>>1GK6:HELIX    2   2 MET B  355  GLU B  405  1                                  51    
MKQLEDKVEELLSKNYHLENEVARLKKLVGDLLNVKMALDIEIATYRKLLE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 2 2 MET B 355 GLU B 405 1 51 ATOM 449 N MET B 355 110.034 35.609 14.001 1.00 66.18 N ATOM 450 CA MET B 355 108.813 36.098 13.287 1.00 66.32 C ATOM 451 C MET B 355 107.627 36.313 14.236 1.00 65.76 C ATOM 452 O MET B 355 106.530 35.739 14.078 1.00 66.37 O ATOM 453 CB MET B 355 108.459 35.158 12.147 1.00 66.39 C ATOM 454 CG MET B 355 109.031 33.776 12.322 1.00 68.07 C ATOM 455 SD MET B 355 108.452 32.667 11.037 1.00 72.15 S ATOM 456 CE MET B 355 108.376 33.788 9.643 1.00 71.30 C ATOM 457 N LYS B 356 107.870 37.187 15.205 1.00 64.66 N ATOM 458 CA LYS B 356 106.928 37.515 16.264 1.00 62.81 C ATOM 459 C LYS B 356 105.704 38.323 15.821 1.00 61.10 C ATOM 460 O LYS B 356 104.573 37.945 16.133 1.00 61.20 O ATOM 461 CB LYS B 356 107.695 38.237 17.384 1.00 63.31 C ATOM 462 CG LYS B 356 107.053 39.494 17.938 1.00 64.36 C ATOM 463 CD LYS B 356 107.300 39.577 19.433 1.00 66.99 C ATOM 464 CE LYS B 356 106.593 40.777 20.039 1.00 68.50 C ATOM 465 NZ LYS B 356 106.043 40.443 21.383 1.00 69.04 N ATOM 466 N GLN B 357 105.916 39.433 15.114 1.00 58.44 N ATOM 467 CA GLN B 357 104.785 40.226 14.635 1.00 55.80 C ATOM 468 C GLN B 357 103.653 39.288 14.189 1.00 53.52 C ATOM 469 O GLN B 357 102.459 39.568 14.378 1.00 52.26 O ATOM 470 CB GLN B 357 105.216 41.145 13.495 1.00 56.40 C ATOM 471 CG GLN B 357 104.536 42.501 13.489 1.00 58.29 C ATOM 472 CD GLN B 357 104.038 42.920 14.858 1.00 61.96 C ATOM 473 OE1 GLN B 357 104.560 42.476 15.881 1.00 65.93 O ATOM 474 NE2 GLN B 357 102.992 43.749 14.881 1.00 62.85 N ATOM 475 N LEU B 358 104.062 38.166 13.603 1.00 50.76 N ATOM 476 CA LEU B 358 103.164 37.112 13.173 1.00 48.84 C ATOM 477 C LEU B 358 102.516 36.455 14.385 1.00 47.91 C ATOM 478 O LEU B 358 101.325 36.162 14.371 1.00 46.88 O ATOM 479 CB LEU B 358 103.893 36.067 12.322 1.00 48.55 C ATOM 480 CG LEU B 358 104.178 36.473 10.868 1.00 48.81 C ATOM 481 CD1 LEU B 358 105.125 35.487 10.212 1.00 47.39 C ATOM 482 CD2 LEU B 358 102.895 36.586 10.064 1.00 47.52 C ATOM 483 N GLU B 359 103.300 36.238 15.439 1.00 46.18 N ATOM 484 CA GLU B 359 102.778 35.607 16.643 1.00 45.46 C ATOM 485 C GLU B 359 101.742 36.461 17.358 1.00 43.49 C ATOM 486 O GLU B 359 100.702 35.953 17.782 1.00 42.56 O ATOM 487 CB GLU B 359 103.925 35.243 17.570 1.00 46.21 C ATOM 488 CG GLU B 359 104.858 34.261 16.890 1.00 51.28 C ATOM 489 CD GLU B 359 106.188 34.147 17.588 1.00 58.96 C ATOM 490 OE1 GLU B 359 106.200 34.267 18.833 1.00 60.82 O ATOM 491 OE2 GLU B 359 107.211 33.944 16.895 1.00 61.12 O ATOM 492 N ASP B 360 102.033 37.751 17.489 1.00 41.54 N ATOM 493 CA ASP B 360 101.114 38.685 18.122 1.00 40.61 C ATOM 494 C ASP B 360 99.833 38.770 17.278 1.00 39.23 C ATOM 495 O ASP B 360 98.739 38.913 17.805 1.00 37.42 O ATOM 496 CB ASP B 360 101.753 40.081 18.262 1.00 40.99 C ATOM 497 CG ASP