>>1GK4:HELIX    2   2 VAL B  330  ARG B  401  1                                  72    
VDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYR
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 2 2 VAL B 330 ARG B 401 1 72 ATOM 664 N VAL B 330 -6.175 22.374 29.811 1.00 93.05 N ATOM 665 CA VAL B 330 -6.202 23.693 30.427 1.00 91.71 C ATOM 666 C VAL B 330 -7.375 23.622 31.405 1.00 93.42 C ATOM 667 O VAL B 330 -7.442 24.367 32.385 1.00 93.35 O ATOM 668 CB VAL B 330 -6.471 24.791 29.388 1.00 87.86 C ATOM 669 CG1 VAL B 330 -7.674 24.404 28.536 1.00 87.32 C ATOM 670 CG2 VAL B 330 -6.716 26.116 30.088 1.00 84.85 C ATOM 671 N ASP B 331 -8.300 22.712 31.112 1.00 94.96 N ATOM 672 CA ASP B 331 -9.462 22.491 31.957 1.00 95.52 C ATOM 673 C ASP B 331 -8.988 21.503 33.014 1.00 92.66 C ATOM 674 O ASP B 331 -9.496 21.469 34.139 1.00 93.04 O ATOM 675 CB ASP B 331 -10.617 21.894 31.144 1.00100.82 C ATOM 676 CG ASP B 331 -10.960 22.728 29.922 1.00107.66 C ATOM 677 OD1 ASP B 331 -10.927 23.975 30.023 1.00111.63 O ATOM 678 OD2 ASP B 331 -11.272 22.142 28.861 1.00111.32 O ATOM 679 N ALA B 332 -7.989 20.708 32.640 1.00 88.86 N ATOM 680 CA ALA B 332 -7.407 19.721 33.540 1.00 85.22 C ATOM 681 C ALA B 332 -6.565 20.403 34.632 1.00 82.17 C ATOM 682 O ALA B 332 -6.615 20.009 35.800 1.00 78.71 O ATOM 683 CB ALA B 332 -6.551 18.743 32.745 1.00 84.20 C ATOM 684 N LEU B 333 -5.794 21.420 34.244 1.00 78.93 N ATOM 685 CA LEU B 333 -4.957 22.157 35.190 1.00 74.54 C ATOM 686 C LEU B 333 -5.807 23.050 36.086 1.00 73.13 C ATOM 687 O LEU B 333 -5.633 23.055 37.300 1.00 73.45 O ATOM 688 CB LEU B 333 -3.918 23.010 34.458 1.00 73.65 C ATOM 689 CG LEU B 333 -2.749 22.276 33.789 1.00 77.26 C ATOM 690 CD1 LEU B 333 -1.804 23.277 33.118 1.00 77.23 C ATOM 691 CD2 LEU B 333 -1.998 21.467 34.830 1.00 77.17 C ATOM 692 N LYS B 334 -6.717 23.812 35.491 1.00 69.89 N ATOM 693 CA LYS B 334 -7.590 24.680 36.270 1.00 70.82 C ATOM 694 C LYS B 334 -8.338 23.821 37.290 1.00 70.57 C ATOM 695 O LYS B 334 -8.685 24.287 38.384 1.00 69.09 O ATOM 696 CB LYS B 334 -8.598 25.385 35.353 1.00 75.00 C ATOM 697 CG LYS B 334 -8.033 26.543 34.531 1.00 79.22 C ATOM 698 CD LYS B 334 -8.237 27.894 35.225 1.00 83.88 C ATOM 699 CE LYS B 334 -7.492 27.983 36.560 1.00 87.65 C ATOM 700 NZ LYS B 334 -7.796 29.246 37.299 1.00 90.46 N ATOM 701 N GLY B 335 -8.580 22.563 36.921 1.00 70.67 N ATOM 702 CA GLY B 335 -9.280 21.644 37.803 1.00 68.00 C ATOM 703 C GLY B 335 -8.398 21.182 38.948 1.00 69.23 C ATOM 704 O GLY B 335 -8.742 21.369 40.118 1.00 67.00 O ATOM 705 N THR B 336 -7.258 20.580 38.617 1.00 68.66 N ATOM 706 CA THR B 336 -6.317 20.100 39.627 1.00 71.39 C ATOM 707 C THR B 336 -5.868 21.236 40.559 1.00 70.65 C ATOM 708 O THR B 336 -5.957 21.126 41.778 1.00 70.28 O ATOM 709 CB THR B 336 -5.069 19.480 38.965 1.00 73.97 C ATOM 710 OG1 THR B 336 -5.466 18.396 38.116 1.00 76.56 O ATOM 711 CG2 THR B 336 -4.095 18.969 40.026 1.00 75.03 C ATOM 712 N ASN B 337 -5.389 22.328 39.975 1.00 71.38 N ATOM 713 CA ASN B 337 -4.931 23.474 40.751 1.00 71.48 C ATOM 714 C ASN B 337 -5.957 23.967 41.759 1.00 74.43 C ATOM 715 O ASN B 337 -5.648 24.119 42.940 1.00 74.88 O ATOM 716 CB ASN B 337 -4.539 24.623 39.820 1.00 65.45 C ATOM 717 CG ASN B 337 -3.175 24.420 39.199 1.00 60.86 C ATOM 718 OD1 ASN B 337 -2.591 23.340 39.291 1.00 58.63 O ATOM 719 ND2 ASN B 337 -2.663 25.453 38.557 1.00 58.24 N ATOM 720 N GLU B 338 -7.177 24.219 41.301 1.00 77.95 N ATOM 721 CA GLU B 338 -8.217 24.703 42.201 1.00 80.15 C ATOM 722 C GLU B 338 -8.540 23.681 43.291 1.00 75.08 C ATOM 723 O GLU B 338 -9.006 24.036 44.379 1.00 73.49 O ATOM 724 CB GLU B 338 -9.480 25.051 41.413 1.00 89.97 C ATOM 725 CG GLU B 338 -10.004 26.450 41.719 1.00104.82 C ATOM 726 CD GLU B 338 -9.089 27.550 41.189 1.00113.25 C ATOM 727 OE1 GLU B 338 -7.862 27.314 41.077 1.00119.19 O ATOM 728 OE2 GLU B 338 -9.596 28.657 40.895 1.00117.92 O ATOM 729 N SER B 339 -8.287 22.410 42.992 1.00 69.97 N ATOM 730 CA SER B 339 -8.531 21.339 43.950 1.00 66.12 C ATOM 731 C SER B 339 -7.503 21.453 45.081 1.00 65.89 C ATOM 732 O SER B 339 -7.863 21.625 46.251 1.00 64.43 O ATOM 733 CB SER B 339 -8.397 19.983 43.257 1.00 64.51 C ATOM 734 OG SER B 339 -8.613 18.916 44.160 1.00 65.19 O ATOM 