>>1C99:HELIX    1   1 GLU A    2  ALA A   40  1                                  39    
ENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 1 1 GLU A 2 ALA A 40 1 39 ATOM 20 N GLU A 2 -3.180 -27.681 0.469 1.00 0.00 N ATOM 21 CA GLU A 2 -2.295 -26.765 -0.240 1.00 0.00 C ATOM 22 C GLU A 2 -3.048 -26.025 -1.339 1.00 0.00 C ATOM 23 O GLU A 2 -2.969 -24.800 -1.446 1.00 0.00 O ATOM 24 CB GLU A 2 -1.113 -27.529 -0.840 1.00 0.00 C ATOM 25 CG GLU A 2 -0.269 -28.253 0.195 1.00 0.00 C ATOM 26 CD GLU A 2 0.356 -27.309 1.204 1.00 0.00 C ATOM 27 OE1 GLU A 2 1.142 -26.432 0.788 1.00 0.00 O ATOM 28 OE2 GLU A 2 0.059 -27.447 2.409 1.00 0.00 O ATOM 29 H GLU A 2 -3.037 -28.643 0.388 1.00 0.00 H ATOM 30 HA GLU A 2 -1.925 -26.045 0.471 1.00 0.00 H ATOM 31 HB2 GLU A 2 -1.489 -28.259 -1.541 1.00 0.00 H ATOM 32 HB3 GLU A 2 -0.478 -26.831 -1.366 1.00 0.00 H ATOM 33 HG2 GLU A 2 -0.895 -28.956 0.725 1.00 0.00 H ATOM 34 HG3 GLU A 2 0.520 -28.789 -0.312 1.00 0.00 H ATOM 35 N ASN A 3 -3.778 -26.774 -2.158 1.00 0.00 N ATOM 36 CA ASN A 3 -4.543 -26.181 -3.246 1.00 0.00 C ATOM 37 C ASN A 3 -5.627 -25.260 -2.698 1.00 0.00 C ATOM 38 O ASN A 3 -5.987 -24.271 -3.333 1.00 0.00 O ATOM 39 CB ASN A 3 -5.165 -27.270 -4.124 1.00 0.00 C ATOM 40 CG ASN A 3 -6.099 -28.179 -3.350 1.00 0.00 C ATOM 41 OD1 ASN A 3 -7.080 -27.724 -2.763 1.00 0.00 O ATOM 42 ND2 ASN A 3 -5.799 -29.472 -3.348 1.00 0.00 N ATOM 43 H ASN A 3 -3.804 -27.744 -2.026 1.00 0.00 H ATOM 44 HA ASN A 3 -3.861 -25.594 -3.844 1.00 0.00 H ATOM 45 HB2 ASN A 3 -5.727 -26.803 -4.920 1.00 0.00 H ATOM 46 HB3 ASN A 3 -4.377 -27.872 -4.552 1.00 0.00 H ATOM 47 HD21 ASN A 3 -5.003 -29.763 -3.840 1.00 0.00 H ATOM 48 HD22 ASN A 3 -6.387 -30.083 -2.857 1.00 0.00 H ATOM 49 N LEU A 4 -6.133 -25.583 -1.511 1.00 0.00 N ATOM 50 CA LEU A 4 -7.168 -24.773 -0.877 1.00 0.00 C ATOM 51 C LEU A 4 -6.572 -23.510 -0.276 1.00 0.00 C ATOM 52 O LEU A 4 -7.076 -22.415 -0.507 1.00 0.00 O ATOM 53 CB LEU A 4 -7.901 -25.580 0.196 1.00 0.00 C ATOM 54 CG LEU A 4 -8.652 -26.807 -0.325 1.00 0.00 C ATOM 55 CD1 LEU A 4 -9.394 -27.502 0.806 1.00 0.00 C ATOM 56 CD2 LEU A 4 -9.614 -26.409 -1.434 1.00 0.00 C ATOM 57 H LEU A 4 -5.797 -26.378 -1.047 1.00 0.00 H ATOM 58 HA LEU A 4 -7.874 -24.481 -1.639 1.00 0.00 H ATOM 59 HB2 LEU A 4 -7.177 -25.909 0.928 1.00 0.00 H ATOM 60 HB3 LEU A 4 -8.613 -24.931 0.683 1.00 0.00 H ATOM 61 HG LEU A 4 -7.940 -27.509 -0.735 1.00 0.00 H ATOM 62 HD11 LEU A 4 -9.994 -26.779 1.341 1.00 0.00 H ATOM 63 HD12 LEU A 4 -10.035 -28.269 0.398 1.00 0.00 H ATOM 64 HD13 LEU A 4 -8.682 -27.950 1.482 1.00 0.00 H ATOM 65 HD21 LEU A 4 -10.150 -25.517 -1.144 1.00 0.00 H ATOM 66 HD22 LEU A 4 -9.059 -26.217 -2.340 1.00 0.00 H ATOM 67 HD23 LEU A 4 -10.318 -27.211 -1.605 1.00 0.00 H ATOM 68 N ASN A 5 -5.488 -23.658 0.477 1.00 0.00 N ATOM 69 CA ASN A 5 -4.835 -22.502 1.075 1.00 0.00 C ATOM 70 C ASN A 5 -4.123 -21.689 -0.001 1.00 0.00 C ATOM 71 O ASN A 5 -3.760 -20.533 0.216 1.00 0.00 O ATOM 72 CB ASN A 5 -3.844 -22.930 2.160 1.00 0.00 C ATOM 73 CG ASN A 5 -4.523 -23.633 3.321 1.00 0.00 C ATOM 74 OD1 ASN A 5 -5.428 -23.085 3.950 1.00 0.00 O ATOM 75 ND2 ASN A 5 -4.081 -24.849 3.617 1.00 0.00 N ATOM 76 H ASN A 5 -5.115 -24.553 0.619 1.00 0.00 H ATOM 77 HA ASN A 5 -5.604 -21.885 1.516 1.00 0.00 H ATOM 78 HB2 ASN A 5 -3.118 -23.604 1.731 1.00 0.00 H ATOM 79 HB3 ASN A 5 -3.336 -22.056 2.541 1.00 0.00 H ATOM 80 HD21 ASN A 5 -3.351 -25.221 3.078 1.00 0.00 H ATOM 81 HD22 ASN A 5 -4.501 -25.327 4.363 1.00 0.00 H ATOM 82 N MET A 6 -3.937 -22.303 -1.165 1.00 0.00 N ATOM 83 CA MET A 6 -3.290 -21.642 -2.285 1.00 0.00 C ATOM 84 C MET A 6 -4.301 -20.771 -3.024 1.00 0.00 C ATOM 85 O MET A 6 -4.120 -19.554 -3.154 1.00 0.00 O ATOM 86 CB MET A 6 -2.683 -22.692 -3.222 1.00 