>>1EJ9:HELIX    9   9 SER A  433  TRP A  465  1                                  33    
SRIKGEKDWQKYETARRLKKCVDKIRNQYREDW
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 9 9 SER A 433 TRP A 465 1 33 ATOM 2809 N SER A 433 20.538 -4.460 33.435 1.00 42.37 N ATOM 2810 CA SER A 433 21.349 -4.958 32.343 1.00 42.27 C ATOM 2811 C SER A 433 22.197 -3.907 31.674 1.00 40.70 C ATOM 2812 O SER A 433 21.907 -2.729 31.681 1.00 41.90 O ATOM 2813 CB SER A 433 20.472 -5.548 31.258 1.00 44.09 C ATOM 2814 OG SER A 433 20.106 -6.857 31.603 1.00 60.77 O ATOM 2815 N ARG A 434 23.205 -4.370 30.974 1.00 36.83 N ATOM 2816 CA ARG A 434 24.026 -3.453 30.275 1.00 36.94 C ATOM 2817 C ARG A 434 23.196 -3.111 29.084 1.00 36.35 C ATOM 2818 O ARG A 434 23.043 -1.961 28.720 1.00 38.51 O ATOM 2819 CB ARG A 434 25.315 -4.120 29.846 1.00 38.41 C ATOM 2820 CG ARG A 434 25.882 -3.511 28.605 1.00 42.77 C ATOM 2821 CD ARG A 434 25.794 -4.525 27.544 1.00 53.81 C ATOM 2822 NE ARG A 434 25.208 -4.107 26.273 1.00 60.72 N ATOM 2823 CZ ARG A 434 24.882 -4.930 25.263 1.00 62.11 C ATOM 2824 NH1 ARG A 434 25.063 -6.248 25.328 1.00 58.43 N ATOM 2825 NH2 ARG A 434 24.363 -4.417 24.150 1.00 62.38 N ATOM 2826 N ILE A 435 22.640 -4.143 28.489 1.00 37.00 N ATOM 2827 CA ILE A 435 21.830 -4.000 27.298 1.00 37.12 C ATOM 2828 C ILE A 435 20.640 -3.084 27.564 1.00 34.90 C ATOM 2829 O ILE A 435 20.190 -2.385 26.688 1.00 34.86 O ATOM 2830 CB ILE A 435 21.428 -5.406 26.754 1.00 34.00 C ATOM 2831 CG1 ILE A 435 20.905 -5.333 25.323 1.00 41.59 C ATOM 2832 CG2 ILE A 435 20.423 -6.045 27.644 1.00 34.26 C ATOM 2833 CD1 ILE A 435 21.107 -6.617 24.547 1.00 43.25 C ATOM 2834 N LYS A 436 20.180 -3.033 28.800 1.00 36.16 N ATOM 2835 CA LYS A 436 19.066 -2.156 29.108 1.00 40.14 C ATOM 2836 C LYS A 436 19.583 -0.794 29.483 1.00 42.88 C ATOM 2837 O LYS A 436 19.220 0.217 28.890 1.00 43.77 O ATOM 2838 CB LYS A 436 18.235 -2.702 30.267 1.00 39.86 C ATOM 2839 CG LYS A 436 17.308 -3.842 29.874 1.00 44.74 C ATOM 2840 CD LYS A 436 16.269 -3.417 28.843 1.00 43.88 C ATOM 2841 CE LYS A 436 15.391 -4.572 28.339 1.00 47.06 C ATOM 2842 NZ LYS A 436 15.627 -4.869 26.867 1.00 57.42 N ATOM 2843 N GLY A 437 20.492 -0.788 30.439 1.00 45.14 N ATOM 2844 CA GLY A 437 21.027 0.459 30.912 1.00 45.04 C ATOM 2845 C GLY A 437 21.719 1.233 29.836 1.00 47.20 C ATOM 2846 O GLY A 437 21.853 2.440 29.934 1.00 52.43 O ATOM 2847 N GLU A 438 22.189 0.569 