>>1HGV:HELIX    1   1 PRO A    5  GLY A   46  1                                  42    
PSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 1 1 PRO A 5 GLY A 46 1 42 ATOM 66 N PRO A 5 -0.164 -26.010 36.327 1.00 4.00 N ATOM 67 CA PRO A 5 0.030 -24.997 35.310 1.00 4.00 C ATOM 68 C PRO A 5 -0.080 -25.625 33.843 1.00 4.00 C ATOM 69 O PRO A 5 0.177 -24.970 32.845 1.00 4.00 O ATOM 70 CB PRO A 5 1.417 -24.416 35.644 1.00 5.70 C ATOM 71 CG PRO A 5 1.966 -25.229 36.766 1.00 5.70 C ATOM 72 CD PRO A 5 1.115 -26.454 36.855 1.00 5.70 C ATOM 73 HA PRO A 5 -0.717 -24.220 35.407 1.00 85.70 H ATOM 74 HB2 PRO A 5 2.050 -24.480 34.773 1.00 85.70 H ATOM 75 HB3 PRO A 5 1.309 -23.381 35.933 1.00 85.70 H ATOM 76 HG2 PRO A 5 2.991 -25.499 36.553 1.00 85.70 H ATOM 77 HG3 PRO A 5 1.912 -24.668 37.686 1.00 85.70 H ATOM 78 HD2 PRO A 5 1.528 -27.244 36.244 1.00 85.70 H ATOM 79 HD3 PRO A 5 1.021 -26.774 37.876 1.00 85.70 H ATOM 80 N SER A 6 -0.461 -26.926 33.801 1.00 6.19 N ATOM 81 CA SER A 6 -0.654 -27.735 32.589 1.00 6.19 C ATOM 82 C SER A 6 -1.952 -27.360 31.888 1.00 6.19 C ATOM 83 O SER A 6 -2.061 -27.525 30.675 1.00 6.19 O ATOM 84 CB SER A 6 -0.697 -29.234 32.930 1.00 6.18 C ATOM 85 OG SER A 6 0.472 -29.661 33.613 1.00 6.18 O ATOM 86 H SER A 6 -0.631 -27.365 34.660 1.00 86.18 H ATOM 87 HA SER A 6 0.175 -27.546 31.923 1.00 86.18 H ATOM 88 HB2 SER A 6 -1.554 -29.432 33.555 1.00 86.18 H ATOM 89 HB3 SER A 6 -0.788 -29.799 32.012 1.00 86.18 H ATOM 90 HG SER A 6 0.874 -30.387 33.126 1.00 86.18 H ATOM 91 N GLU A 7 -2.944 -26.885 32.697 1.00 14.52 N ATOM 92 CA GLU A 7 -4.288 -26.477 32.205 1.00 14.52 C ATOM 93 C GLU A 7 -4.201 -25.230 31.303 1.00 14.52 C ATOM 94 O GLU A 7 -4.926 -25.107 30.308 1.00 14.52 O ATOM 95 CB GLU A 7 -5.322 -26.230 33.360 1.00 8.42 C ATOM 96 CG GLU A 7 -5.902 -27.514 33.979 1.00 8.42 C ATOM 97 CD GLU A 7 -7.179 -27.315 34.814 1.00 8.42 C ATOM 98 OE1 GLU A 7 -8.158 -26.695 34.320 1.00 8.42 O ATOM 99 OE2 GLU A 7 -7.211 -27.825 35.949 1.00 8.42 O ATOM 100 H GLU A 7 -2.763 -26.817 33.658 1.00 88.42 H ATOM 101 HA GLU A 7 -4.652 -27.294 31.594 1.00 88.42 H ATOM 102 HB2 GLU A 7 -4.838 -25.671 34.144 1.00 88.42 H ATOM 103 HB3 GLU A 7 -6.143 -25.645 32.971 1.00 88.42 H ATOM 104 HG2 GLU A 7 -6.128 -28.205 33.183 1.00 88.42 H ATOM 105 HG3 GLU A 7 -5.147 -27.951 34.618 1.00 88.42 H ATOM 106 N VAL A 8 -3.287 -24.314 31.627 1.00 17.77 N ATOM 107 CA VAL A 8 -3.091 -23.136 30.782 1.00 17.77 C ATOM 108 C VAL A 8 -2.672 -23.666 29.467 1.00 17.77 C ATOM 109 O VAL A 8 -3.027 -23.158 28.427 1.00 17.77 O ATOM 110 CB VAL A 8 -2.015 -22.132 31.344 1.00 24.35 C ATOM 111 CG1 VAL A 8 -1.529 -21.184 30.277 1.00 24.35 C ATOM 112 CG2 VAL A 8 -2.603 -21.285 32.455 1.00 24.35 C ATOM 113 H VAL A 8 -2.709 -24.458 32.406 1.00100.00 H ATOM 114 HA VAL A 8 -4.038 -22.624 30.678 1.00100.00 H ATOM 115 HB VAL A 8 -1.175 -22.687 31.735 1.00100.00 H ATOM 116 HG11 VAL A 8 -1.725 -21.606 29.304 1.00100.00 H ATOM 117 HG12 VAL A 8 -2.045 -20.240 30.373 1.00100.00 H ATOM 118 HG13 VAL A 8 -0.465 -21.027 30.395 1.00100.00 H ATOM 119 HG21 VAL A 8 -3.681 -21.320 32.403 1.00100.00 H ATOM 120 HG22 VAL A 8 -2.275 -21.662 33.412 1.00100.00 H ATOM 121 HG23 VAL A 8 -2.272 -20.262 32.340 1.00100.00 H ATOM 122 N ALA A 9 -1.927 -24.741 29.569 1.00 23.80 N ATOM 123 CA ALA A 9 -1.424 -25.425 28.427 1.00 23.80 C ATOM 124 C ALA A 9 -2.553 -26.169 27.707 1.00 23.80 C ATOM 125 O ALA A 9 -2.712 -26.052 26.473 1.00 23.80 O ATOM 126 CB ALA A 9 -0.354 -26.423 28.921 1.00 11.19 C ATOM 127 H ALA A 9 -1.716 -25.090 30.456 1.00 91.19 H ATOM 128 HA ALA A 9 -0.959 -24.715 27.763 1.00 91.19 H ATOM 129 HB1 ALA A 9 0.061 -26.074 29.857 1.00 91.19 H ATOM 130 HB2 ALA A 9 -0.805 -27.393 29.072 1.00 91.19 H ATOM 131 HB3 ALA A 9 0.433 -26.502 28.187 1.00 91.19 H ATOM 132 N SER A 10 -3.327 -26.946 28.483 1.00 37.23 N ATOM 133 CA SER A 10 -4.405 -27.731 27.912 1.00 37.23 C ATOM 134 C SER A 10 -5.668 -26.899 27.539 1.00 37.23 C ATOM 135 O SER A 10 -6.181 -26.987 26.415 1.00 37.23 O ATOM 136 CB SER A 10 -4.743 -28.854 28.921 1.00 22.46 C ATOM 137 OG SER A 10 -3.592 -29.650 29.219 1.00 22.46 O ATOM 138 H SER A 10 -3.142 -27.006 29.441 1.00100.00 H ATOM 139 HA SER A 10 -4.027 -28.192 27.014 1.00100.00 H ATOM 140 HB2 SER A 10 -5.103 -28.414 29.838 1.00100.00 H ATOM 141 HB3 SER A 10 -5.507 -29.494 28.504 1.00100.00 H ATOM 142 HG SER A 10 -3.380 -30.202 28.461 1.00100.00 H ATOM 143 N GLN A 11 -6.150 -26.100 28.461 1.00 12.57 N ATOM 