>>1DIZ:HELIX   15  15 THR A  197  GLU A  258  1                                  62    
TIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 15 15 THR A 197 GLU A 258 1 62 ATOM 2511 N THR A 197 -3.534 40.481 116.656 1.00 40.38 N ATOM 2512 CA THR A 197 -4.080 39.575 117.656 1.00 40.58 C ATOM 2513 C THR A 197 -4.778 40.437 118.697 1.00 40.40 C ATOM 2514 O THR A 197 -4.474 41.626 118.824 1.00 40.19 O ATOM 2515 CB THR A 197 -2.954 38.726 118.312 1.00 41.52 C ATOM 2516 OG1 THR A 197 -3.413 38.199 119.564 1.00 42.82 O ATOM 2517 CG2 THR A 197 -1.691 39.572 118.536 1.00 41.25 C ATOM 2518 N ILE A 198 -5.718 39.846 119.429 1.00 40.38 N ATOM 2519 CA ILE A 198 -6.478 40.582 120.432 1.00 40.12 C ATOM 2520 C ILE A 198 -5.583 41.282 121.455 1.00 41.15 C ATOM 2521 O ILE A 198 -4.684 40.676 122.040 1.00 41.26 O ATOM 2522 CB ILE A 198 -7.487 39.642 121.172 1.00 39.60 C ATOM 2523 CG1 ILE A 198 -8.580 40.464 121.859 1.00 38.64 C ATOM 2524 CG2 ILE A 198 -6.765 38.787 122.212 1.00 39.92 C ATOM 2525 CD1 ILE A 198 -9.646 39.613 122.529 1.00 36.60 C ATOM 2526 N PRO A 199 -5.794 42.590 121.645 1.00 41.76 N ATOM 2527 CA PRO A 199 -5.027 43.398 122.596 1.00 42.34 C ATOM 2528 C PRO A 199 -5.638 43.387 124.002 1.00 43.50 C ATOM 2529 O PRO A 199 -6.765 42.925 124.192 1.00 44.21 O ATOM 2530 CB PRO A 199 -5.044 44.784 121.957 1.00 42.30 C ATOM 2531 CG PRO A 199 -6.366 44.805 121.250 1.00 42.44 C ATOM 2532 CD PRO A 199 -6.439 43.442 120.628 1.00 41.89 C ATOM 2533 N GLY A 200 -4.899 43.898 124.985 1.00 43.64 N ATOM 2534 CA GLY A 200 -5.401 43.917 126.352 1.00 44.53 C ATOM 2535 C GLY A 200 -6.620 44.785 126.625 1.00 44.79 C ATOM 2536 O GLY A 200 -7.420 44.484 127.510 1.00 44.79 O ATOM 2537 N ASP A 201 -6.765 45.873 125.881 1.00 45.82 N ATOM 2538 CA ASP A 201 -7.900 46.779 126.053 1.00 46.71 C ATOM 2539 C ASP A 201 -8.654 46.854 124.719 1.00 46.74 C ATOM 2540 O ASP A 201 -8.500 47.810 123.956 1.00 46.53 O ATOM 2541 CB ASP A 201 -7.392 48.171 126.449 1.00 48.21 C ATOM 2542 CG ASP A 201 -8.512 49.121 126.866 1.00 50.02 C ATOM 2543 OD1 ASP A 201 -9.601 49.099 126.245 1.00 50.43 O ATOM 2544 OD2 ASP A 201 -8.285 49.911 127.811 1.00 51.04 O ATOM 2545 N VAL A 202 -9.464 45.835 124.443 1.00 46.90 N ATOM 2546 CA VAL A 202 -10.228 45.782 123.203 1.00 46.81 C ATOM 2547 C VAL A 202 -10.954 47.089 122.910 1.00 46.93 C ATOM 2548 O VAL A 202 -10.916 47.600 121.792 1.00 46.75 O ATOM 2549 CB VAL A 202 -11.261 44.651 123.240 1.00 46.58 C ATOM 2550 CG1 VAL A 202 -12.024 44.609 121.928 1.00 47.10 C ATOM 2551 CG2 VAL A 202 -10.571 43.331 123.492 1.00 47.27 C ATOM 2552 N GLU A 203 -11.615 47.624 123.923 1.00 47.42 N ATOM 2553 CA GLU A 203 -12.352 48.867 123.774 1.00 48.17 C ATOM 2554 C GLU A 203 -11.436 49.978 123.260 1.00 47.41 C ATOM 2555 O GLU A 203 -11.729 50.626 122.255 1.00 47.31 O ATOM 2556 CB GLU A 203 -12.961 49.280 125.118 1.00 50.30 C ATOM 2557 CG GLU A 203 -13.686 48.161 125.868 1.00 53.68 C ATOM 2558 CD GLU A 203 -12.740 47.204 126.599 1.00 55.40 C ATOM 2559 OE1 GLU A 203 -13.233 46.345 127.361 1.00 56.41 O ATOM 2560 OE2 GLU A 203 -11.510 47.308 126.419 1.00 55.89 O ATOM 2561 N GLN A 204 -10.323 50.190 123.950 1.00 46.56 N ATOM 2562 CA GLN A 204 -9.381 51.227 123.554 1.00 46.36 C ATOM 2563 C GLN A 204 -8.854 50.950 122.141 1.00 45.49 C ATOM 2564 O GLN A 204 -8.648 51.863 121.344 1.00 44.93 O ATOM 2565 CB GLN A 204 -8.213 51.280 124.551 1.00 47.04 C ATOM 2566 CG GLN A 204 -7.700 52.682 124.862 1.00 48.30 C ATOM 2567 CD GLN A 204 -7.478 53.521 123.620 1.00 49.00 C ATOM 2568 OE1 GLN A 204 -8.396 54.152 123.116 1.00 49.24 O ATOM 2569 NE2 GLN A 204 -6.250 53.516 123.110 1.00 49.98 N ATOM 2570 N ALA A 205 -8.641 49.674 121.847 1.00 45.00 N ATOM 2571 CA ALA A 205 -8.136 49.255 120.547 1.00 44.63 C ATOM 2572 C ALA A 205 -9.114 49.633 119.450 1.00 44.05 C ATOM 2573 O ALA A 205 -8.726 50.210 118.437 1.00 43.91 O ATOM 2574 CB ALA A 205 -7.905 47.752 120.538 1.00 44.28 C ATOM 2575 N MET A 206 -10.383 49.296 119.658 1.00 43.54 N ATOM 2576 CA MET A 206 -11.424 49.606 118.684 1.00 43.21 C ATOM 2577 C MET A 206 -11.506 51.113 118.479 1.00 43.03 C ATOM 2578 O MET A 206 -11.616 51.605 117.350 1.00 42.64 O ATOM 2579 CB MET A 206 -12.774 49.075 119.169 1.00 42.38 C ATOM 2580 CG MET A 206 -12.844 47.562 119.271 1.00 41.82 C ATOM 2581 SD MET A 206 -14.529 46.951 119.508 1.00 41.05 S ATOM 2582 CE MET A 206 -14.616 46.771 121.296 1.00 40.62 C ATOM 2583 N LYS A 207 -11.441 51.837 119.589 1.00 42.80 N ATOM 2584 CA LYS A 207 -11.507 53.289 119.579 1.00 42.68 C ATOM 2585 C LYS A 207 -10.456 53.860 118.634 1.00 41.99 C ATOM 2586 O LYS A 207 -10.704 54.841 117.933 1.00 41.64 O ATOM 2587 CB LYS A 207 -11.287 53.821 121.002 1.00 43.58 C ATOM 2588 CG LYS A 207 -11.564 55.294 121.175 1.00 43.64 C ATOM 2589 CD LYS A 207 -11.299 55.740 122.604 1.00 44.04 C ATOM 2590 CE LYS A 207 -11.803 57.157 122.802 1.00 44.29 C ATOM 2591 NZ LYS A 207 -11.405 58.034 121.659 1.00 44.40 N ATOM 2592 N THR A 208 -9.283 53.238 118.613 1.00 41.70 N ATOM 2593 CA THR A 208 -8.200 53.698 117.750 1.00 41.38 C ATOM 2594 C THR A 208 -8.393 53.237 116.313 1.00 40.78 C ATOM 2595 O THR A 208 -8.074 53.975 115.376 1.00 40.72 O ATOM 2596 CB THR A 208 -6.838 53.217 118.271 1.00 41.87 C ATOM 2597 OG1 THR A 208 -6.611 53.790 119.568 1.00 42.66 O ATOM 2598 CG2 THR A 208 -5.706 53.629 117.304 1.00 41.50 C ATOM 2599 N LEU A 209 -8.904 52.020 116.136 1.00 40.00 N ATOM 2600 CA LEU A 209 -9.168 51.518 114.797 1.00 40.54 C ATOM 2601 C LEU A 209 -10.228 52.430 114.169 1.00 40.20 C ATOM 2602 O LEU A 209 -10.304 52.564 112.948 1.00 40.12 O ATOM 2603 CB LEU A 209 -9.681 50.074 114.835 1.00 40.62 C ATOM 2604 CG LEU A 209 -8.768 49.027 114.181 1.00 41.39 C ATOM 2605 CD1 LEU A 209 -9.464 47.659 114.175 1.00 41.31 C ATOM 2606 CD2 LEU A 209 -8.421 49.464 112.751 1.00 41.68 C ATOM 2607 N GLN A 210 -11.039 53.064 115.009 1.00 39.90 N ATOM 2608 CA GLN A 210 -12.063 53.967 114.500 1.00 40.78 C ATOM 2609 C GLN A 210 -11.510 55.308 114.036 1.00 40.66 C ATOM 2610 O GLN A 210 -12.277 56.155 113.605 1.00 41.94 O ATOM 2611 CB GLN A 210 -13.173 54.211 115.538 1.00 40.47 C ATOM 2612 CG GLN A 210 -14.183 53.074 115.645 1.00 41.14 C ATOM 2613 CD GLN A 210 -15.346 53.389 116.570 1.00 41.51 C ATOM 2614 OE1 GLN A 210 -16.046 54.386 116.385 1.00 41.30 O ATOM 2615 NE2 GLN A 210 -15.563 52.534 117.569 1.00 41.82 N ATOM 2616 N THR A 211 -10.201 55.524 114.128 1.00 40.39 N ATOM 2617 CA THR A 211 -9.642 56.798 113.660 1.00 40.48 C ATOM 2618 C THR A 211 -9.148 56.647 112.230 1.00 40.56 C ATOM 2619 O THR A 211 -8.834 57.638 111.567 1.00 41.27 O ATOM 2620 CB THR A 211 -8.447 57.307 114.525 1.00 40.12 C ATOM 2621 OG1 THR A 211 -7.327 56.427 114.375 1.00 39.24 O ATOM 2622 CG2 THR A 211 -8.841 57.395 115.998 1.00 39.34 C ATOM 2623 N PHE A 212 -9.070 55.402 111.766 1.00 40.66 N ATOM 2624 CA PHE A 212 -8.619 55.096 110.403 1.00 40.69 C ATOM 2625 C PHE A 212 -9.701 55.552 109.432 1.00 40.00 C ATOM 2626 O PHE A 212 -10.883 55.558 109.765 1.00 40.20 O ATOM 2627 CB PHE A 212 -8.443 53.581 110.195 1.00 41.46 C ATOM 2628 CG PHE A 212 -7.278 52.966 110.927 1.00 42.16 C ATOM 2629 CD1 PHE A 212 -6.686 53.596 112.020 1.00 42.36 C ATOM 2630 CD2 PHE A 212 -6.803 51.708 110.541 1.00 42.55 C ATOM 2631 CE1 PHE A 212 -5.641 52.982 112.720 1.00 42.67 C ATOM 2632 CE2 PHE A 212 -5.759 51.087 111.238 1.00 42.08 C ATOM 2633 CZ PHE A 212 -5.180 51.726 112.328 1.00 42.12 C ATOM 2634 N PRO A 213 -9.313 55.954 108.222 1.00 39.75 N ATOM 2635 CA PRO A 213 -10.368 56.369 107.300 1.00 39.19 C ATOM 2636 C PRO A 213 -11.200 