>>1HH0:HELIX    1   1 PRO A    5  GLY A   46  1                                  42    
PSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 1 1 PRO A 5 GLY A 46 1 42 ATOM 66 N PRO A 5 -0.759 -25.403 35.241 1.00 4.12 N ATOM 67 CA PRO A 5 -0.902 -24.472 34.107 1.00 4.12 C ATOM 68 C PRO A 5 -0.966 -25.251 32.827 1.00 4.12 C ATOM 69 O PRO A 5 -1.326 -24.723 31.792 1.00 4.12 O ATOM 70 CB PRO A 5 0.452 -23.772 34.112 1.00 8.24 C ATOM 71 CG PRO A 5 1.390 -24.900 34.407 1.00 8.24 C ATOM 72 CD PRO A 5 0.669 -25.747 35.444 1.00 8.24 C ATOM 73 HA PRO A 5 -1.714 -23.768 34.197 1.00 88.24 H ATOM 74 HB2 PRO A 5 0.645 -23.322 33.147 1.00 88.24 H ATOM 75 HB3 PRO A 5 0.474 -23.027 34.887 1.00 88.24 H ATOM 76 HG2 PRO A 5 1.576 -25.475 33.513 1.00 88.24 H ATOM 77 HG3 PRO A 5 2.316 -24.518 34.812 1.00 88.24 H ATOM 78 HD2 PRO A 5 0.839 -26.795 35.256 1.00 88.24 H ATOM 79 HD3 PRO A 5 0.994 -25.485 36.441 1.00 88.24 H ATOM 80 N SER A 6 -0.455 -26.479 33.000 1.00 15.16 N ATOM 81 CA SER A 6 -0.201 -27.457 31.972 1.00 15.16 C ATOM 82 C SER A 6 -1.437 -28.212 31.364 1.00 15.16 C ATOM 83 O SER A 6 -1.561 -28.301 30.083 1.00 15.16 O ATOM 84 CB SER A 6 0.766 -28.460 32.672 1.00 5.79 C ATOM 85 OG SER A 6 1.943 -27.810 33.175 1.00 5.79 O ATOM 86 H SER A 6 -0.132 -26.697 33.888 1.00 85.79 H ATOM 87 HA SER A 6 0.341 -26.976 31.179 1.00 85.79 H ATOM 88 HB2 SER A 6 0.255 -28.934 33.498 1.00 85.79 H ATOM 89 HB3 SER A 6 1.069 -29.215 31.961 1.00 85.79 H ATOM 90 HG SER A 6 2.579 -28.472 33.469 1.00 85.79 H ATOM 91 N GLU A 7 -2.318 -28.788 32.201 1.00 18.73 N ATOM 92 CA GLU A 7 -3.480 -29.474 31.634 1.00 18.73 C ATOM 93 C GLU A 7 -4.576 -28.475 31.194 1.00 18.73 C ATOM 94 O GLU A 7 -5.118 -28.563 30.072 1.00 18.73 O ATOM 95 CB GLU A 7 -4.108 -30.468 32.657 1.00 4.00 C ATOM 96 CG GLU A 7 -3.182 -31.565 33.243 1.00 4.00 C ATOM 97 CD GLU A 7 -3.414 -31.780 34.797 1.00 4.00 C ATOM 98 OE1 GLU A 7 -2.747 -31.075 35.585 1.00 4.00 O ATOM 99 OE2 GLU A 7 -4.273 -32.623 35.196 1.00 4.00 O ATOM 100 H GLU A 7 -2.188 -28.740 33.165 1.00 72.30 H ATOM 101 HA GLU A 7 -3.150 -30.031 30.764 1.00 72.30 H ATOM 102 HB2 GLU A 7 -4.488 -29.895 33.486 1.00 72.30 H ATOM 103 HB3 GLU A 7 -4.942 -30.963 32.174 1.00 72.30 H ATOM 104 HG2 GLU A 7 -3.376 -32.498 32.726 1.00 72.30 H ATOM 105 HG3 GLU A 7 -2.151 -31.277 33.083 1.00 72.30 H ATOM 106 N VAL A 8 -4.904 -27.587 32.177 1.00 4.00 N ATOM 107 CA VAL A 8 -5.950 -26.528 32.141 1.00 4.00 C ATOM 108 C VAL A 8 -5.642 -25.225 31.373 1.00 4.00 C ATOM 109 O VAL A 8 -6.556 -24.618 30.891 1.00 4.00 O ATOM 110 CB VAL A 8 -6.652 -26.342 33.557 1.00 7.90 C ATOM 111 CG1 VAL A 8 -7.780 -25.291 33.604 1.00 7.90 C ATOM 112 CG2 VAL A 8 -7.253 -27.680 34.074 1.00 7.90 C ATOM 113 H VAL A 8 -4.418 -27.671 33.022 1.00 87.90 H ATOM 114 HA VAL A 8 -6.722 -27.010 31.510 1.00 87.90 H ATOM 115 HB VAL A 8 -5.887 -26.036 34.255 1.00 87.90 H ATOM 116 HG11 VAL A 8 -7.804 -24.724 32.686 1.00 87.90 H ATOM 117 HG12 VAL A 8 -8.730 -25.794 33.743 1.00 87.90 H ATOM 118 HG13 VAL A 8 -7.608 -24.624 34.437 1.00 87.90 H ATOM 119 HG21 VAL A 8 -7.031 -28.480 33.387 1.00 87.90 H ATOM 120 HG22 VAL A 8 -6.831 -27.914 35.043 1.00 87.90 H ATOM 121 HG23 VAL A 8 -8.327 -27.579 34.169 1.00 87.90 H ATOM 122 N ALA A 9 -4.373 -24.791 31.263 1.00 4.00 N ATOM 123 CA ALA A 9 -4.034 -23.587 30.469 1.00 4.00 C ATOM 124 C ALA A 9 -4.127 -23.950 28.883 1.00 4.00 C ATOM 125 O ALA A 9 -4.509 -23.177 28.027 1.00 4.00 O ATOM 126 CB ALA A 9 -2.671 -23.029 30.867 1.00 4.00 C ATOM 127 H ALA A 9 -3.656 -25.307 31.670 1.00 79.40 H ATOM 128 HA ALA A 9 -4.785 -22.844 30.676 1.00 79.40 H ATOM 129 HB1 ALA A 9 -2.653 -21.969 30.678 1.00 79.40 H ATOM 130 HB2 ALA A 9 -2.500 -23.219 31.910 1.00 79.40 H ATOM 131 HB3 ALA A 9 -1.897 -23.513 30.281 1.00 79.40 H ATOM 132 N SER A 10 -3.883 -25.193 28.629 1.00 4.00 N ATOM 133 CA SER A 10 -3.992 -25.863 27.370 1.00 4.00 C ATOM 134 C SER A 10 -5.364 -25.718 26.703 1.00 4.00 C ATOM 135 O SER A 10 -5.494 -26.012 25.521 1.00 4.00 O ATOM 136 CB SER A 10 -3.467 -27.254 27.440 1.00 4.00 C ATOM 137 OG SER A 10 -2.077 -27.148 27.655 1.00 4.00 O ATOM 138 H SER A 10 -3.670 -25.757 29.395 1.00 81.16 H ATOM 139 HA SER A 10 -3.314 -25.317 26.733 