>>1HGU:HELIX    5  H4 ASP A  154  SER A  184  1                                  31    
DALLKNYGLLYCFRKDMDKVETFLRIVQCRS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 5 H4 ASP A 154 SER A 184 1 31 ATOM 1199 N ASP A 154 57.132 11.794 51.429 1.00 33.73 N ATOM 1200 CA ASP A 154 57.627 12.979 50.730 1.00 32.52 C ATOM 1201 C ASP A 154 56.555 14.072 50.859 1.00 30.52 C ATOM 1202 O ASP A 154 56.846 15.158 51.356 1.00 28.72 O ATOM 1203 CB ASP A 154 57.930 12.679 49.246 1.00 31.80 C ATOM 1204 CG ASP A 154 59.032 13.605 48.741 1.00 31.10 C ATOM 1205 OD1 ASP A 154 60.187 13.400 49.103 1.00 30.47 O ATOM 1206 OD2 ASP A 154 58.761 14.529 47.989 1.00 30.57 O ATOM 1207 N ALA A 155 55.294 13.715 50.544 1.00 27.20 N ATOM 1208 CA ALA A 155 54.098 14.552 50.510 1.00 25.99 C ATOM 1209 C ALA A 155 54.141 15.776 51.342 1.00 24.85 C ATOM 1210 O ALA A 155 53.764 16.838 50.889 1.00 23.64 O ATOM 1211 CB ALA A 155 52.837 13.839 50.972 1.00 25.07 C ATOM 1212 N LEU A 156 54.661 15.633 52.546 1.00 24.93 N ATOM 1213 CA LEU A 156 54.719 16.755 53.466 1.00 24.87 C ATOM 1214 C LEU A 156 55.800 17.702 53.027 1.00 25.60 C ATOM 1215 O LEU A 156 55.541 18.875 53.214 1.00 26.21 O ATOM 1216 CB LEU A 156 55.028 16.392 54.927 1.00 23.56 C ATOM 1217 CG LEU A 156 55.464 14.999 55.251 1.00 23.71 C ATOM 1218 CD1 LEU A 156 56.831 15.087 55.952 1.00 23.03 C ATOM 1219 CD2 LEU A 156 54.261 14.276 55.900 1.00 22.54 C ATOM 1220 N LEU A 157 56.990 17.377 52.507 1.00 25.22 N ATOM 1221 CA LEU A 157 57.830 18.414 51.944 1.00 24.41 C ATOM 1222 C LEU A 157 57.210 18.952 50.653 1.00 25.00 C ATOM 1223 O LEU A 157 57.687 19.979 50.148 1.00 25.85 O ATOM 1224 CB LEU A 157 59.218 17.873 51.689 1.00 23.19 C ATOM 1225 CG LEU A 157 60.139 18.144 52.850 1.00 22.60 C ATOM 1226 CD1 LEU A 157 61.489 17.566 52.545 1.00 20.88 C ATOM 1227 CD2 LEU A 157 60.341 19.612 53.055 1.00 20.24 C ATOM 1228 N LYS A 158 56.154 18.308 50.092 1.00 24.54 N ATOM 1229 CA LYS A 158 55.386 18.992 49.033 1.00 24.12 C ATOM 1230 C LYS A 158 54.772 20.119 49.870 1.00 24.06 C ATOM 1231 O LYS A 158 55.186 21.259 49.665 1.00 23.30 O ATOM 1232 CB LYS A 158 54.201 18.148 48.341 1.00 23.04 C ATOM 1233 CG LYS A 158 54.349 17.262 47.037 1.00 20.54 C ATOM 1234 CD LYS A 158 55.489 16.205 47.081 1.00 20.23 C ATOM 1235 CE LYS A 158 55.508 15.013 46.074 1.00 19.62 C ATOM 1236 NZ LYS A 158 56.767 14.244 46.179 1.00 16.92 N ATOM 1237 N ASN A 159 54.030 19.721 50.941 1.00 24.68 N ATOM 1238 CA ASN A 159 53.321 20.540 51.945 1.00 25.68 C ATOM 1239 C ASN A 159 