55.166 106.846 1.00 38.87 C ATOM 2637 O PRO A 213 -10.706 54.033 106.793 1.00 38.90 O ATOM 2638 CB PRO A 213 -9.588 57.021 106.157 1.00 39.25 C ATOM 2639 CG PRO A 213 -8.229 56.378 106.229 1.00 39.13 C ATOM 2640 CD PRO A 213 -7.985 56.336 107.712 1.00 39.72 C ATOM 2641 N GLY A 214 -12.469 55.409 106.544 1.00 38.28 N ATOM 2642 CA GLY A 214 -13.335 54.342 106.086 1.00 37.85 C ATOM 2643 C GLY A 214 -13.715 53.298 107.121 1.00 38.34 C ATOM 2644 O GLY A 214 -14.461 52.367 106.805 1.00 38.42 O ATOM 2645 N ILE A 215 -13.210 53.417 108.346 1.00 37.68 N ATOM 2646 CA ILE A 215 -13.559 52.446 109.381 1.00 37.00 C ATOM 2647 C ILE A 215 -14.349 53.110 110.487 1.00 37.16 C ATOM 2648 O ILE A 215 -13.841 53.993 111.188 1.00 38.09 O ATOM 2649 CB ILE A 215 -12.312 51.787 110.029 1.00 37.11 C ATOM 2650 CG1 ILE A 215 -11.603 50.867 109.029 1.00 37.22 C ATOM 2651 CG2 ILE A 215 -12.729 50.984 111.249 1.00 36.38 C ATOM 2652 CD1 ILE A 215 -10.279 50.314 109.543 1.00 35.78 C ATOM 2653 N GLY A 216 -15.590 52.665 110.650 1.00 36.96 N ATOM 2654 CA GLY A 216 -16.458 53.206 111.677 1.00 36.13 C ATOM 2655 C GLY A 216 -16.755 52.208 112.784 1.00 36.75 C ATOM 2656 O GLY A 216 -16.066 51.192 112.928 1.00 35.88 O ATOM 2657 N ARG A 217 -17.803 52.490 113.559 1.00 36.25 N ATOM 2658 CA ARG A 217 -18.169 51.638 114.678 1.00 35.45 C ATOM 2659 C ARG A 217 -18.537 50.210 114.292 1.00 34.05 C ATOM 2660 O ARG A 217 -18.090 49.256 114.936 1.00 33.94 O ATOM 2661 CB ARG A 217 -19.305 52.275 115.486 1.00 37.00 C ATOM 2662 CG ARG A 217 -19.641 51.482 116.730 1.00 38.61 C ATOM 2663 CD ARG A 217 -19.496 52.278 118.001 1.00 41.14 C ATOM 2664 NE ARG A 217 -20.796 52.805 118.404 1.00 44.40 N ATOM 2665 CZ ARG A 217 -21.149 53.088 119.657 1.00 45.89 C ATOM 2666 NH1 ARG A 217 -20.300 52.898 120.659 1.00 46.19 N ATOM 2667 NH2 ARG A 217 -22.374 53.543 119.916 1.00 46.38 N ATOM 2668 N TRP A 218 -19.354 50.047 113.257 1.00 32.36 N ATOM 2669 CA TRP A 218 -19.734 48.698 112.820 1.00 29.98 C ATOM 2670 C TRP A 218 -18.496 47.883 112.401 1.00 29.45 C ATOM 2671 O TRP A 218 -18.315 46.737 112.819 1.00 28.96 O ATOM 2672 CB TRP A 218 -20.691 48.769 111.638 1.00 28.53 C ATOM 2673 CG TRP A 218 -21.005 47.423 111.066 1.00 26.77 C ATOM 2674 CD1 TRP A 218 -22.001 46.568 111.467 1.00 26.94 C ATOM 2675 CD2 TRP A 218 -20.304 46.756 110.010 1.00 24.94 C ATOM 2676 NE1 TRP A 218 -21.959 45.413 110.721 1.00 26.37 N ATOM 2677 CE2 TRP A 218 -20.930 45.499 109.820 1.00 25.64 C ATOM 2678 CE3 TRP A 218 -19.207 47.094 109.205 1.00 24.28 C ATOM 2679 CZ2 TRP A 218 -20.493 44.573 108.852 1.00 24.14 C ATOM 2680 CZ3 TRP A 218 -18.770 46.170 108.236 1.00 23.30 C ATOM 2681 CH2 TRP A 218 -19.420 44.926 108.074 1.00 23.11 C ATOM 2682 N THR A 219 -17.656 48.483 111.562 1.00 27.91 N ATOM 2683 CA THR A 219 -16.457 47.815 111.082 1.00 27.91 C ATOM 2684 C THR A 219 -15.452 47.435 112.185 1.00 28.51 C ATOM 2685 O THR A 219 -14.930 46.317 112.199 1.00 29.40 O ATOM 2686 CB THR A 219 -15.745 48.689 110.043 1.00 27.25 C ATOM 2687 OG1 THR A 219 -16.643 48.953 108.959 1.00 25.86 O ATOM 2688 CG2 THR A 219 -14.493 47.997 109.536 1.00 25.40 C ATOM 2689 N ALA A 220 -15.179 48.357 113.102 1.00 28.16 N ATOM 2690 CA ALA A 220 -14.239 48.088 114.180 1.00 28.22 C ATOM 2691 C ALA A 220 -14.796 47.021 115.117 1.00 28.69 C ATOM 2692 O ALA A 220 -14.057 46.166 115.610 1.00 29.96 O ATOM 2693 CB ALA A 220 -13.937 49.371 114.957 1.00 26.48 C ATOM 2694 N ASN A 221 -16.095 47.053 115.361 1.00 28.55 N ATOM 2695 CA ASN A 221 -16.682 46.063 116.248 1.00 28.83 C ATOM 2696 C ASN A 221 -16.638 44.709 115.552 1.00 28.39 C ATOM 2697 O ASN A 221 -16.298 43.691 116.158 1.00 27.84 O ATOM 2698 CB ASN A 221 -18.146 46.406 116.579 1.00 29.95 C ATOM 2699 CG ASN A 221 -18.294 47.562 117.591 1.00 32.87 C ATOM 