0.00 C ATOM 87 CG MET A 6 -2.018 -22.123 -4.465 1.00 0.00 C ATOM 88 SD MET A 6 -1.298 -23.408 -5.506 1.00 0.00 S ATOM 89 CE MET A 6 -0.701 -22.441 -6.890 1.00 0.00 C ATOM 90 H MET A 6 -4.252 -23.224 -1.278 1.00 0.00 H ATOM 91 HA MET A 6 -2.510 -21.012 -1.891 1.00 0.00 H ATOM 92 HB2 MET A 6 -1.941 -23.254 -2.675 1.00 0.00 H ATOM 93 HB3 MET A 6 -3.467 -23.366 -3.538 1.00 0.00 H ATOM 94 HG2 MET A 6 -2.756 -21.588 -5.041 1.00 0.00 H ATOM 95 HG3 MET A 6 -1.236 -21.446 -4.160 1.00 0.00 H ATOM 96 HE1 MET A 6 -0.049 -21.659 -6.528 1.00 0.00 H ATOM 97 HE2 MET A 6 -0.153 -23.080 -7.566 1.00 0.00 H ATOM 98 HE3 MET A 6 -1.538 -22.000 -7.409 1.00 0.00 H ATOM 99 N ASP A 7 -5.381 -21.395 -3.488 1.00 0.00 N ATOM 100 CA ASP A 7 -6.426 -20.674 -4.193 1.00 0.00 C ATOM 101 C ASP A 7 -7.160 -19.749 -3.231 1.00 0.00 C ATOM 102 O ASP A 7 -7.478 -18.610 -3.574 1.00 0.00 O ATOM 103 CB ASP A 7 -7.412 -21.647 -4.846 1.00 0.00 C ATOM 104 CG ASP A 7 -8.340 -22.302 -3.840 1.00 0.00 C ATOM 105 OD1 ASP A 7 -7.838 -22.825 -2.827 1.00 0.00 O ATOM 106 OD2 ASP A 7 -9.567 -22.289 -4.068 1.00 0.00 O ATOM 107 H ASP A 7 -5.483 -22.358 -3.341 1.00 0.00 H ATOM 108 HA ASP A 7 -5.957 -20.077 -4.961 1.00 0.00 H ATOM 109 HB2 ASP A 7 -8.013 -21.109 -5.560 1.00 0.00 H ATOM 110 HB3 ASP A 7 -6.859 -22.422 -5.359 1.00 0.00 H ATOM 111 N LEU A 8 -7.433 -20.242 -2.020 1.00 0.00 N ATOM 112 CA LEU A 8 -8.129 -19.432 -1.029 1.00 0.00 C ATOM 113 C LEU A 8 -7.333 -18.174 -0.711 1.00 0.00 C ATOM 114 O LEU A 8 -7.906 -17.096 -0.547 1.00 0.00 O ATOM 115 CB LEU A 8 -8.382 -20.218 0.252 1.00 0.00 C ATOM 116 CG LEU A 8 -9.089 -19.434 1.362 1.00 0.00 C ATOM 117 CD1 LEU A 8 -10.429 -18.904 0.874 1.00 0.00 C ATOM 118 CD2 LEU A 8 -9.277 -20.305 2.595 1.00 0.00 C ATOM 119 H LEU A 8 -7.162 -21.166 -1.792 1.00 0.00 H ATOM 120 HA LEU A 8 -9.073 -19.144 -1.449 1.00 0.00 H ATOM 121 HB2 LEU A 8 -8.980 -21.084 0.009 1.00 0.00 H ATOM 122 HB3 LEU A 8 -7.434 -20.552 0.629 1.00 0.00 H ATOM 123 HG LEU A 8 -8.478 -18.588 1.639 1.00 0.00 H ATOM 124 HD11 LEU A 8 -10.309 -18.467 -0.106 1.00 0.00 H ATOM 125 HD12 LEU A 8 -11.140 -19.716 0.821 1.00 0.00 H ATOM 126 HD13 LEU A 8 -10.791 -18.154 1.561 1.00 0.00 H ATOM 127 HD21 LEU A 8 -8.391 -20.901 2.752 1.00 0.00 H ATOM 128 HD22 LEU A 8 -9.447 -19.676 3.456 1.00 0.00 H ATOM 129 HD23 LEU A 8 -10.128 -20.954 2.450 1.00 0.00 H ATOM 130 N LEU A 9 -6.010 -18.307 -0.629 1.00 0.00 N ATOM 131 CA LEU A 9 -5.161 -17.161 -0.336 1.00 0.00 C ATOM 132 C LEU A 9 -5.193 -16.175 -1.497 1.00 0.00 C ATOM 133 O LEU A 9 -5.575 -15.017 -1.324 1.00 0.00 O ATOM 134 CB LEU A 9 -3.729 -17.605 -0.042 1.00 0.00 C ATOM 135 CG LEU A 9 -2.776 -16.474 0.349 1.00 0.00 C ATOM 136 CD1 LEU A 9 -3.338 -15.685 1.521 1.00 0.00 C ATOM 137 CD2 LEU A 9 -1.407 -17.029 0.697 1.00 0.00 C ATOM 138 H LEU A 9 -5.599 -19.189 -0.776 1.00 0.00 H ATOM 139 HA LEU A 9 -5.563 -16.674 0.541 1.00 0.00 H ATOM 140 HB2 LEU A 9 -3.756 -18.321 0.767 1.00 0.00 H ATOM 141 HB3 LEU A 9 -3.334 -18.092 -0.920 1.00 0.00 H ATOM 142 HG LEU A 9 -2.663 -15.799 -0.488 1.00 0.00 H ATOM 143 HD11 LEU A 9 -3.777 -16.366 2.235 1.00 0.00 H ATOM 144 HD12 LEU A 9 -2.543 -15.129 1.994 1.00 0.00 H ATOM 145 HD13 LEU A 9 -4.093 -15.000 1.164 1.00 0.00 H ATOM 146 HD21 LEU A 9 -1.288 -18.003 0.245 1.00 0.00 H ATOM 147 HD22 LEU A 9 -0.644 -16.362 0.324 1.00 0.00 H ATOM 148 HD23 LEU A 9 -1.315 -17.116 1.769 1.00 0.00 H ATOM 149 N TYR A 10 -4.829 -16.642 -2.692 1.00 0.00 N ATOM 150 CA TYR A 10 -4.850 -15.785 -3.880 1.00 0.00 C ATOM 151 C TYR A 10 -6.199 -15.100 -3.994 1.00 0.00 C ATOM 152 O TYR A 10 -6.294 -13.881 -4.138 1.00 0.00 O ATOM 153 CB TYR A 10 -4.634 -16.615 -5.144 1.00 0.00 C ATOM 154 CG TYR A 10 -3.413 -17.500 -5.128 1.00 0.00 C ATOM 155 CD1 TYR A 