28.798 1.00 48.77 N ATOM 2848 CA GLU A 438 22.892 1.315 27.772 1.00 50.50 C ATOM 2849 C GLU A 438 21.887 2.096 26.926 1.00 49.63 C ATOM 2850 O GLU A 438 22.063 3.278 26.666 1.00 50.92 O ATOM 2851 CB GLU A 438 23.802 0.387 26.932 1.00 56.56 C ATOM 2852 CG GLU A 438 25.106 1.077 26.406 1.00 64.98 C ATOM 2853 CD GLU A 438 26.062 0.151 25.593 1.00 70.92 C ATOM 2854 OE1 GLU A 438 27.331 0.288 25.739 1.00 69.01 O ATOM 2855 OE2 GLU A 438 25.531 -0.684 24.796 1.00 70.46 O ATOM 2856 N LYS A 439 20.789 1.450 26.570 1.00 50.06 N ATOM 2857 CA LYS A 439 19.750 2.069 25.756 1.00 46.39 C ATOM 2858 C LYS A 439 19.135 3.265 26.467 1.00 43.41 C ATOM 2859 O LYS A 439 18.875 4.294 25.870 1.00 38.59 O ATOM 2860 CB LYS A 439 18.690 1.021 25.450 1.00 49.86 C ATOM 2861 CG LYS A 439 17.466 1.548 24.774 1.00 58.65 C ATOM 2862 CD LYS A 439 17.609 1.619 23.264 1.00 61.13 C ATOM 2863 CE LYS A 439 16.351 2.284 22.706 1.00 65.94 C ATOM 2864 NZ LYS A 439 16.316 2.401 21.228 1.00 67.16 N ATOM 2865 N ASP A 440 19.029 3.156 27.777 1.00 40.76 N ATOM 2866 CA ASP A 440 18.430 4.208 28.566 1.00 44.31 C ATOM 2867 C ASP A 440 19.335 5.418 28.674 1.00 44.93 C ATOM 2868 O ASP A 440 18.862 6.559 28.685 1.00 45.67 O ATOM 2869 CB ASP A 440 18.078 3.681 29.956 1.00 43.33 C ATOM 2870 CG ASP A 440 16.853 4.360 30.546 1.00 46.24 C ATOM 2871 OD1 ASP A 440 15.870 4.547 29.810 1.00 44.82 O ATOM 2872 OD2 ASP A 440 16.861 4.690 31.750 1.00 39.63 O ATOM 2873 N TRP A 441 20.628 5.158 28.813 1.00 40.57 N ATOM 2874 CA TRP A 441 21.641 6.195 28.924 1.00 41.77 C ATOM 2875 C TRP A 441 21.606 6.958 27.622 1.00 39.40 C ATOM 2876 O TRP A 441 21.733 8.175 27.585 1.00 38.03 O ATOM 2877 CB TRP A 441 22.987 5.500 29.112 1.00 45.71 C ATOM 2878 CG TRP A 441 24.227 6.328 29.093 1.00 54.08 C ATOM 2879 CD1 TRP A 441 24.325 7.686 29.152 1.00 53.85 C ATOM 2880 CD2 TRP A 441 25.574 5.827 29.017 1.00 58.41 C ATOM 2881 NE1 TRP A 441 25.648 8.064 29.118 1.00 57.69 N ATOM 2882 CE2 TRP A 441 26.436 6.945 29.033 1.00 60.27 C ATOM 2883 CE3 TRP A 441 26.132 4.541 28.941 1.00 59.03 C ATOM 2884 CZ2 TRP A 441 27.843 6.816 28.974 1.00 63.14 C ATOM 2885 CZ3 TRP A 441 27.532 4.409 28.883 1.00 61.81 C ATOM 2886 CH2 TRP A 441 28.368 5.541 28.899 1.00 62.72 C ATOM 2887 N GLN A 442 21.398 6.215 26.555 1.00 37.05 N ATOM 2888 CA GLN A 442 21.339 6.778 25.241 1.00 39.96 C ATOM 2889 C GLN A 442 20.069 7.540 25.064 1.00 41.64 C ATOM 2890 O GLN A 442 