2700 OD1 ASN A 221 -19.422 47.935 117.945 1.00 34.82 O ATOM 2701 ND2 ASN A 221 -17.177 48.127 118.055 1.00 32.33 N ATOM 2702 N TYR A 222 -16.979 44.708 114.270 1.00 27.34 N ATOM 2703 CA TYR A 222 -17.019 43.478 113.507 1.00 26.53 C ATOM 2704 C TYR A 222 -15.626 42.915 113.335 1.00 26.52 C ATOM 2705 O TYR A 222 -15.423 41.692 113.374 1.00 24.79 O ATOM 2706 CB TYR A 222 -17.674 43.722 112.149 1.00 26.58 C ATOM 2707 CG TYR A 222 -17.915 42.461 111.369 1.00 26.63 C ATOM 2708 CD1 TYR A 222 -18.539 41.356 111.962 1.00 26.77 C ATOM 2709 CD2 TYR A 222 -17.519 42.363 110.040 1.00 26.46 C ATOM 2710 CE1 TYR A 222 -18.759 40.185 111.243 1.00 27.71 C ATOM 2711 CE2 TYR A 222 -17.734 41.191 109.310 1.00 26.80 C ATOM 2712 CZ TYR A 222 -18.351 40.111 109.911 1.00 27.32 C ATOM 2713 OH TYR A 222 -18.560 38.970 109.176 1.00 27.64 O ATOM 2714 N PHE A 223 -14.661 43.810 113.135 1.00 26.96 N ATOM 2715 CA PHE A 223 -13.283 43.371 112.993 1.00 27.36 C ATOM 2716 C PHE A 223 -12.817 42.691 114.268 1.00 26.91 C ATOM 2717 O PHE A 223 -12.176 41.637 114.226 1.00 27.28 O ATOM 2718 CB PHE A 223 -12.337 44.538 112.727 1.00 27.54 C ATOM 2719 CG PHE A 223 -10.922 44.104 112.541 1.00 27.75 C ATOM 2720 CD1 PHE A 223 -10.560 43.348 111.422 1.00 28.29 C ATOM 2721 CD2 PHE A 223 -9.962 44.391 113.504 1.00 28.30 C ATOM 2722 CE1 PHE A 223 -9.256 42.877 111.262 1.00 28.96 C ATOM 2723 CE2 PHE A 223 -8.647 43.929 113.366 1.00 28.54 C ATOM 2724 CZ PHE A 223 -8.290 43.169 112.243 1.00 29.50 C ATOM 2725 N ALA A 224 -13.137 43.316 115.397 1.00 26.38 N ATOM 2726 CA ALA A 224 -12.733 42.807 116.698 1.00 26.36 C ATOM 2727 C ALA A 224 -13.269 41.408 116.910 1.00 26.22 C ATOM 2728 O ALA A 224 -12.566 40.524 117.403 1.00 27.11 O ATOM 2729 CB ALA A 224 -13.230 43.737 117.806 1.00 24.69 C ATOM 2730 N LEU A 225 -14.521 41.208 116.527 1.00 26.29 N ATOM 2731 CA LEU A 225 -15.171 39.923 116.693 1.00 26.32 C ATOM 2732 C LEU A 225 -14.505 38.836 115.853 1.00 26.54 C ATOM 2733 O LEU A 225 -14.079 37.800 116.361 1.00 26.42 O ATOM 2734 CB LEU A 225 -16.647 40.066 116.327 1.00 27.07 C ATOM 2735 CG LEU A 225 -17.552 38.850 116.541 1.00 28.31 C ATOM 2736 CD1 LEU A 225 -18.957 39.322 116.848 1.00 28.60 C ATOM 2737 CD2 LEU A 225 -17.524 37.955 115.299 1.00 27.60 C ATOM 2738 N ARG A 226 -14.388 39.102 114.566 1.00 27.03 N ATOM 2739 CA ARG A 226 -13.817 38.167 113.633 1.00 27.84 C ATOM 2740 C ARG A 226 -12.286 38.099 113.530 1.00 28.39 C ATOM 2741 O ARG A 226 -11.731 37.009 113.440 1.00 27.94 O ATOM 2742 CB ARG A 226 -14.439 38.450 112.270 1.00 29.03 C ATOM 2743 CG ARG A 226 -15.940 38.135 112.258 1.00 31.29 C ATOM 2744 CD ARG A 226 -16.157 36.738 111.731 1.00 32.13 C ATOM 2745 NE ARG A 226 -16.250 36.794 110.279 1.00 33.85 N ATOM 2746 CZ ARG A 226 -15.708 35.922 109.443 1.00 34.48 C ATOM 2747 NH1 ARG A 226 -15.000 34.893 109.892 1.00 32.98 N ATOM 2748 NH2 ARG A 226 -15.905 36.080 108.142 1.00 35.85 N ATOM 2749 N GLY A 227 -11.607 39.246 113.558 1.00 28.08 N ATOM 2750 CA GLY A 227 -10.158 39.257 113.423 1.00 27.35 C ATOM 2751 C GLY A 227 -9.386 39.032 114.704 1.00 27.56 C ATOM 2752 O GLY A 227 -8.228 38.605 114.665 1.00 28.13 O ATOM 2753 N TRP A 228 -10.009 39.344 115.838 1.00 27.36 N ATOM 2754 CA TRP A 228 -9.383 39.145 117.140 1.00 26.85 C ATOM 2755 C TRP A 228 -10.143 38.063 117.907 1.00 27.05 C ATOM 2756 O TRP A 228 -9.765 37.710 119.019 1.00 26.43 O ATOM 2757 CB TRP A 228 -9.415 40.423 117.987 1.00 25.91 C ATOM 2758 CG TRP A 228 -8.642 41.611 117.451 1.00 25.33 C ATOM 2759 CD1 TRP A 228 -7.555 41.587 116.620 1.00 25.51 C ATOM 2760 CD2 TRP A 228 -8.889 42.996 117.747 1.00 24.07 C ATOM 2761 NE1 TRP A 228 -7.115 42.872 116.379 1.00 25.33 N ATOM 2762 CE2 TRP A 228 -7.915 43.753 117.058 1.00 24.30 C ATOM 2763 CE3 TRP A 228 -9.836 43.667 118.529 