>>1ENV:HELIX    1   1 GLN A    1  LYS A   77  1                                  77    
QIEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 1 1 GLN A 1 LYS A 77 1 77 ATOM 1 N GLN A 1 31.714 8.530 139.598 1.00109.35 N ATOM 2 CA GLN A 1 32.034 8.751 141.030 1.00109.33 C ATOM 3 C GLN A 1 31.228 9.823 141.748 1.00106.55 C ATOM 4 O GLN A 1 31.172 9.816 142.969 1.00105.06 O ATOM 5 CB GLN A 1 33.528 8.930 141.231 1.00111.01 C ATOM 6 CG GLN A 1 34.224 7.592 141.226 1.00118.26 C ATOM 7 CD GLN A 1 35.686 7.703 140.924 1.00123.88 C ATOM 8 OE1 GLN A 1 36.089 7.642 139.765 1.00128.68 O ATOM 9 NE2 GLN A 1 36.495 7.870 141.958 1.00125.37 N ATOM 10 N ILE A 2 30.626 10.755 141.010 1.00103.33 N ATOM 11 CA ILE A 2 29.765 11.747 141.649 1.00 99.54 C ATOM 12 C ILE A 2 28.651 10.888 142.231 1.00 99.03 C ATOM 13 O ILE A 2 28.265 11.039 143.381 1.00102.03 O ATOM 14 CB ILE A 2 29.172 12.743 140.623 1.00 99.38 C ATOM 15 CG1 ILE A 2 29.925 14.069 140.692 1.00100.52 C ATOM 16 CG2 ILE A 2 27.677 12.980 140.873 1.00 96.80 C ATOM 17 CD1 ILE A 2 29.718 14.839 141.977 1.00101.17 C ATOM 18 N GLU A 3 28.197 9.938 141.418 1.00 97.36 N ATOM 19 CA GLU A 3 27.156 8.986 141.789 1.00 95.22 C ATOM 20 C GLU A 3 27.533 8.285 143.106 1.00 93.50 C ATOM 21 O GLU A 3 26.785 8.348 144.082 1.00 92.16 O ATOM 22 CB GLU A 3 27.012 7.928 140.682 1.00 97.33 C ATOM 23 CG GLU A 3 26.918 8.460 139.245 1.00 93.47 C ATOM 24 CD GLU A 3 25.516 8.899 138.863 1.00 92.57 C ATOM 25 OE1 GLU A 3 24.645 8.028 138.649 1.00 86.13 O ATOM 26 OE2 GLU A 3 25.287 10.122 138.769 1.00 94.16 O ATOM 27 N ASP A 4 28.699 7.631 143.114 1.00 92.13 N ATOM 28 CA ASP A 4 29.222 6.898 144.282 1.00 91.67 C ATOM 29 C ASP A 4 29.414 7.766 145.533 1.00 92.37 C ATOM 30 O ASP A 4 29.118 7.337 146.656 1.00 92.89 O ATOM 31 CB ASP A 4 30.567 6.216 143.942 1.00 88.16 C ATOM 32 CG ASP A 4 30.405 4.860 143.243 1.00 84.11 C ATOM 33 OD1 ASP A 4 29.261 4.390 143.059 1.00 80.92 O ATOM 34 OD2 ASP A 4 31.443 4.250 142.890 1.00 76.82 O ATOM 35 N LYS A 5 29.929 8.978 145.339 1.00 90.22 N ATOM 36 CA LYS A 5 30.164 9.889 146.447 1.00 86.25 C ATOM 37 C LYS A 5 28.867 10.218 147.184 1.00 85.44 C ATOM 38 O LYS A 5 28.852 10.262 148.411 1.00 87.02 O ATOM 39 CB LYS A 5 30.870 11.158 145.968 1.00 86.03 C ATOM 40 CG LYS A 5 31.921 11.653 146.945 1.00 85.72 C ATOM 41 CD LYS A 5 33.202 12.083 146.243 1.00 84.40 C ATOM 42 CE LYS A 5 33.103 13.502 145.714 1.00 85.92 C ATOM 43 NZ LYS A 5 34.370 13.939 145.071 1.00 89.61 N ATOM 44 N ILE A 6 27.768 10.388 146.450 1.00 83.17 N ATOM 45 CA ILE A 6 26.484 10.686 147.083 1.00 81.71 C ATOM 46 C ILE A 6 25.990 9.482 147.869 1.00 82.21 C ATOM 47 O ILE A 6 25.220 9.630 148.813 1.00 84.88 O ATOM 48 CB ILE A 6 25.413 11.128 146.067 1.00 79.92 C ATOM 49 CG1 ILE A 6 25.907 12.354 145.302 1.00 79.44 C ATOM 50 CG2 ILE A 6 24.119 11.472 146.776 1.00 77.76 C ATOM 51 CD1 ILE A 6 26.653 13.335 146.157 1.00 76.18 C ATOM 52 N GLU A 7 26.431 8.292 147.481 1.00 82.92 N ATOM 53 CA GLU A 7 26.051 7.083 148.196 1.00 84.12 C ATOM 54 C GLU A 7 26.802 7.101 149.526 1.00 84.48 C ATOM 55 O GLU A 7 26.194 6.953 150.582 1.00 84.07 O ATOM 56 CB GLU A 7 26.411 5.843 147.392 1.00 84.03 C ATOM 57 N GLU A 8 28.111 7.346 149.472 1.00 84.33 N ATOM 58 CA GLU A 8 28.934 7.403 150.679 1.00 85.98 C ATOM 59 C GLU A 8 28.434 8.471 151.639 1.00 83.69 C ATOM 60 O GLU A 8 28.182 8.191 152.810 1.00 85.62 O ATOM 61 CB GLU A 8 30.401 7.680 150.335 1.00 91.09 C ATOM 62 CG GLU A 8 31.076 6.584 149.522 1.00103.02 C ATOM 63 CD GLU A 8 30.987 5.209 150.167 1.00108.86 C ATOM 64 OE1 GLU A 8 30.796 5.121 151.405 1.00109.33 O ATOM 65 OE2 GLU A 8 31.118 4.211 149.421 1.00112.27 O ATOM 66 N ILE A 9 28.320 9.699 151.145 1.00 80.47 N ATOM 67 CA ILE A 9 27.839 10.812 151.951 1.00 77.70 C ATOM 68 C ILE A 9 26.569 10.416 152.696 1.00 78.24 C ATOM 69 O ILE A 9 26.510 10.534 153.922 1.00 83.89 O ATOM 70 CB ILE A 9 27.598 12.069 151.080 1.00 77.78 C ATOM 71 CG1 ILE A 9 28.944 12.681 150.670 1.00 77.48 C ATOM 72 CG2 ILE A 9 26.737 13.083 151.821 1.00 72.43 C ATOM 73 CD1 ILE A 9 28.832 13.887 149.758 1.00 79.90 C ATOM 74 N LEU A 10 25.587 9.885 151.972 1.00 76.52 N ATOM 75 CA LEU A 10 24.331 9.460 152.588 1.00 78.03 C ATOM 76 C LEU A 10 24.507 8.393 153.671 1.00 78.79 C ATOM 77 