53.949 21.708 52.664 1.00 25.02 C ATOM 1240 O ASN A 159 53.448 22.824 52.605 1.00 24.08 O ATOM 1241 CB ASN A 159 52.815 19.657 53.000 1.00 28.04 C ATOM 1242 CG ASN A 159 51.428 19.272 52.610 1.00 32.61 C ATOM 1243 OD1 ASN A 159 50.558 20.038 52.994 1.00 34.36 O ATOM 1244 ND2 ASN A 159 51.098 18.219 51.829 1.00 33.55 N ATOM 1245 N TYR A 160 55.115 21.445 53.239 1.00 26.05 N ATOM 1246 CA TYR A 160 56.015 22.349 53.904 1.00 27.29 C ATOM 1247 C TYR A 160 56.021 23.661 53.180 1.00 25.30 C ATOM 1248 O TYR A 160 55.609 24.677 53.710 1.00 25.83 O ATOM 1249 CB TYR A 160 57.423 21.727 53.904 1.00 30.83 C ATOM 1250 CG TYR A 160 58.721 22.535 53.658 1.00 35.34 C ATOM 1251 CD1 TYR A 160 59.203 22.773 52.373 1.00 37.11 C ATOM 1252 CD2 TYR A 160 59.511 22.946 54.724 1.00 36.62 C ATOM 1253 CE1 TYR A 160 60.434 23.391 52.186 1.00 37.94 C ATOM 1254 CE2 TYR A 160 60.742 23.568 54.537 1.00 37.50 C ATOM 1255 CZ TYR A 160 61.206 23.784 53.263 1.00 38.03 C ATOM 1256 OH TYR A 160 62.436 24.370 53.055 1.00 37.80 O ATOM 1257 N GLY A 161 56.381 23.564 51.907 1.00 24.07 N ATOM 1258 CA GLY A 161 56.527 24.717 51.067 1.00 24.69 C ATOM 1259 C GLY A 161 55.385 25.723 51.224 1.00 24.81 C ATOM 1260 O GLY A 161 55.670 26.869 51.561 1.00 25.47 O ATOM 1261 N LEU A 162 54.110 25.359 51.079 1.00 22.33 N ATOM 1262 CA LEU A 162 53.121 26.392 51.138 1.00 21.04 C ATOM 1263 C LEU A 162 53.122 26.964 52.537 1.00 21.31 C ATOM 1264 O LEU A 162 53.222 28.180 52.651 1.00 20.00 O ATOM 1265 CB LEU A 162 51.783 25.783 50.677 1.00 19.81 C ATOM 1266 CG LEU A 162 51.307 25.690 49.161 1.00 17.87 C ATOM 1267 CD1 LEU A 162 52.296 26.349 48.189 1.00 13.40 C ATOM 1268 CD2 LEU A 162 51.071 24.196 48.839 1.00 17.40 C ATOM 1269 N LEU A 163 53.285 26.127 53.560 1.00 22.99 N ATOM 1270 CA LEU A 163 53.359 26.564 54.964 1.00 24.39 C ATOM 1271 C LEU A 163 54.625 27.325 55.257 1.00 25.94 C ATOM 1272 O LEU A 163 54.781 27.845 56.371 1.00 26.88 O ATOM 1273 CB LEU A 163 53.334 25.409 56.033 1.00 22.60 C ATOM 1274 CG LEU A 163 52.044 25.269 56.819 1.00 21.20 C ATOM 1275 CD1 LEU A 163 51.433 26.650 57.047 1.00 21.31 C ATOM 1276 CD2 LEU A 163 50.984 24.547 56.019 1.00 19.90 C ATOM 1277 N TYR A 164 55.567 27.318 54.314 1.00 25.66 N ATOM 1278 CA TYR A 164 56.663 28.222 54.476 1.00 26.96 C ATOM 1279 C TYR A 164 56.217 29.463 53.693 1.00 28.38 C ATOM 1280 O TYR A 164 56.118 30.500 54.341 1.00 28.87 O ATOM 1281 CB TYR A 164 57.975 27.701 53.900 1.00 23.95 C ATOM 1282 CG TYR A 164 59.165 28.541 54.349 1.00 21.74 C ATOM 1283 CD1 TYR