1.00 81.16 H ATOM 140 HB2 SER A 10 -3.922 -27.792 28.257 1.00 81.16 H ATOM 141 HB3 SER A 10 -3.651 -27.763 26.504 1.00 81.16 H ATOM 142 HG SER A 10 -1.824 -27.671 28.418 1.00 81.16 H ATOM 143 N GLN A 11 -6.457 -25.464 27.436 1.00 4.00 N ATOM 144 CA GLN A 11 -7.782 -25.482 26.769 1.00 4.00 C ATOM 145 C GLN A 11 -7.738 -24.559 25.498 1.00 4.00 C ATOM 146 O GLN A 11 -8.367 -24.806 24.458 1.00 4.00 O ATOM 147 CB GLN A 11 -8.879 -24.789 27.654 1.00 10.85 C ATOM 148 CG GLN A 11 -9.156 -25.289 29.093 1.00 10.85 C ATOM 149 CD GLN A 11 -10.450 -24.659 29.663 1.00 10.85 C ATOM 150 OE1 GLN A 11 -11.370 -25.373 30.094 1.00 10.85 O ATOM 151 NE2 GLN A 11 -10.534 -23.328 29.640 1.00 10.85 N ATOM 152 H GLN A 11 -6.392 -25.371 28.409 1.00 90.85 H ATOM 153 HA GLN A 11 -8.072 -26.491 26.517 1.00 90.85 H ATOM 154 HB2 GLN A 11 -8.616 -23.750 27.741 1.00 90.85 H ATOM 155 HB3 GLN A 11 -9.815 -24.848 27.115 1.00 90.85 H ATOM 156 HG2 GLN A 11 -9.259 -26.364 29.085 1.00 90.85 H ATOM 157 HG3 GLN A 11 -8.328 -25.006 29.728 1.00 90.85 H ATOM 158 HE21 GLN A 11 -9.778 -22.818 29.279 1.00 90.85 H ATOM 159 HE22 GLN A 11 -11.350 -22.917 29.983 1.00 90.85 H ATOM 160 N VAL A 12 -6.977 -23.514 25.606 1.00 7.41 N ATOM 161 CA VAL A 12 -6.816 -22.568 24.537 1.00 7.41 C ATOM 162 C VAL A 12 -6.368 -23.295 23.288 1.00 7.41 C ATOM 163 O VAL A 12 -6.580 -22.851 22.181 1.00 7.41 O ATOM 164 CB VAL A 12 -5.758 -21.518 24.873 1.00 5.97 C ATOM 165 CG1 VAL A 12 -5.699 -20.506 23.751 1.00 5.97 C ATOM 166 CG2 VAL A 12 -6.013 -20.864 26.226 1.00 5.97 C ATOM 167 H VAL A 12 -6.488 -23.367 26.444 1.00 85.97 H ATOM 168 HA VAL A 12 -7.758 -22.077 24.355 1.00 85.97 H ATOM 169 HB VAL A 12 -4.801 -22.018 24.916 1.00 85.97 H ATOM 170 HG11 VAL A 12 -6.681 -20.399 23.313 1.00 85.97 H ATOM 171 HG12 VAL A 12 -5.372 -19.553 24.140 1.00 85.97 H ATOM 172 HG13 VAL A 12 -5.005 -20.847 22.995 1.00 85.97 H ATOM 173 HG21 VAL A 12 -7.041 -21.028 26.518 1.00 85.97 H ATOM 174 HG22 VAL A 12 -5.357 -21.302 26.963 1.00 85.97 H ATOM 175 HG23 VAL A 12 -5.822 -19.805 26.157 1.00 85.97 H ATOM 176 N THR A 13 -5.691 -24.382 23.525 1.00 4.00 N ATOM 177 CA THR A 13 -5.113 -25.197 22.501 1.00 4.00 C ATOM 178 C THR A 13 -6.244 -25.546 21.507 1.00 4.00 C ATOM 179 O THR A 13 -6.073 -25.451 20.311 1.00 4.00 O ATOM 180 CB THR A 13 -4.450 -26.418 23.248 1.00 21.03 C ATOM 181 OG1 THR A 13 -3.368 -25.964 24.054 1.00 21.03 O ATOM 182 CG2 THR A 13 -3.887 -27.552 22.397 1.00 21.03 C ATOM 183 H THR A 13 -5.530 -24.633 24.454 1.00100.00 H ATOM 184 HA THR A 13 -4.350 -24.622 21.993 1.00100.00 H ATOM 185 HB THR A 13 -5.191 -26.851 23.912 1.00100.00 H ATOM 186 HG1 THR A 13 -3.164 -26.627 24.709 1.00100.00 H ATOM 187 HG21 THR A 13 -4.329 -27.526 21.408 1.00100.00 H ATOM 188 HG22 THR A 13 -2.818 -27.443 22.317 1.00100.00 H ATOM 189 HG23 THR A 13 -4.117 -28.502 22.867 1.00100.00 H ATOM 190 N ASN A 14 -7.440 -25.794 22.018 1.00 17.35 N ATOM 191 CA ASN A 14 -8.588 -25.947 21.142 1.00 17.35 C ATOM 192 C ASN A 14 -9.065 -24.574 20.612 1.00 17.35 C ATOM 193 O ASN A 14 -9.648 -24.523 19.551 1.00 17.35 O ATOM 194 CB ASN A 14 -9.748 -26.948 21.555 1.00 16.55 C ATOM 195 CG ASN A 14 -9.478 -28.483 21.289 1.00 16.55 C ATOM 196 OD1 ASN A 14 -10.413 -29.256 21.002 1.00 16.55 O ATOM 197 ND2 ASN A 14 -8.246 -28.937 21.368 1.00 16.55 N ATOM 198 H ASN A 14 -7.572 -25.742 22.999 1.00 96.55 H ATOM 199 HA ASN A 14 -8.135 -26.405 20.274 1.00 96.55 H ATOM 200 HB2 ASN A 14 -9.927 -26.831 22.624 1.00 96.55 H ATOM 201 HB3 ASN A 14 -10.646 -26.671 21.035 1.00 96.55 H ATOM 202 HD21 ASN A 14 -7.532 -28.305 21.584 1.00 96.55 H ATOM 203 HD22 ASN A 14 -8.098 -29.897 21.227 1.00 96.55 H ATOM 204 N TYR A 15 -8.840 -23.457 21.366 1.00 4.00 N ATOM 205 CA TYR A 15 -9.276 -22.074 20.935 1.00 4.00 C ATOM 206 C TYR A 15 -8.727 -21.699 19.513 1.00 4.00 C ATOM 207 O TYR A 15 -9.423 -21.155 18.697 1.00 4.00 O ATOM 208 CB TYR A 15 -8.799 -21.066 22.012 1.00 12.86 C ATOM 209 CG TYR A 15 -9.659 -21.095 23.261 1.00 12.86 C ATOM 210 CD1 TYR A 15 -9.766 -22.269 23.981 1.00 12.86 C ATOM 211 CD2 TYR A 15 -10.399 -19.982 23.664 1.00 12.86 C ATOM 212 CE1 TYR A 15 -10.574 -22.350 25.073 1.00 12.86 C ATOM 213 CE2 TYR A 15 -11.217 -20.044 