 77.77           C  
ATOM   9215  O4'  DT J 111     148.036 147.831 149.524  1.00 77.77           O  
ATOM   9216  C3'  DT J 111     148.266 149.415 147.742  1.00 77.77           C  
ATOM   9217  O3'  DT J 111     147.704 150.737 147.986  1.00 77.77           O  
ATOM   9218  C2'  DT J 111     149.569 149.188 148.489  1.00 77.77           C  
ATOM   9219  C1'  DT J 111     149.050 148.742 149.839  1.00 77.77           C  
ATOM   9220  N1   DT J 111     150.062 148.087 150.728  1.00 77.77           N  
ATOM   9221  C2   DT J 111     150.319 148.616 151.969  1.00 77.77           C  
ATOM   9222  O2   DT J 111     149.765 149.606 152.408  1.00 77.77           O  
ATOM   9223  N3   DT J 111     151.260 147.948 152.690  1.00 77.77           N  
ATOM   9224  C4   DT J 111     151.955 146.824 152.312  1.00 77.77           C  
ATOM   9225  O4   DT J 111     152.786 146.293 153.039  1.00 77.77           O  
ATOM   9226  C5   DT J 111     151.639 146.319 151.005  1.00 77.77           C  
ATOM   9227  C7   DT J 111     152.331 145.101 150.483  1.00 77.77           C  
ATOM   9228  C6   DT J 111     150.717 146.965 150.286  1.00 77.77           C  
ATOM   9229  H5'  DT J 111     146.865 146.353 147.956  1.00 77.77           H  
ATOM   9230 H5''  DT J 111     146.273 147.338 146.876  1.00 77.77           H  
ATOM   9231  H4'  DT J 111     146.524 148.712 148.592  1.00 77.77           H  
ATOM   9232  H3'  DT J 111     148.398 149.276 146.794  1.00 77.77           H  
ATOM   9233  H2'  DT J 111     150.087 148.491 148.064  1.00 77.77           H  
ATOM   9234 H2''  DT J 111     150.074 150.000 148.562  1.00 77.77           H  
ATOM   9235  H1'  DT J 111     148.663 149.501 150.291  1.00 77.77           H  
ATOM   9236  H3   DT J 111     151.437 148.262 153.467  1.00 77.77           H  
ATOM   9237  H71  DT J 111     151.728 144.611 149.906  1.00 77.77           H  
ATOM   9238  H72  DT J 111     153.116 145.367 149.980  1.00 77.77           H  
ATOM   9239  H73  DT J 111     152.597 144.539 151.225  1.00 77.77           H  
ATOM   9240  H6   DT J 111     150.511 146.643 149.443  1.00 77.77           H  
ATOM   9241  P    DA J 112     148.326 152.057 147.297  1.00 79.18           P  
ATOM   9242  OP1  DA J 112     147.412 152.523 146.236  1.00 79.18           O  
ATOM   9243  OP2  DA J 112     149.730 151.782 146.936  1.00 79.18           O  
ATOM   9244  O5'  DA J 112     148.336 153.152 148.470  1.00 79.18           O  
ATOM   9245  C5'  DA J 112     147.117 153.695 148.974  1.00 79.18           C  
ATOM   9246  C4'  DA J 112     147.327 154.382 150.326  1.00 79.18           C  
ATOM   9247  O4'  DA J 112     148.055 153.491 151.219  1.00 79.18           O  
ATOM   9248  C3'  DA J 112     148.158 155.654 150.285  1.00 79.18           C  
ATOM   9249  O3'  DA J 112     147.810 156.540 151.357  1.00 79.18           O  
ATOM   9250  C2'  DA J 112     149.559 155.102 150.429  1.00 79.18           C  
ATOM   9251  C1'  DA J 112     149.350 154.015 151.466  1.00 79.18           C  
ATOM   9252  N9   DA J 112     150.315 152.931 151.383  1.00 79.18           N  
ATOM   9253  C8   DA J 112     150.435 152.034 150.377  1.00 79.18           C  
ATOM   9254  N7   DA J 112     151.387 151.164 150.549  1.00 79.18           N  
ATOM   9255  C5   DA J 112     151.937 151.515 151.758  1.00 79.18           C  
ATOM   9256  C6   DA J 112     152.982 150.964 152.501  1.00 79.18           C  
ATOM   9257  N6   DA J 112     153.681 149.908 152.089  1.00 79.18           N  
ATOM   9258  N1   DA J 112     153.290 151.542 153.679  1.00 79.18           N  
ATOM   9259  C2   DA J 112     152.577 152.601 154.078  1.00 79.18           C  
ATOM   9260  N3   DA J 112     151.559 153.204 153.461  1.00 79.18           N  
ATOM   9261  C4   DA J 112     151.277 152.592 152.303  1.00 79.18           C  
ATOM   9262  H5'  DA J 112     146.471 152.979 149.077  1.00 79.18           H  
ATOM   9263 H5''  DA J 112     146.775 154.342 148.339  1.00 79.18           H  
ATOM   9264  H4'  DA J 112     146.464 154.585 150.716  1.00 79.18           H  
ATOM   9265  H3'  DA J 112     148.055 156.097 149.431  1.00 79.18           H  
ATOM   9266  H2'  DA J 112     149.869 154.725 149.595  1.00 79.18           H  
ATOM   9267 H2''  DA J 112     150.165 155.778 150.750  1.00 79.18           H  
ATOM   9268  H1'  DA J 112     149.376 154.404 152.350  1.00 79.18           H  
ATOM   9269  H8   DA J 112     149.891 152.038 149.633  1.00 79.18           H  
ATOM   9270  H61  DA J 112     154.451 149.742 152.430  1.00 79.18           H  
ATOM   9271  H62  DA J 112     153.360 149.394 151.477  1.00 79.18           H  
ATOM   9272  H2   DA J 112     152.823 152.965 154.897  1.00 79.18           H  
ATOM   9273  P    DC J 113     148.200 158.099 151.278  1.00 86.92           P  
ATOM   9274  OP1  DC J 113     146.936 158.859 151.203  1.00 86.92           O  
ATOM   9275  OP2  DC J 113     149.216 158.250 150.216  1.00 86.92           O  
ATOM   9276  O5'  DC J 113     148.911 158.412 152.682  1.00 86.92           O  
ATOM   9277  C5'  DC J 113     149.595 157.379 153.376  1.00 86.92           C  
ATOM   9278  C4'  DC J 113     150.793 157.893 154.170  1.00 86.92           C  
ATOM   9279  O4'  DC J 113     151.794 156.831 154.228  1.00 86.92           O  
ATOM   9280  C3'  DC J 113     151.544 159.092 153.590  1.00 86.92           C  
ATOM   9281  O3'  DC J 113     152.215 159.810 154.633  1.00 86.92           O  
ATOM   9282  C2'  DC J 113     152.505 158.408 152.640  1.00 86.92           C  
ATOM   9283  C1'  DC J 113     152.944 157.217 153.491  1.00 86.92           C  
ATOM   9284  N1   DC J 113     153.491 156.002 152.723  1.00 86.92           N  
ATOM   9285  C2   DC J 113     154.572 155.273 153.249  1.00 86.92           C  
ATOM   9286  O2   DC J 113     155.082 155.629 154.316  1.00 86.92           O  
ATOM   9287  N3   DC J 113     155.041 154.206 152.558  1.00 86.92           N  
ATOM   9288  C4   DC J 113     154.474 153.852 151.411  1.00 86.92           C  
ATOM   9289  N4   DC J 113     154.965 152.792 150.767  1.00 86.92           N  
ATOM   9290  C5   DC J 113     153.385 154.576 150.860  1.00 86.92           C  
ATOM   9291  C6   DC J 113     152.919 155.615 151.548  1.00 86.92           C  
ATOM   9292  H5'  DC J 113     149.904 156.728 152.739  1.00 86.92           H  
ATOM   9293 H5''  DC J 113     148.976 156.951 153.985  1.00 86.92           H  
ATOM   9294  H4'  DC J 113     150.507 158.107 155.072  1.00 86.92           H  
ATOM   9295  H3'  DC J 113     150.944 159.676 153.106  1.00 86.92           H  
ATOM   9296  H2'  DC J 113     152.041 158.133 151.839  1.00 86.92           H  
ATOM   9297 H2''  DC J 113     153.255 158.974 152.429  1.00 86.92           H  
ATOM   9298  H1'  DC J 113     153.618 157.526 154.112  1.00 86.92           H  
ATOM   9299  H41  DC J 113     154.617 152.542 150.023  1.00 86.92           H  
ATOM   9300  H42  DC J 113     155.628 152.358 151.101  1.00 86.92           H  
ATOM   9301  H5   DC J 113     152.988 154.311 150.064  1.00 86.92           H  
ATOM   9302  H6   DC J 113     152.207 156.101 151.210  1.00 86.92           H  
ATOM   9303  P    DA J 114     152.913 161.235 154.365  1.00 86.77           P  
ATOM   9304  OP1  DA J 114     151.820 162.221 154.260  1.00 86.77           O  
ATOM   9305  OP2  DA J 114     153.896 161.131 153.272  1.00 86.77           O  
ATOM   9306  O5'  DA J 114     153.745 161.552 155.703  1.00 86.77           O  
ATOM   9307  C5'  DA J 114     154.203 160.504 156.588  1.00 86.77           C  
ATOM   9308  C4'  DA J 114     155.728 160.465 156.727  1.00 86.77           C  
ATOM   9309  O4'  DA J 114     156.219 159.256 156.080  1.00 86.77           O  
ATOM   9310  C3'  DA J 114     156.517 161.624 156.101  1.00 86.77           C  
ATOM   9311  O3'  DA J 114     157.622 161.981 156.923  1.00 86.77           O  
ATOM   9312  C2'  DA J 114     156.952 161.052 154.763  1.00 86.77           C  
ATOM   9313  C1'  DA J 114     157.184 159.585 155.104  1.00 86.77           C  
ATOM   9314  N9   DA J 114     157.050 158.655 153.974  1.00 86.77           N  
ATOM   9315  C8   DA J 114     156.089 158.654 152.999  1.00 86.77           C  
ATOM   9316  N7   DA J 114     156.226 157.696 152.121  1.00 86.77           N  
ATOM   9317  C5   DA J 114     157.339 157.008 152.556  1.00 86.77           C  
ATOM   9318  C6   DA J 114     158.005 155.881 152.054  1.00 86.77           C  
ATOM   9319  N6   DA J 114     157.609 155.229 150.967  1.00 86.77           N  
ATOM   9320  N1   DA J 114     159.094 155.445 152.717  1.00 86.77           N  
ATOM   9321  C2   DA J 114     159.485 156.104 153.812  1.00 86.77           C  
ATOM   9322  N3   DA J 114     158.940 157.179 154.378  1.00 86.77           N  
ATOM   9323  C4   DA J 114     157.859 157.582 153.695  1.00 86.77           C  
ATOM   9324  H5'  DA J 114     153.908 159.650 156.254  1.00 86.77           H  
ATOM   9325 H5''  DA J 114     153.813 160.646 157.464  1.00 86.77           H  
ATOM   9326  H4'  DA J 114     155.949 160.419 157.669  1.00 86.77           H  
ATOM   9327  H3'  DA J 114     155.950 162.393 155.965  1.00 86.77           H  
ATOM   9328  H2'  DA J 114     156.249 161.155 154.108  1.00 86.77           H  
ATOM   9329 H2''  DA J 114     157.773 161.466 154.458  1.00 86.77           H  
ATOM   9330  H1'  DA J 114     158.067 159.487 155.492  1.00 86.77           H  
ATOM   9331  H8   DA J 114     155.409 159.284 152.958  1.00 86.77           H  
ATOM   9332  H61  DA J 114     158.037 154.529 150.707  1.00 86.77           H  
ATOM   9333  H62  DA J 114     156.926 155.506 150.526  1.00 86.77           H  
ATOM   9334  H2   DA J 114     160.242 155.766 154.236  1.00 86.77           H  
ATOM   9335  P    DC J 115     158.556 163.229 156.532  1.00 84.54           P  
ATOM   9336  OP1  DC J 115     158.769 164.035 157.753  1.00 84.54           O  
ATOM   9337  OP2  DC J 115     157.987 163.860 155.322  1.00 84.54           O  
ATOM   9338  O5'  DC J 115     159.939 162.543 156.120  1.00 84.54           O  
ATOM   9339  C5'  DC J 115     160.552 161.632 157.012  1.00 84.54           C  
ATOM   9340  C4'  DC J 115     161.728 160.927 156.365  1.00 84.54           C  
ATOM   9341  O4'  DC J 115     161.230 159.971 155.404  1.00 84.54           O  
ATOM   9342  C3'  DC J 115     162.702 161.836 155.611  1.00 84.54           C  
ATOM   9343  O3'  DC J 115     164.021 161.665 156.110  1.00 84.54           O  
ATOM   9344  C2'  DC J 115     162.560 161.408 154.152  1.00 84.54           C  
ATOM   9345  C1'  DC J 115     162.038 159.990 154.262  1.00 84.54           C  
ATOM   9346  N1   DC J 115     161.201 159.519 153.080  1.00 84.54           N  
ATOM   9347  C2   DC J 115     161.571 158.369 152.362  1.00 84.54           C  
ATOM   9348  O2   DC J 115     162.594 157.754 152.686  1.00 84.54           O  
ATOM   9349  N3   DC J 115     160.793 157.969 151.325  1.00 84.54           N  
ATOM   9350  C4   DC J 115     159.703 158.662 151.002  1.00 84.54           C  
ATOM   9351  N4   DC J 115     158.961 158.230 149.989  1.00 84.54           N  
ATOM   9352  C5   DC J 115     159.304 159.816 151.719  1.00 84.54           C  
ATOM   9353  C6   DC J 115     160.065 160.202 152.743  1.00 84.54           C  
ATOM   9354  H5'  DC J 115     159.897 160.971 157.284  1.00 84.54           H  
ATOM   9355 H5''  DC J 115     160.860 162.113 157.794  1.00 84.54           H  
ATOM   9356  H4'  DC J 115     162.219 160.450 157.048  1.00 84.54           H  
ATOM   9357  H3'  DC J 115     162.431 162.758 155.709  1.00 84.54           H  
ATOM   9358  H2'  DC J 115     161.928 161.979 153.697  1.00 84.54           H  
ATOM   9359 H2''  DC J 115     163.413 161.417 153.703  1.00 84.54           H  
ATOM   9360  H1'  DC J 115     162.786 159.394 154.397  1.00 84.54           H  
ATOM   9361  H41  DC J 115     158.140 158.475 149.926  1.00 84.54           H  
ATOM   9362  H42  DC J 115     159.296 157.694 149.410  1.00 84.54           H  
ATOM   9363  H5   DC J 115     158.535 160.282 151.486  1.00 84.54           H  
ATOM   9364  H6   DC J 115     159.829 160.960 153.226  1.00 84.54           H  
ATOM   9365  P    DT J 116     165.240 162.519 155.509  1.00 83.61           P  
ATOM   9366  OP1  DT J 116     166.254 162.678 156.573  1.00 83.61           O  
ATOM   9367  OP2  DT J 116     164.667 163.713 154.851  1.00 83.61           O  
ATOM   9368  O5'  DT J 116     165.826 161.566 154.367  1.00 83.61           O  
ATOM   9369  C5'  DT J 116     165.991 160.182 154.633  1.00 83.61           C  
ATOM   9370  C4'  DT J 116     166.532 159.436 153.425  1.00 83.61           C  
ATOM   9371  O4'  DT J 116     165.453 159.180 152.492  1.00 83.61           O  
ATOM   9372  C3'  DT J 116     167.618 160.168 152.635  1.00 83.61           C  
ATOM   9373  O3'  DT J 116     168.788 159.365 152.584  1.00 83.61           O  
ATOM   9374  C2'  DT J 116     166.990 160.409 151.245  1.00 83.61           C  
ATOM   9375  C1'  DT J 116     165.919 159.332 151.170  1.00 83.61           C  
ATOM   9376  N1   DT J 116     164.711 159.633 150.288  1.00 83.61           N  
ATOM   9377  C2   DT J 116     164.362 158.752 149.285  1.00 83.61           C  
ATOM   9378  O2   DT J 116     165.001 157.752 149.016  1.00 83.61           O  
ATOM   9379  N3   DT J 116     163.234 159.092 148.589  1.00 83.61           N  
ATOM   9380  C4   DT J 116     162.421 160.183 148.799  1.00 83.61           C  
ATOM   9381  O4   DT J 116     161.432 160.406 148.109  1.00 83.61           O  
ATOM   9382  C5   DT J 116     162.831 161.058 149.865  1.00 83.61           C  
ATOM   9383  C7   DT J 116     162.028 162.285 150.176  1.00 83.61           C  
ATOM   9384  C6   DT J 116     163.932 160.738 150.561  1.00 83.61           C  
ATOM   9385  H5'  DT J 116     165.133 159.804 154.877  1.00 83.61           H  
ATOM   9386 H5''  DT J 116     166.607 160.073 155.372  1.00 83.61           H  
ATOM   9387  H4'  DT J 116     166.892 158.586 153.725  1.00 83.61           H  
ATOM   9388  H3'  DT J 116     167.821 161.015 153.058  1.00 83.61           H  
ATOM   9389  H2'  DT J 116     166.596 161.294 151.195  1.00 83.61           H  
ATOM   9390 H2''  DT J 116     167.649 160.284 150.544  1.00 83.61           H  
ATOM   9391  H1'  DT J 116     166.329 158.504 150.885  1.00 83.61           H  
ATOM   9392  H3   DT J 116     163.005 158.563 147.954  1.00 83.61           H  
ATOM   9393  H71  DT J 116     162.066 162.465 151.127  1.00 83.61           H  
ATOM   9394  H72  DT J 116     162.394 163.041 149.689  1.00 83.61           H  
ATOM   9395  H73  DT J 116     161.106 162.146 149.910  1.00 83.61           H  
ATOM   9396  H6   DT J 116     164.193 161.299 151.251  1.00 83.61           H  
ATOM   9397  P    DT J 117     170.168 159.960 152.024  1.00 80.20           P  
ATOM   9398  OP1  DT J 117     171.264 159.274 152.739  1.00 80.20           O  
ATOM   9399  OP2  DT J 117     170.086 161.437 152.035  1.00 80.20           O  
ATOM   9400  O5'  DT J 117     170.183 159.474 150.508  1.00 80.20           O  
ATOM   9401  C5'  DT J 117     170.002 158.104 150.221  1.00 80.20           C  
ATOM   9402  C4'  DT J 117     169.701 157.889 148.750  1.00 80.20           C  
ATOM   9403  O4'  DT J 117     168.333 158.297 148.463  1.00 80.20           O  
ATOM   9404  C3'  DT J 117     170.590 158.689 147.787  1.00 80.20           C  
ATOM   9405  O3'  DT J 117     171.163 157.832 146.808  1.00 80.20           O  
ATOM   9406  C2'  DT J 117     169.627 159.707 147.179  1.00 80.20           C  
ATOM   9407  C1'  DT J 117     168.326 158.931 147.213  1.00 80.20           C  
ATOM   9408  N1   DT J 117     167.062 159.744 147.053  1.00 80.20           N  
ATOM   9409  C2   DT J 117     166.115 159.333 146.142  1.00 80.20           C  
ATOM   9410  O2   DT J 117     166.232 158.341 145.446  1.00 80.20           O  
ATOM   9411  N3   DT J 117     165.011 160.130 146.067  1.00 80.20           N  
ATOM   9412  C4   DT J 117     164.762 161.273 146.788  1.00 80.20           C  
ATOM   9413  O4   DT J 117     163.731 161.919 146.652  1.00 80.20           O  
ATOM   9414  C5   DT J 117     165.781 161.642 147.726  1.00 80.20           C  
ATOM   9415  C7   DT J 117     165.608 162.860 148.567  1.00 80.20           C  
ATOM   9416  C6   DT J 117     166.867 160.871 147.816  1.00 80.20           C  
ATOM   9417  H5'  DT J 117     169.265 157.763 150.751  1.00 80.20           H  
ATOM   9418 H5''  DT J 117     170.809 157.623 150.455  1.00 80.20           H  
ATOM   9419  H4'  DT J 117     169.794 156.945 148.546  1.00 80.20           H  
ATOM   9420  H3'  DT J 117     171.288 159.144 148.281  1.00 80.20           H  
ATOM   9421  H2'  DT J 117     169.581 160.502 147.727  1.00 80.20           H  
ATOM   9422 H2''  DT J 117     169.879 159.922 146.269  1.00 80.20           H  
ATOM   9423  H1'  DT J 117     168.358 158.263 146.526  1.00 80.20           H  
ATOM   9424  H3   DT J 117     164.408 159.895 145.505  1.00 80.20           H  
ATOM   9425  H71  DT J 117     166.083 162.744 149.401  1.00 80.20           H  
ATOM   9426  H72  DT J 117     165.961 163.630 148.097  1.00 80.20           H  
ATOM   9427  H73  DT J 117     164.666 162.994 148.748  1.00 80.20           H  
ATOM   9428  H6   DT J 117     167.530 161.115 148.414  1.00 80.20           H  
ATOM   9429  P    DT J 118     172.631 158.127 146.227  1.00 83.41           P  
ATOM   9430  OP1  DT J 118     173.526 157.079 146.759  1.00 83.41           O  
ATOM   9431  OP2  DT J 118     172.947 159.553 146.453  1.00 83.41           O  
ATOM   9432  O5'  DT J 118     172.467 157.903 144.655  1.00 83.41           O  
ATOM   9433  C5'  DT J 118     172.214 156.605 144.162  1.00 83.41           C  
ATOM   9434  C4'  DT J 118     171.171 156.627 143.058  1.00 83.41           C  
ATOM   9435  O4'  DT J 118     170.115 157.547 143.406  1.00 83.41           O  
ATOM   9436  C3'  DT J 118     171.685 157.071 141.691  1.00 83.41           C  
ATOM   9437  O3'  DT J 118     171.636 155.973 140.793  1.00 83.41           O  
ATOM   9438  C2'  DT J 118     170.761 158.235 141.273  1.00 83.41           C  
ATOM   9439  C1'  DT J 118     169.594 158.130 142.236  1.00 83.41           C  
ATOM   9440  N1   DT J 118     168.969 159.435 142.626  1.00 83.41           N  
ATOM   9441  C2   DT J 118     167.674 159.732 142.237  1.00 83.41           C  
ATOM   9442  O2   DT J 118     166.996 158.997 141.542  1.00 83.41           O  
ATOM   9443  N3   DT J 118     167.206 160.942 142.687  1.00 83.41           N  
ATOM   9444  C4   DT J 118     167.883 161.851 143.477  1.00 83.41           C  
ATOM   9445  O4   DT J 118     167.382 162.912 143.832  1.00 83.41           O  
ATOM   9446  C5   DT J 118     169.221 161.467 143.856  1.00 83.41           C  
ATOM   9447  C7   DT J 118     170.054 162.370 144.710  1.00 83.41           C  
ATOM   9448  C6   DT J 118     169.687 160.293 143.424  1.00 83.41           C  
ATOM   9449  H5'  DT J 118     171.897 156.048 144.889  1.00 83.41           H  
ATOM   9450 H5''  DT J 118     173.037 156.233 143.813  1.00 83.41           H  
ATOM   9451  H4'  DT J 118     170.795 155.739 142.973  1.00 83.41           H  
ATOM   9452  H3'  DT J 118     172.596 157.388 141.772  1.00 83.41           H  
ATOM   9453  H2'  DT J 118     171.213 159.083 141.379  1.00 83.41           H  
ATOM   9454 H2''  DT J 118     170.457 158.123 140.361  1.00 83.41           H  
ATOM   9455  H1'  DT J 118     168.922 157.546 141.860  1.00 83.41           H  
ATOM   9456  H3   DT J 118     166.407 161.156 142.454  1.00 83.41           H  
ATOM   9457  H71  DT J 118     169.850 163.293 144.500  1.00 83.41           H  
ATOM   9458  H72  DT J 118     169.861 162.199 145.645  1.00 83.41           H  
ATOM   9459  H73  DT J 118     170.993 162.199 144.539  1.00 83.41           H  
ATOM   9460  H6   DT J 118     170.549 160.046 143.667  1.00 83.41           H  
ATOM   9461  P    DT J 119     172.251 156.087 139.316  1.00 80.56           P  
ATOM   9462  OP1  DT J 119     172.583 154.718 138.863  1.00 80.56           O  
ATOM   9463  OP2  DT J 119     173.293 157.136 139.331  1.00 80.56           O  
ATOM   9464  O5'  DT J 119     171.025 156.621 138.450  1.00 80.56           O  
ATOM   9465  C5'  DT J 119     169.739 156.053 138.626  1.00 80.56           C  
ATOM   9466  C4'  DT J 119     168.714 156.805 137.820  1.00 80.56           C  
ATOM   9467  O4'  DT J 119     168.305 158.010 138.546  1.00 80.56           O  
ATOM   9468  C3'  DT J 119     169.222 157.296 136.469  1.00 80.56           C  
ATOM   9469  O3'  DT J 119     168.199 157.222 135.487  1.00 80.56           O  
ATOM   9470  C2'  DT J 119     169.612 158.721 136.796  1.00 80.56           C  
ATOM   9471  C1'  DT J 119     168.441 159.107 137.676  1.00 80.56           C  
ATOM   9472  N1   DT J 119     168.587 160.398 138.462  1.00 80.56           N  
ATOM   9473  C2   DT J 119     167.483 161.212 138.629  1.00 80.56           C  
ATOM   9474  O2   DT J 119     166.381 160.945 138.189  1.00 80.56           O  
ATOM   9475  N3   DT J 119     167.714 162.355 139.340  1.00 80.56           N  
ATOM   9476  C4   DT J 119     168.909 162.764 139.888  1.00 80.56           C  
ATOM   9477  O4   DT J 119     169.018 163.809 140.513  1.00 80.56           O  
ATOM   9478  C5   DT J 119     170.021 161.876 139.677  1.00 80.56           C  
ATOM   9479  C7   DT J 119     171.370 162.221 140.229  1.00 80.56           C  
ATOM   9480  C6   DT J 119     169.810 160.751 138.984  1.00 80.56           C  
ATOM   9481  H5'  DT J 119     169.497 156.093 139.562  1.00 80.56           H  
ATOM   9482 H5''  DT J 119     169.756 155.127 138.338  1.00 80.56           H  
ATOM   9483  H4'  DT J 119     167.940 156.238 137.681  1.00 80.56           H  
ATOM   9484  H3'  DT J 119     169.998 156.785 136.193  1.00 80.56           H  
ATOM   9485  H2'  DT J 119     170.447 158.737 137.280  1.00 80.56           H  
ATOM   9486 H2''  DT J 119     169.653 159.265 136.006  1.00 80.56           H  
ATOM   9487  H1'  DT J 119     167.651 159.165 137.123  1.00 80.56           H  
ATOM   9488  H3   DT J 119     167.041 162.875 139.460  1.00 80.56           H  
ATOM   9489  H71  DT J 119     171.454 163.185 140.300  1.00 80.56           H  
ATOM   9490  H72  DT J 119     171.470 161.821 141.108  1.00 80.56           H  
ATOM   9491  H73  DT J 119     172.058 161.880 139.637  1.00 80.56           H  
ATOM   9492  H6   DT J 119     170.526 160.179 138.845  1.00 80.56           H  
ATOM   9493  P    DG J 120     168.254 156.107 134.332  1.00 78.73           P  
ATOM   9494  OP1  DG J 120     168.067 154.791 134.983  1.00 78.73           O  
ATOM   9495  OP2  DG J 120     169.463 156.354 133.517  1.00 78.73           O  
ATOM   9496  O5'  DG J 120     166.971 156.433 133.430  1.00 78.73           O  
ATOM   9497  C5'  DG J 120     165.707 155.904 133.786  1.00 78.73           C  
ATOM   9498  C4'  DG J 120     164.601 156.911 133.566  1.00 78.73           C  
ATOM   9499  O4'  DG J 120     164.960 158.184 134.160  1.00 78.73           O  
ATOM   9500  C3'  DG J 120     164.296 157.230 132.127  1.00 78.73           C  
ATOM   9501  O3'  DG J 120     162.966 157.606 132.027  1.00 78.73           O  
ATOM   9502  C2'  DG J 120     165.250 158.372 131.835  1.00 78.73           C  
ATOM   9503  C1'  DG J 120     165.204 159.149 133.145  1.00 78.73           C  
ATOM   9504  N9   DG J 120     166.424 159.865 133.520  1.00 78.73           N  
ATOM   9505  C8   DG J 120     167.713 159.403 133.451  1.00 78.73           C  
ATOM   9506  N7   DG J 120     168.591 160.245 133.905  1.00 78.73           N  
ATOM   9507  C5   DG J 120     167.839 161.321 134.340  1.00 78.73           C  
ATOM   9508  C6   DG J 120     168.253 162.529 134.934  1.00 78.73           C  
ATOM   9509  O6   DG J 120     169.403 162.893 135.202  1.00 78.73           O  
ATOM   9510  N1   DG J 120     167.176 163.358 135.218  1.00 78.73           N  
ATOM   9511  C2   DG J 120     165.863 163.052 134.967  1.00 78.73           C  
ATOM   9512  N2   DG J 120     164.961 163.981 135.303  1.00 78.73           N  
ATOM   9513  N3   DG J 120     165.461 161.920 134.405  1.00 78.73           N  
ATOM   9514  C4   DG J 120     166.502 161.102 134.124  1.00 78.73           C  
ATOM   9515  H5'  DG J 120     165.720 155.651 134.719  1.00 78.73           H  
ATOM   9516 H5''  DG J 120     165.529 155.121 133.247  1.00 78.73           H  
ATOM   9517  H4'  DG J 120     163.795 156.587 133.986  1.00 78.73           H  
ATOM   9518  H3'  DG J 120     164.485 156.471 131.562  1.00 78.73           H  
ATOM   9519  H2'  DG J 120     166.137 158.036 131.654  1.00 78.73           H  
ATOM   9520 H2''  DG J 120     164.924 158.913 131.103  1.00 78.73           H  
ATOM   9521  H1'  DG J 120     164.465 159.770 133.119  1.00 78.73           H  
ATOM   9522  H8   DG J 120     167.939 158.578 133.091  1.00 78.73           H  
ATOM   9523  H1   DG J 120     167.345 164.115 135.582  1.00 78.73           H  
ATOM   9524  H21  DG J 120     164.132 163.864 135.108  1.00 78.73           H  
ATOM   9525  H22  DG J 120     165.212 164.700 135.698  1.00 78.73           H  
ATOM   9526  P    DG J 121     162.245 157.746 130.608  1.00 74.39           P  
ATOM   9527  OP1  DG J 121     161.315 156.604 130.582  1.00 74.39           O  
ATOM   9528  OP2  DG J 121     163.256 157.924 129.542  1.00 74.39           O  
ATOM   9529  O5'  DG J 121     161.441 159.115 130.766  1.00 74.39           O  
ATOM   9530  C5'  DG J 121     161.925 160.063 131.692  1.00 74.39           C  
ATOM   9531  C4'  DG J 121     161.175 161.376 131.630  1.00 74.39           C  
ATOM   9532  O4'  DG J 121     162.034 162.425 132.145  1.00 74.39           O  
ATOM   9533  C3'  DG J 121     160.786 161.851 130.252  1.00 74.39           C  
ATOM   9534  O3'  DG J 121     159.697 162.758 130.332  1.00 74.39           O  
ATOM   9535  C2'  DG J 121     162.070 162.504 129.775  1.00 74.39           C  
ATOM   9536  C1'  DG J 121     162.641 163.124 131.065  1.00 74.39           C  
ATOM   9537  N9   DG J 121     164.117 163.048 131.218  1.00 74.39           N  
ATOM   9538  C8   DG J 121     164.937 161.987 130.912  1.00 74.39           C  
ATOM   9539  N7   DG J 121     166.194 162.206 131.161  1.00 74.39           N  
ATOM   9540  C5   DG J 121     166.221 163.483 131.684  1.00 74.39           C  
ATOM   9541  C6   DG J 121     167.312 164.242 132.144  1.00 74.39           C  
ATOM   9542  O6   DG J 121     168.507 163.924 132.176  1.00 74.39           O  
ATOM   9543  N1   DG J 121     166.914 165.486 132.601  1.00 74.39           N  
ATOM   9544  C2   DG J 121     165.622 165.938 132.613  1.00 74.39           C  
ATOM   9545  N2   DG J 121     165.429 167.170 133.089  1.00 74.39           N  
ATOM   9546  N3   DG J 121     164.585 165.235 132.184  1.00 74.39           N  
ATOM   9547  C4   DG J 121     164.956 164.019 131.736  1.00 74.39           C  
ATOM   9548  H5'  DG J 121     162.856 160.225 131.507  1.00 74.39           H  
ATOM   9549 H5''  DG J 121     161.841 159.700 132.584  1.00 74.39           H  
ATOM   9550  H4'  DG J 121     160.384 161.316 132.180  1.00 74.39           H  
ATOM   9551  H3'  DG J 121     160.560 161.104 129.686  1.00 74.39           H  
ATOM   9552  H2'  DG J 121     162.665 161.838 129.408  1.00 74.39           H  
ATOM   9553 H2''  DG J 121     161.878 163.186 129.125  1.00 74.39           H  
ATOM   9554  H1'  DG J 121     162.372 164.053 131.105  1.00 74.39           H  
ATOM   9555  H8   DG J 121     164.623 161.196 130.538  1.00 74.39           H  
ATOM   9556  H1   DG J 121     167.521 166.012 132.896  1.00 74.39           H  
ATOM   9557  H21  DG J 121     164.822 167.671 132.748  1.00 74.39           H  
ATOM   9558  H22  DG J 121     165.913 167.462 133.734  1.00 74.39           H  
ATOM   9559  P    DT J 122     159.071 163.405 129.005  1.00 73.07           P  
ATOM   9560  OP1  DT J 122     157.614 163.538 129.214  1.00 73.07           O  
ATOM   9561  OP2  DT J 122     159.591 162.650 127.848  1.00 73.07           O  
ATOM   9562  O5'  DT J 122     159.718 164.861 128.967  1.00 73.07           O  
ATOM   9563  C5'  DT J 122     159.679 165.659 130.128  1.00 73.07           C  
ATOM   9564  C4'  DT J 122     160.435 166.960 129.933  1.00 73.07           C  
ATOM   9565  O4'  DT J 122     161.863 166.713 130.055  1.00 73.07           O  
ATOM   9566  C3'  DT J 122     160.232 167.624 128.573  1.00 73.07           C  
ATOM   9567  O3'  DT J 122     160.065 169.028 128.720  1.00 73.07           O  
ATOM   9568  C2'  DT J 122     161.499 167.260 127.823  1.00 73.07           C  
ATOM   9569  C1'  DT J 122     162.535 167.247 128.939  1.00 73.07           C  
