PDB Short entry for 6R93
HEADER    DNA                                     02-APR-19   6R93              
TITLE     CRYO-EM STRUCTURE OF NCP-6-4PP                                        
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: HUMAN ALPHA-SATELLITE DNA (145-MER);                       
COMPND   3 CHAIN: I;                                                            
COMPND   4 ENGINEERED: YES;                                                     
COMPND   5 MOL_ID: 2;                                                           
COMPND   6 MOLECULE: HUMAN ALPHA-SATELLITE DNA (145-MER) WITH A 6-4PP AT        
COMPND   7 POSITIONS 95-96;                                                     
COMPND   8 CHAIN: J;                                                            
COMPND   9 ENGINEERED: YES;                                                     
COMPND  10 OTHER_DETAILS: 145 BP HUMAN ALPHA-SATELLITE WITH A 6-4 PYRIMIDINE-   
COMPND  11 PYRIMIDONE (6-4PP) AT BASE POSITIONS 95-96.;                         
COMPND  12 MOL_ID: 3;                                                           
COMPND  13 MOLECULE: HISTONE H3.1;                                              
COMPND  14 CHAIN: A, E;                                                         
COMPND  15 SYNONYM: HISTONE H3/A,HISTONE H3/B,HISTONE H3/C,HISTONE H3/D,HISTONE 
COMPND  16 H3/F,HISTONE H3/H,HISTONE H3/I,HISTONE H3/J,HISTONE H3/K,HISTONE     
COMPND  17 H3/L;                                                                
COMPND  18 ENGINEERED: YES;                                                     
COMPND  19 MOL_ID: 4;                                                           
COMPND  20 MOLECULE: HISTONE H4;                                                
COMPND  21 CHAIN: B, F;                                                         
COMPND  22 ENGINEERED: YES;                                                     
COMPND  23 MOL_ID: 5;                                                           
COMPND  24 MOLECULE: HISTONE H2A TYPE 1-B/E;                                    
COMPND  25 CHAIN: C, G;                                                         
COMPND  26 SYNONYM: HISTONE H2A.2,HISTONE H2A/A,HISTONE H2A/M;                  
COMPND  27 ENGINEERED: YES;                                                     
COMPND  28 OTHER_DETAILS:                                                       
COMPND  29 GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILEL
COMPND  30 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK;    
COMPND  31 MOL_ID: 6;                                                           
COMPND  32 MOLECULE: HISTONE H2B TYPE 1-J;                                      
COMPND  33 CHAIN: D, H;                                                         
COMPND  34 SYNONYM: HISTONE H2B.1,HISTONE H2B.R,H2B/R;                          
COMPND  35 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 SYNTHETIC: YES;                                                      
SOURCE   3 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   4 ORGANISM_COMMON: HUMAN;                                              
SOURCE   5 ORGANISM_TAXID: 9606;                                                
SOURCE   6 MOL_ID: 2;                                                           
SOURCE   7 SYNTHETIC: YES;                                                      
SOURCE   8 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   9 ORGANISM_COMMON: HUMAN;                                              
SOURCE  10 ORGANISM_TAXID: 9606;                                                
SOURCE  11 MOL_ID: 3;                                                           
SOURCE  12 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  13 ORGANISM_COMMON: HUMAN;                                              
SOURCE  14 ORGANISM_TAXID: 9606;                                                
SOURCE  15 GENE: HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D,      
SOURCE  16 H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H,      
SOURCE  17 H3FK, HIST1H3I, H3FF, HIST1H3J, H3FJ;                                
SOURCE  18 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  19 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  20 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  21 MOL_ID: 4;                                                           
SOURCE  22 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  23 ORGANISM_COMMON: HUMAN;                                              
SOURCE  24 ORGANISM_TAXID: 9606;                                                
SOURCE  25 GENE: HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G,    
SOURCE  26 H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C,    
SOURCE  27 H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E,    
SOURCE  28 H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N,    
SOURCE  29 H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4;                  
SOURCE  30 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE  31 EXPRESSION_SYSTEM_TAXID: 562;                                        
SOURCE  32 EXPRESSION_SYSTEM_CELL_LINE: JM109(DE3);                             
SOURCE  33 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  34 MOL_ID: 5;                                                           
SOURCE  35 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  36 ORGANISM_COMMON: HUMAN;                                              
SOURCE  37 ORGANISM_TAXID: 9606;                                                
SOURCE  38 GENE: HIST1H2AB, H2AFM, HIST1H2AE, H2AFA;                            
SOURCE  39 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  40 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  41 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  42 MOL_ID: 6;                                                           
SOURCE  43 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  44 ORGANISM_COMMON: HUMAN;                                              
SOURCE  45 ORGANISM_TAXID: 9606;                                                
SOURCE  46 GENE: HIST1H2BJ, H2BFR;                                              
SOURCE  47 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE  48 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE  49 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID                               
KEYWDS    DNA DAMAGE, NUCLEOSOME, 6-4 PHOTOPRODUCT, DNA                         
EXPDTA    ELECTRON MICROSCOPY                                                   
AUTHOR    S.MATSUMOTO,S.CAVADINI,R.D.BUNKER,N.H.THOMA                           
REVDAT   4   18-DEC-19 6R93    1       SCALE                                    
REVDAT   3   06-NOV-19 6R93    1       REMARK                                   
REVDAT   2   17-JUL-19 6R93    1       JRNL   REMARK                            
REVDAT   1   12-JUN-19 6R93    0                                                
JRNL        AUTH   S.MATSUMOTO,S.CAVADINI,R.D.BUNKER,R.S.GRAND,A.POTENZA,       
JRNL        AUTH 2 J.RABL,J.YAMAMOTO,A.D.SCHENK,D.SCHUBELER,S.IWAI,K.SUGASAWA,  
JRNL        AUTH 3 H.KURUMIZAKA,N.H.THOMA                                       
JRNL        TITL   DNA DAMAGE DETECTION IN NUCLEOSOMES INVOLVES DNA REGISTER    
JRNL        TITL 2 SHIFTING.                                                    
JRNL        REF    NATURE                        V. 571    79 2019              
JRNL        REFN                   ESSN 1476-4687                               
JRNL        PMID   31142837                                                     
JRNL        DOI    10.1038/S41586-019-1259-3                                    
REMARK   2                                                                      
REMARK   2 RESOLUTION.    4.00 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   SOFTWARE PACKAGES      : EPU, GCTF, COOT, RELION, RELION,          
REMARK   3                            RELION, REFMAC, PHENIX                    
REMARK   3   RECONSTRUCTION SCHEMA  : NULL                                      
REMARK   3                                                                      
REMARK   3 EM MAP-MODEL FITTING AND REFINEMENT                                  
REMARK   3   PDB ENTRY                    : 4ZUX                                
REMARK   3   REFINEMENT SPACE             : REAL                                
REMARK   3   REFINEMENT PROTOCOL          : FLEXIBLE FIT                        
REMARK   3   REFINEMENT TARGET            : CROSS-CORRELATION COEFFICIENT       
REMARK   3   OVERALL ANISOTROPIC B VALUE  : NULL                                
REMARK   3                                                                      
REMARK   3 FITTING PROCEDURE : NULL                                             
REMARK   3                                                                      
REMARK   3 EM IMAGE RECONSTRUCTION STATISTICS                                   
REMARK   3   NOMINAL PIXEL SIZE (ANGSTROMS)    : NULL                           
REMARK   3   ACTUAL PIXEL SIZE  (ANGSTROMS)    : NULL                           
REMARK   3   EFFECTIVE RESOLUTION (ANGSTROMS)  : 4.000                          
REMARK   3   NUMBER OF PARTICLES               : 98378                          
REMARK   3   CTF CORRECTION METHOD             : PHASE FLIPPING AND AMPLITUDE   
REMARK   3                                       CORRECTION                     
REMARK   3                                                                      
REMARK   3 EM RECONSTRUCTION MAGNIFICATION CALIBRATION: NULL                    
REMARK   3                                                                      
REMARK   3 OTHER DETAILS: NULL                                                  
REMARK   4                                                                      
REMARK   4 6R93 COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY PDBE ON 03-APR-19.                  