B 360 102.891 40.132 19.314 1.00 43.18 C ATOM 498 OD1 ASP B 360 103.249 39.097 19.917 1.00 44.68 O ATOM 499 OD2 ASP B 360 103.479 41.194 19.606 1.00 45.04 O ATOM 500 N LYS B 361 99.977 38.689 15.962 1.00 37.62 N ATOM 501 CA LYS B 361 98.822 38.805 15.089 1.00 36.23 C ATOM 502 C LYS B 361 97.960 37.582 15.280 1.00 35.25 C ATOM 503 O LYS B 361 96.716 37.658 15.287 1.00 34.39 O ATOM 504 CB LYS B 361 99.255 38.901 13.630 1.00 36.61 C ATOM 505 CG LYS B 361 98.174 39.417 12.709 1.00 36.46 C ATOM 506 CD LYS B 361 97.352 40.461 13.440 1.00 37.43 C ATOM 507 CE LYS B 361 97.314 41.768 12.685 1.00 38.73 C ATOM 508 NZ LYS B 361 96.266 42.694 13.203 1.00 36.75 N ATOM 509 N VAL B 362 98.601 36.434 15.407 1.00 33.66 N ATOM 510 CA VAL B 362 97.807 35.237 15.576 1.00 33.36 C ATOM 511 C VAL B 362 97.069 35.275 16.881 1.00 33.63 C ATOM 512 O VAL B 362 95.904 34.843 16.919 1.00 31.70 O ATOM 513 CB VAL B 362 98.583 33.897 15.480 1.00 33.25 C ATOM 514 CG1 VAL B 362 97.681 32.672 15.921 1.00 33.86 C ATOM 515 CG2 VAL B 362 99.050 33.679 14.064 1.00 33.45 C ATOM 516 N GLU B 363 97.707 35.727 17.959 1.00 33.07 N ATOM 517 CA GLU B 363 96.992 35.687 19.240 1.00 32.57 C ATOM 518 C GLU B 363 95.869 36.711 19.226 1.00 30.45 C ATOM 519 O GLU B 363 94.815 36.459 19.797 1.00 29.91 O ATOM 520 CB GLU B 363 97.925 35.875 20.456 1.00 34.03 C ATOM 521 CG GLU B 363 97.363 35.280 21.757 1.00 39.61 C ATOM 522 CD GLU B 363 97.425 33.752 21.834 1.00 47.50 C ATOM 523 OE1 GLU B 363 98.410 33.162 21.320 1.00 52.27 O ATOM 524 OE2 GLU B 363 96.501 33.128 22.429 1.00 49.95 O ATOM 525 N GLU B 364 96.103 37.845 18.577 1.00 28.37 N ATOM 526 CA GLU B 364 95.101 38.873 18.434 1.00 29.23 C ATOM 527 C GLU B 364 93.884 38.273 17.702 1.00 28.33 C ATOM 528 O GLU B 364 92.761 38.461 18.126 1.00 26.27 O ATOM 529 CB GLU B 364 95.618 40.030 17.607 1.00 30.13 C ATOM 530 CG GLU B 364 94.614 41.169 17.473 1.00 32.85 C ATOM 531 CD GLU B 364 95.013 42.194 16.430 1.00 40.95 C ATOM 532 OE1 GLU B 364 96.080 42.033 15.801 1.00 45.86 O ATOM 533 OE2 GLU B 364 94.273 43.186 16.250 1.00 45.81 O ATOM 534 N LEU B 365 94.139 37.575 16.597 1.00 26.61 N ATOM 535 CA LEU B 365 93.080 36.913 15.801 1.00 25.40 C ATOM 536 C LEU B 365 92.320 35.781 16.496 1.00 25.82 C ATOM 537 O LEU B 365 91.112 35.573 16.258 1.00 23.21 O ATOM 538 CB LEU B 365 93.646 36.453 14.452 1.00 25.32 C ATOM 539 CG LEU B 365 94.097 37.638 13.593 1.00 23.22 C ATOM 540 CD1 LEU B 365 94.703 37.214 12.255 1.00 24.06 C ATOM 541 CD2 LEU B 365 92.994 38.648 13.396 1.00 28.33 C ATOM 542 N LEU B 366 93.010 34.953 17.278 1.00 24.90 N ATOM 543 CA LEU B 366 92.357 33.930 18.070 1.00 26.18 C ATOM 544 C LEU B 366 91.374 34.549 19.064 1.00 24.82 C ATOM 545 O LEU B 366 90.281 34.006 19.300 1.00 23.65 O ATOM 546 CB LEU B 366 93.391 33.073 18.823 1.00 27.74 C ATOM 547 CG LEU B 366 94.046 31.989 17.972 1.00 31.69 C ATOM 548 CD1 LEU B 366 95.376 31.480 18.670 1.00 34.89 C ATOM 549 CD2 LEU B 366 93.049 30.871 17.632 1.00 32.89 C ATOM 550 