24.757 1.00 12.86 C ATOM 214 CZ TYR A 15 -11.314 -21.249 25.485 1.00 12.86 C ATOM 215 OH TYR A 15 -12.124 -21.351 26.683 1.00 12.86 O ATOM 216 H TYR A 15 -8.391 -23.556 22.233 1.00 92.86 H ATOM 217 HA TYR A 15 -10.356 -22.061 20.896 1.00 92.86 H ATOM 218 HB2 TYR A 15 -7.788 -21.310 22.298 1.00 92.86 H ATOM 219 HB3 TYR A 15 -8.825 -20.065 21.605 1.00 92.86 H ATOM 220 HD1 TYR A 15 -9.191 -23.129 23.672 1.00 92.86 H ATOM 221 HD2 TYR A 15 -10.317 -19.063 23.107 1.00 92.86 H ATOM 222 HE1 TYR A 15 -10.641 -23.281 25.619 1.00 92.86 H ATOM 223 HE2 TYR A 15 -11.781 -19.175 25.056 1.00 92.86 H ATOM 224 HH TYR A 15 -12.750 -22.078 26.588 1.00 92.86 H ATOM 225 N ILE A 16 -7.485 -22.055 19.284 1.00 4.00 N ATOM 226 CA ILE A 16 -6.744 -21.966 18.014 1.00 4.00 C ATOM 227 C ILE A 16 -7.099 -23.136 16.941 1.00 4.00 C ATOM 228 O ILE A 16 -6.954 -22.948 15.786 1.00 4.00 O ATOM 229 CB ILE A 16 -5.235 -21.856 18.345 1.00 7.96 C ATOM 230 CG1 ILE A 16 -5.001 -20.602 19.249 1.00 7.96 C ATOM 231 CG2 ILE A 16 -4.385 -21.808 17.086 1.00 7.96 C ATOM 232 CD1 ILE A 16 -4.093 -20.843 20.447 1.00 7.96 C ATOM 233 H ILE A 16 -7.027 -22.508 20.023 1.00 87.96 H ATOM 234 HA ILE A 16 -7.037 -21.023 17.563 1.00 87.96 H ATOM 235 HB ILE A 16 -4.955 -22.738 18.897 1.00 87.96 H ATOM 236 HG12 ILE A 16 -4.554 -19.821 18.657 1.00 87.96 H ATOM 237 HG13 ILE A 16 -5.957 -20.255 19.624 1.00 87.96 H ATOM 238 HG21 ILE A 16 -4.881 -22.356 16.298 1.00 87.96 H ATOM 239 HG22 ILE A 16 -4.251 -20.780 16.784 1.00 87.96 H ATOM 240 HG23 ILE A 16 -3.423 -22.255 17.285 1.00 87.96 H ATOM 241 HD11 ILE A 16 -3.263 -21.467 20.150 1.00 87.96 H ATOM 242 HD12 ILE A 16 -3.722 -19.897 20.809 1.00 87.96 H ATOM 243 HD13 ILE A 16 -4.652 -21.334 21.230 1.00 87.96 H ATOM 244 N GLN A 17 -7.509 -24.365 17.381 1.00 4.00 N ATOM 245 CA GLN A 17 -7.833 -25.514 16.485 1.00 4.00 C ATOM 246 C GLN A 17 -9.157 -25.297 15.791 1.00 4.00 C ATOM 247 O GLN A 17 -9.297 -25.698 14.610 1.00 4.00 O ATOM 248 CB GLN A 17 -8.021 -26.912 17.182 1.00 4.00 C ATOM 249 CG GLN A 17 -6.793 -27.738 17.645 1.00 4.00 C ATOM 250 CD GLN A 17 -7.131 -29.253 17.882 1.00 4.00 C ATOM 251 OE1 GLN A 17 -6.262 -30.080 18.180 1.00 4.00 O ATOM 252 NE2 GLN A 17 -8.391 -29.627 17.760 1.00 4.00 N ATOM 253 H GLN A 17 -7.578 -24.500 18.348 1.00 76.19 H ATOM 254 HA GLN A 17 -7.050 -25.589 15.749 1.00 76.19 H ATOM 255 HB2 GLN A 17 -8.631 -26.755 18.057 1.00 76.19 H ATOM 256 HB3 GLN A 17 -8.585 -27.533 16.500 1.00 76.19 H ATOM 257 HG2 GLN A 17 -6.023 -27.675 16.892 1.00 76.19 H ATOM 258 HG3 GLN A 17 -6.424 -27.319 18.572 1.00 76.19 H ATOM 259 HE21 GLN A 17 -9.054 -28.949 17.530 1.00 76.19 H ATOM 260 HE22 GLN A 17 -8.611 -30.570 17.921 1.00 76.19 H ATOM 261 N ALA A 18 -10.144 -24.708 16.528 1.00 6.86 N ATOM 262 CA ALA A 18 -11.520 -24.463 15.989 1.00 6.86 C ATOM 263 C ALA A 18 -11.557 -23.433 14.756 1.00 6.86 C ATOM 264 O ALA A 18 -12.147 -23.705 13.671 1.00 6.86 O ATOM 265 CB ALA A 18 -12.472 -24.036 17.115 1.00 4.00 C ATOM 266 H ALA A 18 -9.946 -24.460 17.455 1.00 80.16 H ATOM 267 HA ALA A 18 -11.875 -25.413 15.621 1.00 80.16 H ATOM 268 HB1 ALA A 18 -11.899 -23.783 17.992 1.00 80.16 H ATOM 269 HB2 ALA A 18 -13.140 -24.852 17.341 1.00 80.16 H ATOM 270 HB3 ALA A 18 -13.047 -23.176 16.800 1.00 80.16 H ATOM 271 N ILE A 19 -10.901 -22.278 14.896 1.00 11.41 N ATOM 272 CA ILE A 19 -10.840 -21.323 13.827 1.00 11.41 C ATOM 273 C ILE A 19 -10.249 -21.923 12.605 1.00 11.41 C ATOM 274 O ILE A 19 -10.551 -21.451 11.579 1.00 11.41 O ATOM 275 CB ILE A 19 -10.095 -19.992 14.122 1.00 15.12 C ATOM 276 CG1 ILE A 19 -10.947 -19.012 14.956 1.00 15.12 C ATOM 277 CG2 ILE A 19 -9.646 -19.345 12.831 1.00 15.12 C ATOM 278 CD1 ILE A 19 -10.415 -17.579 15.001 1.00 15.12 C ATOM 279 H ILE A 19 -10.419 -22.096 15.730 1.00 95.12 H ATOM 280 HA ILE A 19 -11.864 -21.061 13.587 1.00 95.12 H ATOM 281 HB ILE A 19 -9.206 -20.239 14.682 1.00 95.12 H ATOM 282 HG12 ILE A 19 -11.944 -18.975 14.545 1.00 95.12 H ATOM 283 HG13 ILE A 19 -11.002 -19.374 15.976 1.00 95.12 H ATOM 284 HG21 ILE A 19 -9.174 -20.083 12.204 1.00 95.12 H ATOM 285 HG22 ILE A 19 -10.507 -18.933 12.327 1.00 95.12 H ATOM 286 HG23 ILE A 19 -8.949 -18.554 13.046 1.00 95.12 H ATOM 287 HD11 