REMARK 100 THE DEPOSITION ID IS D_1292101591.                                   
REMARK 245                                                                      
REMARK 245 EXPERIMENTAL DETAILS                                                 
REMARK 245   RECONSTRUCTION METHOD          : SINGLE PARTICLE                   
REMARK 245   SPECIMEN TYPE                  : NULL                              
REMARK 245                                                                      
REMARK 245 ELECTRON MICROSCOPE SAMPLE                                           
REMARK 245   SAMPLE TYPE                    : PARTICLE                          
REMARK 245   PARTICLE TYPE                  : POINT                             
REMARK 245   NAME OF SAMPLE                 : 6-4PP NUCLEOSOME; DNA; HISTONE    
REMARK 245                                    H3.1, HISTONE H2A, HISTONE H2B;   
REMARK 245                                    HISTONE H4                        
REMARK 245   SAMPLE CONCENTRATION (MG ML-1) : 2.00                              
REMARK 245   SAMPLE SUPPORT DETAILS         : NULL                              
REMARK 245   SAMPLE VITRIFICATION DETAILS   : NULL                              
REMARK 245   SAMPLE BUFFER                  : NULL                              
REMARK 245   PH                             : 7.40                              
REMARK 245   SAMPLE DETAILS                 : NULL                              
REMARK 245                                                                      
REMARK 245 DATA ACQUISITION                                                     
REMARK 245   DATE OF EXPERIMENT                : NULL                           
REMARK 245   NUMBER OF MICROGRAPHS-IMAGES      : NULL                           
REMARK 245   TEMPERATURE (KELVIN)              : NULL                           
REMARK 245   MICROSCOPE MODEL                  : FEI TITAN KRIOS                
REMARK 245   DETECTOR TYPE                     : GATAN K2 SUMMIT (4K X 4K)      
REMARK 245   MINIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MAXIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MINIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   MAXIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   NOMINAL CS                        : 0.00                           
REMARK 245   IMAGING MODE                      : BRIGHT FIELD                   
REMARK 245   ELECTRON DOSE (ELECTRONS NM**-2)  : 40.00                          
REMARK 245   ILLUMINATION MODE                 : SPOT SCAN                      
REMARK 245   NOMINAL MAGNIFICATION             : 130000                         
REMARK 245   CALIBRATED MAGNIFICATION          : NULL                           
REMARK 245   SOURCE                            : FIELD EMISSION GUN             
REMARK 245   ACCELERATION VOLTAGE (KV)         : 300                            
REMARK 245   IMAGING DETAILS                   : NULL                           
REMARK 247                                                                      
REMARK 247 ELECTRON MICROSCOPY                                                  
REMARK 247  THE COORDINATES IN THIS ENTRY WERE GENERATED FROM ELECTRON          
REMARK 247  MICROSCOPY DATA. PROTEIN DATA BANK CONVENTIONS REQUIRE              
REMARK 247  THAT CRYST1 AND SCALE RECORDS BE INCLUDED, BUT THE VALUES           
REMARK 247  ON THESE RECORDS ARE MEANINGLESS EXCEPT FOR THE CALCULATION         
REMARK 247  OF THE STRUCTURE FACTORS.                                           
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: DECAMERIC                         
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: DECAMERIC                  
REMARK 350 SOFTWARE USED: PISA                                                  
REMARK 350 TOTAL BURIED SURFACE AREA: 57670 ANGSTROM**2                         
REMARK 350 SURFACE AREA OF THE COMPLEX: 74160 ANGSTROM**2                       
REMARK 350 CHANGE IN SOLVENT FREE ENERGY: -373.0 KCAL/MOL                       
REMARK 350 APPLY THE FOLLOWING TO CHAINS: I, J, A, B, C, D, E, F, G, H          
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     GLY A    -2                                                      
REMARK 465     SER A    -1                                                      
REMARK 465     HIS A     0                                                      
REMARK 465     MET A     1                                                      
REMARK 465     ALA A     2                                                      
REMARK 465     ARG A     3                                                      
REMARK 465     THR A     4                                                      
REMARK 465     LYS A     5                                                      
REMARK 465     GLN A     6                                                      
REMARK 465     THR A     7                                                      
REMARK 465     ALA A     8                                                      
REMARK 465     ARG A     9                                                      
REMARK 465     LYS A    10                                                      
REMARK 465     SER A    11                                                      
REMARK 465     THR A    12                                                      
REMARK 465     GLY A    13                                                      
REMARK 465     GLY A    14                                                      
REMARK 465     LYS A    15                                                      
REMARK 465     ALA A    16                                                      
REMARK 465     PRO A    17                                                      
REMARK 465     ARG A    18                                                      
REMARK 465     LYS A    19                                                      
REMARK 465     GLN A    20                                                      
REMARK 465     LEU A    21                                                      
REMARK 465     ALA A    22                                                      
REMARK 465     THR A    23                                                      
REMARK 465     LYS A    24                                                      
REMARK 465     ALA A    25                                                      
REMARK 465     ALA A    26                                                      
REMARK 465     ARG A    27                                                      
REMARK 465     LYS A    28                                                      
REMARK 465     SER A    29                                                      
REMARK 465     ALA A    30                                                      
REMARK 465     PRO A    31                                                      
REMARK 465     ALA A    32                                                      