N SER B 367 91.764 35.674 19.640 1.00 24.81 N ATOM 551 CA SER B 367 90.857 36.356 20.574 1.00 24.87 C ATOM 552 C SER B 367 89.638 36.926 19.839 1.00 23.57 C ATOM 553 O SER B 367 88.493 36.760 20.309 1.00 21.80 O ATOM 554 CB SER B 367 91.581 37.429 21.415 1.00 26.47 C ATOM 555 OG SER B 367 90.642 38.249 22.116 1.00 31.00 O ATOM 556 N LYS B 368 89.863 37.592 18.713 1.00 21.15 N ATOM 557 CA LYS B 368 88.740 38.106 17.956 1.00 22.55 C ATOM 558 C LYS B 368 87.778 36.944 17.547 1.00 21.18 C ATOM 559 O LYS B 368 86.569 37.100 17.596 1.00 21.05 O ATOM 560 CB LYS B 368 89.207 38.844 16.713 1.00 22.62 C ATOM 561 CG LYS B 368 89.883 40.200 17.017 1.00 26.23 C ATOM 562 CD LYS B 368 90.178 41.003 15.751 1.00 32.32 C ATOM 563 CE LYS B 368 90.859 42.361 16.069 1.00 34.59 C ATOM 564 NZ LYS B 368 91.355 43.056 14.847 1.00 36.78 N ATOM 565 N ASN B 369 88.348 35.827 17.120 1.00 19.74 N ATOM 566 CA ASN B 369 87.574 34.650 16.734 1.00 19.59 C ATOM 567 C ASN B 369 86.747 34.155 17.916 1.00 19.56 C ATOM 568 O ASN B 369 85.554 33.805 17.767 1.00 17.43 O ATOM 569 CB ASN B 369 88.537 33.574 16.218 1.00 20.72 C ATOM 570 CG ASN B 369 87.857 32.328 15.806 1.00 21.96 C ATOM 571 OD1 ASN B 369 87.452 32.160 14.657 1.00 24.13 O ATOM 572 ND2 ASN B 369 87.770 31.412 16.732 1.00 22.42 N ATOM 573 N TYR B 370 87.356 34.108 19.105 1.00 18.50 N ATOM 574 CA TYR B 370 86.624 33.647 20.285 1.00 19.17 C ATOM 575 C TYR B 370 85.419 34.560 20.576 1.00 18.17 C ATOM 576 O TYR B 370 84.298 34.074 20.829 1.00 19.04 O ATOM 577 CB TYR B 370 87.592 33.620 21.481 1.00 19.66 C ATOM 578 CG TYR B 370 86.922 33.356 22.813 1.00 21.53 C ATOM 579 CD1 TYR B 370 86.729 32.062 23.261 1.00 22.44 C ATOM 580 CD2 TYR B 370 86.520 34.411 23.627 1.00 22.77 C ATOM 581 CE1 TYR B 370 86.142 31.812 24.502 1.00 26.49 C ATOM 582 CE2 TYR B 370 85.935 34.166 24.876 1.00 24.00 C ATOM 583 CZ TYR B 370 85.740 32.869 25.297 1.00 23.50 C ATOM 584 OH TYR B 370 85.166 32.577 26.513 1.00 22.48 O ATOM 585 N HIS B 371 85.624 35.872 20.488 1.00 17.87 N ATOM 586 CA HIS B 371 84.550 36.808 20.723 1.00 17.89 C ATOM 587 C HIS B 371 83.496 36.762 19.621 1.00 18.25 C ATOM 588 O HIS B 371 82.325 36.836 19.941 1.00 16.05 O ATOM 589 CB HIS B 371 85.069 38.194 21.036 1.00 19.54 C ATOM 590 CG HIS B 371 85.875 38.191 22.296 1.00 20.75 C ATOM 591 ND1 HIS B 371 85.335 37.799 23.503 1.00 21.26 N ATOM 592 CD2 HIS B 371 87.192 38.409 22.524 1.00 25.10 C ATOM 593 CE1 HIS B 371 86.279 37.818 24.431 1.00 21.97 C ATOM 594 NE2 HIS B 371 87.415 38.190 23.864 1.00 24.00 N ATOM 595 N LEU B 372 83.920 36.623 18.367 1.00 16.95 N ATOM 596 CA LEU B 372 82.930 36.432 17.302 1.00 17.09 C ATOM 597 C LEU B 372 82.111 35.187 17.490 1.00 16.89 C ATOM 598 O LEU B 372 80.896 35.203 17.264 1.00 17.50 O ATOM 599 CB LEU B 372 83.573 36.476 15.928 1.00 16.85 C ATOM 600 CG LEU B 372 83.970 37.898 15.547 1.00 18.49 C ATOM 601 CD1 LEU B 372 85.087 37.767 14.562 1.00 20.06 C ATOM 602 CD2 LEU B 372 82.866 38.648 14.894 1.00 18.86 C ATOM 