ATOM   9570  N1   DT J 122     163.790 166.407 128.678  1.00 73.07           N  
ATOM   9571  C2   DT J 122     165.032 166.934 128.941  1.00 73.07           C  
ATOM   9572  O2   DT J 122     165.210 168.064 129.354  1.00 73.07           O  
ATOM   9573  N3   DT J 122     166.075 166.089 128.688  1.00 73.07           N  
ATOM   9574  C4   DT J 122     166.010 164.800 128.222  1.00 73.07           C  
ATOM   9575  O4   DT J 122     167.010 164.119 128.025  1.00 73.07           O  
ATOM   9576  C5   DT J 122     164.691 164.306 127.980  1.00 73.07           C  
ATOM   9577  C7   DT J 122     164.496 162.919 127.459  1.00 73.07           C  
ATOM   9578  C6   DT J 122     163.659 165.117 128.221  1.00 73.07           C  
ATOM   9579  H5'  DT J 122     160.077 165.169 130.860  1.00 73.07           H  
ATOM   9580 H5''  DT J 122     158.758 165.856 130.343  1.00 73.07           H  
ATOM   9581  H4'  DT J 122     160.169 167.582 130.624  1.00 73.07           H  
ATOM   9582  H3'  DT J 122     159.462 167.241 128.129  1.00 73.07           H  
ATOM   9583  H2'  DT J 122     161.405 166.392 127.412  1.00 73.07           H  
ATOM   9584 H2''  DT J 122     161.708 167.930 127.168  1.00 73.07           H  
ATOM   9585  H1'  DT J 122     162.792 168.159 129.134  1.00 73.07           H  
ATOM   9586  H3   DT J 122     166.859 166.398 128.838  1.00 73.07           H  
ATOM   9587  H71  DT J 122     165.134 162.750 126.750  1.00 73.07           H  
ATOM   9588  H72  DT J 122     164.630 162.283 128.170  1.00 73.07           H  
ATOM   9589  H73  DT J 122     163.596 162.830 127.110  1.00 73.07           H  
ATOM   9590  H6   DT J 122     162.807 164.797 128.060  1.00 73.07           H  
ATOM   9591  P    DA J 123     159.673 169.950 127.465  1.00 75.45           P  
ATOM   9592  OP1  DA J 123     158.399 170.621 127.792  1.00 75.45           O  
ATOM   9593  OP2  DA J 123     159.777 169.152 126.228  1.00 75.45           O  
ATOM   9594  O5'  DA J 123     160.824 171.050 127.456  1.00 75.45           O  
ATOM   9595  C5'  DA J 123     161.375 171.456 128.686  1.00 75.45           C  
ATOM   9596  C4'  DA J 123     162.328 172.634 128.532  1.00 75.45           C  
ATOM   9597  O4'  DA J 123     163.683 172.138 128.437  1.00 75.45           O  
ATOM   9598  C3'  DA J 123     162.139 173.488 127.290  1.00 75.45           C  
ATOM   9599  O3'  DA J 123     162.622 174.819 127.500  1.00 75.45           O  
ATOM   9600  C2'  DA J 123     162.957 172.743 126.257  1.00 75.45           C  
ATOM   9601  C1'  DA J 123     164.106 172.142 127.087  1.00 75.45           C  
ATOM   9602  N9   DA J 123     164.480 170.776 126.725  1.00 75.45           N  
ATOM   9603  C8   DA J 123     163.642 169.740 126.451  1.00 75.45           C  
ATOM   9604  N7   DA J 123     164.253 168.621 126.166  1.00 75.45           N  
ATOM   9605  C5   DA J 123     165.587 168.939 126.275  1.00 75.45           C  
ATOM   9606  C6   DA J 123     166.747 168.176 126.106  1.00 75.45           C  
ATOM   9607  N6   DA J 123     166.727 166.890 125.765  1.00 75.45           N  
ATOM   9608  N1   DA J 123     167.931 168.788 126.284  1.00 75.45           N  
ATOM   9609  C2   DA J 123     167.940 170.081 126.624  1.00 75.45           C  
ATOM   9610  N3   DA J 123     166.908 170.903 126.817  1.00 75.45           N  
ATOM   9611  C4   DA J 123     165.750 170.261 126.630  1.00 75.45           C  
ATOM   9612  H5'  DA J 123     161.858 170.710 129.070  1.00 75.45           H  
ATOM   9613 H5''  DA J 123     160.656 171.705 129.282  1.00 75.45           H  
ATOM   9614  H4'  DA J 123     162.256 173.200 129.314  1.00 75.45           H  
ATOM   9615  H3'  DA J 123     161.205 173.504 127.032  1.00 75.45           H  
ATOM   9616  H2'  DA J 123     162.423 172.060 125.837  1.00 75.45           H  
ATOM   9617 H2''  DA J 123     163.300 173.353 125.600  1.00 75.45           H  
ATOM   9618  H1'  DA J 123     164.884 172.712 127.003  1.00 75.45           H  
ATOM   9619  H8   DA J 123     162.716 169.827 126.452  1.00 75.45           H  
ATOM   9620  H61  DA J 123     167.402 166.542 125.364  1.00 75.45           H  
ATOM   9621  H62  DA J 123     166.036 166.409 125.945  1.00 75.45           H  
ATOM   9622  H2   DA J 123     168.778 170.459 126.740  1.00 75.45           H  
ATOM   9623  P    DG J 124     162.501 175.928 126.340  1.00 82.84           P  
ATOM   9624  OP1  DG J 124     162.268 177.245 126.971  1.00 82.84           O  
ATOM   9625  OP2  DG J 124     161.546 175.417 125.333  1.00 82.84           O  
ATOM   9626  O5'  DG J 124     163.961 175.949 125.684  1.00 82.84           O  
ATOM   9627  C5'  DG J 124     164.997 176.681 126.316  1.00 82.84           C  
ATOM   9628  C4'  DG J 124     166.360 176.288 125.787  1.00 82.84           C  
ATOM   9629  O4'  DG J 124     166.460 174.834 125.708  1.00 82.84           O  
ATOM   9630  C3'  DG J 124     166.682 176.812 124.386  1.00 82.84           C  
ATOM   9631  O3'  DG J 124     167.972 177.410 124.362  1.00 82.84           O  
ATOM   9632  C2'  DG J 124     166.600 175.565 123.520  1.00 82.84           C  
ATOM   9633  C1'  DG J 124     167.062 174.487 124.481  1.00 82.84           C  
ATOM   9634  N9   DG J 124     166.669 173.120 124.103  1.00 82.84           N  
ATOM   9635  C8   DG J 124     165.394 172.654 123.920  1.00 82.84           C  
ATOM   9636  N7   DG J 124     165.336 171.399 123.584  1.00 82.84           N  
ATOM   9637  C5   DG J 124     166.659 170.999 123.529  1.00 82.84           C  
ATOM   9638  C6   DG J 124     167.208 169.738 123.219  1.00 82.84           C  
ATOM   9639  O6   DG J 124     166.610 168.700 122.916  1.00 82.84           O  
ATOM   9640  N1   DG J 124     168.593 169.747 123.281  1.00 82.84           N  
ATOM   9641  C2   DG J 124     169.354 170.838 123.611  1.00 82.84           C  
ATOM   9642  N2   DG J 124     170.679 170.657 123.616  1.00 82.84           N  
ATOM   9643  N3   DG J 124     168.852 172.034 123.904  1.00 82.84           N  
ATOM   9644  C4   DG J 124     167.499 172.040 123.847  1.00 82.84           C  
ATOM   9645  H5'  DG J 124     164.967 176.514 127.270  1.00 82.84           H  
ATOM   9646 H5''  DG J 124     164.859 177.626 126.156  1.00 82.84           H  
ATOM   9647  H4'  DG J 124     167.035 176.613 126.400  1.00 82.84           H  
ATOM   9648  H3'  DG J 124     166.012 177.453 124.109  1.00 82.84           H  
ATOM   9649  H2'  DG J 124     165.689 175.408 123.235  1.00 82.84           H  
ATOM   9650 H2''  DG J 124     167.193 175.632 122.764  1.00 82.84           H  
ATOM   9651  H1'  DG J 124     168.026 174.532 124.574  1.00 82.84           H  
ATOM   9652  H8   DG J 124     164.643 173.185 124.027  1.00 82.84           H  
ATOM   9653  H1   DG J 124     169.003 169.016 123.103  1.00 82.84           H  
ATOM   9654  H21  DG J 124     171.200 171.299 123.849  1.00 82.84           H  
ATOM   9655  H22  DG J 124     171.009 169.897 123.387  1.00 82.84           H  
ATOM   9656  P    DA J 125     168.515 178.124 123.029  1.00 85.78           P  
ATOM   9657  OP1  DA J 125     169.092 179.427 123.421  1.00 85.78           O  
ATOM   9658  OP2  DA J 125     167.424 178.073 122.033  1.00 85.78           O  
ATOM   9659  O5'  DA J 125     169.693 177.159 122.527  1.00 85.78           O  
ATOM   9660  C5'  DA J 125     170.789 176.860 123.393  1.00 85.78           C  
ATOM   9661  C4'  DA J 125     171.772 175.904 122.736  1.00 85.78           C  
ATOM   9662  O4'  DA J 125     171.157 174.593 122.605  1.00 85.78           O  
ATOM   9663  C3'  DA J 125     172.218 176.301 121.332  1.00 85.78           C  
ATOM   9664  O3'  DA J 125     173.600 176.024 121.141  1.00 85.78           O  
ATOM   9665  C2'  DA J 125     171.328 175.456 120.437  1.00 85.78           C  
ATOM   9666  C1'  DA J 125     171.169 174.186 121.252  1.00 85.78           C  
ATOM   9667  N9   DA J 125     169.940 173.441 120.979  1.00 85.78           N  
ATOM   9668  C8   DA J 125     168.662 173.909 121.055  1.00 85.78           C  
ATOM   9669  N7   DA J 125     167.751 173.015 120.768  1.00 85.78           N  
ATOM   9670  C5   DA J 125     168.480 171.880 120.493  1.00 85.78           C  
ATOM   9671  C6   DA J 125     168.098 170.584 120.127  1.00 85.78           C  
ATOM   9672  N6   DA J 125     166.828 170.219 119.966  1.00 85.78           N  
ATOM   9673  N1   DA J 125     169.071 169.677 119.923  1.00 85.78           N  
ATOM   9674  C2   DA J 125     170.342 170.052 120.093  1.00 85.78           C  
ATOM   9675  N3   DA J 125     170.824 171.245 120.430  1.00 85.78           N  
ATOM   9676  C4   DA J 125     169.832 172.122 120.614  1.00 85.78           C  
ATOM   9677  H5'  DA J 125     170.448 176.456 124.205  1.00 85.78           H  
ATOM   9678 H5''  DA J 125     171.249 177.683 123.617  1.00 85.78           H  
ATOM   9679  H4'  DA J 125     172.555 175.826 123.300  1.00 85.78           H  
ATOM   9680  H3'  DA J 125     172.043 177.241 121.183  1.00 85.78           H  
ATOM   9681  H2'  DA J 125     170.475 175.890 120.299  1.00 85.78           H  
ATOM   9682 H2''  DA J 125     171.763 175.269 119.595  1.00 85.78           H  
ATOM   9683  H1'  DA J 125     171.933 173.611 121.099  1.00 85.78           H  
ATOM   9684  H8   DA J 125     168.458 174.785 121.279  1.00 85.78           H  
ATOM   9685  H61  DA J 125     166.641 169.442 119.651  1.00 85.78           H  
ATOM   9686  H62  DA J 125     166.196 170.761 120.174  1.00 85.78           H  
ATOM   9687  H2   DA J 125     170.977 169.393 119.936  1.00 85.78           H  
ATOM   9688  P    DA J 126     174.333 176.473 119.783  1.00 88.72           P  
ATOM   9689  OP1  DA J 126     175.679 176.964 120.144  1.00 88.72           O  
ATOM   9690  OP2  DA J 126     173.402 177.349 119.038  1.00 88.72           O  
ATOM   9691  O5'  DA J 126     174.488 175.110 118.963  1.00 88.72           O  
ATOM   9692  C5'  DA J 126     175.294 174.072 119.487  1.00 88.72           C  
ATOM   9693  C4'  DA J 126     175.155 172.792 118.679  1.00 88.72           C  
ATOM   9694  O4'  DA J 126     173.775 172.330 118.725  1.00 88.72           O  
ATOM   9695  C3'  DA J 126     175.502 172.906 117.193  1.00 88.72           C  
ATOM   9696  O3'  DA J 126     176.275 171.780 116.788  1.00 88.72           O  
ATOM   9697  C2'  DA J 126     174.131 172.945 116.522  1.00 88.72           C  
ATOM   9698  C1'  DA J 126     173.353 172.011 117.416  1.00 88.72           C  
ATOM   9699  N9   DA J 126     171.898 172.133 117.346  1.00 88.72           N  
ATOM   9700  C8   DA J 126     171.140 173.240 117.589  1.00 88.72           C  
ATOM   9701  N7   DA J 126     169.851 173.032 117.476  1.00 88.72           N  
ATOM   9702  C5   DA J 126     169.762 171.694 117.148  1.00 88.72           C  
ATOM   9703  C6   DA J 126     168.669 170.851 116.884  1.00 88.72           C  
ATOM   9704  N6   DA J 126     167.403 171.259 116.929  1.00 88.72           N  
ATOM   9705  N1   DA J 126     168.929 169.561 116.589  1.00 88.72           N  
ATOM   9706  C2   DA J 126     170.198 169.155 116.560  1.00 88.72           C  
ATOM   9707  N3   DA J 126     171.304 169.855 116.776  1.00 88.72           N  
ATOM   9708  C4   DA J 126     171.014 171.129 117.064  1.00 88.72           C  
ATOM   9709  H5'  DA J 126     175.027 173.900 120.403  1.00 88.72           H  
ATOM   9710 H5''  DA J 126     176.219 174.356 119.474  1.00 88.72           H  
ATOM   9711  H4'  DA J 126     175.723 172.113 119.076  1.00 88.72           H  
ATOM   9712  H3'  DA J 126     175.985 173.728 117.023  1.00 88.72           H  
ATOM   9713  H2'  DA J 126     173.757 173.839 116.544  1.00 88.72           H  
ATOM   9714 H2''  DA J 126     174.173 172.603 115.617  1.00 88.72           H  
ATOM   9715  H1'  DA J 126     173.606 171.098 117.214  1.00 88.72           H  
ATOM   9716  H8   DA J 126     171.503 174.064 117.805  1.00 88.72           H  
ATOM   9717  H61  DA J 126     166.768 170.710 116.747  1.00 88.72           H  
ATOM   9718  H62  DA J 126     167.220 172.069 117.150  1.00 88.72           H  
ATOM   9719  H2   DA J 126     170.327 168.260 116.344  1.00 88.72           H  
ATOM   9720  P    DT J 127     177.125 171.807 115.426  1.00 88.18           P  
ATOM   9721  OP1  DT J 127     177.980 170.601 115.436  1.00 88.18           O  
ATOM   9722  OP2  DT J 127     177.742 173.145 115.300  1.00 88.18           O  
ATOM   9723  O5'  DT J 127     176.019 171.665 114.278  1.00 88.18           O  
ATOM   9724  C5'  DT J 127     176.202 170.743 113.206  1.00 88.18           C  
ATOM   9725  C4'  DT J 127     175.499 169.431 113.494  1.00 88.18           C  
ATOM   9726  O4'  DT J 127     174.211 169.698 114.112  1.00 88.18           O  
ATOM   9727  C3'  DT J 127     175.191 168.582 112.267  1.00 88.18           C  
ATOM   9728  O3'  DT J 127     175.323 167.201 112.578  1.00 88.18           O  
ATOM   9729  C2'  DT J 127     173.755 168.969 111.949  1.00 88.18           C  
ATOM   9730  C1'  DT J 127     173.183 169.115 113.334  1.00 88.18           C  
ATOM   9731  N1   DT J 127     171.971 169.968 113.440  1.00 88.18           N  
ATOM   9732  C2   DT J 127     170.734 169.395 113.309  1.00 88.18           C  
ATOM   9733  O2   DT J 127     170.567 168.213 113.074  1.00 88.18           O  
ATOM   9734  N3   DT J 127     169.686 170.258 113.472  1.00 88.18           N  
ATOM   9735  C4   DT J 127     169.753 171.606 113.746  1.00 88.18           C  
ATOM   9736  O4   DT J 127     168.750 172.301 113.868  1.00 88.18           O  
ATOM   9737  C5   DT J 127     171.081 172.138 113.875  1.00 88.18           C  
ATOM   9738  C7   DT J 127     171.282 173.581 114.177  1.00 88.18           C  
ATOM   9739  C6   DT J 127     172.113 171.304 113.728  1.00 88.18           C  
ATOM   9740  H5'  DT J 127     177.149 170.578 113.086  1.00 88.18           H  
ATOM   9741 H5''  DT J 127     175.840 171.125 112.393  1.00 88.18           H  
ATOM   9742  H4'  DT J 127     176.040 168.913 114.107  1.00 88.18           H  
ATOM   9743  H3'  DT J 127     175.775 168.823 111.536  1.00 88.18           H  
ATOM   9744  H2'  DT J 127     173.718 169.809 111.470  1.00 88.18           H  
ATOM   9745 H2''  DT J 127     173.305 168.264 111.461  1.00 88.18           H  
ATOM   9746  H1'  DT J 127     172.984 168.236 113.685  1.00 88.18           H  
ATOM   9747  H3   DT J 127     168.900 169.925 113.391  1.00 88.18           H  
ATOM   9748  H71  DT J 127     172.074 173.687 114.721  1.00 88.18           H  
ATOM   9749  H72  DT J 127     171.389 174.072 113.349  1.00 88.18           H  
ATOM   9750  H73  DT J 127     170.513 173.919 114.658  1.00 88.18           H  
ATOM   9751  H6   DT J 127     172.968 171.647 113.813  1.00 88.18           H  
ATOM   9752  P    DC J 128     175.808 166.153 111.464  1.00 91.22           P  
ATOM   9753  OP1  DC J 128     176.076 164.877 112.161  1.00 91.22           O  
ATOM   9754  OP2  DC J 128     176.869 166.781 110.649  1.00 91.22           O  
ATOM   9755  O5'  DC J 128     174.521 165.955 110.543  1.00 91.22           O  
ATOM   9756  C5'  DC J 128     173.410 165.231 111.039  1.00 91.22           C  
ATOM   9757  C4'  DC J 128     172.293 165.165 110.013  1.00 91.22           C  
ATOM   9758  O4'  DC J 128     171.391 166.298 110.200  1.00 91.22           O  
ATOM   9759  C3'  DC J 128     172.744 165.250 108.553  1.00 91.22           C  
ATOM   9760  O3'  DC J 128     171.876 164.508 107.709  1.00 91.22           O  
ATOM   9761  C2'  DC J 128     172.637 166.738 108.294  1.00 91.22           C  
ATOM   9762  C1'  DC J 128     171.309 167.017 108.987  1.00 91.22           C  
ATOM   9763  N1   DC J 128     170.966 168.465 109.289  1.00 91.22           N  
ATOM   9764  C2   DC J 128     169.642 168.783 109.587  1.00 91.22           C  
ATOM   9765  O2   DC J 128     168.803 167.879 109.599  1.00 91.22           O  
ATOM   9766  N3   DC J 128     169.314 170.066 109.858  1.00 91.22           N  
ATOM   9767  C4   DC J 128     170.251 171.008 109.838  1.00 91.22           C  
ATOM   9768  N4   DC J 128     169.884 172.264 110.108  1.00 91.22           N  
ATOM   9769  C5   DC J 128     171.606 170.709 109.536  1.00 91.22           C  
ATOM   9770  C6   DC J 128     171.915 169.441 109.266  1.00 91.22           C  
ATOM   9771  H5'  DC J 128     173.081 165.668 111.840  1.00 91.22           H  
ATOM   9772 H5''  DC J 128     173.692 164.331 111.261  1.00 91.22           H  
ATOM   9773  H4'  DC J 128     171.796 164.344 110.142  1.00 91.22           H  
ATOM   9774  H3'  DC J 128     173.660 164.948 108.458  1.00 91.22           H  
ATOM   9775  H2'  DC J 128     173.371 167.207 108.714  1.00 91.22           H  
ATOM   9776 H2''  DC J 128     172.587 166.927 107.346  1.00 91.22           H  
ATOM   9777  H1'  DC J 128     170.597 166.638 108.448  1.00 91.22           H  
ATOM   9778  H41  DC J 128     170.481 172.860 110.272  1.00 91.22           H  
ATOM   9779  H42  DC J 128     169.050 172.475 110.119  1.00 91.22           H  
ATOM   9780  H5   DC J 128     172.252 171.374 109.522  1.00 91.22           H  
ATOM   9781  H6   DC J 128     172.792 169.221 109.071  1.00 91.22           H  
ATOM   9782  P    DT J 129     172.051 162.924 107.521  1.00 87.12           P  
ATOM   9783  OP1  DT J 129     172.222 162.295 108.848  1.00 87.12           O  
ATOM   9784  OP2  DT J 129     173.074 162.713 106.475  1.00 87.12           O  
ATOM   9785  O5'  DT J 129     170.642 162.473 106.918  1.00 87.12           O  
ATOM   9786  C5'  DT J 129     169.436 162.751 107.629  1.00 87.12           C  
ATOM   9787  C4'  DT J 129     168.291 163.103 106.689  1.00 87.12           C  
ATOM   9788  O4'  DT J 129     168.061 164.547 106.727  1.00 87.12           O  
ATOM   9789  C3'  DT J 129     168.523 162.779 105.213  1.00 87.12           C  
ATOM   9790  O3'  DT J 129     167.311 162.486 104.563  1.00 87.12           O  
ATOM   9791  C2'  DT J 129     169.119 164.074 104.723  1.00 87.12           C  
ATOM   9792  C1'  DT J 129     168.188 165.058 105.416  1.00 87.12           C  
ATOM   9793  N1   DT J 129     168.630 166.505 105.480  1.00 87.12           N  
ATOM   9794  C2   DT J 129     167.701 167.446 105.830  1.00 87.12           C  
ATOM   9795  O2   DT J 129     166.550 167.170 106.100  1.00 87.12           O  
ATOM   9796  N3   DT J 129     168.164 168.728 105.862  1.00 87.12           N  
ATOM   9797  C4   DT J 129     169.440 169.159 105.580  1.00 87.12           C  
ATOM   9798  O4   DT J 129     169.763 170.337 105.636  1.00 87.12           O  
ATOM   9799  C5   DT J 129     170.368 168.129 105.212  1.00 87.12           C  
ATOM   9800  C7   DT J 129     171.788 168.480 104.879  1.00 87.12           C  
ATOM   9801  C6   DT J 129     169.928 166.868 105.177  1.00 87.12           C  
ATOM   9802  H5'  DT J 129     169.589 163.496 108.228  1.00 87.12           H  
ATOM   9803 H5''  DT J 129     169.189 161.973 108.150  1.00 87.12           H  
ATOM   9804  H4'  DT J 129     167.489 162.650 106.987  1.00 87.12           H  
ATOM   9805  H3'  DT J 129     169.148 162.049 105.109  1.00 87.12           H  
ATOM   9806  H2'  DT J 129     170.032 164.159 105.033  1.00 87.12           H  
ATOM   9807 H2''  DT J 129     169.058 164.149 103.760  1.00 87.12           H  
ATOM   9808  H1'  DT J 129     167.323 165.021 104.984  1.00 87.12           H  
ATOM   9809  H3   DT J 129     167.599 169.332 106.083  1.00 87.12           H  
ATOM   9810  H71  DT J 129     172.368 167.738 105.112  1.00 87.12           H  
ATOM   9811  H72  DT J 129     171.861 168.661 103.929  1.00 87.12           H  
ATOM   9812  H73  DT J 129     172.052 169.267 105.379  1.00 87.12           H  
ATOM   9813  H6   DT J 129     170.527 166.206 104.942  1.00 87.12           H  
ATOM   9814  P    DG J 130     166.680 161.014 104.636  1.00 85.42           P  
ATOM   9815  OP1  DG J 130     167.104 160.404 105.915  1.00 85.42           O  
ATOM   9816  OP2  DG J 130     166.980 160.333 103.357  1.00 85.42           O  
ATOM   9817  O5'  DG J 130     165.111 161.294 104.689  1.00 85.42           O  
ATOM   9818  C5'  DG J 130     164.587 162.173 105.668  1.00 85.42           C  
ATOM   9819  C4'  DG J 130     163.232 162.721 105.263  1.00 85.42           C  
ATOM   9820  O4'  DG J 130     163.374 164.060 104.743  1.00 85.42           O  
ATOM   9821  C3'  DG J 130     162.526 161.971 104.169  1.00 85.42           C  
ATOM   9822  O3'  DG J 130     161.115 162.161 104.294  1.00 85.42           O  
ATOM   9823  C2'  DG J 130     163.119 162.573 102.913  1.00 85.42           C  
ATOM   9824  C1'  DG J 130     163.371 164.033 103.322  1.00 85.42           C  
ATOM   9825  N9   DG J 130     164.634 164.641 102.890  1.00 85.42           N  
ATOM   9826  C8   DG J 130     165.782 164.022 102.457  1.00 85.42           C  
ATOM   9827  N7   DG J 130     166.748 164.847 102.194  1.00 85.42           N  
ATOM   9828  C5   DG J 130     166.217 166.088 102.492  1.00 85.42           C  
ATOM   9829  C6   DG J 130     166.803 167.360 102.410  1.00 85.42           C  
ATOM   9830  O6   DG J 130     167.944 167.647 102.035  1.00 85.42           O  
ATOM   9831  N1   DG J 130     165.922 168.360 102.804  1.00 85.42           N  
ATOM   9832  C2   DG J 130     164.636 168.149 103.233  1.00 85.42           C  
ATOM   9833  N2   DG J 130     163.930 169.236 103.580  1.00 85.42           N  
ATOM   9834  N3   DG J 130     164.078 166.955 103.317  1.00 85.42           N  
ATOM   9835  C4   DG J 130     164.925 165.976 102.930  1.00 85.42           C  
ATOM   9836  H5'  DG J 130     165.200 162.910 105.791  1.00 85.42           H  
ATOM   9837 H5''  DG J 130     164.495 161.695 106.503  1.00 85.42           H  
ATOM   9838  H4'  DG J 130     162.661 162.746 106.042  1.00 85.42           H  
ATOM   9839  H3'  DG J 130     162.747 161.054 104.214  1.00 85.42           H  
ATOM   9840  H2'  DG J 130     163.932 162.115 102.683  1.00 85.42           H  
ATOM   9841 H2''  DG J 130     162.493 162.526 102.191  1.00 85.42           H  
ATOM   9842  H1'  DG J 130     162.639 164.578 103.002  1.00 85.42           H  
ATOM   9843  H8   DG J 130     165.855 163.103 102.348  1.00 85.42           H  
ATOM   9844  H1   DG J 130     166.205 169.171 102.780  1.00 85.42           H  
ATOM   9845  H21  DG J 130     163.102 169.158 103.800  1.00 85.42           H  
ATOM   9846  H22  DG J 130     164.305 170.010 103.583  1.00 85.42           H  
ATOM   9847  P    DC J 131     160.066 161.544 103.243  1.00 84.95           P  
ATOM   9848  OP1  DC J 131     159.025 160.841 104.025  1.00 84.95           O  
ATOM   9849  OP2  DC J 131     160.802 160.783 102.209  1.00 84.95           O  
ATOM   9850  O5'  DC J 131     159.425 162.850 102.567  1.00 84.95           O  
ATOM   9851  C5'  DC J 131     158.907 163.908 103.390  1.00 84.95           C  
ATOM   9852  C4'  DC J 131     158.986 165.248 102.690  1.00 84.95           C  
ATOM   9853  O4'  DC J 131     160.376 165.549 102.346  1.00 84.95           O  
ATOM   9854  C3'  DC J 131     158.232 165.326 101.374  1.00 84.95           C  
ATOM   9855  O3'  DC J 131     157.761 166.641 101.150  1.00 84.95           O  
ATOM   9856  C2'  DC J 131     159.322 164.959 100.392  1.00 84.95           C  
ATOM   9857  C1'  DC J 131     160.430 165.827 100.961  1.00 84.95           C  
ATOM   9858  N1   DC J 131     161.852 165.590 100.423  1.00 84.95           N  
ATOM   9859  C2   DC J 131     162.706 166.686 100.206  1.00 84.95           C  
ATOM   9860  O2   DC J 131     162.295 167.823 100.436  1.00 84.95           O  
ATOM   9861  N3   DC J 131     163.952 166.465  99.735  1.00 84.95           N  
ATOM   9862  C4   DC J 131     164.358 165.227  99.491  1.00 84.95           C  
ATOM   9863  N4   DC J 131     165.594 165.054  99.033  1.00 84.95           N  
ATOM   9864  C5   DC J 131     163.520 164.106  99.707  1.00 84.95           C  
ATOM   9865  C6   DC J 131     162.286 164.330 100.160  1.00 84.95           C  
ATOM   9866  H5'  DC J 131     159.416 163.953 104.209  1.00 84.95           H  
ATOM   9867 H5''  DC J 131     157.982 163.720 103.600  1.00 84.95           H  
ATOM   9868  H4'  DC J 131     158.651 165.934 103.283  1.00 84.95           H  
ATOM   9869  H3'  DC J 131     157.511 164.685 101.352  1.00 84.95           H  
ATOM   9870  H2'  DC J 131     159.538 164.019 100.447  1.00 84.95           H  
ATOM   9871 H2''  DC J 131     159.087 165.215  99.495  1.00 84.95           H  
ATOM   9872  H1'  DC J 131     160.190 166.751 100.826  1.00 84.95           H  
ATOM   9873  H41  DC J 131     165.832 164.291  98.718  1.00 84.95           H  
ATOM   9874  H42  DC J 131     166.155 165.703  99.060  1.00 84.95           H  
ATOM   9875  H5   DC J 131     163.818 163.245  99.532  1.00 84.95           H  
ATOM   9876  H6   DC J 131     161.722 163.610 100.319  1.00 84.95           H  
ATOM   9877  P    DA J 132     156.300 167.107 101.613  1.00 98.93           P  
ATOM   9878  OP1  DA J 132     156.350 167.267 103.082  1.00 98.93           O  
ATOM   9879  OP2  DA J 132     155.322 166.178 101.009  1.00 98.93           O  
ATOM   9880  O5'  DA J 132     156.127 168.547 100.911  1.00 98.93           O  
ATOM   9881  C5'  DA J 132     156.169 169.753 101.695  1.00 98.93           C  
ATOM   9882  C4'  DA J 132     156.600 170.959 100.862  1.00 98.93           C  
ATOM   9883  O4'  DA J 132     157.955 170.754 100.384  1.00 98.93           O  
ATOM   9884  C3'  DA J 132     155.757 171.235  99.624  1.00 98.93           C  
ATOM   9885  O3'  DA J 132     155.630 172.636  99.391  1.00 98.93           O  
ATOM   9886  C2'  DA J 132     156.525 170.536  98.518  1.00 98.93           C  
ATOM   9887  C1'  DA J 132     157.977 170.670  98.972  1.00 98.93           C  
ATOM   9888  N9   DA J 132     158.836 169.545  98.594  1.00 98.93           N  
ATOM   9889  C8   DA J 132     158.586 168.220  98.792  1.00 98.93           C  
ATOM   9890  N7   DA J 132     159.532 167.433  98.363  1.00 98.93           N  
ATOM   9891  C5   DA J 132     160.479 168.290  97.863  1.00 98.93           C  
ATOM   9892  C6   DA J 132     161.721 168.059  97.274  1.00 98.93           C  
ATOM   9893  N6   DA J 132     162.222 166.838  97.094  1.00 98.93           N  
ATOM   9894  N1   DA J 132     162.429 169.128  96.871  1.00 98.93           N  
ATOM   9895  C2   DA J 132     161.917 170.346  97.062  1.00 98.93           C  
ATOM   9896  N3   DA J 132     160.753 170.688  97.610  1.00 98.93           N  
ATOM   9897  C4   DA J 132     160.078 169.600  97.999  1.00 98.93           C  
ATOM   9898  H5'  DA J 132     156.797 169.633 102.424  1.00 98.93           H  
ATOM   9899 H5''  DA J 132     155.288 169.921 102.062  1.00 98.93           H  
ATOM   9900  H4'  DA J 132     156.587 171.747 101.426  1.00 98.93           H  
ATOM   9901  H3'  DA J 132     154.882 170.834  99.724  1.00 98.93           H  
ATOM   9902  H2'  DA J 132     156.258 169.609  98.459  1.00 98.93           H  
ATOM   9903 H2''  DA J 132     156.392 170.984  97.673  1.00 98.93           H  
ATOM   9904  H1'  DA J 132     158.346 171.489  98.612  1.00 98.93           H  
ATOM   9905  H8   DA J 132     157.805 167.905  99.186  1.00 98.93           H  
ATOM   9906  H61  DA J 132     162.951 166.733  96.656  1.00 98.93           H  
ATOM   9907  H62  DA J 132     161.821 166.156  97.432  1.00 98.93           H  
ATOM   9908  H2   DA J 132     162.444 171.051  96.769  1.00 98.93           H  
ATOM   9909  P    DG J 133     154.682 173.177  98.209  1.00105.57           P  
ATOM   9910  OP1  DG J 133     154.136 174.485  98.632  1.00105.57           O  
ATOM   9911  OP2  DG J 133     153.757 172.082  97.839  1.00105.57           O  
ATOM   9912  O5'  DG J 133     155.686 173.404  96.979  1.00105.57           O  
ATOM   9913  C5'  DG J 133     156.390 174.635  96.859  1.00105.57           C  
ATOM   9914  C4'  DG J 133     157.583 174.511  95.925  1.00105.57           C  
ATOM   9915  O4'  DG J 133     158.209 173.208  96.090  1.00105.57           O  
ATOM   9916  C3'  DG J 133     157.260 174.634  94.428  1.00105.57           C  
ATOM   9917  O3'  DG J 133     158.018 175.692  93.846  1.00105.57           O  
ATOM   9918  C2'  DG J 133     157.637 173.266  93.861  1.00105.57           C  
ATOM   9919  C1'  DG J 133     158.694 172.801  94.837  1.00105.57           C  
ATOM   9920  N9   DG J 133     158.937 171.353  94.844  1.00105.57           N  
ATOM   9921  C8   DG J 133     158.142 170.378  95.386  1.00105.57           C  
ATOM   9922  N7   DG J 133     158.626 169.173  95.243  1.00105.57           N  
ATOM   9923  C5   DG J 133     159.817 169.364  94.564  1.00105.57           C  
ATOM   9924  C6   DG J 133     160.774 168.427  94.124  1.00105.57           C  