REMARK 465     THR A    33                                                      
REMARK 465     GLY A    34                                                      
REMARK 465     GLY A    35                                                      
REMARK 465     VAL A    36                                                      
REMARK 465     LYS A    37                                                      
REMARK 465     GLY B    -2                                                      
REMARK 465     SER B    -1                                                      
REMARK 465     HIS B     0                                                      
REMARK 465     MET B     1                                                      
REMARK 465     SER B     2                                                      
REMARK 465     GLY B     3                                                      
REMARK 465     ARG B     4                                                      
REMARK 465     GLY B     5                                                      
REMARK 465     LYS B     6                                                      
REMARK 465     GLY B     7                                                      
REMARK 465     GLY B     8                                                      
REMARK 465     LYS B     9                                                      
REMARK 465     GLY B    10                                                      
REMARK 465     LEU B    11                                                      
REMARK 465     GLY B    12                                                      
REMARK 465     LYS B    13                                                      
REMARK 465     GLY B    14                                                      
REMARK 465     GLY B    15                                                      
REMARK 465     ALA B    16                                                      
REMARK 465     LYS B    17                                                      
REMARK 465     ARG B    18                                                      
REMARK 465     HIS B    19                                                      
REMARK 465     ARG B    20                                                      
REMARK 465     LYS B    21                                                      
REMARK 465     GLY C    -2                                                      
REMARK 465     SER C    -1                                                      
REMARK 465     HIS C     0                                                      
REMARK 465     MET C     1                                                      
REMARK 465     SER C     2                                                      
REMARK 465     GLY C     3                                                      
REMARK 465     ARG C     4                                                      
REMARK 465     GLY C     5                                                      
REMARK 465     LYS C     6                                                      
REMARK 465     GLN C     7                                                      
REMARK 465     GLY C     8                                                      
REMARK 465     GLY C     9                                                      
REMARK 465     LYS C    10                                                      
REMARK 465     ALA C    11                                                      
REMARK 465     SER C   123                                                      
REMARK 465     HIS C   124                                                      
REMARK 465     HIS C   125                                                      
REMARK 465     LYS C   126                                                      
REMARK 465     ALA C   127                                                      
REMARK 465     LYS C   128                                                      
REMARK 465     GLY C   129                                                      
REMARK 465     LYS C   130                                                      
REMARK 465     GLY D    -2                                                      
REMARK 465     SER D    -1                                                      
REMARK 465     HIS D     0                                                      
REMARK 465     MET D     1                                                      
REMARK 465     PRO D     2                                                      
REMARK 465     GLU D     3                                                      
REMARK 465     PRO D     4                                                      
REMARK 465     ALA D     5                                                      
REMARK 465     LYS D     6                                                      
REMARK 465     SER D     7                                                      
REMARK 465     ALA D     8                                                      
REMARK 465     PRO D     9                                                      
REMARK 465     ALA D    10                                                      
REMARK 465     PRO D    11                                                      
REMARK 465     LYS D    12                                                      
REMARK 465     LYS D    13                                                      
REMARK 465     GLY D    14                                                      
REMARK 465     SER D    15                                                      
REMARK 465     LYS D    16                                                      
REMARK 465     LYS D    17                                                      
REMARK 465     ALA D    18                                                      
REMARK 465     VAL D    19                                                      
REMARK 465     THR D    20                                                      
REMARK 465     LYS D    21                                                      
REMARK 465     ALA D    22                                                      
REMARK 465     GLN D    23                                                      
REMARK 465     LYS D    24                                                      
REMARK 465     LYS D    25                                                      
REMARK 465     ASP D    26                                                      
REMARK 465     GLY D    27                                                      
REMARK 465     LYS D    28                                                      
REMARK 465     LYS D    29                                                      
REMARK 465     GLY E    -2                                                      
REMARK 465     SER E    -1                                                      
REMARK 465     HIS E     0                                                      
REMARK 465     MET E     1                                                      