603 N GLU B 373 82.725 34.090 17.934 1.00 16.55 N ATOM 604 CA GLU B 373 81.921 32.881 18.189 1.00 17.25 C ATOM 605 C GLU B 373 80.923 33.094 19.299 1.00 18.76 C ATOM 606 O GLU B 373 79.754 32.625 19.232 1.00 17.88 O ATOM 607 CB GLU B 373 82.783 31.637 18.428 1.00 18.57 C ATOM 608 CG GLU B 373 83.499 31.268 17.149 1.00 21.83 C ATOM 609 CD GLU B 373 84.250 29.971 17.241 1.00 31.33 C ATOM 610 OE1 GLU B 373 84.672 29.621 18.362 1.00 34.00 O ATOM 611 OE2 GLU B 373 84.405 29.298 16.200 1.00 33.26 O ATOM 612 N ASN B 374 81.354 33.816 20.315 1.00 18.31 N ATOM 613 CA ASN B 374 80.472 34.171 21.426 1.00 20.10 C ATOM 614 C ASN B 374 79.267 34.982 20.936 1.00 19.45 C ATOM 615 O ASN B 374 78.150 34.717 21.370 1.00 18.30 O ATOM 616 CB ASN B 374 81.248 34.996 22.480 1.00 19.98 C ATOM 617 CG ASN B 374 80.395 35.427 23.666 1.00 26.02 C ATOM 618 OD1 ASN B 374 79.836 36.516 23.670 1.00 33.88 O ATOM 619 ND2 ASN B 374 80.320 34.588 24.697 1.00 28.27 N ATOM 620 N GLU B 375 79.516 35.987 20.087 1.00 18.57 N ATOM 621 CA GLU B 375 78.464 36.874 19.607 1.00 17.41 C ATOM 622 C GLU B 375 77.430 36.097 18.758 1.00 17.22 C ATOM 623 O GLU B 375 76.208 36.292 18.882 1.00 15.97 O ATOM 624 CB GLU B 375 79.120 38.057 18.869 1.00 18.17 C ATOM 625 CG GLU B 375 78.175 39.079 18.295 1.00 21.47 C ATOM 626 CD GLU B 375 77.487 39.906 19.371 1.00 25.33 C ATOM 627 OE1 GLU B 375 77.593 39.563 20.608 1.00 25.94 O ATOM 628 OE2 GLU B 375 76.805 40.855 18.961 1.00 25.49 O ATOM 629 N VAL B 376 77.941 35.243 17.888 1.00 15.22 N ATOM 630 CA VAL B 376 77.080 34.305 17.119 1.00 16.66 C ATOM 631 C VAL B 376 76.170 33.419 17.998 1.00 16.84 C ATOM 632 O VAL B 376 74.976 33.368 17.771 1.00 15.79 O ATOM 633 CB VAL B 376 77.922 33.414 16.214 1.00 15.48 C ATOM 634 CG1 VAL B 376 77.108 32.238 15.565 1.00 14.47 C ATOM 635 CG2 VAL B 376 78.603 34.260 15.000 1.00 13.87 C ATOM 636 N ALA B 377 76.760 32.851 19.036 1.00 17.10 N ATOM 637 CA ALA B 377 75.972 32.039 19.983 1.00 18.35 C ATOM 638 C ALA B 377 74.890 32.894 20.653 1.00 18.82 C ATOM 639 O ALA B 377 73.727 32.464 20.758 1.00 19.08 O ATOM 640 CB ALA B 377 76.892 31.403 21.007 1.00 17.89 C ATOM 641 N ARG B 378 75.258 34.082 21.103 1.00 17.95 N ATOM 642 CA ARG B 378 74.306 35.009 21.756 1.00 18.34 C ATOM 643 C ARG B 378 73.158 35.369 20.837 1.00 17.79 C ATOM 644 O ARG B 378 71.976 35.397 21.250 1.00 14.99 O ATOM 645 CB ARG B 378 74.997 36.305 22.188 1.00 18.08 C ATOM 646 CG ARG B 378 74.064 37.359 22.825 1.00 20.67 C ATOM 647 CD ARG B 378 74.767 38.698 23.145 1.00 24.18 C ATOM 648 NE ARG B 378 75.050 39.537 21.980 1.00 24.47 N ATOM 649 CZ ARG B 378 74.137 40.311 21.378 1.00 28.05 C ATOM 650 NH1 ARG B 378 72.873 40.331 21.818 1.00 25.21 N ATOM 651 NH2 ARG B 378 74.476 41.076 20.363 1.00 27.33 N ATOM 652 N LEU B 379 73.495 35.710 19.593 1.00 15.39 N ATOM 653 CA LEU B 379 72.450 36.114 18.673 1.00 15.10 C ATOM 654 C LEU B 379 71.561 34.969 18.282 1.00 15.03 C ATOM 655 O LEU B 379 70.344 35.143 18.120 1.00 15.23 O ATOM 