A 164 59.068 29.898 54.640 1.00 21.32 C ATOM 1284 CD2 TYR A 164 60.360 27.901 54.509 1.00 20.63 C ATOM 1285 CE1 TYR A 164 60.153 30.620 55.074 1.00 21.88 C ATOM 1286 CE2 TYR A 164 61.454 28.614 54.941 1.00 22.23 C ATOM 1287 CZ TYR A 164 61.350 29.961 55.227 1.00 22.68 C ATOM 1288 OH TYR A 164 62.480 30.632 55.648 1.00 23.63 O ATOM 1289 N CYS A 165 55.988 29.461 52.365 1.00 30.74 N ATOM 1290 CA CYS A 165 55.587 30.609 51.562 1.00 30.76 C ATOM 1291 C CYS A 165 54.463 31.389 52.195 1.00 29.93 C ATOM 1292 O CYS A 165 54.600 32.589 52.049 1.00 31.18 O ATOM 1293 CB CYS A 165 55.142 30.203 50.145 1.00 33.51 C ATOM 1294 SG CYS A 165 56.545 29.760 49.082 1.00 36.68 S ATOM 1295 N PHE A 166 53.442 30.922 52.963 1.00 27.42 N ATOM 1296 CA PHE A 166 52.396 31.752 53.586 1.00 24.32 C ATOM 1297 C PHE A 166 53.042 32.627 54.691 1.00 24.63 C ATOM 1298 O PHE A 166 52.425 33.460 55.329 1.00 25.43 O ATOM 1299 CB PHE A 166 51.366 30.721 54.014 1.00 19.03 C ATOM 1300 CG PHE A 166 49.959 30.977 54.543 1.00 17.81 C ATOM 1301 CD1 PHE A 166 49.179 32.080 54.276 1.00 19.58 C ATOM 1302 CD2 PHE A 166 49.463 30.013 55.429 1.00 16.95 C ATOM 1303 CE1 PHE A 166 47.934 32.163 54.932 1.00 19.26 C ATOM 1304 CE2 PHE A 166 48.248 30.090 56.068 1.00 14.40 C ATOM 1305 CZ PHE A 166 47.469 31.186 55.817 1.00 16.80 C ATOM 1306 N ARG A 167 54.363 32.565 54.874 1.00 25.17 N ATOM 1307 CA ARG A 167 55.187 33.461 55.679 1.00 25.51 C ATOM 1308 C ARG A 167 55.661 34.509 54.661 1.00 25.60 C ATOM 1309 O ARG A 167 55.299 35.691 54.694 1.00 25.91 O ATOM 1310 CB ARG A 167 56.336 32.579 56.305 1.00 25.47 C ATOM 1311 CG ARG A 167 57.501 33.038 57.182 1.00 26.64 C ATOM 1312 CD ARG A 167 58.908 33.354 56.584 1.00 29.19 C ATOM 1313 NE ARG A 167 58.944 34.440 55.598 1.00 31.29 N ATOM 1314 CZ ARG A 167 59.967 35.280 55.350 1.00 31.75 C ATOM 1315 NH1 ARG A 167 61.144 35.267 55.988 1.00 30.78 N ATOM 1316 NH2 ARG A 167 59.776 36.193 54.396 1.00 33.93 N ATOM 1317 N LYS A 168 56.434 34.024 53.678 1.00 24.45 N ATOM 1318 CA LYS A 168 57.138 34.793 52.654 1.00 23.35 C ATOM 1319 C LYS A 168 56.224 35.337 51.567 1.00 22.81 C ATOM 1320 O LYS A 168 56.718 35.991 50.650 1.00 23.99 O ATOM 1321 CB LYS A 168 58.256 33.899 52.029 1.00 23.69 C ATOM 1322 CG LYS A 168 59.268 34.426 50.920 1.00 23.71 C ATOM 1323 CD LYS A 168 60.286 33.354 50.440 1.00 18.12 C ATOM 1324 CE LYS A 168 61.401 34.012 49.662 1.00 17.67 C ATOM 1325 NZ LYS A 168 62.367 34.737 50.468 1.00 15.68 N ATOM 1326 N ASP A 169 54.906 35.109 51.560 1.00 21.22 N ATOM 1327 