144 CA GLN A 11 -7.359 -25.303 28.263 1.00 12.57 C ATOM 145 C GLN A 11 -7.284 -24.327 27.094 1.00 12.57 C ATOM 146 O GLN A 11 -8.206 -24.197 26.294 1.00 12.57 O ATOM 147 CB GLN A 11 -7.639 -24.492 29.548 1.00 4.69 C ATOM 148 CG GLN A 11 -8.159 -25.315 30.708 1.00 4.69 C ATOM 149 CD GLN A 11 -9.637 -25.081 30.986 1.00 4.69 C ATOM 150 OE1 GLN A 11 -10.252 -25.747 31.834 1.00 4.69 O ATOM 151 NE2 GLN A 11 -10.220 -24.122 30.282 1.00 4.69 N ATOM 152 H GLN A 11 -5.708 -26.072 29.320 1.00 84.69 H ATOM 153 HA GLN A 11 -8.181 -25.979 28.102 1.00 84.69 H ATOM 154 HB2 GLN A 11 -6.722 -24.018 29.861 1.00 84.69 H ATOM 155 HB3 GLN A 11 -8.364 -23.727 29.322 1.00 84.69 H ATOM 156 HG2 GLN A 11 -8.012 -26.359 30.483 1.00 84.69 H ATOM 157 HG3 GLN A 11 -7.596 -25.056 31.592 1.00 84.69 H ATOM 158 HE21 GLN A 11 -9.682 -23.625 29.634 1.00 84.69 H ATOM 159 HE22 GLN A 11 -11.173 -23.954 30.435 1.00 84.69 H ATOM 160 N VAL A 12 -6.231 -23.581 27.059 1.00 4.00 N ATOM 161 CA VAL A 12 -6.065 -22.567 26.070 1.00 4.00 C ATOM 162 C VAL A 12 -5.681 -23.029 24.659 1.00 4.00 C ATOM 163 O VAL A 12 -6.217 -22.536 23.645 1.00 4.00 O ATOM 164 CB VAL A 12 -5.046 -21.560 26.544 1.00 4.00 C ATOM 165 CG1 VAL A 12 -4.584 -20.695 25.369 1.00 4.00 C ATOM 166 CG2 VAL A 12 -5.640 -20.712 27.649 1.00 4.00 C ATOM 167 H VAL A 12 -5.554 -23.680 27.761 1.00 83.20 H ATOM 168 HA VAL A 12 -7.007 -22.046 26.000 1.00 83.20 H ATOM 169 HB VAL A 12 -4.192 -22.091 26.939 1.00 83.20 H ATOM 170 HG11 VAL A 12 -5.331 -20.717 24.591 1.00 83.20 H ATOM 171 HG12 VAL A 12 -4.444 -19.677 25.705 1.00 83.20 H ATOM 172 HG13 VAL A 12 -3.649 -21.078 24.984 1.00 83.20 H ATOM 173 HG21 VAL A 12 -6.682 -20.964 27.774 1.00 83.20 H ATOM 174 HG22 VAL A 12 -5.110 -20.896 28.570 1.00 83.20 H ATOM 175 HG23 VAL A 12 -5.553 -19.665 27.386 1.00 83.20 H ATOM 176 N THR A 13 -4.685 -23.890 24.573 1.00 4.00 N ATOM 177 CA THR A 13 -4.155 -24.231 23.263 1.00 4.00 C ATOM 178 C THR A 13 -5.251 -24.669 22.374 1.00 4.00 C ATOM 179 O THR A 13 -5.465 -24.081 21.342 1.00 4.00 O ATOM 180 CB THR A 13 -3.225 -25.444 23.472 1.00 31.64 C ATOM 181 OG1 THR A 13 -2.119 -25.114 24.299 1.00 31.64 O ATOM 182 CG2 THR A 13 -2.704 -26.075 22.198 1.00 31.64 C ATOM 183 H THR A 13 -4.227 -24.202 25.383 1.00100.00 H ATOM 184 HA THR A 13 -3.612 -23.402 22.841 1.00100.00 H ATOM 185 HB THR A 13 -3.793 -26.205 23.991 1.00100.00 H ATOM 186 HG1 THR A 13 -1.993 -25.806 24.950 1.00100.00 H ATOM 187 HG21 THR A 13 -2.581 -25.317 21.440 1.00100.00 H ATOM 188 HG22 THR A 13 -1.749 -26.545 22.396 1.00100.00 H ATOM 189 HG23 THR A 13 -3.404 -26.821 21.855 1.00100.00 H ATOM 190 N ASN A 14 -6.007 -25.580 22.882 1.00 11.26 N ATOM 191 CA ASN A 14 -7.174 -26.117 22.263 1.00 11.26 C ATOM 192 C ASN A 14 -8.208 -25.036 21.857 1.00 11.26 C ATOM 193 O ASN A 14 -9.035 -25.311 21.001 1.00 11.26 O ATOM 194 CB ASN A 14 -7.715 -27.340 23.024 1.00 4.00 C ATOM 195 CG ASN A 14 -6.861 -28.597 22.724 1.00 4.00 C ATOM 196 OD1 ASN A 14 -5.642 -28.540 22.694 1.00 4.00 O ATOM 197 ND2 ASN A 14 -7.488 -29.739 22.507 1.00 4.00 N ATOM 198 H ASN A 14 -5.791 -25.894 23.790 1.00 74.75 H ATOM 199 HA ASN A 14 -6.803 -26.500 21.322 1.00 74.75 H ATOM 200 HB2 ASN A 14 -7.690 -27.144 24.087 1.00 74.75 H ATOM 201 HB3 ASN A 14 -8.731 -27.534 22.717 1.00 74.75 H ATOM 202 HD21 ASN A 14 -8.464 -29.749 22.544 1.00 74.75 H ATOM 203 HD22 ASN A 14 -6.944 -30.533 22.315 1.00 74.75 H ATOM 204 N TYR A 15 -8.241 -23.856 22.523 1.00 24.27 N ATOM 205 CA TYR A 15 -9.280 -22.822 22.245 1.00 24.27 C ATOM 206 C TYR A 15 -9.357 -22.465 20.743 1.00 24.27 C ATOM 207 O TYR A 15 -10.498 -22.417 20.188 1.00 24.27 O ATOM 208 CB TYR A 15 -8.897 -21.533 22.975 1.00 4.00 C ATOM 209 CG TYR A 15 -9.714 -21.166 24.174 1.00 4.00 C ATOM 210 CD1 TYR A 15 -9.565 -21.840 25.393 1.00 4.00 C ATOM 211 CD2 TYR A 15 -10.558 -20.074 24.122 1.00 4.00 C ATOM 212 CE1 TYR A 15 -10.241 -21.415 26.548 1.00 4.00 C ATOM 213 CE2 TYR A 15 -11.257 -19.653 25.244 1.00 4.00 C ATOM 214 CZ TYR A 15 -11.092 -20.315 26.471 1.00 4.00 C ATOM 215 OH TYR A 15 -11.744 -19.853 27.605 1.00 4.00 O ATOM 216 H TYR A 15 -7.607 -23.704 23.256 1.00 79.06 H ATOM 217 HA TYR A 15 -10.238 -23.173 22.596 1.00 79.06 H ATOM 218 HB2 TYR A 15 -7.875 -21.618 23.302 1.00 79.06 H ATOM 219 HB3 TYR A 15 -8.967 -20.715 22.275 1.00 79.06 H ATOM 220 HD1 TYR A 15 -8.907 -22.693 25.441 1.00 79.06 H ATOM 221 HD2 TYR A 15 -10.693 -19.562 23.185 1.00 79.06 H ATOM 222 HE1 TYR A 15 -10.114 -21.947 27.480 