ILE A 19 -9.885 -17.365 14.086 1.00 95.12 H ATOM 288 HD12 ILE A 19 -11.240 -16.890 15.108 1.00 95.12 H ATOM 289 HD13 ILE A 19 -9.744 -17.467 15.840 1.00 95.12 H ATOM 290 N ALA A 20 -9.388 -22.910 12.636 1.00 5.85 N ATOM 291 CA ALA A 20 -8.866 -23.302 11.360 1.00 5.85 C ATOM 292 C ALA A 20 -10.040 -23.580 10.437 1.00 5.85 C ATOM 293 O ALA A 20 -10.060 -23.018 9.353 1.00 5.85 O ATOM 294 CB ALA A 20 -7.912 -24.496 11.390 1.00 4.00 C ATOM 295 H ALA A 20 -9.082 -23.309 13.471 1.00 80.05 H ATOM 296 HA ALA A 20 -8.324 -22.454 10.964 1.00 80.05 H ATOM 297 HB1 ALA A 20 -7.554 -24.651 12.394 1.00 80.05 H ATOM 298 HB2 ALA A 20 -8.430 -25.379 11.051 1.00 80.05 H ATOM 299 HB3 ALA A 20 -7.074 -24.300 10.737 1.00 80.05 H ATOM 300 N ALA A 21 -11.059 -24.371 10.828 1.00 14.15 N ATOM 301 CA ALA A 21 -12.161 -24.609 9.872 1.00 14.15 C ATOM 302 C ALA A 21 -13.051 -23.384 9.477 1.00 14.15 C ATOM 303 O ALA A 21 -13.160 -23.116 8.259 1.00 14.15 O ATOM 304 CB ALA A 21 -13.047 -25.726 10.413 1.00 4.00 C ATOM 305 H ALA A 21 -11.062 -24.785 11.717 1.00 81.62 H ATOM 306 HA ALA A 21 -11.715 -24.982 8.965 1.00 81.62 H ATOM 307 HB1 ALA A 21 -12.512 -26.662 10.367 1.00 81.62 H ATOM 308 HB2 ALA A 21 -13.944 -25.792 9.819 1.00 81.62 H ATOM 309 HB3 ALA A 21 -13.311 -25.512 11.439 1.00 81.62 H ATOM 310 N ALA A 22 -13.610 -22.605 10.430 1.00 4.00 N ATOM 311 CA ALA A 22 -14.388 -21.349 10.117 1.00 4.00 C ATOM 312 C ALA A 22 -13.501 -20.148 9.788 1.00 4.00 C ATOM 313 O ALA A 22 -13.879 -19.162 9.131 1.00 4.00 O ATOM 314 CB ALA A 22 -15.396 -20.962 11.178 1.00 4.00 C ATOM 315 H ALA A 22 -13.444 -22.828 11.372 1.00 83.13 H ATOM 316 HA ALA A 22 -14.950 -21.573 9.219 1.00 83.13 H ATOM 317 HB1 ALA A 22 -15.981 -21.827 11.450 1.00 83.13 H ATOM 318 HB2 ALA A 22 -14.876 -20.587 12.047 1.00 83.13 H ATOM 319 HB3 ALA A 22 -16.046 -20.194 10.785 1.00 83.13 H ATOM 320 N GLY A 23 -12.356 -20.204 10.379 1.00 4.00 N ATOM 321 CA GLY A 23 -11.438 -19.130 10.299 1.00 4.00 C ATOM 322 C GLY A 23 -10.909 -19.043 8.972 1.00 4.00 C ATOM 323 O GLY A 23 -10.732 -17.987 8.468 1.00 4.00 O ATOM 324 H GLY A 23 -12.153 -20.976 10.945 1.00 83.77 H ATOM 325 HA2 GLY A 23 -10.637 -19.295 11.002 1.00 83.77 H ATOM 326 HA3 GLY A 23 -11.951 -18.214 10.552 1.00 83.77 H ATOM 327 N VAL A 24 -10.706 -20.181 8.438 1.00 4.00 N ATOM 328 CA VAL A 24 -10.255 -20.287 7.083 1.00 4.00 C ATOM 329 C VAL A 24 -11.388 -20.021 6.099 1.00 4.00 C ATOM 330 O VAL A 24 -11.225 -19.321 5.181 1.00 4.00 O ATOM 331 CB VAL A 24 -9.572 -21.588 6.746 1.00 4.00 C ATOM 332 CG1 VAL A 24 -9.533 -21.760 5.226 1.00 4.00 C ATOM 333 CG2 VAL A 24 -8.163 -21.582 7.307 1.00 4.00 C ATOM 334 H VAL A 24 -10.912 -20.996 8.940 1.00 82.28 H ATOM 335 HA VAL A 24 -9.529 -19.502 6.951 1.00 82.28 H ATOM 336 HB VAL A 24 -10.118 -22.402 7.182 1.00 82.28 H ATOM 337 HG11 VAL A 24 -9.261 -20.820 4.760 1.00 82.28 H ATOM 338 HG12 VAL A 24 -8.800 -22.511 4.962 1.00 82.28 H ATOM 339 HG13 VAL A 24 -10.505 -22.067 4.868 1.00 82.28 H ATOM 340 HG21 VAL A 24 -7.860 -20.565 7.500 1.00 82.28 H ATOM 341 HG22 VAL A 24 -8.134 -22.150 8.224 1.00 82.28 H ATOM 342 HG23 VAL A 24 -7.489 -22.027 6.585 1.00 82.28 H ATOM 343 N GLY A 25 -12.553 -20.492 6.347 1.00 4.00 N ATOM 344 CA GLY A 25 -13.627 -20.216 5.446 1.00 4.00 C ATOM 345 C GLY A 25 -13.730 -18.728 5.218 1.00 4.00 C ATOM 346 O GLY A 25 -14.207 -18.316 4.209 1.00 4.00 O ATOM 347 H GLY A 25 -12.704 -21.021 7.156 1.00 81.01 H ATOM 348 HA2 GLY A 25 -14.553 -20.573 5.868 1.00 81.01 H ATOM 349 HA3 GLY A 25 -13.449 -20.713 4.502 1.00 81.01 H ATOM 350 N VAL A 26 -13.319 -17.884 6.142 1.00 4.00 N ATOM 351 CA VAL A 26 -13.419 -16.451 5.878 1.00 4.00 C ATOM 352 C VAL A 26 -12.339 -16.029 4.889 1.00 4.00 C ATOM 353 O VAL A 26 -12.660 -15.443 3.907 1.00 4.00 O ATOM 354 CB VAL A 26 -13.264 -15.561 7.124 1.00 15.71 C ATOM 355 CG1 VAL A 26 -13.231 -14.086 6.697 1.00 15.71 C ATOM 356 CG2 VAL A 26 -14.357 -15.842 8.222 1.00 15.71 C ATOM 357 H VAL A 26 -12.945 -18.212 6.986 1.00 95.71 H ATOM 358 HA VAL A 26 -14.387 -16.260 5.438 1.00 95.71 H ATOM 359 HB VAL A 26 -12.299 -15.788 7.558 1.00 95.71 H ATOM 360 HG11 VAL A 26 -13.588 -13.999 5.682 1.00 95.71 H ATOM 361 HG12 VAL A 26 -13.862 -13.504 