735 N LEU B 340 -6.223 21.359 44.716 1.00 64.19 N ATOM 736 CA LEU B 340 -5.120 21.464 45.672 1.00 62.95 C ATOM 737 C LEU B 340 -5.276 22.732 46.504 1.00 61.97 C ATOM 738 O LEU B 340 -5.315 22.692 47.735 1.00 58.70 O ATOM 739 CB LEU B 340 -3.781 21.522 44.927 1.00 60.32 C ATOM 740 CG LEU B 340 -3.310 20.285 44.161 1.00 62.36 C ATOM 741 CD1 LEU B 340 -2.141 20.643 43.255 1.00 62.99 C ATOM 742 CD2 LEU B 340 -2.914 19.201 45.151 1.00 63.58 C ATOM 743 N GLU B 341 -5.360 23.850 45.793 1.00 64.13 N ATOM 744 CA GLU B 341 -5.506 25.182 46.363 1.00 64.14 C ATOM 745 C GLU B 341 -6.522 25.286 47.503 1.00 65.61 C ATOM 746 O GLU B 341 -6.372 26.114 48.400 1.00 65.26 O ATOM 747 CB GLU B 341 -5.863 26.152 45.240 1.00 68.06 C ATOM 748 CG GLU B 341 -5.836 27.616 45.609 1.00 74.29 C ATOM 749 CD GLU B 341 -5.863 28.490 44.372 1.00 79.69 C ATOM 750 OE1 GLU B 341 -6.653 28.183 43.452 1.00 82.29 O ATOM 751 OE2 GLU B 341 -5.099 29.478 44.316 1.00 82.57 O ATOM 752 N ARG B 342 -7.557 24.458 47.489 1.00 68.45 N ATOM 753 CA ARG B 342 -8.525 24.522 48.575 1.00 71.58 C ATOM 754 C ARG B 342 -8.208 23.457 49.634 1.00 70.29 C ATOM 755 O ARG B 342 -8.491 23.644 50.828 1.00 67.32 O ATOM 756 CB ARG B 342 -9.945 24.335 48.055 1.00 77.36 C ATOM 757 CG ARG B 342 -10.992 24.606 49.129 1.00 88.67 C ATOM 758 CD ARG B 342 -12.102 23.559 49.127 1.00 98.24 C ATOM 759 NE ARG B 342 -13.266 23.967 48.342 1.00108.00 N ATOM 760 CZ ARG B 342 -13.281 24.112 47.018 1.00112.84 C ATOM 761 NH1 ARG B 342 -12.189 23.882 46.298 1.00115.89 N ATOM 762 NH2 ARG B 342 -14.398 24.493 46.410 1.00115.57 N ATOM 763 N GLN B 343 -7.633 22.339 49.195 1.00 66.84 N ATOM 764 CA GLN B 343 -7.243 21.271 50.109 1.00 66.10 C ATOM 765 C GLN B 343 -6.250 21.864 51.109 1.00 63.87 C ATOM 766 O GLN B 343 -6.341 21.643 52.311 1.00 62.98 O ATOM 767 CB GLN B 343 -6.558 20.151 49.339 1.00 70.69 C ATOM 768 CG GLN B 343 -7.363 18.885 49.201 1.00 77.85 C ATOM 769 CD GLN B 343 -6.749 17.929 48.186 1.00 82.62 C ATOM 770 OE1 GLN B 343 -5.539 17.705 48.180 1.00 84.16 O ATOM 771 NE2 GLN B 343 -7.586 17.357 47.326 1.00 84.94 N ATOM 772 N MET B 344 -5.293 22.626 50.598 1.00 62.55 N ATOM 773 CA MET B 344 -4.309 23.251 51.463 1.00 63.53 C ATOM 774 C MET B 344 -4.958 24.254 52.397 1.00 64.99 C ATOM 775 O MET B 344 -4.620 24.311 53.587 1.00 61.85 O ATOM 776 CB MET B 344 -3.232 23.928 50.638 1.00 60.25 C ATOM 777 CG MET B 344 -2.135 22.965 50.234 1.00 63.26 C ATOM 778 SD MET B 344 -0.903 23.812 49.292 1.00 67.37 S ATOM 779 CE MET B 344 -0.714 25.351 50.272 1.00 64.34 C ATOM 780 N ARG B 345 -5.881 25.050 51.860 1.00 65.40 N ATOM 781 CA ARG B 345 -6.585 26.013 52.684 1.00 69.50 C ATOM 782 C ARG B 345 -7.197 25.209 53.834 1.00 68.00 C ATOM 783 O ARG B 345 -7.244 25.671 54.981 1.00 68.11 O ATOM 784 CB ARG B 345 -7.683 26.702 51.876 1.00 80.72 C ATOM 785 CG ARG B 345 -8.465 27.735 52.671 1.00 93.31 C ATOM 786 CD ARG B 345 -9.666 28.277 51.895 1.00104.99 C ATOM 787 NE ARG B 345 -10.420 29.241 52.697 1.00114.28 N ATOM 788 CZ ARG B 345 -11.528 29.859 52.295 1.00117.71 C ATOM 789 NH1 ARG B 345 -12.025 29.616 51.089 1.00119.37 N ATOM 790 NH2 ARG B 345 -12.139 30.721 53.102 1.00119.73 N ATOM 791 N GLU B 346 -7.649 23.997 53.514 1.00 66.10 N ATOM 792 CA GLU B 346 -8.238 23.107 54.502 1.00 65.83 C ATOM 793 C GLU B 346 -7.208 22.745 55.569 1.00 63.25 C ATOM 794 O GLU B 346 -7.360 23.106 56.744 1.00 60.17 O ATOM 795 CB GLU B 346 -8.739 21.818 53.835 1.00 71.70 C ATOM 796 CG GLU B 346 -9.119 20.704 54.821 1.00 78.54 C ATOM 797 CD GLU B 346 -10.630 20.493 54.964 1.00 83.94 C ATOM 798 OE1 GLU B 346 -11.383 21.479 55.145 1.00 85.15 O ATOM 799 OE2 GLU B 346 -11.059 19.322 54.909 1.00 87.20 O ATOM 800 N MET B 347 -6.167 22.024 55.156 1.00 62.21 N ATOM 801 CA MET B 347 -5.123 21.595 56.082 1.00 61.95 C ATOM 802 C MET B 347 -4.683 22.737 56.992 1.00 58.93 C ATOM 803 O MET B 347 -4.769 22.620 58.217 1.00 56.93 O ATOM 804 CB MET B 347 -3.928 21.055 55.305 1.00 68.73 C ATOM 805 CG MET B 347 -4.221 19.804 54.495 1.00 75.08 C ATOM 806 SD MET B 347 -2.773 19.196 53.592 1.00 86.22 S ATOM 807 CE MET B 347 -1.825 18.426 54.923 1.00 83.60 C ATOM 808 N GLU B 348 -4.240 23.841 56.386 1.00 58.93 N ATOM 809 CA GLU B 348 -3.787 25.013 57.127 1.00 64.59 