REMARK 465     ALA E     2                                                      
REMARK 465     ARG E     3                                                      
REMARK 465     THR E     4                                                      
REMARK 465     LYS E     5                                                      
REMARK 465     GLN E     6                                                      
REMARK 465     THR E     7                                                      
REMARK 465     ALA E     8                                                      
REMARK 465     ARG E     9                                                      
REMARK 465     LYS E    10                                                      
REMARK 465     SER E    11                                                      
REMARK 465     THR E    12                                                      
REMARK 465     GLY E    13                                                      
REMARK 465     GLY E    14                                                      
REMARK 465     LYS E    15                                                      
REMARK 465     ALA E    16                                                      
REMARK 465     PRO E    17                                                      
REMARK 465     ARG E    18                                                      
REMARK 465     LYS E    19                                                      
REMARK 465     GLN E    20                                                      
REMARK 465     LEU E    21                                                      
REMARK 465     ALA E    22                                                      
REMARK 465     THR E    23                                                      
REMARK 465     LYS E    24                                                      
REMARK 465     ALA E    25                                                      
REMARK 465     ALA E    26                                                      
REMARK 465     ARG E    27                                                      
REMARK 465     LYS E    28                                                      
REMARK 465     SER E    29                                                      
REMARK 465     ALA E    30                                                      
REMARK 465     PRO E    31                                                      
REMARK 465     ALA E    32                                                      
REMARK 465     THR E    33                                                      
REMARK 465     GLY E    34                                                      
REMARK 465     GLY E    35                                                      
REMARK 465     VAL E    36                                                      
REMARK 465     LYS E    37                                                      
REMARK 465     GLY F    -2                                                      
REMARK 465     SER F    -1                                                      
REMARK 465     HIS F     0                                                      
REMARK 465     MET F     1                                                      
REMARK 465     SER F     2                                                      
REMARK 465     GLY F     3                                                      
REMARK 465     ARG F     4                                                      
REMARK 465     GLY F     5                                                      
REMARK 465     LYS F     6                                                      
REMARK 465     GLY F     7                                                      
REMARK 465     GLY F     8                                                      
REMARK 465     LYS F     9                                                      
REMARK 465     GLY F    10                                                      
REMARK 465     LEU F    11                                                      
REMARK 465     GLY F    12                                                      
REMARK 465     LYS F    13                                                      
REMARK 465     GLY F    14                                                      
REMARK 465     GLY F    15                                                      
REMARK 465     ALA F    16                                                      
REMARK 465     LYS F    17                                                      
REMARK 465     ARG F    18                                                      
REMARK 465     HIS F    19                                                      
REMARK 465     ARG F    20                                                      
REMARK 465     LYS F    21                                                      
REMARK 465     GLY G    -2                                                      
REMARK 465     SER G    -1                                                      
REMARK 465     HIS G     0                                                      
REMARK 465     MET G     1                                                      
REMARK 465     SER G     2                                                      
REMARK 465     GLY G     3                                                      
REMARK 465     ARG G     4                                                      
REMARK 465     GLY G     5                                                      
REMARK 465     LYS G     6                                                      
REMARK 465     GLN G     7                                                      
REMARK 465     GLY G     8                                                      
REMARK 465     GLY G     9                                                      
REMARK 465     LYS G    10                                                      
REMARK 465     ALA G    11                                                      
REMARK 465     LYS G   120                                                      
REMARK 465     THR G   121                                                      
REMARK 465     GLU G   122                                                      
REMARK 465     SER G   123                                                      
REMARK 465     HIS G   124                                                      
REMARK 465     HIS G   125                                                      
REMARK 465     LYS G   126                                                      
REMARK 465     ALA G   127                                                      
REMARK 465     LYS G   128                                                      
REMARK 465     GLY G   129                                                      
REMARK 465     LYS G   130                                                      
REMARK 465     GLY H    -2                                                      