7.352 1.00 95.71 H ATOM 362 HG13 VAL A 26 -12.218 -13.716 6.755 1.00 95.71 H ATOM 363 HG21 VAL A 26 -15.259 -16.208 7.752 1.00 95.71 H ATOM 364 HG22 VAL A 26 -13.985 -16.582 8.915 1.00 95.71 H ATOM 365 HG23 VAL A 26 -14.573 -14.929 8.753 1.00 95.71 H ATOM 366 N LEU A 27 -11.078 -16.362 5.072 1.00 4.00 N ATOM 367 CA LEU A 27 -10.119 -16.012 4.047 1.00 4.00 C ATOM 368 C LEU A 27 -10.281 -16.961 2.889 1.00 4.00 C ATOM 369 O LEU A 27 -10.212 -16.573 1.745 1.00 4.00 O ATOM 370 CB LEU A 27 -8.662 -15.828 4.488 1.00 6.05 C ATOM 371 CG LEU A 27 -8.303 -14.484 5.189 1.00 6.05 C ATOM 372 CD1 LEU A 27 -8.521 -13.308 4.237 1.00 6.05 C ATOM 373 CD2 LEU A 27 -9.082 -14.255 6.472 1.00 6.05 C ATOM 374 H LEU A 27 -10.811 -16.891 5.850 1.00 86.05 H ATOM 375 HA LEU A 27 -10.459 -15.050 3.685 1.00 86.05 H ATOM 376 HB2 LEU A 27 -8.415 -16.631 5.165 1.00 86.05 H ATOM 377 HB3 LEU A 27 -8.039 -15.924 3.614 1.00 86.05 H ATOM 378 HG LEU A 27 -7.252 -14.502 5.440 1.00 86.05 H ATOM 379 HD11 LEU A 27 -9.263 -13.573 3.498 1.00 86.05 H ATOM 380 HD12 LEU A 27 -8.863 -12.454 4.798 1.00 86.05 H ATOM 381 HD13 LEU A 27 -7.592 -13.066 3.745 1.00 86.05 H ATOM 382 HD21 LEU A 27 -9.810 -15.041 6.597 1.00 86.05 H ATOM 383 HD22 LEU A 27 -8.402 -14.256 7.309 1.00 86.05 H ATOM 384 HD23 LEU A 27 -9.588 -13.302 6.421 1.00 86.05 H ATOM 385 N ALA A 28 -10.568 -18.196 3.184 1.00 4.00 N ATOM 386 CA ALA A 28 -10.808 -19.193 2.155 1.00 4.00 C ATOM 387 C ALA A 28 -11.869 -18.670 1.274 1.00 4.00 C ATOM 388 O ALA A 28 -11.751 -18.742 0.061 1.00 4.00 O ATOM 389 CB ALA A 28 -11.248 -20.526 2.705 1.00 4.00 C ATOM 390 H ALA A 28 -10.650 -18.433 4.101 1.00 81.55 H ATOM 391 HA ALA A 28 -9.899 -19.331 1.587 1.00 81.55 H ATOM 392 HB1 ALA A 28 -11.884 -20.369 3.564 1.00 81.55 H ATOM 393 HB2 ALA A 28 -10.381 -21.100 3.000 1.00 81.55 H ATOM 394 HB3 ALA A 28 -11.795 -21.064 1.948 1.00 81.55 H ATOM 395 N LEU A 29 -12.908 -18.151 1.896 1.00 4.00 N ATOM 396 CA LEU A 29 -14.000 -17.508 1.174 1.00 4.00 C ATOM 397 C LEU A 29 -13.642 -16.025 0.667 1.00 4.00 C ATOM 398 O LEU A 29 -14.083 -15.607 -0.434 1.00 4.00 O ATOM 399 CB LEU A 29 -15.335 -17.657 1.923 1.00 9.20 C ATOM 400 CG LEU A 29 -15.942 -19.102 1.919 1.00 9.20 C ATOM 401 CD1 LEU A 29 -16.705 -19.399 0.644 1.00 9.20 C ATOM 402 CD2 LEU A 29 -14.878 -20.166 2.097 1.00 9.20 C ATOM 403 H LEU A 29 -12.918 -18.143 2.878 1.00 89.20 H ATOM 404 HA LEU A 29 -14.096 -18.098 0.273 1.00 89.20 H ATOM 405 HB2 LEU A 29 -15.186 -17.356 2.950 1.00 89.20 H ATOM 406 HB3 LEU A 29 -16.054 -16.991 1.474 1.00 89.20 H ATOM 407 HG LEU A 29 -16.636 -19.193 2.745 1.00 89.20 H ATOM 408 HD11 LEU A 29 -17.430 -18.622 0.470 1.00 89.20 H ATOM 409 HD12 LEU A 29 -16.014 -19.444 -0.183 1.00 89.20 H ATOM 410 HD13 LEU A 29 -17.209 -20.351 0.746 1.00 89.20 H ATOM 411 HD21 LEU A 29 -14.045 -19.958 1.443 1.00 89.20 H ATOM 412 HD22 LEU A 29 -14.539 -20.169 3.123 1.00 89.20 H ATOM 413 HD23 LEU A 29 -15.295 -21.134 1.855 1.00 89.20 H ATOM 414 N ALA A 30 -12.827 -15.198 1.455 1.00 26.22 N ATOM 415 CA ALA A 30 -12.469 -13.810 0.996 1.00 26.22 C ATOM 416 C ALA A 30 -11.459 -13.957 -0.112 1.00 26.22 C ATOM 417 O ALA A 30 -11.711 -13.570 -1.257 1.00 26.22 O ATOM 418 CB ALA A 30 -11.834 -12.977 2.134 1.00 4.00 C ATOM 419 H ALA A 30 -12.485 -15.526 2.300 1.00 80.11 H ATOM 420 HA ALA A 30 -13.356 -13.309 0.629 1.00 80.11 H ATOM 421 HB1 ALA A 30 -11.331 -13.637 2.822 1.00 80.11 H ATOM 422 HB2 ALA A 30 -12.604 -12.431 2.655 1.00 80.11 H ATOM 423 HB3 ALA A 30 -11.116 -12.282 1.719 1.00 80.11 H ATOM 424 N ILE A 31 -10.435 -14.735 0.197 1.00 6.10 N ATOM 425 CA ILE A 31 -9.476 -15.152 -0.758 1.00 6.10 C ATOM 426 C ILE A 31 -10.163 -15.838 -1.879 1.00 6.10 C ATOM 427 O ILE A 31 -9.613 -15.911 -2.942 1.00 6.10 O ATOM 428 CB ILE A 31 -8.430 -16.138 -0.268 1.00 4.00 C ATOM 429 CG1 ILE A 31 -7.336 -15.481 0.546 1.00 4.00 C ATOM 430 CG2 ILE A 31 -7.864 -16.872 -1.471 1.00 4.00 C ATOM 431 CD1 ILE A 31 -6.175 -16.402 0.816 1.00 4.00 C ATOM 432 H ILE A 31 -10.410 -15.127 1.076 1.00 81.86 H ATOM 433 HA ILE A 31 -8.971 -14.277 -1.141 1.00 81.86 H ATOM 434 HB ILE A 31 -8.933 -16.868 0.345 1.00 81.86 H ATOM 435 HG12 ILE A 31 -6.952 -14.643 -0.006 1.00 81.86 H ATOM 