ATOM   9925  O6   DG J 133     160.765 167.199  94.260  1.00105.57           O  
ATOM   9926  N1   DG J 133     161.835 169.039  93.476  1.00105.57           N  
ATOM   9927  C2   DG J 133     161.957 170.391  93.281  1.00105.57           C  
ATOM   9928  N2   DG J 133     163.042 170.806  92.616  1.00105.57           N  
ATOM   9929  N3   DG J 133     161.060 171.278  93.674  1.00105.57           N  
ATOM   9930  C4   DG J 133     160.024 170.697  94.312  1.00105.57           C  
ATOM   9931  H5'  DG J 133     156.703 174.907  97.736  1.00105.57           H  
ATOM   9932 H5''  DG J 133     155.788 175.312  96.514  1.00105.57           H  
ATOM   9933  H4'  DG J 133     158.228 175.195  96.156  1.00105.57           H  
ATOM   9934  H3'  DG J 133     156.313 174.795  94.304  1.00105.57           H  
ATOM   9935  H2'  DG J 133     156.874 172.668  93.868  1.00105.57           H  
ATOM   9936 H2''  DG J 133     158.005 173.351  92.971  1.00105.57           H  
ATOM   9937  H1'  DG J 133     159.523 173.264  94.652  1.00105.57           H  
ATOM   9938  H8   DG J 133     157.339 170.556  95.814  1.00105.57           H  
ATOM   9939  H1   DG J 133     162.460 168.537  93.178  1.00105.57           H  
ATOM   9940  H21  DG J 133     163.233 171.644  92.586  1.00105.57           H  
ATOM   9941  H22  DG J 133     163.542 170.237  92.212  1.00105.57           H  
ATOM   9942  P    DG J 134     157.689 176.227  92.367  1.00115.54           P  
ATOM   9943  OP1  DG J 134     157.067 177.559  92.516  1.00115.54           O  
ATOM   9944  OP2  DG J 134     156.965 175.170  91.632  1.00115.54           O  
ATOM   9945  O5'  DG J 134     159.133 176.406  91.693  1.00115.54           O  
ATOM   9946  C5'  DG J 134     160.175 175.473  91.978  1.00115.54           C  
ATOM   9947  C4'  DG J 134     160.908 175.018  90.726  1.00115.54           C  
ATOM   9948  O4'  DG J 134     161.223 173.598  90.875  1.00115.54           O  
ATOM   9949  C3'  DG J 134     160.122 175.090  89.418  1.00115.54           C  
ATOM   9950  O3'  DG J 134     161.012 175.149  88.282  1.00115.54           O  
ATOM   9951  C2'  DG J 134     159.368 173.789  89.494  1.00115.54           C  
ATOM   9952  C1'  DG J 134     160.507 172.874  89.889  1.00115.54           C  
ATOM   9953  N9   DG J 134     160.104 171.561  90.400  1.00115.54           N  
ATOM   9954  C8   DG J 134     159.001 171.250  91.156  1.00115.54           C  
ATOM   9955  N7   DG J 134     158.906 169.979  91.435  1.00115.54           N  
ATOM   9956  C5   DG J 134     160.010 169.415  90.818  1.00115.54           C  
ATOM   9957  C6   DG J 134     160.450 168.072  90.780  1.00115.54           C  
ATOM   9958  O6   DG J 134     159.925 167.077  91.295  1.00115.54           O  
ATOM   9959  N1   DG J 134     161.627 167.937  90.050  1.00115.54           N  
ATOM   9960  C2   DG J 134     162.293 168.971  89.440  1.00115.54           C  
ATOM   9961  N2   DG J 134     163.413 168.660  88.780  1.00115.54           N  
ATOM   9962  N3   DG J 134     161.894 170.228  89.476  1.00115.54           N  
ATOM   9963  C4   DG J 134     160.756 170.377  90.184  1.00115.54           C  
ATOM   9964  H5'  DG J 134     159.792 174.699  92.410  1.00115.54           H  
ATOM   9965 H5''  DG J 134     160.811 175.887  92.578  1.00115.54           H  
ATOM   9966  H4'  DG J 134     161.730 175.520  90.634  1.00115.54           H  
ATOM   9967  H3'  DG J 134     159.515 175.840  89.414  1.00115.54           H  
ATOM   9968  H2'  DG J 134     158.688 173.827  90.183  1.00115.54           H  
ATOM   9969 H2''  DG J 134     158.995 173.543  88.641  1.00115.54           H  
ATOM   9970  H1'  DG J 134     161.080 172.745  89.121  1.00115.54           H  
ATOM   9971  H8   DG J 134     158.383 171.881  91.436  1.00115.54           H  
ATOM   9972  H1   DG J 134     161.961 167.148  89.975  1.00115.54           H  
ATOM   9973  H21  DG J 134     163.919 169.285  88.474  1.00115.54           H  
ATOM   9974  H22  DG J 134     163.632 167.837  88.669  1.00115.54           H  
ATOM   9975  P    DT J 135     160.439 175.200  86.775  1.00117.49           P  
ATOM   9976  OP1  DT J 135     159.607 176.418  86.667  1.00117.49           O  
ATOM   9977  OP2  DT J 135     159.873 173.891  86.401  1.00117.49           O  
ATOM   9978  O5'  DT J 135     161.737 175.375  85.855  1.00117.49           O  
ATOM   9979  C5'  DT J 135     162.908 174.579  86.075  1.00117.49           C  
ATOM   9980  C4'  DT J 135     162.896 173.261  85.296  1.00117.49           C  
ATOM   9981  O4'  DT J 135     162.340 172.214  86.109  1.00117.49           O  
ATOM   9982  C3'  DT J 135     162.084 173.221  83.996  1.00117.49           C  
ATOM   9983  O3'  DT J 135     162.948 173.334  82.872  1.00117.49           O  
ATOM   9984  C2'  DT J 135     161.365 171.861  84.043  1.00117.49           C  
ATOM   9985  C1'  DT J 135     161.988 171.173  85.245  1.00117.49           C  
ATOM   9986  N1   DT J 135     161.080 170.206  85.983  1.00117.49           N  
ATOM   9987  C2   DT J 135     161.364 168.855  85.975  1.00117.49           C  
ATOM   9988  O2   DT J 135     162.308 168.368  85.381  1.00117.49           O  
ATOM   9989  N3   DT J 135     160.487 168.085  86.691  1.00117.49           N  
ATOM   9990  C4   DT J 135     159.390 168.512  87.398  1.00117.49           C  
ATOM   9991  O4   DT J 135     158.662 167.744  88.008  1.00117.49           O  
ATOM   9992  C5   DT J 135     159.150 169.921  87.366  1.00117.49           C  
ATOM   9993  C7   DT J 135     157.990 170.489  88.113  1.00117.49           C  
ATOM   9994  C6   DT J 135     160.000 170.697  86.681  1.00117.49           C  
ATOM   9995  H5'  DT J 135     162.979 174.380  87.019  1.00117.49           H  
ATOM   9996 H5''  DT J 135     163.684 175.090  85.805  1.00117.49           H  
ATOM   9997  H4'  DT J 135     163.811 173.026  85.086  1.00117.49           H  
ATOM   9998  H3'  DT J 135     161.432 173.931  83.984  1.00117.49           H  
ATOM   9999  H2'  DT J 135     160.415 171.985  84.174  1.00117.49           H  
ATOM  10000 H2''  DT J 135     161.539 171.356  83.238  1.00117.49           H  
ATOM  10001  H1'  DT J 135     162.791 170.714  84.963  1.00117.49           H  
ATOM  10002  H3   DT J 135     160.637 167.241  86.697  1.00117.49           H  
ATOM  10003  H71  DT J 135     158.204 171.384  88.409  1.00117.49           H  
ATOM  10004  H72  DT J 135     157.213 170.515  87.535  1.00117.49           H  
ATOM  10005  H73  DT J 135     157.801 169.932  88.883  1.00117.49           H  
ATOM  10006  H6   DT J 135     159.845 171.609  86.665  1.00117.49           H  
ATOM  10007  P    DG J 136     162.348 173.414  81.383  1.00117.64           P  
ATOM  10008  OP1  DG J 136     163.337 174.114  80.535  1.00117.64           O  
ATOM  10009  OP2  DG J 136     160.964 173.929  81.477  1.00117.64           O  
ATOM  10010  O5'  DG J 136     162.264 171.885  80.921  1.00117.64           O  
ATOM  10011  C5'  DG J 136     163.423 171.062  80.967  1.00117.64           C  
ATOM  10012  C4'  DG J 136     163.057 169.596  80.842  1.00117.64           C  
ATOM  10013  O4'  DG J 136     162.336 169.188  82.021  1.00117.64           O  
ATOM  10014  C3'  DG J 136     162.151 169.258  79.662  1.00117.64           C  
ATOM  10015  O3'  DG J 136     162.898 168.682  78.609  1.00117.64           O  
ATOM  10016  C2'  DG J 136     161.109 168.286  80.234  1.00117.64           C  
ATOM  10017  C1'  DG J 136     161.510 168.099  81.697  1.00117.64           C  
ATOM  10018  N9   DG J 136     160.380 168.070  82.639  1.00117.64           N  
ATOM  10019  C8   DG J 136     159.622 169.135  83.058  1.00117.64           C  
ATOM  10020  N7   DG J 136     158.692 168.810  83.911  1.00117.64           N  
ATOM  10021  C5   DG J 136     158.840 167.444  84.071  1.00117.64           C  
ATOM  10022  C6   DG J 136     158.117 166.542  84.880  1.00117.64           C  
ATOM  10023  O6   DG J 136     157.164 166.778  85.632  1.00117.64           O  
ATOM  10024  N1   DG J 136     158.590 165.242  84.752  1.00117.64           N  
ATOM  10025  C2   DG J 136     159.637 164.866  83.950  1.00117.64           C  
ATOM  10026  N2   DG J 136     159.962 163.567  83.955  1.00117.64           N  
ATOM  10027  N3   DG J 136     160.325 165.705  83.188  1.00117.64           N  
ATOM  10028  C4   DG J 136     159.875 166.972  83.300  1.00117.64           C  
ATOM  10029  H5'  DG J 136     163.879 171.203  81.811  1.00117.64           H  
ATOM  10030 H5''  DG J 136     164.015 171.304  80.241  1.00117.64           H  
ATOM  10031  H4'  DG J 136     163.869 169.073  80.771  1.00117.64           H  
ATOM  10032  H3'  DG J 136     161.712 170.058  79.347  1.00117.64           H  
ATOM  10033  H2'  DG J 136     160.222 168.669  80.172  1.00117.64           H  
ATOM  10034 H2''  DG J 136     161.148 167.442  79.765  1.00117.64           H  
ATOM  10035  H1'  DG J 136     162.020 167.279  81.783  1.00117.64           H  
ATOM  10036  H8   DG J 136     159.757 170.003  82.761  1.00117.64           H  
ATOM  10037  H1   DG J 136     158.200 164.629  85.212  1.00117.64           H  
ATOM  10038  H21  DG J 136     160.486 163.251  83.352  1.00117.64           H  
ATOM  10039  H22  DG J 136     159.649 163.048  84.569  1.00117.64           H  
ATOM  10040  P    DG J 137     162.185 168.342  77.213  1.00120.05           P  
ATOM  10041  OP1  DG J 137     163.225 168.353  76.165  1.00120.05           O  
ATOM  10042  OP2  DG J 137     161.005 169.222  77.085  1.00120.05           O  
ATOM  10043  O5'  DG J 137     161.656 166.847  77.408  1.00120.05           O  
ATOM  10044  C5'  DG J 137     162.544 165.845  77.881  1.00120.05           C  
ATOM  10045  C4'  DG J 137     161.793 164.604  78.344  1.00120.05           C  
ATOM  10046  O4'  DG J 137     160.977 164.938  79.493  1.00120.05           O  
ATOM  10047  C3'  DG J 137     160.842 163.984  77.311  1.00120.05           C  
ATOM  10048  O3'  DG J 137     161.230 162.650  77.022  1.00120.05           O  
ATOM  10049  C2'  DG J 137     159.462 164.056  77.969  1.00120.05           C  
ATOM  10050  C1'  DG J 137     159.793 164.187  79.442  1.00120.05           C  
ATOM  10051  N9   DG J 137     158.767 164.864  80.239  1.00120.05           N  
ATOM  10052  C8   DG J 137     158.467 166.204  80.247  1.00120.05           C  
ATOM  10053  N7   DG J 137     157.508 166.516  81.069  1.00120.05           N  
ATOM  10054  C5   DG J 137     157.152 165.309  81.645  1.00120.05           C  
ATOM  10055  C6   DG J 137     156.165 165.021  82.610  1.00120.05           C  
ATOM  10056  O6   DG J 137     155.389 165.803  83.166  1.00120.05           O  
ATOM  10057  N1   DG J 137     156.130 163.667  82.924  1.00120.05           N  
ATOM  10058  C2   DG J 137     156.943 162.713  82.369  1.00120.05           C  
ATOM  10059  N2   DG J 137     156.768 161.456  82.793  1.00120.05           N  
ATOM  10060  N3   DG J 137     157.871 162.971  81.461  1.00120.05           N  
ATOM  10061  C4   DG J 137     157.916 164.284  81.146  1.00120.05           C  
ATOM  10062  H5'  DG J 137     163.055 166.202  78.625  1.00120.05           H  
ATOM  10063 H5''  DG J 137     163.152 165.600  77.168  1.00120.05           H  
ATOM  10064  H4'  DG J 137     162.439 163.932  78.608  1.00120.05           H  
ATOM  10065  H3'  DG J 137     160.848 164.511  76.500  1.00120.05           H  
ATOM  10066  H2'  DG J 137     158.975 164.832  77.656  1.00120.05           H  
ATOM  10067 H2''  DG J 137     158.961 163.246  77.804  1.00120.05           H  
ATOM  10068  H1'  DG J 137     159.957 163.306  79.810  1.00120.05           H  
ATOM  10069  H8   DG J 137     158.903 166.825  79.715  1.00120.05           H  
ATOM  10070  H1   DG J 137     155.554 163.407  83.508  1.00120.05           H  
ATOM  10071  H21  DG J 137     157.299 160.835  82.528  1.00120.05           H  
ATOM  10072  H22  DG J 137     156.123 161.271  83.332  1.00120.05           H  
ATOM  10073  P    DA J 138     160.481 161.817  75.873  1.00116.43           P  
ATOM  10074  OP1  DA J 138     161.465 160.885  75.283  1.00116.43           O  
ATOM  10075  OP2  DA J 138     159.771 162.784  75.010  1.00116.43           O  
ATOM  10076  O5'  DA J 138     159.386 160.972  76.673  1.00116.43           O  
ATOM  10077  C5'  DA J 138     159.775 160.227  77.816  1.00116.43           C  
ATOM  10078  C4'  DA J 138     158.621 159.398  78.361  1.00116.43           C  
ATOM  10079  O4'  DA J 138     157.711 160.259  79.100  1.00116.43           O  
ATOM  10080  C3'  DA J 138     157.761 158.705  77.311  1.00116.43           C  
ATOM  10081  O3'  DA J 138     157.296 157.450  77.800  1.00116.43           O  
ATOM  10082  C2'  DA J 138     156.631 159.702  77.098  1.00116.43           C  
ATOM  10083  C1'  DA J 138     156.423 160.225  78.509  1.00116.43           C  
ATOM  10084  N9   DA J 138     155.835 161.564  78.613  1.00116.43           N  
ATOM  10085  C8   DA J 138     156.163 162.682  77.901  1.00116.43           C  
ATOM  10086  N7   DA J 138     155.479 163.745  78.241  1.00116.43           N  
ATOM  10087  C5   DA J 138     154.662 163.298  79.259  1.00116.43           C  
ATOM  10088  C6   DA J 138     153.695 163.940  80.050  1.00116.43           C  
ATOM  10089  N6   DA J 138     153.383 165.229  79.924  1.00116.43           N  
ATOM  10090  N1   DA J 138     153.058 163.203  80.982  1.00116.43           N  
ATOM  10091  C2   DA J 138     153.373 161.911  81.106  1.00116.43           C  
ATOM  10092  N3   DA J 138     154.260 161.201  80.420  1.00116.43           N  
ATOM  10093  C4   DA J 138     154.877 161.961  79.506  1.00116.43           C  
ATOM  10094  H5'  DA J 138     160.076 160.841  78.503  1.00116.43           H  
ATOM  10095 H5''  DA J 138     160.504 159.637  77.576  1.00116.43           H  
ATOM  10096  H4'  DA J 138     158.976 158.727  78.964  1.00116.43           H  
ATOM  10097  H3'  DA J 138     158.264 158.585  76.492  1.00116.43           H  
ATOM  10098  H2'  DA J 138     156.906 160.409  76.497  1.00116.43           H  
ATOM  10099 H2''  DA J 138     155.834 159.257  76.774  1.00116.43           H  
ATOM  10100  H1'  DA J 138     155.869 159.597  78.997  1.00116.43           H  
ATOM  10101  H8   DA J 138     156.799 162.685  77.227  1.00116.43           H  
ATOM  10102  H61  DA J 138     152.814 165.588  80.459  1.00116.43           H  
ATOM  10103  H62  DA J 138     153.749 165.700  79.305  1.00116.43           H  
ATOM  10104  H2   DA J 138     152.907 161.445  81.761  1.00116.43           H  
ATOM  10105  P    DT J 139     156.764 156.324  76.787  1.00114.73           P  
ATOM  10106  OP1  DT J 139     156.597 155.081  77.568  1.00114.73           O  
ATOM  10107  OP2  DT J 139     157.631 156.331  75.589  1.00114.73           O  
ATOM  10108  O5'  DT J 139     155.323 156.853  76.346  1.00114.73           O  
ATOM  10109  C5'  DT J 139     154.197 155.992  76.415  1.00114.73           C  
ATOM  10110  C4'  DT J 139     153.594 156.000  77.804  1.00114.73           C  
ATOM  10111  O4'  DT J 139     153.657 157.350  78.343  1.00114.73           O  
ATOM  10112  C3'  DT J 139     152.125 155.584  77.859  1.00114.73           C  
ATOM  10113  O3'  DT J 139     151.860 154.757  78.988  1.00114.73           O  
ATOM  10114  C2'  DT J 139     151.390 156.907  77.936  1.00114.73           C  
ATOM  10115  C1'  DT J 139     152.361 157.798  78.685  1.00114.73           C  
ATOM  10116  N1   DT J 139     152.239 159.244  78.333  1.00114.73           N  
ATOM  10117  C2   DT J 139     151.365 160.039  79.037  1.00114.73           C  
ATOM  10118  O2   DT J 139     150.674 159.628  79.950  1.00114.73           O  
ATOM  10119  N3   DT J 139     151.332 161.345  78.632  1.00114.73           N  
ATOM  10120  C4   DT J 139     152.065 161.919  77.616  1.00114.73           C  
ATOM  10121  O4   DT J 139     151.970 163.100  77.324  1.00114.73           O  
ATOM  10122  C5   DT J 139     152.953 161.035  76.921  1.00114.73           C  
ATOM  10123  C7   DT J 139     153.797 161.560  75.805  1.00114.73           C  
ATOM  10124  C6   DT J 139     153.000 159.754  77.305  1.00114.73           C  
ATOM  10125  H5'  DT J 139     154.472 155.090  76.193  1.00114.73           H  
ATOM  10126 H5''  DT J 139     153.530 156.287  75.778  1.00114.73           H  
ATOM  10127  H4'  DT J 139     154.110 155.411  78.374  1.00114.73           H  
ATOM  10128  H3'  DT J 139     151.884 155.120  77.044  1.00114.73           H  
ATOM  10129  H2'  DT J 139     151.219 157.257  77.050  1.00114.73           H  
ATOM  10130 H2''  DT J 139     150.566 156.810  78.434  1.00114.73           H  
ATOM  10131  H1'  DT J 139     152.227 157.687  79.637  1.00114.73           H  
ATOM  10132  H3   DT J 139     150.796 161.863  79.056  1.00114.73           H  
ATOM  10133  H71  DT J 139     154.597 161.022  75.725  1.00114.73           H  
ATOM  10134  H72  DT J 139     153.297 161.523  74.975  1.00114.73           H  
ATOM  10135  H73  DT J 139     154.044 162.479  75.994  1.00114.73           H  
ATOM  10136  H6   DT J 139     153.575 159.181  76.856  1.00114.73           H  
ATOM  10137  P    DA J 140     150.528 153.858  79.037  1.00113.52           P  
ATOM  10138  OP1  DA J 140     150.683 152.913  80.163  1.00113.52           O  
ATOM  10139  OP2  DA J 140     150.263 153.347  77.675  1.00113.52           O  
ATOM  10140  O5'  DA J 140     149.365 154.892  79.410  1.00113.52           O  
ATOM  10141  C5'  DA J 140     149.276 155.400  80.730  1.00113.52           C  
ATOM  10142  C4'  DA J 140     148.110 156.365  80.882  1.00113.52           C  
ATOM  10143  O4'  DA J 140     148.417 157.627  80.219  1.00113.52           O  
ATOM  10144  C3'  DA J 140     146.790 155.887  80.279  1.00113.52           C  
ATOM  10145  O3'  DA J 140     145.723 156.122  81.189  1.00113.52           O  
ATOM  10146  C2'  DA J 140     146.663 156.725  79.009  1.00113.52           C  
ATOM  10147  C1'  DA J 140     147.310 158.022  79.437  1.00113.52           C  
ATOM  10148  N9   DA J 140     147.786 158.878  78.353  1.00113.52           N  
ATOM  10149  C8   DA J 140     148.628 158.536  77.341  1.00113.52           C  
ATOM  10150  N7   DA J 140     148.910 159.522  76.525  1.00113.52           N  
ATOM  10151  C5   DA J 140     148.207 160.591  77.045  1.00113.52           C  
ATOM  10152  C6   DA J 140     148.078 161.935  76.638  1.00113.52           C  
ATOM  10153  N6   DA J 140     148.687 162.441  75.564  1.00113.52           N  
ATOM  10154  N1   DA J 140     147.295 162.741  77.382  1.00113.52           N  
ATOM  10155  C2   DA J 140     146.680 162.231  78.449  1.00113.52           C  
ATOM  10156  N3   DA J 140     146.729 160.991  78.934  1.00113.52           N  
ATOM  10157  C4   DA J 140     147.515 160.214  78.177  1.00113.52           C  
ATOM  10158  H5'  DA J 140     150.100 155.861  80.946  1.00113.52           H  
ATOM  10159 H5''  DA J 140     149.157 154.660  81.345  1.00113.52           H  
ATOM  10160  H4'  DA J 140     147.973 156.535  81.826  1.00113.52           H  
ATOM  10161  H3'  DA J 140     146.847 154.946  80.058  1.00113.52           H  
ATOM  10162  H2'  DA J 140     147.150 156.320  78.277  1.00113.52           H  
ATOM  10163 H2''  DA J 140     145.734 156.864  78.777  1.00113.52           H  
ATOM  10164  H1'  DA J 140     146.691 158.521  79.988  1.00113.52           H  
ATOM  10165  H8   DA J 140     148.970 157.680  77.238  1.00113.52           H  
ATOM  10166  H61  DA J 140     148.477 163.224  75.280  1.00113.52           H  
ATOM  10167  H62  DA J 140     149.289 161.983  75.156  1.00113.52           H  
ATOM  10168  H2   DA J 140     146.159 162.830  78.932  1.00113.52           H  
ATOM  10169  P    DT J 141     144.582 155.019  81.429  1.00110.35           P  
ATOM  10170  OP1  DT J 141     144.820 154.421  82.758  1.00110.35           O  
ATOM  10171  OP2  DT J 141     144.507 154.152  80.234  1.00110.35           O  
ATOM  10172  O5'  DT J 141     143.240 155.882  81.478  1.00110.35           O  
ATOM  10173  C5'  DT J 141     142.837 156.612  80.330  1.00110.35           C  
ATOM  10174  C4'  DT J 141     142.588 158.071  80.667  1.00110.35           C  
ATOM  10175  O4'  DT J 141     143.553 158.905  79.951  1.00110.35           O  
ATOM  10176  C3'  DT J 141     141.223 158.614  80.253  1.00110.35           C  
ATOM  10177  O3'  DT J 141     140.800 159.634  81.142  1.00110.35           O  
ATOM  10178  C2'  DT J 141     141.514 159.139  78.861  1.00110.35           C  
ATOM  10179  C1'  DT J 141     142.860 159.782  79.072  1.00110.35           C  
ATOM  10180  N1   DT J 141     143.672 159.975  77.815  1.00110.35           N  
ATOM  10181  C2   DT J 141     143.728 161.222  77.224  1.00110.35           C  
ATOM  10182  O2   DT J 141     143.142 162.197  77.658  1.00110.35           O  
ATOM  10183  N3   DT J 141     144.508 161.287  76.100  1.00110.35           N  
ATOM  10184  C4   DT J 141     145.217 160.260  75.519  1.00110.35           C  
ATOM  10185  O4   DT J 141     145.889 160.417  74.507  1.00110.35           O  
ATOM  10186  C5   DT J 141     145.116 158.986  76.183  1.00110.35           C  
ATOM  10187  C7   DT J 141     145.848 157.799  75.640  1.00110.35           C  
ATOM  10188  C6   DT J 141     144.361 158.905  77.288  1.00110.35           C  
ATOM  10189  H5'  DT J 141     142.028 156.220  79.974  1.00110.35           H  
ATOM  10190 H5''  DT J 141     143.536 156.558  79.662  1.00110.35           H  
ATOM  10191  H4'  DT J 141     142.703 158.199  81.621  1.00110.35           H  
ATOM  10192  H3'  DT J 141     140.566 157.904  80.216  1.00110.35           H  
ATOM  10193  H2'  DT J 141     141.581 158.414  78.233  1.00110.35           H  
ATOM  10194 H2''  DT J 141     140.857 159.789  78.583  1.00110.35           H  
ATOM  10195  H1'  DT J 141     142.738 160.638  79.510  1.00110.35           H  
ATOM  10196  H3   DT J 141     144.560 162.052  75.713  1.00110.35           H  
ATOM  10197  H71  DT J 141     146.074 157.201  76.364  1.00110.35           H  
ATOM  10198  H72  DT J 141     145.285 157.336  75.001  1.00110.35           H  
ATOM  10199  H73  DT J 141     146.660 158.094  75.200  1.00110.35           H  
ATOM  10200  H6   DT J 141     144.296 158.085  77.717  1.00110.35           H  
ATOM  10201  P    DT J 142     139.242 159.996  81.268  1.00101.68           P  
ATOM  10202  OP1  DT J 142     139.125 161.253  82.039  1.00101.68           O  
ATOM  10203  OP2  DT J 142     138.530 158.781  81.718  1.00101.68           O  
ATOM  10204  O5'  DT J 142     138.806 160.284  79.765  1.00101.68           O  
ATOM  10205  C5'  DT J 142     137.490 160.654  79.480  1.00101.68           C  
ATOM  10206  C4'  DT J 142     137.424 162.088  79.016  1.00101.68           C  
ATOM  10207  O4'  DT J 142     138.596 162.392  78.222  1.00101.68           O  
ATOM  10208  C3'  DT J 142     136.239 162.403  78.137  1.00101.68           C  
ATOM  10209  O3'  DT J 142     135.807 163.716  78.330  1.00101.68           O  
ATOM  10210  C2'  DT J 142     136.773 162.179  76.741  1.00101.68           C  
ATOM  10211  C1'  DT J 142     138.241 162.558  76.861  1.00101.68           C  
ATOM  10212  N1   DT J 142     139.194 161.714  76.018  1.00101.68           N  
ATOM  10213  C2   DT J 142     139.948 162.310  75.020  1.00101.68           C  
ATOM  10214  O2   DT J 142     139.884 163.494  74.743  1.00101.68           O  
ATOM  10215  N3   DT J 142     140.783 161.454  74.346  1.00101.68           N  
ATOM  10216  C4   DT J 142     140.947 160.106  74.565  1.00101.68           C  
ATOM  10217  O4   DT J 142     141.723 159.423  73.907  1.00101.68           O  
ATOM  10218  C5   DT J 142     140.143 159.551  75.619  1.00101.68           C  
ATOM  10219  C7   DT J 142     140.235 158.095  75.934  1.00101.68           C  
ATOM  10220  C6   DT J 142     139.321 160.367  76.291  1.00101.68           C  
ATOM  10221  H5'  DT J 142     136.951 160.552  80.277  1.00101.68           H  
ATOM  10222 H5''  DT J 142     137.142 160.079  78.784  1.00101.68           H  
ATOM  10223  H4'  DT J 142     137.405 162.668  79.788  1.00101.68           H  
ATOM  10224  H3'  DT J 142     135.524 161.784  78.320  1.00101.68           H  
ATOM  10225  H2'  DT J 142     136.673 161.253  76.485  1.00101.68           H  
ATOM  10226 H2''  DT J 142     136.324 162.760  76.114  1.00101.68           H  
ATOM  10227  H1'  DT J 142     138.340 163.490  76.623  1.00101.68           H  
ATOM  10228  H3   DT J 142     141.258 161.798  73.720  1.00101.68           H  
ATOM  10229  H71  DT J 142     139.820 157.925  76.794  1.00101.68           H  
ATOM  10230  H72  DT J 142     139.777 157.587  75.247  1.00101.68           H  
ATOM  10231  H73  DT J 142     141.167 157.831  75.966  1.00101.68           H  
ATOM  10232  H6   DT J 142     138.803 160.006  76.974  1.00101.68           H  
ATOM  10233  P    DG J 143     134.341 164.143  77.849  1.00100.81           P  
ATOM  10234  OP1  DG J 143     134.036 165.402  78.548  1.00100.81           O  
ATOM  10235  OP2  DG J 143     133.451 162.978  78.025  1.00100.81           O  
ATOM  10236  O5'  DG J 143     134.511 164.429  76.281  1.00100.81           O  
ATOM  10237  C5'  DG J 143     135.298 165.533  75.850  1.00100.81           C  
ATOM  10238  C4'  DG J 143     135.473 165.550  74.342  1.00100.81           C  
ATOM  10239  O4'  DG J 143     136.409 164.513  73.962  1.00100.81           O  
ATOM  10240  C3'  DG J 143     134.203 165.291  73.529  1.00100.81           C  
ATOM  10241  O3'  DG J 143     134.116 166.191  72.445  1.00100.81           O  
ATOM  10242  C2'  DG J 143     134.379 163.858  73.069  1.00100.81           C  
ATOM  10243  C1'  DG J 143     135.878 163.799  72.880  1.00100.81           C  
ATOM  10244  N9   DG J 143     136.473 162.459  72.866  1.00100.81           N  
ATOM  10245  C8   DG J 143     136.170 161.385  73.666  1.00100.81           C  
ATOM  10246  N7   DG J 143     136.904 160.332  73.425  1.00100.81           N  
ATOM  10247  C5   DG J 143     137.741 160.737  72.399  1.00100.81           C  
ATOM  10248  C6   DG J 143     138.749 160.034  71.708  1.00100.81           C  
ATOM  10249  O6   DG J 143     139.126 158.865  71.868  1.00100.81           O  
ATOM  10250  N1   DG J 143     139.349 160.828  70.739  1.00100.81           N  
ATOM  10251  C2   DG J 143     139.017 162.131  70.478  1.00100.81           C  
ATOM  10252  N2   DG J 143     139.690 162.743  69.509  1.00100.81           N  
ATOM  10253  N3   DG J 143     138.080 162.792  71.111  1.00100.81           N  
ATOM  10254  C4   DG J 143     137.487 162.042  72.053  1.00100.81           C  
ATOM  10255  H5'  DG J 143     136.171 165.476  76.269  1.00100.81           H  
ATOM  10256 H5''  DG J 143     134.866 166.353  76.125  1.00100.81           H  
ATOM  10257  H4'  DG J 143     135.837 166.406  74.078  1.00100.81           H  
ATOM  10258  H3'  DG J 143     133.422 165.369  74.090  1.00100.81           H  
ATOM  10259  H2'  DG J 143     134.085 163.241  73.750  1.00100.81           H  
ATOM  10260 H2''  DG J 143     133.916 163.708  72.234  1.00100.81           H  
ATOM  10261  H1'  DG J 143     136.107 164.258  72.061  1.00100.81           H  
ATOM  10262  H8   DG J 143     135.515 161.409  74.325  1.00100.81           H  
ATOM  10263  H1   DG J 143     139.975 160.478  70.271  1.00100.81           H  
ATOM  10264  H21  DG J 143     139.375 163.457  69.154  1.00100.81           H  
ATOM  10265  H22  DG J 143     140.437 162.420  69.236  1.00100.81           H  
ATOM  10266  P    DA J 144     132.689 166.518  71.789  1.00111.67           P  
ATOM  10267  OP1  DA J 144     132.282 167.859  72.260  1.00111.67           O  
ATOM  10268  OP2  DA J 144     131.815 165.355  72.045  1.00111.67           O  
ATOM  10269  O5'  DA J 144     132.992 166.587  70.218  1.00111.67           O  
ATOM  10270  C5'  DA J 144     133.737 167.679  69.685  1.00111.67           C  
ATOM  10271  C4'  DA J 144     134.493 167.269  68.432  1.00111.67           C  
ATOM  10272  O4'  DA J 144     135.313 166.111  68.740  1.00111.67           O  
ATOM  10273  C3'  DA J 144     133.611 166.877  67.238  1.00111.67           C  
ATOM  10274  O3'  DA J 144     134.041 167.533  66.039  1.00111.67           O  
ATOM  10275  C2'  DA J 144     133.757 165.364  67.159  1.00111.67           C  
ATOM  10276  C1'  DA J 144     135.123 165.117  67.768  1.00111.67           C  
ATOM  10277  N9   DA J 144     135.234 163.813  68.393  1.00111.67           N  
ATOM  10278  C8   DA J 144     134.505 163.338  69.444  1.00111.67           C  
ATOM  10279  N7   DA J 144     134.810 162.112  69.786  1.00111.67           N  