10 -2.352 -17.274 -4.258 1.00 0.00 C ATOM 156 CD2 TYR A 10 -3.323 -18.563 -6.008 1.00 0.00 C ATOM 157 CE1 TYR A 10 -1.240 -18.089 -4.267 1.00 0.00 C ATOM 158 CE2 TYR A 10 -2.213 -19.382 -6.025 1.00 0.00 C ATOM 159 CZ TYR A 10 -1.176 -19.141 -5.151 1.00 0.00 C ATOM 160 OH TYR A 10 -0.064 -19.951 -5.166 1.00 0.00 O ATOM 161 H TYR A 10 -4.560 -17.584 -2.782 1.00 0.00 H ATOM 162 HA TYR A 10 -4.070 -15.037 -3.792 1.00 0.00 H ATOM 163 HB2 TYR A 10 -5.494 -17.250 -5.294 1.00 0.00 H ATOM 164 HB3 TYR A 10 -4.545 -15.945 -5.988 1.00 0.00 H ATOM 165 HD1 TYR A 10 -2.405 -16.450 -3.566 1.00 0.00 H ATOM 166 HD2 TYR A 10 -4.147 -18.749 -6.685 1.00 0.00 H ATOM 167 HE1 TYR A 10 -0.428 -17.901 -3.582 1.00 0.00 H ATOM 168 HE2 TYR A 10 -2.161 -20.208 -6.720 1.00 0.00 H ATOM 169 HH TYR A 10 0.524 -19.674 -5.874 1.00 0.00 H ATOM 170 N MET A 11 -7.242 -15.911 -3.935 1.00 0.00 N ATOM 171 CA MET A 11 -8.601 -15.423 -4.031 1.00 0.00 C ATOM 172 C MET A 11 -8.881 -14.451 -2.896 1.00 0.00 C ATOM 173 O MET A 11 -9.524 -13.418 -3.087 1.00 0.00 O ATOM 174 CB MET A 11 -9.563 -16.604 -3.989 1.00 0.00 C ATOM 175 CG MET A 11 -10.981 -16.260 -4.418 1.00 0.00 C ATOM 176 SD MET A 11 -12.090 -17.682 -4.369 1.00 0.00 S ATOM 177 CE MET A 11 -11.315 -18.765 -5.567 1.00 0.00 C ATOM 178 H MET A 11 -7.091 -16.873 -3.823 1.00 0.00 H ATOM 179 HA MET A 11 -8.706 -14.906 -4.974 1.00 0.00 H ATOM 180 HB2 MET A 11 -9.180 -17.378 -4.643 1.00 0.00 H ATOM 181 HB3 MET A 11 -9.598 -16.987 -2.979 1.00 0.00 H ATOM 182 HG2 MET A 11 -11.368 -15.498 -3.756 1.00 0.00 H ATOM 183 HG3 MET A 11 -10.955 -15.876 -5.428 1.00 0.00 H ATOM 184 HE1 MET A 11 -10.242 -18.713 -5.461 1.00 0.00 H ATOM 185 HE2 MET A 11 -11.642 -19.781 -5.399 1.00 0.00 H ATOM 186 HE3 MET A 11 -11.594 -18.457 -6.564 1.00 0.00 H ATOM 187 N ALA A 12 -8.355 -14.773 -1.718 1.00 0.00 N ATOM 188 CA ALA A 12 -8.513 -13.910 -0.559 1.00 0.00 C ATOM 189 C ALA A 12 -7.881 -12.563 -0.844 1.00 0.00 C ATOM 190 O ALA A 12 -8.388 -11.540 -0.425 1.00 0.00 O ATOM 191 CB ALA A 12 -7.893 -14.543 0.679 1.00 0.00 C ATOM 192 H ALA A 12 -7.828 -15.594 -1.637 1.00 0.00 H ATOM 193 HA ALA A 12 -9.572 -13.763 -0.380 1.00 0.00 H ATOM 194 HB1 ALA A 12 -7.125 -15.241 0.381 1.00 0.00 H ATOM 195 HB2 ALA A 12 -7.456 -13.771 1.297 1.00 0.00 H ATOM 196 HB3 ALA A 12 -8.656 -15.062 1.240 1.00 0.00 H ATOM 197 N ALA A 13 -6.781 -12.571 -1.585 1.00 0.00 N ATOM 198 CA ALA A 13 -6.110 -11.335 -1.942 1.00 0.00 C ATOM 199 C ALA A 13 -7.017 -10.491 -2.824 1.00 0.00 C ATOM 200 O ALA A 13 -7.058 -9.272 -2.701 1.00 0.00 O ATOM 201 CB ALA A 13 -4.794 -11.626 -2.649 1.00 0.00 C ATOM 202 H ALA A 13 -6.425 -13.421 -1.910 1.00 0.00 H ATOM 203 HA ALA A 13 -5.898 -10.791 -1.028 1.00 0.00 H ATOM 204 HB1 ALA A 13 -4.960 -12.351 -3.432 1.00 0.00 H ATOM 205 HB2 ALA A 13 -4.409 -10.714 -3.080 1.00 0.00 H ATOM 206 HB3 ALA A 13 -4.082 -12.019 -1.939 1.00 0.00 H ATOM 207 N ALA A 14 -7.763 -11.153 -3.703 1.00 0.00 N ATOM 208 CA ALA A 14 -8.688 -10.456 -4.587 1.00 0.00 C ATOM 209 C ALA A 14 -9.775 -9.783 -3.760 1.00 0.00 C ATOM 210 O ALA A 14 -9.989 -8.574 -3.855 1.00 0.00 O ATOM 211 CB ALA A 14 -9.300 -11.421 -5.592 1.00 0.00 C ATOM 212 H ALA A 14 -7.702 -12.131 -3.748 1.00 0.00 H ATOM 213 HA ALA A 14 -8.135 -9.702 -5.128 1.00 0.00 H ATOM 214 HB1 ALA A 14 -8.722 -12.333 -5.613 1.00 0.00 H ATOM 215 HB2 ALA A 14 -10.317 -11.646 -5.304 1.00 0.00 H ATOM 216 HB3 ALA A 14 -9.295 -10.969 -6.573 1.00 0.00 H ATOM 217 N VAL A 15 -10.441 -10.578 -2.928 1.00 0.00 N ATOM 218 CA VAL A 15 -11.492 -10.070 -2.057 1.00 0.00 C ATOM 219 C VAL A 15 -10.919 -9.030 -1.100 1.00 0.00 C ATOM 220 O VAL A 15 -11.453 -7.934 -0.962 1.00 0.00 O ATOM 221 CB VAL A 15 -12.138 -11.211 -1.244 1.00 0.00 C ATOM 222 CG1 VAL A 15 -13.274 -10.682 -0.375 1.00 0.00 C ATOM 223 CG2 VAL A 15 -12.631 -12.308 -2.173 1.00 0.00 C ATOM 224 H VAL A 15 -10.207 -11.530 -2.887 1.00 0.00 H ATOM 225 HA VAL A 15 -12.254 -9.610 -2.674 1.00 0.00 H ATOM 226 HB VAL A 15 -11.384 -11.634 -0.593 1.00 0.00 H ATOM 227 HG11 VAL A 15 -13.388 -9.620 -0.537 1.00 0.00 H ATOM 228 HG12 VAL A 15 -14.192 -11.188 -0.636 1.00 0.00 H ATOM 229 HG13 VAL A 15 -13.045 -10.864 0.665 1.00 0.00 H ATOM 230 HG21 VAL A 15 -12.094 -12.257 -3.109 1.00 0.00 H ATOM 231 HG22 VAL A 15 -12.463 -13.271 -1.713 1.00 0.00 H ATOM 232 HG23 VAL A 15 -13.688 -12.178 -2.357 1.00 0.00 H ATOM 233 N MET A 16 -9.819 -9.392 -0.453 1.00 0.00 N ATOM 234 CA MET A 16 -9.140 -8.507 0.493 1.00 0.00 C ATOM 235 C MET A 16 -8.741 -7.195 -0.173 1.00 0.00 C ATOM 236 O MET A 16 -8.949 -6.115 0.380 1.00 0.00 O ATOM 237 CB MET A 16 -7.895 -9.192 1.072 1.00 0.00 C ATOM 238 CG MET A 16 -8.116 -9.885 2.413 1.00 0.00 C ATOM 239 SD MET A 16 -9.105 -11.393 2.303 1.00 0.00 S ATOM 240 CE MET A 16 -10.768 -10.736 2.193 1.00 0.00 C ATOM 241 H MET A 16 -9.451 -10.280 -0.618 1.00 0.00 H ATOM 242 HA MET A 16 -9.827 -8.291 1.291 1.00 0.00 H ATOM 243 HB2 MET A 16 -7.550 -9.931 0.369 1.00 0.00 H ATOM 244 HB3 MET A 16 -7.117 -8.456 1.196 1.00 0.00 H ATOM 245 HG2 MET A 16 -7.153 -10.140 2.829 1.00 0.00 H ATOM 246 HG3 MET A 16 -8.615 -9.194 3.078 1.00 0.00 H ATOM 247 HE1 MET A 16 -10.964 -10.112 3.051 1.00 0.00 H ATOM 248 HE2 MET A 16 -10.869 -10.152 1.293 1.00 0.00 H ATOM 249 HE3 MET A 16 -11.474 -11.553 2.173 1.00 0.00 H ATOM 250 N MET A 17 -8.164 -7.301 -1.359 1.00 0.00 N ATOM 251 CA MET A 17 -7.731 -6.127 -2.108 1.00 0.00 C ATOM 252 C MET A 17 -8.927 -5.282 -2.512 1.00 0.00 C ATOM 253 O MET A 17 -8.887 -4.055 -2.428 1.00 0.00 O ATOM 254 CB MET A 17 -6.937 -6.534 -3.355 1.00 0.00 C ATOM 255 CG MET A 17 -5.530 -7.030 -3.057 1.00 0.00 C ATOM 256 SD MET A 17 -4.476 -5.750 -2.349 1.00 0.00 S ATOM 257 CE MET A 17 -4.498 -4.524 -3.654 1.00 0.00 C ATOM 258 H MET A 17 -8.030 -8.189 -1.738 1.00 0.00 H ATOM 259 HA MET A 17 -7.091 -5.540 -1.462 1.00 0.00 H ATOM 260 HB2 MET A 17 -7.472 -7.320 -3.868 1.00 0.00 H ATOM 261 HB3 MET A 17 -6.862 -5.679 -4.009 1.00 0.00 H ATOM 262 HG2 MET A 17 -5.589 -7.848 -2.356 1.00 0.00 H ATOM 263 HG3 MET A 17 -5.083 -7.377 -3.976 1.00 0.00 H ATOM 264 HE1 MET A 17 -5.119 -4.873 -4.466 1.00 0.00 H ATOM 265 HE2 MET A 17 -4.897 -3.597 -3.269 1.00 0.00 H ATOM 266 HE3 MET A 17 -3.494 -4.362 -4.014 1.00 0.00 H ATOM 267 N GLY A 18 -9.997 -5.945 -2.943 1.00 0.00 N ATOM 268 CA GLY A 18 -11.193 -5.236 -3.349 1.00 0.00 C ATOM 269 C GLY A 18 -11.865 -4.552 -2.182 1.00 0.00 C ATOM 270 O GLY A 18 -12.107 -3.348 -2.216 1.00 0.00 O ATOM 271 H GLY A 18 -9.975 -6.924 -2.979 1.00 0.00 H ATOM 272 HA2 GLY A 18 -10.926 -4.490 -4.086 1.00 0.00 H ATOM 273 HA3 GLY A 18 -11.886 -5.936 -3.792 1.00 0.00 H ATOM 274 N LEU A 19 -12.160 -5.320 -1.139 1.00 0.00 N ATOM 275 CA LEU A 19 -12.800 -4.779 0.050 1.00 0.00 C ATOM 276 C LEU A 19 -11.921 -3.696 0.651 1.00 0.00 C ATOM 277 O LEU A 19 -12.401 -2.633 1.048 1.00 0.00 O ATOM 278 CB LEU A 19 -13.055 -5.893 1.069 1.00 0.00 C ATOM 279 CG LEU A 19 -11.813 -6.445 1.774 1.00 0.00 C ATOM 280 CD1 LEU A 19 -11.425 -5.573 2.962 1.00 0.00 C ATOM 281 CD2 LEU A 19 -12.051 -7.877 2.222 1.00 0.00 C ATOM 282 H LEU A 19 -11.935 -6.271 -1.167 1.00 0.00 H ATOM 283 HA LEU A 19 -13.743 -4.344 -0.246 1.00 0.00 H ATOM 284 HB2 LEU A 19 -13.731 -5.517 1.821 1.00 0.00 H ATOM 285 HB3 LEU A 19 -13.537 -6.712 0.554 1.00 0.00 H ATOM 286 HG LEU A 19 -10.987 -6.443 1.078 1.00 0.00 H ATOM 287 HD11 LEU A 19 -11.715 -4.552 2.777 1.00 0.00 H ATOM 288 HD12 LEU A 19 -11.926 -5.934 3.848 1.00 0.00 H ATOM 289 HD13 LEU A 19 -10.356 -5.624 3.111 1.00 0.00 H ATOM 290 