20.036 8.517 24.330 1.00 42.48 O ATOM 2891 CB GLN A 442 21.358 5.678 24.246 1.00 42.83 C ATOM 2892 CG GLN A 442 21.246 6.164 22.867 1.00 54.11 C ATOM 2893 CD GLN A 442 21.216 5.002 21.905 1.00 67.39 C ATOM 2894 OE1 GLN A 442 21.463 3.839 22.293 1.00 68.47 O ATOM 2895 NE2 GLN A 442 20.982 5.298 20.623 1.00 75.41 N ATOM 2896 N LYS A 443 19.021 7.053 25.713 1.00 41.37 N ATOM 2897 CA LYS A 443 17.728 7.695 25.661 1.00 40.65 C ATOM 2898 C LYS A 443 17.896 9.102 26.221 1.00 44.62 C ATOM 2899 O LYS A 443 17.516 10.083 25.597 1.00 48.01 O ATOM 2900 CB LYS A 443 16.727 6.937 26.529 1.00 42.80 C ATOM 2901 CG LYS A 443 15.325 7.555 26.561 1.00 36.72 C ATOM 2902 CD LYS A 443 14.405 6.857 27.575 1.00 30.49 C ATOM 2903 CE LYS A 443 14.775 7.187 29.004 1.00 32.67 C ATOM 2904 NZ LYS A 443 13.962 6.391 29.983 1.00 36.32 N ATOM 2905 N TYR A 444 18.443 9.219 27.425 1.00 45.70 N ATOM 2906 CA TYR A 444 18.614 10.549 27.990 1.00 45.67 C ATOM 2907 C TYR A 444 19.586 11.400 27.147 1.00 46.07 C ATOM 2908 O TYR A 444 19.360 12.587 26.918 1.00 48.58 O ATOM 2909 CB TYR A 444 19.007 10.469 29.480 1.00 45.08 C ATOM 2910 CG TYR A 444 17.886 9.963 30.369 1.00 44.28 C ATOM 2911 CD1 TYR A 444 17.946 8.712 30.945 1.00 44.41 C ATOM 2912 CD2 TYR A 444 16.739 10.725 30.584 1.00 46.04 C ATOM 2913 CE1 TYR A 444 16.883 8.220 31.712 1.00 50.42 C ATOM 2914 CE2 TYR A 444 15.675 10.248 31.340 1.00 44.20 C ATOM 2915 CZ TYR A 444 15.748 8.996 31.903 1.00 49.02 C ATOM 2916 OH TYR A 444 14.700 8.530 32.644 1.00 42.87 O ATOM 2917 N GLU A 445 20.643 10.780 26.650 1.00 45.65 N ATOM 2918 CA GLU A 445 21.605 11.490 25.833 1.00 44.79 C ATOM 2919 C GLU A 445 20.907 12.237 24.714 1.00 44.64 C ATOM 2920 O GLU A 445 21.142 13.403 24.487 1.00 48.11 O ATOM 2921 CB GLU A 445 22.646 10.508 25.277 1.00 48.07 C ATOM 2922 CG GLU A 445 23.789 10.285 26.231 1.00 44.99 C ATOM 2923 CD GLU A 445 24.407 11.608 26.647 1.00 50.00 C ATOM 2924 OE1 GLU A 445 25.092 12.221 25.802 1.00 52.92 O ATOM 2925 OE2 GLU A 445 24.180 12.061 27.792 1.00 47.52 O ATOM 2926 N THR A 446 20.029 11.553 24.025 1.00 42.98 N ATOM 2927 CA THR A 446 19.288 12.148 22.938 1.00 47.58 C ATOM 2928 C THR A 446 18.445 13.381 23.326 1.00 48.42 C ATOM 2929 O THR A 446 18.385 14.378 22.587 1.00 45.78 O ATOM 2930 CB THR A 446 18.402 11.063 22.323 1.00 47.04 C ATOM 2931 OG1 THR A 446 19.244 10.090 21.694 1.00 53.04 O ATOM 2932 CG2 THR A 446 17.437 11.645 21.311 