ATOM  10280  C5   DA J 144     135.804 161.763  68.895  1.00111.67           C  
ATOM  10281  C6   DA J 144     136.550 160.592  68.729  1.00111.67           C  
ATOM  10282  N6   DA J 144     136.399 159.515  69.498  1.00111.67           N  
ATOM  10283  N1   DA J 144     137.465 160.572  67.744  1.00111.67           N  
ATOM  10284  C2   DA J 144     137.614 161.657  66.982  1.00111.67           C  
ATOM  10285  N3   DA J 144     136.971 162.813  67.042  1.00111.67           N  
ATOM  10286  C4   DA J 144     136.074 162.801  68.029  1.00111.67           C  
ATOM  10287  H5'  DA J 144     134.370 167.985  70.352  1.00111.67           H  
ATOM  10288 H5''  DA J 144     133.129 168.403  69.467  1.00111.67           H  
ATOM  10289  H4'  DA J 144     135.073 167.998  68.165  1.00111.67           H  
ATOM  10290  H3'  DA J 144     132.687 167.107  67.424  1.00111.67           H  
ATOM  10291  H2'  DA J 144     133.065 164.932  67.678  1.00111.67           H  
ATOM  10292 H2''  DA J 144     133.737 165.059  66.244  1.00111.67           H  
ATOM  10293  H1'  DA J 144     135.800 165.203  67.083  1.00111.67           H  
ATOM  10294  H8   DA J 144     133.852 163.839  69.876  1.00111.67           H  
ATOM  10295  H61  DA J 144     136.905 158.831  69.383  1.00111.67           H  
ATOM  10296  H62  DA J 144     135.803 159.509  70.117  1.00111.67           H  
ATOM  10297  H2   DA J 144     138.256 161.592  66.317  1.00111.67           H  
ATOM  10298  P    DT J 145     133.232 167.333  64.662  1.00115.80           P  
ATOM  10299  OP1  DT J 145     133.468 168.525  63.821  1.00115.80           O  
ATOM  10300  OP2  DT J 145     131.850 166.933  65.000  1.00115.80           O  
ATOM  10301  O5'  DT J 145     133.948 166.072  63.983  1.00115.80           O  
ATOM  10302  C5'  DT J 145     135.365 166.058  63.851  1.00115.80           C  
ATOM  10303  C4'  DT J 145     135.872 164.728  63.312  1.00115.80           C  
ATOM  10304  O4'  DT J 145     135.752 163.708  64.326  1.00115.80           O  
ATOM  10305  C3'  DT J 145     135.118 164.181  62.095  1.00115.80           C  
ATOM  10306  O3'  DT J 145     135.895 164.336  60.916  1.00115.80           O  
ATOM  10307  C2'  DT J 145     134.867 162.703  62.433  1.00115.80           C  
ATOM  10308  C1'  DT J 145     135.723 162.473  63.668  1.00115.80           C  
ATOM  10309  N1   DT J 145     135.191 161.422  64.600  1.00115.80           N  
ATOM  10310  C2   DT J 145     135.736 160.158  64.576  1.00115.80           C  
ATOM  10311  O2   DT J 145     136.645 159.832  63.834  1.00115.80           O  
ATOM  10312  N3   DT J 145     135.180 159.277  65.460  1.00115.80           N  
ATOM  10313  C4   DT J 145     134.156 159.522  66.345  1.00115.80           C  
ATOM  10314  O4   DT J 145     133.727 158.659  67.099  1.00115.80           O  
ATOM  10315  C5   DT J 145     133.626 160.863  66.321  1.00115.80           C  
ATOM  10316  C7   DT J 145     132.507 161.248  67.241  1.00115.80           C  
ATOM  10317  C6   DT J 145     134.162 161.739  65.458  1.00115.80           C  
ATOM  10318  H5'  DT J 145     135.763 166.218  64.720  1.00115.80           H  
ATOM  10319 H5''  DT J 145     135.632 166.766  63.245  1.00115.80           H  
ATOM  10320  H4'  DT J 145     136.808 164.824  63.078  1.00115.80           H  
ATOM  10321  H3'  DT J 145     134.272 164.642  61.995  1.00115.80           H  
ATOM  10322 HO3'  DT J 145     136.188 163.657  60.516  1.00115.80           H  
ATOM  10323  H2'  DT J 145     133.931 162.554  62.634  1.00115.80           H  
ATOM  10324 H2''  DT J 145     135.158 162.133  61.705  1.00115.80           H  
ATOM  10325  H1'  DT J 145     136.623 162.240  63.395  1.00115.80           H  
ATOM  10326  H3   DT J 145     135.505 158.483  65.464  1.00115.80           H  
ATOM  10327  H71  DT J 145     132.622 162.169  67.522  1.00115.80           H  
ATOM  10328  H72  DT J 145     131.660 161.154  66.776  1.00115.80           H  
ATOM  10329  H73  DT J 145     132.514 160.669  68.019  1.00115.80           H  
ATOM  10330  H6   DT J 145     133.825 162.604  65.441  1.00115.80           H  
TER   10331       DT J 145                                                      
ATOM  10332  N   LYS A  38      77.309 139.178 101.396  1.00 96.85           N  
ATOM  10333  CA  LYS A  38      78.745 139.220 101.161  1.00 96.85           C  
ATOM  10334  C   LYS A  38      79.423 139.918 102.351  1.00 96.85           C  
ATOM  10335  O   LYS A  38      78.905 140.922 102.834  1.00 96.85           O  
ATOM  10336  CB  LYS A  38      79.044 139.944  99.847  1.00 96.85           C  
ATOM  10337  CG  LYS A  38      80.504 139.979  99.445  1.00 96.85           C  
ATOM  10338  CD  LYS A  38      81.163 141.278  99.847  1.00 96.85           C  
ATOM  10339  CE  LYS A  38      82.660 141.125  99.974  1.00 96.85           C  
ATOM  10340  NZ  LYS A  38      83.295 142.445 100.241  1.00 96.85           N  
ATOM  10341  H   LYS A  38      76.880 139.848 101.070  1.00 96.85           H  
ATOM  10342  HA  LYS A  38      79.033 138.307 101.059  1.00 96.85           H  
ATOM  10343  HB2 LYS A  38      78.561 139.495  99.135  1.00 96.85           H  
ATOM  10344  HB3 LYS A  38      78.738 140.860  99.924  1.00 96.85           H  
ATOM  10345  HG2 LYS A  38      80.974 139.252  99.867  1.00 96.85           H  
ATOM  10346  HG3 LYS A  38      80.569 139.896  98.482  1.00 96.85           H  
ATOM  10347  HD2 LYS A  38      80.988 141.945  99.167  1.00 96.85           H  
ATOM  10348  HD3 LYS A  38      80.815 141.576 100.697  1.00 96.85           H  
ATOM  10349  HE2 LYS A  38      82.852 140.532 100.718  1.00 96.85           H  
ATOM  10350  HE3 LYS A  38      83.023 140.767  99.150  1.00 96.85           H  
ATOM  10351  HZ1 LYS A  38      84.172 142.348 100.362  1.00 96.85           H  
ATOM  10352  HZ2 LYS A  38      83.154 142.993  99.554  1.00 96.85           H  
ATOM  10353  HZ3 LYS A  38      82.940 142.805 100.975  1.00 96.85           H  
ATOM  10354  N   PRO A  39      80.565 139.413 102.834  1.00 95.50           N  
ATOM  10355  CA  PRO A  39      81.151 140.003 104.042  1.00 95.50           C  
ATOM  10356  C   PRO A  39      81.635 141.427 103.834  1.00 95.50           C  
ATOM  10357  O   PRO A  39      82.116 141.797 102.762  1.00 95.50           O  
ATOM  10358  CB  PRO A  39      82.329 139.076 104.371  1.00 95.50           C  
ATOM  10359  CG  PRO A  39      82.097 137.851 103.636  1.00 95.50           C  
ATOM  10360  CD  PRO A  39      81.355 138.241 102.405  1.00 95.50           C  
ATOM  10361  HA  PRO A  39      80.510 139.984 104.767  1.00 95.50           H  
ATOM  10362  HB2 PRO A  39      83.157 139.491 104.085  1.00 95.50           H  
ATOM  10363  HB3 PRO A  39      82.350 138.903 105.326  1.00 95.50           H  
ATOM  10364  HG2 PRO A  39      82.950 137.448 103.409  1.00 95.50           H  
ATOM  10365  HG3 PRO A  39      81.569 137.244 104.179  1.00 95.50           H  
ATOM  10366  HD2 PRO A  39      81.992 138.501 101.725  1.00 95.50           H  
ATOM  10367  HD3 PRO A  39      80.801 137.501 102.124  1.00 95.50           H  
ATOM  10368  N   HIS A  40      81.510 142.220 104.889  1.00 95.22           N  
ATOM  10369  CA  HIS A  40      81.943 143.606 104.864  1.00 95.22           C  
ATOM  10370  C   HIS A  40      83.453 143.590 104.733  1.00 95.22           C  
ATOM  10371  O   HIS A  40      84.122 142.735 105.319  1.00 95.22           O  
ATOM  10372  CB  HIS A  40      81.526 144.334 106.134  1.00 95.22           C  
ATOM  10373  CG  HIS A  40      82.033 145.736 106.215  1.00 95.22           C  
ATOM  10374  ND1 HIS A  40      82.731 146.210 107.304  1.00 95.22           N  
ATOM  10375  CD2 HIS A  40      81.949 146.765 105.342  1.00 95.22           C  
ATOM  10376  CE1 HIS A  40      83.051 147.475 107.100  1.00 95.22           C  
ATOM  10377  NE2 HIS A  40      82.588 147.837 105.917  1.00 95.22           N  
ATOM  10378  H   HIS A  40      81.172 141.977 105.641  1.00 95.22           H  
ATOM  10379  HA  HIS A  40      81.569 144.071 104.101  1.00 95.22           H  
ATOM  10380  HB2 HIS A  40      80.561 144.369 106.171  1.00 95.22           H  
ATOM  10381  HB3 HIS A  40      81.875 143.854 106.899  1.00 95.22           H  
ATOM  10382  HD2 HIS A  40      81.534 146.745 104.512  1.00 95.22           H  
ATOM  10383  HE1 HIS A  40      83.523 148.018 107.689  1.00 95.22           H  
ATOM  10384  HE2 HIS A  40      82.675 148.616 105.564  1.00 95.22           H  
ATOM  10385  N   ARG A  41      84.001 144.534 103.969  1.00 86.25           N  
ATOM  10386  CA  ARG A  41      85.439 144.545 103.740  1.00 86.25           C  
ATOM  10387  C   ARG A  41      86.037 145.937 103.659  1.00 86.25           C  
ATOM  10388  O   ARG A  41      85.821 146.646 102.677  1.00 86.25           O  
ATOM  10389  CB  ARG A  41      85.622 143.853 102.362  1.00 86.25           C  
ATOM  10390  CG  ARG A  41      87.003 143.700 101.822  1.00 86.25           C  
ATOM  10391  CD  ARG A  41      87.833 142.951 102.727  1.00 86.25           C  
ATOM  10392  NE  ARG A  41      88.418 143.936 103.606  1.00 86.25           N  
ATOM  10393  CZ  ARG A  41      89.314 143.702 104.530  1.00 86.25           C  
ATOM  10394  NH1 ARG A  41      89.762 142.492 104.741  1.00 86.25           N  
ATOM  10395  NH2 ARG A  41      89.674 144.707 105.299  1.00 86.25           N  
ATOM  10396  H   ARG A  41      83.565 145.164 103.580  1.00 86.25           H  
ATOM  10397  HA  ARG A  41      85.915 144.049 104.418  1.00 86.25           H  
ATOM  10398  HB2 ARG A  41      85.240 142.967 102.413  1.00 86.25           H  
ATOM  10399  HB3 ARG A  41      85.132 144.373 101.710  1.00 86.25           H  
ATOM  10400  HG2 ARG A  41      86.946 143.175 101.011  1.00 86.25           H  
ATOM  10401  HG3 ARG A  41      87.375 144.566 101.608  1.00 86.25           H  
ATOM  10402  HD2 ARG A  41      87.294 142.330 103.237  1.00 86.25           H  
ATOM  10403  HD3 ARG A  41      88.527 142.491 102.230  1.00 86.25           H  
ATOM  10404  HE  ARG A  41      88.416 144.747 103.334  1.00 86.25           H  
ATOM  10405 HH11 ARG A  41      89.514 141.825 104.267  1.00 86.25           H  
ATOM  10406 HH12 ARG A  41      90.328 142.373 105.348  1.00 86.25           H  
ATOM  10407 HH21 ARG A  41      89.363 145.477 105.138  1.00 86.25           H  
ATOM  10408 HH22 ARG A  41      90.254 144.614 105.907  1.00 86.25           H  
ATOM  10409  N   TYR A  42      86.981 146.205 104.579  1.00 86.48           N  
ATOM  10410  CA  TYR A  42      87.736 147.447 104.625  1.00 86.48           C  
ATOM  10411  C   TYR A  42      88.852 147.434 103.585  1.00 86.48           C  
ATOM  10412  O   TYR A  42      89.459 146.394 103.317  1.00 86.48           O  
ATOM  10413  CB  TYR A  42      88.295 147.693 106.032  1.00 86.48           C  
ATOM  10414  CG  TYR A  42      87.310 148.272 107.012  1.00 86.48           C  
ATOM  10415  CD1 TYR A  42      86.860 149.574 106.882  1.00 86.48           C  
ATOM  10416  CD2 TYR A  42      86.853 147.532 108.080  1.00 86.48           C  
ATOM  10417  CE1 TYR A  42      85.967 150.116 107.777  1.00 86.48           C  
ATOM  10418  CE2 TYR A  42      85.962 148.062 108.983  1.00 86.48           C  
ATOM  10419  CZ  TYR A  42      85.522 149.359 108.830  1.00 86.48           C  
ATOM  10420  OH  TYR A  42      84.628 149.908 109.721  1.00 86.48           O  
ATOM  10421  H   TYR A  42      87.201 145.667 105.215  1.00 86.48           H  
ATOM  10422  HA  TYR A  42      87.148 148.167 104.446  1.00 86.48           H  
ATOM  10423  HB2 TYR A  42      88.569 146.859 106.430  1.00 86.48           H  
ATOM  10424  HB3 TYR A  42      89.044 148.299 105.974  1.00 86.48           H  
ATOM  10425  HD1 TYR A  42      87.160 150.088 106.170  1.00 86.48           H  
ATOM  10426  HD2 TYR A  42      87.150 146.662 108.183  1.00 86.48           H  
ATOM  10427  HE1 TYR A  42      85.669 150.992 107.673  1.00 86.48           H  
ATOM  10428  HE2 TYR A  42      85.661 147.549 109.694  1.00 86.48           H  
ATOM  10429  HH  TYR A  42      84.450 149.360 110.331  1.00 86.48           H  
ATOM  10430  N   ARG A  43      89.133 148.592 103.006  1.00 84.25           N  
ATOM  10431  CA  ARG A  43      90.200 148.667 102.022  1.00 84.25           C  
ATOM  10432  C   ARG A  43      91.574 148.570 102.686  1.00 84.25           C  
ATOM  10433  O   ARG A  43      91.727 148.896 103.865  1.00 84.25           O  
ATOM  10434  CB  ARG A  43      90.096 149.923 101.170  1.00 84.25           C  
ATOM  10435  CG  ARG A  43      90.462 151.218 101.839  1.00 84.25           C  
ATOM  10436  CD  ARG A  43      89.622 152.364 101.285  1.00 84.25           C  
ATOM  10437  NE  ARG A  43      89.805 153.588 102.055  1.00 84.25           N  
ATOM  10438  CZ  ARG A  43      90.885 154.363 101.998  1.00 84.25           C  
ATOM  10439  NH1 ARG A  43      91.902 154.067 101.193  1.00 84.25           N  
ATOM  10440  NH2 ARG A  43      90.943 155.454 102.748  1.00 84.25           N  
ATOM  10441  H   ARG A  43      88.733 149.336 103.164  1.00 84.25           H  
ATOM  10442  HA  ARG A  43      90.059 147.909 101.444  1.00 84.25           H  
ATOM  10443  HB2 ARG A  43      90.707 149.807 100.426  1.00 84.25           H  
ATOM  10444  HB3 ARG A  43      89.190 149.985 100.838  1.00 84.25           H  
ATOM  10445  HG2 ARG A  43      90.324 151.147 102.794  1.00 84.25           H  
ATOM  10446  HG3 ARG A  43      91.392 151.411 101.649  1.00 84.25           H  
ATOM  10447  HD2 ARG A  43      89.888 152.537 100.369  1.00 84.25           H  
ATOM  10448  HD3 ARG A  43      88.680 152.139 101.311  1.00 84.25           H  
ATOM  10449  HE  ARG A  43      89.257 153.724 102.704  1.00 84.25           H  
ATOM  10450 HH11 ARG A  43      91.890 153.367 100.696  1.00 84.25           H  
ATOM  10451 HH12 ARG A  43      92.587 154.584 101.172  1.00 84.25           H  
ATOM  10452 HH21 ARG A  43      90.288 155.651 103.268  1.00 84.25           H  
ATOM  10453 HH22 ARG A  43      91.634 155.962 102.715  1.00 84.25           H  
ATOM  10454  N   PRO A  44      92.589 148.118 101.951  1.00 77.19           N  
ATOM  10455  CA  PRO A  44      93.943 148.018 102.518  1.00 77.19           C  
ATOM  10456  C   PRO A  44      94.500 149.350 103.011  1.00 77.19           C  
ATOM  10457  O   PRO A  44      94.539 150.338 102.275  1.00 77.19           O  
ATOM  10458  CB  PRO A  44      94.771 147.476 101.349  1.00 77.19           C  
ATOM  10459  CG  PRO A  44      93.788 146.852 100.450  1.00 77.19           C  
ATOM  10460  CD  PRO A  44      92.580 147.689 100.545  1.00 77.19           C  
ATOM  10461  HA  PRO A  44      93.964 147.379 103.245  1.00 77.19           H  
ATOM  10462  HB2 PRO A  44      95.217 148.213 100.906  1.00 77.19           H  
ATOM  10463  HB3 PRO A  44      95.412 146.829 101.680  1.00 77.19           H  
ATOM  10464  HG2 PRO A  44      94.129 146.850  99.544  1.00 77.19           H  
ATOM  10465  HG3 PRO A  44      93.591 145.952 100.748  1.00 77.19           H  
ATOM  10466  HD2 PRO A  44      92.639 148.455  99.961  1.00 77.19           H  
ATOM  10467  HD3 PRO A  44      91.814 147.138 100.345  1.00 77.19           H  
ATOM  10468  N   GLY A  45      94.939 149.356 104.271  1.00 74.95           N  
ATOM  10469  CA  GLY A  45      95.478 150.525 104.945  1.00 74.95           C  
ATOM  10470  C   GLY A  45      94.668 151.065 106.110  1.00 74.95           C  
ATOM  10471  O   GLY A  45      95.240 151.596 107.066  1.00 74.95           O  
ATOM  10472  H   GLY A  45      94.923 148.666 104.769  1.00 74.95           H  
ATOM  10473  HA2 GLY A  45      96.358 150.299 105.277  1.00 74.95           H  
ATOM  10474  HA3 GLY A  45      95.583 151.245 104.306  1.00 74.95           H  
ATOM  10475  N   THR A  46      93.345 150.951 106.044  1.00 77.25           N  
ATOM  10476  CA  THR A  46      92.487 151.479 107.100  1.00 77.25           C  
ATOM  10477  C   THR A  46      92.737 150.779 108.436  1.00 77.25           C  
ATOM  10478  O   THR A  46      92.910 151.426 109.481  1.00 77.25           O  
ATOM  10479  CB  THR A  46      91.032 151.341 106.688  1.00 77.25           C  
ATOM  10480  OG1 THR A  46      90.823 152.049 105.462  1.00 77.25           O  
ATOM  10481  CG2 THR A  46      90.130 151.927 107.756  1.00 77.25           C  
ATOM  10482  H   THR A  46      92.919 150.571 105.405  1.00 77.25           H  
ATOM  10483  HA  THR A  46      92.677 152.419 107.209  1.00 77.25           H  
ATOM  10484  HB  THR A  46      90.830 150.403 106.571  1.00 77.25           H  
ATOM  10485  HG1 THR A  46      90.111 151.790 105.102  1.00 77.25           H  
ATOM  10486 HG21 THR A  46      89.254 152.107 107.383  1.00 77.25           H  
ATOM  10487 HG22 THR A  46      90.036 151.313 108.498  1.00 77.25           H  
ATOM  10488 HG23 THR A  46      90.508 152.759 108.081  1.00 77.25           H  
ATOM  10489  N   VAL A  47      92.815 149.448 108.409  1.00 74.81           N  
ATOM  10490  CA  VAL A  47      93.013 148.674 109.633  1.00 74.81           C  
ATOM  10491  C   VAL A  47      94.439 148.852 110.143  1.00 74.81           C  
ATOM  10492  O   VAL A  47      94.676 148.821 111.359  1.00 74.81           O  
ATOM  10493  CB  VAL A  47      92.645 147.195 109.405  1.00 74.81           C  
ATOM  10494  CG1 VAL A  47      93.675 146.523 108.574  1.00 74.81           C  
ATOM  10495  CG2 VAL A  47      92.464 146.473 110.728  1.00 74.81           C  
ATOM  10496  H   VAL A  47      92.760 148.979 107.689  1.00 74.81           H  
ATOM  10497  HA  VAL A  47      92.411 149.017 110.310  1.00 74.81           H  
ATOM  10498  HB  VAL A  47      91.806 147.153 108.924  1.00 74.81           H  
ATOM  10499 HG11 VAL A  47      93.281 145.767 108.120  1.00 74.81           H  
ATOM  10500 HG12 VAL A  47      93.969 147.175 107.933  1.00 74.81           H  
ATOM  10501 HG13 VAL A  47      94.416 146.241 109.130  1.00 74.81           H  
ATOM  10502 HG21 VAL A  47      92.174 145.565 110.551  1.00 74.81           H  
ATOM  10503 HG22 VAL A  47      93.310 146.463 111.199  1.00 74.81           H  
ATOM  10504 HG23 VAL A  47      91.792 146.937 111.251  1.00 74.81           H  
ATOM  10505  N   ALA A  48      95.415 148.958 109.241  1.00 69.24           N  
ATOM  10506  CA  ALA A  48      96.785 149.232 109.661  1.00 69.24           C  
ATOM  10507  C   ALA A  48      96.830 150.514 110.478  1.00 69.24           C  
ATOM  10508  O   ALA A  48      97.480 150.574 111.527  1.00 69.24           O  
ATOM  10509  CB  ALA A  48      97.706 149.340 108.455  1.00 69.24           C  
ATOM  10510  H   ALA A  48      95.310 148.872 108.391  1.00 69.24           H  
ATOM  10511  HA  ALA A  48      97.096 148.507 110.221  1.00 69.24           H  
ATOM  10512  HB1 ALA A  48      98.611 149.482 108.772  1.00 69.24           H  
ATOM  10513  HB2 ALA A  48      97.655 148.520 107.943  1.00 69.24           H  
ATOM  10514  HB3 ALA A  48      97.422 150.096 107.919  1.00 69.24           H  
ATOM  10515  N   LEU A  49      96.169 151.559 109.991  1.00 69.66           N  
ATOM  10516  CA  LEU A  49      96.086 152.807 110.733  1.00 69.66           C  
ATOM  10517  C   LEU A  49      95.391 152.606 112.073  1.00 69.66           C  
ATOM  10518  O   LEU A  49      95.780 153.218 113.083  1.00 69.66           O  
ATOM  10519  CB  LEU A  49      95.337 153.835 109.910  1.00 69.66           C  
ATOM  10520  CG  LEU A  49      96.132 154.391 108.748  1.00 69.66           C  
ATOM  10521  CD1 LEU A  49      95.168 154.969 107.751  1.00 69.66           C  
ATOM  10522  CD2 LEU A  49      97.109 155.429 109.228  1.00 69.66           C  
ATOM  10523  H   LEU A  49      95.770 151.581 109.233  1.00 69.66           H  
ATOM  10524  HA  LEU A  49      96.979 153.133 110.890  1.00 69.66           H  
ATOM  10525  HB2 LEU A  49      94.544 153.419 109.546  1.00 69.66           H  
ATOM  10526  HB3 LEU A  49      95.086 154.577 110.479  1.00 69.66           H  
ATOM  10527  HG  LEU A  49      96.625 153.665 108.337  1.00 69.66           H  
ATOM  10528 HD11 LEU A  49      95.661 155.443 107.067  1.00 69.66           H  
ATOM  10529 HD12 LEU A  49      94.663 154.242 107.356  1.00 69.66           H  
ATOM  10530 HD13 LEU A  49      94.568 155.575 108.215  1.00 69.66           H  
ATOM  10531 HD21 LEU A  49      97.557 155.816 108.462  1.00 69.66           H  
ATOM  10532 HD22 LEU A  49      96.627 156.116 109.714  1.00 69.66           H  
ATOM  10533 HD23 LEU A  49      97.753 155.003 109.809  1.00 69.66           H  
ATOM  10534  N   ARG A  50      94.357 151.756 112.116  1.00 88.18           N  
ATOM  10535  CA  ARG A  50      93.721 151.516 113.409  1.00 88.18           C  
ATOM  10536  C   ARG A  50      94.689 150.860 114.381  1.00 88.18           C  
ATOM  10537  O   ARG A  50      94.730 151.219 115.564  1.00 88.18           O  
ATOM  10538  CB  ARG A  50      92.494 150.623 113.265  1.00 88.18           C  
ATOM  10539  CG  ARG A  50      91.236 151.338 112.881  1.00 88.18           C  
ATOM  10540  CD  ARG A  50      90.221 150.364 112.291  1.00 88.18           C  
ATOM  10541  NE  ARG A  50      89.056 151.015 111.698  1.00 88.18           N  
ATOM  10542  CZ  ARG A  50      88.167 151.758 112.357  1.00 88.18           C  
ATOM  10543  NH1 ARG A  50      88.266 151.983 113.666  1.00 88.18           N  
ATOM  10544  NH2 ARG A  50      87.153 152.283 111.688  1.00 88.18           N  
ATOM  10545  H   ARG A  50      94.019 151.338 111.448  1.00 88.18           H  
ATOM  10546  HA  ARG A  50      93.434 152.360 113.784  1.00 88.18           H  
ATOM  10547  HB2 ARG A  50      92.683 149.954 112.590  1.00 88.18           H  
ATOM  10548  HB3 ARG A  50      92.329 150.187 114.114  1.00 88.18           H  
ATOM  10549  HG2 ARG A  50      90.888 151.763 113.674  1.00 88.18           H  
ATOM  10550  HG3 ARG A  50      91.437 152.006 112.208  1.00 88.18           H  
ATOM  10551  HD2 ARG A  50      90.639 149.836 111.595  1.00 88.18           H  
ATOM  10552  HD3 ARG A  50      89.909 149.777 112.998  1.00 88.18           H  
ATOM  10553  HE  ARG A  50      88.843 150.775 110.901  1.00 88.18           H  
ATOM  10554 HH11 ARG A  50      88.896 151.643 114.133  1.00 88.18           H  
ATOM  10555 HH12 ARG A  50      87.667 152.456 114.060  1.00 88.18           H  
ATOM  10556 HH21 ARG A  50      87.083 152.145 110.842  1.00 88.18           H  
ATOM  10557 HH22 ARG A  50      86.568 152.763 112.096  1.00 88.18           H  
ATOM  10558  N   GLU A  51      95.522 149.948 113.888  1.00 68.96           N  
ATOM  10559  CA  GLU A  51      96.502 149.305 114.753  1.00 68.96           C  
ATOM  10560  C   GLU A  51      97.562 150.295 115.198  1.00 68.96           C  
ATOM  10561  O   GLU A  51      98.034 150.226 116.337  1.00 68.96           O  
ATOM  10562  CB  GLU A  51      97.157 148.109 114.054  1.00 68.96           C  
ATOM  10563  CG  GLU A  51      96.295 146.849 113.973  1.00 68.96           C  
ATOM  10564  CD  GLU A  51      96.968 145.746 113.161  1.00 68.96           C  
ATOM  10565  OE1 GLU A  51      98.142 145.935 112.784  1.00 68.96           O  
ATOM  10566  OE2 GLU A  51      96.288 144.761 112.781  1.00 68.96           O  
ATOM  10567  H   GLU A  51      95.551 149.684 113.065  1.00 68.96           H  
ATOM  10568  HA  GLU A  51      96.047 148.987 115.560  1.00 68.96           H  
ATOM  10569  HB2 GLU A  51      97.412 148.357 113.147  1.00 68.96           H  
ATOM  10570  HB3 GLU A  51      97.936 147.868 114.576  1.00 68.96           H  
ATOM  10571  HG2 GLU A  51      96.212 146.516 114.871  1.00 68.96           H  
ATOM  10572  HG3 GLU A  51      95.411 147.054 113.606  1.00 68.96           H  
ATOM  10573  N   ILE A  52      97.964 151.212 114.310  1.00 63.69           N  
ATOM  10574  CA  ILE A  52      98.942 152.217 114.709  1.00 63.69           C  
ATOM  10575  C   ILE A  52      98.405 153.041 115.868  1.00 63.69           C  
ATOM  10576  O   ILE A  52      99.064 153.178 116.901  1.00 63.69           O  
ATOM  10577  CB  ILE A  52      99.306 153.133 113.524  1.00 63.69           C  
ATOM  10578  CG1 ILE A  52     100.081 152.377 112.457  1.00 63.69           C  
ATOM  10579  CG2 ILE A  52     100.139 154.317 114.009  1.00 63.69           C  
ATOM  10580  CD1 ILE A  52     100.158 153.087 111.145  1.00 63.69           C  
ATOM  10581  H   ILE A  52      97.696 151.273 113.494  1.00 63.69           H  
ATOM  10582  HA  ILE A  52      99.757 151.777 114.985  1.00 63.69           H  
ATOM  10583  HB  ILE A  52      98.495 153.475 113.129  1.00 63.69           H  
ATOM  10584 HG12 ILE A  52     100.981 152.247 112.766  1.00 63.69           H  
ATOM  10585 HG13 ILE A  52      99.654 151.530 112.307  1.00 63.69           H  
ATOM  10586 HG21 ILE A  52     100.677 154.672 113.290  1.00 63.69           H  
ATOM  10587 HG22 ILE A  52      99.551 155.013 114.335  1.00 63.69           H  
ATOM  10588 HG23 ILE A  52     100.724 154.016 114.718  1.00 63.69           H  
ATOM  10589 HD11 ILE A  52     100.362 152.443 110.455  1.00 63.69           H  
ATOM  10590 HD12 ILE A  52      99.308 153.514 110.966  1.00 63.69           H  
ATOM  10591 HD13 ILE A  52     100.859 153.755 111.197  1.00 63.69           H  
ATOM  10592  N   ARG A  53      97.201 153.596 115.723  1.00 68.90           N  
ATOM  10593  CA  ARG A  53      96.648 154.401 116.809  1.00 68.90           C  
ATOM  10594  C   ARG A  53      96.481 153.598 118.095  1.00 68.90           C  
ATOM  10595  O   ARG A  53      96.851 154.064 119.186  1.00 68.90           O  
ATOM  10596  CB  ARG A  53      95.322 155.025 116.393  1.00 68.90           C  
ATOM  10597  CG  ARG A  53      95.463 156.133 115.382  1.00 68.90           C  
ATOM  10598  CD  ARG A  53      94.113 156.732 115.069  1.00 68.90           C  
ATOM  10599  NE  ARG A  53      94.084 157.480 113.809  1.00 68.90           N  
ATOM  10600  CZ  ARG A  53      93.611 157.041 112.642  1.00 68.90           C  
ATOM  10601  NH1 ARG A  53      93.061 155.839 112.510  1.00 68.90           N  
ATOM  10602  NH2 ARG A  53      93.656 157.847 111.589  1.00 68.90           N  
ATOM  10603  H   ARG A  53      96.698 153.529 115.032  1.00 68.90           H  
ATOM  10604  HA  ARG A  53      97.257 155.127 116.998  1.00 68.90           H  
ATOM  10605  HB2 ARG A  53      94.771 154.335 115.995  1.00 68.90           H  
ATOM  10606  HB3 ARG A  53      94.886 155.388 117.177  1.00 68.90           H  
ATOM  10607  HG2 ARG A  53      96.041 156.823 115.738  1.00 68.90           H  
ATOM  10608  HG3 ARG A  53      95.832 155.772 114.565  1.00 68.90           H  
ATOM  10609  HD2 ARG A  53      93.451 156.029 115.067  1.00 68.90           H  
ATOM  10610  HD3 ARG A  53      93.902 157.360 115.776  1.00 68.90           H  
ATOM  10611  HE  ARG A  53      94.558 158.196 113.783  1.00 68.90           H  
ATOM  10612 HH11 ARG A  53      93.013 155.295 113.171  1.00 68.90           H  
ATOM  10613 HH12 ARG A  53      92.759 155.597 111.742  1.00 68.90           H  
ATOM  10614 HH21 ARG A  53      94.002 158.632 111.663  1.00 68.90           H  
ATOM  10615 HH22 ARG A  53      93.346 157.585 110.831  1.00 68.90           H  
ATOM  10616  N   ARG A  54      96.026 152.350 117.971  1.00 66.42           N  
ATOM  10617  CA  ARG A  54      95.828 151.511 119.146  1.00 66.42           C  
ATOM  10618  C   ARG A  54      97.154 151.258 119.851  1.00 66.42           C  
ATOM  10619  O   ARG A  54      97.258 151.436 121.070  1.00 66.42           O  
ATOM  10620  CB  ARG A  54      95.061 150.234 118.777  1.00 66.42           C  
ATOM  10621  CG  ARG A  54      94.802 149.268 119.947  1.00 66.42           C  
ATOM  10622  CD  ARG A  54      94.311 147.897 119.513  1.00 66.42           C  
ATOM  10623  NE  ARG A  54      95.140 147.201 118.540  1.00 66.42           N  
ATOM  10624  CZ  ARG A  54      94.958 145.931 118.184  1.00 66.42           C  
ATOM  10625  NH1 ARG A  54      93.973 145.204 118.705  1.00 66.42           N  
ATOM  10626  NH2 ARG A  54      95.759 145.379 117.288  1.00 66.42           N  
ATOM  10627  H   ARG A  54      95.853 151.969 117.223  1.00 66.42           H  
ATOM  10628  HA  ARG A  54      95.269 151.997 119.770  1.00 66.42           H  
ATOM  10629  HB2 ARG A  54      94.196 150.480 118.414  1.00 66.42           H  
ATOM  10630  HB3 ARG A  54      95.577 149.760 118.108  1.00 66.42           H  
ATOM  10631  HG2 ARG A  54      95.612 149.120 120.452  1.00 66.42           H  
ATOM  10632  HG3 ARG A  54      94.124 149.653 120.522  1.00 66.42           H  
ATOM  10633  HD2 ARG A  54      94.245 147.335 120.300  1.00 66.42           H  