O LEU A 10 23.772 8.378 154.660 1.00 76.05 O ATOM 78 CB LEU A 10 23.339 8.955 151.534 1.00 78.44 C ATOM 79 CG LEU A 10 22.354 9.978 150.975 1.00 77.87 C ATOM 80 CD1 LEU A 10 21.340 9.267 150.101 1.00 76.10 C ATOM 81 CD2 LEU A 10 21.647 10.687 152.121 1.00 81.52 C ATOM 82 N SER A 11 25.464 7.492 153.477 1.00 81.16 N ATOM 83 CA SER A 11 25.714 6.437 154.451 1.00 83.59 C ATOM 84 C SER A 11 26.291 7.030 155.735 1.00 85.16 C ATOM 85 O SER A 11 25.861 6.672 156.839 1.00 86.73 O ATOM 86 CB SER A 11 26.665 5.383 153.873 1.00 84.90 C ATOM 87 OG SER A 11 26.728 4.237 154.707 1.00 85.55 O ATOM 88 N LYS A 12 27.269 7.922 155.596 1.00 83.03 N ATOM 89 CA LYS A 12 27.874 8.561 156.756 1.00 81.38 C ATOM 90 C LYS A 12 26.835 9.386 157.509 1.00 81.83 C ATOM 91 O LYS A 12 26.706 9.267 158.729 1.00 82.41 O ATOM 92 CB LYS A 12 29.039 9.457 156.348 1.00 81.01 C ATOM 93 CG LYS A 12 30.264 8.703 155.899 1.00 87.75 C ATOM 94 CD LYS A 12 31.474 9.623 155.802 1.00 91.74 C ATOM 95 CE LYS A 12 32.694 8.863 155.289 1.00 93.84 C ATOM 96 NZ LYS A 12 33.925 9.693 155.339 1.00 94.57 N ATOM 97 N ILE A 13 26.060 10.181 156.778 1.00 80.20 N ATOM 98 CA ILE A 13 25.046 11.012 157.405 1.00 81.94 C ATOM 99 C ILE A 13 24.047 10.176 158.210 1.00 82.74 C ATOM 100 O ILE A 13 23.592 10.610 159.258 1.00 86.62 O ATOM 101 CB ILE A 13 24.309 11.913 156.379 1.00 84.09 C ATOM 102 CG1 ILE A 13 23.875 13.219 157.052 1.00 87.62 C ATOM 103 CG2 ILE A 13 23.073 11.202 155.811 1.00 86.09 C ATOM 104 CD1 ILE A 13 23.182 14.203 156.114 1.00 87.13 C ATOM 105 N TYR A 14 23.739 8.969 157.752 1.00 83.31 N ATOM 106 CA TYR A 14 22.802 8.108 158.472 1.00 86.38 C ATOM 107 C TYR A 14 23.410 7.559 159.764 1.00 89.95 C ATOM 108 O TYR A 14 22.828 7.701 160.842 1.00 93.46 O ATOM 109 CB TYR A 14 22.333 6.964 157.584 1.00 83.91 C ATOM 110 N HIS A 15 24.598 6.967 159.662 1.00 90.77 N ATOM 111 CA HIS A 15 25.262 6.388 160.833 1.00 89.07 C ATOM 112 C HIS A 15 25.560 7.425 161.895 1.00 85.93 C ATOM 113 O HIS A 15 25.446 7.134 163.084 1.00 84.99 O ATOM 114 CB HIS A 15 26.536 5.640 160.441 1.00 94.33 C ATOM 115 CG HIS A 15 26.296 4.478 159.521 1.00102.89 C ATOM 116 ND1 HIS A 15 27.316 3.816 158.873 1.00104.06 N ATOM 117 CD2 HIS A 15 25.150 3.876 159.133 1.00104.36 C ATOM 118 CE1 HIS A 15 26.811 2.857 158.122 1.00103.08 C ATOM 119 NE2 HIS A 15 25.494 2.867 158.260 1.00105.44 N ATOM 120 N ILE A 16 25.937 8.632 161.477 1.00 82.06 N ATOM 121 CA ILE A 16 26.206 9.686 162.444 1.00 79.89 C ATOM 122 C ILE A 16 24.878 10.233 162.966 1.00 79.69 C ATOM 123 O ILE A 16 24.771 10.612 164.133 1.00 82.66 O ATOM 124 CB ILE A 16 27.103 10.837 161.892 1.00 76.14 C ATOM 125 CG1 ILE A 16 26.310 11.797 161.011 1.00 72.98 C ATOM 126 CG2 ILE A 16 28.296 10.267 161.153 1.00 76.33 C ATOM 127 CD1 ILE A 16 27.108 12.996 160.588 1.00 71.22 C ATOM 128 N GLU A 17 23.858 10.244 162.112 1.00 77.73 N ATOM 129 CA GLU A 17 22.530 10.714 162.511 1.00 77.42 C ATOM 130 C GLU A 17 22.083 9.817 163.662 1.00 76.14 C ATOM 131 O GLU A 17 21.319 10.240 164.535 1.00 73.36 O ATOM 132 CB GLU A 17 21.553 10.621 161.333 1.00 80.37 C ATOM 133 CG GLU A 17 20.198 11.273 161.559 1.00 82.42 C ATOM 134 CD GLU A 17 19.402 11.441 160.273 1.00 84.18 C ATOM 135 OE1 GLU A 17 18.815 10.449 159.791 1.00 82.67 O ATOM 136 OE2 GLU A 17 19.344 12.577 159.753 1.00 85.84 O ATOM 137 N ASN A 18 22.579 8.579 163.657 1.00 74.29 N ATOM 138 CA ASN A 18 22.275 7.617 164.710 1.00 73.77 C ATOM 139 C ASN A 18 22.958 8.041 166.003 1.00 72.77 C ATOM 140 O ASN A 18 22.320 8.080 167.055 1.00 71.67 O ATOM 141 CB ASN A 18 22.727 6.214 164.316 1.00 74.14 C ATOM 142 CG ASN A 18 21.583 5.342 163.834 1.00 75.14 C ATOM 143 OD1 ASN A 18 21.801 4.214 163.398 1.00 76.88 O ATOM 144 ND2 ASN A 18 20.350 5.851 163.929 1.00 72.27 N ATOM 145 N GLU A 19 24.245 8.380 165.910 1.00 70.23 N ATOM 146 CA GLU A 19 25.036 8.831 167.056 1.00 66.88 C ATOM 147 C GLU A 19 24.287 9.879 167.863 1.00 66.20 C ATOM 148 O GLU A 19 24.184 9.770 169.086 1.00 70.47 O ATOM 149 CB GLU A 19 26.364 9.431 166.598 1.00 63.09 C ATOM 150 CG GLU A 19 27.303 8.439 165.970 1.00 62.24 C ATOM 151 CD GLU A 19 27.813 7.422 166.956 1.00 64.20 C ATOM 152 OE1 GLU A 19 27.029 6.543 167.384 1.00 59.22 O ATOM 153 OE2 GLU A 19 29.013 7.501 167.296 1.00 67.95 O