REMARK 465     SER H    -1                                                      
REMARK 465     HIS H     0                                                      
REMARK 465     MET H     1                                                      
REMARK 465     PRO H     2                                                      
REMARK 465     GLU H     3                                                      
REMARK 465     PRO H     4                                                      
REMARK 465     ALA H     5                                                      
REMARK 465     LYS H     6                                                      
REMARK 465     SER H     7                                                      
REMARK 465     ALA H     8                                                      
REMARK 465     PRO H     9                                                      
REMARK 465     ALA H    10                                                      
REMARK 465     PRO H    11                                                      
REMARK 465     LYS H    12                                                      
REMARK 465     LYS H    13                                                      
REMARK 465     GLY H    14                                                      
REMARK 465     SER H    15                                                      
REMARK 465     LYS H    16                                                      
REMARK 465     LYS H    17                                                      
REMARK 465     ALA H    18                                                      
REMARK 465     VAL H    19                                                      
REMARK 465     THR H    20                                                      
REMARK 465     LYS H    21                                                      
REMARK 465     ALA H    22                                                      
REMARK 465     GLN H    23                                                      
REMARK 465     LYS H    24                                                      
REMARK 465     LYS H    25                                                      
REMARK 465     ASP H    26                                                      
REMARK 465     GLY H    27                                                      
REMARK 465     LYS H    28                                                      
REMARK 465     LYS H    29                                                      
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   O3'   DA I    82    HH22  ARG E    41              1.59            
REMARK 500   O5'   DG I    39     NH1  ARG D    87              2.13            
REMARK 500   OP1   DT I   119     NZ   LYS G    14              2.18            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND LENGTHS                                      
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,2(A3,1X,A1,I4,A1,1X,A4,3X),1X,F6.3)               
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   RES CSSEQI ATM2   DEVIATION                     
REMARK 500     DT I  38   O3'    DT I  38   C3'    -0.039                       
REMARK 500     DA I  55   O3'    DA I  56   P      -0.074                       
REMARK 500     DT I  90   O3'    DT I  91   P       0.100                       
REMARK 500     DT J  38   C1'    DT J  38   N1      0.080                       
REMARK 500     DT J  89   O3'    DT J  89   C3'    -0.038                       
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500     DC I  26   O4' -  C1' -  N1  ANGL. DEV. =   2.4 DEGREES          
REMARK 500     DT I  37   O4' -  C1' -  N1  ANGL. DEV. =   2.3 DEGREES          
REMARK 500     DT I  38   C3' -  C2' -  C1' ANGL. DEV. =  -5.1 DEGREES          
REMARK 500     DT I  38   O4' -  C1' -  N1  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG I  46   O4' -  C1' -  N9  ANGL. DEV. =   2.3 DEGREES          
REMARK 500     DC I  52   O4' -  C1' -  N1  ANGL. DEV. =   3.1 DEGREES          
REMARK 500     DC I  52   O4' -  C1' -  N1  ANGL. DEV. =   3.1 DEGREES          
REMARK 500     DA I  55   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DA I  55   O4' -  C1' -  N9  ANGL. DEV. =   3.0 DEGREES          
REMARK 500     DA I  57   O4' -  C1' -  N9  ANGL. DEV. =   1.9 DEGREES          
REMARK 500     DC I  66   O4' -  C1' -  N1  ANGL. DEV. =   1.8 DEGREES          
REMARK 500     DG I  68   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DA I  82   O4' -  C1' -  N9  ANGL. DEV. =   3.1 DEGREES          
REMARK 500     DC I  88   O4' -  C1' -  N1  ANGL. DEV. =   2.5 DEGREES          
REMARK 500     DT I  90   C3' -  O3' -  P   ANGL. DEV. =  14.7 DEGREES          
REMARK 500     DT I  90   C3' -  O3' -  P   ANGL. DEV. =  13.1 DEGREES          
REMARK 500     DT I  91   O3' -  P   -  O5' ANGL. DEV. = -36.2 DEGREES          
REMARK 500     DT I  91   O3' -  P   -  OP2 ANGL. DEV. = -22.9 DEGREES          
REMARK 500     DT I  91   O3' -  P   -  OP1 ANGL. DEV. =  13.2 DEGREES          
REMARK 500     DT I  91   O3' -  P   -  OP1 ANGL. DEV. = -29.7 DEGREES          
REMARK 500     DA I  94   C3' -  O3' -  P   ANGL. DEV. = -15.1 DEGREES          
REMARK 500    T64 I  95   O3' -  P   -  OP2 ANGL. DEV. =  17.6 DEGREES          
REMARK 500    T64 I  95   O3' -  P   -  OP1 ANGL. DEV. = -22.9 DEGREES          
REMARK 500     DG I  97   OP1 -  P   -  OP2 ANGL. DEV. =  11.3 DEGREES          
REMARK 500     DG I  97   O5' -  P   -  OP1 ANGL. DEV. = -18.1 DEGREES          
REMARK 500     DG I  97   O5' -  P   -  OP2 ANGL. DEV. = -32.2 DEGREES          
REMARK 500     DG I  97   O4' -  C1' -  N9  ANGL. DEV. =   3.1 DEGREES          
REMARK 500     DG I  99   C3' -  O3' -  P   ANGL. DEV. =  30.8 DEGREES          
REMARK 500     DG I  99   C3' -  O3' -  P   ANGL. DEV. =  23.3 DEGREES          
REMARK 500     DT I 111   O4' -  C1' -  N1  ANGL. DEV. =   2.3 DEGREES          
REMARK 500     DT J   8   O4' -  C1' -  N1  ANGL. DEV. =   2.4 DEGREES          
REMARK 500     DC J  26   O4' -  C1' -  N1  ANGL. DEV. =   2.1 DEGREES          
REMARK 500     DA J  42   O4' -  C1' -  N9  ANGL. DEV. =   2.0 DEGREES          
REMARK 500     DG J  46   O4' -  C1' -  N9  ANGL. DEV. =   2.9 DEGREES          
REMARK 500     DC J  60   O4' -  C1' -  N1  ANGL. DEV. =   2.3 DEGREES          
REMARK 500     DC J  75   O4' -  C1' -  N1  ANGL. DEV. =   2.1 DEGREES          
REMARK 500     DT J  79   O4' -  C1' -  N1  ANGL. DEV. =   2.8 DEGREES          
REMARK 500     DG J  80   O4' -  C1' -  N9  ANGL. DEV. =   2.2 DEGREES          
REMARK 500     DG J  86   O4' -  C1' -  N9  ANGL. DEV. =   1.8 DEGREES          
REMARK 500     DC J  88   O4' -  C1' -  N1  ANGL. DEV. =   3.1 DEGREES          
REMARK 500     DT J  90   C3' -  O3' -  P   ANGL. DEV. =  12.5 DEGREES          
REMARK 500     DT J  90   C3' -  O3' -  P   ANGL. DEV. =   9.9 DEGREES          
REMARK 500     DT J  91   O3' -  P   -  OP1 ANGL. DEV. =  15.6 DEGREES          