HD21 LEU A 19 -12.925 -7.916 2.855 1.00 0.00 H ATOM 291 HD22 LEU A 19 -12.204 -8.505 1.357 1.00 0.00 H ATOM 292 HD23 LEU A 19 -11.192 -8.227 2.773 1.00 0.00 H ATOM 293 N ALA A 20 -10.621 -3.967 0.694 1.00 0.00 N ATOM 294 CA ALA A 20 -9.665 -3.012 1.221 1.00 0.00 C ATOM 295 C ALA A 20 -9.561 -1.822 0.285 1.00 0.00 C ATOM 296 O ALA A 20 -9.315 -0.700 0.717 1.00 0.00 O ATOM 297 CB ALA A 20 -8.304 -3.661 1.414 1.00 0.00 C ATOM 298 H ALA A 20 -10.298 -4.824 0.346 1.00 0.00 H ATOM 299 HA ALA A 20 -10.023 -2.674 2.184 1.00 0.00 H ATOM 300 HB1 ALA A 20 -8.405 -4.525 2.053 1.00 0.00 H ATOM 301 HB2 ALA A 20 -7.910 -3.963 0.456 1.00 0.00 H ATOM 302 HB3 ALA A 20 -7.633 -2.949 1.872 1.00 0.00 H ATOM 303 N ALA A 21 -9.770 -2.074 -1.005 1.00 0.00 N ATOM 304 CA ALA A 21 -9.719 -1.013 -2.002 1.00 0.00 C ATOM 305 C ALA A 21 -10.879 -0.061 -1.801 1.00 0.00 C ATOM 306 O ALA A 21 -10.722 1.155 -1.872 1.00 0.00 O ATOM 307 CB ALA A 21 -9.736 -1.587 -3.413 1.00 0.00 C ATOM 308 H ALA A 21 -9.976 -2.991 -1.288 1.00 0.00 H ATOM 309 HA ALA A 21 -8.801 -0.470 -1.865 1.00 0.00 H ATOM 310 HB1 ALA A 21 -10.091 -2.605 -3.385 1.00 0.00 H ATOM 311 HB2 ALA A 21 -10.395 -0.997 -4.033 1.00 0.00 H ATOM 312 HB3 ALA A 21 -8.737 -1.564 -3.824 1.00 0.00 H ATOM 313 N ILE A 22 -12.039 -0.633 -1.528 1.00 0.00 N ATOM 314 CA ILE A 22 -13.239 0.151 -1.290 1.00 0.00 C ATOM 315 C ILE A 22 -13.069 0.991 -0.032 1.00 0.00 C ATOM 316 O ILE A 22 -13.180 2.212 -0.073 1.00 0.00 O ATOM 317 CB ILE A 22 -14.483 -0.745 -1.145 1.00 0.00 C ATOM 318 CG1 ILE A 22 -14.648 -1.621 -2.386 1.00 0.00 C ATOM 319 CG2 ILE A 22 -15.728 0.103 -0.924 1.00 0.00 C ATOM 320 CD1 ILE A 22 -15.789 -2.609 -2.282 1.00 0.00 C ATOM 321 H ILE A 22 -12.081 -1.608 -1.471 1.00 0.00 H ATOM 322 HA ILE A 22 -13.388 0.805 -2.134 1.00 0.00 H ATOM 323 HB ILE A 22 -14.346 -1.373 -0.282 1.00 0.00 H ATOM 324 HG12 ILE A 22 -14.834 -0.991 -3.241 1.00 0.00 H ATOM 325 HG13 ILE A 22 -13.740 -2.178 -2.547 1.00 0.00 H ATOM 326 HG21 ILE A 22 -15.554 1.101 -1.298 1.00 0.00 H ATOM 327 HG22 ILE A 22 -16.562 -0.339 -1.449 1.00 0.00 H ATOM 328 HG23 ILE A 22 -15.950 0.148 0.132 1.00 0.00 H ATOM 329 HD11 ILE A 22 -16.609 -2.156 -1.744 1.00 0.00 H ATOM 330 HD12 ILE A 22 -16.118 -2.885 -3.273 1.00 0.00 H ATOM 331 HD13 ILE A 22 -15.455 -3.490 -1.754 1.00 0.00 H ATOM 332 N GLY A 23 -12.778 0.328 1.086 1.00 0.00 N ATOM 333 CA GLY A 23 -12.579 1.042 2.334 1.00 0.00 C ATOM 334 C GLY A 23 -11.423 2.016 2.236 1.00 0.00 C ATOM 335 O GLY A 23 -11.520 3.163 2.682 1.00 0.00 O ATOM 336 H GLY A 23 -12.687 -0.647 1.059 1.00 0.00 H ATOM 337 HA2 GLY A 23 -13.481 1.586 2.578 1.00 0.00 H ATOM 338 HA3 GLY A 23 -12.372 0.330 3.119 1.00 0.00 H ATOM 339 N ALA A 24 -10.331 1.558 1.633 1.00 0.00 N ATOM 340 CA ALA A 24 -9.150 2.389 1.454 1.00 0.00 C ATOM 341 C ALA A 24 -9.490 3.608 0.616 1.00 0.00 C ATOM 342 O ALA A 24 -9.097 4.723 0.949 1.00 0.00 O ATOM 343 CB ALA A 24 -8.030 1.598 0.796 1.00 0.00 C ATOM 344 H ALA A 24 -10.325 0.641 1.290 1.00 0.00 H ATOM 345 HA ALA A 24 -8.814 2.711 2.428 1.00 0.00 H ATOM 346 HB1 ALA A 24 -8.401 1.131 -0.104 1.00 0.00 H ATOM 347 HB2 ALA A 24 -7.218 2.263 0.545 1.00 0.00 H ATOM 348 HB3 ALA A 24 -7.677 0.838 1.477 1.00 0.00 H ATOM 349 N ALA A 25 -10.223 3.383 -0.474 1.00 0.00 N ATOM 350 CA ALA A 25 -10.625 4.465 -1.363 1.00 0.00 C ATOM 351 C ALA A 25 -11.476 5.478 -0.613 1.00 0.00 C ATOM 352 O ALA A 25 -11.255 6.687 -0.704 1.00 0.00 O ATOM 353 CB ALA A 25 -11.388 3.922 -2.563 1.00 0.00 C ATOM 354 H ALA A 25 -10.499 2.464 -0.681 1.00 0.00 H ATOM 355 HA ALA A 25 -9.732 4.951 -1.723 1.00 0.00 H ATOM 356 HB1 ALA A 25 -11.757 2.934 -2.339 1.00 0.00 H ATOM 357 HB2 ALA A 25 -12.220 4.573 -2.785 1.00 0.00 H ATOM 358 HB3 ALA A 25 -10.729 3.877 -3.418 