ATOM 154 N ILE A 20 23.775 10.895 167.178 1.00 62.24 N ATOM 155 CA ILE A 20 23.034 11.957 167.837 1.00 60.14 C ATOM 156 C ILE A 20 21.866 11.404 168.661 1.00 64.30 C ATOM 157 O ILE A 20 21.794 11.660 169.867 1.00 70.39 O ATOM 158 CB ILE A 20 22.601 13.060 166.829 1.00 53.74 C ATOM 159 CG1 ILE A 20 23.844 13.837 166.373 1.00 48.32 C ATOM 160 CG2 ILE A 20 21.585 14.023 167.456 1.00 50.37 C ATOM 161 CD1 ILE A 20 23.543 15.073 165.556 1.00 48.52 C ATOM 162 N ALA A 21 21.003 10.587 168.057 1.00 62.79 N ATOM 163 CA ALA A 21 19.870 10.019 168.796 1.00 62.31 C ATOM 164 C ALA A 21 20.378 9.212 170.006 1.00 63.54 C ATOM 165 O ALA A 21 19.817 9.283 171.094 1.00 63.39 O ATOM 166 CB ALA A 21 18.934 9.273 167.863 1.00 56.32 C ATOM 167 N ARG A 22 21.452 8.448 169.826 1.00 64.74 N ATOM 168 CA ARG A 22 22.094 7.716 170.937 1.00 64.52 C ATOM 169 C ARG A 22 22.456 8.646 172.091 1.00 64.80 C ATOM 170 O ARG A 22 22.005 8.473 173.228 1.00 63.49 O ATOM 171 CB ARG A 22 23.363 7.031 170.413 1.00 68.56 C ATOM 172 CG ARG A 22 23.718 5.727 171.101 1.00 77.01 C ATOM 173 CD ARG A 22 23.117 4.531 170.374 1.00 84.97 C ATOM 174 NE ARG A 22 23.122 4.686 168.916 1.00 92.99 N ATOM 175 CZ ARG A 22 24.220 4.802 168.169 1.00 94.83 C ATOM 176 NH1 ARG A 22 25.418 4.792 168.736 1.00 95.77 N ATOM 177 NH2 ARG A 22 24.115 4.932 166.851 1.00 93.62 N ATOM 178 N ILE A 23 23.252 9.658 171.759 1.00 60.92 N ATOM 179 CA ILE A 23 23.706 10.659 172.705 1.00 57.66 C ATOM 180 C ILE A 23 22.539 11.330 173.428 1.00 58.59 C ATOM 181 O ILE A 23 22.607 11.538 174.634 1.00 63.76 O ATOM 182 CB ILE A 23 24.566 11.717 171.990 1.00 53.28 C ATOM 183 CG1 ILE A 23 25.845 11.059 171.462 1.00 51.00 C ATOM 184 CG2 ILE A 23 24.881 12.885 172.927 1.00 53.38 C ATOM 185 CD1 ILE A 23 26.755 12.005 170.683 1.00 44.41 C ATOM 186 N LYS A 24 21.464 11.645 172.707 1.00 57.91 N ATOM 187 CA LYS A 24 20.296 12.285 173.322 1.00 58.10 C ATOM 188 C LYS A 24 19.526 11.370 174.282 1.00 57.01 C ATOM 189 O LYS A 24 18.816 11.846 175.177 1.00 56.40 O ATOM 190 CB LYS A 24 19.332 12.833 172.261 1.00 59.03 C ATOM 191 CG LYS A 24 19.895 13.940 171.383 1.00 63.63 C ATOM 192 CD LYS A 24 18.770 14.808 170.819 1.00 62.24 C ATOM 193 CE LYS A 24 17.669 13.962 170.183 1.00 62.02 C ATOM 194 NZ LYS A 24 16.500 14.784 169.765 1.00 59.48 N ATOM 195 N LYS A 25 19.636 10.060 174.079 1.00 53.33 N ATOM 196 CA LYS A 25 18.956 9.109 174.941 1.00 51.29 C ATOM 197 C LYS A 25 19.727 9.106 176.253 1.00 50.14 C ATOM 198 O LYS A 25 19.167 9.363 177.316 1.00 47.88 O ATOM 199 CB LYS A 25 18.973 7.716 174.323 1.00 51.49 C ATOM 200 CG LYS A 25 18.082 6.734 175.041 1.00 63.37 C ATOM 201 CD LYS A 25 18.242 5.347 174.460 1.00 71.56 C ATOM 202 CE LYS A 25 17.248 4.373 175.075 1.00 79.75 C ATOM 203 NZ LYS A 25 17.393 3.023 174.464 1.00 84.85 N ATOM 204 N LEU A 26 21.024 8.835 176.162 1.00 45.79 N ATOM 205 CA LEU A 26 21.895 8.819 177.323 1.00 41.25 C ATOM 206 C LEU A 26 21.746 10.132 178.097 1.00 45.39 C ATOM 207 O LEU A 26 21.623 10.124 179.322 1.00 53.27 O ATOM 208 CB LEU A 26 23.339 8.601 176.880 1.00 35.16 C ATOM 209 CG LEU A 26 24.478 8.842 177.867 1.00 43.08 C ATOM 210 CD1 LEU A 26 25.607 7.867 177.585 1.00 39.26 C ATOM 211 CD2 LEU A 26 24.965 10.293 177.787 1.00 43.47 C ATOM 212 N ILE A 27 21.738 11.254 177.388 1.00 40.61 N ATOM 213 CA ILE A 27 21.582 12.551 178.035 1.00 38.67 C ATOM 214 C ILE A 27 20.241 12.623 178.785 1.00 42.26 C ATOM 215 O ILE A 27 20.134 13.286 179.820 1.00 42.64 O ATOM 216 CB ILE A 27 21.732 13.712 177.002 1.00 37.33 C ATOM 217 CG1 ILE A 27 23.193 14.147 176.915 1.00 34.10 C ATOM 218 CG2 ILE A 27 20.834 14.900 177.342 1.00 38.96 C ATOM 219 CD1 ILE A 27 23.423 15.262 175.939 1.00 38.17 C ATOM 220 N GLY A 28 19.227 11.932 178.269 1.00 45.36 N ATOM 221 CA GLY A 28 17.923 11.929 178.912 1.00 48.77 C ATOM 222 C GLY A 28 18.091 11.253 180.284 1.00 53.23 C ATOM 223 O GLY A 28 17.766 11.832 181.318 1.00 54.75 O ATOM 224 N GLU A 29 18.635 10.024 180.266 1.00 54.46 N ATOM 225 CA GLU A 29 18.899 9.243 181.487 1.00 52.05 C ATOM 226 C GLU A 29 19.663 10.035 182.548 1.00 46.85 C ATOM 227 O GLU A 29 19.212 10.193 183.683 1.00 48.39 O ATOM 228 CB GLU A 29 19.689 7.968 181.172 1.00 55.17 C ATOM 229 CG GLU A 29 19.457 7.411 179.778 1.00 64.80 C ATOM 230 CD