REMARK 500     DT J  91   O3' -  P   -  OP1 ANGL. DEV. =  10.2 DEGREES          
REMARK 500     DA J  94   C3' -  O3' -  P   ANGL. DEV. =   9.2 DEGREES          
REMARK 500    T64 J  95   O3' -  P   -  O5' ANGL. DEV. =  20.0 DEGREES          
REMARK 500     DT J  95   C3' -  O3' -  P   ANGL. DEV. =  47.6 DEGREES          
REMARK 500     DG J  96   C3' -  O3' -  P   ANGL. DEV. =  45.9 DEGREES          
REMARK 500     DG J  97   O4' -  C1' -  N9  ANGL. DEV. =   4.9 DEGREES          
REMARK 500     DG J  99   C3' -  O3' -  P   ANGL. DEV. =  28.9 DEGREES          
REMARK 500                                                                      
REMARK 500 THIS ENTRY HAS      59 ANGLE DEVIATIONS.                             
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    LEU B  23      -27.22     69.47                                   
REMARK 500    ARG B  24       -0.60   -154.92                                   
REMARK 500    ASN B  26     -150.93   -150.99                                   
REMARK 500    PRO C 110       78.09    -61.83                                   
REMARK 500    ASP D  52       73.63   -103.49                                   
REMARK 500    THR D  53      138.98   -171.88                                   
REMARK 500    ALA D 125       37.89    -97.21                                   
REMARK 500    ASP F  25       -3.13     71.43                                   
REMARK 500    ASN F  26      -15.31     82.55                                   
REMARK 500    PRO G 110       79.86    -62.15                                   
REMARK 500    ASP H  52       68.49   -102.32                                   
REMARK 500    ALA H 125       35.30    -94.44                                   
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: NON-CIS, NON-TRANS                                         
REMARK 500                                                                      
REMARK 500 THE FOLLOWING PEPTIDE BONDS DEVIATE SIGNIFICANTLY FROM BOTH          
REMARK 500 CIS AND TRANS CONFORMATION.  CIS BONDS, IF ANY, ARE LISTED           
REMARK 500 ON CISPEP RECORDS.  TRANS IS DEFINED AS 180 +/- 30 AND               
REMARK 500 CIS IS DEFINED AS 0 +/- 30 DEGREES.                                  
REMARK 500                                 MODEL     OMEGA                      
REMARK 500 LEU C  117     PRO C  118                 -147.79                    
REMARK 500 LEU G  117     PRO G  118                 -148.41                    
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: MAIN CHAIN PLANARITY                                       
REMARK 500                                                                      
REMARK 500 THE FOLLOWING RESIDUES HAVE A PSEUDO PLANARITY                       
REMARK 500 TORSION ANGLE, C(I) - CA(I) - N(I+1) - O(I), GREATER                 
REMARK 500 10.0 DEGREES. (M=MODEL NUMBER; RES=RESIDUE NAME;                     
REMARK 500 C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;                            
REMARK 500 I=INSERTION CODE).                                                   
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        ANGLE                                           
REMARK 500    ARG A 135        -11.56                                           
REMARK 500    GLY B 102         11.98                                           
REMARK 500    ALA D 125        -12.49                                           
REMARK 500    ARG E 135        -11.10                                           
REMARK 500    GLY F 102         12.20                                           
REMARK 500    ALA H 125        -12.46                                           
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: EMD-4767   RELATED DB: EMDB                              
REMARK 900 CRYO-EM STRUCTURE OF NCP-6-4PP                                       
DBREF  6R93 I    1   145  PDB    6R93     6R93             1    145             
DBREF  6R93 J    1   145  PDB    6R93     6R93             1    145             
DBREF  6R93 A    1   136  UNP    P68431   H31_HUMAN        1    136             
DBREF  6R93 B    1   103  UNP    P62805   H4_HUMAN         1    103             
DBREF  6R93 C    1   130  UNP    P04908   H2A1B_HUMAN      1    130             
DBREF  6R93 D    1   126  UNP    P06899   H2B1J_HUMAN      1    126             
DBREF  6R93 E    1   136  UNP    P68431   H31_HUMAN        1    136             
DBREF  6R93 F    1   103  UNP    P62805   H4_HUMAN         1    103             
DBREF  6R93 G    1   130  UNP    P04908   H2A1B_HUMAN      1    130             
DBREF  6R93 H    1   126  UNP    P06899   H2B1J_HUMAN      1    126             
SEQADV 6R93 GLY A   -2  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 SER A   -1  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 HIS A    0  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 GLY B   -2  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 SER B   -1  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 HIS B    0  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 GLY C   -2  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 SER C   -1  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 HIS C    0  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 GLY D   -2  UNP  P06899              EXPRESSION TAG                 
SEQADV 6R93 SER D   -1  UNP  P06899              EXPRESSION TAG                 
SEQADV 6R93 HIS D    0  UNP  P06899              EXPRESSION TAG                 
SEQADV 6R93 GLY E   -2  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 SER E   -1  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 HIS E    0  UNP  P68431              EXPRESSION TAG                 
SEQADV 6R93 GLY F   -2  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 SER F   -1  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 HIS F    0  UNP  P62805              EXPRESSION TAG                 
SEQADV 6R93 GLY G   -2  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 SER G   -1  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 HIS G    0  UNP  P04908              EXPRESSION TAG                 
SEQADV 6R93 GLY H   -2  UNP  P06899              EXPRESSION TAG                 
SEQADV 6R93 SER H   -1  UNP  P06899              EXPRESSION TAG                 
SEQADV 6R93 HIS H    0  UNP  P06899              EXPRESSION TAG                 
SEQRES   1 I  145   DA  DT  DC  DA  DA  DT  DA  DT  DC  DC  DA  DC  DC          
SEQRES   2 I  145   DT  DG  DC  DA  DG  DA  DT  DT  DC  DT  DA  DC  DC          
SEQRES   3 I  145   DA  DA  DA  DA  DG  DT  DG  DT  DA  DT  DT  DT  DG          
SEQRES   4 I  145   DG  DA  DA  DA  DC  DT  DG  DC  DT  DC  DA  DA  DC          
SEQRES   5 I  145   DC  DA  DA  DA  DA  DG  DG  DC  DA  DT  DG  DT  DT          
SEQRES   6 I  145   DC  DA  DG  DC  DT  DG  DG  DT  DT  DC  DA  DG  DC          
SEQRES   7 I  145   DT  DG  DA  DA  DC  DA  DT  DG  DC  DC  DT  DT  DT          