C ATOM 810 C GLU B 348 -4.719 25.334 58.291 1.00 68.07 C ATOM 811 O GLU B 348 -4.281 25.413 59.444 1.00 67.40 O ATOM 812 CB GLU B 348 -3.703 26.225 56.200 1.00 68.64 C ATOM 813 CG GLU B 348 -2.304 26.609 55.768 1.00 78.32 C ATOM 814 CD GLU B 348 -2.306 27.618 54.624 1.00 84.15 C ATOM 815 OE1 GLU B 348 -3.051 28.621 54.715 1.00 87.62 O ATOM 816 OE2 GLU B 348 -1.560 27.413 53.636 1.00 87.89 O ATOM 817 N GLU B 349 -6.000 25.523 57.977 1.00 72.26 N ATOM 818 CA GLU B 349 -7.021 25.844 58.971 1.00 75.47 C ATOM 819 C GLU B 349 -7.164 24.747 60.024 1.00 71.98 C ATOM 820 O GLU B 349 -7.234 25.027 61.228 1.00 69.44 O ATOM 821 CB GLU B 349 -8.370 26.073 58.269 1.00 84.22 C ATOM 822 CG GLU B 349 -9.575 26.176 59.205 1.00101.53 C ATOM 823 CD GLU B 349 -9.581 27.446 60.048 1.00111.19 C ATOM 824 OE1 GLU B 349 -9.699 28.547 59.462 1.00117.38 O ATOM 825 OE2 GLU B 349 -9.470 27.343 61.292 1.00115.75 O ATOM 826 N ASN B 350 -7.210 23.499 59.568 1.00 68.76 N ATOM 827 CA ASN B 350 -7.364 22.370 60.475 1.00 68.52 C ATOM 828 C ASN B 350 -6.203 22.179 61.440 1.00 66.86 C ATOM 829 O ASN B 350 -6.401 22.099 62.650 1.00 65.29 O ATOM 830 CB ASN B 350 -7.574 21.094 59.672 1.00 72.42 C ATOM 831 CG ASN B 350 -8.875 21.110 58.901 1.00 77.31 C ATOM 832 OD1 ASN B 350 -9.121 20.243 58.055 1.00 80.80 O ATOM 833 ND2 ASN B 350 -9.727 22.100 59.193 1.00 75.56 N ATOM 834 N PHE B 351 -4.989 22.102 60.912 1.00 65.31 N ATOM 835 CA PHE B 351 -3.837 21.910 61.781 1.00 62.63 C ATOM 836 C PHE B 351 -3.763 23.020 62.805 1.00 59.79 C ATOM 837 O PHE B 351 -3.505 22.770 63.975 1.00 60.75 O ATOM 838 CB PHE B 351 -2.533 21.883 60.992 1.00 61.62 C ATOM 839 CG PHE B 351 -1.369 21.434 61.812 1.00 63.98 C ATOM 840 CD1 PHE B 351 -1.322 20.135 62.324 1.00 62.34 C ATOM 841 CD2 PHE B 351 -0.330 22.307 62.104 1.00 64.76 C ATOM 842 CE1 PHE B 351 -0.273 19.727 63.135 1.00 64.10 C ATOM 843 CE2 PHE B 351 0.734 21.903 62.920 1.00 65.81 C ATOM 844 CZ PHE B 351 0.764 20.608 63.426 1.00 64.27 C ATOM 845 N ALA B 352 -4.009 24.244 62.355 1.00 57.38 N ATOM 846 CA ALA B 352 -3.972 25.407 63.228 1.00 57.29 C ATOM 847 C ALA B 352 -4.719 25.152 64.532 1.00 58.15 C ATOM 848 O ALA B 352 -4.180 25.372 65.623 1.00 57.99 O ATOM 849 CB ALA B 352 -4.565 26.618 62.512 1.00 56.95 C ATOM 850 N VAL B 353 -5.956 24.682 64.419 1.00 56.25 N ATOM 851 CA VAL B 353 -6.760 24.409 65.598 1.00 56.22 C ATOM 852 C VAL B 353 -6.209 23.220 66.383 1.00 54.24 C ATOM 853 O VAL B 353 -6.121 23.264 67.612 1.00 54.69 O ATOM 854 CB VAL B 353 -8.248 24.169 65.200 1.00 59.19 C ATOM 855 CG1 VAL B 353 -8.873 23.023 66.029 1.00 54.35 C ATOM 856 CG2 VAL B 353 -9.031 25.468 65.399 1.00 56.10 C ATOM 857 N GLU B 354 -5.837 22.167 65.667 1.00 51.81 N ATOM 858 CA GLU B 354 -5.293 20.969 66.289 1.00 54.95 C ATOM 859 C GLU B 354 -4.030 21.288 67.119 1.00 56.30 C ATOM 860 O GLU B 354 -3.949 20.974 68.310 1.00 54.90 O ATOM 861 CB GLU B 354 -4.967 19.955 65.197 1.00 58.13 C ATOM 862 CG GLU B 354 -4.423 18.632 65.704 1.00 68.10 C ATOM 863 CD GLU B 354 -4.113 17.676 64.563 1.00 74.46 C ATOM 864 OE1 GLU B 354 -4.529 17.979 63.417 1.00 77.90 O ATOM 865 OE2 GLU B 354 -3.469 16.625 64.807 1.00 74.69 O ATOM 866 N ALA B 355 -3.044 21.918 66.488 1.00 54.29 N ATOM 867 CA ALA B 355 -1.811 22.285 67.178 1.00 52.20 C ATOM 868 C ALA B 355 -2.159 23.169 68.367 1.00 51.97 C ATOM 869 O ALA B 355 -1.591 23.042 69.455 1.00 48.29 O ATOM 870 CB ALA B 355 -0.887 23.038 66.226 1.00 50.55 C ATOM 871 N ALA B 356 -3.098 24.079 68.134 1.00 54.06 N ATOM 872 CA ALA B 356 -3.561 24.997 69.161 1.00 53.23 C ATOM 873 C ALA B 356 -4.044 24.213 70.366 1.00 53.42 C ATOM 874 O ALA B 356 -3.799 24.610 71.505 1.00 55.39 O ATOM 875 CB ALA B 356 -4.688 25.848 68.625 1.00 55.72 C ATOM 876 N ASN B 357 -4.735 23.103 70.123 1.00 50.89 N ATOM 877 CA ASN B 357 -5.222 22.297 71.233 1.00 52.26 C ATOM 878 C ASN B 357 -4.097 21.470 71.825 1.00 50.18 C ATOM 879 O ASN B 357 -4.089 21.217 73.030 1.00 52.83 O ATOM 880 CB ASN B 357 -6.368 21.379 70.803 1.00 56.17 C ATOM 881 CG ASN B 357 -7.650 22.149 70.489 1.00 59.35 C ATOM 882 OD1 ASN B 357 -8.016 23.113 71.188 1.00 58.35 O ATOM 883 ND2 ASN B 357 -8.348 21.716 69.440 1.00 58.78 N ATOM 884 N TYR B 358 -3.153 21.038 70.987 1.00 48.04 N ATOM 885 