1.00 79.06 H ATOM 223 HE2 TYR A 15 -11.916 -18.800 25.173 1.00 79.06 H ATOM 224 HH TYR A 15 -11.302 -20.190 28.389 1.00 79.06 H ATOM 225 N ILE A 16 -8.131 -22.282 20.097 1.00 58.98 N ATOM 226 CA ILE A 16 -7.899 -21.998 18.591 1.00 58.98 C ATOM 227 C ILE A 16 -8.076 -23.138 17.619 1.00 58.98 C ATOM 228 O ILE A 16 -8.237 -22.857 16.451 1.00 58.98 O ATOM 229 CB ILE A 16 -6.533 -21.368 18.210 1.00 4.06 C ATOM 230 CG1 ILE A 16 -6.534 -19.904 18.492 1.00 4.06 C ATOM 231 CG2 ILE A 16 -6.125 -21.649 16.783 1.00 4.06 C ATOM 232 CD1 ILE A 16 -7.730 -19.214 17.897 1.00 4.06 C ATOM 233 H ILE A 16 -7.329 -22.394 20.652 1.00 84.06 H ATOM 234 HA ILE A 16 -8.645 -21.260 18.328 1.00 84.06 H ATOM 235 HB ILE A 16 -5.787 -21.826 18.840 1.00 84.06 H ATOM 236 HG12 ILE A 16 -6.545 -19.745 19.554 1.00 84.06 H ATOM 237 HG13 ILE A 16 -5.646 -19.456 18.068 1.00 84.06 H ATOM 238 HG21 ILE A 16 -6.911 -21.333 16.114 1.00 84.06 H ATOM 239 HG22 ILE A 16 -5.219 -21.106 16.553 1.00 84.06 H ATOM 240 HG23 ILE A 16 -5.950 -22.708 16.659 1.00 84.06 H ATOM 241 HD11 ILE A 16 -7.971 -19.670 16.948 1.00 84.06 H ATOM 242 HD12 ILE A 16 -8.571 -19.313 18.566 1.00 84.06 H ATOM 243 HD13 ILE A 16 -7.506 -18.168 17.748 1.00 84.06 H ATOM 244 N GLN A 17 -7.877 -24.384 18.024 1.00 4.00 N ATOM 245 CA GLN A 17 -7.818 -25.477 17.060 1.00 4.00 C ATOM 246 C GLN A 17 -9.040 -25.532 16.098 1.00 4.00 C ATOM 247 O GLN A 17 -8.862 -25.591 14.898 1.00 4.00 O ATOM 248 CB GLN A 17 -7.635 -26.788 17.844 1.00 9.76 C ATOM 249 CG GLN A 17 -6.251 -26.923 18.462 1.00 9.76 C ATOM 250 CD GLN A 17 -5.751 -28.355 18.499 1.00 9.76 C ATOM 251 OE1 GLN A 17 -6.358 -29.220 19.149 1.00 9.76 O ATOM 252 NE2 GLN A 17 -4.641 -28.622 17.778 1.00 9.76 N ATOM 253 H GLN A 17 -7.622 -24.550 18.954 1.00 89.76 H ATOM 254 HA GLN A 17 -6.933 -25.321 16.460 1.00 89.76 H ATOM 255 HB2 GLN A 17 -8.369 -26.830 18.635 1.00 89.76 H ATOM 256 HB3 GLN A 17 -7.788 -27.622 17.174 1.00 89.76 H ATOM 257 HG2 GLN A 17 -5.554 -26.332 17.886 1.00 89.76 H ATOM 258 HG3 GLN A 17 -6.289 -26.545 19.474 1.00 89.76 H ATOM 259 HE21 GLN A 17 -4.227 -27.891 17.277 1.00 89.76 H ATOM 260 HE22 GLN A 17 -4.296 -29.540 17.783 1.00 89.76 H ATOM 261 N ALA A 18 -10.235 -25.435 16.613 1.00 5.16 N ATOM 262 CA ALA A 18 -11.423 -25.362 15.788 1.00 5.16 C ATOM 263 C ALA A 18 -11.497 -23.974 15.212 1.00 5.16 C ATOM 264 O ALA A 18 -12.171 -23.712 14.252 1.00 5.16 O ATOM 265 CB ALA A 18 -12.668 -25.656 16.577 1.00 4.00 C ATOM 266 H ALA A 18 -10.323 -25.332 17.582 1.00 81.39 H ATOM 267 HA ALA A 18 -11.332 -26.085 14.986 1.00 81.39 H ATOM 268 HB1 ALA A 18 -13.050 -26.627 16.298 1.00 81.39 H ATOM 269 HB2 ALA A 18 -12.437 -25.646 17.630 1.00 81.39 H ATOM 270 HB3 ALA A 18 -13.412 -24.902 16.363 1.00 81.39 H ATOM 271 N ILE A 19 -10.915 -23.057 15.967 1.00 9.23 N ATOM 272 CA ILE A 19 -10.966 -21.628 15.682 1.00 9.23 C ATOM 273 C ILE A 19 -10.171 -21.209 14.476 1.00 9.23 C ATOM 274 O ILE A 19 -10.617 -20.300 13.842 1.00 9.23 O ATOM 275 CB ILE A 19 -10.488 -20.747 16.883 1.00 12.67 C ATOM 276 CG1 ILE A 19 -11.479 -20.778 18.071 1.00 12.67 C ATOM 277 CG2 ILE A 19 -10.307 -19.322 16.416 1.00 12.67 C ATOM 278 CD1 ILE A 19 -11.311 -19.633 19.068 1.00 12.67 C ATOM 279 H ILE A 19 -10.496 -23.346 16.798 1.00 92.67 H ATOM 280 HA ILE A 19 -12.000 -21.382 15.497 1.00 92.67 H ATOM 281 HB ILE A 19 -9.529 -21.116 17.208 1.00 92.67 H ATOM 282 HG12 ILE A 19 -12.488 -20.730 17.692 1.00 92.67 H ATOM 283 HG13 ILE A 19 -11.353 -21.705 18.613 1.00 92.67 H ATOM 284 HG21 ILE A 19 -11.133 -19.046 15.778 1.00 92.67 H ATOM 285 HG22 ILE A 19 -10.275 -18.665 17.272 1.00 92.67 H ATOM 286 HG23 ILE A 19 -9.383 -19.241 15.864 1.00 92.67 H ATOM 287 HD11 ILE A 19 -10.272 -19.339 19.106 1.00 92.67 H ATOM 288 HD12 ILE A 19 -11.911 -18.793 18.753 1.00 92.67 H ATOM 289 HD13 ILE A 19 -11.631 -19.957 20.047 1.00 92.67 H ATOM 290 N ALA A 20 -8.983 -21.838 14.214 1.00 4.00 N ATOM 291 CA ALA A 20 -8.061 -21.491 13.048 1.00 4.00 C ATOM 292 C ALA A 20 -8.600 -22.013 11.719 1.00 4.00 C ATOM 293 O ALA A 20 -8.784 -21.269 10.777 1.00 4.00 O ATOM 294 CB ALA A 20 -6.651 -22.027 13.241 1.00 31.78 C ATOM 295 H ALA A 20 -8.700 -22.545 14.830 1.00100.00 H ATOM 296 HA ALA A 20 -8.004 -20.419 12.989 1.00100.00 H ATOM 297 HB1 ALA A 20 -6.549 -22.427 14.239 1.00100.00 H ATOM 298 HB2 ALA A 20 -5.940 -21.227 13.097 1.00100.00 H ATOM 299 HB3 ALA A 20 -6.463 -22.808 12.517 1.00100.00 H ATOM 300 N ALA A 21 -8.955 -23.258 11.752 1.00 4.00 N ATOM 