1.00 23.51 C ATOM 2764 CZ2 TRP A 228 -7.863 45.156 117.127 1.00 24.04 C ATOM 2765 CZ3 TRP A 228 -9.785 45.064 118.600 1.00 23.24 C ATOM 2766 CH2 TRP A 228 -8.805 45.791 117.903 1.00 23.99 C ATOM 2767 N GLN A 229 -11.219 37.545 117.316 1.00 27.48 N ATOM 2768 CA GLN A 229 -12.048 36.543 117.983 1.00 27.88 C ATOM 2769 C GLN A 229 -12.479 37.063 119.360 1.00 27.98 C ATOM 2770 O GLN A 229 -12.667 36.281 120.288 1.00 28.22 O ATOM 2771 CB GLN A 229 -11.300 35.211 118.151 1.00 26.84 C ATOM 2772 CG GLN A 229 -10.906 34.528 116.830 1.00 27.49 C ATOM 2773 CD GLN A 229 -9.647 35.113 116.193 1.00 28.66 C ATOM 2774 OE1 GLN A 229 -8.556 35.000 116.752 1.00 30.43 O ATOM 2775 NE2 GLN A 229 -9.793 35.739 115.021 1.00 26.55 N ATOM 2776 N ALA A 230 -12.615 38.381 119.488 1.00 28.36 N ATOM 2777 CA ALA A 230 -13.041 38.996 120.748 1.00 29.34 C ATOM 2778 C ALA A 230 -14.426 38.428 121.112 1.00 30.25 C ATOM 2779 O ALA A 230 -15.329 38.401 120.286 1.00 30.13 O ATOM 2780 CB ALA A 230 -13.106 40.516 120.594 1.00 29.05 C ATOM 2781 N LYS A 231 -14.588 37.992 122.354 1.00 30.88 N ATOM 2782 CA LYS A 231 -15.828 37.369 122.778 1.00 31.98 C ATOM 2783 C LYS A 231 -16.914 38.253 123.362 1.00 33.36 C ATOM 2784 O LYS A 231 -18.034 37.787 123.543 1.00 33.26 O ATOM 2785 CB LYS A 231 -15.520 36.254 123.785 1.00 32.18 C ATOM 2786 CG LYS A 231 -14.664 35.112 123.250 1.00 31.48 C ATOM 2787 CD LYS A 231 -15.336 34.418 122.069 1.00 31.48 C ATOM 2788 CE LYS A 231 -14.516 33.256 121.607 1.00 30.71 C ATOM 2789 NZ LYS A 231 -13.100 33.692 121.580 1.00 33.09 N ATOM 2790 N ASP A 232 -16.624 39.519 123.640 1.00 35.32 N ATOM 2791 CA ASP A 232 -17.653 40.359 124.252 1.00 36.62 C ATOM 2792 C ASP A 232 -18.011 41.644 123.514 1.00 36.96 C ATOM 2793 O ASP A 232 -18.050 42.722 124.117 1.00 36.58 O ATOM 2794 CB ASP A 232 -17.246 40.684 125.704 1.00 37.57 C ATOM 2795 CG ASP A 232 -18.431 41.124 126.569 1.00 39.44 C ATOM 2796 OD1 ASP A 232 -19.555 40.587 126.386 1.00 40.38 O ATOM 2797 OD2 ASP A 232 -18.235 41.994 127.449 1.00 39.49 O ATOM 2798 N VAL A 233 -18.283 41.540 122.218 1.00 37.04 N ATOM 2799 CA VAL A 233 -18.655 42.724 121.458 1.00 37.88 C ATOM 2800 C VAL A 233 -20.008 42.548 120.783 1.00 38.41 C ATOM 2801 O VAL A 233 -20.392 41.428 120.417 1.00 38.70 O ATOM 2802 CB VAL A 233 -17.601 43.070 120.368 1.00 38.02 C ATOM 2803 CG1 VAL A 233 -16.194 42.932 120.942 1.00 37.57 C ATOM 2804 CG2 VAL A 233 -17.789 42.189 119.148 1.00 37.85 C ATOM 2805 N PHE A 234 -20.740 43.646 120.628 1.00 38.55 N ATOM 2806 CA PHE A 234 -22.034 43.573 119.959 1.00 39.37 C ATOM 2807 C PHE A 234 -22.013 44.545 118.781 1.00 39.90 C ATOM 2808 O PHE A 234 -21.242 45.507 118.773 1.00 39.48 O ATOM 2809 CB PHE A 234 -23.164 43.947 120.923 1.00 39.52 C ATOM 2810 CG PHE A 234 -24.449 43.198 120.671 1.00 39.33 C ATOM 2811 CD1 PHE A 234 -24.581 41.868 121.066 1.00 38.52 C ATOM 2812 CD2 PHE A 234 -25.524 43.818 120.031 1.00 38.91 C ATOM 2813 CE1 PHE A 234 -25.755 41.165 120.830 1.00 38.45 C ATOM 2814 CE2 PHE A 234 -26.708 43.123 119.788 1.00 39.14 C ATOM 2815 CZ PHE A 234 -26.826 41.794 120.188 1.00 39.01 C ATOM 2816 N LEU A 235 -22.841 44.280 117.777 1.00 40.90 N ATOM 2817 CA LEU A 235 -22.921 45.155 116.609 1.00 42.27 C ATOM 2818 C LEU A 235 -24.290 45.834 116.553 1.00 43.52 C ATOM 2819 O LEU A 235 -25.162 45.445 115.774 1.00 43.73 O ATOM 2820 CB LEU A 235 -22.669 44.357 115.325 1.00 41.82 C ATOM 2821 CG LEU A 235 -21.207 44.085 114.953 1.00 41.95 C ATOM 2822 CD1 LEU A 235 -20.416 43.676 116.171 1.00 42.73 C ATOM 2823 CD2 LEU A 235 -21.140 42.994 113.896 1.00 42.25 C ATOM 2824 N PRO A 236 -24.501 46.854 117.399 1.00 45.08 N ATOM 2825 CA PRO A 236 -25.777 47.579 117.433 1.00 46.38 C ATOM 2826 C PRO A 236 -26.123 48.354 116.157 1.00 47.38 C ATOM 2827 O PRO A 236 -27.297 48.614 115.889 1.00 47.12 O ATOM 2828 CB PRO A 236 -25.627 48.489 118.660 1.00 46.01 C ATOM 2829 CG PRO A 236 -24.152 48.695 118.763 1.00 46.16 C ATOM 2830 CD PRO A 236 -23.616 47.311 118.485 1.00 45.75 C ATOM 2831 N ASP A 237 -25.100 48.710 115.380 1.00 49.06 N ATOM 2832 CA ASP A 237 -25.275 49.450 114.129 1.00 49.85 C ATOM 2833 C ASP A 237 -25.520 48.525 112.941 1.00 49.86 C ATOM 2834 O ASP A 237 -25.624 48.986 111.807 1.00 50.06 O ATOM 2835 CB ASP A 237 -24.025 50.282 113.831 1.00 51.08 C ATOM 2836 CG ASP A 237 -23.638 51.188 114.979 1.00 52.50 C ATOM 2837 OD1 ASP A 237 -24.489 52.009 115.393 1.00 53.96 O ATOM 2838 OD2 ASP A 237 -22.487 51.082 115.464 1.00 52.19 O ATOM 2839 N ASP A 238 -25.601 47.225 113.201 1.00 50.00 N ATOM 2840 CA ASP A 238 -25.800 46.239 112.144 1.00 50.39 C ATOM 2841 C ASP A 238 -27.208 46.275 111.563 1.00 51.63 C ATOM 2842 O ASP A 238 -28.195 46.366 112.295 1.00 51.49 O ATOM 2843 CB ASP A 238 -25.503 44.838 112.679 1.00 48.94 C ATOM 2844 CG ASP A 238 -25.517 43.785 111.594 1.00 48.08 C ATOM 2845 OD1 ASP A 238 -24.587 43.760 110.759 1.00 48.28 O ATOM 2846 OD2 ASP A 238 -26.461 42.975 111.571 1.00 46.96 O ATOM 2847 N TYR A 239 -27.289 46.182 110.241 1.00 52.94 N ATOM 2848 CA TYR A 239 -28.562 46.215 109.530 1.00 54.29 C ATOM 2849 C TYR A 239 -29.554 45.130 109.975 1.00 55.55 C ATOM 2850 O TYR A 239 -30.761 45.376 110.059 1.00 55.35 O ATOM 2851 CB TYR A 239 -28.307 46.093 108.027 1.00 53.64 C ATOM 2852 CG TYR A 239 -29.537 46.232 107.158 1.00 53.46 C ATOM 2853 CD1 TYR A 239 -30.086 47.487 106.889 1.00 53.14 C ATOM 2854 CD2 TYR A 239 -30.143 45.111 106.587 1.00 53.33 C ATOM 2855 CE1 TYR A 239 -31.202 47.623 106.073 1.00 52.88 C ATOM 2856 CE2 TYR A 239 -31.265 45.238 105.766 1.00 53.52 C ATOM 2857 CZ TYR A 239 -31.786 46.498 105.514 1.00 53.34 C ATOM 2858 OH TYR A 239 -32.883 46.642 104.699 1.00 53.67 O ATOM 2859 N LEU A 240 -29.055 43.933 110.251 1.00 56.84 N ATOM 2860 CA LEU A 240 -29.933 42.846 110.663 1.00 58.41 C ATOM 2861 C LEU A 240 -30.250 42.891 112.150 1.00 59.71 C ATOM 2862 O LEU A 240 -31.227 42.294 112.601 1.00 59.63 O ATOM 2863 CB LEU A 240 -29.310 41.495 110.297 1.00 58.11 C ATOM 2864 CG LEU A 240 -30.015 40.225 110.781 1.00 58.35 C ATOM 2865 CD1 LEU A 240 -31.498 40.286 110.481 1.00 58.37 C ATOM 2866 CD2 LEU A 240 -29.392 39.025 110.101 1.00 58.77 C ATOM 2867 N ILE A 241 -29.428 43.604 112.911 1.00 61.42 N ATOM 2868 CA ILE A 241 -29.647 43.716 114.345 1.00 63.34 C ATOM 2869 C ILE A 241 -30.760 44.716 114.625 1.00 64.81 C ATOM 2870 O ILE A 241 -31.610 44.482 115.482 1.00 65.17 O ATOM 2871 CB ILE A 241 -28.362 44.158 115.082 1.00 63.13 C ATOM 2872 CG1 ILE A 241 -27.314 43.050 115.000 1.00 63.05 C ATOM 2873 CG2 ILE A 241 -28.667 44.458 116.544 1.00 63.43 C ATOM 2874 CD1 ILE A 241 -27.733 41.760 115.675 1.00 62.44 C ATOM 2875 N LYS A 242 -30.752 45.828 113.896 1.00 66.31 N ATOM 2876 CA LYS A 242 -31.769 46.855 114.064 1.00 68.01 C ATOM 2877 C LYS A 242 -33.120 46.265 113.696 1.00 69.14 C ATOM 2878 O LYS A 242 -34.161 46.695 114.193 1.00 69.32 O ATOM 2879 CB LYS A 242 -31.458 48.056 113.171 1.00 68.16 C ATOM 2880 CG LYS A 242 -30.129 48.726 113.487 1.00 68.37 C ATOM 2881 CD LYS A 242 -29.867 49.894 112.559 1.00 68.96 C ATOM 2882 CE LYS A 242 -28.437 50.388 112.692 1.00 69.30 C ATOM 2883 NZ LYS A 242 -28.111 50.794 114.090 1.00 69.83 N ATOM 2884 N GLN A 243 -33.084 45.263 112.827 1.00 70.30 N ATOM 2885 CA GLN A 243 -34.283 44.577 112.367 1.00 71.63 C ATOM 2886 C GLN A 243 -34.732 43.536 113.402 1.00 72.36 C ATOM 2887 O GLN A 243 -35.874 43.075 113.384 1.00 72.39 O ATOM 2888 CB GLN A 243 -33.984 43.918 111.018 1.00 71.99 C ATOM 2889 CG GLN A 243 -35.098 43.099 110.407 1.00 72.94 C ATOM 2890 CD GLN A 243 -34.724 42.567 109.027 1.00 