CA TYR B 358 -2.006 20.255 71.476 1.00 45.35 C ATOM 886 C TYR B 358 -1.237 21.066 72.510 1.00 42.68 C ATOM 887 O TYR B 358 -0.845 20.556 73.547 1.00 40.77 O ATOM 888 CB TYR B 358 -1.058 19.921 70.336 1.00 45.16 C ATOM 889 CG TYR B 358 -1.427 18.682 69.568 1.00 52.82 C ATOM 890 CD1 TYR B 358 -1.539 17.452 70.213 1.00 52.54 C ATOM 891 CD2 TYR B 358 -1.625 18.725 68.183 1.00 51.99 C ATOM 892 CE1 TYR B 358 -1.833 16.290 69.495 1.00 55.51 C ATOM 893 CE2 TYR B 358 -1.917 17.576 67.466 1.00 53.20 C ATOM 894 CZ TYR B 358 -2.018 16.362 68.123 1.00 54.55 C ATOM 895 OH TYR B 358 -2.284 15.216 67.406 1.00 59.34 O ATOM 896 N GLN B 359 -1.032 22.343 72.199 1.00 44.48 N ATOM 897 CA GLN B 359 -0.328 23.258 73.070 1.00 45.28 C ATOM 898 C GLN B 359 -1.093 23.513 74.360 1.00 47.84 C ATOM 899 O GLN B 359 -0.490 23.787 75.402 1.00 46.11 O ATOM 900 CB GLN B 359 -0.083 24.566 72.324 1.00 46.46 C ATOM 901 CG GLN B 359 0.676 24.357 71.023 1.00 48.39 C ATOM 902 CD GLN B 359 0.759 25.598 70.153 1.00 47.63 C ATOM 903 OE1 GLN B 359 1.369 25.576 69.078 1.00 50.09 O ATOM 904 NE2 GLN B 359 0.152 26.682 70.609 1.00 48.84 N ATOM 905 N ASP B 360 -2.417 23.417 74.297 1.00 50.25 N ATOM 906 CA ASP B 360 -3.239 23.638 75.483 1.00 51.22 C ATOM 907 C ASP B 360 -3.037 22.481 76.433 1.00 48.46 C ATOM 908 O ASP B 360 -2.886 22.665 77.632 1.00 49.72 O ATOM 909 CB ASP B 360 -4.731 23.723 75.125 1.00 58.69 C ATOM 910 CG ASP B 360 -5.089 24.996 74.381 1.00 65.99 C ATOM 911 OD1 ASP B 360 -4.235 25.908 74.328 1.00 72.04 O ATOM 912 OD2 ASP B 360 -6.227 25.089 73.859 1.00 71.45 O ATOM 913 N THR B 361 -3.049 21.280 75.875 1.00 46.18 N ATOM 914 CA THR B 361 -2.881 20.062 76.653 1.00 45.79 C ATOM 915 C THR B 361 -1.528 20.082 77.336 1.00 45.04 C ATOM 916 O THR B 361 -1.433 19.996 78.562 1.00 48.38 O ATOM 917 CB THR B 361 -2.959 18.813 75.742 1.00 47.61 C ATOM 918 OG1 THR B 361 -4.268 18.719 75.173 1.00 46.52 O ATOM 919 CG2 THR B 361 -2.656 17.545 76.525 1.00 44.28 C ATOM 920 N ILE B 362 -0.485 20.212 76.524 1.00 43.29 N ATOM 921 CA ILE B 362 0.880 20.235 77.017 1.00 40.79 C ATOM 922 C ILE B 362 1.032 21.196 78.184 1.00 40.31 C ATOM 923 O ILE B 362 1.611 20.840 79.211 1.00 38.90 O ATOM 924 CB ILE B 362 1.864 20.580 75.860 1.00 39.27 C ATOM 925 CG1 ILE B 362 1.905 19.409 74.871 1.00 37.62 C ATOM 926 CG2 ILE B 362 3.260 20.825 76.396 1.00 42.75 C ATOM 927 CD1 ILE B 362 2.642 19.706 73.574 1.00 40.80 C ATOM 928 N GLY B 363 0.490 22.401 78.044 1.00 39.44 N ATOM 929 CA GLY B 363 0.592 23.366 79.122 1.00 41.01 C ATOM 930 C GLY B 363 -0.129 22.892 80.370 1.00 43.97 C ATOM 931 O GLY B 363 0.374 22.999 81.490 1.00 39.19 O ATOM 932 N ARG B 364 -1.322 22.349 80.168 1.00 49.02 N ATOM 933 CA ARG B 364 -2.144 21.860 81.264 1.00 51.74 C ATOM 934 C ARG B 364 -1.414 20.747 82.013 1.00 49.18 C ATOM 935 O ARG B 364 -1.425 20.696 83.251 1.00 49.60 O ATOM 936 CB ARG B 364 -3.490 21.355 80.714 1.00 54.63 C ATOM 937 CG ARG B 364 -4.488 20.915 81.780 1.00 60.00 C ATOM 938 CD ARG B 364 -5.794 20.424 81.151 1.00 63.78 C ATOM 939 NE ARG B 364 -5.613 19.270 80.260 1.00 63.21 N ATOM 940 CZ ARG B 364 -5.336 18.030 80.666 1.00 60.39 C ATOM 941 NH1 ARG B 364 -5.202 17.758 81.958 1.00 58.73 N ATOM 942 NH2 ARG B 364 -5.197 17.055 79.777 1.00 58.10 N ATOM 943 N LEU B 365 -0.778 19.857 81.261 1.00 44.88 N ATOM 944 CA LEU B 365 -0.048 18.759 81.873 1.00 45.26 C ATOM 945 C LEU B 365 1.194 19.215 82.633 1.00 43.02 C ATOM 946 O LEU B 365 1.508 18.663 83.683 1.00 41.27 O ATOM 947 CB LEU B 365 0.332 17.732 80.812 1.00 46.32 C ATOM 948 CG LEU B 365 -0.684 16.612 80.600 1.00 51.21 C ATOM 949 CD1 LEU B 365 -2.101 17.114 80.822 1.00 52.13 C ATOM 950 CD2 LEU B 365 -0.506 16.060 79.201 1.00 53.62 C ATOM 951 N GLN B 366 1.892 20.221 82.109 1.00 42.42 N ATOM 952 CA GLN B 366 3.097 20.740 82.764 1.00 39.88 C ATOM 953 C GLN B 366 2.673 21.385 84.068 1.00 39.49 C ATOM 954 O GLN B 366 3.313 21.198 85.110 1.00 37.57 O ATOM 955 CB GLN B 366 3.808 21.756 81.864 1.00 34.91 C ATOM 956 CG GLN B 366 4.353 21.138 80.587 1.00 32.90 C ATOM 957 CD GLN B 366 4.801 22.173 79.582 1.00 33.55 C ATOM 958 OE1 GLN B 366 4.354 23.316 79.623 1.00 34.34 O ATOM 959 NE2 GLN B 366 5.676 21.771 78.656 1.00 32.05 N ATOM 960 N ASP B 367 1.571 22.125 