1.00 0.00 H ATOM 359 N ILE A 26 -12.446 4.972 0.138 1.00 0.00 N ATOM 360 CA ILE A 26 -13.334 5.821 0.913 1.00 0.00 C ATOM 361 C ILE A 26 -12.553 6.746 1.840 1.00 0.00 C ATOM 362 O ILE A 26 -12.723 7.959 1.794 1.00 0.00 O ATOM 363 CB ILE A 26 -14.329 4.989 1.733 1.00 0.00 C ATOM 364 CG1 ILE A 26 -15.229 4.203 0.788 1.00 0.00 C ATOM 365 CG2 ILE A 26 -15.162 5.877 2.653 1.00 0.00 C ATOM 366 CD1 ILE A 26 -15.985 5.065 -0.199 1.00 0.00 C ATOM 367 H ILE A 26 -12.565 3.999 0.173 1.00 0.00 H ATOM 368 HA ILE A 26 -13.906 6.414 0.223 1.00 0.00 H ATOM 369 HB ILE A 26 -13.770 4.300 2.344 1.00 0.00 H ATOM 370 HG12 ILE A 26 -14.631 3.508 0.228 1.00 0.00 H ATOM 371 HG13 ILE A 26 -15.947 3.666 1.370 1.00 0.00 H ATOM 372 HG21 ILE A 26 -14.936 6.914 2.456 1.00 0.00 H ATOM 373 HG22 ILE A 26 -16.212 5.696 2.474 1.00 0.00 H ATOM 374 HG23 ILE A 26 -14.928 5.646 3.682 1.00 0.00 H ATOM 375 HD11 ILE A 26 -15.767 6.107 -0.011 1.00 0.00 H ATOM 376 HD12 ILE A 26 -15.682 4.810 -1.204 1.00 0.00 H ATOM 377 HD13 ILE A 26 -17.045 4.895 -0.088 1.00 0.00 H ATOM 378 N GLY A 27 -11.707 6.168 2.688 1.00 0.00 N ATOM 379 CA GLY A 27 -10.935 6.978 3.618 1.00 0.00 C ATOM 380 C GLY A 27 -9.935 7.882 2.930 1.00 0.00 C ATOM 381 O GLY A 27 -9.869 9.072 3.237 1.00 0.00 O ATOM 382 H GLY A 27 -11.613 5.191 2.692 1.00 0.00 H ATOM 383 HA2 GLY A 27 -11.618 7.592 4.185 1.00 0.00 H ATOM 384 HA3 GLY A 27 -10.412 6.336 4.300 1.00 0.00 H ATOM 385 N ILE A 28 -9.149 7.337 1.998 1.00 0.00 N ATOM 386 CA ILE A 28 -8.172 8.154 1.293 1.00 0.00 C ATOM 387 C ILE A 28 -8.846 9.409 0.778 1.00 0.00 C ATOM 388 O ILE A 28 -8.359 10.515 0.969 1.00 0.00 O ATOM 389 CB ILE A 28 -7.501 7.414 0.124 1.00 0.00 C ATOM 390 CG1 ILE A 28 -8.525 6.876 -0.867 1.00 0.00 C ATOM 391 CG2 ILE A 28 -6.625 6.286 0.641 1.00 0.00 C ATOM 392 CD1 ILE A 28 -7.891 6.260 -2.098 1.00 0.00 C ATOM 393 H ILE A 28 -9.233 6.388 1.780 1.00 0.00 H ATOM 394 HA ILE A 28 -7.410 8.438 2.001 1.00 0.00 H ATOM 395 HB ILE A 28 -6.877 8.116 -0.384 1.00 0.00 H ATOM 396 HG12 ILE A 28 -9.114 6.119 -0.382 1.00 0.00 H ATOM 397 HG13 ILE A 28 -9.165 7.679 -1.194 1.00 0.00 H ATOM 398 HG21 ILE A 28 -7.048 5.894 1.555 1.00 0.00 H ATOM 399 HG22 ILE A 28 -6.578 5.500 -0.098 1.00 0.00 H ATOM 400 HG23 ILE A 28 -5.631 6.658 0.834 1.00 0.00 H ATOM 401 HD11 ILE A 28 -6.988 6.797 -2.346 1.00 0.00 H ATOM 402 HD12 ILE A 28 -7.651 5.225 -1.900 1.00 0.00 H ATOM 403 HD13 ILE A 28 -8.583 6.316 -2.925 1.00 0.00 H ATOM 404 N GLY A 29 -9.998 9.216 0.167 1.00 0.00 N ATOM 405 CA GLY A 29 -10.769 10.333 -0.332 1.00 0.00 C ATOM 406 C GLY A 29 -11.261 11.208 0.804 1.00 0.00 C ATOM 407 O GLY A 29 -11.302 12.432 0.686 1.00 0.00 O ATOM 408 H GLY A 29 -10.338 8.304 0.080 1.00 0.00 H ATOM 409 HA2 GLY A 29 -10.152 10.924 -0.994 1.00 0.00 H ATOM 410 HA3 GLY A 29 -11.621 9.959 -0.882 1.00 0.00 H ATOM 411 N ILE A 30 -11.622 10.571 1.921 1.00 0.00 N ATOM 412 CA ILE A 30 -12.097 11.293 3.098 1.00 0.00 C ATOM 413 C ILE A 30 -11.030 12.263 3.603 1.00 0.00 C ATOM 414 O ILE A 30 -11.163 13.478 3.460 1.00 0.00 O ATOM 415 CB ILE A 30 -12.498 10.317 4.235 1.00 0.00 C ATOM 416 CG1 ILE A 30 -13.755 9.545 3.847 1.00 0.00 C ATOM 417 CG2 ILE A 30 -12.733 11.070 5.539 1.00 0.00 C ATOM 418 CD1 ILE A 30 -14.119 8.454 4.830 1.00 0.00 C ATOM 419 H ILE A 30 -11.553 9.592 1.957 1.00 0.00 H ATOM 420 HA ILE A 30 -12.974 11.856 2.810 1.00 0.00 H ATOM 421 HB ILE A 30 -11.687 9.609 4.391 1.00 0.00 H ATOM 422 HG12 ILE A 30 -14.588 10.232 3.792 1.00 0.00 H ATOM 423 HG13 ILE A 30 -13.607 9.092 2.883 1.00 0.00 H ATOM 424 HG21 ILE A 30 -13.381 11.914 5.354 1.00 0.00 H ATOM 425 HG22 ILE A 30 -13.196 10.410 6.257 1.00 0.00 H ATOM 426 HG23 ILE A 30 -11.789 11.420 5.928 1.00 0.00 H ATOM 427 HD11 ILE A 30 -13.228 8.119 5.340 