ATOM  10634  HD3 ARG A  54      93.432 148.003 119.117  1.00 66.42           H  
ATOM  10635  HE  ARG A  54      95.874 147.579 118.307  1.00 66.42           H  
ATOM  10636 HH11 ARG A  54      93.433 145.530 119.288  1.00 66.42           H  
ATOM  10637 HH12 ARG A  54      93.876 144.387 118.457  1.00 66.42           H  
ATOM  10638 HH21 ARG A  54      96.396 145.840 116.943  1.00 66.42           H  
ATOM  10639 HH22 ARG A  54      95.642 144.560 117.055  1.00 66.42           H  
ATOM  10640  N   TYR A  55      98.183 150.845 119.112  1.00 64.17           N  
ATOM  10641  CA  TYR A  55      99.431 150.490 119.778  1.00 64.17           C  
ATOM  10642  C   TYR A  55     100.208 151.724 120.231  1.00 64.17           C  
ATOM  10643  O   TYR A  55     101.010 151.629 121.169  1.00 64.17           O  
ATOM  10644  CB  TYR A  55     100.314 149.621 118.875  1.00 64.17           C  
ATOM  10645  CG  TYR A  55      99.771 148.247 118.616  1.00 64.17           C  
ATOM  10646  CD1 TYR A  55      99.565 147.363 119.655  1.00 64.17           C  
ATOM  10647  CD2 TYR A  55      99.529 147.809 117.335  1.00 64.17           C  
ATOM  10648  CE1 TYR A  55      99.069 146.113 119.432  1.00 64.17           C  
ATOM  10649  CE2 TYR A  55      99.048 146.554 117.098  1.00 64.17           C  
ATOM  10650  CZ  TYR A  55      98.822 145.707 118.150  1.00 64.17           C  
ATOM  10651  OH  TYR A  55      98.340 144.446 117.918  1.00 64.17           O  
ATOM  10652  H   TYR A  55      98.180 150.772 118.252  1.00 64.17           H  
ATOM  10653  HA  TYR A  55      99.216 149.978 120.570  1.00 64.17           H  
ATOM  10654  HB2 TYR A  55     100.387 150.051 118.012  1.00 64.17           H  
ATOM  10655  HB3 TYR A  55     101.191 149.521 119.277  1.00 64.17           H  
ATOM  10656  HD1 TYR A  55      99.724 147.645 120.524  1.00 64.17           H  
ATOM  10657  HD2 TYR A  55      99.677 148.386 116.626  1.00 64.17           H  
ATOM  10658  HE1 TYR A  55      98.922 145.534 120.143  1.00 64.17           H  
ATOM  10659  HE2 TYR A  55      98.877 146.274 116.232  1.00 64.17           H  
ATOM  10660  HH  TYR A  55      98.586 144.186 117.159  1.00 64.17           H  
ATOM  10661  N   GLN A  56      99.984 152.888 119.616  1.00 61.07           N  
ATOM  10662  CA  GLN A  56     100.653 154.092 120.090  1.00 61.07           C  
ATOM  10663  C   GLN A  56      99.976 154.675 121.314  1.00 61.07           C  
ATOM  10664  O   GLN A  56     100.584 155.489 122.016  1.00 61.07           O  
ATOM  10665  CB  GLN A  56     100.668 155.152 118.990  1.00 61.07           C  
ATOM  10666  CG  GLN A  56     101.574 154.833 117.836  1.00 61.07           C  
ATOM  10667  CD  GLN A  56     101.662 155.957 116.833  1.00 61.07           C  
ATOM  10668  OE1 GLN A  56     100.753 156.774 116.720  1.00 61.07           O  
ATOM  10669  NE2 GLN A  56     102.767 156.018 116.114  1.00 61.07           N  
ATOM  10670  H   GLN A  56      99.436 153.014 118.965  1.00 61.07           H  
ATOM  10671  HA  GLN A  56     101.568 153.889 120.323  1.00 61.07           H  
ATOM  10672  HB2 GLN A  56      99.768 155.228 118.646  1.00 61.07           H  
ATOM  10673  HB3 GLN A  56     100.946 155.996 119.371  1.00 61.07           H  
ATOM  10674  HG2 GLN A  56     102.462 154.682 118.184  1.00 61.07           H  
ATOM  10675  HG3 GLN A  56     101.261 154.045 117.385  1.00 61.07           H  
ATOM  10676 HE21 GLN A  56     103.383 155.432 116.227  1.00 61.07           H  
ATOM  10677 HE22 GLN A  56     102.866 156.642 115.533  1.00 61.07           H  
ATOM  10678  N   LYS A  57      98.743 154.255 121.589  1.00 66.65           N  
ATOM  10679  CA  LYS A  57      98.027 154.723 122.765  1.00 66.65           C  
ATOM  10680  C   LYS A  57      98.355 153.913 124.012  1.00 66.65           C  
ATOM  10681  O   LYS A  57      98.295 154.442 125.129  1.00 66.65           O  
ATOM  10682  CB  LYS A  57      96.550 154.776 122.423  1.00 66.65           C  
ATOM  10683  CG  LYS A  57      96.310 156.152 121.906  1.00 66.65           C  
ATOM  10684  CD  LYS A  57      94.921 156.445 121.380  1.00 66.65           C  
ATOM  10685  CE  LYS A  57      94.907 157.729 120.491  1.00 66.65           C  
ATOM  10686  NZ  LYS A  57      96.145 158.086 119.679  1.00 66.65           N  
ATOM  10687  H   LYS A  57      98.314 153.689 121.113  1.00 66.65           H  
ATOM  10688  HA  LYS A  57      98.324 155.619 122.978  1.00 66.65           H  
ATOM  10689  HB2 LYS A  57      96.368 154.128 121.711  1.00 66.65           H  
ATOM  10690  HB3 LYS A  57      95.974 154.626 123.185  1.00 66.65           H  
ATOM  10691  HG2 LYS A  57      96.440 156.741 122.669  1.00 66.65           H  
ATOM  10692  HG3 LYS A  57      96.982 156.312 121.231  1.00 66.65           H  
ATOM  10693  HD2 LYS A  57      94.554 155.704 120.865  1.00 66.65           H  
ATOM  10694  HD3 LYS A  57      94.394 156.632 122.173  1.00 66.65           H  
ATOM  10695  HE2 LYS A  57      94.204 157.590 119.844  1.00 66.65           H  
ATOM  10696  HE3 LYS A  57      94.685 158.497 121.038  1.00 66.65           H  
ATOM  10697  HZ1 LYS A  57      95.982 158.788 119.150  1.00 66.65           H  
ATOM  10698  HZ2 LYS A  57      96.823 158.293 120.219  1.00 66.65           H  
ATOM  10699  HZ3 LYS A  57      96.390 157.400 119.169  1.00 66.65           H  
ATOM  10700  N   SER A  58      98.723 152.656 123.841  1.00 62.79           N  
ATOM  10701  CA  SER A  58      99.003 151.734 124.923  1.00 62.79           C  
ATOM  10702  C   SER A  58     100.515 151.568 125.039  1.00 62.79           C  
ATOM  10703  O   SER A  58     101.276 152.015 124.176  1.00 62.79           O  
ATOM  10704  CB  SER A  58      98.280 150.410 124.690  1.00 62.79           C  
ATOM  10705  OG  SER A  58      98.811 149.764 123.547  1.00 62.79           O  
ATOM  10706  H   SER A  58      98.841 152.300 123.073  1.00 62.79           H  
ATOM  10707  HA  SER A  58      98.696 152.079 125.764  1.00 62.79           H  
ATOM  10708  HB2 SER A  58      98.524 149.829 125.417  1.00 62.79           H  
ATOM  10709  HB3 SER A  58      97.308 150.536 124.654  1.00 62.79           H  
ATOM  10710  HG  SER A  58      98.755 148.927 123.620  1.00 62.79           H  
ATOM  10711  N   THR A  59     100.940 150.922 126.121  1.00 58.78           N  
ATOM  10712  CA  THR A  59     102.351 150.752 126.415  1.00 58.78           C  
ATOM  10713  C   THR A  59     102.743 149.308 126.652  1.00 58.78           C  
ATOM  10714  O   THR A  59     103.928 149.044 126.871  1.00 58.78           O  
ATOM  10715  CB  THR A  59     102.728 151.566 127.653  1.00 58.78           C  
ATOM  10716  OG1 THR A  59     102.059 151.023 128.794  1.00 58.78           O  
ATOM  10717  CG2 THR A  59     102.320 153.015 127.481  1.00 58.78           C  
ATOM  10718  H   THR A  59     100.427 150.576 126.718  1.00 58.78           H  
ATOM  10719  HA  THR A  59     102.894 151.073 125.688  1.00 58.78           H  
ATOM  10720  HB  THR A  59     103.687 151.528 127.783  1.00 58.78           H  
ATOM  10721  HG1 THR A  59     102.166 151.527 129.454  1.00 58.78           H  
ATOM  10722 HG21 THR A  59     102.716 153.555 128.183  1.00 58.78           H  
ATOM  10723 HG22 THR A  59     102.620 153.344 126.621  1.00 58.78           H  
ATOM  10724 HG23 THR A  59     101.354 153.096 127.532  1.00 58.78           H  
ATOM  10725  N   GLU A  60     101.801 148.372 126.624  1.00 66.36           N  
ATOM  10726  CA  GLU A  60     102.136 146.986 126.894  1.00 66.36           C  
ATOM  10727  C   GLU A  60     103.105 146.450 125.842  1.00 66.36           C  
ATOM  10728  O   GLU A  60     103.110 146.880 124.686  1.00 66.36           O  
ATOM  10729  CB  GLU A  60     100.849 146.158 127.014  1.00 66.36           C  
ATOM  10730  CG  GLU A  60      99.886 146.176 125.812  1.00 66.36           C  
ATOM  10731  CD  GLU A  60     100.304 145.304 124.654  1.00 66.36           C  
ATOM  10732  OE1 GLU A  60     100.803 144.185 124.898  1.00 66.36           O  
ATOM  10733  OE2 GLU A  60     100.143 145.744 123.497  1.00 66.36           O  
ATOM  10734  H   GLU A  60     100.975 148.518 126.450  1.00 66.36           H  
ATOM  10735  HA  GLU A  60     102.592 146.952 127.747  1.00 66.36           H  
ATOM  10736  HB2 GLU A  60     101.093 145.230 127.163  1.00 66.36           H  
ATOM  10737  HB3 GLU A  60     100.350 146.476 127.783  1.00 66.36           H  
ATOM  10738  HG2 GLU A  60      99.037 145.845 126.129  1.00 66.36           H  
ATOM  10739  HG3 GLU A  60      99.773 147.084 125.483  1.00 66.36           H  
ATOM  10740  N   LEU A  61     103.935 145.505 126.272  1.00 64.08           N  
ATOM  10741  CA  LEU A  61     104.929 144.880 125.409  1.00 64.08           C  
ATOM  10742  C   LEU A  61     104.312 144.008 124.326  1.00 64.08           C  
ATOM  10743  O   LEU A  61     103.344 143.280 124.560  1.00 64.08           O  
ATOM  10744  CB  LEU A  61     105.886 144.060 126.248  1.00 64.08           C  
ATOM  10745  CG  LEU A  61     106.778 144.943 127.109  1.00 64.08           C  
ATOM  10746  CD1 LEU A  61     107.419 144.085 128.149  1.00 64.08           C  
ATOM  10747  CD2 LEU A  61     107.820 145.685 126.294  1.00 64.08           C  
ATOM  10748  H   LEU A  61     103.957 145.216 127.081  1.00 64.08           H  
ATOM  10749  HA  LEU A  61     105.429 145.576 124.966  1.00 64.08           H  
ATOM  10750  HB2 LEU A  61     105.370 143.481 126.825  1.00 64.08           H  
ATOM  10751  HB3 LEU A  61     106.450 143.538 125.663  1.00 64.08           H  
ATOM  10752  HG  LEU A  61     106.228 145.601 127.556  1.00 64.08           H  
ATOM  10753 HD11 LEU A  61     107.978 144.638 128.715  1.00 64.08           H  
ATOM  10754 HD12 LEU A  61     106.714 143.675 128.672  1.00 64.08           H  
ATOM  10755 HD13 LEU A  61     107.946 143.401 127.709  1.00 64.08           H  
ATOM  10756 HD21 LEU A  61     108.511 146.017 126.885  1.00 64.08           H  
ATOM  10757 HD22 LEU A  61     108.199 145.080 125.640  1.00 64.08           H  
ATOM  10758 HD23 LEU A  61     107.388 146.428 125.846  1.00 64.08           H  
ATOM  10759  N   LEU A  62     104.881 144.106 123.123  1.00 58.59           N  
ATOM  10760  CA  LEU A  62     104.337 143.450 121.950  1.00 58.59           C  
ATOM  10761  C   LEU A  62     105.000 142.134 121.579  1.00 58.59           C  
ATOM  10762  O   LEU A  62     104.428 141.390 120.779  1.00 58.59           O  
ATOM  10763  CB  LEU A  62     104.511 144.376 120.757  1.00 58.59           C  
ATOM  10764  CG  LEU A  62     103.940 145.770 120.922  1.00 58.59           C  
ATOM  10765  CD1 LEU A  62     104.350 146.590 119.733  1.00 58.59           C  
ATOM  10766  CD2 LEU A  62     102.442 145.714 121.086  1.00 58.59           C  
ATOM  10767  H   LEU A  62     105.590 144.558 122.958  1.00 58.59           H  
ATOM  10768  HA  LEU A  62     103.395 143.288 122.072  1.00 58.59           H  
ATOM  10769  HB2 LEU A  62     105.458 144.467 120.593  1.00 58.59           H  
ATOM  10770  HB3 LEU A  62     104.080 143.966 119.996  1.00 58.59           H  
ATOM  10771  HG  LEU A  62     104.320 146.183 121.708  1.00 58.59           H  
ATOM  10772 HD11 LEU A  62     103.836 147.412 119.720  1.00 58.59           H  
ATOM  10773 HD12 LEU A  62     105.295 146.787 119.817  1.00 58.59           H  
ATOM  10774 HD13 LEU A  62     104.197 146.074 118.927  1.00 58.59           H  
ATOM  10775 HD21 LEU A  62     102.085 146.615 121.057  1.00 58.59           H  
ATOM  10776 HD22 LEU A  62     102.071 145.178 120.367  1.00 58.59           H  
ATOM  10777 HD23 LEU A  62     102.242 145.306 121.943  1.00 58.59           H  
ATOM  10778  N   ILE A  63     106.169 141.825 122.120  1.00 61.96           N  
ATOM  10779  CA  ILE A  63     106.815 140.538 121.880  1.00 61.96           C  
ATOM  10780  C   ILE A  63     106.478 139.567 122.998  1.00 61.96           C  
ATOM  10781  O   ILE A  63     106.319 139.954 124.160  1.00 61.96           O  
ATOM  10782  CB  ILE A  63     108.332 140.708 121.711  1.00 61.96           C  
ATOM  10783  CG1 ILE A  63     108.629 141.625 120.519  1.00 61.96           C  
ATOM  10784  CG2 ILE A  63     108.974 139.361 121.504  1.00 61.96           C  
ATOM  10785  CD1 ILE A  63     110.050 142.132 120.461  1.00 61.96           C  
ATOM  10786  H   ILE A  63     106.617 142.351 122.625  1.00 61.96           H  
ATOM  10787  HA  ILE A  63     106.494 140.154 121.056  1.00 61.96           H  
ATOM  10788  HB  ILE A  63     108.687 141.108 122.514  1.00 61.96           H  
ATOM  10789 HG12 ILE A  63     108.458 141.122 119.711  1.00 61.96           H  
ATOM  10790 HG13 ILE A  63     108.057 142.401 120.538  1.00 61.96           H  
ATOM  10791 HG21 ILE A  63     109.826 139.460 121.060  1.00 61.96           H  
ATOM  10792 HG22 ILE A  63     109.097 138.939 122.366  1.00 61.96           H  
ATOM  10793 HG23 ILE A  63     108.378 138.824 120.962  1.00 61.96           H  
ATOM  10794 HD11 ILE A  63     110.085 142.926 119.910  1.00 61.96           H  
ATOM  10795 HD12 ILE A  63     110.343 142.342 121.360  1.00 61.96           H  
ATOM  10796 HD13 ILE A  63     110.613 141.443 120.080  1.00 61.96           H  
ATOM  10797  N   ARG A  64     106.376 138.295 122.640  1.00 76.62           N  
ATOM  10798  CA  ARG A  64     106.088 137.252 123.605  1.00 76.62           C  
ATOM  10799  C   ARG A  64     107.271 137.017 124.539  1.00 76.62           C  
ATOM  10800  O   ARG A  64     108.431 137.026 124.123  1.00 76.62           O  
ATOM  10801  CB  ARG A  64     105.746 135.962 122.885  1.00 76.62           C  
ATOM  10802  CG  ARG A  64     104.486 136.040 122.045  1.00 76.62           C  
ATOM  10803  CD  ARG A  64     103.216 135.859 122.834  1.00 76.62           C  
ATOM  10804  NE  ARG A  64     102.158 136.717 122.305  1.00 76.62           N  
ATOM  10805  CZ  ARG A  64     101.100 137.150 122.986  1.00 76.62           C  
ATOM  10806  NH1 ARG A  64     100.213 137.917 122.373  1.00 76.62           N  
ATOM  10807  NH2 ARG A  64     100.919 136.834 124.263  1.00 76.62           N  
ATOM  10808  H   ARG A  64     106.477 138.012 121.838  1.00 76.62           H  
ATOM  10809  HA  ARG A  64     105.333 137.515 124.147  1.00 76.62           H  
ATOM  10810  HB2 ARG A  64     106.483 135.744 122.297  1.00 76.62           H  
ATOM  10811  HB3 ARG A  64     105.624 135.270 123.551  1.00 76.62           H  
ATOM  10812  HG2 ARG A  64     104.445 136.901 121.606  1.00 76.62           H  
ATOM  10813  HG3 ARG A  64     104.520 135.336 121.380  1.00 76.62           H  
ATOM  10814  HD2 ARG A  64     102.913 134.954 122.762  1.00 76.62           H  
ATOM  10815  HD3 ARG A  64     103.390 136.089 123.760  1.00 76.62           H  
ATOM  10816  HE  ARG A  64     102.099 136.761 121.448  1.00 76.62           H  
ATOM  10817 HH11 ARG A  64     100.325 138.120 121.545  1.00 76.62           H  
ATOM  10818 HH12 ARG A  64      99.524 138.206 122.799  1.00 76.62           H  
ATOM  10819 HH21 ARG A  64     101.482 136.340 124.674  1.00 76.62           H  
ATOM  10820 HH22 ARG A  64     100.228 137.130 124.682  1.00 76.62           H  
ATOM  10821  N   LYS A  65     106.962 136.816 125.817  1.00 70.39           N  
ATOM  10822  CA  LYS A  65     107.992 136.693 126.845  1.00 70.39           C  
ATOM  10823  C   LYS A  65     108.854 135.437 126.679  1.00 70.39           C  
ATOM  10824  O   LYS A  65     110.094 135.505 126.709  1.00 70.39           O  
ATOM  10825  CB  LYS A  65     107.331 136.697 128.221  1.00 70.39           C  
ATOM  10826  CG  LYS A  65     108.310 136.609 129.390  1.00 70.39           C  
ATOM  10827  CD  LYS A  65     107.656 137.017 130.713  1.00 70.39           C  
ATOM  10828  CE  LYS A  65     108.676 137.227 131.825  1.00 70.39           C  
ATOM  10829  NZ  LYS A  65     109.661 138.297 131.521  1.00 70.39           N  
ATOM  10830  H   LYS A  65     106.161 136.743 126.116  1.00 70.39           H  
ATOM  10831  HA  LYS A  65     108.567 137.469 126.798  1.00 70.39           H  
ATOM  10832  HB2 LYS A  65     106.824 137.517 128.309  1.00 70.39           H  
ATOM  10833  HB3 LYS A  65     106.733 135.935 128.270  1.00 70.39           H  
ATOM  10834  HG2 LYS A  65     108.619 135.695 129.479  1.00 70.39           H  
ATOM  10835  HG3 LYS A  65     109.058 137.199 129.215  1.00 70.39           H  
ATOM  10836  HD2 LYS A  65     107.172 137.848 130.594  1.00 70.39           H  
ATOM  10837  HD3 LYS A  65     107.049 136.315 130.995  1.00 70.39           H  
ATOM  10838  HE2 LYS A  65     108.208 137.477 132.637  1.00 70.39           H  
ATOM  10839  HE3 LYS A  65     109.164 136.404 131.970  1.00 70.39           H  
ATOM  10840  HZ1 LYS A  65     110.144 138.478 132.247  1.00 70.39           H  
ATOM  10841  HZ2 LYS A  65     110.207 138.034 130.869  1.00 70.39           H  
ATOM  10842  HZ3 LYS A  65     109.236 139.035 131.265  1.00 70.39           H  
ATOM  10843  N   LEU A  66     108.209 134.280 126.500  1.00 76.51           N  
ATOM  10844  CA  LEU A  66     108.920 133.001 126.428  1.00 76.51           C  
ATOM  10845  C   LEU A  66     109.939 132.862 125.295  1.00 76.51           C  
ATOM  10846  O   LEU A  66     111.090 132.477 125.585  1.00 76.51           O  
ATOM  10847  CB  LEU A  66     107.881 131.873 126.422  1.00 76.51           C  
ATOM  10848  CG  LEU A  66     108.386 130.438 126.327  1.00 76.51           C  
ATOM  10849  CD1 LEU A  66     109.288 130.110 127.498  1.00 76.51           C  
ATOM  10850  CD2 LEU A  66     107.206 129.499 126.298  1.00 76.51           C  
ATOM  10851  H   LEU A  66     107.355 134.212 126.422  1.00 76.51           H  
ATOM  10852  HA  LEU A  66     109.414 132.906 127.253  1.00 76.51           H  
ATOM  10853  HB2 LEU A  66     107.415 131.927 127.269  1.00 76.51           H  
ATOM  10854  HB3 LEU A  66     107.231 132.007 125.730  1.00 76.51           H  
ATOM  10855  HG  LEU A  66     108.885 130.319 125.506  1.00 76.51           H  
ATOM  10856 HD11 LEU A  66     109.531 129.173 127.458  1.00 76.51           H  
ATOM  10857 HD12 LEU A  66     110.085 130.659 127.451  1.00 76.51           H  
ATOM  10858 HD13 LEU A  66     108.809 130.296 128.320  1.00 76.51           H  
ATOM  10859 HD21 LEU A  66     107.529 128.587 126.221  1.00 76.51           H  
ATOM  10860 HD22 LEU A  66     106.706 129.606 127.121  1.00 76.51           H  
ATOM  10861 HD23 LEU A  66     106.646 129.722 125.540  1.00 76.51           H  
ATOM  10862  N   PRO A  67     109.621 133.120 124.022  1.00 71.44           N  
ATOM  10863  CA  PRO A  67     110.670 132.998 123.001  1.00 71.44           C  
ATOM  10864  C   PRO A  67     111.790 133.976 123.184  1.00 71.44           C  
ATOM  10865  O   PRO A  67     112.937 133.681 122.829  1.00 71.44           O  
ATOM  10866  CB  PRO A  67     109.923 133.276 121.698  1.00 71.44           C  
ATOM  10867  CG  PRO A  67     108.602 132.920 121.977  1.00 71.44           C  
ATOM  10868  CD  PRO A  67     108.326 133.344 123.373  1.00 71.44           C  
ATOM  10869  HA  PRO A  67     111.014 132.097 122.978  1.00 71.44           H  
ATOM  10870  HB2 PRO A  67     109.991 134.217 121.495  1.00 71.44           H  
ATOM  10871  HB3 PRO A  67     110.290 132.735 120.988  1.00 71.44           H  
ATOM  10872  HG2 PRO A  67     108.003 133.335 121.343  1.00 71.44           H  
ATOM  10873  HG3 PRO A  67     108.563 131.959 121.936  1.00 71.44           H  
ATOM  10874  HD2 PRO A  67     108.083 134.280 123.404  1.00 71.44           H  
ATOM  10875  HD3 PRO A  67     107.644 132.774 123.730  1.00 71.44           H  
ATOM  10876  N   PHE A  68     111.497 135.129 123.763  1.00 61.91           N  
ATOM  10877  CA  PHE A  68     112.553 136.080 124.038  1.00 61.91           C  
ATOM  10878  C   PHE A  68     113.505 135.494 125.073  1.00 61.91           C  
ATOM  10879  O   PHE A  68     114.731 135.588 124.916  1.00 61.91           O  
ATOM  10880  CB  PHE A  68     111.951 137.402 124.490  1.00 61.91           C  
ATOM  10881  CG  PHE A  68     112.950 138.477 124.676  1.00 61.91           C  
ATOM  10882  CD1 PHE A  68     113.437 139.139 123.573  1.00 61.91           C  
ATOM  10883  CD2 PHE A  68     113.414 138.821 125.914  1.00 61.91           C  
ATOM  10884  CE1 PHE A  68     114.360 140.134 123.700  1.00 61.91           C  
ATOM  10885  CE2 PHE A  68     114.351 139.824 126.056  1.00 61.91           C  
ATOM  10886  CZ  PHE A  68     114.824 140.480 124.947  1.00 61.91           C  
ATOM  10887  H   PHE A  68     110.714 135.373 124.004  1.00 61.91           H  
ATOM  10888  HA  PHE A  68     113.047 136.242 123.226  1.00 61.91           H  
ATOM  10889  HB2 PHE A  68     111.323 137.704 123.821  1.00 61.91           H  
ATOM  10890  HB3 PHE A  68     111.510 137.260 125.338  1.00 61.91           H  
ATOM  10891  HD1 PHE A  68     113.121 138.908 122.731  1.00 61.91           H  
ATOM  10892  HD2 PHE A  68     113.091 138.373 126.658  1.00 61.91           H  
ATOM  10893  HE1 PHE A  68     114.671 140.569 122.942  1.00 61.91           H  
ATOM  10894  HE2 PHE A  68     114.665 140.057 126.897  1.00 61.91           H  
ATOM  10895  HZ  PHE A  68     115.455 141.156 125.044  1.00 61.91           H  
ATOM  10896  N   GLN A  69     112.963 134.909 126.150  1.00 66.22           N  
ATOM  10897  CA  GLN A  69     113.829 134.297 127.157  1.00 66.22           C  
ATOM  10898  C   GLN A  69     114.677 133.191 126.541  1.00 66.22           C  
ATOM  10899  O   GLN A  69     115.870 133.061 126.844  1.00 66.22           O  
ATOM  10900  CB  GLN A  69     113.024 133.682 128.302  1.00 66.22           C  
ATOM  10901  CG  GLN A  69     112.185 134.599 129.141  1.00 66.22           C  
ATOM  10902  CD  GLN A  69     111.033 133.871 129.833  1.00 66.22           C  
ATOM  10903  OE1 GLN A  69     110.612 132.792 129.418  1.00 66.22           O  
ATOM  10904  NE2 GLN A  69     110.541 134.453 130.913  1.00 66.22           N  
ATOM  10905  H   GLN A  69     112.123 134.854 126.309  1.00 66.22           H  
ATOM  10906  HA  GLN A  69     114.411 134.971 127.533  1.00 66.22           H  
ATOM  10907  HB2 GLN A  69     112.450 133.022 127.898  1.00 66.22           H  
ATOM  10908  HB3 GLN A  69     113.645 133.244 128.905  1.00 66.22           H  
ATOM  10909  HG2 GLN A  69     112.748 134.985 129.827  1.00 66.22           H  
ATOM  10910  HG3 GLN A  69     111.815 135.290 128.574  1.00 66.22           H  
ATOM  10911 HE21 GLN A  69     110.861 135.203 131.181  1.00 66.22           H  
ATOM  10912 HE22 GLN A  69     109.894 134.082 131.341  1.00 66.22           H  
ATOM  10913  N   ARG A  70     114.080 132.401 125.643  1.00 72.74           N  
ATOM  10914  CA  ARG A  70     114.829 131.309 125.019  1.00 72.74           C  
ATOM  10915  C   ARG A  70     115.951 131.846 124.140  1.00 72.74           C  
ATOM  10916  O   ARG A  70     117.066 131.311 124.154  1.00 72.74           O  
ATOM  10917  CB  ARG A  70     113.901 130.382 124.235  1.00 72.74           C  
ATOM  10918  CG  ARG A  70     113.167 129.413 125.142  1.00 72.74           C  
ATOM  10919  CD  ARG A  70     112.286 128.436 124.398  1.00 72.74           C  
ATOM  10920  NE  ARG A  70     111.309 129.085 123.526  1.00 72.74           N  
ATOM  10921  CZ  ARG A  70     111.460 129.293 122.218  1.00 72.74           C  
ATOM  10922  NH1 ARG A  70     112.579 128.956 121.583  1.00 72.74           N  
ATOM  10923  NH2 ARG A  70     110.489 129.889 121.539  1.00 72.74           N  
ATOM  10924  H   ARG A  70     113.268 132.485 125.376  1.00 72.74           H  
ATOM  10925  HA  ARG A  70     115.235 130.773 125.715  1.00 72.74           H  
ATOM  10926  HB2 ARG A  70     113.247 130.912 123.762  1.00 72.74           H  
ATOM  10927  HB3 ARG A  70     114.425 129.861 123.609  1.00 72.74           H  
ATOM  10928  HG2 ARG A  70     113.821 128.901 125.639  1.00 72.74           H  
ATOM  10929  HG3 ARG A  70     112.608 129.913 125.752  1.00 72.74           H  
ATOM  10930  HD2 ARG A  70     112.838 127.822 123.896  1.00 72.74           H  
ATOM  10931  HD3 ARG A  70     111.780 127.938 125.057  1.00 72.74           H  
ATOM  10932  HE  ARG A  70     110.515 129.176 123.842  1.00 72.74           H  
ATOM  10933 HH11 ARG A  70     113.227 128.572 121.994  1.00 72.74           H  
ATOM  10934 HH12 ARG A  70     112.648 129.111 120.741  1.00 72.74           H  
ATOM  10935 HH21 ARG A  70     109.764 130.122 121.940  1.00 72.74           H  
ATOM  10936 HH22 ARG A  70     110.581 130.040 120.698  1.00 72.74           H  
ATOM  10937  N   LEU A  71     115.682 132.906 123.381  1.00 64.24           N  
ATOM  10938  CA  LEU A  71     116.722 133.508 122.557  1.00 64.24           C  
ATOM  10939  C   LEU A  71     117.866 134.028 123.409  1.00 64.24           C  
ATOM  10940  O   LEU A  71     119.045 133.813 123.090  1.00 64.24           O  
ATOM  10941  CB  LEU A  71     116.117 134.647 121.751  1.00 64.24           C  
ATOM  10942  CG  LEU A  71     117.040 135.495 120.896  1.00 64.24           C  
ATOM  10943  CD1 LEU A  71     117.733 134.655 119.881  1.00 64.24           C  
ATOM  10944  CD2 LEU A  71     116.227 136.560 120.228  1.00 64.24           C  
ATOM  10945  H   LEU A  71     114.920 133.298 123.335  1.00 64.24           H  
ATOM  10946  HA  LEU A  71     117.069 132.850 121.942  1.00 64.24           H  
ATOM  10947  HB2 LEU A  71     115.444 134.280 121.164  1.00 64.24           H  
ATOM  10948  HB3 LEU A  71     115.705 135.245 122.386  1.00 64.24           H  
ATOM  10949  HG  LEU A  71     117.701 135.927 121.452  1.00 64.24           H  
ATOM  10950 HD11 LEU A  71     118.220 135.235 119.279  1.00 64.24           H  
ATOM  10951 HD12 LEU A  71     118.343 134.057 120.336  1.00 64.24           H  
ATOM  10952 HD13 LEU A  71     117.065 134.150 119.394  1.00 64.24           H  
ATOM  10953 HD21 LEU A  71     116.808 137.090 119.665  1.00 64.24           H  
ATOM  10954 HD22 LEU A  71     115.542 136.133 119.693  1.00 64.24           H  
ATOM  10955 HD23 LEU A  71     115.819 137.114 120.907  1.00 64.24           H  
ATOM  10956  N   VAL A  72     117.531 134.754 124.471  1.00 60.44           N  
ATOM  10957  CA  VAL A  72     118.547 135.272 125.376  1.00 60.44           C  
ATOM  10958  C   VAL A  72     119.408 134.140 125.917  1.00 60.44           C  
ATOM  10959  O   VAL A  72     120.642 134.229 125.938  1.00 60.44           O  
ATOM  10960  CB  VAL A  72     117.885 136.083 126.500  1.00 60.44           C  
ATOM  10961  CG1 VAL A  72     118.838 136.303 127.655  1.00 60.44           C  
ATOM  10962  CG2 VAL A  72     117.440 137.400 125.962  1.00 60.44           C  
ATOM  10963  H   VAL A  72     116.730 134.960 124.684  1.00 60.44           H  
ATOM  10964  HA  VAL A  72     119.111 135.878 124.881  1.00 60.44           H  
ATOM  10965  HB  VAL A  72     117.111 135.601 126.813  1.00 60.44           H  
ATOM  10966 HG11 VAL A  72     118.513 137.055 128.171  1.00 60.44           H  
ATOM  10967 HG12 VAL A  72     118.869 135.513 128.217  1.00 60.44           H  
ATOM  10968 HG13 VAL A  72     119.716 136.511 127.303  1.00 60.44           H  
ATOM  10969 HG21 VAL A  72     116.912 137.856 126.633  1.00 60.44           H  
ATOM  10970 HG22 VAL A  72     118.228 137.920 125.745  1.00 60.44           H  
ATOM  10971 HG23 VAL A  72     116.916 137.243 125.165  1.00 60.44           H  
ATOM  10972  N   ARG A  73     118.770 133.060 126.366  1.00 68.62           N  
ATOM  10973  CA  ARG A  73     119.509 131.946 126.948  1.00 68.62           C  
ATOM  10974  C   ARG A  73     120.410 131.258 125.927  1.00 68.62           C  
ATOM  10975  O   ARG A  73     121.554 130.907 126.242  1.00 68.62           O  
ATOM  10976  CB  ARG A  73     118.510 130.950 127.518  1.00 68.62           C  
ATOM  10977  CG  ARG A  73     117.801 131.400 128.775  1.00 68.62           C  
ATOM  10978  CD  ARG A  73     116.744 130.393 129.147  1.00 68.62           C  
ATOM  10979  NE  ARG A  73     115.861 130.866 130.204  1.00 68.62           N  
ATOM  10980  CZ  ARG A  73     116.160 130.863 131.500  1.00 68.62           C  
ATOM  10981  NH1 ARG A  73     117.313 130.376 131.943  1.00 68.62           N  
ATOM  10982  NH2 ARG A  73     115.271 131.318 132.369  1.00 68.62           N  
ATOM  10983  H   ARG A  73     117.920 132.951 126.339  1.00 68.62           H  
ATOM  10984  HA  ARG A  73     120.059 132.274 127.672  1.00 68.62           H  
ATOM  10985  HB2 ARG A  73     117.838 130.783 126.843  1.00 68.62           H  
ATOM  10986  HB3 ARG A  73     118.980 130.131 127.726  1.00 68.62           H  
ATOM  10987  HG2 ARG A  73     118.435 131.456 129.502  1.00 68.62           H  
ATOM  10988  HG3 ARG A  73     117.376 132.255 128.633  1.00 68.62           H  