84.008 1.00 44.10 N ATOM 961 CA ASP B 367 1.057 22.768 85.196 1.00 49.15 C ATOM 962 C ASP B 367 0.664 21.728 86.226 1.00 50.28 C ATOM 963 O ASP B 367 0.848 21.942 87.421 1.00 52.81 O ATOM 964 CB ASP B 367 -0.146 23.645 84.868 1.00 55.39 C ATOM 965 CG ASP B 367 0.254 24.978 84.250 1.00 63.60 C ATOM 966 OD1 ASP B 367 1.396 25.433 84.495 1.00 66.58 O ATOM 967 OD2 ASP B 367 -0.578 25.584 83.533 1.00 68.08 O ATOM 968 N GLU B 368 0.124 20.601 85.775 1.00 48.22 N ATOM 969 CA GLU B 368 -0.264 19.551 86.712 1.00 47.27 C ATOM 970 C GLU B 368 0.975 18.913 87.331 1.00 44.41 C ATOM 971 O GLU B 368 1.010 18.609 88.523 1.00 40.91 O ATOM 972 CB GLU B 368 -1.074 18.462 86.012 1.00 51.49 C ATOM 973 CG GLU B 368 -2.526 18.815 85.757 1.00 59.35 C ATOM 974 CD GLU B 368 -3.268 17.703 85.011 1.00 64.35 C ATOM 975 OE1 GLU B 368 -2.967 16.505 85.240 1.00 64.22 O ATOM 976 OE2 GLU B 368 -4.162 18.033 84.202 1.00 69.01 O ATOM 977 N ILE B 369 1.997 18.693 86.517 1.00 42.88 N ATOM 978 CA ILE B 369 3.205 18.090 87.039 1.00 44.73 C ATOM 979 C ILE B 369 3.824 18.991 88.104 1.00 47.52 C ATOM 980 O ILE B 369 4.298 18.508 89.145 1.00 46.30 O ATOM 981 CB ILE B 369 4.203 17.805 85.910 1.00 43.50 C ATOM 982 CG1 ILE B 369 3.616 16.710 84.997 1.00 43.20 C ATOM 983 CG2 ILE B 369 5.546 17.378 86.496 1.00 42.25 C ATOM 984 CD1 ILE B 369 4.504 16.260 83.853 1.00 40.35 C ATOM 985 N GLN B 370 3.788 20.299 87.866 1.00 45.70 N ATOM 986 CA GLN B 370 4.346 21.225 88.830 1.00 43.98 C ATOM 987 C GLN B 370 3.553 21.182 90.130 1.00 42.01 C ATOM 988 O GLN B 370 4.117 21.059 91.221 1.00 44.75 O ATOM 989 CB GLN B 370 4.339 22.640 88.259 1.00 47.93 C ATOM 990 CG GLN B 370 5.068 23.666 89.139 1.00 51.10 C ATOM 991 CD GLN B 370 6.466 23.192 89.556 1.00 56.62 C ATOM 992 OE1 GLN B 370 7.251 22.715 88.730 1.00 59.99 O ATOM 993 NE2 GLN B 370 6.779 23.328 90.842 1.00 56.61 N ATOM 994 N ASN B 371 2.236 21.270 90.015 1.00 40.78 N ATOM 995 CA ASN B 371 1.374 21.246 91.193 1.00 42.22 C ATOM 996 C ASN B 371 1.605 19.981 91.991 1.00 40.16 C ATOM 997 O ASN B 371 1.637 20.010 93.205 1.00 42.90 O ATOM 998 CB ASN B 371 -0.098 21.334 90.787 1.00 46.34 C ATOM 999 CG ASN B 371 -0.426 22.628 90.062 1.00 52.18 C ATOM 1000 OD1 ASN B 371 -1.565 22.851 89.655 1.00 55.08 O ATOM 1001 ND2 ASN B 371 0.576 23.486 89.891 1.00 57.19 N ATOM 1002 N MET B 372 1.761 18.861 91.301 1.00 42.47 N ATOM 1003 CA MET B 372 2.007 17.594 91.972 1.00 39.62 C ATOM 1004 C MET B 372 3.348 17.637 92.675 1.00 37.34 C ATOM 1005 O MET B 372 3.454 17.213 93.829 1.00 32.95 O ATOM 1006 CB MET B 372 1.977 16.442 90.967 1.00 40.99 C ATOM 1007 CG MET B 372 0.572 15.910 90.678 1.00 50.29 C ATOM 1008 SD MET B 372 0.520 14.803 89.242 1.00 55.07 S ATOM 1009 CE MET B 372 1.294 13.338 89.886 1.00 44.88 C ATOM 1010 N LYS B 373 4.370 18.152 91.988 1.00 37.81 N ATOM 1011 CA LYS B 373 5.706 18.244 92.583 1.00 40.80 C ATOM 1012 C LYS B 373 5.638 19.050 93.871 1.00 41.35 C ATOM 1013 O LYS B 373 6.251 18.694 94.872 1.00 38.38 O ATOM 1014 CB LYS B 373 6.712 18.895 91.620 1.00 38.71 C ATOM 1015 CG LYS B 373 7.277 17.923 90.603 1.00 38.69 C ATOM 1016 CD LYS B 373 8.520 18.436 89.880 1.00 39.65 C ATOM 1017 CE LYS B 373 8.966 17.416 88.829 1.00 41.31 C ATOM 1018 NZ LYS B 373 10.299 17.655 88.210 1.00 41.99 N ATOM 1019 N GLU B 374 4.876 20.135 93.849 1.00 42.07 N ATOM 1020 CA GLU B 374 4.745 20.952 95.040 1.00 45.15 C ATOM 1021 C GLU B 374 4.115 20.134 96.152 1.00 47.80 C ATOM 1022 O GLU B 374 4.648 20.064 97.264 1.00 46.72 O ATOM 1023 CB GLU B 374 3.901 22.195 94.744 1.00 48.68 C ATOM 1024 CG GLU B 374 4.680 23.307 94.052 1.00 54.76 C ATOM 1025 CD GLU B 374 3.784 24.351 93.402 1.00 59.74 C ATOM 1026 OE1 GLU B 374 2.688 24.627 93.941 1.00 64.03 O ATOM 1027 OE2 GLU B 374 4.188 24.906 92.356 1.00 60.37 O ATOM 1028 N GLU B 375 2.983 19.507 95.843 1.00 49.34 N ATOM 1029 CA GLU B 375 2.277 18.684 96.818 1.00 48.77 C ATOM 1030 C GLU B 375 3.212 17.602 97.347 1.00 41.70 C ATOM 1031 O GLU B 375 3.254 17.349 98.545 1.00 42.65 O ATOM 1032 CB GLU B 375 1.041 18.046 96.192 1.00 51.84 C ATOM 1033 CG GLU B 375 0.226 17.275 97.193 1.00 66.59 C ATOM 1034 CD GLU B 375 -0.890 16.495 96.549 1.00 74.18 C ATOM 1035 OE1 GLU B 375 -1.182 16.757 95.361 1.00 77.35 O ATOM 1036 OE2 