GLU A 29 18.516 6.222 179.774 1.00 69.75 C ATOM 231 OE1 GLU A 29 17.287 6.441 179.788 1.00 71.99 O ATOM 232 OE2 GLU A 29 19.007 5.073 179.757 1.00 72.58 O ATOM 233 N ALA A 30 20.831 10.528 182.159 1.00 40.90 N ATOM 234 CA ALA A 30 21.675 11.319 183.038 1.00 44.88 C ATOM 235 C ALA A 30 20.967 12.519 183.675 1.00 46.78 C ATOM 236 O ALA A 30 21.420 13.025 184.707 1.00 50.20 O ATOM 237 CB ALA A 30 22.920 11.774 182.297 1.00 44.02 C ATOM 238 N ARG A 31 19.898 13.015 183.057 1.00 46.42 N ATOM 239 CA ARG A 31 19.169 14.133 183.649 1.00 46.32 C ATOM 240 C ARG A 31 18.500 13.608 184.924 1.00 47.11 C ATOM 241 O ARG A 31 18.541 14.279 185.961 1.00 47.94 O ATOM 242 CB ARG A 31 18.128 14.709 182.675 1.00 44.62 C ATOM 243 N GLN A 32 17.979 12.376 184.867 1.00 43.08 N ATOM 244 CA GLN A 32 17.316 11.765 186.026 1.00 44.27 C ATOM 245 C GLN A 32 18.258 11.567 187.189 1.00 43.14 C ATOM 246 O GLN A 32 17.999 12.054 188.288 1.00 42.70 O ATOM 247 CB GLN A 32 16.643 10.436 185.677 1.00 48.18 C ATOM 248 CG GLN A 32 15.652 10.530 184.541 1.00 66.69 C ATOM 249 CD GLN A 32 14.636 11.649 184.714 1.00 75.44 C ATOM 250 OE1 GLN A 32 14.871 12.634 185.416 1.00 79.82 O ATOM 251 NE2 GLN A 32 13.502 11.513 184.051 1.00 79.99 N ATOM 252 N LEU A 33 19.372 10.891 186.941 1.00 38.57 N ATOM 253 CA LEU A 33 20.365 10.647 187.979 1.00 35.37 C ATOM 254 C LEU A 33 20.867 11.961 188.600 1.00 35.25 C ATOM 255 O LEU A 33 21.239 12.009 189.774 1.00 40.32 O ATOM 256 CB LEU A 33 21.528 9.844 187.394 1.00 29.37 C ATOM 257 CG LEU A 33 22.733 9.678 188.306 1.00 32.46 C ATOM 258 CD1 LEU A 33 22.318 8.973 189.588 1.00 35.24 C ATOM 259 CD2 LEU A 33 23.814 8.907 187.588 1.00 35.91 C ATOM 260 N LEU A 34 20.840 13.031 187.820 1.00 38.61 N ATOM 261 CA LEU A 34 21.303 14.336 188.286 1.00 38.01 C ATOM 262 C LEU A 34 20.298 14.957 189.246 1.00 35.44 C ATOM 263 O LEU A 34 20.684 15.629 190.198 1.00 37.72 O ATOM 264 CB LEU A 34 21.551 15.270 187.100 1.00 38.80 C ATOM 265 CG LEU A 34 22.847 16.062 187.231 1.00 41.69 C ATOM 266 CD1 LEU A 34 24.037 15.159 186.948 1.00 41.23 C ATOM 267 CD2 LEU A 34 22.830 17.225 186.283 1.00 42.02 C ATOM 268 N SER A 35 19.010 14.783 188.978 1.00 28.51 N ATOM 269 CA SER A 35 18.007 15.330 189.879 1.00 34.68 C ATOM 270 C SER A 35 18.051 14.490 191.157 1.00 36.11 C ATOM 271 O SER A 35 17.877 15.013 192.248 1.00 39.77 O ATOM 272 CB SER A 35 16.614 15.298 189.258 1.00 29.94 C ATOM 273 OG SER A 35 16.213 13.968 188.997 1.00 41.98 O ATOM 274 N GLY A 36 18.317 13.193 191.012 1.00 36.50 N ATOM 275 CA GLY A 36 18.413 12.301 192.156 1.00 34.84 C ATOM 276 C GLY A 36 19.568 12.700 193.063 1.00 36.78 C ATOM 277 O GLY A 36 19.467 12.581 194.285 1.00 33.45 O ATOM 278 N ILE A 37 20.671 13.161 192.475 1.00 32.41 N ATOM 279 CA ILE A 37 21.818 13.595 193.258 1.00 30.07 C ATOM 280 C ILE A 37 21.509 14.914 193.964 1.00 32.92 C ATOM 281 O ILE A 37 21.930 15.132 195.104 1.00 39.37 O ATOM 282 CB ILE A 37 23.057 13.745 192.388 1.00 28.66 C ATOM 283 CG1 ILE A 37 23.588 12.357 192.037 1.00 30.47 C ATOM 284 CG2 ILE A 37 24.131 14.565 193.098 1.00 22.97 C ATOM 285 CD1 ILE A 37 24.762 12.391 191.092 1.00 31.82 C ATOM 286 N VAL A 38 20.758 15.784 193.300 1.00 29.96 N ATOM 287 CA VAL A 38 20.401 17.063 193.896 1.00 27.61 C ATOM 288 C VAL A 38 19.402 16.896 195.051 1.00 29.57 C ATOM 289 O VAL A 38 19.531 17.554 196.086 1.00 32.02 O ATOM 290 CB VAL A 38 19.918 18.083 192.813 1.00 23.80 C ATOM 291 CG1 VAL A 38 19.229 19.298 193.448 1.00 18.14 C ATOM 292 CG2 VAL A 38 21.116 18.553 192.004 1.00 19.59 C ATOM 293 N GLN A 39 18.435 15.995 194.894 1.00 31.46 N ATOM 294 CA GLN A 39 17.451 15.752 195.938 1.00 32.35 C ATOM 295 C GLN A 39 18.170 15.129 197.128 1.00 35.58 C ATOM 296 O GLN A 39 17.978 15.554 198.264 1.00 36.13 O ATOM 297 CB GLN A 39 16.356 14.825 195.444 1.00 34.08 C ATOM 298 CG GLN A 39 15.143 14.798 196.349 1.00 56.24 C ATOM 299 CD GLN A 39 14.067 13.873 195.820 1.00 70.12 C ATOM 300 OE1 GLN A 39 14.039 13.547 194.626 1.00 75.98 O ATOM 301 NE2 GLN A 39 13.171 13.441 196.700 1.00 76.71 N ATOM 302 N GLN A 40 19.024 14.147 196.854 1.00 33.82 N ATOM 303 CA GLN A 40 19.807 13.468 197.882 1.00 27.91 C ATOM 304 C GLN A 40 20.554 14.470 198.742 1.00 29.63 C ATOM 305 O GLN A 40 20.699 14.279 199.944 1.00 36.78 