ATOM  10989  HD2 ARG A  73     116.191 130.220 128.373  1.00 68.62           H  
ATOM  10990  HD3 ARG A  73     117.169 129.575 129.437  1.00 68.62           H  
ATOM  10991  HE  ARG A  73     115.263 131.432 129.958  1.00 68.62           H  
ATOM  10992 HH11 ARG A  73     117.905 130.071 131.400  1.00 68.62           H  
ATOM  10993 HH12 ARG A  73     117.474 130.379 132.788  1.00 68.62           H  
ATOM  10994 HH21 ARG A  73     114.521 131.627 132.088  1.00 68.62           H  
ATOM  10995 HH22 ARG A  73     115.445 131.313 133.209  1.00 68.62           H  
ATOM  10996  N   GLU A  74     119.940 131.104 124.687  1.00 70.44           N  
ATOM  10997  CA  GLU A  74     120.771 130.481 123.657  1.00 70.44           C  
ATOM  10998  C   GLU A  74     121.998 131.331 123.354  1.00 70.44           C  
ATOM  10999  O   GLU A  74     123.110 130.805 123.236  1.00 70.44           O  
ATOM  11000  CB  GLU A  74     119.971 130.206 122.380  1.00 70.44           C  
ATOM  11001  CG  GLU A  74     118.856 129.138 122.456  1.00 70.44           C  
ATOM  11002  CD  GLU A  74     119.288 127.724 122.855  1.00 70.44           C  
ATOM  11003  OE1 GLU A  74     118.506 126.792 122.584  1.00 70.44           O  
ATOM  11004  OE2 GLU A  74     120.371 127.514 123.431  1.00 70.44           O  
ATOM  11005  H   GLU A  74     119.159 131.347 124.425  1.00 70.44           H  
ATOM  11006  HA  GLU A  74     121.113 129.659 124.022  1.00 70.44           H  
ATOM  11007  HB2 GLU A  74     119.547 131.032 122.102  1.00 70.44           H  
ATOM  11008  HB3 GLU A  74     120.592 129.919 121.694  1.00 70.44           H  
ATOM  11009  HG2 GLU A  74     118.192 129.420 123.094  1.00 70.44           H  
ATOM  11010  HG3 GLU A  74     118.457 129.067 121.574  1.00 70.44           H  
ATOM  11011  N   ILE A  75     121.818 132.643 123.189  1.00 62.91           N  
ATOM  11012  CA  ILE A  75     122.960 133.507 122.906  1.00 62.91           C  
ATOM  11013  C   ILE A  75     123.930 133.483 124.077  1.00 62.91           C  
ATOM  11014  O   ILE A  75     125.145 133.369 123.887  1.00 62.91           O  
ATOM  11015  CB  ILE A  75     122.502 134.929 122.559  1.00 62.91           C  
ATOM  11016  CG1 ILE A  75     121.859 134.908 121.180  1.00 62.91           C  
ATOM  11017  CG2 ILE A  75     123.670 135.887 122.594  1.00 62.91           C  
ATOM  11018  CD1 ILE A  75     121.066 136.128 120.846  1.00 62.91           C  
ATOM  11019  H   ILE A  75     121.069 133.052 123.239  1.00 62.91           H  
ATOM  11020  HA  ILE A  75     123.419 133.175 122.124  1.00 62.91           H  
ATOM  11021  HB  ILE A  75     121.851 135.211 123.210  1.00 62.91           H  
ATOM  11022 HG12 ILE A  75     122.570 134.830 120.531  1.00 62.91           H  
ATOM  11023 HG13 ILE A  75     121.278 134.141 121.114  1.00 62.91           H  
ATOM  11024 HG21 ILE A  75     123.460 136.676 122.079  1.00 62.91           H  
ATOM  11025 HG22 ILE A  75     123.843 136.145 123.511  1.00 62.91           H  
ATOM  11026 HG23 ILE A  75     124.440 135.450 122.208  1.00 62.91           H  
ATOM  11027 HD11 ILE A  75     120.512 135.938 120.074  1.00 62.91           H  
ATOM  11028 HD12 ILE A  75     120.513 136.356 121.607  1.00 62.91           H  
ATOM  11029 HD13 ILE A  75     121.673 136.856 120.648  1.00 62.91           H  
ATOM  11030  N   ALA A  76     123.417 133.614 125.295  1.00 63.74           N  
ATOM  11031  CA  ALA A  76     124.269 133.607 126.474  1.00 63.74           C  
ATOM  11032  C   ALA A  76     125.055 132.306 126.585  1.00 63.74           C  
ATOM  11033  O   ALA A  76     126.196 132.313 127.061  1.00 63.74           O  
ATOM  11034  CB  ALA A  76     123.427 133.822 127.721  1.00 63.74           C  
ATOM  11035  H   ALA A  76     122.583 133.701 125.466  1.00 63.74           H  
ATOM  11036  HA  ALA A  76     124.898 134.337 126.411  1.00 63.74           H  
ATOM  11037  HB1 ALA A  76     124.004 133.808 128.498  1.00 63.74           H  
ATOM  11038  HB2 ALA A  76     122.983 134.679 127.650  1.00 63.74           H  
ATOM  11039  HB3 ALA A  76     122.773 133.109 127.770  1.00 63.74           H  
ATOM  11040  N   GLN A  77     124.457 131.185 126.170  1.00 65.11           N  
ATOM  11041  CA  GLN A  77     125.146 129.896 126.214  1.00 65.11           C  
ATOM  11042  C   GLN A  77     126.463 129.901 125.442  1.00 65.11           C  
ATOM  11043  O   GLN A  77     127.439 129.292 125.893  1.00 65.11           O  
ATOM  11044  CB  GLN A  77     124.215 128.814 125.651  1.00 65.11           C  
ATOM  11045  CG  GLN A  77     124.834 127.446 125.386  1.00 65.11           C  
ATOM  11046  CD  GLN A  77     123.802 126.445 124.911  1.00 65.11           C  
ATOM  11047  OE1 GLN A  77     122.756 126.825 124.388  1.00 65.11           O  
ATOM  11048  NE2 GLN A  77     124.094 125.160 125.076  1.00 65.11           N  
ATOM  11049  H   GLN A  77     123.656 131.153 125.854  1.00 65.11           H  
ATOM  11050  HA  GLN A  77     125.343 129.668 127.134  1.00 65.11           H  
ATOM  11051  HB2 GLN A  77     123.481 128.684 126.269  1.00 65.11           H  
ATOM  11052  HB3 GLN A  77     123.866 129.120 124.806  1.00 65.11           H  
ATOM  11053  HG2 GLN A  77     125.490 127.508 124.675  1.00 65.11           H  
ATOM  11054  HG3 GLN A  77     125.242 127.111 126.197  1.00 65.11           H  
ATOM  11055 HE21 GLN A  77     124.837 124.929 125.442  1.00 65.11           H  
ATOM  11056 HE22 GLN A  77     123.537 124.557 124.818  1.00 65.11           H  
ATOM  11057  N   ASP A  78     126.525 130.571 124.290  1.00 68.29           N  
ATOM  11058  CA  ASP A  78     127.765 130.563 123.519  1.00 68.29           C  
ATOM  11059  C   ASP A  78     128.884 131.371 124.167  1.00 68.29           C  
ATOM  11060  O   ASP A  78     130.048 131.192 123.793  1.00 68.29           O  
ATOM  11061  CB  ASP A  78     127.515 131.081 122.105  1.00 68.29           C  
ATOM  11062  CG  ASP A  78     126.581 130.190 121.314  1.00 68.29           C  
ATOM  11063  OD1 ASP A  78     126.300 130.514 120.141  1.00 68.29           O  
ATOM  11064  OD2 ASP A  78     126.132 129.161 121.862  1.00 68.29           O  
ATOM  11065  H   ASP A  78     125.884 131.023 123.945  1.00 68.29           H  
ATOM  11066  HA  ASP A  78     128.072 129.648 123.447  1.00 68.29           H  
ATOM  11067  HB2 ASP A  78     127.127 131.966 122.159  1.00 68.29           H  
ATOM  11068  HB3 ASP A  78     128.362 131.121 121.635  1.00 68.29           H  
ATOM  11069  N   PHE A  79     128.576 132.247 125.132  1.00 61.02           N  
ATOM  11070  CA  PHE A  79     129.638 132.967 125.834  1.00 61.02           C  
ATOM  11071  C   PHE A  79     130.010 132.288 127.143  1.00 61.02           C  
ATOM  11072  O   PHE A  79     131.195 132.080 127.424  1.00 61.02           O  
ATOM  11073  CB  PHE A  79     129.222 134.414 126.110  1.00 61.02           C  
ATOM  11074  CG  PHE A  79     129.036 135.249 124.884  1.00 61.02           C  
ATOM  11075  CD1 PHE A  79     130.047 135.381 123.961  1.00 61.02           C  
ATOM  11076  CD2 PHE A  79     127.867 135.933 124.677  1.00 61.02           C  
ATOM  11077  CE1 PHE A  79     129.880 136.153 122.846  1.00 61.02           C  
ATOM  11078  CE2 PHE A  79     127.698 136.707 123.565  1.00 61.02           C  
ATOM  11079  CZ  PHE A  79     128.703 136.818 122.650  1.00 61.02           C  
ATOM  11080  H   PHE A  79     127.781 132.436 125.392  1.00 61.02           H  
ATOM  11081  HA  PHE A  79     130.446 132.995 125.305  1.00 61.02           H  
ATOM  11082  HB2 PHE A  79     128.378 134.407 126.583  1.00 61.02           H  
ATOM  11083  HB3 PHE A  79     129.902 134.838 126.653  1.00 61.02           H  
ATOM  11084  HD1 PHE A  79     130.843 134.926 124.094  1.00 61.02           H  
ATOM  11085  HD2 PHE A  79     127.183 135.858 125.295  1.00 61.02           H  
ATOM  11086  HE1 PHE A  79     130.565 136.228 122.226  1.00 61.02           H  
ATOM  11087  HE2 PHE A  79     126.902 137.159 123.430  1.00 61.02           H  
ATOM  11088  HZ  PHE A  79     128.588 137.344 121.895  1.00 61.02           H  
ATOM  11089  N   LYS A  80     129.017 131.953 127.961  1.00 65.17           N  
ATOM  11090  CA  LYS A  80     129.274 131.258 129.209  1.00 65.17           C  
ATOM  11091  C   LYS A  80     128.168 130.242 129.433  1.00 65.17           C  
ATOM  11092  O   LYS A  80     126.993 130.507 129.166  1.00 65.17           O  
ATOM  11093  CB  LYS A  80     129.399 132.217 130.387  1.00 65.17           C  
ATOM  11094  CG  LYS A  80     129.568 131.504 131.704  1.00 65.17           C  
ATOM  11095  CD  LYS A  80     129.999 132.457 132.789  1.00 65.17           C  
ATOM  11096  CE  LYS A  80     130.047 131.755 134.132  1.00 65.17           C  
ATOM  11097  NZ  LYS A  80     131.120 130.720 134.154  1.00 65.17           N  
ATOM  11098  H   LYS A  80     128.188 132.114 127.814  1.00 65.17           H  
ATOM  11099  HA  LYS A  80     130.102 130.764 129.150  1.00 65.17           H  
ATOM  11100  HB2 LYS A  80     130.172 132.781 130.244  1.00 65.17           H  
ATOM  11101  HB3 LYS A  80     128.600 132.755 130.433  1.00 65.17           H  
ATOM  11102  HG2 LYS A  80     128.727 131.108 131.976  1.00 65.17           H  
ATOM  11103  HG3 LYS A  80     130.241 130.815 131.606  1.00 65.17           H  
ATOM  11104  HD2 LYS A  80     130.885 132.793 132.585  1.00 65.17           H  
ATOM  11105  HD3 LYS A  80     129.367 133.190 132.844  1.00 65.17           H  
ATOM  11106  HE2 LYS A  80     130.234 132.405 134.828  1.00 65.17           H  
ATOM  11107  HE3 LYS A  80     129.198 131.316 134.295  1.00 65.17           H  
ATOM  11108  HZ1 LYS A  80     130.927 130.074 133.572  1.00 65.17           H  
ATOM  11109  HZ2 LYS A  80     131.901 131.084 133.932  1.00 65.17           H  
ATOM  11110  HZ3 LYS A  80     131.187 130.366 134.968  1.00 65.17           H  
ATOM  11111  N   THR A  81     128.567 129.076 129.918  1.00 69.94           N  
ATOM  11112  CA  THR A  81     127.668 127.946 130.118  1.00 69.94           C  
ATOM  11113  C   THR A  81     126.918 128.063 131.441  1.00 69.94           C  
ATOM  11114  O   THR A  81     127.309 128.813 132.332  1.00 69.94           O  
ATOM  11115  CB  THR A  81     128.421 126.595 130.073  1.00 69.94           C  
ATOM  11116  OG1 THR A  81     129.321 126.351 131.170  1.00 69.94           O  
ATOM  11117  CG2 THR A  81     128.611 125.886 128.701  1.00 69.94           C  
ATOM  11118  H   THR A  81     129.372 128.974 130.203  1.00 69.94           H  
ATOM  11119  HA  THR A  81     127.007 127.936 129.409  1.00 69.94           H  
ATOM  11120  HB  THR A  81     129.179 127.061 129.711  1.00 69.94           H  
ATOM  11121  HG1 THR A  81     129.818 125.699 130.991  1.00 69.94           H  
ATOM  11122 HG21 THR A  81     129.441 125.383 128.705  1.00 69.94           H  
ATOM  11123 HG22 THR A  81     127.877 125.277 128.528  1.00 69.94           H  
ATOM  11124 HG23 THR A  81     128.653 126.543 127.989  1.00 69.94           H  
ATOM  11125  N   ASP A  82     125.752 127.407 131.474  1.00 71.41           N  
ATOM  11126  CA  ASP A  82     124.855 127.269 132.638  1.00 71.41           C  
ATOM  11127  C   ASP A  82     124.476 128.602 133.299  1.00 71.41           C  
ATOM  11128  O   ASP A  82     124.272 128.687 134.512  1.00 71.41           O  
ATOM  11129  CB  ASP A  82     125.405 126.224 133.642  1.00 71.41           C  
ATOM  11130  CG  ASP A  82     126.356 126.779 134.716  1.00 71.41           C  
ATOM  11131  OD1 ASP A  82     126.507 126.080 135.740  1.00 71.41           O  
ATOM  11132  OD2 ASP A  82     126.931 127.870 134.599  1.00 71.41           O  
ATOM  11133  H   ASP A  82     125.439 127.000 130.787  1.00 71.41           H  
ATOM  11134  HA  ASP A  82     124.026 126.899 132.301  1.00 71.41           H  
ATOM  11135  HB2 ASP A  82     124.648 125.829 134.105  1.00 71.41           H  
ATOM  11136  HB3 ASP A  82     125.880 125.534 133.152  1.00 71.41           H  
ATOM  11137  N   LEU A  83     124.328 129.650 132.495  1.00 67.04           N  
ATOM  11138  CA  LEU A  83     123.922 130.933 133.052  1.00 67.04           C  
ATOM  11139  C   LEU A  83     122.437 130.952 133.370  1.00 67.04           C  
ATOM  11140  O   LEU A  83     121.627 130.290 132.718  1.00 67.04           O  
ATOM  11141  CB  LEU A  83     124.225 132.075 132.098  1.00 67.04           C  
ATOM  11142  CG  LEU A  83     125.673 132.516 131.947  1.00 67.04           C  
ATOM  11143  CD1 LEU A  83     125.810 133.386 130.724  1.00 67.04           C  
ATOM  11144  CD2 LEU A  83     126.118 133.271 133.192  1.00 67.04           C  
ATOM  11145  H   LEU A  83     124.445 129.647 131.646  1.00 67.04           H  
ATOM  11146  HA  LEU A  83     124.397 131.097 133.876  1.00 67.04           H  
ATOM  11147  HB2 LEU A  83     123.909 131.806 131.224  1.00 67.04           H  
ATOM  11148  HB3 LEU A  83     123.719 132.842 132.398  1.00 67.04           H  
ATOM  11149  HG  LEU A  83     126.236 131.736 131.835  1.00 67.04           H  
ATOM  11150 HD11 LEU A  83     126.638 133.884 130.781  1.00 67.04           H  
ATOM  11151 HD12 LEU A  83     125.809 132.824 129.934  1.00 67.04           H  
ATOM  11152 HD13 LEU A  83     125.061 134.001 130.699  1.00 67.04           H  
ATOM  11153 HD21 LEU A  83     127.035 133.564 133.076  1.00 67.04           H  
ATOM  11154 HD22 LEU A  83     125.541 134.040 133.313  1.00 67.04           H  
ATOM  11155 HD23 LEU A  83     126.052 132.689 133.964  1.00 67.04           H  
ATOM  11156  N   ARG A  84     122.095 131.729 134.394  1.00 86.13           N  
ATOM  11157  CA  ARG A  84     120.719 132.018 134.761  1.00 86.13           C  
ATOM  11158  C   ARG A  84     120.426 133.490 134.509  1.00 86.13           C  
ATOM  11159  O   ARG A  84     121.335 134.293 134.291  1.00 86.13           O  
ATOM  11160  CB  ARG A  84     120.483 131.696 136.241  1.00 86.13           C  
ATOM  11161  CG  ARG A  84     120.714 130.233 136.611  1.00 86.13           C  
ATOM  11162  CD  ARG A  84     120.860 130.027 138.112  1.00 86.13           C  
ATOM  11163  NE  ARG A  84     119.597 129.732 138.779  1.00 86.13           N  
ATOM  11164  CZ  ARG A  84     119.478 129.035 139.906  1.00 86.13           C  
ATOM  11165  NH1 ARG A  84     120.536 128.515 140.523  1.00 86.13           N  
ATOM  11166  NH2 ARG A  84     118.276 128.845 140.420  1.00 86.13           N  
ATOM  11167  H   ARG A  84     122.671 132.108 134.903  1.00 86.13           H  
ATOM  11168  HA  ARG A  84     120.113 131.489 134.227  1.00 86.13           H  
ATOM  11169  HB2 ARG A  84     121.085 132.247 136.764  1.00 86.13           H  
ATOM  11170  HB3 ARG A  84     119.563 131.916 136.463  1.00 86.13           H  
ATOM  11171  HG2 ARG A  84     119.952 129.713 136.319  1.00 86.13           H  
ATOM  11172  HG3 ARG A  84     121.521 129.907 136.184  1.00 86.13           H  
ATOM  11173  HD2 ARG A  84     121.458 129.275 138.231  1.00 86.13           H  
ATOM  11174  HD3 ARG A  84     121.238 130.814 138.531  1.00 86.13           H  
ATOM  11175  HE  ARG A  84     118.904 130.171 138.515  1.00 86.13           H  
ATOM  11176 HH11 ARG A  84     120.425 128.066 141.246  1.00 86.13           H  
ATOM  11177 HH12 ARG A  84     121.332 128.621 140.219  1.00 86.13           H  
ATOM  11178 HH21 ARG A  84     118.184 128.392 141.144  1.00 86.13           H  
ATOM  11179 HH22 ARG A  84     117.590 129.178 140.026  1.00 86.13           H  
ATOM  11180  N   PHE A  85     119.142 133.835 134.510  1.00 68.45           N  
ATOM  11181  CA  PHE A  85     118.725 135.208 134.275  1.00 68.45           C  
ATOM  11182  C   PHE A  85     117.614 135.621 135.223  1.00 68.45           C  
ATOM  11183  O   PHE A  85     116.681 134.846 135.449  1.00 68.45           O  
ATOM  11184  CB  PHE A  85     118.286 135.361 132.835  1.00 68.45           C  
ATOM  11185  CG  PHE A  85     119.394 135.720 131.930  1.00 68.45           C  
ATOM  11186  CD1 PHE A  85     119.868 137.000 131.873  1.00 68.45           C  
ATOM  11187  CD2 PHE A  85     119.984 134.764 131.159  1.00 68.45           C  
ATOM  11188  CE1 PHE A  85     120.904 137.322 131.046  1.00 68.45           C  
ATOM  11189  CE2 PHE A  85     121.014 135.077 130.330  1.00 68.45           C  
ATOM  11190  CZ  PHE A  85     121.478 136.356 130.272  1.00 68.45           C  
ATOM  11191  H   PHE A  85     118.493 133.297 134.651  1.00 68.45           H  
ATOM  11192  HA  PHE A  85     119.462 135.811 134.415  1.00 68.45           H  
ATOM  11193  HB2 PHE A  85     117.935 134.514 132.536  1.00 68.45           H  
ATOM  11194  HB3 PHE A  85     117.615 136.049 132.787  1.00 68.45           H  
ATOM  11195  HD1 PHE A  85     119.476 137.650 132.401  1.00 68.45           H  
ATOM  11196  HD2 PHE A  85     119.665 133.900 131.204  1.00 68.45           H  
ATOM  11197  HE1 PHE A  85     121.216 138.194 131.008  1.00 68.45           H  
ATOM  11198  HE2 PHE A  85     121.403 134.422 129.806  1.00 68.45           H  
ATOM  11199  HZ  PHE A  85     122.181 136.568 129.707  1.00 68.45           H  
ATOM  11200  N   GLN A  86     117.703 136.827 135.774  1.00 73.14           N  
ATOM  11201  CA  GLN A  86     116.578 137.361 136.522  1.00 73.14           C  
ATOM  11202  C   GLN A  86     115.491 137.801 135.556  1.00 73.14           C  
ATOM  11203  O   GLN A  86     115.764 138.263 134.448  1.00 73.14           O  
ATOM  11204  CB  GLN A  86     116.996 138.534 137.399  1.00 73.14           C  
ATOM  11205  CG  GLN A  86     117.872 138.143 138.588  1.00 73.14           C  
ATOM  11206  CD  GLN A  86     118.106 139.289 139.561  1.00 73.14           C  
ATOM  11207  OE1 GLN A  86     118.128 140.457 139.172  1.00 73.14           O  
ATOM  11208  NE2 GLN A  86     118.288 138.958 140.832  1.00 73.14           N  
ATOM  11209  H   GLN A  86     118.378 137.350 135.727  1.00 73.14           H  
ATOM  11210  HA  GLN A  86     116.212 136.669 137.085  1.00 73.14           H  
ATOM  11211  HB2 GLN A  86     117.479 139.169 136.855  1.00 73.14           H  
ATOM  11212  HB3 GLN A  86     116.193 138.948 137.747  1.00 73.14           H  
ATOM  11213  HG2 GLN A  86     117.451 137.422 139.077  1.00 73.14           H  
ATOM  11214  HG3 GLN A  86     118.736 137.855 138.260  1.00 73.14           H  
ATOM  11215 HE21 GLN A  86     118.267 138.131 141.067  1.00 73.14           H  
ATOM  11216 HE22 GLN A  86     118.426 139.570 141.422  1.00 73.14           H  
ATOM  11217  N   SER A  87     114.244 137.648 135.990  1.00 73.18           N  
ATOM  11218  CA  SER A  87     113.117 138.015 135.141  1.00 73.18           C  
ATOM  11219  C   SER A  87     113.135 139.501 134.779  1.00 73.18           C  
ATOM  11220  O   SER A  87     112.828 139.875 133.637  1.00 73.18           O  
ATOM  11221  CB  SER A  87     111.816 137.626 135.836  1.00 73.18           C  
ATOM  11222  OG  SER A  87     111.630 138.412 136.995  1.00 73.18           O  
ATOM  11223  H   SER A  87     114.033 137.350 136.765  1.00 73.18           H  
ATOM  11224  HA  SER A  87     113.160 137.513 134.323  1.00 73.18           H  
ATOM  11225  HB2 SER A  87     111.094 137.884 135.257  1.00 73.18           H  
ATOM  11226  HB3 SER A  87     111.786 136.660 136.008  1.00 73.18           H  
ATOM  11227  HG  SER A  87     110.811 138.542 137.141  1.00 73.18           H  
ATOM  11228  N   SER A  88     113.539 140.362 135.714  1.00 67.80           N  
ATOM  11229  CA  SER A  88     113.608 141.780 135.395  1.00 67.80           C  
ATOM  11230  C   SER A  88     114.729 142.097 134.411  1.00 67.80           C  
ATOM  11231  O   SER A  88     114.632 143.080 133.669  1.00 67.80           O  
ATOM  11232  CB  SER A  88     113.778 142.576 136.678  1.00 67.80           C  
ATOM  11233  OG  SER A  88     114.948 142.172 137.362  1.00 67.80           O  
ATOM  11234  H   SER A  88     113.778 140.152 136.508  1.00 67.80           H  
ATOM  11235  HA  SER A  88     112.773 142.051 134.991  1.00 67.80           H  
ATOM  11236  HB2 SER A  88     113.838 143.517 136.464  1.00 67.80           H  
ATOM  11237  HB3 SER A  88     113.009 142.409 137.237  1.00 67.80           H  
ATOM  11238  HG  SER A  88     115.205 142.791 137.866  1.00 67.80           H  
ATOM  11239  N   ALA A  89     115.749 141.240 134.316  1.00 63.20           N  
ATOM  11240  CA  ALA A  89     116.791 141.454 133.315  1.00 63.20           C  
ATOM  11241  C   ALA A  89     116.231 141.224 131.923  1.00 63.20           C  
ATOM  11242  O   ALA A  89     116.536 141.962 130.976  1.00 63.20           O  
ATOM  11243  CB  ALA A  89     117.983 140.539 133.575  1.00 63.20           C  
ATOM  11244  H   ALA A  89     115.851 140.535 134.802  1.00 63.20           H  
ATOM  11245  HA  ALA A  89     117.102 142.369 133.370  1.00 63.20           H  
ATOM  11246  HB1 ALA A  89     118.601 140.621 132.833  1.00 63.20           H  
ATOM  11247  HB2 ALA A  89     118.415 140.812 134.401  1.00 63.20           H  
ATOM  11248  HB3 ALA A  89     117.665 139.628 133.641  1.00 63.20           H  
ATOM  11249  N   VAL A  90     115.345 140.244 131.807  1.00 61.81           N  
ATOM  11250  CA  VAL A  90     114.727 139.926 130.536  1.00 61.81           C  
ATOM  11251  C   VAL A  90     113.719 140.996 130.169  1.00 61.81           C  
ATOM  11252  O   VAL A  90     113.598 141.376 128.998  1.00 61.81           O  
ATOM  11253  CB  VAL A  90     114.081 138.535 130.606  1.00 61.81           C  
ATOM  11254  CG1 VAL A  90     113.456 138.191 129.297  1.00 61.81           C  
ATOM  11255  CG2 VAL A  90     115.129 137.507 130.950  1.00 61.81           C  
ATOM  11256  H   VAL A  90     115.083 139.747 132.452  1.00 61.81           H  
ATOM  11257  HA  VAL A  90     115.412 139.901 129.857  1.00 61.81           H  
ATOM  11258  HB  VAL A  90     113.398 138.542 131.288  1.00 61.81           H  
ATOM  11259 HG11 VAL A  90     113.290 137.238 129.257  1.00 61.81           H  
ATOM  11260 HG12 VAL A  90     112.620 138.673 129.209  1.00 61.81           H  
ATOM  11261 HG13 VAL A  90     114.079 138.448 128.607  1.00 61.81           H  
ATOM  11262 HG21 VAL A  90     114.749 136.617 130.881  1.00 61.81           H  
ATOM  11263 HG22 VAL A  90     115.861 137.606 130.323  1.00 61.81           H  
ATOM  11264 HG23 VAL A  90     115.443 137.660 131.852  1.00 61.81           H  
ATOM  11265  N   MET A  91     113.012 141.534 131.160  1.00 64.51           N  
ATOM  11266  CA  MET A  91     112.082 142.614 130.853  1.00 64.51           C  
ATOM  11267  C   MET A  91     112.847 143.850 130.402  1.00 64.51           C  
ATOM  11268  O   MET A  91     112.412 144.566 129.490  1.00 64.51           O  
ATOM  11269  CB  MET A  91     111.262 142.944 132.094  1.00 64.51           C  
ATOM  11270  CG  MET A  91     110.245 141.890 132.512  1.00 64.51           C  
ATOM  11271  SD  MET A  91     109.087 141.378 131.248  1.00 64.51           S  
ATOM  11272  CE  MET A  91     108.227 142.921 131.084  1.00 64.51           C  
ATOM  11273  H   MET A  91     113.058 141.302 131.983  1.00 64.51           H  
ATOM  11274  HA  MET A  91     111.489 142.345 130.142  1.00 64.51           H  
ATOM  11275  HB2 MET A  91     111.872 143.087 132.830  1.00 64.51           H  
ATOM  11276  HB3 MET A  91     110.775 143.763 131.910  1.00 64.51           H  
ATOM  11277  HG2 MET A  91     110.727 141.098 132.795  1.00 64.51           H  
ATOM  11278  HG3 MET A  91     109.727 142.239 133.253  1.00 64.51           H  
ATOM  11279  HE1 MET A  91     107.388 142.758 130.633  1.00 64.51           H  
ATOM  11280  HE2 MET A  91     108.065 143.283 131.967  1.00 64.51           H  
ATOM  11281  HE3 MET A  91     108.791 143.530 130.580  1.00 64.51           H  
ATOM  11282  N   ALA A  92     114.008 144.100 131.016  1.00 61.75           N  
ATOM  11283  CA  ALA A  92     114.841 145.230 130.618  1.00 61.75           C  
ATOM  11284  C   ALA A  92     115.349 145.069 129.189  1.00 61.75           C  
ATOM  11285  O   ALA A  92     115.313 146.018 128.395  1.00 61.75           O  
ATOM  11286  CB  ALA A  92     116.005 145.383 131.593  1.00 61.75           C  
ATOM  11287  H   ALA A  92     114.330 143.627 131.658  1.00 61.75           H  
ATOM  11288  HA  ALA A  92     114.312 146.038 130.653  1.00 61.75           H  
ATOM  11289  HB1 ALA A  92     116.581 146.101 131.291  1.00 61.75           H  
ATOM  11290  HB2 ALA A  92     115.652 145.589 132.472  1.00 61.75           H  
ATOM  11291  HB3 ALA A  92     116.497 144.549 131.618  1.00 61.75           H  
ATOM  11292  N   LEU A  93     115.815 143.867 128.842  1.00 56.10           N  
ATOM  11293  CA  LEU A  93     116.293 143.623 127.488  1.00 56.10           C  
ATOM  11294  C   LEU A  93     115.177 143.758 126.479  1.00 56.10           C  
ATOM  11295  O   LEU A  93     115.388 144.268 125.376  1.00 56.10           O  
ATOM  11296  CB  LEU A  93     116.907 142.242 127.373  1.00 56.10           C  
ATOM  11297  CG  LEU A  93     118.275 142.132 128.013  1.00 56.10           C  
ATOM  11298  CD1 LEU A  93     118.626 140.685 128.286  1.00 56.10           C  
ATOM  11299  CD2 LEU A  93     119.306 142.793 127.125  1.00 56.10           C  
ATOM  11300  H   LEU A  93     115.864 143.188 129.362  1.00 56.10           H  
ATOM  11301  HA  LEU A  93     116.958 144.282 127.271  1.00 56.10           H  
ATOM  11302  HB2 LEU A  93     116.317 141.618 127.811  1.00 56.10           H  
ATOM  11303  HB3 LEU A  93     116.980 142.025 126.435  1.00 56.10           H  
ATOM  11304  HG  LEU A  93     118.244 142.602 128.854  1.00 56.10           H  
ATOM  11305 HD11 LEU A  93     119.528 140.636 128.642  1.00 56.10           H  
ATOM  11306 HD12 LEU A  93     117.995 140.328 128.930  1.00 56.10           H  
ATOM  11307 HD13 LEU A  93     118.568 140.190 127.454  1.00 56.10           H  
ATOM  11308 HD21 LEU A  93     120.191 142.596 127.464  1.00 56.10           H  
ATOM  11309 HD22 LEU A  93     119.210 142.455 126.223  1.00 56.10           H  
ATOM  11310 HD23 LEU A  93     119.157 143.749 127.130  1.00 56.10           H  
ATOM  11311  N   GLN A  94     113.977 143.332 126.846  1.00 61.14           N  
ATOM  11312  CA  GLN A  94     112.868 143.412 125.911  1.00 61.14           C  
ATOM  11313  C   GLN A  94     112.490 144.863 125.670  1.00 61.14           C  
ATOM  11314  O   GLN A  94     112.256 145.270 124.527  1.00 61.14           O  
ATOM  11315  CB  GLN A  94     111.687 142.631 126.473  1.00 61.14           C  
ATOM  11316  CG  GLN A  94     110.702 142.121 125.475  1.00 61.14           C  
ATOM  11317  CD  GLN A  94     109.614 141.315 126.145  1.00 61.14           C  
ATOM  11318  OE1 GLN A  94     109.871 140.567 127.087  1.00 61.14           O  
ATOM  11319  NE2 GLN A  94     108.384 141.487 125.687  1.00 61.14           N  
ATOM  11320  H   GLN A  94     113.788 143.006 127.614  1.00 61.14           H  
ATOM  11321  HA  GLN A  94     113.121 143.007 125.070  1.00 61.14           H  
ATOM  11322  HB2 GLN A  94     112.028 141.859 126.947  1.00 61.14           H  
ATOM  11323  HB3 GLN A  94     111.203 143.205 127.083  1.00 61.14           H  
ATOM  11324  HG2 GLN A  94     110.297 142.870 125.016  1.00 61.14           H  
ATOM  11325  HG3 GLN A  94     111.162 141.544 124.848  1.00 61.14           H  
ATOM  11326 HE21 GLN A  94     108.242 142.024 125.032  1.00 61.14           H  
ATOM  11327 HE22 GLN A  94     107.731 141.054 126.042  1.00 61.14           H  
ATOM  11328  N   GLU A  95     112.432 145.658 126.739  1.00 60.78           N  
ATOM  11329  CA  GLU A  95     112.173 147.086 126.597  1.00 60.78           C  
ATOM  11330  C   GLU A  95     113.233 147.773 125.743  1.00 60.78           C  
ATOM  11331  O   GLU A  95     112.905 148.571 124.856  1.00 60.78           O  
ATOM  11332  CB  GLU A  95     112.084 147.739 127.969  1.00 60.78           C  
ATOM  11333  CG  GLU A  95     111.819 149.243 127.975  1.00 60.78           C  
ATOM  11334  CD  GLU A  95     110.834 149.727 126.916  1.00 60.78           C  
ATOM  11335  OE1 GLU A  95     111.039 150.839 126.383  1.00 60.78           O  
ATOM  11336  OE2 GLU A  95     109.837 149.024 126.646  1.00 60.78           O  
ATOM  11337  H   GLU A  95     112.555 145.403 127.547  1.00 60.78           H  
ATOM  11338  HA  GLU A  95     111.324 147.168 126.148  1.00 60.78           H  
ATOM  11339  HB2 GLU A  95     111.376 147.306 128.469  1.00 60.78           H  
ATOM  11340  HB3 GLU A  95     112.933 147.599 128.416  1.00 60.78           H  
ATOM  11341  HG2 GLU A  95     111.452 149.470 128.841  1.00 60.78           H  
ATOM  11342  HG3 GLU A  95     112.657 149.706 127.834  1.00 60.78           H  
ATOM  11343  N   ALA A  96     114.511 147.462 125.982  1.00 60.55           N  