GLU B 375 -1.478 15.633 97.239 1.00 77.06 O ATOM 1037 N MET B 376 3.982 16.977 96.462 1.00 40.75 N ATOM 1038 CA MET B 376 4.929 15.949 96.898 1.00 41.33 C ATOM 1039 C MET B 376 5.931 16.552 97.861 1.00 44.17 C ATOM 1040 O MET B 376 6.289 15.942 98.864 1.00 43.96 O ATOM 1041 CB MET B 376 5.684 15.355 95.701 1.00 42.05 C ATOM 1042 CG MET B 376 4.796 14.575 94.727 1.00 50.76 C ATOM 1043 SD MET B 376 5.740 13.682 93.447 1.00 56.20 S ATOM 1044 CE MET B 376 6.713 12.539 94.501 1.00 53.04 C ATOM 1045 N ALA B 377 6.382 17.760 97.541 1.00 45.25 N ATOM 1046 CA ALA B 377 7.353 18.471 98.366 1.00 45.83 C ATOM 1047 C ALA B 377 6.783 18.645 99.763 1.00 42.51 C ATOM 1048 O ALA B 377 7.437 18.324 100.758 1.00 42.90 O ATOM 1049 CB ALA B 377 7.667 19.840 97.761 1.00 41.08 C ATOM 1050 N ARG B 378 5.562 19.160 99.836 1.00 44.29 N ATOM 1051 CA ARG B 378 4.899 19.368 101.120 1.00 48.80 C ATOM 1052 C ARG B 378 4.847 18.053 101.926 1.00 49.69 C ATOM 1053 O ARG B 378 5.167 18.031 103.119 1.00 50.50 O ATOM 1054 CB ARG B 378 3.489 19.903 100.880 1.00 53.03 C ATOM 1055 CG ARG B 378 2.676 20.100 102.139 1.00 67.68 C ATOM 1056 CD ARG B 378 1.188 20.249 101.810 1.00 77.55 C ATOM 1057 NE ARG B 378 0.653 19.056 101.149 1.00 86.54 N ATOM 1058 CZ ARG B 378 -0.590 18.938 100.688 1.00 89.97 C ATOM 1059 NH1 ARG B 378 -1.450 19.942 100.812 1.00 92.42 N ATOM 1060 NH2 ARG B 378 -0.971 17.818 100.090 1.00 91.72 N ATOM 1061 N HIS B 379 4.465 16.961 101.264 1.00 46.85 N ATOM 1062 CA HIS B 379 4.381 15.656 101.915 1.00 44.47 C ATOM 1063 C HIS B 379 5.713 15.204 102.452 1.00 43.02 C ATOM 1064 O HIS B 379 5.773 14.580 103.507 1.00 41.12 O ATOM 1065 CB HIS B 379 3.856 14.595 100.943 1.00 42.05 C ATOM 1066 CG HIS B 379 2.386 14.684 100.703 1.00 42.05 C ATOM 1067 ND1 HIS B 379 1.803 14.340 99.504 1.00 47.59 N ATOM 1068 CD2 HIS B 379 1.379 15.109 101.506 1.00 46.32 C ATOM 1069 CE1 HIS B 379 0.498 14.554 99.574 1.00 49.02 C ATOM 1070 NE2 HIS B 379 0.218 15.020 100.779 1.00 45.03 N ATOM 1071 N LEU B 380 6.782 15.499 101.718 1.00 45.88 N ATOM 1072 CA LEU B 380 8.111 15.107 102.159 1.00 48.32 C ATOM 1073 C LEU B 380 8.522 15.901 103.405 1.00 48.69 C ATOM 1074 O LEU B 380 9.274 15.408 104.249 1.00 46.35 O ATOM 1075 CB LEU B 380 9.137 15.300 101.037 1.00 51.59 C ATOM 1076 CG LEU B 380 10.515 14.692 101.358 1.00 59.50 C ATOM 1077 CD1 LEU B 380 10.359 13.192 101.635 1.00 58.70 C ATOM 1078 CD2 LEU B 380 11.488 14.923 100.199 1.00 59.33 C ATOM 1079 N ARG B 381 8.025 17.127 103.533 1.00 50.26 N ATOM 1080 CA ARG B 381 8.362 17.919 104.709 1.00 53.05 C ATOM 1081 C ARG B 381 7.703 17.253 105.907 1.00 52.64 C ATOM 1082 O ARG B 381 8.374 16.920 106.894 1.00 49.93 O ATOM 1083 CB ARG B 381 7.873 19.373 104.573 1.00 56.62 C ATOM 1084 CG ARG B 381 8.950 20.349 104.072 1.00 59.91 C ATOM 1085 CD ARG B 381 8.746 20.724 102.616 1.00 64.41 C ATOM 1086 NE ARG B 381 10.011 20.946 101.917 1.00 70.90 N ATOM 1087 CZ ARG B 381 10.115 21.397 100.672 1.00 67.16 C ATOM 1088 NH1 ARG B 381 9.023 21.683 99.984 1.00 69.54 N ATOM 1089 NH2 ARG B 381 11.308 21.547 100.112 1.00 67.66 N ATOM 1090 N GLU B 382 6.389 17.053 105.805 1.00 48.63 N ATOM 1091 CA GLU B 382 5.627 16.407 106.866 1.00 45.74 C ATOM 1092 C GLU B 382 6.296 15.089 107.260 1.00 41.36 C ATOM 1093 O GLU B 382 6.426 14.769 108.445 1.00 41.91 O ATOM 1094 CB GLU B 382 4.200 16.164 106.394 1.00 51.15 C ATOM 1095 CG GLU B 382 3.417 17.449 106.190 1.00 55.62 C ATOM 1096 CD GLU B 382 2.135 17.249 105.371 1.00 62.74 C ATOM 1097 OE1 GLU B 382 1.972 16.179 104.729 1.00 65.18 O ATOM 1098 OE2 GLU B 382 1.300 18.181 105.354 1.00 60.52 O ATOM 1099 N TYR B 383 6.755 14.341 106.264 1.00 40.05 N ATOM 1100 CA TYR B 383 7.422 13.081 106.535 1.00 40.35 C ATOM 1101 C TYR B 383 8.705 13.324 107.336 1.00 44.68 C ATOM 1102 O TYR B 383 9.070 12.552 108.243 1.00 40.74 O ATOM 1103 CB TYR B 383 7.776 12.389 105.225 1.00 36.51 C ATOM 1104 CG TYR B 383 8.519 11.094 105.432 1.00 39.11 C ATOM 1105 CD1 TYR B 383 7.831 9.906 105.707 1.00 43.23 C ATOM 1106 CD2 TYR B 383 9.908 11.062 105.411 1.00 44.22 C ATOM 1107 CE1 TYR B 383 8.515 8.708 105.962 1.00 45.86 C ATOM 1108 CE2 TYR B 383 10.616 9.868 105.660 1.00 45.71 C ATOM 1109 CZ TYR B 383 9.910 8.699 105.936 1.00 47.50 C ATOM 1110 