1.00 0.00 H ATOM 428 HD12 ILE A 30 -14.823 8.840 5.553 1.00 0.00 H ATOM 429 HD13 ILE A 30 -14.564 7.625 4.301 1.00 0.00 H ATOM 430 N LEU A 31 -9.970 11.713 4.185 1.00 0.00 N ATOM 431 CA LEU A 31 -8.873 12.517 4.709 1.00 0.00 C ATOM 432 C LEU A 31 -8.115 13.181 3.565 1.00 0.00 C ATOM 433 O LEU A 31 -7.579 14.279 3.710 1.00 0.00 O ATOM 434 CB LEU A 31 -7.936 11.627 5.534 1.00 0.00 C ATOM 435 CG LEU A 31 -6.876 12.356 6.365 1.00 0.00 C ATOM 436 CD1 LEU A 31 -6.193 11.389 7.323 1.00 0.00 C ATOM 437 CD2 LEU A 31 -5.849 13.020 5.464 1.00 0.00 C ATOM 438 H LEU A 31 -9.922 10.737 4.261 1.00 0.00 H ATOM 439 HA LEU A 31 -9.290 13.288 5.349 1.00 0.00 H ATOM 440 HB2 LEU A 31 -8.540 11.035 6.204 1.00 0.00 H ATOM 441 HB3 LEU A 31 -7.427 10.958 4.856 1.00 0.00 H ATOM 442 HG LEU A 31 -7.356 13.125 6.953 1.00 0.00 H ATOM 443 HD11 LEU A 31 -6.676 10.425 7.268 1.00 0.00 H ATOM 444 HD12 LEU A 31 -5.153 11.284 7.049 1.00 0.00 H ATOM 445 HD13 LEU A 31 -6.264 11.770 8.330 1.00 0.00 H ATOM 446 HD21 LEU A 31 -5.789 12.484 4.528 1.00 0.00 H ATOM 447 HD22 LEU A 31 -6.146 14.037 5.278 1.00 0.00 H ATOM 448 HD23 LEU A 31 -4.885 13.009 5.949 1.00 0.00 H ATOM 449 N GLY A 32 -8.086 12.511 2.418 1.00 0.00 N ATOM 450 CA GLY A 32 -7.403 13.056 1.261 1.00 0.00 C ATOM 451 C GLY A 32 -7.979 14.387 0.839 1.00 0.00 C ATOM 452 O GLY A 32 -7.243 15.335 0.609 1.00 0.00 O ATOM 453 H GLY A 32 -8.539 11.644 2.355 1.00 0.00 H ATOM 454 HA2 GLY A 32 -6.357 13.186 1.502 1.00 0.00 H ATOM 455 HA3 GLY A 32 -7.487 12.363 0.436 1.00 0.00 H ATOM 456 N GLY A 33 -9.300 14.461 0.736 1.00 0.00 N ATOM 457 CA GLY A 33 -9.936 15.702 0.338 1.00 0.00 C ATOM 458 C GLY A 33 -9.627 16.839 1.293 1.00 0.00 C ATOM 459 O GLY A 33 -9.210 17.916 0.872 1.00 0.00 O ATOM 460 H GLY A 33 -9.845 13.672 0.932 1.00 0.00 H ATOM 461 HA2 GLY A 33 -9.589 15.971 -0.651 1.00 0.00 H ATOM 462 HA3 GLY A 33 -11.006 15.554 0.306 1.00 0.00 H ATOM 463 N LYS A 34 -9.835 16.595 2.583 1.00 0.00 N ATOM 464 CA LYS A 34 -9.585 17.602 3.609 1.00 0.00 C ATOM 465 C LYS A 34 -8.120 18.041 3.624 1.00 0.00 C ATOM 466 O LYS A 34 -7.815 19.234 3.536 1.00 0.00 O ATOM 467 CB LYS A 34 -9.998 17.060 4.986 1.00 0.00 C ATOM 468 CG LYS A 34 -9.270 15.796 5.404 1.00 0.00 C ATOM 469 CD LYS A 34 -9.809 15.252 6.718 1.00 0.00 C ATOM 470 CE LYS A 34 -11.265 14.835 6.595 1.00 0.00 C ATOM 471 NZ LYS A 34 -11.793 14.278 7.871 1.00 0.00 N ATOM 472 H LYS A 34 -10.170 15.714 2.852 1.00 0.00 H ATOM 473 HA LYS A 34 -10.196 18.461 3.377 1.00 0.00 H ATOM 474 HB2 LYS A 34 -9.803 17.812 5.729 1.00 0.00 H ATOM 475 HB3 LYS A 34 -11.056 16.849 4.971 1.00 0.00 H ATOM 476 HG2 LYS A 34 -9.395 15.050 4.636 1.00 0.00 H ATOM 477 HG3 LYS A 34 -8.221 16.021 5.526 1.00 0.00 H ATOM 478 HD2 LYS A 34 -9.223 14.393 7.008 1.00 0.00 H ATOM 479 HD3 LYS A 34 -9.725 16.018 7.475 1.00 0.00 H ATOM 480 HE2 LYS A 34 -11.853 15.698 6.321 1.00 0.00 H ATOM 481 HE3 LYS A 34 -11.348 14.084 5.823 1.00 0.00 H ATOM 482 HZ1 LYS A 34 -11.039 13.770 8.379 1.00 0.00 H ATOM 483 HZ2 LYS A 34 -12.146 15.046 8.477 1.00 0.00 H ATOM 484 HZ3 LYS A 34 -12.571 13.615 7.678 1.00 0.00 H ATOM 485 N PHE A 35 -7.215 17.074 3.734 1.00 0.00 N ATOM 486 CA PHE A 35 -5.784 17.362 3.769 1.00 0.00 C ATOM 487 C PHE A 35 -5.338 17.978 2.453 1.00 0.00 C ATOM 488 O PHE A 35 -4.653 19.001 2.426 1.00 0.00 O ATOM 489 CB PHE A 35 -5.008 16.075 4.033 1.00 0.00 C ATOM 490 CG PHE A 35 -3.624 16.305 4.565 1.00 0.00 C ATOM 491 CD1 PHE A 35 -3.430 16.941 5.780 1.00 0.00 C ATOM 492 CD2 PHE A 35 -2.518 15.899 3.844 1.00 0.00 C ATOM 493 CE1 PHE A 35 -2.156 17.169 6.259 1.00 0.00 C ATOM 494 CE2 PHE A 35 -1.244 16.121 4.320 1.00 0.00 C ATOM 495 CZ PHE A 35 -1.063 16.758 5.528 1.00 0.00 C ATOM 496 H PHE A 35 -7.514 16.145 3.796 1.00 0.00 H ATOM 