1.00 50.81 C ATOM 2933 N ALA A 447 17.774 13.281 24.467 1.00 48.71 N ATOM 2934 CA ALA A 447 16.919 14.337 24.984 1.00 48.61 C ATOM 2935 C ALA A 447 17.683 15.621 25.301 1.00 50.05 C ATOM 2936 O ALA A 447 17.091 16.707 25.329 1.00 52.47 O ATOM 2937 CB ALA A 447 16.192 13.839 26.216 1.00 44.63 C ATOM 2938 N ARG A 448 18.969 15.474 25.623 1.00 50.52 N ATOM 2939 CA ARG A 448 19.840 16.605 25.928 1.00 49.95 C ATOM 2940 C ARG A 448 20.194 17.227 24.579 1.00 51.03 C ATOM 2941 O ARG A 448 20.376 18.437 24.464 1.00 53.18 O ATOM 2942 CB ARG A 448 21.104 16.138 26.661 1.00 45.88 C ATOM 2943 CG ARG A 448 20.833 15.272 27.862 1.00 47.47 C ATOM 2944 CD ARG A 448 22.102 14.750 28.480 1.00 50.29 C ATOM 2945 NE ARG A 448 22.818 15.774 29.244 1.00 58.11 N ATOM 2946 CZ ARG A 448 24.103 15.697 29.616 1.00 56.41 C ATOM 2947 NH1 ARG A 448 24.841 14.643 29.300 1.00 57.37 N ATOM 2948 NH2 ARG A 448 24.654 16.672 30.330 1.00 55.04 N ATOM 2949 N ARG A 449 20.252 16.401 23.541 1.00 47.82 N ATOM 2950 CA ARG A 449 20.551 16.938 22.238 1.00 49.22 C ATOM 2951 C ARG A 449 19.395 17.802 21.810 1.00 49.45 C ATOM 2952 O ARG A 449 19.569 18.830 21.159 1.00 53.53 O ATOM 2953 CB ARG A 449 20.825 15.837 21.249 1.00 47.33 C ATOM 2954 CG ARG A 449 22.226 15.320 21.419 1.00 49.02 C ATOM 2955 CD ARG A 449 22.625 14.491 20.244 1.00 51.93 C ATOM 2956 NE ARG A 449 22.007 13.173 20.288 1.00 53.02 N ATOM 2957 CZ ARG A 449 21.163 12.710 19.372 1.00 57.19 C ATOM 2958 NH1 ARG A 449 20.817 13.454 18.327 1.00 59.78 N ATOM 2959 NH2 ARG A 449 20.687 11.480 19.482 1.00 61.12 N ATOM 2960 N LEU A 450 18.208 17.407 22.222 1.00 47.76 N ATOM 2961 CA LEU A 450 17.044 18.185 21.906 1.00 46.94 C ATOM 2962 C LEU A 450 17.161 19.488 22.665 1.00 47.08 C ATOM 2963 O LEU A 450 16.867 20.548 22.134 1.00 46.90 O ATOM 2964 CB LEU A 450 15.796 17.438 22.339 1.00 47.64 C ATOM 2965 CG LEU A 450 14.458 18.168 22.288 1.00 45.26 C ATOM 2966 CD1 LEU A 450 14.230 18.759 20.935 1.00 40.30 C ATOM 2967 CD2 LEU A 450 13.355 17.196 22.628 1.00 43.52 C ATOM 2968 N LYS A 451 17.563 19.400 23.921 1.00 44.49 N ATOM 2969 CA LYS A 451 17.703 20.588 24.728 1.00 47.91 C ATOM 2970 C LYS A 451 18.459 21.609 23.914 1.00 50.29 C ATOM 2971 O LYS A 451 18.032 22.757 23.751 1.00 50.71 O ATOM 2972 CB LYS A 451 18.479 20.270 25.997 1.00 46.69 C ATOM 2973 CG LYS A 451 18.978 21.493 26.740 1.00 52.54 C ATOM 2974 CD LYS A 451 19.649 21.156 28.083 1.00 