OH TYR B 383 10.590 7.533 106.193 1.00 49.78 O ATOM 1111 N GLN B 384 9.395 14.404 106.990 1.00 47.13 N ATOM 1112 CA GLN B 384 10.647 14.738 107.652 1.00 47.47 C ATOM 1113 C GLN B 384 10.464 15.079 109.129 1.00 45.66 C ATOM 1114 O GLN B 384 11.232 14.598 109.968 1.00 43.16 O ATOM 1115 CB GLN B 384 11.325 15.879 106.907 1.00 55.61 C ATOM 1116 CG GLN B 384 12.750 15.559 106.477 1.00 64.47 C ATOM 1117 CD GLN B 384 12.882 14.226 105.750 1.00 69.08 C ATOM 1118 OE1 GLN B 384 12.883 13.163 106.369 1.00 72.17 O ATOM 1119 NE2 GLN B 384 12.992 14.281 104.428 1.00 73.41 N ATOM 1120 N ASP B 385 9.455 15.898 109.443 1.00 46.58 N ATOM 1121 CA ASP B 385 9.155 16.255 110.828 1.00 50.96 C ATOM 1122 C ASP B 385 8.903 14.963 111.601 1.00 51.98 C ATOM 1123 O ASP B 385 9.499 14.723 112.646 1.00 53.73 O ATOM 1124 CB ASP B 385 7.881 17.101 110.931 1.00 58.71 C ATOM 1125 CG ASP B 385 7.974 18.403 110.167 1.00 68.63 C ATOM 1126 OD1 ASP B 385 8.831 19.246 110.520 1.00 74.98 O ATOM 1127 OD2 ASP B 385 7.188 18.580 109.211 1.00 70.80 O ATOM 1128 N LEU B 386 8.003 14.138 111.076 1.00 48.93 N ATOM 1129 CA LEU B 386 7.665 12.884 111.722 1.00 46.49 C ATOM 1130 C LEU B 386 8.903 12.039 111.944 1.00 42.20 C ATOM 1131 O LEU B 386 9.105 11.518 113.037 1.00 47.40 O ATOM 1132 CB LEU B 386 6.637 12.094 110.888 1.00 44.45 C ATOM 1133 CG LEU B 386 6.170 10.752 111.476 1.00 42.74 C ATOM 1134 CD1 LEU B 386 5.513 10.989 112.839 1.00 34.64 C ATOM 1135 CD2 LEU B 386 5.196 10.068 110.512 1.00 33.11 C ATOM 1136 N LEU B 387 9.736 11.895 110.922 1.00 39.99 N ATOM 1137 CA LEU B 387 10.931 11.077 111.092 1.00 41.27 C ATOM 1138 C LEU B 387 11.828 11.637 112.194 1.00 43.26 C ATOM 1139 O LEU B 387 12.480 10.884 112.909 1.00 39.85 O ATOM 1140 CB LEU B 387 11.723 10.998 109.790 1.00 41.81 C ATOM 1141 CG LEU B 387 12.997 10.150 109.881 1.00 41.99 C ATOM 1142 CD1 LEU B 387 12.643 8.708 110.198 1.00 38.71 C ATOM 1143 CD2 LEU B 387 13.779 10.227 108.565 1.00 42.27 C ATOM 1144 N ASN B 388 11.864 12.960 112.334 1.00 44.22 N ATOM 1145 CA ASN B 388 12.705 13.565 113.362 1.00 46.43 C ATOM 1146 C ASN B 388 12.151 13.181 114.731 1.00 46.72 C ATOM 1147 O ASN B 388 12.889 12.766 115.613 1.00 48.30 O ATOM 1148 CB ASN B 388 12.746 15.104 113.230 1.00 43.20 C ATOM 1149 CG ASN B 388 13.372 15.579 111.912 1.00 46.18 C ATOM 1150 OD1 ASN B 388 14.245 14.912 111.338 1.00 41.61 O ATOM 1151 ND2 ASN B 388 12.936 16.756 111.439 1.00 48.18 N ATOM 1152 N VAL B 389 10.841 13.317 114.893 1.00 45.98 N ATOM 1153 CA VAL B 389 10.180 12.988 116.150 1.00 44.94 C ATOM 1154 C VAL B 389 10.401 11.526 116.528 1.00 41.69 C ATOM 1155 O VAL B 389 10.632 11.195 117.682 1.00 43.80 O ATOM 1156 CB VAL B 389 8.672 13.250 116.054 1.00 44.56 C ATOM 1157 CG1 VAL B 389 7.972 12.705 117.284 1.00 43.23 C ATOM 1158 CG2 VAL B 389 8.416 14.745 115.901 1.00 43.32 C ATOM 1159 N LYS B 390 10.341 10.648 115.541 1.00 40.75 N ATOM 1160 CA LYS B 390 10.536 9.230 115.792 1.00 41.13 C ATOM 1161 C LYS B 390 11.949 8.928 116.249 1.00 42.96 C ATOM 1162 O LYS B 390 12.146 8.132 117.159 1.00 43.43 O ATOM 1163 CB LYS B 390 10.196 8.429 114.535 1.00 37.34 C ATOM 1164 CG LYS B 390 10.282 6.922 114.707 1.00 37.92 C ATOM 1165 CD LYS B 390 11.603 6.405 114.189 1.00 38.40 C ATOM 1166 CE LYS B 390 11.761 4.926 114.413 1.00 41.88 C ATOM 1167 NZ LYS B 390 13.121 4.469 113.989 1.00 41.51 N ATOM 1168 N MET B 391 12.934 9.574 115.629 1.00 49.90 N ATOM 1169 CA MET B 391 14.344 9.370 115.995 1.00 50.27 C ATOM 1170 C MET B 391 14.638 9.896 117.405 1.00 48.35 C ATOM 1171 O MET B 391 15.420 9.313 118.152 1.00 46.94 O ATOM 1172 CB MET B 391 15.258 10.070 114.988 1.00 52.75 C ATOM 1173 CG MET B 391 15.001 9.641 113.561 1.00 59.22 C ATOM 1174 SD MET B 391 16.364 9.973 112.439 1.00 67.10 S ATOM 1175 CE MET B 391 16.916 8.270 112.072 1.00 62.87 C ATOM 1176 N ALA B 392 14.008 11.011 117.756 1.00 45.34 N ATOM 1177 CA ALA B 392 14.177 11.605 119.069 1.00 46.86 C ATOM 1178 C ALA B 392 13.637 10.618 120.091 1.00 50.40 C ATOM 1179 O ALA B 392 14.205 10.441 121.165 1.00 53.54 O ATOM 1180 CB ALA B 392 13.404 12.924 119.144 1.00 47.80 C ATOM 1181 N LEU B 393 12.521 9.986 119.747 1.00 51.37 N ATOM 1182 CA LEU B 393 11.908 9.000 120.618 1.00 49.03 C ATOM 1183 C LEU B 393 12.864 