O ATOM 306 CB GLN A 40 20.830 12.547 197.232 1.00 29.95 C ATOM 307 CG GLN A 40 21.707 11.810 198.215 1.00 24.70 C ATOM 308 CD GLN A 40 20.949 10.729 198.924 1.00 26.82 C ATOM 309 OE1 GLN A 40 19.836 10.950 199.411 1.00 33.78 O ATOM 310 NE2 GLN A 40 21.506 9.529 198.928 1.00 25.88 N ATOM 311 N GLN A 41 21.043 15.534 198.127 1.00 24.40 N ATOM 312 CA GLN A 41 21.784 16.533 198.876 1.00 29.32 C ATOM 313 C GLN A 41 20.901 17.399 199.747 1.00 32.01 C ATOM 314 O GLN A 41 21.356 17.917 200.765 1.00 27.54 O ATOM 315 CB GLN A 41 22.610 17.396 197.947 1.00 29.61 C ATOM 316 CG GLN A 41 23.569 16.577 197.166 1.00 32.24 C ATOM 317 CD GLN A 41 24.742 17.371 196.736 1.00 36.32 C ATOM 318 OE1 GLN A 41 24.603 18.347 196.009 1.00 39.71 O ATOM 319 NE2 GLN A 41 25.914 16.990 197.211 1.00 38.87 N ATOM 320 N ASN A 42 19.656 17.603 199.326 1.00 32.80 N ATOM 321 CA ASN A 42 18.739 18.390 200.133 1.00 32.65 C ATOM 322 C ASN A 42 18.420 17.558 201.386 1.00 33.20 C ATOM 323 O ASN A 42 18.278 18.089 202.490 1.00 31.10 O ATOM 324 CB ASN A 42 17.450 18.691 199.367 1.00 32.57 C ATOM 325 CG ASN A 42 16.426 19.420 200.229 1.00 40.28 C ATOM 326 OD1 ASN A 42 15.325 18.931 200.463 1.00 45.50 O ATOM 327 ND2 ASN A 42 16.811 20.583 200.742 1.00 44.39 N ATOM 328 N ASN A 43 18.351 16.244 201.192 1.00 28.40 N ATOM 329 CA ASN A 43 18.069 15.304 202.256 1.00 25.37 C ATOM 330 C ASN A 43 19.223 15.242 203.234 1.00 29.95 C ATOM 331 O ASN A 43 19.034 15.353 204.449 1.00 32.34 O ATOM 332 CB ASN A 43 17.814 13.926 201.682 1.00 21.58 C ATOM 333 CG ASN A 43 16.388 13.746 201.249 1.00 24.03 C ATOM 334 OD1 ASN A 43 15.507 14.533 201.606 1.00 33.17 O ATOM 335 ND2 ASN A 43 16.140 12.706 200.476 1.00 36.65 N ATOM 336 N LEU A 44 20.428 15.087 202.700 1.00 29.05 N ATOM 337 CA LEU A 44 21.627 15.020 203.524 1.00 27.20 C ATOM 338 C LEU A 44 21.784 16.294 204.365 1.00 28.70 C ATOM 339 O LEU A 44 22.236 16.240 205.507 1.00 32.41 O ATOM 340 CB LEU A 44 22.844 14.810 202.623 1.00 26.97 C ATOM 341 CG LEU A 44 23.539 13.443 202.617 1.00 30.90 C ATOM 342 CD1 LEU A 44 22.548 12.298 202.681 1.00 29.54 C ATOM 343 CD2 LEU A 44 24.438 13.340 201.399 1.00 26.78 C ATOM 344 N LEU A 45 21.387 17.432 203.805 1.00 25.88 N ATOM 345 CA LEU A 45 21.477 18.714 204.506 1.00 23.76 C ATOM 346 C LEU A 45 20.454 18.830 205.634 1.00 26.74 C ATOM 347 O LEU A 45 20.745 19.402 206.683 1.00 26.72 O ATOM 348 CB LEU A 45 21.275 19.884 203.530 1.00 19.83 C ATOM 349 CG LEU A 45 21.285 21.286 204.150 1.00 19.81 C ATOM 350 CD1 LEU A 45 22.608 21.546 204.831 1.00 17.59 C ATOM 351 CD2 LEU A 45 21.031 22.340 203.101 1.00 22.09 C ATOM 352 N ARG A 46 19.245 18.335 205.395 1.00 27.71 N ATOM 353 CA ARG A 46 18.190 18.404 206.387 1.00 27.43 C ATOM 354 C ARG A 46 18.515 17.537 207.572 1.00 28.88 C ATOM 355 O ARG A 46 18.185 17.896 208.690 1.00 31.72 O ATOM 356 CB ARG A 46 16.850 18.038 205.768 1.00 31.90 C ATOM 357 CG ARG A 46 16.258 19.188 204.962 1.00 40.33 C ATOM 358 CD ARG A 46 15.165 18.733 204.002 1.00 49.83 C ATOM 359 NE ARG A 46 14.039 18.078 204.667 1.00 58.36 N ATOM 360 CZ ARG A 46 13.270 17.148 204.101 1.00 63.95 C ATOM 361 NH1 ARG A 46 13.502 16.747 202.850 1.00 62.03 N ATOM 362 NH2 ARG A 46 12.262 16.619 204.783 1.00 66.30 N ATOM 363 N ALA A 47 19.193 16.419 207.330 1.00 25.92 N ATOM 364 CA ALA A 47 19.596 15.517 208.406 1.00 26.58 C ATOM 365 C ALA A 47 20.629 16.244 209.245 1.00 26.11 C ATOM 366 O ALA A 47 20.539 16.270 210.467 1.00 31.65 O ATOM 367 CB ALA A 47 20.198 14.247 207.844 1.00 22.14 C ATOM 368 N ILE A 48 21.595 16.852 208.568 1.00 26.91 N ATOM 369 CA ILE A 48 22.660 17.619 209.211 1.00 25.92 C ATOM 370 C ILE A 48 22.084 18.768 210.063 1.00 26.99 C ATOM 371 O ILE A 48 22.564 19.038 211.170 1.00 32.03 O ATOM 372 CB ILE A 48 23.671 18.138 208.146 1.00 23.21 C ATOM 373 CG1 ILE A 48 24.524 16.973 207.631 1.00 22.71 C ATOM 374 CG2 ILE A 48 24.534 19.256 208.717 1.00 23.39 C ATOM 375 CD1 ILE A 48 25.486 17.346 206.551 1.00 21.04 C ATOM 376 N GLU A 49 21.037 19.419 209.570 1.00 26.11 N ATOM 377 CA GLU A 49 20.402 20.498 210.314 1.00 28.36 C ATOM 378 C GLU A 49 19.837 19.917 211.608 1.00 29.81 C ATOM 379 O GLU A 49 20.157 20.386 212.697 1.00 35.61 O ATOM 380 CB GLU A 49 19.247 21.097 209.527 1.00 29.37 C ATOM 381 CG GLU A 49 19.580 