57.74 C ATOM 2975 CE LYS A 451 20.205 22.419 28.772 1.00 61.08 C ATOM 2976 NZ LYS A 451 20.406 22.299 30.267 1.00 62.51 N ATOM 2977 N LYS A 452 19.526 21.127 23.301 1.00 54.16 N ATOM 2978 CA LYS A 452 20.400 21.963 22.508 1.00 57.67 C ATOM 2979 C LYS A 452 19.836 22.516 21.229 1.00 59.76 C ATOM 2980 O LYS A 452 20.505 23.313 20.591 1.00 68.02 O ATOM 2981 CB LYS A 452 21.700 21.238 22.190 1.00 60.56 C ATOM 2982 CG LYS A 452 22.604 21.013 23.387 1.00 64.94 C ATOM 2983 CD LYS A 452 23.749 20.133 22.967 1.00 71.01 C ATOM 2984 CE LYS A 452 24.539 19.647 24.149 1.00 76.21 C ATOM 2985 NZ LYS A 452 25.032 18.257 23.869 1.00 80.82 N ATOM 2986 N CYS A 453 18.667 22.081 20.786 1.00 55.37 N ATOM 2987 CA CYS A 453 18.142 22.659 19.553 1.00 52.91 C ATOM 2988 C CYS A 453 16.644 22.851 19.639 1.00 53.21 C ATOM 2989 O CYS A 453 15.962 23.051 18.632 1.00 48.35 O ATOM 2990 CB CYS A 453 18.491 21.773 18.378 1.00 52.95 C ATOM 2991 SG CYS A 453 17.783 20.134 18.560 1.00 60.01 S ATOM 2992 N VAL A 454 16.142 22.813 20.864 1.00 51.08 N ATOM 2993 CA VAL A 454 14.729 22.966 21.086 1.00 49.78 C ATOM 2994 C VAL A 454 14.277 24.348 20.648 1.00 48.35 C ATOM 2995 O VAL A 454 13.453 24.465 19.756 1.00 47.65 O ATOM 2996 CB VAL A 454 14.345 22.654 22.559 1.00 50.61 C ATOM 2997 CG1 VAL A 454 14.922 23.676 23.498 1.00 52.38 C ATOM 2998 CG2 VAL A 454 12.843 22.552 22.709 1.00 48.39 C ATOM 2999 N ASP A 455 14.872 25.398 21.193 1.00 50.61 N ATOM 3000 CA ASP A 455 14.448 26.738 20.805 1.00 56.27 C ATOM 3001 C ASP A 455 14.467 26.950 19.290 1.00 55.29 C ATOM 3002 O ASP A 455 13.714 27.736 18.757 1.00 60.57 O ATOM 3003 CB ASP A 455 15.234 27.820 21.567 1.00 60.21 C ATOM 3004 CG ASP A 455 14.706 28.036 23.027 1.00 66.41 C ATOM 3005 OD1 ASP A 455 15.514 27.926 23.995 1.00 67.58 O ATOM 3006 OD2 ASP A 455 13.490 28.323 23.211 1.00 61.19 O ATOM 3007 N LYS A 456 15.241 26.159 18.575 1.00 57.10 N ATOM 3008 CA LYS A 456 15.294 26.306 17.125 1.00 57.98 C ATOM 3009 C LYS A 456 14.071 25.689 16.491 1.00 54.00 C ATOM 3010 O LYS A 456 13.441 26.249 15.588 1.00 51.58 O ATOM 3011 CB LYS A 456 16.572 25.638 16.590 1.00 65.19 C ATOM 3012 CG LYS A 456 16.500 25.090 15.160 1.00 74.64 C ATOM 3013 CD LYS A 456 16.097 26.140 14.126 1.00 85.82 C ATOM 3014 CE LYS A 456 15.767 25.482 12.771 1.00 91.50 C ATOM 3015 NZ LYS A 456 14.725 24.397 12.890 1.00 96.14 N ATOM 3016 N ILE A 457 13.824 24.466 16.916 1.00 52.64 N