301 CA ALA A 21 -9.604 -23.901 10.687 1.00 4.00 C ATOM 302 C ALA A 21 -10.848 -23.066 10.363 1.00 4.00 C ATOM 303 O ALA A 21 -11.349 -22.998 9.224 1.00 4.00 O ATOM 304 CB ALA A 21 -9.973 -25.298 11.155 1.00 4.00 C ATOM 305 H ALA A 21 -8.852 -23.751 12.593 1.00 83.47 H ATOM 306 HA ALA A 21 -8.945 -23.957 9.835 1.00 83.47 H ATOM 307 HB1 ALA A 21 -10.441 -25.836 10.344 1.00 83.47 H ATOM 308 HB2 ALA A 21 -10.662 -25.230 11.983 1.00 83.47 H ATOM 309 HB3 ALA A 21 -9.082 -25.820 11.469 1.00 83.47 H ATOM 310 N ALA A 22 -11.327 -22.419 11.414 1.00 15.68 N ATOM 311 CA ALA A 22 -12.494 -21.540 11.358 1.00 15.68 C ATOM 312 C ALA A 22 -12.123 -20.227 10.699 1.00 15.68 C ATOM 313 O ALA A 22 -12.950 -19.555 10.137 1.00 15.68 O ATOM 314 CB ALA A 22 -13.081 -21.288 12.765 1.00 4.01 C ATOM 315 H ALA A 22 -10.870 -22.525 12.272 1.00 84.01 H ATOM 316 HA ALA A 22 -13.249 -22.030 10.759 1.00 84.01 H ATOM 317 HB1 ALA A 22 -12.394 -21.650 13.515 1.00 84.01 H ATOM 318 HB2 ALA A 22 -14.024 -21.806 12.862 1.00 84.01 H ATOM 319 HB3 ALA A 22 -13.238 -20.228 12.906 1.00 84.01 H ATOM 320 N GLY A 23 -10.890 -19.829 10.819 1.00 4.03 N ATOM 321 CA GLY A 23 -10.515 -18.601 10.237 1.00 4.03 C ATOM 322 C GLY A 23 -10.378 -18.758 8.782 1.00 4.03 C ATOM 323 O GLY A 23 -10.898 -17.994 7.997 1.00 4.03 O ATOM 324 H GLY A 23 -10.246 -20.368 11.318 1.00 82.58 H ATOM 325 HA2 GLY A 23 -9.571 -18.281 10.649 1.00 82.58 H ATOM 326 HA3 GLY A 23 -11.270 -17.859 10.449 1.00 82.58 H ATOM 327 N VAL A 24 -9.651 -19.777 8.434 1.00 7.19 N ATOM 328 CA VAL A 24 -9.364 -20.079 7.075 1.00 7.19 C ATOM 329 C VAL A 24 -10.603 -20.311 6.242 1.00 7.19 C ATOM 330 O VAL A 24 -10.654 -19.914 5.128 1.00 7.19 O ATOM 331 CB VAL A 24 -8.414 -21.244 6.968 1.00 4.00 C ATOM 332 CG1 VAL A 24 -8.451 -21.818 5.554 1.00 4.00 C ATOM 333 CG2 VAL A 24 -7.017 -20.781 7.320 1.00 4.00 C ATOM 334 H VAL A 24 -9.266 -20.341 9.138 1.00 70.63 H ATOM 335 HA VAL A 24 -8.854 -19.218 6.669 1.00 70.63 H ATOM 336 HB VAL A 24 -8.714 -22.006 7.668 1.00 70.63 H ATOM 337 HG11 VAL A 24 -9.473 -22.036 5.282 1.00 70.63 H ATOM 338 HG12 VAL A 24 -8.042 -21.096 4.863 1.00 70.63 H ATOM 339 HG13 VAL A 24 -7.866 -22.725 5.515 1.00 70.63 H ATOM 340 HG21 VAL A 24 -6.837 -19.813 6.872 1.00 70.63 H ATOM 341 HG22 VAL A 24 -6.924 -20.705 8.391 1.00 70.63 H ATOM 342 HG23 VAL A 24 -6.298 -21.490 6.944 1.00 70.63 H ATOM 343 N GLY A 25 -11.633 -20.847 6.776 1.00 4.00 N ATOM 344 CA GLY A 25 -12.818 -20.996 5.970 1.00 4.00 C ATOM 345 C GLY A 25 -13.176 -19.658 5.380 1.00 4.00 C ATOM 346 O GLY A 25 -13.846 -19.603 4.397 1.00 4.00 O ATOM 347 H GLY A 25 -11.627 -21.110 7.718 1.00 83.29 H ATOM 348 HA2 GLY A 25 -13.631 -21.349 6.583 1.00 83.29 H ATOM 349 HA3 GLY A 25 -12.628 -21.705 5.176 1.00 83.29 H ATOM 350 N VAL A 26 -12.789 -18.590 6.076 1.00 4.00 N ATOM 351 CA VAL A 26 -13.071 -17.209 5.699 1.00 4.00 C ATOM 352 C VAL A 26 -12.176 -16.667 4.508 1.00 4.00 C ATOM 353 O VAL A 26 -12.657 -15.927 3.661 1.00 4.00 O ATOM 354 CB VAL A 26 -13.011 -16.328 6.982 1.00 4.00 C ATOM 355 CG1 VAL A 26 -13.226 -14.847 6.713 1.00 4.00 C ATOM 356 CG2 VAL A 26 -14.057 -16.807 7.962 1.00 4.00 C ATOM 357 H VAL A 26 -12.303 -18.743 6.910 1.00 82.74 H ATOM 358 HA VAL A 26 -14.095 -17.192 5.356 1.00 82.74 H ATOM 359 HB VAL A 26 -12.044 -16.454 7.440 1.00 82.74 H ATOM 360 HG11 VAL A 26 -13.048 -14.641 5.667 1.00 82.74 H ATOM 361 HG12 VAL A 26 -14.242 -14.580 6.965 1.00 82.74 H ATOM 362 HG13 VAL A 26 -12.542 -14.267 7.316 1.00 82.74 H ATOM 363 HG21 VAL A 26 -14.553 -17.677 7.562 1.00 82.74 H ATOM 364 HG22 VAL A 26 -13.583 -17.061 8.897 1.00 82.74 H ATOM 365 HG23 VAL A 26 -14.782 -16.024 8.126 1.00 82.74 H ATOM 366 N LEU A 27 -10.895 -17.056 4.433 1.00 4.00 N ATOM 367 CA LEU A 27 -10.032 -16.655 3.326 1.00 4.00 C ATOM 368 C LEU A 27 -10.329 -17.421 2.059 1.00 4.00 C ATOM 369 O LEU A 27 -10.143 -16.923 0.987 1.00 4.00 O ATOM 370 CB LEU A 27 -8.556 -16.721 3.593 1.00 4.00 C ATOM 371 CG LEU A 27 -8.036 -15.576 4.402 1.00 4.00 C ATOM 372 CD1 LEU A 27 -7.591 -14.456 3.495 1.00 4.00 C ATOM 373 CD2 LEU A 27 -9.104 -15.100 5.347 1.00 4.00 C ATOM 374 H LEU A 27 -10.546 -17.665 5.117 1.00 63.82 H ATOM 375 HA LEU A 27 -10.278 -15.621 3.130 1.00 63.82 H ATOM 376 HB2 LEU A 27 -8.340 -17.639 4.117 1.00 63.82 H ATOM 377 HB3 LEU A 27 -8.035 -16.731 2.648 1.00 63.82 H ATOM 378 HG LEU A 27 -7.189 -15.900 4.984 1.00 63.82 H ATOM 379 HD11 LEU A 27 -7.089 -14.870 2.634 1.00 63.82 H ATOM 380 HD12 LEU A 27 -8.452 -13.891 3.173 1.00 63.82 H ATOM 381 HD13 LEU A 27 -6.914 -13.809 4.027 1.00 63.82 H ATOM 382 HD21 LEU A 27 -10.069 -15.180 4.869 1.00 63.82 H ATOM 383 HD22 LEU A 27 -9.092 -15.709 6.238 1.00 63.82 H ATOM 384 HD23 LEU A 27 -8.918 -14.073 5.610 1.00 63.82 H ATOM 385 N ALA A 28 -10.808 -18.622 2.158 1.00 26.87 N ATOM 386 CA ALA A 28 -11.090 -19.324 0.963 1.00 26.87 C ATOM 387 C ALA A 28 -11.969 -18.391 0.224 1.00 26.87 C ATOM 388 O ALA A 28 -11.814 -18.128 -0.977 1.00 26.87 O ATOM 389 CB ALA A 28 -11.814 -20.644 1.237 1.00 4.00 C ATOM 390 H ALA A 28 -10.975 -19.027 3.035 1.00 83.08 H ATOM 391 HA ALA A 28 -10.174 -19.503 0.418 1.00 83.08 H ATOM 392 HB1 ALA A 28 -12.768 -20.442 1.703 1.00 83.08 H ATOM 393 HB2 ALA A 28 -11.217 -21.257 1.892 1.00 83.08 H ATOM 394 HB3 ALA A 28 -11.977 -21.167 0.305 1.00 83.08 H ATOM 395 N LEU A 29 -12.879 -17.865 0.961 1.00 10.07 N ATOM 396 CA LEU A 29 -13.791 -16.910 0.443 1.00 10.07 C ATOM 397 C LEU A 29 -13.129 -15.504 0.273 1.00 10.07 C ATOM 398 O LEU A 29 -13.492 -14.726 -0.581 1.00 10.07 O ATOM 399 CB LEU A 29 -15.092 -17.000 1.267 1.00 4.35 C ATOM 400 CG LEU A 29 -15.781 -18.390 1.135 1.00 4.35 C ATOM 401 CD1 LEU A 29 -16.184 -18.951 2.491 1.00 4.35 C ATOM 402 CD2 LEU A 29 -16.994 -18.334 0.189 1.00 4.35 C ATOM 403 H LEU A 29 -12.925 -18.108 1.907 1.00 84.35 H ATOM 404 HA LEU A 29 -14.029 -17.251 -0.559 1.00 84.35 H ATOM 405 HB2 LEU A 29 -14.856 -16.820 2.308 1.00 84.35 H ATOM 406 HB3 LEU A 29 -15.779 -16.244 0.924 1.00 84.35 H ATOM 407 HG LEU A 29 -15.069 -19.082 0.708 1.00 84.35 H ATOM 408 HD11 LEU A 29 -16.502 -18.146 3.134 1.00 84.35 H ATOM 409 HD12 LEU A 29 -16.998 -19.651 2.362 1.00 84.35 H ATOM 410 HD13 LEU A 29 -15.342 -19.459 2.936 1.00 84.35 H ATOM 411 HD21 LEU A 29 -17.464 -17.364 0.258 1.00 84.35 H ATOM 412 HD22 LEU A 29 -16.667 -18.504 -0.827 1.00 84.35 H ATOM 413 HD23 LEU A 29 -17.705 -19.097 0.467 1.00 84.35 H ATOM 414 N ALA A 30 -12.158 -15.177 1.065 1.00 4.01 N ATOM 415 CA ALA A 30 -11.502 -13.875 0.926 1.00 4.01 C ATOM 416 C ALA A 30 -10.527 -13.790 -0.281 1.00 4.01 C ATOM 417 O ALA A 30 -10.284 -12.738 -0.791 1.00 4.01 O ATOM 418 CB ALA A 30 -10.807 -13.488 2.238 1.00 13.66 C ATOM 419 H ALA A 30 -11.860 -15.803 1.752 1.00 93.66 H ATOM 420 HA ALA A 30 -12.288 -13.152 0.760 1.00 93.66 H ATOM 421 HB1 ALA A 30 -10.947 -14.274 2.965 1.00 93.66 H ATOM 422 HB2 ALA A 30 -9.750 -13.349 2.060 1.00 93.66 H ATOM 423 HB3 ALA A 30 -11.232 -12.570 2.615 1.00 93.66 H ATOM 424 N ILE A 31 -9.930 -14.911 -0.665 1.00 4.00 N ATOM 425 CA ILE A 31 -8.936 -15.001 -1.748 1.00 4.00 C ATOM 426 C ILE A 31 -9.564 -14.912 -3.109 1.00 4.00 C ATOM 427 O ILE A 31 -9.024 -14.338 -4.040 1.00 4.00 O ATOM 428 CB ILE A 31 -8.223 -16.347 -1.746 1.00 4.00 C ATOM 429 CG1 ILE A 31 -7.469 -16.650 -0.409 1.00 4.00 C ATOM 430 CG2 ILE A 31 -7.339 -16.459 -2.982 1.00 4.00 C ATOM 431 CD1 ILE A 31 -6.920 -15.453 0.352 1.00 4.00 C ATOM 432 H ILE A 31 -10.137 -15.725 -0.170 1.00 80.61 H ATOM 433 HA ILE A 31 -8.210 -14.222 -1.623 1.00 80.61 H ATOM 434 HB ILE A 31 -8.995 -17.094 -1.864 1.00 80.61 H ATOM 435 HG12 ILE A 31 -8.142 -17.166 0.257 1.00 80.61 H ATOM 436 HG13 ILE A 31 -6.637 -17.303 -0.630 1.00 80.61 H ATOM 437 HG21 ILE A 31 -7.149 -15.472 -3.376 1.00 80.61 H ATOM 438 HG22 ILE A 31 -6.405 -16.927 -2.715 1.00 80.61 H ATOM 439 HG23 ILE A 31 -7.840 -17.052 -3.729 1.00 80.61 H ATOM 440 HD11 ILE A 31 -7.065 -14.557 -0.234 1.00 80.61 H ATOM 441 HD12 ILE A 31 -7.438 -15.356 1.293 1.00 80.61 H ATOM 442 HD13 ILE A 31 -5.866 -15.595 0.535 1.00 80.61 H ATOM 443 N GLY A 32 -10.686 -15.571 -3.186 1.00 4.25 N ATOM 444 CA GLY A 32 -11.426 -15.668 -4.389 1.00 4.25 C ATOM 445 C GLY A 32 -12.144 -14.401 -4.705 1.00 4.25 C ATOM 446 O GLY A 32 -12.246 -14.044 -5.891 1.00 4.25 O ATOM 447 H GLY A 32 -11.004 -16.041 -2.390 1.00 83.49 H ATOM 448 HA2 GLY A 32 -12.150 -16.461 -4.289 1.00 83.49 H ATOM 449 HA3 GLY A 32 -10.755 -15.910 -5.196 1.00 83.49 H ATOM 450 N LEU A 33 -12.651 -13.715 -3.631 1.00 22.39 N ATOM 451 CA LEU A 33 -13.416 -12.466 -3.809 1.00 22.39 C ATOM 452 C LEU A 33 -12.645 -11.417 -4.622 1.00 22.39 C ATOM 453 O LEU A 33 -13.150 -10.995 -5.631 1.00 22.39 O ATOM 454 CB LEU A 33 -13.901 -11.910 -2.474 1.00 7.47 C ATOM 455 CG LEU A 33 -15.131 -12.619 -1.867 1.00 7.47 C ATOM 456 CD1 LEU A 33 -15.173 -14.095 -2.246 1.00 7.47 C ATOM 457 CD2 LEU A 33 -15.148 -12.458 -0.340 1.00 7.47 C ATOM 458 H LEU A 33 -12.529 -14.079 -2.729 1.00 87.47 