7.844 120.796 1.00 48.31 C ATOM 1184 O LEU B 393 13.125 7.431 121.920 1.00 51.60 O ATOM 1185 CB LEU B 393 10.587 8.500 120.015 1.00 45.00 C ATOM 1186 CG LEU B 393 9.282 9.006 120.640 1.00 46.89 C ATOM 1187 CD1 LEU B 393 9.491 10.328 121.354 1.00 44.53 C ATOM 1188 CD2 LEU B 393 8.232 9.130 119.548 1.00 41.23 C ATOM 1189 N ASP B 394 13.379 7.322 119.684 1.00 50.63 N ATOM 1190 CA ASP B 394 14.318 6.198 119.720 1.00 56.87 C ATOM 1191 C ASP B 394 15.404 6.486 120.740 1.00 61.89 C ATOM 1192 O ASP B 394 15.574 5.754 121.725 1.00 61.35 O ATOM 1193 CB ASP B 394 14.970 5.976 118.345 1.00 56.44 C ATOM 1194 CG ASP B 394 14.144 5.068 117.438 1.00 59.93 C ATOM 1195 OD1 ASP B 394 13.335 4.271 117.967 1.00 58.89 O ATOM 1196 OD2 ASP B 394 14.324 5.134 116.199 1.00 61.26 O ATOM 1197 N ILE B 395 16.131 7.573 120.495 1.00 65.74 N ATOM 1198 CA ILE B 395 17.195 8.011 121.380 1.00 67.87 C ATOM 1199 C ILE B 395 16.705 7.938 122.829 1.00 66.56 C ATOM 1200 O ILE B 395 17.198 7.135 123.626 1.00 68.39 O ATOM 1201 CB ILE B 395 17.600 9.460 121.048 1.00 70.93 C ATOM 1202 CG1 ILE B 395 18.289 9.503 119.682 1.00 72.90 C ATOM 1203 CG2 ILE B 395 18.503 10.018 122.140 1.00 74.32 C ATOM 1204 CD1 ILE B 395 18.587 10.911 119.194 1.00 72.77 C ATOM 1205 N GLU B 396 15.722 8.774 123.150 1.00 63.54 N ATOM 1206 CA GLU B 396 15.144 8.836 124.486 1.00 62.08 C ATOM 1207 C GLU B 396 14.872 7.457 125.088 1.00 61.28 C ATOM 1208 O GLU B 396 15.060 7.237 126.285 1.00 59.49 O ATOM 1209 CB GLU B 396 13.847 9.632 124.429 1.00 61.96 C ATOM 1210 CG GLU B 396 13.114 9.700 125.741 1.00 65.22 C ATOM 1211 CD GLU B 396 11.928 10.639 125.683 1.00 68.00 C ATOM 1212 OE1 GLU B 396 11.700 11.241 124.608 1.00 68.60 O ATOM 1213 OE2 GLU B 396 11.229 10.777 126.711 1.00 69.60 O ATOM 1214 N ILE B 397 14.428 6.527 124.254 1.00 60.17 N ATOM 1215 CA ILE B 397 14.134 5.190 124.727 1.00 58.87 C ATOM 1216 C ILE B 397 15.400 4.458 125.124 1.00 60.28 C ATOM 1217 O ILE B 397 15.464 3.867 126.198 1.00 59.60 O ATOM 1218 CB ILE B 397 13.385 4.372 123.656 1.00 56.99 C ATOM 1219 CG1 ILE B 397 11.917 4.798 123.630 1.00 56.01 C ATOM 1220 CG2 ILE B 397 13.503 2.875 123.944 1.00 57.55 C ATOM 1221 CD1 ILE B 397 11.062 3.986 122.687 1.00 51.14 C ATOM 1222 N ALA B 398 16.404 4.486 124.254 1.00 65.12 N ATOM 1223 CA ALA B 398 17.665 3.808 124.544 1.00 69.40 C ATOM 1224 C ALA B 398 18.103 4.165 125.963 1.00 71.41 C ATOM 1225 O ALA B 398 18.566 3.304 126.725 1.00 70.88 O ATOM 1226 CB ALA B 398 18.730 4.229 123.539 1.00 66.01 C ATOM 1227 N THR B 399 17.931 5.441 126.305 1.00 71.43 N ATOM 1228 CA THR B 399 18.282 5.967 127.615 1.00 73.27 C ATOM 1229 C THR B 399 17.511 5.270 128.726 1.00 75.08 C ATOM 1230 O THR B 399 18.106 4.628 129.587 1.00 75.70 O ATOM 1231 CB THR B 399 17.998 7.476 127.696 1.00 75.34 C ATOM 1232 OG1 THR B 399 18.812 8.166 126.740 1.00 75.95 O ATOM 1233 CG2 THR B 399 18.299 8.004 129.092 1.00 76.89 C ATOM 1234 N TYR B 400 16.187 5.403 128.713 1.00 75.96 N ATOM 1235 CA TYR B 400 15.362 4.775 129.737 1.00 74.84 C ATOM 1236 C TYR B 400 15.609 3.279 129.856 1.00 73.41 C ATOM 1237 O TYR B 400 15.314 2.687 130.884 1.00 75.18 O ATOM 1238 CB TYR B 400 13.872 5.013 129.473 1.00 74.75 C ATOM 1239 CG TYR B 400 13.415 6.440 129.680 1.00 77.93 C ATOM 1240 CD1 TYR B 400 14.255 7.393 130.249 1.00 78.98 C ATOM 1241 CD2 TYR B 400 12.132 6.837 129.305 1.00 80.76 C ATOM 1242 CE1 TYR B 400 13.827 8.710 130.435 1.00 83.00 C ATOM 1243 CE2 TYR B 400 11.692 8.147 129.487 1.00 81.77 C ATOM 1244 CZ TYR B 400 12.538 9.079 130.049 1.00 83.65 C ATOM 1245 OH TYR B 400 12.094 10.377 130.214 1.00 85.84 O ATOM 1246 N ARG B 401 16.149 2.656 128.819 1.00 73.41 N ATOM 1247 CA ARG B 401 16.400 1.223 128.904 1.00 78.15 C ATOM 1248 C ARG B 401 17.790 0.946 129.485 1.00 82.17 C ATOM 1249 O ARG B 401 18.143 -0.212 129.769 1.00 79.42 O ATOM 1250 CB ARG B 401 16.242 0.566 127.533 1.00 77.42 C ATOM 1251 CG ARG B 401 16.009 -0.938 127.615 1.00 78.97 C ATOM 1252 CD ARG B 401 15.466 -1.478 126.309 1.00 81.83 C ATOM 1253 NE ARG B 401 16.310 -1.112 125.176 1.00 89.37 N ATOM 1254 CZ ARG B 401 16.088 -1.488 123.919 1.00 92.30 C ATOM 1255 NH1 ARG B 401 15.041 -2.248 123.626 1.00 94.91 N ATOM 1256 NH2 ARG B 401 16.912 -1.104 122.953 1.00 94.43 N