ATOM 3017 CA ILE A 457 12.705 23.704 16.435 1.00 53.17 C ATOM 3018 C ILE A 457 11.452 24.541 16.697 1.00 51.89 C ATOM 3019 O ILE A 457 10.627 24.752 15.810 1.00 52.05 O ATOM 3020 CB ILE A 457 12.672 22.328 17.178 1.00 53.22 C ATOM 3021 CG1 ILE A 457 14.034 21.636 16.999 1.00 51.22 C ATOM 3022 CG2 ILE A 457 11.526 21.448 16.666 1.00 53.37 C ATOM 3023 CD1 ILE A 457 14.096 20.173 17.392 1.00 44.86 C ATOM 3024 N ARG A 458 11.376 25.072 17.907 1.00 49.19 N ATOM 3025 CA ARG A 458 10.258 25.875 18.340 1.00 51.03 C ATOM 3026 C ARG A 458 9.991 27.017 17.386 1.00 56.44 C ATOM 3027 O ARG A 458 8.861 27.215 16.914 1.00 59.21 O ATOM 3028 CB ARG A 458 10.528 26.406 19.744 1.00 46.76 C ATOM 3029 CG ARG A 458 10.424 25.327 20.778 1.00 47.25 C ATOM 3030 CD ARG A 458 10.759 25.797 22.139 1.00 42.30 C ATOM 3031 NE ARG A 458 10.395 24.754 23.089 1.00 47.13 N ATOM 3032 CZ ARG A 458 10.920 24.636 24.302 1.00 48.18 C ATOM 3033 NH1 ARG A 458 11.849 25.493 24.699 1.00 48.98 N ATOM 3034 NH2 ARG A 458 10.465 23.712 25.142 1.00 49.25 N ATOM 3035 N ASN A 459 11.042 27.768 17.090 1.00 60.93 N ATOM 3036 CA ASN A 459 10.917 28.910 16.198 1.00 62.04 C ATOM 3037 C ASN A 459 10.361 28.495 14.863 1.00 58.93 C ATOM 3038 O ASN A 459 9.531 29.194 14.274 1.00 58.98 O ATOM 3039 CB ASN A 459 12.268 29.615 16.037 1.00 68.80 C ATOM 3040 CG ASN A 459 12.433 30.789 17.015 1.00 77.62 C ATOM 3041 OD1 ASN A 459 11.986 30.725 18.178 1.00 81.93 O ATOM 3042 ND2 ASN A 459 13.003 31.900 16.523 1.00 79.83 N ATOM 3043 N GLN A 460 10.774 27.316 14.428 1.00 55.73 N ATOM 3044 CA GLN A 460 10.330 26.800 13.160 1.00 56.75 C ATOM 3045 C GLN A 460 8.841 26.519 13.144 1.00 56.15 C ATOM 3046 O GLN A 460 8.110 26.992 12.268 1.00 54.26 O ATOM 3047 CB GLN A 460 11.082 25.528 12.836 1.00 58.27 C ATOM 3048 CG GLN A 460 11.686 25.555 11.476 1.00 65.04 C ATOM 3049 CD GLN A 460 11.658 24.190 10.834 1.00 72.11 C ATOM 3050 OE1 GLN A 460 10.585 23.653 10.526 1.00 75.86 O ATOM 3051 NE2 GLN A 460 12.834 23.610 10.639 1.00 77.00 N ATOM 3052 N TYR A 461 8.394 25.717 14.099 1.00 55.80 N ATOM 3053 CA TYR A 461 6.994 25.384 14.125 1.00 55.67 C ATOM 3054 C TYR A 461 6.156 26.628 14.281 1.00 54.69 C ATOM 3055 O TYR A 461 5.182 26.787 13.566 1.00 56.04 O ATOM 3056 CB TYR A 461 6.657 24.256 15.128 1.00 53.70 C ATOM 3057 CG TYR A 461 6.718 24.535 16.625 1.00 49.98 C ATOM 3058 CD1 TYR A 461 7.455 23.697 17.464 1.00 45.08 C ATOM 3059 CD2 TYR