H ATOM 459 HA LEU A 33 -14.289 -12.732 -4.389 1.00 87.47 H ATOM 460 HB2 LEU A 33 -13.087 -11.978 -1.766 1.00 87.47 H ATOM 461 HB3 LEU A 33 -14.148 -10.868 -2.612 1.00 87.47 H ATOM 462 HG LEU A 33 -16.027 -12.156 -2.254 1.00 87.47 H ATOM 463 HD11 LEU A 33 -14.168 -14.456 -2.404 1.00 87.47 H ATOM 464 HD12 LEU A 33 -15.636 -14.657 -1.447 1.00 87.47 H ATOM 465 HD13 LEU A 33 -15.748 -14.218 -3.150 1.00 87.47 H ATOM 466 HD21 LEU A 33 -15.072 -11.411 -0.087 1.00 87.47 H ATOM 467 HD22 LEU A 33 -16.073 -12.857 0.051 1.00 87.47 H ATOM 468 HD23 LEU A 33 -14.315 -12.995 0.088 1.00 87.47 H ATOM 469 N SER A 34 -11.401 -11.095 -4.333 1.00 4.00 N ATOM 470 CA SER A 34 -10.715 -10.236 -5.267 1.00 4.00 C ATOM 471 C SER A 34 -10.503 -11.095 -6.442 1.00 4.00 C ATOM 472 O SER A 34 -10.535 -10.673 -7.597 1.00 4.00 O ATOM 473 CB SER A 34 -9.369 -9.687 -4.814 1.00 12.18 C ATOM 474 OG SER A 34 -9.515 -8.622 -3.917 1.00 12.18 O ATOM 475 H SER A 34 -10.926 -11.516 -3.590 1.00 92.18 H ATOM 476 HA SER A 34 -11.378 -9.425 -5.537 1.00 92.18 H ATOM 477 HB2 SER A 34 -8.809 -10.473 -4.331 1.00 92.18 H ATOM 478 HB3 SER A 34 -8.822 -9.339 -5.680 1.00 92.18 H ATOM 479 HG SER A 34 -9.659 -7.807 -4.407 1.00 92.18 H ATOM 480 N ALA A 35 -10.313 -12.316 -6.125 1.00 4.00 N ATOM 481 CA ALA A 35 -10.124 -13.261 -7.102 1.00 4.00 C ATOM 482 C ALA A 35 -11.281 -13.207 -8.043 1.00 4.00 C ATOM 483 O ALA A 35 -11.139 -13.570 -9.180 1.00 4.00 O ATOM 484 CB ALA A 35 -9.969 -14.613 -6.497 1.00 17.89 C ATOM 485 H ALA A 35 -10.320 -12.586 -5.183 1.00 97.89 H ATOM 486 HA ALA A 35 -9.221 -13.016 -7.632 1.00 97.89 H ATOM 487 HB1 ALA A 35 -10.032 -14.529 -5.427 1.00 97.89 H ATOM 488 HB2 ALA A 35 -10.754 -15.259 -6.852 1.00 97.89 H ATOM 489 HB3 ALA A 35 -9.007 -15.022 -6.769 1.00 97.89 H ATOM 490 N ALA A 36 -12.440 -12.799 -7.546 1.00 8.67 N ATOM 491 CA ALA A 36 -13.665 -12.766 -8.356 1.00 8.67 C ATOM 492 C ALA A 36 -13.652 -11.715 -9.534 1.00 8.67 C ATOM 493 O ALA A 36 -13.921 -12.042 -10.687 1.00 8.67 O ATOM 494 CB ALA A 36 -14.852 -12.547 -7.420 1.00 13.96 C ATOM 495 H ALA A 36 -12.487 -12.551 -6.604 1.00 93.96 H ATOM 496 HA ALA A 36 -13.780 -13.748 -8.788 1.00 93.96 H ATOM 497 HB1 ALA A 36 -14.581 -12.848 -6.418 1.00 93.96 H ATOM 498 HB2 ALA A 36 -15.691 -13.139 -7.756 1.00 93.96 H ATOM 499 HB3 ALA A 36 -15.125 -11.503 -7.419 1.00 93.96 H ATOM 500 N TRP A 37 -13.292 -10.475 -9.271 1.00 4.33 N ATOM 501 CA TRP A 37 -13.205 -9.508 -10.331 1.00 4.33 C ATOM 502 C TRP A 37 -11.909 -9.818 -11.132 1.00 4.33 C ATOM 503 O TRP A 37 -11.850 -9.573 -12.295 1.00 4.33 O ATOM 504 CB TRP A 37 -13.334 -8.045 -9.825 1.00 13.26 C ATOM 505 CG TRP A 37 -14.704 -7.693 -9.228 1.00 13.26 C ATOM 506 CD1 TRP A 37 -15.500 -8.526 -8.521 1.00 13.26 C ATOM 507 CD2 TRP A 37 -15.395 -6.384 -9.202 1.00 13.26 C ATOM 508 NE1 TRP A 37 -16.601 -7.846 -8.023 1.00 13.26 N ATOM 509 CE2 TRP A 37 -16.562 -6.536 -8.421 1.00 13.26 C ATOM 510 CE3 TRP A 37 -15.133 -5.109 -9.730 1.00 13.26 C ATOM 511 CZ2 TRP A 37 -17.450 -5.474 -8.152 1.00 13.26 C ATOM 512 CZ3 TRP A 37 -16.011 -4.056 -9.461 1.00 13.26 C ATOM 513 CH2 TRP A 37 -17.154 -4.246 -8.676 1.00 13.26 C ATOM 514 H TRP A 37 -13.040 -10.222 -8.358 1.00 93.26 H ATOM 515 HA TRP A 37 -14.042 -9.706 -10.990 1.00 93.26 H ATOM 516 HB2 TRP A 37 -12.590 -7.874 -9.062 1.00 93.26 H ATOM 517 HB3 TRP A 37 -13.150 -7.374 -10.652 1.00 93.26 H ATOM 518 HD1 TRP A 37 -15.284 -9.571 -8.359 1.00 93.26 H ATOM 519 HE1 TRP A 37 -17.298 -8.241 -7.460 1.00 93.26 H ATOM 520 HE3 TRP A 37 -14.270 -4.945 -10.338 1.00 93.26 H ATOM 521 HZ2 TRP A 37 -18.333 -5.609 -7.544 1.00 93.26 H ATOM 522 HZ3 TRP A 37 -15.806 -3.070 -9.856 1.00 93.26 H ATOM 523 HH2 TRP A 37 -17.803 -3.403 -8.493 1.00 93.26 H ATOM 524 N LYS A 38 -10.880 -10.403 -10.498 1.00 4.00 N ATOM 525 CA LYS A 38 -9.692 -10.754 -11.228 1.00 4.00 C ATOM 526 C LYS A 38 -10.237 -11.573 -12.304 1.00 4.00 C ATOM 527 O LYS A 38 -9.761 -11.615 -13.370 1.00 4.00 O ATOM 528 CB LYS A 38 -8.693 -11.721 -10.536 1.00 4.00 C ATOM 529 CG LYS A 38 -8.096 -11.370 -9.163 1.00 4.00 C ATOM 530 CD LYS A 38 -6.992 -12.379 -8.751 1.00 4.00 C ATOM 531 CE LYS A 38 -7.512 -13.808 -8.569 1.00 4.00 C ATOM 532 NZ LYS A 38 -6.422 -14.799 -8.340 1.00 4.00 N ATOM 533 H LYS A 38 -10.955 -10.629 -9.547 1.00 74.86 H ATOM 534 HA LYS A 38 -9.202 -9.874 -11.613 1.00 74.86 H ATOM 535 HB2 LYS A 38 -9.188 -12.669 -10.421 1.00 74.86 H ATOM 536 HB3 LYS A 38 -7.865 -11.865 -11.217 1.00 74.86 H ATOM 537 