73.71 C ATOM 2891 OE1 GLN A 243 -35.383 41.673 108.494 1.00 73.98 O ATOM 2892 NE2 GLN A 243 -33.664 43.121 108.441 1.00 73.41 N ATOM 2893 N ARG A 244 -33.821 43.171 114.303 1.00 73.21 N ATOM 2894 CA ARG A 244 -34.112 42.204 115.358 1.00 73.91 C ATOM 2895 C ARG A 244 -34.591 42.978 116.576 1.00 74.78 C ATOM 2896 O ARG A 244 -35.259 42.431 117.456 1.00 74.86 O ATOM 2897 CB ARG A 244 -32.856 41.399 115.716 1.00 73.63 C ATOM 2898 CG ARG A 244 -32.517 40.265 114.755 1.00 72.99 C ATOM 2899 CD ARG A 244 -33.459 39.086 114.942 1.00 72.36 C ATOM 2900 NE ARG A 244 -33.102 37.933 114.116 1.00 71.85 N ATOM 2901 CZ ARG A 244 -33.178 37.899 112.789 1.00 71.68 C ATOM 2902 NH1 ARG A 244 -33.599 38.962 112.122 1.00 71.56 N ATOM 2903 NH2 ARG A 244 -32.850 36.795 112.128 1.00 71.45 N ATOM 2904 N PHE A 245 -34.237 44.260 116.610 1.00 75.77 N ATOM 2905 CA PHE A 245 -34.624 45.163 117.691 1.00 76.96 C ATOM 2906 C PHE A 245 -35.596 46.198 117.121 1.00 77.79 C ATOM 2907 O PHE A 245 -35.286 47.392 117.076 1.00 77.81 O ATOM 2908 CB PHE A 245 -33.393 45.883 118.262 1.00 77.43 C ATOM 2909 CG PHE A 245 -32.496 45.003 119.097 1.00 77.91 C ATOM 2910 CD1 PHE A 245 -31.820 43.927 118.528 1.00 78.20 C ATOM 2911 CD2 PHE A 245 -32.334 45.249 120.456 1.00 78.06 C ATOM 2912 CE1 PHE A 245 -30.999 43.109 119.299 1.00 78.09 C ATOM 2913 CE2 PHE A 245 -31.518 44.439 121.235 1.00 78.29 C ATOM 2914 CZ PHE A 245 -30.848 43.366 120.655 1.00 78.35 C ATOM 2915 N PRO A 246 -36.790 45.751 116.683 1.00 78.55 N ATOM 2916 CA PRO A 246 -37.811 46.633 116.107 1.00 79.11 C ATOM 2917 C PRO A 246 -38.040 47.899 116.919 1.00 79.68 C ATOM 2918 O PRO A 246 -38.441 47.836 118.080 1.00 79.43 O ATOM 2919 CB PRO A 246 -39.057 45.748 116.076 1.00 79.18 C ATOM 2920 CG PRO A 246 -38.496 44.377 115.910 1.00 78.78 C ATOM 2921 CD PRO A 246 -37.334 44.393 116.871 1.00 78.72 C ATOM 2922 N GLY A 247 -37.780 49.046 116.305 1.00 80.42 N ATOM 2923 CA GLY A 247 -37.987 50.306 116.989 1.00 81.52 C ATOM 2924 C GLY A 247 -36.828 50.797 117.831 1.00 82.48 C ATOM 2925 O GLY A 247 -36.414 51.951 117.700 1.00 82.64 O ATOM 2926 N MET A 248 -36.304 49.937 118.699 1.00 83.45 N ATOM 2927 CA MET A 248 -35.192 50.316 119.571 1.00 84.44 C ATOM 2928 C MET A 248 -34.010 50.908 118.813 1.00 84.82 C ATOM 2929 O MET A 248 -33.665 50.450 117.721 1.00 84.97 O ATOM 2930 CB MET A 248 -34.721 49.105 120.379 1.00 84.75 C ATOM 2931 CG MET A 248 -35.679 48.685 121.482 1.00 85.24 C ATOM 2932 SD MET A 248 -35.628 46.906 121.785 1.00 85.00 S ATOM 2933 CE MET A 248 -36.855 46.366 120.572 1.00 85.00 C ATOM 2934 N THR A 249 -33.389 51.925 119.403 1.00 85.08 N ATOM 2935 CA THR A 249 -32.240 52.586 118.792 1.00 85.37 C ATOM 2936 C THR A 249 -30.932 51.929 119.220 1.00 85.62 C ATOM 2937 O THR A 249 -30.869 51.280 120.266 1.00 85.91 O ATOM 2938 CB THR A 249 -32.179 54.071 119.184 1.00 85.47 C ATOM 2939 OG1 THR A 249 -32.152 54.185 120.613 1.00 85.56 O ATOM 2940 CG2 THR A 249 -33.382 54.819 118.632 1.00 85.57 C ATOM 2941 N PRO A 250 -29.868 52.089 118.411 1.00 85.72 N ATOM 2942 CA PRO A 250 -28.546 51.519 118.694 1.00 85.46 C ATOM 2943 C PRO A 250 -28.086 51.644 120.152 1.00 85.11 C ATOM 2944 O PRO A 250 -27.641 50.664 120.756 1.00 85.01 O ATOM 2945 CB PRO A 250 -27.650 52.270 117.721 1.00 85.71 C ATOM 2946 CG PRO A 250 -28.530 52.346 116.511 1.00 85.55 C ATOM 2947 CD PRO A 250 -29.866 52.765 117.098 1.00 85.64 C ATOM 2948 N ALA A 251 -28.191 52.840 120.719 1.00 84.47 N ATOM 2949 CA ALA A 251 -27.784 53.031 122.106 1.00 83.71 C ATOM 2950 C ALA A 251 -28.629 52.142 123.013 1.00 83.22 C ATOM 2951 O ALA A 251 -28.117 51.533 123.954 1.00 83.29 O ATOM 2952 CB ALA A 251 -27.947 54.471 122.501 1.00 83.99 C ATOM 2953 N GLN A 252 -29.929 52.079 122.733 1.00 82.38 N ATOM 2954 CA GLN A 252 -30.828 