497 HA PHE A 35 -5.596 18.065 4.574 1.00 0.00 H ATOM 498 HB2 PHE A 35 -5.548 15.486 4.748 1.00 0.00 H ATOM 499 HB3 PHE A 35 -4.921 15.519 3.110 1.00 0.00 H ATOM 500 HD1 PHE A 35 -4.287 17.263 6.352 1.00 0.00 H ATOM 501 HD2 PHE A 35 -2.660 15.398 2.901 1.00 0.00 H ATOM 502 HE1 PHE A 35 -2.017 17.668 7.207 1.00 0.00 H ATOM 503 HE2 PHE A 35 -0.389 15.798 3.746 1.00 0.00 H ATOM 504 HZ PHE A 35 -0.064 16.936 5.901 1.00 0.00 H ATOM 505 N LEU A 36 -5.744 17.345 1.362 1.00 0.00 N ATOM 506 CA LEU A 36 -5.407 17.821 0.024 1.00 0.00 C ATOM 507 C LEU A 36 -5.964 19.225 -0.178 1.00 0.00 C ATOM 508 O LEU A 36 -5.325 20.076 -0.794 1.00 0.00 O ATOM 509 CB LEU A 36 -5.962 16.861 -1.036 1.00 0.00 C ATOM 510 CG LEU A 36 -5.384 17.006 -2.447 1.00 0.00 C ATOM 511 CD1 LEU A 36 -5.777 18.336 -3.075 1.00 0.00 C ATOM 512 CD2 LEU A 36 -3.870 16.853 -2.415 1.00 0.00 C ATOM 513 H LEU A 36 -6.288 16.538 1.462 1.00 0.00 H ATOM 514 HA LEU A 36 -4.333 17.855 -0.059 1.00 0.00 H ATOM 515 HB2 LEU A 36 -5.773 15.854 -0.703 1.00 0.00 H ATOM 516 HB3 LEU A 36 -7.031 17.007 -1.094 1.00 0.00 H ATOM 517 HG LEU A 36 -5.783 16.219 -3.070 1.00 0.00 H ATOM 518 HD11 LEU A 36 -6.480 18.846 -2.436 1.00 0.00 H ATOM 519 HD12 LEU A 36 -4.898 18.946 -3.205 1.00 0.00 H ATOM 520 HD13 LEU A 36 -6.234 18.156 -4.037 1.00 0.00 H ATOM 521 HD21 LEU A 36 -3.601 16.105 -1.683 1.00 0.00 H ATOM 522 HD22 LEU A 36 -3.519 16.546 -3.388 1.00 0.00 H ATOM 523 HD23 LEU A 36 -3.418 17.797 -2.149 1.00 0.00 H ATOM 524 N GLU A 37 -7.156 19.463 0.364 1.00 0.00 N ATOM 525 CA GLU A 37 -7.798 20.768 0.254 1.00 0.00 C ATOM 526 C GLU A 37 -6.943 21.848 0.909 1.00 0.00 C ATOM 527 O GLU A 37 -6.589 22.844 0.275 1.00 0.00 O ATOM 528 CB GLU A 37 -9.183 20.733 0.908 1.00 0.00 C ATOM 529 CG GLU A 37 -9.926 22.057 0.836 1.00 0.00 C ATOM 530 CD GLU A 37 -11.300 21.990 1.478 1.00 0.00 C ATOM 531 OE1 GLU A 37 -11.674 20.906 1.975 1.00 0.00 O ATOM 532 OE2 GLU A 37 -12.003 23.023 1.484 1.00 0.00 O ATOM 533 H GLU A 37 -7.611 18.747 0.855 1.00 0.00 H ATOM 534 HA GLU A 37 -7.910 20.997 -0.795 1.00 0.00 H ATOM 535 HB2 GLU A 37 -9.782 19.984 0.415 1.00 0.00 H ATOM 536 HB3 GLU A 37 -9.071 20.465 1.948 1.00 0.00 H ATOM 537 HG2 GLU A 37 -9.345 22.810 1.345 1.00 0.00 H ATOM 538 HG3 GLU A 37 -10.044 22.333 -0.201 1.00 0.00 H ATOM 539 N GLY A 38 -6.611 21.643 2.179 1.00 0.00 N ATOM 540 CA GLY A 38 -5.796 22.610 2.899 1.00 0.00 C ATOM 541 C GLY A 38 -4.452 22.831 2.233 1.00 0.00 C ATOM 542 O GLY A 38 -4.091 23.961 1.889 1.00 0.00 O ATOM 543 H GLY A 38 -6.918 20.827 2.630 1.00 0.00 H ATOM 544 HA2 GLY A 38 -6.326 23.552 2.941 1.00 0.00 H ATOM 545 HA3 GLY A 38 -5.634 22.254 3.906 1.00 0.00 H ATOM 546 N ALA A 39 -3.711 21.747 2.044 1.00 0.00 N ATOM 547 CA ALA A 39 -2.407 21.820 1.407 1.00 0.00 C ATOM 548 C ALA A 39 -2.520 22.476 0.043 1.00 0.00 C ATOM 549 O ALA A 39 -1.765 23.387 -0.292 1.00 0.00 O ATOM 550 CB ALA A 39 -1.815 20.432 1.268 1.00 0.00 C ATOM 551 H ALA A 39 -4.055 20.876 2.334 1.00 0.00 H ATOM 552 HA ALA A 39 -1.757 22.409 2.030 1.00 0.00 H ATOM 553 HB1 ALA A 39 -1.783 19.953 2.235 1.00 0.00 H ATOM 554 HB2 ALA A 39 -2.430 19.853 0.600 1.00 0.00 H ATOM 555 HB3 ALA A 39 -0.816 20.503 0.865 1.00 0.00 H ATOM 556 N ALA A 40 -3.484 22.016 -0.735 1.00 0.00 N ATOM 557 CA ALA A 40 -3.704 22.570 -2.058 1.00 0.00 C ATOM 558 C ALA A 40 -4.275 23.973 -1.961 1.00 0.00 C ATOM 559 O ALA A 40 -4.236 24.737 -2.928 1.00 0.00 O ATOM 560 CB ALA A 40 -4.603 21.654 -2.860 1.00 0.00 C ATOM 561 H ALA A 40 -4.068 21.297 -0.409 1.00 0.00 H ATOM 562 HA ALA A 40 -2.748 22.623 -2.557 1.00 0.00 H ATOM 563 HB1 ALA A 40 -4.310 20.630 -2.677 1.00 0.00 H ATOM 564 HB2 ALA A 40 -5.628 21.796 -2.557 1.00 0.00 H ATOM 565 HB3 ALA A 40 -4.499 21.876 -3.911 1.00 0.00 H