ATOM  11344  CA  ALA A  96     115.587 148.065 125.193  1.00 60.55           C  
ATOM  11345  C   ALA A  96     115.485 147.678 123.722  1.00 60.55           C  
ATOM  11346  O   ALA A  96     115.591 148.535 122.834  1.00 60.55           O  
ATOM  11347  CB  ALA A  96     116.943 147.649 125.756  1.00 60.55           C  
ATOM  11348  H   ALA A  96     114.772 146.900 126.578  1.00 60.55           H  
ATOM  11349  HA  ALA A  96     115.522 149.030 125.253  1.00 60.55           H  
ATOM  11350  HB1 ALA A  96     117.646 147.998 125.188  1.00 60.55           H  
ATOM  11351  HB2 ALA A  96     117.034 148.005 126.650  1.00 60.55           H  
ATOM  11352  HB3 ALA A  96     116.994 146.679 125.778  1.00 60.55           H  
ATOM  11353  N   CYS A  97     115.242 146.400 123.450  1.00 54.31           N  
ATOM  11354  CA  CYS A  97     115.133 145.917 122.080  1.00 54.31           C  
ATOM  11355  C   CYS A  97     113.984 146.611 121.383  1.00 54.31           C  
ATOM  11356  O   CYS A  97     114.101 147.051 120.236  1.00 54.31           O  
ATOM  11357  CB  CYS A  97     114.939 144.409 122.050  1.00 54.31           C  
ATOM  11358  SG  CYS A  97     116.428 143.475 122.458  1.00 54.31           S  
ATOM  11359  H   CYS A  97     115.132 145.792 124.051  1.00 54.31           H  
ATOM  11360  HA  CYS A  97     115.953 146.116 121.593  1.00 54.31           H  
ATOM  11361  HB2 CYS A  97     114.207 144.165 122.643  1.00 54.31           H  
ATOM  11362  HB3 CYS A  97     114.722 144.163 121.143  1.00 54.31           H  
ATOM  11363  HG  CYS A  97     116.263 142.349 122.086  1.00 54.31           H  
ATOM  11364  N   GLU A  98     112.845 146.682 122.061  1.00 56.25           N  
ATOM  11365  CA  GLU A  98     111.674 147.263 121.438  1.00 56.25           C  
ATOM  11366  C   GLU A  98     111.854 148.752 121.186  1.00 56.25           C  
ATOM  11367  O   GLU A  98     111.468 149.246 120.122  1.00 56.25           O  
ATOM  11368  CB  GLU A  98     110.467 147.026 122.344  1.00 56.25           C  
ATOM  11369  CG  GLU A  98     109.135 147.396 121.736  1.00 56.25           C  
ATOM  11370  CD  GLU A  98     108.712 148.850 121.931  1.00 56.25           C  
ATOM  11371  OE1 GLU A  98     109.147 149.491 122.910  1.00 56.25           O  
ATOM  11372  OE2 GLU A  98     107.920 149.351 121.104  1.00 56.25           O  
ATOM  11373  H   GLU A  98     112.736 146.409 122.867  1.00 56.25           H  
ATOM  11374  HA  GLU A  98     111.511 146.811 120.600  1.00 56.25           H  
ATOM  11375  HB2 GLU A  98     110.439 146.082 122.553  1.00 56.25           H  
ATOM  11376  HB3 GLU A  98     110.587 147.530 123.164  1.00 56.25           H  
ATOM  11377  HG2 GLU A  98     109.260 147.293 120.800  1.00 56.25           H  
ATOM  11378  HG3 GLU A  98     108.452 146.805 122.080  1.00 56.25           H  
ATOM  11379  N   ALA A  99     112.468 149.477 122.122  1.00 56.22           N  
ATOM  11380  CA  ALA A  99     112.717 150.898 121.899  1.00 56.22           C  
ATOM  11381  C   ALA A  99     113.696 151.124 120.749  1.00 56.22           C  
ATOM  11382  O   ALA A  99     113.510 152.025 119.911  1.00 56.22           O  
ATOM  11383  CB  ALA A  99     113.255 151.523 123.178  1.00 56.22           C  
ATOM  11384  H   ALA A  99     112.760 149.171 122.870  1.00 56.22           H  
ATOM  11385  HA  ALA A  99     111.881 151.338 121.702  1.00 56.22           H  
ATOM  11386  HB1 ALA A  99     113.454 152.456 123.016  1.00 56.22           H  
ATOM  11387  HB2 ALA A  99     112.581 151.437 123.872  1.00 56.22           H  
ATOM  11388  HB3 ALA A  99     114.060 151.044 123.431  1.00 56.22           H  
ATOM  11389  N   TYR A 100     114.678 150.233 120.627  1.00 52.86           N  
ATOM  11390  CA  TYR A 100     115.657 150.338 119.553  1.00 52.86           C  
ATOM  11391  C   TYR A 100     114.993 150.099 118.199  1.00 52.86           C  
ATOM  11392  O   TYR A 100     115.174 150.881 117.255  1.00 52.86           O  
ATOM  11393  CB  TYR A 100     116.808 149.366 119.827  1.00 52.86           C  
ATOM  11394  CG  TYR A 100     117.713 149.093 118.669  1.00 52.86           C  
ATOM  11395  CD1 TYR A 100     118.646 150.025 118.287  1.00 52.86           C  
ATOM  11396  CD2 TYR A 100     117.664 147.903 117.985  1.00 52.86           C  
ATOM  11397  CE1 TYR A 100     119.482 149.798 117.236  1.00 52.86           C  
ATOM  11398  CE2 TYR A 100     118.503 147.660 116.936  1.00 52.86           C  
ATOM  11399  CZ  TYR A 100     119.411 148.611 116.562  1.00 52.86           C  
ATOM  11400  OH  TYR A 100     120.263 148.371 115.513  1.00 52.86           O  
ATOM  11401  H   TYR A 100     114.789 149.563 121.158  1.00 52.86           H  
ATOM  11402  HA  TYR A 100     116.030 151.233 119.557  1.00 52.86           H  
ATOM  11403  HB2 TYR A 100     117.363 149.733 120.532  1.00 52.86           H  
ATOM  11404  HB3 TYR A 100     116.442 148.517 120.110  1.00 52.86           H  
ATOM  11405  HD1 TYR A 100     118.686 150.828 118.745  1.00 52.86           H  
ATOM  11406  HD2 TYR A 100     117.046 147.262 118.235  1.00 52.86           H  
ATOM  11407  HE1 TYR A 100     120.102 150.440 116.987  1.00 52.86           H  
ATOM  11408  HE2 TYR A 100     118.457 146.858 116.478  1.00 52.86           H  
ATOM  11409  HH  TYR A 100     120.769 149.031 115.401  1.00 52.86           H  
ATOM  11410  N   LEU A 101     114.196 149.034 118.097  1.00 48.01           N  
ATOM  11411  CA  LEU A 101     113.516 148.717 116.849  1.00 48.01           C  
ATOM  11412  C   LEU A 101     112.509 149.784 116.444  1.00 48.01           C  
ATOM  11413  O   LEU A 101     112.396 150.094 115.257  1.00 48.01           O  
ATOM  11414  CB  LEU A 101     112.820 147.373 116.962  1.00 48.01           C  
ATOM  11415  CG  LEU A 101     113.703 146.152 117.050  1.00 48.01           C  
ATOM  11416  CD1 LEU A 101     112.829 144.947 117.226  1.00 48.01           C  
ATOM  11417  CD2 LEU A 101     114.522 146.026 115.813  1.00 48.01           C  
ATOM  11418  H   LEU A 101     114.034 148.473 118.727  1.00 48.01           H  
ATOM  11419  HA  LEU A 101     114.176 148.675 116.149  1.00 48.01           H  
ATOM  11420  HB2 LEU A 101     112.286 147.392 117.763  1.00 48.01           H  
ATOM  11421  HB3 LEU A 101     112.254 147.253 116.190  1.00 48.01           H  
ATOM  11422  HG  LEU A 101     114.292 146.245 117.809  1.00 48.01           H  
ATOM  11423 HD11 LEU A 101     113.385 144.165 117.342  1.00 48.01           H  
ATOM  11424 HD12 LEU A 101     112.269 145.078 118.005  1.00 48.01           H  
ATOM  11425 HD13 LEU A 101     112.279 144.854 116.435  1.00 48.01           H  
ATOM  11426 HD21 LEU A 101     114.863 145.126 115.753  1.00 48.01           H  
ATOM  11427 HD22 LEU A 101     113.962 146.226 115.051  1.00 48.01           H  
ATOM  11428 HD23 LEU A 101     115.247 146.664 115.866  1.00 48.01           H  
ATOM  11429  N   VAL A 102     111.701 150.291 117.376  1.00 50.88           N  
ATOM  11430  CA  VAL A 102     110.778 151.360 117.008  1.00 50.88           C  
ATOM  11431  C   VAL A 102     111.543 152.550 116.458  1.00 50.88           C  
ATOM  11432  O   VAL A 102     111.135 153.147 115.452  1.00 50.88           O  
ATOM  11433  CB  VAL A 102     109.839 151.767 118.156  1.00 50.88           C  
ATOM  11434  CG1 VAL A 102     108.942 150.620 118.513  1.00 50.88           C  
ATOM  11435  CG2 VAL A 102     110.578 152.247 119.342  1.00 50.88           C  
ATOM  11436  H   VAL A 102     111.668 150.048 118.191  1.00 50.88           H  
ATOM  11437  HA  VAL A 102     110.228 151.031 116.290  1.00 50.88           H  
ATOM  11438  HB  VAL A 102     109.287 152.495 117.840  1.00 50.88           H  
ATOM  11439 HG11 VAL A 102     108.291 150.908 119.171  1.00 50.88           H  
ATOM  11440 HG12 VAL A 102     108.497 150.330 117.706  1.00 50.88           H  
ATOM  11441 HG13 VAL A 102     109.483 149.903 118.863  1.00 50.88           H  
ATOM  11442 HG21 VAL A 102     109.951 152.375 120.067  1.00 50.88           H  
ATOM  11443 HG22 VAL A 102     111.199 151.568 119.570  1.00 50.88           H  
ATOM  11444 HG23 VAL A 102     111.034 153.074 119.140  1.00 50.88           H  
ATOM  11445  N   GLY A 103     112.641 152.940 117.109  1.00 53.95           N  
ATOM  11446  CA  GLY A 103     113.407 154.059 116.582  1.00 53.95           C  
ATOM  11447  C   GLY A 103     113.928 153.778 115.182  1.00 53.95           C  
ATOM  11448  O   GLY A 103     113.889 154.648 114.297  1.00 53.95           O  
ATOM  11449  H   GLY A 103     112.946 152.571 117.821  1.00 53.95           H  
ATOM  11450  HA2 GLY A 103     112.854 154.854 116.560  1.00 53.95           H  
ATOM  11451  HA3 GLY A 103     114.164 154.226 117.166  1.00 53.95           H  
ATOM  11452  N   LEU A 104     114.354 152.539 114.937  1.00 47.71           N  
ATOM  11453  CA  LEU A 104     114.837 152.203 113.604  1.00 47.71           C  
ATOM  11454  C   LEU A 104     113.720 152.194 112.576  1.00 47.71           C  
ATOM  11455  O   LEU A 104     113.935 152.603 111.434  1.00 47.71           O  
ATOM  11456  CB  LEU A 104     115.518 150.845 113.624  1.00 47.71           C  
ATOM  11457  CG  LEU A 104     116.093 150.305 112.324  1.00 47.71           C  
ATOM  11458  CD1 LEU A 104     117.150 151.185 111.707  1.00 47.71           C  
ATOM  11459  CD2 LEU A 104     116.640 148.932 112.598  1.00 47.71           C  
ATOM  11460  H   LEU A 104     114.357 151.893 115.504  1.00 47.71           H  
ATOM  11461  HA  LEU A 104     115.474 152.871 113.332  1.00 47.71           H  
ATOM  11462  HB2 LEU A 104     116.251 150.888 114.251  1.00 47.71           H  
ATOM  11463  HB3 LEU A 104     114.865 150.200 113.921  1.00 47.71           H  
ATOM  11464  HG  LEU A 104     115.375 150.209 111.687  1.00 47.71           H  
ATOM  11465 HD11 LEU A 104     118.010 150.758 111.823  1.00 47.71           H  
ATOM  11466 HD12 LEU A 104     116.953 151.284 110.765  1.00 47.71           H  
ATOM  11467 HD13 LEU A 104     117.160 152.050 112.130  1.00 47.71           H  
ATOM  11468 HD21 LEU A 104     117.024 148.578 111.784  1.00 47.71           H  
ATOM  11469 HD22 LEU A 104     117.315 149.002 113.288  1.00 47.71           H  
ATOM  11470 HD23 LEU A 104     115.916 148.363 112.898  1.00 47.71           H  
ATOM  11471  N   PHE A 105     112.526 151.733 112.945  1.00 50.37           N  
ATOM  11472  CA  PHE A 105     111.431 151.761 111.986  1.00 50.37           C  
ATOM  11473  C   PHE A 105     111.009 153.189 111.696  1.00 50.37           C  
ATOM  11474  O   PHE A 105     110.593 153.495 110.576  1.00 50.37           O  
ATOM  11475  CB  PHE A 105     110.211 150.972 112.474  1.00 50.37           C  
ATOM  11476  CG  PHE A 105     110.307 149.494 112.301  1.00 50.37           C  
ATOM  11477  CD1 PHE A 105     110.574 148.939 111.077  1.00 50.37           C  
ATOM  11478  CD2 PHE A 105     110.032 148.659 113.351  1.00 50.37           C  
ATOM  11479  CE1 PHE A 105     110.641 147.588 110.920  1.00 50.37           C  
ATOM  11480  CE2 PHE A 105     110.087 147.302 113.200  1.00 50.37           C  
ATOM  11481  CZ  PHE A 105     110.390 146.764 111.979  1.00 50.37           C  
ATOM  11482  H   PHE A 105     112.331 151.415 113.715  1.00 50.37           H  
ATOM  11483  HA  PHE A 105     111.752 151.390 111.158  1.00 50.37           H  
ATOM  11484  HB2 PHE A 105     110.092 151.142 113.416  1.00 50.37           H  
ATOM  11485  HB3 PHE A 105     109.434 151.259 111.979  1.00 50.37           H  
ATOM  11486  HD1 PHE A 105     110.753 149.497 110.363  1.00 50.37           H  
ATOM  11487  HD2 PHE A 105     109.828 149.024 114.176  1.00 50.37           H  
ATOM  11488  HE1 PHE A 105     110.844 147.230 110.091  1.00 50.37           H  
ATOM  11489  HE2 PHE A 105     109.914 146.749 113.925  1.00 50.37           H  
ATOM  11490  HZ  PHE A 105     110.429 145.842 111.871  1.00 50.37           H  
ATOM  11491  N   GLU A 106     111.155 154.079 112.672  1.00 53.11           N  
ATOM  11492  CA  GLU A 106     110.865 155.486 112.442  1.00 53.11           C  
ATOM  11493  C   GLU A 106     111.829 156.078 111.418  1.00 53.11           C  
ATOM  11494  O   GLU A 106     111.414 156.723 110.437  1.00 53.11           O  
ATOM  11495  CB  GLU A 106     110.944 156.224 113.773  1.00 53.11           C  
ATOM  11496  CG  GLU A 106     110.348 157.621 113.770  1.00 53.11           C  
ATOM  11497  CD  GLU A 106     111.334 158.716 113.387  1.00 53.11           C  
ATOM  11498  OE1 GLU A 106     112.557 158.536 113.564  1.00 53.11           O  
ATOM  11499  OE2 GLU A 106     110.874 159.775 112.914  1.00 53.11           O  
ATOM  11500  H   GLU A 106     111.432 153.902 113.463  1.00 53.11           H  
ATOM  11501  HA  GLU A 106     109.961 155.569 112.106  1.00 53.11           H  
ATOM  11502  HB2 GLU A 106     110.444 155.703 114.417  1.00 53.11           H  
ATOM  11503  HB3 GLU A 106     111.870 156.259 114.043  1.00 53.11           H  
ATOM  11504  HG2 GLU A 106     109.615 157.646 113.137  1.00 53.11           H  
ATOM  11505  HG3 GLU A 106     110.020 157.816 114.662  1.00 53.11           H  
ATOM  11506  N   ASP A 107     113.124 155.792 111.588  1.00 55.05           N  
ATOM  11507  CA  ASP A 107     114.105 156.322 110.642  1.00 55.05           C  
ATOM  11508  C   ASP A 107     113.919 155.692 109.260  1.00 55.05           C  
ATOM  11509  O   ASP A 107     114.000 156.376 108.229  1.00 55.05           O  
ATOM  11510  CB  ASP A 107     115.517 156.045 111.159  1.00 55.05           C  
ATOM  11511  CG  ASP A 107     115.816 156.762 112.459  1.00 55.05           C  
ATOM  11512  OD1 ASP A 107     116.930 156.586 112.995  1.00 55.05           O  
ATOM  11513  OD2 ASP A 107     114.932 157.489 112.958  1.00 55.05           O  
ATOM  11514  H   ASP A 107     113.439 155.305 112.224  1.00 55.05           H  
ATOM  11515  HA  ASP A 107     113.994 157.281 110.573  1.00 55.05           H  
ATOM  11516  HB2 ASP A 107     115.601 155.098 111.328  1.00 55.05           H  
ATOM  11517  HB3 ASP A 107     116.170 156.328 110.492  1.00 55.05           H  
ATOM  11518  N   THR A 108     113.663 154.386 109.228  1.00 49.25           N  
ATOM  11519  CA  THR A 108     113.380 153.690 107.987  1.00 49.25           C  
ATOM  11520  C   THR A 108     112.189 154.282 107.266  1.00 49.25           C  
ATOM  11521  O   THR A 108     112.206 154.408 106.039  1.00 49.25           O  
ATOM  11522  CB  THR A 108     113.112 152.231 108.284  1.00 49.25           C  
ATOM  11523  OG1 THR A 108     114.265 151.648 108.894  1.00 49.25           O  
ATOM  11524  CG2 THR A 108     112.761 151.505 107.050  1.00 49.25           C  
ATOM  11525  H   THR A 108     113.641 153.875 109.917  1.00 49.25           H  
ATOM  11526  HA  THR A 108     114.143 153.749 107.403  1.00 49.25           H  
ATOM  11527  HB  THR A 108     112.354 152.190 108.883  1.00 49.25           H  
ATOM  11528  HG1 THR A 108     114.121 150.836 109.029  1.00 49.25           H  
ATOM  11529 HG21 THR A 108     113.019 150.576 107.125  1.00 49.25           H  
ATOM  11530 HG22 THR A 108     111.808 151.567 106.908  1.00 49.25           H  
ATOM  11531 HG23 THR A 108     113.223 151.909 106.311  1.00 49.25           H  
ATOM  11532  N   ASN A 109     111.123 154.583 107.997  1.00 53.85           N  
ATOM  11533  CA  ASN A 109     109.948 155.151 107.361  1.00 53.85           C  
ATOM  11534  C   ASN A 109     110.264 156.498 106.748  1.00 53.85           C  
ATOM  11535  O   ASN A 109     109.783 156.821 105.655  1.00 53.85           O  
ATOM  11536  CB  ASN A 109     108.812 155.298 108.363  1.00 53.85           C  
ATOM  11537  CG  ASN A 109     107.450 155.360 107.694  1.00 53.85           C  
ATOM  11538  OD1 ASN A 109     107.223 154.738 106.655  1.00 53.85           O  
ATOM  11539  ND2 ASN A 109     106.544 156.137 108.271  1.00 53.85           N  
ATOM  11540  H   ASN A 109     111.065 154.469 108.841  1.00 53.85           H  
ATOM  11541  HA  ASN A 109     109.671 154.549 106.661  1.00 53.85           H  
ATOM  11542  HB2 ASN A 109     108.829 154.540 108.963  1.00 53.85           H  
ATOM  11543  HB3 ASN A 109     108.946 156.122 108.856  1.00 53.85           H  
ATOM  11544 HD21 ASN A 109     105.759 156.210 107.927  1.00 53.85           H  
ATOM  11545 HD22 ASN A 109     106.741 156.563 108.991  1.00 53.85           H  
ATOM  11546  N   LEU A 110     111.085 157.296 107.425  1.00 56.17           N  
ATOM  11547  CA  LEU A 110     111.441 158.579 106.830  1.00 56.17           C  
ATOM  11548  C   LEU A 110     112.283 158.400 105.572  1.00 56.17           C  
ATOM  11549  O   LEU A 110     112.103 159.133 104.590  1.00 56.17           O  
ATOM  11550  CB  LEU A 110     112.170 159.433 107.851  1.00 56.17           C  
ATOM  11551  CG  LEU A 110     111.295 159.832 109.033  1.00 56.17           C  
ATOM  11552  CD1 LEU A 110     112.124 160.596 109.997  1.00 56.17           C  
ATOM  11553  CD2 LEU A 110     110.101 160.670 108.607  1.00 56.17           C  
ATOM  11554  H   LEU A 110     111.440 157.128 108.190  1.00 56.17           H  
ATOM  11555  HA  LEU A 110     110.636 159.033 106.552  1.00 56.17           H  
ATOM  11556  HB2 LEU A 110     112.925 158.936 108.197  1.00 56.17           H  
ATOM  11557  HB3 LEU A 110     112.484 160.247 107.423  1.00 56.17           H  
ATOM  11558  HG  LEU A 110     110.964 159.034 109.471  1.00 56.17           H  
ATOM  11559 HD11 LEU A 110     111.595 160.822 110.777  1.00 56.17           H  
ATOM  11560 HD12 LEU A 110     112.896 160.066 110.252  1.00 56.17           H  
ATOM  11561 HD13 LEU A 110     112.401 161.396 109.534  1.00 56.17           H  
ATOM  11562 HD21 LEU A 110     109.777 161.182 109.362  1.00 56.17           H  
ATOM  11563 HD22 LEU A 110     110.379 161.264 107.892  1.00 56.17           H  
ATOM  11564 HD23 LEU A 110     109.409 160.073 108.284  1.00 56.17           H  
ATOM  11565  N   CYS A 111     113.159 157.391 105.552  1.00 54.50           N  
ATOM  11566  CA  CYS A 111     113.950 157.131 104.346  1.00 54.50           C  
ATOM  11567  C   CYS A 111     113.067 156.633 103.202  1.00 54.50           C  
ATOM  11568  O   CYS A 111     113.263 157.004 102.039  1.00 54.50           O  
ATOM  11569  CB  CYS A 111     115.051 156.121 104.645  1.00 54.50           C  
ATOM  11570  SG  CYS A 111     116.293 156.722 105.827  1.00 54.50           S  
ATOM  11571  H   CYS A 111     113.327 156.869 106.212  1.00 54.50           H  
ATOM  11572  HA  CYS A 111     114.375 157.954 104.045  1.00 54.50           H  
ATOM  11573  HB2 CYS A 111     114.666 155.283 104.942  1.00 54.50           H  
ATOM  11574  HB3 CYS A 111     115.564 156.019 103.842  1.00 54.50           H  
ATOM  11575  HG  CYS A 111     117.293 156.087 105.614  1.00 54.50           H  
ATOM  11576  N   ALA A 112     112.089 155.784 103.517  1.00 52.78           N  
ATOM  11577  CA  ALA A 112     111.172 155.283 102.502  1.00 52.78           C  
ATOM  11578  C   ALA A 112     110.363 156.415 101.910  1.00 52.78           C  
ATOM  11579  O   ALA A 112     110.229 156.522 100.687  1.00 52.78           O  
ATOM  11580  CB  ALA A 112     110.244 154.234 103.098  1.00 52.78           C  
ATOM  11581  H   ALA A 112     111.932 155.495 104.305  1.00 52.78           H  
ATOM  11582  HA  ALA A 112     111.675 154.879 101.783  1.00 52.78           H  
ATOM  11583  HB1 ALA A 112     109.635 153.932 102.406  1.00 52.78           H  
ATOM  11584  HB2 ALA A 112     110.771 153.491 103.422  1.00 52.78           H  
ATOM  11585  HB3 ALA A 112     109.743 154.641 103.819  1.00 52.78           H  
ATOM  11586  N   ILE A 113     109.805 157.260 102.768  1.00 53.47           N  
ATOM  11587  CA  ILE A 113     109.015 158.387 102.310  1.00 53.47           C  
ATOM  11588  C   ILE A 113     109.882 159.298 101.467  1.00 53.47           C  
ATOM  11589  O   ILE A 113     109.408 159.904 100.499  1.00 53.47           O  
ATOM  11590  CB  ILE A 113     108.377 159.111 103.501  1.00 53.47           C  
ATOM  11591  CG1 ILE A 113     107.276 158.227 104.084  1.00 53.47           C  
ATOM  11592  CG2 ILE A 113     107.820 160.449 103.079  1.00 53.47           C  
ATOM  11593  CD1 ILE A 113     106.829 158.586 105.474  1.00 53.47           C  
ATOM  11594  H   ILE A 113     109.884 157.208 103.616  1.00 53.47           H  
ATOM  11595  HA  ILE A 113     108.294 158.063 101.758  1.00 53.47           H  
ATOM  11596  HB  ILE A 113     109.068 159.248 104.163  1.00 53.47           H  
ATOM  11597 HG12 ILE A 113     106.504 158.296 103.503  1.00 53.47           H  
ATOM  11598 HG13 ILE A 113     107.585 157.311 104.106  1.00 53.47           H  
ATOM  11599 HG21 ILE A 113     107.149 160.726 103.718  1.00 53.47           H  
ATOM  11600 HG22 ILE A 113     108.536 161.099 103.059  1.00 53.47           H  
ATOM  11601 HG23 ILE A 113     107.418 160.359 102.203  1.00 53.47           H  
ATOM  11602 HD11 ILE A 113     106.551 157.778 105.936  1.00 53.47           H  
ATOM  11603 HD12 ILE A 113     107.565 159.005 105.945  1.00 53.47           H  
ATOM  11604 HD13 ILE A 113     106.083 159.200 105.408  1.00 53.47           H  
ATOM  11605  N   HIS A 114     111.154 159.425 101.830  1.00 51.03           N  
ATOM  11606  CA  HIS A 114     112.082 160.245 101.064  1.00 51.03           C  
ATOM  11607  C   HIS A 114     112.223 159.786  99.614  1.00 51.03           C  
ATOM  11608  O   HIS A 114     112.343 160.624  98.715  1.00 51.03           O  
ATOM  11609  CB  HIS A 114     113.445 160.212 101.713  1.00 51.03           C  
ATOM  11610  CG  HIS A 114     114.397 161.159 101.100  1.00 51.03           C  
ATOM  11611  ND1 HIS A 114     114.261 162.517 101.252  1.00 51.03           N  
ATOM  11612  CD2 HIS A 114     115.455 160.966 100.286  1.00 51.03           C  
ATOM  11613  CE1 HIS A 114     115.224 163.121 100.590  1.00 51.03           C  
ATOM  11614  NE2 HIS A 114     115.963 162.204  99.993  1.00 51.03           N  
ATOM  11615  H   HIS A 114     111.500 159.027 102.510  1.00 51.03           H  
ATOM  11616  HA  HIS A 114     111.785 161.165 101.062  1.00 51.03           H  
ATOM  11617  HB2 HIS A 114     113.364 160.441 102.646  1.00 51.03           H  
ATOM  11618  HB3 HIS A 114     113.825 159.335 101.602  1.00 51.03           H  
ATOM  11619  HD2 HIS A 114     115.781 160.151  99.999  1.00 51.03           H  
ATOM  11620  HE1 HIS A 114     115.361 164.031 100.549  1.00 51.03           H  
ATOM  11621  HE2 HIS A 114     116.645 162.355  99.498  1.00 51.03           H  
ATOM  11622  N   ALA A 115     112.236 158.474  99.367  1.00 53.34           N  
ATOM  11623  CA  ALA A 115     112.327 157.897  98.025  1.00 53.34           C  
ATOM  11624  C   ALA A 115     110.989 157.840  97.286  1.00 53.34           C  
ATOM  11625  O   ALA A 115     110.856 157.073  96.327  1.00 53.34           O  
ATOM  11626  CB  ALA A 115     112.931 156.492  98.092  1.00 53.34           C  
ATOM  11627  H   ALA A 115     112.197 157.884  99.991  1.00 53.34           H  
ATOM  11628  HA  ALA A 115     112.919 158.447  97.492  1.00 53.34           H  
ATOM  11629  HB1 ALA A 115     113.027 156.149  97.190  1.00 53.34           H  
ATOM  11630  HB2 ALA A 115     113.800 156.539  98.519  1.00 53.34           H  
ATOM  11631  HB3 ALA A 115     112.341 155.917  98.601  1.00 53.34           H  
ATOM  11632  N   LYS A 116     110.002 158.616  97.716  1.00 59.44           N  
ATOM  11633  CA  LYS A 116     108.674 158.643  97.116  1.00 59.44           C  
ATOM  11634  C   LYS A 116     107.995 157.286  97.157  1.00 59.44           C  
ATOM  11635  O   LYS A 116     107.210 156.948  96.270  1.00 59.44           O  
ATOM  11636  CB  LYS A 116     108.738 159.115  95.669  1.00 59.44           C  
ATOM  11637  CG  LYS A 116     109.346 160.476  95.473  1.00 59.44           C  
ATOM  11638  CD  LYS A 116     109.153 160.948  94.031  1.00 59.44           C  
ATOM  11639  CE  LYS A 116     108.992 162.449  93.930  1.00 59.44           C  
ATOM  11640  NZ  LYS A 116     109.443 162.931  92.600  1.00 59.44           N  
ATOM  11641  H   LYS A 116     110.069 159.159  98.368  1.00 59.44           H  
ATOM  11642  HA  LYS A 116     108.121 159.260  97.609  1.00 59.44           H  
ATOM  11643  HB2 LYS A 116     109.254 158.478  95.157  1.00 59.44           H  
ATOM  11644  HB3 LYS A 116     107.831 159.142  95.337  1.00 59.44           H  
ATOM  11645  HG2 LYS A 116     108.915 161.106  96.070  1.00 59.44           H  
ATOM  11646  HG3 LYS A 116     110.296 160.421  95.664  1.00 59.44           H  
ATOM  11647  HD2 LYS A 116     109.933 160.697  93.512  1.00 59.44           H  
ATOM  11648  HD3 LYS A 116     108.359 160.546  93.648  1.00 59.44           H  
ATOM  11649  HE2 LYS A 116     108.056 162.679  94.039  1.00 59.44           H  
ATOM  11650  HE3 LYS A 116     109.530 162.880  94.612  1.00 59.44           H  
ATOM  11651  HZ1 LYS A 116     109.345 163.813  92.547  1.00 59.44           H  
ATOM  11652  HZ2 LYS A 116     110.300 162.723  92.477  1.00 59.44           H  
ATOM  11653  HZ3 LYS A 116     108.958 162.547  91.960  1.00 59.44           H  
ATOM  11654  N   ARG A 117     108.305 156.501  98.172  1.00 57.19           N  
ATOM  11655  CA  ARG A 117     107.688 155.210  98.398  1.00 57.19           C  
ATOM  11656  C   ARG A 117     106.954 155.222  99.730  1.00 57.19           C  
ATOM  11657  O   ARG A 117     107.140 156.111 100.563  1.00 57.19           O  
ATOM  11658  CB  ARG A 117     108.727 154.092  98.354  1.00 57.19           C  
ATOM  11659  CG  ARG A 117     109.167 153.785  96.956  1.00 57.19           C  
ATOM  11660  CD  ARG A 117     110.118 152.614  96.917  1.00 57.19           C  
ATOM  11661  NE  ARG A 117     111.474 152.986  97.314  1.00 57.19           N  
ATOM  11662  CZ  ARG A 117     111.978 152.879  98.541  1.00 57.19           C  
ATOM  11663  NH1 ARG A 117     111.259 152.410  99.552  1.00 57.19           N  
ATOM  11664  NH2 ARG A 117     113.229 153.248  98.757  1.00 57.19           N  
ATOM  11665  H   ARG A 117     108.894 156.701  98.755  1.00 57.19           H  
ATOM  11666  HA  ARG A 117     107.035 155.027  97.713  1.00 57.19           H  
ATOM  11667  HB2 ARG A 117     109.510 154.363  98.853  1.00 57.19           H  
ATOM  11668  HB3 ARG A 117     108.346 153.289  98.737  1.00 57.19           H  
ATOM  11669  HG2 ARG A 117     108.391 153.571  96.420  1.00 57.19           H  
ATOM  11670  HG3 ARG A 117     109.620 154.565  96.602  1.00 57.19           H  
ATOM  11671  HD2 ARG A 117     109.783 151.905  97.482  1.00 57.19           H  
ATOM  11672  HD3 ARG A 117     110.163 152.297  96.004  1.00 57.19           H  
ATOM  11673  HE  ARG A 117     112.012 153.235  96.693  1.00 57.19           H  
ATOM  11674 HH11 ARG A 117     110.445 152.166  99.442  1.00 57.19           H  
ATOM  11675 HH12 ARG A 117     111.616 152.358 100.332  1.00 57.19           H  
ATOM  11676 HH21 ARG A 117     113.704 153.552  98.107  1.00 57.19           H  
ATOM  11677 HH22 ARG A 117     113.564 153.185  99.545  1.00 57.19           H  
ATOM  11678  N   VAL A 118     106.092 154.226  99.906  1.00 51.09           N  
ATOM  11679  CA  VAL A 118     105.405 153.996 101.169  1.00 51.09           C  
ATOM  11680  C   VAL A 118     105.738 152.641 101.760  1.00 51.09           C  
ATOM  11681  O   VAL A 118     105.312 152.349 102.884  1.00 51.09           O  
ATOM  11682  CB  VAL A 118     103.883 154.135 100.990  1.00 51.09           C  
ATOM  11683  CG1 VAL A 118     103.182 154.243 102.327  1.00 51.09           C  
ATOM  11684  CG2 VAL A 118     103.595 155.330 100.110  1.00 51.09           C  
ATOM  11685  H   VAL A 118     105.880 153.658  99.304  1.00 51.09           H  
ATOM  11686  HA  VAL A 118     105.684 154.651 101.815  1.00 51.09           H  
ATOM  11687  HB  VAL A 118     103.568 153.341 100.543  1.00 51.09           H  
ATOM  11688 HG11 VAL A 118     102.298 154.619 102.207  1.00 51.09           H  
ATOM  11689 HG12 VAL A 118     103.100 153.355 102.701  1.00 51.09           H  
ATOM  11690 HG13 VAL A 118     103.707 154.805 102.916  1.00 51.09           H  
ATOM  11691 HG21 VAL A 118     102.676 155.616 100.219  1.00 51.09           H  
ATOM  11692 HG22 VAL A 118     104.202 156.042 100.363  1.00 51.09           H  
ATOM  11693 HG23 VAL A 118     103.749 155.082  99.188  1.00 51.09           H  
ATOM  11694  N   THR A 119     106.542 151.842 101.076  1.00 57.80           N  
ATOM  11695  CA  THR A 119     106.905 150.502 101.504  1.00 57.80           C  
ATOM  11696  C   THR A 119     108.349 150.535 101.954  1.00 57.80           C  
ATOM  11697  O   THR A 119     109.229 150.961 101.200  1.00 57.80           O  
ATOM  11698  CB  THR A 119     106.729 149.474 100.393  1.00 57.80           C  