SEQRES   8 I  145   DT  DG  DA  DT  DG  DG  DA  DG  DC  DA  DG  DT  DT          
SEQRES   9 I  145   DT  DC  DC  DA  DA  DA  DT  DA  DC  DA  DC  DT  DT          
SEQRES  10 I  145   DT  DT  DG  DG  DT  DA  DG  DA  DA  DT  DC  DT  DG          
SEQRES  11 I  145   DC  DA  DG  DG  DT  DG  DG  DA  DT  DA  DT  DT  DG          
SEQRES  12 I  145   DA  DT                                                      
SEQRES   1 J  145   DA  DT  DC  DA  DA  DT  DA  DT  DC  DC  DA  DC  DC          
SEQRES   2 J  145   DT  DG  DC  DA  DG  DA  DT  DT  DC  DT  DA  DC  DC          
SEQRES   3 J  145   DA  DA  DA  DA  DG  DT  DG  DT  DA  DT  DT  DT  DG          
SEQRES   4 J  145   DG  DA  DA  DA  DC  DT  DG  DC  DT  DC  DC  DA  DT          
SEQRES   5 J  145   DC  DA  DA  DA  DA  DG  DG  DC  DA  DT  DG  DT  DT          
SEQRES   6 J  145   DC  DA  DG  DC  DT  DG  DA  DA  DC  DC  DA  DG  DC          
SEQRES   7 J  145   DT  DG  DA  DA  DC  DA  DT  DG  DC  DC  DT  DT  DT          
SEQRES   8 J  145   DT  DG  DA T64  DG  DG  DA  DG  DC  DA  DG  DT  DT          
SEQRES   9 J  145   DT  DC  DC  DA  DA  DA  DT  DA  DC  DA  DC  DT  DT          
SEQRES  10 J  145   DT  DT  DG  DG  DT  DA  DG  DA  DA  DT  DC  DT  DG          
SEQRES  11 J  145   DC  DA  DG  DG  DT  DG  DG  DA  DT  DA  DT  DT  DG          
SEQRES  12 J  145   DA  DT                                                      
SEQRES   1 A  139  GLY SER HIS MET ALA ARG THR LYS GLN THR ALA ARG LYS          
SEQRES   2 A  139  SER THR GLY GLY LYS ALA PRO ARG LYS GLN LEU ALA THR          
SEQRES   3 A  139  LYS ALA ALA ARG LYS SER ALA PRO ALA THR GLY GLY VAL          
SEQRES   4 A  139  LYS LYS PRO HIS ARG TYR ARG PRO GLY THR VAL ALA LEU          
SEQRES   5 A  139  ARG GLU ILE ARG ARG TYR GLN LYS SER THR GLU LEU LEU          
SEQRES   6 A  139  ILE ARG LYS LEU PRO PHE GLN ARG LEU VAL ARG GLU ILE          
SEQRES   7 A  139  ALA GLN ASP PHE LYS THR ASP LEU ARG PHE GLN SER SER          
SEQRES   8 A  139  ALA VAL MET ALA LEU GLN GLU ALA CYS GLU ALA TYR LEU          
SEQRES   9 A  139  VAL GLY LEU PHE GLU ASP THR ASN LEU CYS ALA ILE HIS          
SEQRES  10 A  139  ALA LYS ARG VAL THR ILE MET PRO LYS ASP ILE GLN LEU          
SEQRES  11 A  139  ALA ARG ARG ILE ARG GLY GLU ARG ALA                          
SEQRES   1 B  106  GLY SER HIS MET SER GLY ARG GLY LYS GLY GLY LYS GLY          
SEQRES   2 B  106  LEU GLY LYS GLY GLY ALA LYS ARG HIS ARG LYS VAL LEU          
SEQRES   3 B  106  ARG ASP ASN ILE GLN GLY ILE THR LYS PRO ALA ILE ARG          
SEQRES   4 B  106  ARG LEU ALA ARG ARG GLY GLY VAL LYS ARG ILE SER GLY          
SEQRES   5 B  106  LEU ILE TYR GLU GLU THR ARG GLY VAL LEU LYS VAL PHE          
SEQRES   6 B  106  LEU GLU ASN VAL ILE ARG ASP ALA VAL THR TYR THR GLU          
SEQRES   7 B  106  HIS ALA LYS ARG LYS THR VAL THR ALA MET ASP VAL VAL          
SEQRES   8 B  106  TYR ALA LEU LYS ARG GLN GLY ARG THR LEU TYR GLY PHE          
SEQRES   9 B  106  GLY GLY                                                      
SEQRES   1 C  133  GLY SER HIS MET SER GLY ARG GLY LYS GLN GLY GLY LYS          
SEQRES   2 C  133  ALA ARG ALA LYS ALA LYS THR ARG SER SER ARG ALA GLY          
SEQRES   3 C  133  LEU GLN PHE PRO VAL GLY ARG VAL HIS ARG LEU LEU ARG          
SEQRES   4 C  133  LYS GLY ASN TYR SER GLU ARG VAL GLY ALA GLY ALA PRO          
SEQRES   5 C  133  VAL TYR LEU ALA ALA VAL LEU GLU TYR LEU THR ALA GLU          
SEQRES   6 C  133  ILE LEU GLU LEU ALA GLY ASN ALA ALA ARG ASP ASN LYS          
SEQRES   7 C  133  LYS THR ARG ILE ILE PRO ARG HIS LEU GLN LEU ALA ILE          
SEQRES   8 C  133  ARG ASN ASP GLU GLU LEU ASN LYS LEU LEU GLY ARG VAL          
SEQRES   9 C  133  THR ILE ALA GLN GLY GLY VAL LEU PRO ASN ILE GLN ALA          
SEQRES  10 C  133  VAL LEU LEU PRO LYS LYS THR GLU SER HIS HIS LYS ALA          
SEQRES  11 C  133  LYS GLY LYS                                                  
SEQRES   1 D  129  GLY SER HIS MET PRO GLU PRO ALA LYS SER ALA PRO ALA          
SEQRES   2 D  129  PRO LYS LYS GLY SER LYS LYS ALA VAL THR LYS ALA GLN          
SEQRES   3 D  129  LYS LYS ASP GLY LYS LYS ARG LYS ARG SER ARG LYS GLU          
SEQRES   4 D  129  SER TYR SER ILE TYR VAL TYR LYS VAL LEU LYS GLN VAL          
SEQRES   5 D  129  HIS PRO ASP THR GLY ILE SER SER LYS ALA MET GLY ILE          
SEQRES   6 D  129  MET ASN SER PHE VAL ASN ASP ILE PHE GLU ARG ILE ALA          
SEQRES   7 D  129  GLY GLU ALA SER ARG LEU ALA HIS TYR ASN LYS ARG SER          
SEQRES   8 D  129  THR ILE THR SER ARG GLU ILE GLN THR ALA VAL ARG LEU          
SEQRES   9 D  129  LEU LEU PRO GLY GLU LEU ALA LYS HIS ALA VAL SER GLU          
SEQRES  10 D  129  GLY THR LYS ALA VAL THR LYS TYR THR SER ALA LYS              
SEQRES   1 E  139  GLY SER HIS MET ALA ARG THR LYS GLN THR ALA ARG LYS          
SEQRES   2 E  139  SER THR GLY GLY LYS ALA PRO ARG LYS GLN LEU ALA THR          
SEQRES   3 E  139  LYS ALA ALA ARG LYS SER ALA PRO ALA THR GLY GLY VAL          
SEQRES   4 E  139  LYS LYS PRO HIS ARG TYR ARG PRO GLY THR VAL ALA LEU          
SEQRES   5 E  139  ARG GLU ILE ARG ARG TYR GLN LYS SER THR GLU LEU LEU          
SEQRES   6 E  139  ILE ARG LYS LEU PRO PHE GLN ARG LEU VAL ARG GLU ILE          
SEQRES   7 E  139  ALA GLN ASP PHE LYS THR ASP LEU ARG PHE GLN SER SER          
SEQRES   8 E  139  ALA VAL MET ALA LEU GLN GLU ALA CYS GLU ALA TYR LEU          
SEQRES   9 E  139  VAL GLY LEU PHE GLU ASP THR ASN LEU CYS ALA ILE HIS          
SEQRES  10 E  139  ALA LYS ARG VAL THR ILE MET PRO LYS ASP ILE GLN LEU          
SEQRES  11 E  139  ALA ARG ARG ILE ARG GLY GLU ARG ALA                          
SEQRES   1 F  106  GLY SER HIS MET SER GLY ARG GLY LYS GLY GLY LYS GLY          
SEQRES   2 F  106  LEU GLY LYS GLY GLY ALA LYS ARG HIS ARG LYS VAL LEU          
SEQRES   3 F  106  ARG ASP ASN ILE GLN GLY ILE THR LYS PRO ALA ILE ARG          
SEQRES   4 F  106  ARG LEU ALA ARG ARG GLY GLY VAL LYS ARG ILE SER GLY          
SEQRES   5 F  106  LEU ILE TYR GLU GLU THR ARG GLY VAL LEU LYS VAL PHE          
SEQRES   6 F  106  LEU GLU ASN VAL ILE ARG ASP ALA VAL THR TYR THR GLU          
SEQRES   7 F  106  HIS ALA LYS ARG LYS THR VAL THR ALA MET ASP VAL VAL          
SEQRES   8 F  106  TYR ALA LEU LYS ARG GLN GLY ARG THR LEU TYR GLY PHE          
SEQRES   9 F  106  GLY GLY                                                      
SEQRES   1 G  133  GLY SER HIS MET SER GLY ARG GLY LYS GLN GLY GLY LYS          
SEQRES   2 G  133  ALA ARG ALA LYS ALA LYS THR ARG SER SER ARG ALA GLY          
SEQRES   3 G  133  LEU GLN PHE PRO VAL GLY ARG VAL HIS ARG LEU LEU ARG          
SEQRES   4 G  133  LYS GLY ASN TYR SER GLU ARG VAL GLY ALA GLY ALA PRO          
SEQRES   5 G  133  VAL TYR LEU ALA ALA VAL LEU GLU TYR LEU THR ALA GLU          
SEQRES   6 G  133  ILE LEU GLU LEU ALA GLY ASN ALA ALA ARG ASP ASN LYS          
SEQRES   7 G  133  LYS THR ARG ILE ILE PRO ARG HIS LEU GLN LEU ALA ILE          
SEQRES   8 G  133  ARG ASN ASP GLU GLU LEU ASN LYS LEU LEU GLY ARG VAL          
SEQRES   9 G  133  THR ILE ALA GLN GLY GLY VAL LEU PRO ASN ILE GLN ALA          