22.292 208.715 1.00 43.03 C ATOM 382 CD GLU A 49 18.333 22.897 208.119 1.00 55.52 C ATOM 383 OE1 GLU A 49 17.593 23.575 208.867 1.00 61.09 O ATOM 384 OE2 GLU A 49 18.084 22.693 206.910 1.00 53.39 O ATOM 385 N ALA A 50 18.984 18.903 211.472 1.00 27.78 N ATOM 386 CA ALA A 50 18.344 18.231 212.598 1.00 27.73 C ATOM 387 C ALA A 50 19.373 17.738 213.613 1.00 32.50 C ATOM 388 O ALA A 50 19.191 17.905 214.835 1.00 35.77 O ATOM 389 CB ALA A 50 17.505 17.074 212.096 1.00 23.63 C ATOM 390 N GLN A 51 20.474 17.177 213.123 1.00 29.18 N ATOM 391 CA GLN A 51 21.503 16.694 214.031 1.00 29.18 C ATOM 392 C GLN A 51 22.113 17.821 214.820 1.00 29.83 C ATOM 393 O GLN A 51 22.515 17.632 215.974 1.00 32.51 O ATOM 394 CB GLN A 51 22.559 15.882 213.299 1.00 30.95 C ATOM 395 CG GLN A 51 22.047 14.488 212.941 1.00 34.71 C ATOM 396 CD GLN A 51 23.151 13.541 212.550 1.00 35.50 C ATOM 397 OE1 GLN A 51 24.248 13.963 212.192 1.00 35.40 O ATOM 398 NE2 GLN A 51 22.872 12.246 212.617 1.00 40.81 N ATOM 399 N GLN A 52 22.132 19.008 214.228 1.00 30.62 N ATOM 400 CA GLN A 52 22.656 20.160 214.937 1.00 32.65 C ATOM 401 C GLN A 52 21.693 20.565 216.066 1.00 31.24 C ATOM 402 O GLN A 52 22.146 20.962 217.125 1.00 31.16 O ATOM 403 CB GLN A 52 22.911 21.329 213.985 1.00 30.08 C ATOM 404 CG GLN A 52 23.562 22.528 214.663 1.00 34.29 C ATOM 405 CD GLN A 52 24.915 22.201 215.261 1.00 36.48 C ATOM 406 OE1 GLN A 52 25.496 21.154 214.980 1.00 43.61 O ATOM 407 NE2 GLN A 52 25.424 23.096 216.092 1.00 28.70 N ATOM 408 N HIS A 53 20.375 20.472 215.849 1.00 32.59 N ATOM 409 CA HIS A 53 19.426 20.831 216.905 1.00 38.84 C ATOM 410 C HIS A 53 19.621 19.845 218.016 1.00 39.46 C ATOM 411 O HIS A 53 19.619 20.217 219.189 1.00 38.04 O ATOM 412 CB HIS A 53 17.970 20.787 216.443 1.00 43.75 C ATOM 413 CG HIS A 53 17.613 21.866 215.470 1.00 63.98 C ATOM 414 ND1 HIS A 53 17.735 23.211 215.771 1.00 69.16 N ATOM 415 CD2 HIS A 53 17.203 21.803 214.190 1.00 71.09 C ATOM 416 CE1 HIS A 53 17.416 23.924 214.708 1.00 70.53 C ATOM 417 NE2 HIS A 53 17.088 23.094 213.731 1.00 73.11 N ATOM 418 N LEU A 54 19.803 18.586 217.637 1.00 37.55 N ATOM 419 CA LEU A 54 20.030 17.533 218.603 1.00 34.61 C ATOM 420 C LEU A 54 21.284 17.879 219.429 1.00 36.51 C ATOM 421 O LEU A 54 21.218 17.884 220.664 1.00 44.80 O ATOM 422 CB LEU A 54 20.176 16.186 217.899 1.00 29.80 C ATOM 423 CG LEU A 54 19.634 14.993 218.685 1.00 35.65 C ATOM 424 CD1 LEU A 54 18.145 15.185 218.960 1.00 35.38 C ATOM 425 CD2 LEU A 54 19.863 13.714 217.898 1.00 40.01 C ATOM 426 N LEU A 55 22.387 18.242 218.765 1.00 32.35 N ATOM 427 CA LEU A 55 23.639 18.607 219.455 1.00 29.13 C ATOM 428 C LEU A 55 23.460 19.814 220.380 1.00 31.32 C ATOM 429 O LEU A 55 24.082 19.890 221.447 1.00 35.94 O ATOM 430 CB LEU A 55 24.755 18.884 218.443 1.00 30.94 C ATOM 431 CG LEU A 55 25.562 17.665 217.985 1.00 34.59 C ATOM 432 CD1 LEU A 55 26.381 17.994 216.742 1.00 30.34 C ATOM 433 CD2 LEU A 55 26.464 17.211 219.113 1.00 28.22 C ATOM 434 N GLN A 56 22.629 20.769 219.969 1.00 30.41 N ATOM 435 CA GLN A 56 22.369 21.939 220.805 1.00 31.35 C ATOM 436 C GLN A 56 21.607 21.514 222.074 1.00 29.63 C ATOM 437 O GLN A 56 21.874 22.007 223.169 1.00 29.27 O ATOM 438 CB GLN A 56 21.594 23.036 220.048 1.00 37.19 C ATOM 439 CG GLN A 56 22.388 23.759 218.959 1.00 49.64 C ATOM 440 CD GLN A 56 23.796 24.162 219.403 1.00 60.81 C ATOM 441 OE1 GLN A 56 24.129 24.136 220.587 1.00 68.76 O ATOM 442 NE2 GLN A 56 24.627 24.548 218.443 1.00 68.74 N ATOM 443 N LEU A 57 20.697 20.557 221.923 1.00 25.51 N ATOM 444 CA LEU A 57 19.914 20.058 223.037 1.00 23.68 C ATOM 445 C LEU A 57 20.821 19.349 224.035 1.00 30.22 C ATOM 446 O LEU A 57 20.656 19.487 225.250 1.00 32.51 O ATOM 447 CB LEU A 57 18.813 19.103 222.548 1.00 20.06 C ATOM 448 CG LEU A 57 17.615 19.787 221.874 1.00 28.07 C ATOM 449 CD1 LEU A 57 16.584 18.768 221.465 1.00 28.32 C ATOM 450 CD2 LEU A 57 17.004 20.799 222.833 1.00 29.19 C ATOM 451 N THR A 58 21.802 18.609 223.542 1.00 26.72 N ATOM 452 CA THR A 58 22.677 17.904 224.459 1.00 28.07 C ATOM 453 C THR A 58 23.689 18.802 225.194 1.00 28.37 C ATOM 454 O THR A 58 24.089 18.500 226.327 1.00 28.39 O ATOM 455 CB THR A 58 23.363 16.723 223.774 1.00 22.10 C ATOM 456 OG1 THR A 58 24.179 17.197 222.703 1.00 17.92 