HG2 LYS A 38 -7.666 -10.380 -9.208 1.00 74.86 H ATOM 538 HG3 LYS A 38 -8.881 -11.392 -8.422 1.00 74.86 H ATOM 539 HD2 LYS A 38 -6.232 -12.388 -9.515 1.00 74.86 H ATOM 540 HD3 LYS A 38 -6.553 -12.048 -7.821 1.00 74.86 H ATOM 541 HE2 LYS A 38 -8.168 -13.828 -7.718 1.00 74.86 H ATOM 542 HE3 LYS A 38 -8.062 -14.092 -9.451 1.00 74.86 H ATOM 543 HZ1 LYS A 38 -5.696 -14.392 -7.716 1.00 74.86 H ATOM 544 HZ2 LYS A 38 -6.805 -15.654 -7.894 1.00 74.86 H ATOM 545 HZ3 LYS A 38 -5.980 -15.058 -9.241 1.00 74.86 H ATOM 546 N TYR A 39 -11.230 -12.298 -11.984 1.00 4.00 N ATOM 547 CA TYR A 39 -11.795 -13.202 -12.941 1.00 4.00 C ATOM 548 C TYR A 39 -12.659 -12.515 -14.037 1.00 4.00 C ATOM 549 O TYR A 39 -12.618 -12.892 -15.203 1.00 4.00 O ATOM 550 CB TYR A 39 -12.552 -14.306 -12.187 1.00 11.24 C ATOM 551 CG TYR A 39 -11.622 -15.331 -11.536 1.00 11.24 C ATOM 552 CD1 TYR A 39 -10.228 -15.254 -11.712 1.00 11.24 C ATOM 553 CD2 TYR A 39 -12.134 -16.418 -10.810 1.00 11.24 C ATOM 554 CE1 TYR A 39 -9.383 -16.220 -11.182 1.00 11.24 C ATOM 555 CE2 TYR A 39 -11.291 -17.396 -10.285 1.00 11.24 C ATOM 556 CZ TYR A 39 -9.920 -17.295 -10.470 1.00 11.24 C ATOM 557 OH TYR A 39 -9.089 -18.289 -9.986 1.00 11.24 O ATOM 558 H TYR A 39 -11.570 -12.280 -11.067 1.00 91.24 H ATOM 559 HA TYR A 39 -10.961 -13.668 -13.444 1.00 91.24 H ATOM 560 HB2 TYR A 39 -13.156 -13.860 -11.415 1.00 91.24 H ATOM 561 HB3 TYR A 39 -13.193 -14.833 -12.882 1.00 91.24 H ATOM 562 HD1 TYR A 39 -9.815 -14.423 -12.267 1.00 91.24 H ATOM 563 HD2 TYR A 39 -13.202 -16.495 -10.661 1.00 91.24 H ATOM 564 HE1 TYR A 39 -8.314 -16.140 -11.328 1.00 91.24 H ATOM 565 HE2 TYR A 39 -11.705 -18.222 -9.725 1.00 91.24 H ATOM 566 HH TYR A 39 -9.618 -18.975 -9.567 1.00 91.24 H ATOM 567 N ALA A 40 -13.448 -11.526 -13.692 1.00 5.69 N ATOM 568 CA ALA A 40 -14.263 -10.893 -14.705 1.00 5.69 C ATOM 569 C ALA A 40 -13.380 -10.109 -15.675 1.00 5.69 C ATOM 570 O ALA A 40 -13.502 -10.294 -16.863 1.00 5.69 O ATOM 571 CB ALA A 40 -15.327 -10.014 -14.056 1.00 10.33 C ATOM 572 H ALA A 40 -13.489 -11.227 -12.760 1.00 90.33 H ATOM 573 HA ALA A 40 -14.763 -11.676 -15.256 1.00 90.33 H ATOM 574 HB1 ALA A 40 -15.110 -8.975 -14.260 1.00 90.33 H ATOM 575 HB2 ALA A 40 -15.328 -10.179 -12.988 1.00 90.33 H ATOM 576 HB3 ALA A 40 -16.295 -10.266 -14.459 1.00 90.33 H ATOM 577 N LYS A 41 -12.480 -9.282 -15.110 1.00 4.00 N ATOM 578 CA LYS A 41 -11.498 -8.449 -15.820 1.00 4.00 C ATOM 579 C LYS A 41 -10.412 -9.287 -16.519 1.00 4.00 C ATOM 580 O LYS A 41 -9.823 -8.827 -17.466 1.00 4.00 O ATOM 581 CB LYS A 41 -10.834 -7.360 -14.937 1.00 6.79 C ATOM 582 CG LYS A 41 -11.419 -5.934 -15.110 1.00 6.79 C ATOM 583 CD LYS A 41 -10.426 -4.839 -14.662 1.00 6.79 C ATOM 584 CE LYS A 41 -11.076 -3.459 -14.516 1.00 6.79 C ATOM 585 NZ LYS A 41 -10.211 -2.494 -13.744 1.00 6.79 N ATOM 586 H LYS A 41 -12.463 -9.251 -14.128 1.00 86.79 H ATOM 587 HA LYS A 41 -12.053 -7.942 -16.596 1.00 86.79 H ATOM 588 HB2 LYS A 41 -10.948 -7.643 -13.901 1.00 86.79 H ATOM 589 HB3 LYS A 41 -9.782 -7.321 -15.172 1.00 86.79 H ATOM 590 HG2 LYS A 41 -11.658 -5.782 -16.149 1.00 86.79 H ATOM 591 HG3 LYS A 41 -12.320 -5.852 -14.519 1.00 86.79 H ATOM 592 HD2 LYS A 41 -10.005 -5.119 -13.710 1.00 86.79 H ATOM 593 HD3 LYS A 41 -9.632 -4.773 -15.394 1.00 86.79 H ATOM 594 HE2 LYS A 41 -11.251 -3.055 -15.499 1.00 86.79 H ATOM 595 HE3 LYS A 41 -12.017 -3.573 -14.003 1.00 86.79 H ATOM 596 HZ1 LYS A 41 -9.829 -2.954 -12.893 1.00 86.79 H ATOM 597 HZ2 LYS A 41 -9.419 -2.172 -14.336 1.00 86.79 H ATOM 598 HZ3 LYS A 41 -10.769 -1.665 -13.456 1.00 86.79 H ATOM 599 N ARG A 42 -10.084 -10.483 -16.034 1.00 13.60 N ATOM 600 CA ARG A 42 -9.025 -11.318 -16.694 1.00 13.60 C ATOM 601 C ARG A 42 -9.469 -11.635 -18.135 1.00 13.60 C ATOM 602 O ARG A 42 -8.691 -11.756 -19.076 1.00 13.60 O ATOM 603 CB ARG A 42 -8.713 -12.673 -15.918 1.00 5.23 C ATOM 604 CG ARG A 42 -7.823 -12.576 -14.639 1.00 5.23 C ATOM 605 CD ARG A 42 -6.496 -11.949 -14.959 1.00 5.23 C ATOM 606 NE ARG A 42 -5.814 -11.405 -13.815 1.00 5.23 N ATOM 607 CZ ARG A 42 -5.022 -10.360 -13.926 1.00 5.23 C ATOM 608 NH1 ARG A 42 -5.092 -9.607 -15.043 1.00 5.23 N ATOM 609 NH2 ARG A 42 -4.189 -10.035 -12.932 1.00 5.23 N ATOM 610 H ARG A 42 -10.536 -10.822 -15.232 1.00 85.23 H ATOM 611 HA ARG A 42 -8.123 -10.719 -16.739 1.00 85.23 H ATOM 612 HB2 ARG A 42 -9.653 -13.111 -15.618 1.00 85.23 H ATOM 613 HB3 ARG A 42 -8.230 -13.351 -16.605 1.00 85.23 H ATOM 614 HG2 ARG A 42 -8.304 -11.979 -13.900 1.00 85.23 H ATOM 615 HG3 ARG A 42 -7.657 -13.571 -14.249 1.00 85.23 H ATOM 616 HD2 ARG A 42 -5.863 -12.700 -15.400 1.00 85.23 H ATOM 617 HD3 ARG A 42 -6.656 -11.156 -15.674 1.00 85.23 H ATOM 618 HE ARG A 42 -5.865 -11.889 -12.965 1.00 85.23 H ATOM 619 HH11 ARG A 42 -5.739 -9.846 -15.767 1.00 85.23 H ATOM 620 HH12 ARG A 42 -4.500 -8.809 -15.147 1.00 85.23 H ATOM 621 HH21 ARG A 42 -4.167 -10.588 -12.098 1.00 85.23 H ATOM 622 HH22 ARG A 42 -3.592 -9.238 -13.018 1.00 85.23 H ATOM 623 N PHE A 43 -10.736 -11.778 -18.249 1.00 22.98 N ATOM 624 CA PHE A 43 -11.407 -12.087 -19.485 1.00 22.98 C ATOM 625 C PHE A 43 -11.534 -10.898 -20.492 1.00 22.98 C ATOM 626 O PHE A 43 -11.695 -11.130 -21.633 1.00 22.98 O ATOM 627 CB PHE A 43 -12.665 -12.847 -19.108 1.00 4.00 C ATOM 628 CG PHE A 43 -12.186 -14.102 -18.450 1.00 4.00 C ATOM 629 CD1 PHE A 43 -11.695 -14.043 -17.191 1.00 4.00 C ATOM 630 CD2 PHE A 43 -12.016 -15.275 -19.161 1.00 4.00 C ATOM 631 CE1 PHE A 43 -11.095 -15.126 -16.610 1.00 4.00 C ATOM 632 CE2 PHE A 43 -11.391 -16.367 -18.597 1.00 4.00 C ATOM 633 CZ PHE A 43 -10.942 -16.291 -17.309 1.00 4.00 C ATOM 634 H PHE A 43 -11.284 -11.678 -17.443 1.00 81.06 H ATOM 635 HA PHE A 43 -10.762 -12.804 -19.973 1.00 81.06 H ATOM 636 HB2 PHE A 43 -13.260 -12.278 -18.407 1.00 81.06 H ATOM 637 HB3 PHE A 43 -13.236 -13.103 -19.985 1.00 81.06 H ATOM 638 HD1 PHE A 43 -11.792 -13.126 -16.641 1.00 81.06 H ATOM 639 HD2 PHE A 43 -12.400 -15.341 -20.170 1.00 81.06 H ATOM 640 HE1 PHE A 43 -10.741 -15.059 -15.591 1.00 81.06 H ATOM 641 HE2 PHE A 43 -11.262 -17.275 -19.167 1.00 81.06 H ATOM 642 HZ PHE A 43 -10.451 -17.138 -16.854 1.00 81.06 H ATOM 643 N LEU A 44 -11.564 -9.638 -20.035 1.00 20.02 N ATOM 644 CA LEU A 44 -11.767 -8.426 -20.914 1.00 20.02 C ATOM 645 C LEU A 44 -10.744 -8.043 -21.999 1.00 20.02 C ATOM 646 O LEU A 44 -11.138 -7.604 -23.107 1.00 20.02 O ATOM 647 CB LEU A 44 -11.725 -7.164 -20.053 1.00 4.00 C ATOM 648 CG LEU A 44 -12.934 -6.864 -19.256 1.00 4.00 C ATOM 649 CD1 LEU A 44 -13.563 -5.606 -19.781 1.00 4.00 C ATOM 650 CD2 LEU A 44 -13.862 -8.035 -19.319 1.00 4.00 C ATOM 651 H LEU A 44 -11.501 -9.502 -19.069 1.00 83.97 H ATOM 652 HA LEU A 44 -12.747 -8.489 -21.354 1.00 83.97 H ATOM 653 HB2 LEU A 44 -10.894 -7.252 -19.374 1.00 83.97 H ATOM 654 HB3 LEU A 44 -11.539 -6.324 -20.706 1.00 83.97 H ATOM 655 HG LEU A 44 -12.659 -6.702 -18.224 1.00 83.97 H ATOM 656 HD11 LEU A 44 -12.818 -5.021 -20.299 1.00 83.97 H ATOM 657 HD12 LEU A 44 -14.361 -5.861 -20.465 1.00 83.97 H ATOM 658 HD13 LEU A 44 -13.965 -5.033 -18.960 1.00 83.97 H ATOM 659 HD21 LEU A 44 -13.948 -8.373 -20.341 1.00 83.97 H ATOM 660 HD22 LEU A 44 -13.480 -8.834 -18.704 1.00 83.97 H ATOM 661 HD23 LEU A 44 -14.818 -7.738 -18.964 1.00 83.97 H ATOM 662 N LYS A 45 -9.468 -7.998 -21.604 1.00 16.11 N ATOM 663 CA LYS A 45 -8.422 -7.396 -22.462 1.00 16.11 C ATOM 664 C LYS A 45 -8.303 -7.938 -23.927 1.00 16.11 C ATOM 665 O LYS A 45 -8.281 -7.127 -24.868 1.00 16.11 O ATOM 666 CB LYS A 45 -7.076 -7.429 -21.723 1.00 4.00 C ATOM 667 CG LYS A 45 -6.939 -6.348 -20.642 1.00 4.00 C ATOM 668 CD LYS A 45 -8.245 -5.595 -20.381 1.00 4.00 C ATOM 669 CE LYS A 45 -7.987 -4.281 -19.658 1.00 4.00 C ATOM 670 NZ LYS A 45 -8.843 -3.163 -20.157 1.00 4.00 N ATOM 671 H LYS A 45 -9.257 -8.207 -20.675 1.00 83.00 H ATOM 672 HA LYS A 45 -8.697 -6.356 -22.553 1.00 83.00 H ATOM 673 HB2 LYS A 45 -6.956 -8.394 -21.255 1.00 83.00 H ATOM 674 HB3 LYS A 45 -6.280 -7.287 -22.442 1.00 83.00 H ATOM 675 HG2 LYS A 45 -6.623 -6.817 -19.721 1.00 83.00 H ATOM 676 HG3 LYS A 45 -6.185 -5.640 -20.956 1.00 83.00 H ATOM 677 HD2 LYS A 45 -8.726 -5.387 -21.324 1.00 83.00 H ATOM 678 HD3 LYS A 45 -8.890 -6.210 -19.773 1.00 83.00 H ATOM 679 HE2 LYS A 45 -8.181 -4.423 -18.605 1.00 83.00 H ATOM 680 HE3 LYS A 45 -6.949 -4.012 -19.792 1.00 83.00 H ATOM 681 HZ1 LYS A 45 -9.847 -3.427 -20.099 1.00 83.00 H ATOM 682 HZ2 LYS A 45 -8.687 -2.308 -19.584 1.00 83.00 H ATOM 683 HZ3 LYS A 45 -8.608 -2.947 -21.147 1.00 83.00 H ATOM 684 N GLY A 46 -8.263 -9.246 -24.120 1.00 25.10 N ATOM 685 CA GLY A 46 -8.228 -9.778 -25.457 1.00 25.10 C ATOM 686 C GLY A 46 -9.615 -9.652 -26.046 1.00 25.10 C ATOM 687 O GLY A 46 -10.517 -9.194 -25.267 1.00 25.10 O ATOM 688 OXT GLY A 46 -9.820 -10.018 -27.257 1.00 23.08 O ATOM 689 H GLY A 46 -8.321 -9.849 -23.357 1.00100.00 H ATOM 690 HA2 GLY A 46 -7.941 -10.817 -25.430 1.00100.00 H ATOM 691 HA3 GLY A 46 -7.520 -9.213 -26.051 1.00100.00 H