51.241 123.518 1.00 81.60 C ATOM 2955 C GLN A 252 -30.306 49.819 123.430 1.00 80.99 C ATOM 2956 O GLN A 252 -29.948 49.208 124.438 1.00 81.03 O ATOM 2957 CB GLN A 252 -32.255 51.283 122.956 1.00 81.82 C ATOM 2958 CG GLN A 252 -33.165 52.328 123.577 1.00 81.82 C ATOM 2959 CD GLN A 252 -34.597 52.191 123.102 1.00 81.80 C ATOM 2960 OE1 GLN A 252 -34.896 52.400 121.927 1.00 81.88 O ATOM 2961 NE2 GLN A 252 -35.491 51.827 124.013 1.00 81.51 N ATOM 2962 N ILE A 253 -30.262 49.304 122.205 1.00 79.90 N ATOM 2963 CA ILE A 253 -29.784 47.957 121.954 1.00 78.75 C ATOM 2964 C ILE A 253 -28.537 47.707 122.797 1.00 77.94 C ATOM 2965 O ILE A 253 -28.339 46.612 123.320 1.00 77.73 O ATOM 2966 CB ILE A 253 -29.446 47.768 120.456 1.00 78.83 C ATOM 2967 CG1 ILE A 253 -30.682 48.069 119.607 1.00 78.52 C ATOM 2968 CG2 ILE A 253 -28.970 46.343 120.194 1.00 78.62 C ATOM 2969 CD1 ILE A 253 -30.453 47.942 118.114 1.00 78.23 C ATOM 2970 N ARG A 254 -27.717 48.742 122.953 1.00 76.91 N ATOM 2971 CA ARG A 254 -26.486 48.628 123.719 1.00 75.96 C ATOM 2972 C ARG A 254 -26.714 48.227 125.176 1.00 75.25 C ATOM 2973 O ARG A 254 -26.238 47.176 125.614 1.00 75.22 O ATOM 2974 CB ARG A 254 -25.707 49.941 123.653 1.00 76.16 C ATOM 2975 CG ARG A 254 -24.234 49.799 123.983 1.00 76.50 C ATOM 2976 CD ARG A 254 -23.373 50.440 122.903 1.00 76.78 C ATOM 2977 NE ARG A 254 -21.949 50.194 123.112 1.00 77.30 N ATOM 2978 CZ ARG A 254 -21.390 48.985 123.135 1.00 77.68 C ATOM 2979 NH1 ARG A 254 -22.134 47.898 122.964 1.00 77.70 N ATOM 2980 NH2 ARG A 254 -20.084 48.859 123.327 1.00 77.64 N ATOM 2981 N ARG A 255 -27.438 49.047 125.933 1.00 74.21 N ATOM 2982 CA ARG A 255 -27.684 48.718 127.334 1.00 72.84 C ATOM 2983 C ARG A 255 -28.416 47.396 127.457 1.00 71.52 C ATOM 2984 O ARG A 255 -28.259 46.685 128.445 1.00 71.54 O ATOM 2985 CB ARG A 255 -28.505 49.806 128.035 1.00 73.46 C ATOM 2986 CG ARG A 255 -28.665 49.570 129.544 1.00 74.07 C ATOM 2987 CD ARG A 255 -30.040 49.024 129.955 1.00 74.66 C ATOM 2988 NE ARG A 255 -30.454 47.828 129.220 1.00 75.16 N ATOM 2989 CZ ARG A 255 -31.541 47.109 129.505 1.00 75.49 C ATOM 2990 NH1 ARG A 255 -32.329 47.458 130.515 1.00 75.65 N ATOM 2991 NH2 ARG A 255 -31.848 46.043 128.778 1.00 75.48 N ATOM 2992 N TYR A 256 -29.218 47.069 126.450 1.00 69.80 N ATOM 2993 CA TYR A 256 -29.977 45.825 126.467 1.00 68.07 C ATOM 2994 C TYR A 256 -29.079 44.606 126.278 1.00 67.46 C ATOM 2995 O TYR A 256 -29.333 43.542 126.849 1.00 67.11 O ATOM 2996 CB TYR A 256 -31.059 45.853 125.382 1.00 66.91 C ATOM 2997 CG TYR A 256 -31.961 44.640 125.398 1.00 66.13 C ATOM 2998 CD1 TYR A 256 -31.544 43.426 124.859 1.00 65.29 C ATOM 2999 CD2 TYR A 256 -33.223 44.698 125.988 1.00 65.76 C ATOM 3000 CE1 TYR A 256 -32.358 42.298 124.908 1.00 64.68 C ATOM 3001 CE2 TYR A 256 -34.046 43.573 126.043 1.00 65.24 C ATOM 3002 CZ TYR A 256 -33.607 42.377 125.503 1.00 64.78 C ATOM 3003 OH TYR A 256 -34.411 41.262 125.575 1.00 64.07 O ATOM 3004 N ALA A 257 -28.024 44.772 125.480 1.00 66.71 N ATOM 3005 CA ALA A 257 -27.088 43.686 125.198 1.00 65.42 C ATOM 3006 C ALA A 257 -26.206 43.364 126.396 1.00 64.76 C ATOM 3007 O ALA A 257 -25.789 42.216 126.569 1.00 64.47 O ATOM 3008 CB ALA A 257 -26.227 44.039 123.990 1.00 65.10 C ATOM 3009 N GLU A 258 -25.929 44.375 127.219 1.00 63.94 N ATOM 3010 CA GLU A 258 -25.096 44.210 128.411 1.00 62.95 C ATOM 3011 C GLU A 258 -25.434 42.954 129.202 1.00 62.05 C ATOM 3012 O GLU A 258 -24.547 42.269 129.712 1.00 62.30 O ATOM 3013 CB GLU A 258 -25.244 45.418 129.331 1.00 63.33 C ATOM 3014 CG GLU A 258 -24.514 46.662 128.870 1.00 64.56 C ATOM 3015 CD GLU A 258 -24.848 47.880 129.723 1.00 65.16 C ATOM 3016 OE1 GLU A 258 -25.996 48.366 129.632 1.00 66.15 O ATOM 3017 OE2 GLU A 258 -23.970 48.347 130.486 1.00 64.79 O