656 CB LEU B 379 73.060 36.753 17.426 1.00 14.24 C ATOM 657 CG LEU B 379 73.624 38.161 17.676 1.00 16.24 C ATOM 658 CD1 LEU B 379 74.665 38.578 16.636 1.00 18.15 C ATOM 659 CD2 LEU B 379 72.490 39.166 17.735 1.00 19.20 C ATOM 660 N LYS B 380 72.122 33.770 18.134 1.00 14.94 N ATOM 661 CA LYS B 380 71.243 32.622 17.823 1.00 15.44 C ATOM 662 C LYS B 380 70.212 32.425 18.917 1.00 17.08 C ATOM 663 O LYS B 380 69.054 32.049 18.649 1.00 16.95 O ATOM 664 CB LYS B 380 72.001 31.301 17.598 1.00 15.41 C ATOM 665 CG LYS B 380 72.838 31.287 16.328 1.00 12.76 C ATOM 666 CD LYS B 380 73.733 30.019 16.257 1.00 15.44 C ATOM 667 CE LYS B 380 74.534 29.988 14.934 1.00 17.68 C ATOM 668 NZ LYS B 380 75.602 28.978 15.081 1.00 21.31 N ATOM 669 N LYS B 381 70.647 32.544 20.158 1.00 19.17 N ATOM 670 CA LYS B 381 69.723 32.422 21.277 1.00 19.72 C ATOM 671 C LYS B 381 68.643 33.532 21.231 1.00 20.66 C ATOM 672 O LYS B 381 67.475 33.298 21.526 1.00 20.09 O ATOM 673 CB LYS B 381 70.537 32.495 22.584 1.00 20.31 C ATOM 674 CG LYS B 381 69.684 32.470 23.892 1.00 22.76 C ATOM 675 CD LYS B 381 68.696 31.351 23.934 1.00 27.11 C ATOM 676 CE LYS B 381 68.274 31.102 25.366 1.00 35.20 C ATOM 677 NZ LYS B 381 67.809 32.388 25.979 1.00 39.99 N ATOM 678 N LEU B 382 69.029 34.741 20.856 1.00 19.89 N ATOM 679 CA LEU B 382 68.098 35.857 20.832 1.00 19.06 C ATOM 680 C LEU B 382 67.061 35.616 19.714 1.00 19.57 C ATOM 681 O LEU B 382 65.846 35.831 19.882 1.00 18.81 O ATOM 682 CB LEU B 382 68.847 37.180 20.662 1.00 19.54 C ATOM 683 CG LEU B 382 68.034 38.480 20.618 1.00 20.20 C ATOM 684 CD1 LEU B 382 67.078 38.603 21.847 1.00 21.45 C ATOM 685 CD2 LEU B 382 69.041 39.685 20.562 1.00 21.32 C ATOM 686 N VAL B 383 67.531 35.105 18.589 1.00 17.68 N ATOM 687 CA VAL B 383 66.628 34.744 17.505 1.00 18.61 C ATOM 688 C VAL B 383 65.609 33.607 17.940 1.00 20.45 C ATOM 689 O VAL B 383 64.414 33.729 17.675 1.00 19.69 O ATOM 690 CB VAL B 383 67.388 34.267 16.238 1.00 18.63 C ATOM 691 CG1 VAL B 383 66.446 33.599 15.206 1.00 17.47 C ATOM 692 CG2 VAL B 383 68.171 35.469 15.564 1.00 16.13 C ATOM 693 N GLY B 384 66.095 32.541 18.582 1.00 19.11 N ATOM 694 CA GLY B 384 65.221 31.489 19.096 1.00 20.21 C ATOM 695 C GLY B 384 64.213 32.085 20.078 1.00 20.65 C ATOM 696 O GLY B 384 63.002 31.763 20.005 1.00 21.36 O ATOM 697 N ASP B 385 64.676 32.944 20.975 1.00 19.54 N ATOM 698 CA ASP B 385 63.790 33.503 21.992 1.00 20.66 C ATOM 699 C ASP B 385 62.741 34.384 21.323 1.00 21.60 C ATOM 700 O ASP B 385 61.523 34.331 21.659 1.00 19.78 O ATOM 701 CB ASP B 385 64.557 34.320 23.016 1.00 21.09 C ATOM 702 CG ASP B 385 65.345 33.458 23.963 1.00 23.43 C ATOM 703 OD1 ASP B 385 65.178 32.221 23.904 1.00 22.96 O ATOM 704 OD2 ASP B 385 66.110 33.963 24.812 1.00 25.53 O ATOM 705 N LEU B 386 63.180 35.223 20.394 1.00 19.17 N ATOM 706 CA LEU B 386 62.201 36.053 19.704 1.00 20.25 C ATOM 707 C LEU B 386 61.229 35.240 18.860 1.00 20.66 C ATOM 708 O LEU B 386 60.041 35.603 18.700 1.00 20.83 O ATOM 