CA ASP A 169 54.016 35.732 50.613 1.00 19.37 C ATOM 1328 C ASP A 169 52.831 36.210 51.422 1.00 20.25 C ATOM 1329 O ASP A 169 51.664 36.151 51.084 1.00 19.43 O ATOM 1330 CB ASP A 169 53.755 34.692 49.519 1.00 18.19 C ATOM 1331 CG ASP A 169 52.544 33.795 49.489 1.00 17.35 C ATOM 1332 OD1 ASP A 169 51.449 34.300 49.325 1.00 15.04 O ATOM 1333 OD2 ASP A 169 52.693 32.584 49.523 1.00 18.62 O ATOM 1334 N MET A 170 53.239 36.821 52.539 1.00 23.02 N ATOM 1335 CA MET A 170 52.353 37.452 53.526 1.00 24.90 C ATOM 1336 C MET A 170 53.163 38.570 54.152 1.00 24.60 C ATOM 1337 O MET A 170 52.548 39.611 54.423 1.00 24.19 O ATOM 1338 CB MET A 170 51.915 36.553 54.708 1.00 26.42 C ATOM 1339 CG MET A 170 50.418 36.509 54.953 1.00 27.45 C ATOM 1340 SD MET A 170 49.557 35.439 53.773 1.00 31.21 S ATOM 1341 CE MET A 170 47.966 36.195 53.576 1.00 30.33 C ATOM 1342 N ASP A 171 54.511 38.500 54.356 1.00 23.89 N ATOM 1343 CA ASP A 171 55.283 39.673 54.848 1.00 22.65 C ATOM 1344 C ASP A 171 54.973 40.829 53.907 1.00 20.53 C ATOM 1345 O ASP A 171 55.040 41.964 54.344 1.00 19.30 O ATOM 1346 CB ASP A 171 56.851 39.379 54.910 1.00 24.57 C ATOM 1347 CG ASP A 171 57.959 40.457 54.832 1.00 26.77 C ATOM 1348 OD1 ASP A 171 57.668 41.637 55.048 1.00 28.16 O ATOM 1349 OD2 ASP A 171 59.125 40.104 54.540 1.00 26.63 O ATOM 1350 N LYS A 172 54.479 40.513 52.703 1.00 17.94 N ATOM 1351 CA LYS A 172 54.048 41.501 51.752 1.00 17.38 C ATOM 1352 C LYS A 172 52.541 41.884 51.691 1.00 18.24 C ATOM 1353 O LYS A 172 52.276 43.056 51.403 1.00 18.24 O ATOM 1354 CB LYS A 172 54.555 40.995 50.463 1.00 13.20 C ATOM 1355 CG LYS A 172 56.091 41.056 50.519 1.00 10.47 C ATOM 1356 CD LYS A 172 56.650 40.416 49.301 1.00 5.74 C ATOM 1357 CE LYS A 172 56.680 38.929 49.647 1.00 7.50 C ATOM 1358 NZ LYS A 172 58.053 38.557 49.966 1.00 9.08 N ATOM 1359 N VAL A 173 51.477 41.107 52.044 1.00 19.19 N ATOM 1360 CA VAL A 173 50.080 41.571 51.843 1.00 17.56 C ATOM 1361 C VAL A 173 49.746 42.581 52.918 1.00 18.97 C ATOM 1362 O VAL A 173 48.853 43.405 52.786 1.00 19.32 O ATOM 1363 CB VAL A 173 48.977 40.507 51.989 1.00 14.33 C ATOM 1364 CG1 VAL A 173 47.815 40.945 51.143 1.00 13.17 C ATOM 1365 CG2 VAL A 173 49.449 39.123 51.599 1.00 15.88 C ATOM 1366 N GLU A 174 50.510 42.562 53.997 1.00 20.00 N ATOM 1367 CA GLU A 174 50.210 43.380 55.157 1.00 20.49 C ATOM 1368 C GLU A 174 51.233 44.456 55.393 1.00 20.46 C ATOM 1369 O GLU A 174 50.868 45.589 55.704 1.00 21.86 O ATOM 1370 CB GLU A 174 50.153 42.584 56.436 0.00 27.03 C ATOM 1371 CG