A 461 5.964 25.548 17.212 1.00 46.69 C ATOM 3060 CE1 TYR A 461 7.434 23.841 18.833 1.00 45.19 C ATOM 3061 CE2 TYR A 461 5.939 25.705 18.581 1.00 46.35 C ATOM 3062 CZ TYR A 461 6.681 24.846 19.391 1.00 49.56 C ATOM 3063 OH TYR A 461 6.688 25.003 20.763 1.00 49.66 O ATOM 3064 N ARG A 462 6.567 27.544 15.144 1.00 54.56 N ATOM 3065 CA ARG A 462 5.792 28.757 15.283 1.00 59.36 C ATOM 3066 C ARG A 462 5.637 29.374 13.901 1.00 60.33 C ATOM 3067 O ARG A 462 4.553 29.826 13.517 1.00 61.21 O ATOM 3068 CB ARG A 462 6.445 29.725 16.262 1.00 63.94 C ATOM 3069 CG ARG A 462 6.385 29.212 17.696 1.00 73.36 C ATOM 3070 CD ARG A 462 6.667 30.290 18.771 1.00 81.80 C ATOM 3071 NE ARG A 462 6.255 29.869 20.130 1.00 90.80 N ATOM 3072 CZ ARG A 462 6.883 28.953 20.888 1.00 94.67 C ATOM 3073 NH1 ARG A 462 7.983 28.336 20.445 1.00100.35 N ATOM 3074 NH2 ARG A 462 6.387 28.610 22.083 1.00 93.44 N ATOM 3075 N GLU A 463 6.703 29.313 13.116 1.00 61.05 N ATOM 3076 CA GLU A 463 6.641 29.844 11.763 1.00 59.95 C ATOM 3077 C GLU A 463 5.700 29.014 10.883 1.00 59.87 C ATOM 3078 O GLU A 463 4.931 29.567 10.099 1.00 59.67 O ATOM 3079 CB GLU A 463 8.035 29.881 11.144 1.00 57.06 C ATOM 3080 N ASP A 464 5.780 27.692 10.991 1.00 57.90 N ATOM 3081 CA ASP A 464 4.937 26.831 10.186 1.00 57.30 C ATOM 3082 C ASP A 464 3.476 27.052 10.404 1.00 58.17 C ATOM 3083 O ASP A 464 2.678 26.755 9.519 1.00 57.86 O ATOM 3084 CB ASP A 464 5.246 25.378 10.452 1.00 60.17 C ATOM 3085 CG ASP A 464 6.637 25.033 10.101 1.00 62.81 C ATOM 3086 OD1 ASP A 464 7.109 25.547 9.080 1.00 68.73 O ATOM 3087 OD2 ASP A 464 7.266 24.265 10.838 1.00 63.63 O ATOM 3088 N TRP A 465 3.110 27.508 11.597 1.00 59.81 N ATOM 3089 CA TRP A 465 1.703 27.752 11.893 1.00 64.29 C ATOM 3090 C TRP A 465 1.159 28.664 10.819 1.00 66.38 C ATOM 3091 O TRP A 465 -0.035 28.679 10.534 1.00 67.93 O ATOM 3092 CB TRP A 465 1.531 28.451 13.238 1.00 62.74 C ATOM 3093 CG TRP A 465 1.886 27.631 14.429 1.00 61.48 C ATOM 3094 CD1 TRP A 465 1.901 26.268 14.521 1.00 60.26 C ATOM 3095 CD2 TRP A 465 2.323 28.125 15.694 1.00 60.90 C ATOM 3096 NE1 TRP A 465 2.336 25.882 15.763 1.00 59.48 N ATOM 3097 CE2 TRP A 465 2.604 27.001 16.503 1.00 59.80 C ATOM 3098 CE3 TRP A 465 2.510 29.410 16.220 1.00 61.97 C ATOM 3099 CZ2 TRP A 465 3.067 27.124 17.817 1.00 60.58 C ATOM 3100 CZ3 TRP A 465 2.970 29.535 17.528 1.00 64.15 C ATOM 3101 CH2 TRP A 465 3.245 28.392 18.312 1.00 65.16 C