709 CB LEU B 386 62.904 37.124 18.849 1.00 19.42 C ATOM 710 CG LEU B 386 63.521 38.242 19.695 1.00 19.87 C ATOM 711 CD1 LEU B 386 64.377 39.098 18.800 1.00 20.00 C ATOM 712 CD2 LEU B 386 62.416 39.139 20.363 1.00 22.65 C ATOM 713 N LEU B 387 61.674 34.124 18.327 1.00 20.65 N ATOM 714 CA LEU B 387 60.736 33.383 17.528 1.00 20.74 C ATOM 715 C LEU B 387 59.718 32.727 18.470 1.00 22.75 C ATOM 716 O LEU B 387 58.560 32.490 18.116 1.00 22.54 O ATOM 717 CB LEU B 387 61.438 32.323 16.695 1.00 21.08 C ATOM 718 CG LEU B 387 62.058 32.796 15.390 1.00 19.90 C ATOM 719 CD1 LEU B 387 63.042 31.665 14.930 1.00 20.10 C ATOM 720 CD2 LEU B 387 60.999 32.979 14.321 1.00 19.84 C ATOM 721 N ASN B 388 60.151 32.380 19.662 1.00 22.00 N ATOM 722 CA ASN B 388 59.214 31.830 20.633 1.00 23.79 C ATOM 723 C ASN B 388 58.209 32.890 21.071 1.00 23.69 C ATOM 724 O ASN B 388 57.013 32.580 21.223 1.00 23.61 O ATOM 725 CB ASN B 388 59.945 31.275 21.834 1.00 23.08 C ATOM 726 CG ASN B 388 60.549 29.894 21.556 1.00 27.92 C ATOM 727 OD1 ASN B 388 60.088 29.146 20.667 1.00 32.00 O ATOM 728 ND2 ASN B 388 61.594 29.554 22.303 1.00 33.62 N ATOM 729 N VAL B 389 58.706 34.098 21.326 1.00 22.77 N ATOM 730 CA VAL B 389 57.851 35.256 21.627 1.00 23.92 C ATOM 731 C VAL B 389 56.804 35.503 20.521 1.00 24.13 C ATOM 732 O VAL B 389 55.596 35.681 20.809 1.00 23.70 O ATOM 733 CB VAL B 389 58.688 36.515 21.840 1.00 24.76 C ATOM 734 CG1 VAL B 389 57.836 37.793 21.677 1.00 25.22 C ATOM 735 CG2 VAL B 389 59.373 36.466 23.223 1.00 25.12 C ATOM 736 N LYS B 390 57.241 35.484 19.268 1.00 22.09 N ATOM 737 CA LYS B 390 56.327 35.679 18.149 1.00 22.13 C ATOM 738 C LYS B 390 55.203 34.635 18.191 1.00 23.22 C ATOM 739 O LYS B 390 54.032 34.970 18.007 1.00 22.92 O ATOM 740 CB LYS B 390 57.045 35.607 16.791 1.00 20.21 C ATOM 741 CG LYS B 390 56.096 35.624 15.566 1.00 21.44 C ATOM 742 CD LYS B 390 56.886 35.535 14.206 1.00 19.89 C ATOM 743 CE LYS B 390 55.961 35.584 12.996 1.00 24.87 C ATOM 744 NZ LYS B 390 55.016 34.443 13.009 1.00 23.33 N ATOM 745 N MET B 391 55.563 33.374 18.438 1.00 23.44 N ATOM 746 CA MET B 391 54.599 32.284 18.491 1.00 25.42 C ATOM 747 C MET B 391 53.564 32.566 19.566 1.00 24.25 C ATOM 748 O MET B 391 52.365 32.339 19.323 1.00 23.90 O ATOM 749 CB MET B 391 55.312 30.968 18.817 1.00 25.86 C ATOM 750 CG MET B 391 54.375 29.793 19.097 1.00 32.91 C ATOM 751 SD MET B 391 55.324 28.238 19.344 1.00 47.28 S ATOM 752 CE MET B 391 56.746 28.609 18.132 1.00 43.13 C ATOM 753 N ALA B 392 54.020 32.995 20.741 1.00 22.01 N ATOM 754 CA ALA B 392 53.087 33.245 21.843 1.00 23.03 C ATOM 755 C ALA B 392 52.166 34.436 21.558 1.00 22.48 C ATOM 756 O ALA B 392 50.967 34.417 21.878 1.00 22.38 O ATOM 757 CB ALA B 392 53.819 33.425 23.200 1.00 22.25 C ATOM 758 N LEU B 393 52.700 35.479 20.953 1.00 21.84 N ATOM 759 CA LEU B 393 51.872 36.639 20.641 1.00 21.17 C ATOM 760 C LEU B 393 50.853 36.304 19.557 1.00 22.33 C ATOM 761 O LEU B 393 49.685 36.757 19.601 1.00 21.95 O ATOM 762 