GLU A 174 50.965 41.306 56.361 0.00 27.80 C ATOM 1372 CD GLU A 174 50.165 40.052 56.055 0.00 28.31 C ATOM 1373 OE1 GLU A 174 49.295 40.019 55.181 0.00 28.97 O ATOM 1374 OE2 GLU A 174 50.464 39.070 56.713 0.00 28.99 O ATOM 1375 N THR A 175 52.522 44.117 55.328 1.00 19.34 N ATOM 1376 CA THR A 175 53.517 45.117 55.510 1.00 17.29 C ATOM 1377 C THR A 175 53.340 46.002 54.306 1.00 18.08 C ATOM 1378 O THR A 175 53.120 47.180 54.553 1.00 15.62 O ATOM 1379 CB THR A 175 54.834 44.390 55.584 1.00 17.13 C ATOM 1380 OG1 THR A 175 54.794 43.476 56.699 1.00 15.56 O ATOM 1381 CG2 THR A 175 55.966 45.366 55.731 1.00 17.89 C ATOM 1382 N PHE A 176 53.280 45.434 53.072 1.00 21.18 N ATOM 1383 CA PHE A 176 52.979 46.210 51.860 1.00 22.14 C ATOM 1384 C PHE A 176 51.547 46.681 51.742 1.00 22.72 C ATOM 1385 O PHE A 176 51.250 47.458 50.815 1.00 25.04 O ATOM 1386 CB PHE A 176 53.174 45.525 50.551 1.00 21.57 C ATOM 1387 CG PHE A 176 54.586 45.155 50.270 1.00 22.42 C ATOM 1388 CD1 PHE A 176 55.633 45.718 50.994 1.00 21.63 C ATOM 1389 CD2 PHE A 176 54.789 44.203 49.286 1.00 22.48 C ATOM 1390 CE1 PHE A 176 56.905 45.288 50.666 1.00 22.97 C ATOM 1391 CE2 PHE A 176 56.062 43.804 48.989 1.00 22.38 C ATOM 1392 CZ PHE A 176 57.113 44.328 49.684 1.00 22.76 C ATOM 1393 N LEU A 177 50.596 46.235 52.559 1.00 21.83 N ATOM 1394 CA LEU A 177 49.447 47.089 52.597 1.00 20.79 C ATOM 1395 C LEU A 177 49.681 48.082 53.744 1.00 22.74 C ATOM 1396 O LEU A 177 49.118 49.195 53.730 1.00 23.88 O ATOM 1397 CB LEU A 177 48.206 46.313 52.807 1.00 17.55 C ATOM 1398 CG LEU A 177 47.539 45.916 51.538 1.00 15.92 C ATOM 1399 CD1 LEU A 177 46.329 45.070 51.860 1.00 13.47 C ATOM 1400 CD2 LEU A 177 47.110 47.138 50.813 1.00 14.57 C ATOM 1401 N ARG A 178 50.598 47.821 54.688 1.00 23.13 N ATOM 1402 CA ARG A 178 50.812 48.724 55.797 1.00 23.37 C ATOM 1403 C ARG A 178 51.354 49.950 55.147 1.00 22.94 C ATOM 1404 O ARG A 178 50.868 51.015 55.539 1.00 23.11 O ATOM 1405 CB ARG A 178 51.866 48.350 56.804 1.00 25.09 C ATOM 1406 CG ARG A 178 51.921 49.344 57.986 1.00 26.68 C ATOM 1407 CD ARG A 178 53.169 49.233 58.818 1.00 27.21 C ATOM 1408 NE ARG A 178 53.268 47.840 59.195 1.00 28.36 N ATOM 1409 CZ ARG A 178 54.364 47.144 58.899 1.00 30.21 C ATOM 1410 NH1 ARG A 178 55.406 47.717 58.270 1.00 30.79 N ATOM 1411 NH2 ARG A 178 54.369 45.833 59.155 1.00 28.65 N ATOM 1412 N ILE A 179 52.202 49.830 54.104 1.00 22.17 N ATOM 1413 CA ILE A 179 52.742 51.022 53.473 1.00 21.57 C ATOM 1414 C ILE A 179 51.610 51.893 52.990 1.00 23.16 C ATOM 