O ATOM 457 CG2 THR A 58 22.312 15.733 223.221 1.00 16.15 C ATOM 458 N VAL A 59 24.102 19.897 224.555 1.00 29.42 N ATOM 459 CA VAL A 59 25.043 20.835 225.178 1.00 27.11 C ATOM 460 C VAL A 59 24.308 21.540 226.304 1.00 27.67 C ATOM 461 O VAL A 59 24.888 21.864 227.328 1.00 30.59 O ATOM 462 CB VAL A 59 25.564 21.894 224.177 1.00 26.57 C ATOM 463 CG1 VAL A 59 26.103 23.133 224.927 1.00 18.48 C ATOM 464 CG2 VAL A 59 26.654 21.292 223.338 1.00 23.05 C ATOM 465 N TRP A 60 23.033 21.820 226.079 1.00 29.14 N ATOM 466 CA TRP A 60 22.218 22.463 227.086 1.00 33.81 C ATOM 467 C TRP A 60 22.030 21.450 228.220 1.00 33.26 C ATOM 468 O TRP A 60 22.177 21.805 229.386 1.00 37.07 O ATOM 469 CB TRP A 60 20.880 22.913 226.488 1.00 31.08 C ATOM 470 CG TRP A 60 19.989 23.666 227.435 1.00 38.92 C ATOM 471 CD1 TRP A 60 19.921 25.026 227.602 1.00 37.96 C ATOM 472 CD2 TRP A 60 19.006 23.104 228.315 1.00 36.94 C ATOM 473 NE1 TRP A 60 18.948 25.340 228.526 1.00 39.40 N ATOM 474 CE2 TRP A 60 18.372 24.182 228.982 1.00 38.48 C ATOM 475 CE3 TRP A 60 18.597 21.799 228.608 1.00 40.53 C ATOM 476 CZ2 TRP A 60 17.352 23.988 229.928 1.00 44.19 C ATOM 477 CZ3 TRP A 60 17.583 21.602 229.553 1.00 46.94 C ATOM 478 CH2 TRP A 60 16.971 22.696 230.200 1.00 45.56 C ATOM 479 N GLY A 61 21.762 20.190 227.871 1.00 30.10 N ATOM 480 CA GLY A 61 21.586 19.144 228.869 1.00 29.19 C ATOM 481 C GLY A 61 22.810 19.052 229.765 1.00 33.64 C ATOM 482 O GLY A 61 22.701 19.003 230.992 1.00 35.07 O ATOM 483 N ILE A 62 23.983 19.062 229.146 1.00 30.58 N ATOM 484 CA ILE A 62 25.238 19.011 229.862 1.00 27.50 C ATOM 485 C ILE A 62 25.416 20.235 230.764 1.00 32.23 C ATOM 486 O ILE A 62 25.773 20.078 231.927 1.00 38.20 O ATOM 487 CB ILE A 62 26.409 18.888 228.885 1.00 25.84 C ATOM 488 CG1 ILE A 62 26.394 17.509 228.233 1.00 25.12 C ATOM 489 CG2 ILE A 62 27.735 19.113 229.581 1.00 16.84 C ATOM 490 CD1 ILE A 62 27.624 17.260 227.358 1.00 29.40 C ATOM 491 N LYS A 63 25.147 21.439 230.258 1.00 33.84 N ATOM 492 CA LYS A 63 25.282 22.656 231.070 1.00 35.04 C ATOM 493 C LYS A 63 24.430 22.619 232.338 1.00 39.83 C ATOM 494 O LYS A 63 24.870 23.067 233.407 1.00 41.37 O ATOM 495 CB LYS A 63 24.951 23.906 230.260 1.00 33.72 C ATOM 496 CG LYS A 63 26.151 24.485 229.551 1.00 45.00 C ATOM 497 CD LYS A 63 25.775 25.749 228.787 1.00 54.33 C ATOM 498 CE LYS A 63 26.988 26.402 228.122 1.00 59.27 C ATOM 499 NZ LYS A 63 27.531 25.650 226.946 1.00 68.98 N ATOM 500 N GLN A 64 23.225 22.062 232.229 1.00 38.16 N ATOM 501 CA GLN A 64 22.337 21.959 233.382 1.00 39.41 C ATOM 502 C GLN A 64 22.952 21.025 234.413 1.00 40.03 C ATOM 503 O GLN A 64 23.016 21.365 235.595 1.00 43.33 O ATOM 504 CB GLN A 64 20.948 21.462 232.983 1.00 41.37 C ATOM 505 CG GLN A 64 20.210 22.369 232.009 1.00 46.06 C ATOM 506 CD GLN A 64 20.191 23.832 232.433 1.00 52.86 C ATOM 507 OE1 GLN A 64 19.670 24.187 233.496 1.00 55.98 O ATOM 508 NE2 GLN A 64 20.764 24.691 231.593 1.00 54.15 N ATOM 509 N LEU A 65 23.443 19.871 233.972 1.00 35.68 N ATOM 510 CA LEU A 65 24.072 18.947 234.904 1.00 33.63 C ATOM 511 C LEU A 65 25.297 19.573 235.552 1.00 34.98 C ATOM 512 O LEU A 65 25.658 19.199 236.657 1.00 39.11 O ATOM 513 CB LEU A 65 24.438 17.625 234.242 1.00 27.23 C ATOM 514 CG LEU A 65 23.259 16.812 233.705 1.00 30.54 C ATOM 515 CD1 LEU A 65 23.665 15.368 233.613 1.00 31.56 C ATOM 516 CD2 LEU A 65 22.053 16.951 234.610 1.00 27.86 C ATOM 517 N GLN A 66 25.932 20.532 234.891 1.00 33.56 N ATOM 518 CA GLN A 66 27.085 21.181 235.495 1.00 37.89 C ATOM 519 C GLN A 66 26.631 22.017 236.675 1.00 38.51 C ATOM 520 O GLN A 66 27.273 22.015 237.716 1.00 42.19 O ATOM 521 CB GLN A 66 27.787 22.082 234.507 1.00 37.45 C ATOM 522 CG GLN A 66 28.655 21.350 233.550 1.00 53.09 C ATOM 523 CD GLN A 66 28.860 22.145 232.300 1.00 60.42 C ATOM 524 OE1 GLN A 66 29.007 23.362 232.343 1.00 66.78 O ATOM 525 NE2 GLN A 66 28.840 21.473 231.167 1.00 66.75 N ATOM 526 N ALA A 67 25.529 22.740 236.497 1.00 39.34 N ATOM 527 CA ALA A 67 24.977 23.586 237.551 1.00 36.54 C ATOM 528 C ALA A 67 24.545 22.723 238.736 1.00 40.26 C ATOM 529 O ALA A 67 25.010 22.927 239.858 1.00 44.31 O ATOM 530 CB ALA A 67 23.785 24.415 237.020 1.00 26.60 C ATOM 531 N ARG A 68 23.706 21.724 238.482 1.00 40.70 N ATOM 532 CA ARG A 68 