SEQRES  10 G  133  VAL LEU LEU PRO LYS LYS THR GLU SER HIS HIS LYS ALA          
SEQRES  11 G  133  LYS GLY LYS                                                  
SEQRES   1 H  129  GLY SER HIS MET PRO GLU PRO ALA LYS SER ALA PRO ALA          
SEQRES   2 H  129  PRO LYS LYS GLY SER LYS LYS ALA VAL THR LYS ALA GLN          
SEQRES   3 H  129  LYS LYS ASP GLY LYS LYS ARG LYS ARG SER ARG LYS GLU          
SEQRES   4 H  129  SER TYR SER ILE TYR VAL TYR LYS VAL LEU LYS GLN VAL          
SEQRES   5 H  129  HIS PRO ASP THR GLY ILE SER SER LYS ALA MET GLY ILE          
SEQRES   6 H  129  MET ASN SER PHE VAL ASN ASP ILE PHE GLU ARG ILE ALA          
SEQRES   7 H  129  GLY GLU ALA SER ARG LEU ALA HIS TYR ASN LYS ARG SER          
SEQRES   8 H  129  THR ILE THR SER ARG GLU ILE GLN THR ALA VAL ARG LEU          
SEQRES   9 H  129  LEU LEU PRO GLY GLU LEU ALA LYS HIS ALA VAL SER GLU          
SEQRES  10 H  129  GLY THR LYS ALA VAL THR LYS TYR THR SER ALA LYS              
HET    T64  I  95      64                                                       
HET    T64  J  95      64                                                       
HETNAM     T64 (6-4)PHOTOPRODUCT                                                
HETSYN     T64 [(2R,4S,5R,10S,11R,13R,18R,19S)-4,8,18-TRIHYDROXY-18,            
HETSYN   2 T64  24-DIMETHYL-8-OXIDO-15,17,22-TRIOXO-7,9,12,26-                  
HETSYN   3 T64  TETRAOXA-1,14,16,21-TETRAAZA-8-                                 
HETSYN   4 T64  PHOSPHAPENTACYCLO[18.2.2.1~2,5~.1~10,13~.0~14,                  
HETSYN   5 T64  19~]HEXACOSA-20,23-DIEN-11-YL]METHYL DIHYDROGEN                 
HETSYN   6 T64  PHOSPHATE                                                       
FORMUL   1  T64    2(C20 H28 N4 O15 P2)                                         
HELIX    1 AA1 GLY A   45  SER A   58  1                                  14    
HELIX    2 AA2 ARG A   64  LYS A   80  1                                  17    
HELIX    3 AA3 GLN A   86  ALA A  115  1                                  30    
HELIX    4 AA4 MET A  121  GLY A  133  1                                  13    
HELIX    5 AA5 ASN B   26  ILE B   30  5                                   5    
HELIX    6 AA6 THR B   31  GLY B   42  1                                  12    
HELIX    7 AA7 LEU B   50  ALA B   77  1                                  28    
HELIX    8 AA8 THR B   83  GLN B   94  1                                  12    
HELIX    9 AA9 THR C   17  GLY C   23  1                                   7    
HELIX   10 AB1 PRO C   27  LYS C   37  1                                  11    
HELIX   11 AB2 ALA C   46  ASN C   74  1                                  29    
HELIX   12 AB3 ILE C   80  ASN C   90  1                                  11    
HELIX   13 AB4 ASP C   91  LEU C   98  1                                   8    
HELIX   14 AB5 GLN C  113  LEU C  117  5                                   5    
HELIX   15 AB6 TYR D   38  HIS D   50  1                                  13    
HELIX   16 AB7 SER D   56  ASN D   85  1                                  30    
HELIX   17 AB8 THR D   91  LEU D  103  1                                  13    
HELIX   18 AB9 PRO D  104  ALA D  125  1                                  22    
HELIX   19 AC1 GLY E   45  SER E   58  1                                  14    
HELIX   20 AC2 ARG E   64  LYS E   80  1                                  17    
HELIX   21 AC3 GLN E   86  ALA E  115  1                                  30    
HELIX   22 AC4 MET E  121  GLY E  133  1                                  13    
HELIX   23 AC5 ASN F   26  ILE F   30  5                                   5    
HELIX   24 AC6 THR F   31  GLY F   42  1                                  12    
HELIX   25 AC7 LEU F   50  LYS F   78  1                                  29    
HELIX   26 AC8 THR F   83  GLN F   94  1                                  12    
HELIX   27 AC9 THR G   17  GLY G   23  1                                   7    
HELIX   28 AD1 PRO G   27  LYS G   37  1                                  11    
HELIX   29 AD2 ALA G   46  ASN G   74  1                                  29    
HELIX   30 AD3 ILE G   80  ASN G   90  1                                  11    
HELIX   31 AD4 ASP G   91  LEU G   98  1                                   8    
HELIX   32 AD5 GLN G  113  LEU G  117  5                                   5    
HELIX   33 AD6 TYR H   38  HIS H   50  1                                  13    
HELIX   34 AD7 SER H   56  ASN H   85  1                                  30    
HELIX   35 AD8 THR H   91  LEU H  103  1                                  13    
HELIX   36 AD9 PRO H  104  ALA H  125  1                                  22    
SHEET    1 AA1 2 ARG A  84  PHE A  85  0                                        
SHEET    2 AA1 2 THR B  81  VAL B  82  1  O  VAL B  82   N  ARG A  84           
SHEET    1 AA2 2 THR A 119  ILE A 120  0                                        
SHEET    2 AA2 2 ARG B  46  ILE B  47  1  O  ARG B  46   N  ILE A 120           
SHEET    1 AA3 2 THR B  97  TYR B  99  0                                        
SHEET    2 AA3 2 VAL G 101  ILE G 103  1  O  THR G 102   N  THR B  97           
SHEET    1 AA4 2 ARG C  43  VAL C  44  0                                        
SHEET    2 AA4 2 THR D  89  ILE D  90  1  O  ILE D  90   N  ARG C  43           
SHEET    1 AA5 2 ARG C  78  ILE C  79  0                                        
SHEET    2 AA5 2 GLY D  54  ILE D  55  1  O  GLY D  54   N  ILE C  79           
SHEET    1 AA6 2 VAL C 101  ILE C 103  0                                        
SHEET    2 AA6 2 THR F  97  TYR F  99  1  O  THR F  97   N  THR C 102           
SHEET    1 AA7 2 ARG E  84  PHE E  85  0                                        
SHEET    2 AA7 2 THR F  81  VAL F  82  1  O  VAL F  82   N  ARG E  84           
SHEET    1 AA8 2 THR E 119  ILE E 120  0                                        
SHEET    2 AA8 2 ARG F  46  ILE F  47  1  O  ARG F  46   N  ILE E 120           
SHEET    1 AA9 2 ARG G  43  VAL G  44  0                                        
SHEET    2 AA9 2 THR H  89  ILE H  90  1  O  ILE H  90   N  ARG G  43           
SHEET    1 AB1 2 ARG G  78  ILE G  79  0                                        
SHEET    2 AB1 2 GLY H  54  ILE H  55  1  O  GLY H  54   N  ILE G  79           
LINK         O3'B DA I  94                 P  BT64 I  95     1555   1555  1.60  
LINK         O3'BT64 I  95                 P  B DG I  97     1555   1555  1.60  
LINK         O3'A DA J  94                 P  AT64 J  95     1555   1555  1.61  
LINK         O3'AT64 J  95                 P  A DG J  97     1555   1555  1.60  
CRYST1    1.000    1.000    1.000  90.00  90.00  90.00 P 1           1          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      1.000000  0.000000  0.000000        0.00000                         
SCALE2      0.000000  1.000000  0.000000        0.00000                         
SCALE3      0.000000  0.000000  1.000000        0.00000