1415 O ILE A 179 51.565 53.029 53.445 1.00 24.22 O ATOM 1416 CB ILE A 179 53.621 50.731 52.300 1.00 20.10 C ATOM 1417 CG1 ILE A 179 54.434 49.475 52.325 1.00 17.17 C ATOM 1418 CG2 ILE A 179 54.719 51.700 52.513 1.00 19.82 C ATOM 1419 CD1 ILE A 179 54.968 49.088 50.971 0.00 17.64 C ATOM 1420 N VAL A 180 50.613 51.360 52.278 1.00 23.45 N ATOM 1421 CA VAL A 180 49.543 52.213 51.778 1.00 24.08 C ATOM 1422 C VAL A 180 48.715 52.732 52.954 1.00 27.67 C ATOM 1423 O VAL A 180 48.189 53.839 52.800 1.00 29.33 O ATOM 1424 CB VAL A 180 48.604 51.478 50.618 1.00 22.61 C ATOM 1425 CG1 VAL A 180 49.100 50.066 50.333 1.00 20.95 C ATOM 1426 CG2 VAL A 180 47.120 51.415 50.971 1.00 20.78 C ATOM 1427 N GLN A 181 48.859 51.743 54.441 1.00 30.14 N ATOM 1428 CA GLN A 181 47.995 52.664 55.178 1.00 31.59 C ATOM 1429 C GLN A 181 48.830 53.756 55.862 1.00 33.43 C ATOM 1430 O GLN A 181 48.290 54.713 56.435 1.00 33.89 O ATOM 1431 CB GLN A 181 47.119 51.902 56.211 1.00 32.47 C ATOM 1432 CG GLN A 181 47.880 51.251 57.379 1.00 32.47 C ATOM 1433 CD GLN A 181 46.953 50.797 58.534 1.00 32.63 C ATOM 1434 OE1 GLN A 181 45.732 50.720 58.369 1.00 31.86 O ATOM 1435 NE2 GLN A 181 47.460 50.488 59.715 1.00 32.34 N ATOM 1436 N CYS A 182 50.159 53.695 55.844 1.00 35.88 N ATOM 1437 CA CYS A 182 50.996 54.749 56.433 1.00 40.15 C ATOM 1438 C CYS A 182 51.745 55.443 55.290 1.00 39.82 C ATOM 1439 O CYS A 182 52.976 55.586 55.333 1.00 38.67 O ATOM 1440 CB CYS A 182 51.955 54.143 57.460 1.00 44.82 C ATOM 1441 SG CYS A 182 51.287 52.597 58.253 1.00 48.77 S ATOM 1442 N ARG A 183 50.921 55.824 54.322 1.00 40.23 N ATOM 1443 CA ARG A 183 51.315 56.499 53.063 1.00 40.47 C ATOM 1444 C ARG A 183 50.094 57.246 52.521 1.00 40.00 C ATOM 1445 O ARG A 183 50.129 58.456 52.284 1.00 40.42 O ATOM 1446 CB ARG A 183 51.727 55.440 52.019 1.00 40.29 C ATOM 1447 CG ARG A 183 52.748 55.882 50.931 1.00 42.06 C ATOM 1448 CD ARG A 183 53.493 54.647 50.385 1.00 43.72 C ATOM 1449 NE ARG A 183 54.090 54.803 49.050 1.00 46.90 N ATOM 1450 CZ ARG A 183 54.431 53.760 48.265 1.00 49.10 C ATOM 1451 NH1 ARG A 183 54.216 52.494 48.661 1.00 49.25 N ATOM 1452 NH2 ARG A 183 55.006 53.876 47.060 1.00 49.41 N ATOM 1453 N SER A 184 48.812 56.527 52.740 1.00 39.47 N ATOM 1454 CA SER A 184 47.567 57.132 52.274 1.00 39.66 C ATOM 1455 C SER A 184 46.623 57.687 53.360 1.00 40.89 C ATOM 1456 O SER A 184 45.506 58.125 53.037 1.00 39.34 O ATOM 1457 CB SER A 184 46.820 56.105 51.380 1.00 39.28 C ATOM 1458 OG SER A 184 47.509 55.662 50.194 1.00 37.76 O