23.230 20.858 239.557 1.00 41.56 C ATOM 533 C ARG A 68 24.354 20.166 240.343 1.00 45.93 C ATOM 534 O ARG A 68 24.289 20.078 241.570 1.00 56.02 O ATOM 535 CB ARG A 68 22.208 19.831 239.039 1.00 38.79 C ATOM 536 CG ARG A 68 20.987 20.443 238.350 1.00 37.35 C ATOM 537 CD ARG A 68 19.715 19.634 238.618 1.00 46.91 C ATOM 538 NE ARG A 68 19.796 18.235 238.179 1.00 51.47 N ATOM 539 CZ ARG A 68 18.834 17.327 238.356 1.00 54.55 C ATOM 540 NH1 ARG A 68 17.712 17.659 238.973 1.00 56.50 N ATOM 541 NH2 ARG A 68 18.980 16.090 237.895 1.00 55.64 N ATOM 542 N ILE A 69 25.396 19.701 239.664 1.00 46.79 N ATOM 543 CA ILE A 69 26.486 19.041 240.372 1.00 45.05 C ATOM 544 C ILE A 69 27.367 20.061 241.078 1.00 45.95 C ATOM 545 O ILE A 69 27.941 19.747 242.110 1.00 51.35 O ATOM 546 CB ILE A 69 27.327 18.115 239.443 1.00 49.21 C ATOM 547 CG1 ILE A 69 27.884 16.933 240.234 1.00 54.87 C ATOM 548 CG2 ILE A 69 28.479 18.869 238.812 1.00 48.98 C ATOM 549 CD1 ILE A 69 29.105 17.252 241.072 1.00 60.04 C ATOM 550 N LEU A 70 27.492 21.266 240.531 1.00 45.60 N ATOM 551 CA LEU A 70 28.303 22.299 241.173 1.00 48.77 C ATOM 552 C LEU A 70 27.670 22.647 242.519 1.00 54.58 C ATOM 553 O LEU A 70 28.354 22.686 243.539 1.00 57.39 O ATOM 554 CB LEU A 70 28.375 23.557 240.316 1.00 47.71 C ATOM 555 CG LEU A 70 28.985 24.768 241.027 1.00 50.83 C ATOM 556 CD1 LEU A 70 30.497 24.638 241.046 1.00 47.58 C ATOM 557 CD2 LEU A 70 28.560 26.056 240.340 1.00 53.31 C ATOM 558 N ALA A 71 26.364 22.909 242.511 1.00 57.23 N ATOM 559 CA ALA A 71 25.623 23.242 243.726 1.00 56.98 C ATOM 560 C ALA A 71 25.741 22.119 244.757 1.00 58.48 C ATOM 561 O ALA A 71 26.104 22.378 245.904 1.00 63.83 O ATOM 562 CB ALA A 71 24.152 23.535 243.411 1.00 53.21 C ATOM 563 N VAL A 72 25.450 20.881 244.362 1.00 58.33 N ATOM 564 CA VAL A 72 25.572 19.764 245.294 1.00 60.42 C ATOM 565 C VAL A 72 26.971 19.746 245.927 1.00 66.09 C ATOM 566 O VAL A 72 27.081 19.546 247.135 1.00 71.90 O ATOM 567 CB VAL A 72 25.216 18.389 244.639 1.00 58.26 C ATOM 568 CG1 VAL A 72 25.836 17.222 245.419 1.00 49.08 C ATOM 569 CG2 VAL A 72 23.711 18.215 244.604 1.00 53.22 C ATOM 570 N GLU A 73 28.032 20.007 245.159 1.00 67.83 N ATOM 571 CA GLU A 73 29.365 20.015 245.771 1.00 72.39 C ATOM 572 C GLU A 73 29.560 21.189 246.750 1.00 75.88 C ATOM 573 O GLU A 73 30.251 21.069 247.764 1.00 78.04 O ATOM 574 CB GLU A 73 30.504 19.730 244.768 1.00 71.50 C ATOM 575 CG GLU A 73 30.561 20.635 243.544 1.00 74.28 C ATOM 576 CD GLU A 73 31.581 20.122 242.516 1.00 75.72 C ATOM 577 OE1 GLU A 73 31.701 18.852 242.309 1.00 69.37 O ATOM 578 OE2 GLU A 73 32.319 20.950 241.861 1.00 77.44 O ATOM 579 N ARG A 74 28.945 22.316 246.518 1.00 78.45 N ATOM 580 CA ARG A 74 29.024 23.431 247.500 1.00 78.89 C ATOM 581 C ARG A 74 28.341 23.071 248.818 1.00 78.90 C ATOM 582 O ARG A 74 28.908 23.257 249.904 1.00 79.46 O ATOM 583 CB ARG A 74 28.352 24.667 246.939 1.00 82.91 C ATOM 584 CG ARG A 74 29.244 25.462 245.991 1.00 92.13 C ATOM 585 CD ARG A 74 28.564 26.730 245.483 1.00100.30 C ATOM 586 NE ARG A 74 29.376 27.470 244.513 1.00108.55 N ATOM 587 CZ ARG A 74 29.014 28.645 243.989 1.00113.03 C ATOM 588 NH1 ARG A 74 27.856 29.224 244.334 1.00115.47 N ATOM 589 NH2 ARG A 74 29.750 29.328 243.104 1.00114.76 N ATOM 590 N TYR A 75 27.128 22.573 248.703 1.00 75.59 N ATOM 591 CA TYR A 75 26.347 22.173 249.878 1.00 72.98 C ATOM 592 C TYR A 75 27.222 21.284 250.773 1.00 72.58 C ATOM 593 O TYR A 75 27.264 21.443 251.997 1.00 74.91 O ATOM 594 CB TYR A 75 25.088 21.417 249.440 1.00 69.89 C ATOM 595 N LEU A 76 27.923 20.381 250.117 1.00 70.37 N ATOM 596 CA LEU A 76 28.816 19.407 250.774 1.00 70.96 C ATOM 597 C LEU A 76 30.145 20.021 251.353 1.00 77.93 C ATOM 598 O LEU A 76 30.765 19.447 252.261 1.00 85.29 O ATOM 599 CB LEU A 76 29.309 18.368 249.756 1.00 64.97 C ATOM 600 CG LEU A 76 28.330 17.221 249.512 1.00 65.11 C ATOM 601 CD1 LEU A 76 29.032 15.883 249.258 1.00 62.04 C ATOM 602 CD2 LEU A 76 27.386 16.979 250.688 1.00 61.69 C ATOM 603 N LYS A 77 30.552 21.205 250.863 1.00 82.59 N ATOM 604 CA LYS A 77 31.959 21.738 251.053 1.00 89.74 C ATOM 605 C LYS A 77 32.390 22.628 252.240 1.00 95.24 C ATOM 606 O LYS A 77 32.196 22.209 253.405 1.00 99.15 O ATOM 607 CB LYS A 77 32.352 22.615 249.862 1.00 87.28 C