ATOM  11699  OG1 THR A 119     105.411 149.572  99.843  1.00 57.80           O  
ATOM  11700  CG2 THR A 119     106.959 148.087 100.938  1.00 57.80           C  
ATOM  11701  H   THR A 119     106.912 152.050 100.336  1.00 57.80           H  
ATOM  11702  HA  THR A 119     106.367 150.234 102.259  1.00 57.80           H  
ATOM  11703  HB  THR A 119     107.390 149.634  99.705  1.00 57.80           H  
ATOM  11704  HG1 THR A 119     105.254 148.902  99.361  1.00 57.80           H  
ATOM  11705 HG21 THR A 119     106.631 147.427 100.311  1.00 57.80           H  
ATOM  11706 HG22 THR A 119     107.907 147.946 101.081  1.00 57.80           H  
ATOM  11707 HG23 THR A 119     106.496 147.984 101.783  1.00 57.80           H  
ATOM  11708  N   ILE A 120     108.588 150.074 103.140  1.00 50.38           N  
ATOM  11709  CA  ILE A 120     109.945 150.016 103.645  1.00 50.38           C  
ATOM  11710  C   ILE A 120     110.610 148.778 103.076  1.00 50.38           C  
ATOM  11711  O   ILE A 120     109.973 147.734 102.902  1.00 50.38           O  
ATOM  11712  CB  ILE A 120     109.942 150.037 105.184  1.00 50.38           C  
ATOM  11713  CG1 ILE A 120     109.169 148.862 105.782  1.00 50.38           C  
ATOM  11714  CG2 ILE A 120     109.318 151.327 105.665  1.00 50.38           C  
ATOM  11715  CD1 ILE A 120     109.544 148.587 107.196  1.00 50.38           C  
ATOM  11716  H   ILE A 120     107.990 149.786 103.675  1.00 50.38           H  
ATOM  11717  HA  ILE A 120     110.435 150.787 103.338  1.00 50.38           H  
ATOM  11718  HB  ILE A 120     110.856 149.987 105.488  1.00 50.38           H  
ATOM  11719 HG12 ILE A 120     108.225 149.069 105.757  1.00 50.38           H  
ATOM  11720 HG13 ILE A 120     109.330 148.048 105.296  1.00 50.38           H  
ATOM  11721 HG21 ILE A 120     109.427 151.395 106.626  1.00 50.38           H  
ATOM  11722 HG22 ILE A 120     109.764 152.067 105.227  1.00 50.38           H  
ATOM  11723 HG23 ILE A 120     108.377 151.334 105.433  1.00 50.38           H  
ATOM  11724 HD11 ILE A 120     109.100 147.777 107.486  1.00 50.38           H  
ATOM  11725 HD12 ILE A 120     110.505 148.477 107.245  1.00 50.38           H  
ATOM  11726 HD13 ILE A 120     109.266 149.336 107.744  1.00 50.38           H  
ATOM  11727  N   MET A 121     111.888 148.904 102.757  1.00 54.20           N  
ATOM  11728  CA  MET A 121     112.661 147.832 102.156  1.00 54.20           C  
ATOM  11729  C   MET A 121     113.972 147.689 102.899  1.00 54.20           C  
ATOM  11730  O   MET A 121     114.380 148.596 103.636  1.00 54.20           O  
ATOM  11731  CB  MET A 121     112.914 148.103 100.673  1.00 54.20           C  
ATOM  11732  CG  MET A 121     111.639 148.321  99.887  1.00 54.20           C  
ATOM  11733  SD  MET A 121     111.896 148.316  98.105  1.00 54.20           S  
ATOM  11734  CE  MET A 121     112.094 146.562  97.814  1.00 54.20           C  
ATOM  11735  H   MET A 121     112.338 149.623 102.879  1.00 54.20           H  
ATOM  11736  HA  MET A 121     112.161 147.014 102.224  1.00 54.20           H  
ATOM  11737  HB2 MET A 121     113.457 148.899 100.595  1.00 54.20           H  
ATOM  11738  HB3 MET A 121     113.373 147.346 100.293  1.00 54.20           H  
ATOM  11739  HG2 MET A 121     111.021 147.606 100.103  1.00 54.20           H  
ATOM  11740  HG3 MET A 121     111.254 149.175 100.138  1.00 54.20           H  
ATOM  11741  HE1 MET A 121     112.165 146.406  96.860  1.00 54.20           H  
ATOM  11742  HE2 MET A 121     112.898 146.256  98.261  1.00 54.20           H  
ATOM  11743  HE3 MET A 121     111.321 146.095  98.168  1.00 54.20           H  
ATOM  11744  N   PRO A 122     114.642 146.543 102.767  1.00 50.87           N  
ATOM  11745  CA  PRO A 122     115.936 146.346 103.431  1.00 50.87           C  
ATOM  11746  C   PRO A 122     116.959 147.443 103.234  1.00 50.87           C  
ATOM  11747  O   PRO A 122     117.694 147.780 104.168  1.00 50.87           O  
ATOM  11748  CB  PRO A 122     116.422 145.045 102.802  1.00 50.87           C  
ATOM  11749  CG  PRO A 122     115.198 144.320 102.520  1.00 50.87           C  
ATOM  11750  CD  PRO A 122     114.271 145.351 101.996  1.00 50.87           C  
ATOM  11751  HA  PRO A 122     115.783 146.211 104.375  1.00 50.87           H  
ATOM  11752  HB2 PRO A 122     116.889 145.256 101.980  1.00 50.87           H  
ATOM  11753  HB3 PRO A 122     116.990 144.565 103.419  1.00 50.87           H  
ATOM  11754  HG2 PRO A 122     115.365 143.640 101.854  1.00 50.87           H  
ATOM  11755  HG3 PRO A 122     114.850 143.940 103.339  1.00 50.87           H  
ATOM  11756  HD2 PRO A 122     114.434 145.504 101.060  1.00 50.87           H  
ATOM  11757  HD3 PRO A 122     113.357 145.110 102.174  1.00 50.87           H  
ATOM  11758  N   LYS A 123     117.028 148.009 102.034  1.00 54.51           N  
ATOM  11759  CA  LYS A 123     117.980 149.081 101.775  1.00 54.51           C  
ATOM  11760  C   LYS A 123     117.720 150.317 102.631  1.00 54.51           C  
ATOM  11761  O   LYS A 123     118.671 151.008 103.016  1.00 54.51           O  
ATOM  11762  CB  LYS A 123     117.990 149.367 100.277  1.00 54.51           C  
ATOM  11763  CG  LYS A 123     116.708 149.891  99.713  1.00 54.51           C  
ATOM  11764  CD  LYS A 123     116.929 150.438  98.322  1.00 54.51           C  
ATOM  11765  CE  LYS A 123     115.745 150.166  97.414  1.00 54.51           C  
ATOM  11766  NZ  LYS A 123     116.020 150.608  96.024  1.00 54.51           N  
ATOM  11767  H   LYS A 123     116.533 147.792 101.365  1.00 54.51           H  
ATOM  11768  HA  LYS A 123     118.863 148.762 102.012  1.00 54.51           H  
ATOM  11769  HB2 LYS A 123     118.673 150.029 100.096  1.00 54.51           H  
ATOM  11770  HB3 LYS A 123     118.197 148.548  99.808  1.00 54.51           H  
ATOM  11771  HG2 LYS A 123     116.093 149.149  99.639  1.00 54.51           H  
ATOM  11772  HG3 LYS A 123     116.330 150.560 100.285  1.00 54.51           H  
ATOM  11773  HD2 LYS A 123     117.076 151.392  98.363  1.00 54.51           H  
ATOM  11774  HD3 LYS A 123     117.703 149.997  97.940  1.00 54.51           H  
ATOM  11775  HE2 LYS A 123     115.564 149.214  97.393  1.00 54.51           H  
ATOM  11776  HE3 LYS A 123     114.969 150.649  97.741  1.00 54.51           H  
ATOM  11777  HZ1 LYS A 123     115.299 150.486  95.518  1.00 54.51           H  
ATOM  11778  HZ2 LYS A 123     116.238 151.470  96.015  1.00 54.51           H  
ATOM  11779  HZ3 LYS A 123     116.696 150.137  95.687  1.00 54.51           H  
ATOM  11780  N   ASP A 124     116.472 150.560 103.030  1.00 54.84           N  
ATOM  11781  CA  ASP A 124     116.201 151.681 103.924  1.00 54.84           C  
ATOM  11782  C   ASP A 124     116.761 151.411 105.311  1.00 54.84           C  
ATOM  11783  O   ASP A 124     117.347 152.300 105.942  1.00 54.84           O  
ATOM  11784  CB  ASP A 124     114.705 151.946 104.012  1.00 54.84           C  
ATOM  11785  CG  ASP A 124     114.090 152.290 102.676  1.00 54.84           C  
ATOM  11786  OD1 ASP A 124     114.536 151.737 101.653  1.00 54.84           O  
ATOM  11787  OD2 ASP A 124     113.181 153.139 102.650  1.00 54.84           O  
ATOM  11788  H   ASP A 124     115.779 150.110 102.799  1.00 54.84           H  
ATOM  11789  HA  ASP A 124     116.623 152.482 103.570  1.00 54.84           H  
ATOM  11790  HB2 ASP A 124     114.263 151.173 104.402  1.00 54.84           H  
ATOM  11791  HB3 ASP A 124     114.573 152.718 104.577  1.00 54.84           H  
ATOM  11792  N   ILE A 125     116.574 150.187 105.804  1.00 48.22           N  
ATOM  11793  CA  ILE A 125     117.119 149.801 107.096  1.00 48.22           C  
ATOM  11794  C   ILE A 125     118.631 149.892 107.061  1.00 48.22           C  
ATOM  11795  O   ILE A 125     119.265 150.384 108.005  1.00 48.22           O  
ATOM  11796  CB  ILE A 125     116.625 148.398 107.466  1.00 48.22           C  
ATOM  11797  CG1 ILE A 125     115.154 148.501 107.820  1.00 48.22           C  
ATOM  11798  CG2 ILE A 125     117.439 147.845 108.609  1.00 48.22           C  
ATOM  11799  CD1 ILE A 125     114.459 147.216 108.090  1.00 48.22           C  
ATOM  11800  H   ILE A 125     116.145 149.561 105.414  1.00 48.22           H  
ATOM  11801  HA  ILE A 125     116.786 150.403 107.768  1.00 48.22           H  
ATOM  11802  HB  ILE A 125     116.725 147.838 106.691  1.00 48.22           H  
ATOM  11803 HG12 ILE A 125     115.097 149.029 108.621  1.00 48.22           H  
ATOM  11804 HG13 ILE A 125     114.696 148.946 107.097  1.00 48.22           H  
ATOM  11805 HG21 ILE A 125     116.965 147.132 109.048  1.00 48.22           H  
ATOM  11806 HG22 ILE A 125     118.272 147.496 108.266  1.00 48.22           H  
ATOM  11807 HG23 ILE A 125     117.599 148.559 109.241  1.00 48.22           H  
ATOM  11808 HD11 ILE A 125     113.507 147.351 107.995  1.00 48.22           H  
ATOM  11809 HD12 ILE A 125     114.777 146.556 107.459  1.00 48.22           H  
ATOM  11810 HD13 ILE A 125     114.663 146.937 108.994  1.00 48.22           H  
ATOM  11811  N   GLN A 126     119.231 149.413 105.972  1.00 52.17           N  
ATOM  11812  CA  GLN A 126     120.684 149.445 105.851  1.00 52.17           C  
ATOM  11813  C   GLN A 126     121.166 150.882 105.853  1.00 52.17           C  
ATOM  11814  O   GLN A 126     122.190 151.204 106.465  1.00 52.17           O  
ATOM  11815  CB  GLN A 126     121.154 148.719 104.594  1.00 52.17           C  
ATOM  11816  CG  GLN A 126     120.915 147.222 104.618  1.00 52.17           C  
ATOM  11817  CD  GLN A 126     120.754 146.615 103.238  1.00 52.17           C  
ATOM  11818  OE1 GLN A 126     121.109 147.226 102.230  1.00 52.17           O  
ATOM  11819  NE2 GLN A 126     120.251 145.386 103.191  1.00 52.17           N  
ATOM  11820  H   GLN A 126     118.817 149.075 105.299  1.00 52.17           H  
ATOM  11821  HA  GLN A 126     121.075 148.990 106.611  1.00 52.17           H  
ATOM  11822  HB2 GLN A 126     120.667 149.088 103.842  1.00 52.17           H  
ATOM  11823  HB3 GLN A 126     122.104 148.871 104.480  1.00 52.17           H  
ATOM  11824  HG2 GLN A 126     121.672 146.794 105.047  1.00 52.17           H  
ATOM  11825  HG3 GLN A 126     120.106 147.045 105.120  1.00 52.17           H  
ATOM  11826 HE21 GLN A 126     120.025 144.988 103.918  1.00 52.17           H  
ATOM  11827 HE22 GLN A 126     120.145 144.992 102.435  1.00 52.17           H  
ATOM  11828  N   LEU A 127     120.399 151.771 105.229  1.00 52.25           N  
ATOM  11829  CA  LEU A 127     120.769 153.174 105.202  1.00 52.25           C  
ATOM  11830  C   LEU A 127     120.698 153.789 106.596  1.00 52.25           C  
ATOM  11831  O   LEU A 127     121.615 154.507 107.013  1.00 52.25           O  
ATOM  11832  CB  LEU A 127     119.818 153.890 104.258  1.00 52.25           C  
ATOM  11833  CG  LEU A 127     119.947 155.378 104.084  1.00 52.25           C  
ATOM  11834  CD1 LEU A 127     121.338 155.683 103.630  1.00 52.25           C  
ATOM  11835  CD2 LEU A 127     118.927 155.819 103.086  1.00 52.25           C  
ATOM  11836  H   LEU A 127     119.669 151.592 104.814  1.00 52.25           H  
ATOM  11837  HA  LEU A 127     121.666 153.256 104.856  1.00 52.25           H  
ATOM  11838  HB2 LEU A 127     119.909 153.490 103.386  1.00 52.25           H  
ATOM  11839  HB3 LEU A 127     118.925 153.742 104.588  1.00 52.25           H  
ATOM  11840  HG  LEU A 127     119.764 155.812 104.926  1.00 52.25           H  
ATOM  11841 HD11 LEU A 127     121.367 156.573 103.251  1.00 52.25           H  
ATOM  11842 HD12 LEU A 127     121.924 155.623 104.399  1.00 52.25           H  
ATOM  11843 HD13 LEU A 127     121.594 155.022 102.968  1.00 52.25           H  
ATOM  11844 HD21 LEU A 127     118.959 156.783 103.004  1.00 52.25           H  
ATOM  11845 HD22 LEU A 127     119.124 155.397 102.236  1.00 52.25           H  
ATOM  11846 HD23 LEU A 127     118.056 155.538 103.403  1.00 52.25           H  
ATOM  11847  N   ALA A 128     119.595 153.562 107.309  1.00 50.36           N  
ATOM  11848  CA  ALA A 128     119.444 154.107 108.657  1.00 50.36           C  
ATOM  11849  C   ALA A 128     120.552 153.639 109.584  1.00 50.36           C  
ATOM  11850  O   ALA A 128     121.162 154.435 110.313  1.00 50.36           O  
ATOM  11851  CB  ALA A 128     118.103 153.699 109.241  1.00 50.36           C  
ATOM  11852  H   ALA A 128     118.928 153.097 107.041  1.00 50.36           H  
ATOM  11853  HA  ALA A 128     119.470 155.069 108.622  1.00 50.36           H  
ATOM  11854  HB1 ALA A 128     118.053 154.042 110.144  1.00 50.36           H  
ATOM  11855  HB2 ALA A 128     117.390 154.059 108.697  1.00 50.36           H  
ATOM  11856  HB3 ALA A 128     118.076 152.732 109.257  1.00 50.36           H  
ATOM  11857  N   ARG A 129     120.861 152.351 109.526  1.00 51.90           N  
ATOM  11858  CA  ARG A 129     121.895 151.805 110.386  1.00 51.90           C  
ATOM  11859  C   ARG A 129     123.275 152.284 109.989  1.00 51.90           C  
ATOM  11860  O   ARG A 129     124.139 152.482 110.851  1.00 51.90           O  
ATOM  11861  CB  ARG A 129     121.841 150.293 110.333  1.00 51.90           C  
ATOM  11862  CG  ARG A 129     120.591 149.754 110.933  1.00 51.90           C  
ATOM  11863  CD  ARG A 129     120.648 148.275 111.014  1.00 51.90           C  
ATOM  11864  NE  ARG A 129     121.637 147.884 112.005  1.00 51.90           N  
ATOM  11865  CZ  ARG A 129     122.592 146.978 111.843  1.00 51.90           C  
ATOM  11866  NH1 ARG A 129     122.764 146.313 110.704  1.00 51.90           N  
ATOM  11867  NH2 ARG A 129     123.397 146.747 112.863  1.00 51.90           N  
ATOM  11868  H   ARG A 129     120.489 151.787 109.006  1.00 51.90           H  
ATOM  11869  HA  ARG A 129     121.716 152.081 111.292  1.00 51.90           H  
ATOM  11870  HB2 ARG A 129     121.874 150.016 109.409  1.00 51.90           H  
ATOM  11871  HB3 ARG A 129     122.599 149.938 110.816  1.00 51.90           H  
ATOM  11872  HG2 ARG A 129     120.510 150.098 111.833  1.00 51.90           H  
ATOM  11873  HG3 ARG A 129     119.836 150.021 110.393  1.00 51.90           H  
ATOM  11874  HD2 ARG A 129     119.789 147.926 111.290  1.00 51.90           H  
ATOM  11875  HD3 ARG A 129     120.877 147.953 110.136  1.00 51.90           H  
ATOM  11876  HE  ARG A 129     121.796 148.477 112.606  1.00 51.90           H  
ATOM  11877 HH11 ARG A 129     122.256 146.446 110.027  1.00 51.90           H  
ATOM  11878 HH12 ARG A 129     123.400 145.738 110.643  1.00 51.90           H  
ATOM  11879 HH21 ARG A 129     123.284 147.177 113.598  1.00 51.90           H  
ATOM  11880 HH22 ARG A 129     124.022 146.174 112.798  1.00 51.90           H  
ATOM  11881  N   ARG A 130     123.506 152.470 108.696  1.00 59.30           N  
ATOM  11882  CA  ARG A 130     124.779 153.008 108.246  1.00 59.30           C  
ATOM  11883  C   ARG A 130     124.971 154.448 108.703  1.00 59.30           C  
ATOM  11884  O   ARG A 130     126.065 154.821 109.142  1.00 59.30           O  
ATOM  11885  CB  ARG A 130     124.880 152.908 106.728  1.00 59.30           C  
ATOM  11886  CG  ARG A 130     126.258 153.196 106.190  1.00 59.30           C  
ATOM  11887  CD  ARG A 130     126.301 154.557 105.547  1.00 59.30           C  
ATOM  11888  NE  ARG A 130     127.655 154.948 105.168  1.00 59.30           N  
ATOM  11889  CZ  ARG A 130     128.597 155.347 106.019  1.00 59.30           C  
ATOM  11890  NH1 ARG A 130     128.359 155.432 107.323  1.00 59.30           N  
ATOM  11891  NH2 ARG A 130     129.794 155.678 105.555  1.00 59.30           N  
ATOM  11892  H   ARG A 130     122.941 152.291 108.073  1.00 59.30           H  
ATOM  11893  HA  ARG A 130     125.495 152.474 108.624  1.00 59.30           H  
ATOM  11894  HB2 ARG A 130     124.640 152.009 106.459  1.00 59.30           H  
ATOM  11895  HB3 ARG A 130     124.273 153.548 106.332  1.00 59.30           H  
ATOM  11896  HG2 ARG A 130     126.899 153.182 106.915  1.00 59.30           H  
ATOM  11897  HG3 ARG A 130     126.484 152.535 105.519  1.00 59.30           H  
ATOM  11898  HD2 ARG A 130     125.758 154.538 104.746  1.00 59.30           H  
ATOM  11899  HD3 ARG A 130     125.954 155.214 106.169  1.00 59.30           H  
ATOM  11900  HE  ARG A 130     127.911 154.734 104.376  1.00 59.30           H  
ATOM  11901 HH11 ARG A 130     127.593 155.223 107.649  1.00 59.30           H  
ATOM  11902 HH12 ARG A 130     128.985 155.694 107.851  1.00 59.30           H  
ATOM  11903 HH21 ARG A 130     129.957 155.628 104.712  1.00 59.30           H  
ATOM  11904 HH22 ARG A 130     130.407 155.939 106.098  1.00 59.30           H  
ATOM  11905  N   ILE A 131     123.926 155.276 108.615  1.00 50.99           N  
ATOM  11906  CA  ILE A 131     124.090 156.665 109.022  1.00 50.99           C  
ATOM  11907  C   ILE A 131     124.239 156.787 110.536  1.00 50.99           C  
ATOM  11908  O   ILE A 131     125.002 157.632 111.017  1.00 50.99           O  
ATOM  11909  CB  ILE A 131     122.897 157.485 108.504  1.00 50.99           C  
ATOM  11910  CG1 ILE A 131     122.875 157.508 106.983  1.00 50.99           C  
ATOM  11911  CG2 ILE A 131     122.962 158.891 109.035  1.00 50.99           C  
ATOM  11912  CD1 ILE A 131     121.620 158.012 106.426  1.00 50.99           C  
ATOM  11913  H   ILE A 131     123.142 155.072 108.335  1.00 50.99           H  
ATOM  11914  HA  ILE A 131     124.882 157.025 108.606  1.00 50.99           H  
ATOM  11915  HB  ILE A 131     122.086 157.070 108.814  1.00 50.99           H  
ATOM  11916 HG12 ILE A 131     123.575 158.069 106.663  1.00 50.99           H  
ATOM  11917 HG13 ILE A 131     122.994 156.620 106.639  1.00 50.99           H  
ATOM  11918 HG21 ILE A 131     122.607 159.510 108.388  1.00 50.99           H  
ATOM  11919 HG22 ILE A 131     122.439 158.928 109.846  1.00 50.99           H  
ATOM  11920 HG23 ILE A 131     123.880 159.127 109.215  1.00 50.99           H  
ATOM  11921 HD11 ILE A 131     121.249 157.339 105.849  1.00 50.99           H  
ATOM  11922 HD12 ILE A 131     121.015 158.203 107.153  1.00 50.99           H  
ATOM  11923 HD13 ILE A 131     121.810 158.821 105.938  1.00 50.99           H  
ATOM  11924  N   ARG A 132     123.553 155.949 111.319  1.00 51.56           N  
ATOM  11925  CA  ARG A 132     123.801 156.017 112.759  1.00 51.56           C  
ATOM  11926  C   ARG A 132     125.168 155.477 113.138  1.00 51.56           C  
ATOM  11927  O   ARG A 132     125.621 155.731 114.258  1.00 51.56           O  
ATOM  11928  CB  ARG A 132     122.731 155.352 113.631  1.00 51.56           C  
ATOM  11929  CG  ARG A 132     121.459 156.192 113.740  1.00 51.56           C  
ATOM  11930  CD  ARG A 132     120.187 155.504 114.255  1.00 51.56           C  
ATOM  11931  NE  ARG A 132     119.994 154.104 113.912  1.00 51.56           N  
ATOM  11932  CZ  ARG A 132     119.075 153.326 114.483  1.00 51.56           C  
ATOM  11933  NH1 ARG A 132     118.274 153.793 115.436  1.00 51.56           N  
ATOM  11934  NH2 ARG A 132     118.960 152.060 114.116  1.00 51.56           N  
ATOM  11935  H   ARG A 132     122.984 155.366 111.064  1.00 51.56           H  
ATOM  11936  HA  ARG A 132     123.805 156.948 113.014  1.00 51.56           H  
ATOM  11937  HB2 ARG A 132     122.508 154.496 113.246  1.00 51.56           H  
ATOM  11938  HB3 ARG A 132     123.090 155.238 114.522  1.00 51.56           H  
ATOM  11939  HG2 ARG A 132     121.646 156.926 114.344  1.00 51.56           H  
ATOM  11940  HG3 ARG A 132     121.261 156.540 112.860  1.00 51.56           H  
ATOM  11941  HD2 ARG A 132     120.210 155.551 115.223  1.00 51.56           H  
ATOM  11942  HD3 ARG A 132     119.411 155.987 113.936  1.00 51.56           H  
ATOM  11943  HE  ARG A 132     120.271 153.864 113.137  1.00 51.56           H  
ATOM  11944 HH11 ARG A 132     118.318 154.606 115.702  1.00 51.56           H  
ATOM  11945 HH12 ARG A 132     117.694 153.268 115.788  1.00 51.56           H  
ATOM  11946 HH21 ARG A 132     119.470 151.741 113.504  1.00 51.56           H  
ATOM  11947 HH22 ARG A 132     118.367 151.560 114.488  1.00 51.56           H  
ATOM  11948  N   GLY A 133     125.829 154.750 112.246  1.00 56.40           N  
ATOM  11949  CA  GLY A 133     127.101 154.131 112.543  1.00 56.40           C  
ATOM  11950  C   GLY A 133     126.994 152.739 113.118  1.00 56.40           C  
ATOM  11951  O   GLY A 133     127.963 152.253 113.711  1.00 56.40           O  
ATOM  11952  H   GLY A 133     125.556 154.605 111.448  1.00 56.40           H  
ATOM  11953  HA2 GLY A 133     127.618 154.072 111.727  1.00 56.40           H  
ATOM  11954  HA3 GLY A 133     127.590 154.678 113.174  1.00 56.40           H  
ATOM  11955  N   GLU A 134     125.844 152.086 112.961  1.00 57.22           N  
ATOM  11956  CA  GLU A 134     125.629 150.721 113.433  1.00 57.22           C  
ATOM  11957  C   GLU A 134     126.097 149.777 112.324  1.00 57.22           C  
ATOM  11958  O   GLU A 134     125.323 149.249 111.522  1.00 57.22           O  
ATOM  11959  CB  GLU A 134     124.164 150.513 113.793  1.00 57.22           C  
ATOM  11960  CG  GLU A 134     123.662 151.453 114.886  1.00 57.22           C  
ATOM  11961  CD  GLU A 134     122.190 151.267 115.190  1.00 57.22           C  
ATOM  11962  OE1 GLU A 134     121.656 152.022 116.031  1.00 57.22           O  
ATOM  11963  OE2 GLU A 134     121.566 150.372 114.584  1.00 57.22           O  
ATOM  11964  H   GLU A 134     125.156 152.422 112.580  1.00 57.22           H  
ATOM  11965  HA  GLU A 134     126.169 150.568 114.222  1.00 57.22           H  
ATOM  11966  HB2 GLU A 134     123.621 150.659 113.002  1.00 57.22           H  
ATOM  11967  HB3 GLU A 134     124.040 149.604 114.105  1.00 57.22           H  
ATOM  11968  HG2 GLU A 134     124.158 151.286 115.703  1.00 57.22           H  
ATOM  11969  HG3 GLU A 134     123.794 152.372 114.605  1.00 57.22           H  
ATOM  11970  N   ARG A 135     127.416 149.569 112.304  1.00 68.55           N  
ATOM  11971  CA  ARG A 135     128.108 149.134 111.086  1.00 68.55           C  
ATOM  11972  C   ARG A 135     128.027 147.637 110.764  1.00 68.55           C  
ATOM  11973  O   ARG A 135     127.917 147.283 109.589  1.00 68.55           O  
ATOM  11974  CB  ARG A 135     129.552 149.673 111.007  1.00 68.55           C  
ATOM  11975  CG  ARG A 135     130.261 149.440 109.665  1.00 68.55           C  
ATOM  11976  CD  ARG A 135     129.732 150.338 108.565  1.00 68.55           C  
ATOM  11977  NE  ARG A 135     130.724 150.510 107.506  1.00 68.55           N  
ATOM  11978  CZ  ARG A 135     130.703 151.474 106.588  1.00 68.55           C  
ATOM  11979  NH1 ARG A 135     129.741 152.386 106.570  1.00 68.55           N  
ATOM  11980  NH2 ARG A 135     131.662 151.527 105.676  1.00 68.55           N  
ATOM  11981  H   ARG A 135     127.923 149.702 112.987  1.00 68.55           H  
ATOM  11982  HA  ARG A 135     128.529 148.734 111.848  1.00 68.55           H  
ATOM  11983  HB2 ARG A 135     129.524 150.629 111.161  1.00 68.55           H  
ATOM  11984  HB3 ARG A 135     130.127 149.265 111.681  1.00 68.55           H  
ATOM  11985  HG2 ARG A 135     131.203 149.641 109.779  1.00 68.55           H  
ATOM  11986  HG3 ARG A 135     130.167 148.522 109.372  1.00 68.55           H  
ATOM  11987  HD2 ARG A 135     128.938 149.938 108.177  1.00 68.55           H  
ATOM  11988  HD3 ARG A 135     129.526 151.209 108.934  1.00 68.55           H  
ATOM  11989  HE  ARG A 135     131.321 149.897 107.422  1.00 68.55           H  
ATOM  11990 HH11 ARG A 135     129.106 152.378 107.148  1.00 68.55           H  
ATOM  11991 HH12 ARG A 135     129.756 152.995 105.965  1.00 68.55           H  
ATOM  11992 HH21 ARG A 135     132.291 150.942 105.679  1.00 68.55           H  
ATOM  11993 HH22 ARG A 135     131.654 152.148 105.081  1.00 68.55           H  
ATOM  11994  N   ALA A 136     127.639 146.796 111.762  1.00 63.18           N  
ATOM  11995  CA  ALA A 136     127.472 145.277 111.620  1.00 63.18           C  
ATOM  11996  C   ALA A 136     127.883 144.498 110.358  1.00 63.18           C  
ATOM  11997  O   ALA A 136     128.975 144.701 109.825  1.00 63.18           O  
ATOM  11998  CB  ALA A 136     126.060 144.829 112.078  1.00 63.18           C  
ATOM  11999  H   ALA A 136     127.372 147.069 112.552  1.00 63.18           H  
ATOM  12000  HA  ALA A 136     126.905 145.585 110.897  1.00 63.18           H  
ATOM  12001  HB1 ALA A 136     125.363 145.193 111.505  1.00 63.18           H  
ATOM  12002  HB2 ALA A 136     126.024 143.860 112.035  1.00 63.18           H  
ATOM  12003  HB3 ALA A 136     125.919 145.118 112.992  1.00 63.18           H  
TER   12004      ALA A 136                                                      
ATOM  12005  N   VAL B  22     111.877 124.576 117.834  1.00 85.96           N  
ATOM  12006  CA  VAL B  22     110.602 125.013 117.280  1.00 85.96           C  
ATOM  12007  C   VAL B  22     110.884 125.965 116.105  1.00 85.96           C  
ATOM  12008  O   VAL B  22     111.122 127.156 116.269  1.00 85.96           O  
ATOM  12009  CB  VAL B  22     109.685 125.626 118.396  1.00 85.96           C  
ATOM  12010  CG1 VAL B  22     109.465 124.605 119.509  1.00 85.96           C  
ATOM  12011  CG2 VAL B  22     110.264 126.905 119.019  1.00 85.96           C  
ATOM  12012  H   VAL B  22     111.824 123.847 118.287  1.00 85.96           H  
ATOM  12013  HA  VAL B  22     110.144 124.236 116.918  1.00 85.96           H  
ATOM  12014  HB  VAL B  22     108.821 125.843 118.012  1.00 85.96           H  
ATOM  12015 HG11 VAL B  22     108.878 124.984 120.181  1.00 85.96           H  
ATOM  12016 HG12 VAL B  22     109.069 123.802 119.138  1.00 85.96           H  
ATOM  12017 HG13 VAL B  22     110.319 124.396 119.917  1.00 85.96           H  
ATOM  12018 HG21 VAL B  22     109.755 127.107 119.819  1.00 85.96           H  
ATOM  12019 HG22 VAL B  22     111.197 126.761 119.250  1.00 85.96           H  
ATOM  12020 HG23 VAL B  22     110.172 127.643 118.403  1.00 85.96           H  
ATOM  12021  N   LEU B  23     110.971 125.364 114.917  1.00 84.35           N  
ATOM  12022  CA  LEU B  23     111.202 126.004 113.619  1.00 84.35           C  
ATOM  12023  C   LEU B  23     112.607 126.579 113.446  1.00 84.35           C  
ATOM  12024  O   LEU B  23     113.092 126.678 112.314  1.00 84.35           O  
ATOM  12025  CB  LEU B  23     110.203 127.148 113.392  1.00 84.35           C  
ATOM  12026  CG  LEU B  23     108.680 126.944 113.393  1.00 84.35           C  
ATOM  12027  CD1 LEU B  23     108.042 127.393 114.705  1.00 84.35           C  
ATOM  12028  CD2 LEU B  23     108.053 127.721 112.239  1.00 84.35           C  
ATOM  12029  H   LEU B  23     110.879 124.512 114.828  1.00 84.35           H  
ATOM  12030  HA  LEU B  23     111.063 125.351 112.914  1.00 84.35           H  
ATOM  12031  HB2 LEU B  23     110.394 127.829 114.051  1.00 84.35           H  
ATOM  12032  HB3 LEU B  23     110.415 127.516 112.521  1.00 84.35           H  
ATOM  12033  HG  LEU B  23     108.479 126.005 113.264  1.00 84.35           H  
ATOM  12034 HD11 LEU B  23     107.081 127.280 114.640  1.00 84.35           H  
ATOM  12035 HD12 LEU B  23     108.383 126.857 115.434  1.00 84.35           H  
ATOM  12036 HD13 LEU B  23     108.250 128.329 114.857  1.00 84.35           H  
ATOM  12037 HD21 LEU B  23     107.091 127.607 112.270  1.00 84.35           H  
ATOM  12038 HD22 LEU B  23     108.274 128.661 112.342  1.00 84.35           H  
ATOM  12039 HD23 LEU B  23     108.397 127.392 111.395  1.00 84.35           H  
ATOM  12040  N   ARG B  24     113.276 126.964 114.535  1.00 82.68           N  
ATOM  12041  CA  ARG B  24     114.729 127.081 114.561  1.00 82.68           C  
ATOM  12042  C   ARG B  24     115.312 126.930 115.969  1.00 82.68           C  
ATOM  12043  O   ARG B  24     116.534 126.985 116.133  1.00 82.68           O  
ATOM  12044  CB  ARG B  24     115.142 128.423 113.950  1.00 82.68           C  
ATOM  12045  CG  ARG B  24     116.608 128.502 113.503  1.00 82.68           C  
ATOM  12046  CD  ARG B  24     116.951 129.787 112.738  1.00 82.68           C  
ATOM  12047  NE  ARG B  24     115.968 130.144 111.717  1.00 82.68           N  
ATOM  12048  CZ  ARG B  24     116.066 131.212 110.934  1.00 82.68           C  
ATOM  12049  NH1 ARG B  24     115.127 131.462 110.032  1.00 82.68           N  
ATOM  12050  NH2 ARG B  24     117.104 132.028 111.050  1.00 82.68           N  
ATOM  12051  H   ARG B  24     112.899 127.212 115.255  1.00 82.68           H  
ATOM  12052  HA  ARG B  24     115.106 126.376 114.014  1.00 82.68           H  
ATOM  12053  HB2 ARG B  24     114.573 128.574 113.182  1.00 82.68           H  
ATOM  12054