CB LEU B 393 52.760 37.805 20.198 1.00 21.19 C ATOM 763 CG LEU B 393 53.665 38.408 21.287 1.00 21.59 C ATOM 764 CD1 LEU B 393 54.624 39.478 20.723 1.00 20.62 C ATOM 765 CD2 LEU B 393 52.819 39.045 22.447 1.00 25.28 C ATOM 766 N ASP B 394 51.289 35.519 18.574 1.00 21.99 N ATOM 767 CA ASP B 394 50.410 35.147 17.489 1.00 22.43 C ATOM 768 C ASP B 394 49.228 34.396 18.077 1.00 22.43 C ATOM 769 O ASP B 394 48.088 34.590 17.654 1.00 22.14 O ATOM 770 CB ASP B 394 51.114 34.214 16.521 1.00 21.99 C ATOM 771 CG ASP B 394 51.929 34.938 15.498 1.00 24.18 C ATOM 772 OD1 ASP B 394 51.739 36.170 15.291 1.00 24.61 O ATOM 773 OD2 ASP B 394 52.815 34.344 14.845 1.00 26.21 O ATOM 774 N ILE B 395 49.506 33.541 19.056 1.00 23.34 N ATOM 775 CA ILE B 395 48.428 32.796 19.705 1.00 24.11 C ATOM 776 C ILE B 395 47.455 33.756 20.440 1.00 24.03 C ATOM 777 O ILE B 395 46.216 33.621 20.309 1.00 23.21 O ATOM 778 CB ILE B 395 48.995 31.672 20.625 1.00 24.56 C ATOM 779 CG1 ILE B 395 49.536 30.512 19.789 1.00 26.84 C ATOM 780 CG2 ILE B 395 47.927 31.087 21.564 1.00 23.85 C ATOM 781 CD1 ILE B 395 50.431 29.535 20.590 1.00 28.25 C ATOM 782 N GLU B 396 47.992 34.743 21.156 1.00 23.94 N ATOM 783 CA GLU B 396 47.135 35.684 21.876 1.00 24.13 C ATOM 784 C GLU B 396 46.265 36.474 20.894 1.00 24.95 C ATOM 785 O GLU B 396 45.082 36.697 21.141 1.00 23.22 O ATOM 786 CB GLU B 396 47.935 36.669 22.731 1.00 24.30 C ATOM 787 CG GLU B 396 48.801 35.988 23.794 1.00 27.44 C ATOM 788 CD GLU B 396 49.335 36.978 24.807 1.00 32.99 C ATOM 789 OE1 GLU B 396 50.087 37.887 24.405 1.00 34.12 O ATOM 790 OE2 GLU B 396 48.950 36.905 25.994 1.00 38.87 O ATOM 791 N ILE B 397 46.854 36.926 19.804 1.00 24.19 N ATOM 792 CA ILE B 397 46.064 37.689 18.845 1.00 25.27 C ATOM 793 C ILE B 397 45.023 36.803 18.198 1.00 25.58 C ATOM 794 O ILE B 397 43.893 37.231 17.937 1.00 24.67 O ATOM 795 CB ILE B 397 46.948 38.220 17.762 1.00 25.91 C ATOM 796 CG1 ILE B 397 47.719 39.441 18.258 1.00 26.58 C ATOM 797 CG2 ILE B 397 46.150 38.767 16.597 1.00 27.82 C ATOM 798 CD1 ILE B 397 48.801 39.843 17.308 1.00 29.14 C ATOM 799 N ALA B 398 45.370 35.542 17.954 1.00 24.01 N ATOM 800 CA ALA B 398 44.416 34.694 17.299 1.00 24.22 C ATOM 801 C ALA B 398 43.227 34.532 18.213 1.00 24.43 C ATOM 802 O ALA B 398 42.098 34.353 17.746 1.00 23.77 O ATOM 803 CB ALA B 398 45.007 33.307 16.971 1.00 23.78 C ATOM 804 N THR B 399 43.472 34.484 19.509 1.00 23.80 N ATOM 805 CA THR B 399 42.393 34.292 20.455 1.00 24.85 C ATOM 806 C THR B 399 41.442 35.477 20.400 1.00 24.23 C ATOM 807 O THR B 399 40.216 35.295 20.336 1.00 25.56 O ATOM 808 CB THR B 399 42.952 34.220 21.885 1.00 25.20 C ATOM 809 OG1 THR B 399 43.697 33.004 22.025 1.00 27.14 O ATOM 810 CG2 THR B 399 41.816 34.092 22.901 1.00 23.60 C ATOM 811 N TYR B 400 42.009 36.662 20.482 1.00 23.96 N ATOM 812 CA TYR B 400 41.230 37.893 20.402 1.00 25.30 C ATOM 813 C TYR B 400 40.432 37.990 19.097 1.00 25.70 C ATOM 814 O TYR B 400 39.252 38.312 19.100 1.00 24.75 O ATOM 815 CB TYR B 400 42.148 39.094 20.454 1.00 25.45 C ATOM 816 CG TYR B 400 42.551 39.491 21.853 1.00 27.06 C ATOM 817 CD1 TYR B 400 41.610 39.892 22.769 1.00 26.08 C ATOM 818 CD2 TYR B 400 43.888 39.424 22.267 1.00 30.83 C ATOM 819 CE1 TYR B 400 41.969 40.251 24.070 1.00 26.30 C ATOM 820 CE2 TYR B 400 44.263 39.763 23.558 1.00 31.29 C ATOM 821 CZ TYR B 400 43.290 40.180 24.463 1.00 31.51 C ATOM 822 OH TYR B 400 43.642 40.531 25.747 1.00 32.63 O ATOM 823 N ARG B 401 41.102 37.800 17.974 1.00 24.89 N ATOM 824 CA ARG B 401 40.421 37.889 16.686 1.00 26.54 C ATOM 825 C ARG B 401 39.284 36.913 16.508 1.00 26.70 C ATOM 826 O ARG B 401 38.222 37.239 15.950 1.00 27.32 O ATOM 827 CB ARG B 401 41.438 37.749 15.569 1.00 26.43 C ATOM 828 CG ARG B 401 42.429 38.897 15.602 1.00 29.66 C ATOM 829 CD ARG B 401 43.135 39.091 14.314 1.00 39.29 C ATOM 830 NE ARG B 401 42.089 39.229 13.317 1.00 44.98 N ATOM 831 CZ ARG B 401 42.294 39.217 12.023 1.00 48.05 C ATOM 832 NH1 ARG B 401 43.526 39.075 11.535 1.00 47.15 N ATOM 833 NH2 ARG B 401 41.246 39.349 11.216 1.00 48.47 N ATOM 834 N LYS B 402 39.514 35.701 16.986 1.00 26.17 N ATOM 835 CA LYS B 402 38.495 34.663 16.900 1.00 29.12 C ATOM 836 C LYS B 402 37.278 35.063 17.731 1.00 29.72 C ATOM 837 O LYS B 402 36.143 34.941 17.279 1.00 29.15 O ATOM 838 CB LYS B 402 39.042 33.307 17.358 1.00 29.48 C ATOM 839 CG LYS B 402 37.968 32.211 17.528 1.00 36.53 C ATOM 840 CD LYS B 402 37.715 31.431 16.236 1.00 44.68 C ATOM 841 CE LYS B 402 38.441 30.080 16.235 1.00 49.88 C ATOM 842 NZ LYS B 402 38.645 29.505 14.867 1.00 54.30 N ATOM 843 N LEU B 403 37.539 35.579 18.932 1.00 29.64 N ATOM 844 CA LEU B 403 36.494 36.087 19.818 1.00 32.12 C ATOM 845 C LEU B 403 35.800 37.299 19.196 1.00 31.56 C ATOM 846 O LEU B 403 34.593 37.376 19.258 1.00 33.89 O ATOM 847 CB LEU B 403 37.060 36.457 21.208 1.00 31.54 C ATOM 848 CG LEU B 403 37.232 35.170 22.016 1.00 34.85 C ATOM 849 CD1 LEU B 403 37.939 35.424 23.378 1.00 37.55 C ATOM 850 CD2 LEU B 403 35.858 34.464 22.213 1.00 39.62 C ATOM 851 N LEU B 404 36.539 38.213 18.597 1.00 32.67 N ATOM 852 CA LEU B 404 35.936 39.401 18.027 1.00 35.47 C ATOM 853 C LEU B 404 35.074 39.000 16.825 1.00 39.02 C ATOM 854 O LEU B 404 34.031 39.608 16.579 1.00 38.45 O ATOM 855 CB LEU B 404 37.013 40.383 17.664 1.00 34.70 C ATOM 856 CG LEU B 404 37.486 41.356 18.781 1.00 33.34 C ATOM 857 CD1 LEU B 404 38.776 42.042 18.425 1.00 32.18 C ATOM 858 CD2 LEU B 404 36.424 42.442 19.066 1.00 32.36 C ATOM 859 N GLU B 405 35.497 37.968 16.099 1.00 41.76 N ATOM 860 CA GLU B 405 34.797 37.596 14.882 1.00 46.44 C ATOM 861 C GLU B 405 33.410 37.073 15.199 1.00 48.72 C ATOM 862 O GLU B 405 32.435 37.444 14.551 1.00 49.59 O ATOM 863 CB GLU B 405 35.653 36.677 13.995 1.00 46.94 C ATOM 864 CG GLU B 405 36.504 37.503 13.026 1.00 51.45 C ATOM 865 CD GLU B 405 37.895 36.948 12.672 1.00 58.47 C ATOM 866 OE1 GLU B 405 38.431 36.006 13.312 1.00 60.87 O ATOM 867 OE2 GLU B 405 38.495 37.503 11.725 1.00 60.68 O