436 HG13 ILE A 31 -7.735 -15.147 1.486 1.00 81.86 H ATOM 437 HG21 ILE A 31 -7.724 -16.179 -2.288 1.00 81.86 H ATOM 438 HG22 ILE A 31 -6.914 -17.314 -1.210 1.00 81.86 H ATOM 439 HG23 ILE A 31 -8.550 -17.649 -1.775 1.00 81.86 H ATOM 440 HD11 ILE A 31 -6.508 -17.427 0.752 1.00 81.86 H ATOM 441 HD12 ILE A 31 -5.401 -16.230 0.082 1.00 81.86 H ATOM 442 HD13 ILE A 31 -5.785 -16.211 1.802 1.00 81.86 H ATOM 443 N GLY A 32 -11.296 -16.444 -1.611 1.00 5.35 N ATOM 444 CA GLY A 32 -11.940 -17.225 -2.650 1.00 5.35 C ATOM 445 C GLY A 32 -12.229 -16.414 -3.876 1.00 5.35 C ATOM 446 O GLY A 32 -11.768 -16.769 -4.910 1.00 5.35 O ATOM 447 H GLY A 32 -11.650 -16.436 -0.699 1.00 82.87 H ATOM 448 HA2 GLY A 32 -12.868 -17.622 -2.266 1.00 82.87 H ATOM 449 HA3 GLY A 32 -11.294 -18.050 -2.918 1.00 82.87 H ATOM 450 N LEU A 33 -12.866 -15.263 -3.708 1.00 15.52 N ATOM 451 CA LEU A 33 -13.074 -14.306 -4.789 1.00 15.52 C ATOM 452 C LEU A 33 -11.780 -13.552 -5.065 1.00 15.52 C ATOM 453 O LEU A 33 -11.544 -13.052 -6.165 1.00 15.52 O ATOM 454 CB LEU A 33 -14.315 -13.403 -4.684 1.00 13.76 C ATOM 455 CG LEU A 33 -15.663 -14.064 -5.064 1.00 13.76 C ATOM 456 CD1 LEU A 33 -16.043 -15.172 -4.123 1.00 13.76 C ATOM 457 CD2 LEU A 33 -16.790 -13.038 -5.148 1.00 13.76 C ATOM 458 H LEU A 33 -13.110 -14.999 -2.796 1.00 93.76 H ATOM 459 HA LEU A 33 -13.228 -14.934 -5.663 1.00 93.76 H ATOM 460 HB2 LEU A 33 -14.387 -13.041 -3.670 1.00 93.76 H ATOM 461 HB3 LEU A 33 -14.165 -12.556 -5.341 1.00 93.76 H ATOM 462 HG LEU A 33 -15.559 -14.503 -6.048 1.00 93.76 H ATOM 463 HD11 LEU A 33 -15.745 -14.907 -3.120 1.00 93.76 H ATOM 464 HD12 LEU A 33 -17.113 -15.321 -4.156 1.00 93.76 H ATOM 465 HD13 LEU A 33 -15.545 -16.084 -4.419 1.00 93.76 H ATOM 466 HD21 LEU A 33 -16.464 -12.190 -5.733 1.00 93.76 H ATOM 467 HD22 LEU A 33 -17.653 -13.488 -5.618 1.00 93.76 H ATOM 468 HD23 LEU A 33 -17.053 -12.712 -4.156 1.00 93.76 H ATOM 469 N SER A 34 -10.927 -13.423 -4.052 1.00 4.00 N ATOM 470 CA SER A 34 -9.710 -12.691 -4.291 1.00 4.00 C ATOM 471 C SER A 34 -8.888 -13.178 -5.477 1.00 4.00 C ATOM 472 O SER A 34 -8.571 -12.355 -6.237 1.00 4.00 O ATOM 473 CB SER A 34 -8.829 -12.677 -3.075 1.00 4.00 C ATOM 474 OG SER A 34 -9.324 -11.763 -2.193 1.00 4.00 O ATOM 475 H SER A 34 -11.127 -13.801 -3.173 1.00 81.71 H ATOM 476 HA SER A 34 -10.000 -11.671 -4.492 1.00 81.71 H ATOM 477 HB2 SER A 34 -8.824 -13.655 -2.611 1.00 81.71 H ATOM 478 HB3 SER A 34 -7.825 -12.393 -3.345 1.00 81.71 H ATOM 479 HG SER A 34 -10.284 -11.792 -2.199 1.00 81.71 H ATOM 480 N ALA A 35 -8.557 -14.454 -5.673 1.00 4.00 N ATOM 481 CA ALA A 35 -7.793 -14.829 -6.886 1.00 4.00 C ATOM 482 C ALA A 35 -8.737 -14.840 -8.182 1.00 4.00 C ATOM 483 O ALA A 35 -8.376 -14.336 -9.237 1.00 4.00 O ATOM 484 CB ALA A 35 -7.005 -16.129 -6.689 1.00 4.00 C ATOM 485 H ALA A 35 -8.841 -15.139 -5.032 1.00 79.40 H ATOM 486 HA ALA A 35 -7.065 -14.040 -7.036 1.00 79.40 H ATOM 487 HB1 ALA A 35 -7.322 -16.604 -5.774 1.00 79.40 H ATOM 488 HB2 ALA A 35 -7.185 -16.791 -7.521 1.00 79.40 H ATOM 489 HB3 ALA A 35 -5.950 -15.903 -6.632 1.00 79.40 H ATOM 490 N ALA A 36 -9.965 -15.394 -8.030 1.00 4.58 N ATOM 491 CA ALA A 36 -10.975 -15.473 -9.082 1.00 4.58 C ATOM 492 C ALA A 36 -11.355 -14.140 -9.525 1.00 4.58 C ATOM 493 O ALA A 36 -11.749 -13.972 -10.643 1.00 4.58 O ATOM 494 CB ALA A 36 -12.244 -16.138 -8.608 1.00 4.00 C ATOM 495 H ALA A 36 -10.198 -15.751 -7.147 1.00 81.27 H ATOM 496 HA ALA A 36 -10.579 -16.034 -9.911 1.00 81.27 H ATOM 497 HB1 ALA A 36 -12.015 -17.105 -8.192 1.00 81.27 H ATOM 498 HB2 ALA A 36 -12.916 -16.254 -9.442 1.00 81.27 H ATOM 499 HB3 ALA A 36 -12.714 -15.522 -7.855 1.00 81.27 H ATOM 500 N TRP A 37 -11.255 -13.195 -8.635 1.00 4.00 N ATOM 501 CA TRP A 37 -11.608 -11.852 -8.958 1.00 4.00 C ATOM 502 C TRP A 37 -10.688 -11.337 -10.065 1.00 4.00 C ATOM 503 O TRP A 37 -11.129 -10.611 -10.924 1.00 4.00 O ATOM 504 CB TRP A 37 -11.557 -10.939 -7.754 1.00 56.47 C ATOM 505 CG TRP A 37 -12.214 -9.630 -8.022 1.00 56.47 C ATOM 506 CD1 TRP A 37 -11.636 -8.496 -8.522 1.00 56.47 C ATOM 507 CD2 TRP A 37 -13.608 -9.340 -7.859 1.00 56.47 C ATOM 508 NE1 TRP A 37 -12.585 -7.507 -8.648 1.00 56.47 N ATOM 509 CE2 TRP A 37 -13.807 -8.007 -8.248 1.00 56.47 C ATOM 510 CE3 TRP A 37 -14.706 -10.078 -7.403 1.00 56.47 C ATOM 511 CZ2 TRP A 37 -15.066 -7.401 -8.197 1.00 56.47 C ATOM 512 CZ3 TRP A 37 -15.949 -9.471 -7.351 1.00 56.47 C ATOM 513 CH2 TRP A 37 -16.119 -8.146 -7.746 1.00 56.47 C ATOM 514 H TRP A 37 -10.937 -13.409 -7.734 1.00 46.48 H ATOM 515 HA TRP A 37 -12.617 -11.872 -9.334 1.00 46.48 H ATOM 516 HB2 TRP A 37 -12.067 -11.410 -6.929 1.00 46.48 H ATOM 517 HB3 TRP A 37 -10.530 -10.755 -7.488 1.00 46.48 H ATOM 518 HD1 TRP A 37 -10.588 -8.398 -8.755 1.00 46.48 H ATOM 519 HE1 TRP A 37 -12.421 -6.594 -8.973 1.00 46.48 H ATOM 520 HE3 TRP A 37 -14.595 -11.106 -7.092 1.00 46.48 H ATOM 521 HZ2 TRP A 37 -15.217 -6.378 -8.502 1.00 46.48 H ATOM 522 HZ3 TRP A 37 -16.803 -10.026 -6.996 1.00 46.48 H ATOM 523 HH2 TRP A 37 -17.107 -7.711 -7.686 1.00 46.48 H ATOM 524 N LYS A 38 -9.421 -11.734 -10.073 1.00 5.73 N ATOM 525 CA LYS A 38 -8.547 -11.273 -11.137 1.00 5.73 C ATOM 526 C LYS A 38 -8.966 -11.761 -12.551 1.00 5.73 C ATOM 527 O LYS A 38 -9.030 -10.958 -13.445 1.00 5.73 O ATOM 528 CB LYS A 38 -7.025 -11.544 -10.914 1.00 4.00 C ATOM 529 CG LYS A 38 -6.296 -10.587 -9.950 1.00 4.00 C ATOM 530 CD LYS A 38 -4.993 -9.956 -10.570 1.00 4.00 C ATOM 531 CE LYS A 38 -4.051 -10.993 -11.239 1.00 4.00 C ATOM 532 NZ LYS A 38 -2.599 -10.610 -11.187 1.00 4.00 N ATOM 533 H LYS A 38 -9.089 -12.349 -9.386 1.00 82.23 H ATOM 534 HA LYS A 38 -8.669 -10.199 -11.145 1.00 82.23 H ATOM 535 HB2 LYS A 38 -6.916 -12.543 -10.520 1.00 82.23 H ATOM 536 HB3 LYS A 38 -6.524 -11.496 -11.869 1.00 82.23 H ATOM 537 HG2 LYS A 38 -6.971 -9.786 -9.684 1.00 82.23 H ATOM 538 HG3 LYS A 38 -6.027 -11.135 -9.057 1.00 82.23 H ATOM 539 HD2 LYS A 38 -5.281 -9.230 -11.312 1.00 82.23 H ATOM 540 HD3 LYS A 38 -4.447 -9.456 -9.780 1.00 82.23 H ATOM 541 HE2 LYS A 38 -4.172 -11.941 -10.739 1.00 82.23 H ATOM 542 HE3 LYS A 38 -4.345 -11.100 -12.271 1.00 82.23 H ATOM 543 HZ1 LYS A 38 -2.426 -9.958 -10.397 1.00 82.23 H ATOM 544 HZ2 LYS A 38 -2.009 -11.458 -11.055 1.00 82.23 H ATOM 545 HZ3 LYS A 38 -2.320 -10.143 -12.072 1.00 82.23 H ATOM 546 N TYR A 39 -9.236 -13.042 -12.771 1.00 9.30 N ATOM 547 CA TYR A 39 -9.609 -13.547 -14.141 1.00 9.30 C ATOM 548 C TYR A 39 -11.019 -13.180 -14.528 1.00 9.30 C ATOM 549 O TYR A 39 -11.285 -12.798 -15.682 1.00 9.30 O ATOM 550 CB TYR A 39 -9.474 -15.092 -14.174 1.00 8.93 C ATOM 551 CG TYR A 39 -10.084 -15.827 -15.344 1.00 8.93 C ATOM 552 CD1 TYR A 39 -11.182 -15.320 -16.078 1.00 8.93 C ATOM 553 CD2 TYR A 39 -9.540 -17.038 -15.750 1.00 8.93 C ATOM 554 CE1 TYR A 39 -11.693 -15.983 -17.164 1.00 8.93 C ATOM 555 CE2 TYR A 39 -10.045 -17.707 -16.867 1.00 8.93 C ATOM 556 CZ TYR A 39 -11.126 -17.175 -17.579 1.00 8.93 C ATOM 557 OH TYR A 39 -11.632 -17.848 -18.704 1.00 8.93 O ATOM 558 H TYR A 39 -9.164 -13.676 -12.025 1.00 88.93 H ATOM 559 HA TYR A 39 -8.924 -13.120 -14.858 1.00 88.93 H ATOM 560 HB2 TYR A 39 -8.426 -15.345 -14.159 1.00 88.93 H ATOM 561 HB3 TYR A 39 -9.935 -15.488 -13.281 1.00 88.93 H ATOM 562 HD1 TYR A 39 -11.647 -14.413 -15.766 1.00 88.93 H ATOM 563 HD2 TYR A 39 -8.698 -17.446 -15.212 1.00 88.93 H ATOM 564 HE1 TYR A 39 -12.519 -15.562 -17.704 1.00 88.93 H ATOM 565 HE2 TYR A 39 -9.610 -18.650 -17.168 1.00 88.93 H ATOM 566 HH TYR A 39 -11.335 -18.761 -18.683 1.00 88.93 H ATOM 567 N ALA A 40 -11.924 -13.375 -13.568 1.00 11.22 N ATOM 568 CA ALA A 40 -13.308 -13.138 -13.783 1.00 11.22 C ATOM 569 C ALA A 40 -13.494 -11.678 -14.122 1.00 11.22 C ATOM 570 O ALA A 40 -14.223 -11.337 -15.042 1.00 11.22 O ATOM 571 CB ALA A 40 -14.089 -13.629 -12.580 1.00 4.00 C ATOM 572 H ALA A 40 -11.634 -13.728 -12.700 1.00 81.78 H ATOM 573 HA ALA A 40 -13.609 -13.728 -14.639 1.00 81.78 H ATOM 574 HB1 ALA A 40 -14.307 -14.682 -12.700 1.00 81.78 H ATOM 575 HB2 ALA A 40 -13.500 -13.485 -11.688 1.00 81.78 H ATOM 576 HB3 ALA A 40 -15.009 -13.077 -12.500 1.00 81.78 H ATOM 577 N LYS A 41 -12.786 -10.854 -13.403 1.00 4.00 N ATOM 578 CA LYS A 41 -12.749 -9.439 -13.648 1.00 4.00 C ATOM 579 C LYS A 41 -11.861 -9.084 -14.841 1.00 4.00 C ATOM 580 O LYS A 41 -12.171 -8.130 -15.516 1.00 4.00 O ATOM 581 CB LYS A 41 -12.322 -8.674 -12.432 1.00 94.12 C ATOM 582 CG LYS A 41 -13.212 -8.948 -11.248 1.00 94.12 C ATOM 583 CD LYS A 41 -14.535 -9.560 -11.673 1.00 94.12 C ATOM 584 CE LYS A 41 -15.211 -10.222 -10.488 1.00 94.12 C ATOM 585 NZ LYS A 41 -14.315 -11.215 -9.814 1.00 94.12 N ATOM 586 H LYS A 41 -12.199 -11.223 -12.712 1.00 84.13 H ATOM 587 HA LYS A 41 -13.758 -9.145 -13.892 1.00 84.13 H ATOM 588 HB2 LYS A 41 -11.311 -8.953 -12.179 1.00 84.13 H ATOM 589 HB3 LYS A 41 -12.358 -7.618 -12.653 1.00 84.13 H ATOM 590 HG2 LYS A 41 -12.710 -9.631 -10.580 1.00 84.13 H ATOM 591 HG3 LYS A 41 -13.407 -8.017 -10.735 1.00 84.13 H ATOM 592 HD2 LYS A 41 -15.176 -8.783 -12.061 1.00 84.13 H ATOM 593 HD3 LYS A 41 -14.356 -10.302 -12.437 1.00 84.13 H ATOM 594 HE2 LYS A 41 -15.487 -9.459 -9.776 1.00 84.13 H ATOM 595 HE3 LYS A 41 -16.099 -10.728 -10.835 1.00 84.13 H ATOM 596 HZ1 LYS A 41 -13.435 -10.752 -9.515 1.00 84.13 H ATOM 597 HZ2 LYS A 41 -14.785 -11.614 -8.975 1.00 84.13 H ATOM 598 HZ3 LYS A 41 -14.080 -11.988 -10.468 1.00 84.13 H ATOM 599 N ARG A 42 -10.690 -9.825 -15.041 1.00 9.80 N ATOM 600 CA ARG A 42 -9.631 -9.600 -16.172 1.00 9.80 C ATOM 601 C ARG A 42 -9.888 -10.060 -17.686 1.00 9.80 C ATOM 602 O ARG A 42 -9.426 -9.445 -18.665 1.00 9.80 O ATOM 603 CB ARG A 42 -8.227 -10.256 -15.861 1.00 6.30 C ATOM 604 CG ARG A 42 -7.278 -9.551 -14.895 1.00 6.30 C ATOM 605 CD ARG A 42 -6.123 -8.888 -15.667 1.00 6.30 C ATOM 606 NE ARG A 42 -5.073 -9.804 -16.144 1.00 6.30 N ATOM 607 CZ ARG A 42 -4.385 -9.620 -17.321 1.00 6.30 C ATOM 608 NH1 ARG A 42 -4.950 -8.985 -18.389 1.00 6.30 N ATOM 609 NH2 ARG A 42 -3.163 -10.146 -17.470 1.00 6.30 N ATOM 610 H ARG A 42 -10.505 -10.538 -14.396 1.00 86.30 H ATOM 611 HA ARG A 42 -9.466 -8.535 -16.194 1.00 86.30 H ATOM 612 HB2 ARG A 42 -8.405 -11.238 -15.458 1.00 86.30 H ATOM 613 HB3 ARG A 42 -7.704 -10.372 -16.800 1.00 86.30 H ATOM 614 HG2 ARG A 42 -7.820 -8.790 -14.349 1.00 86.30 H ATOM 615 HG3 ARG A 42 -6.869 -10.274 -14.205 1.00 86.30 H ATOM 616 HD2 ARG A 42 -6.534 -8.380 -16.521 1.00 86.30 H ATOM 617 HD3 ARG A 42 -5.662 -8.156 -15.014 1.00 86.30 H ATOM 618 HE ARG A 42 -4.738 -10.463 -15.501 1.00 86.30 H ATOM 619 HH11 ARG A 42 -5.886 -8.640 -18.329 1.00 86.30 H ATOM 620 HH12 ARG A 42 -4.424 -8.858 -19.231 1.00 86.30 H ATOM 621 HH21 ARG A 42 -2.751 -10.672 -16.727 1.00 86.30 H ATOM 622 HH22 ARG A 42 -2.658 -10.006 -18.323 1.00 86.30 H ATOM 623 N PHE A 43 -10.311 -11.273 -17.857 1.00 5.44 N ATOM 624 CA PHE A 43 -10.223 -11.830 -19.166 1.00 5.44 C ATOM 625 C PHE A 43 -11.157 -11.351 -20.221 1.00 5.44 C ATOM 626 O PHE A 43 -10.765 -11.347 -21.338 1.00 5.44 O ATOM 627 CB PHE A 43 -10.027 -13.350 -19.088 1.00 19.63 C ATOM 628 CG PHE A 43 -8.564 -13.716 -18.691 1.00 19.63 C ATOM 629 CD1 PHE A 43 -7.517 -13.611 -19.613 1.00 19.63 C ATOM 630 CD2 PHE A 43 -8.219 -14.088 -17.380 1.00 19.63 C ATOM 631 CE1 PHE A 43 -6.203 -13.865 -19.247 1.00 19.63 C ATOM 632 CE2 PHE A 43 -6.905 -14.348 -17.029 1.00 19.63 C ATOM 633 CZ PHE A 43 -5.904 -14.237 -17.950 1.00 19.63 C ATOM 634 H PHE A 43 -10.460 -11.857 -17.082 1.00 99.63 H ATOM 635 HA PHE A 43 -9.269 -11.462 -19.509 1.00 99.63 H ATOM 636 HB2 PHE A 43 -10.699 -13.763 -18.347 1.00 99.63 H ATOM 637 HB3 PHE A 43 -10.238 -13.791 -20.056 1.00 99.63 H ATOM 638 HD1 PHE A 43 -7.740 -13.322 -20.631 1.00 99.63 H ATOM 639 HD2 PHE A 43 -8.998 -14.178 -16.634 1.00 99.63 H ATOM 640 HE1 PHE A 43 -5.413 -13.778 -19.982 1.00 99.63 H ATOM 641 HE2 PHE A 43 -6.668 -14.637 -16.013 1.00 99.63 H ATOM 642 HZ PHE A 43 -4.881 -14.434 -17.665 1.00 99.63 H ATOM 643 N LEU A 44 -12.299 -10.915 -19.922 1.00 4.00 N ATOM 644 CA LEU A 44 -13.150 -10.404 -20.929 1.00 4.00 C ATOM 645 C LEU A 44 -12.569 -9.126 -21.605 1.00 4.00 C ATOM 646 O LEU A 44 -12.897 -8.801 -22.801 1.00 4.00 O ATOM 647 CB LEU A 44 -14.538 -10.339 -20.443 1.00 14.39 C ATOM 648 CG LEU A 44 -15.060 -11.741 -20.187 1.00 14.39 C ATOM 649 CD1 LEU A 44 -16.585 -11.789 -20.255 1.00 14.39 C ATOM 650 CD2 LEU A 44 -14.409 -12.719 -21.172 1.00 14.39 C ATOM 651 H LEU A 44 -12.581 -10.890 -18.987 1.00 94.39 H ATOM 652 HA LEU A 44 -13.133 -11.160 -21.705 1.00 94.39 H ATOM 653 HB2 LEU A 44 -14.567 -9.765 -19.527 1.00 94.39 H ATOM 654 HB3 LEU A 44 -15.159 -9.867 -21.189 1.00 94.39 H ATOM 655 HG LEU A 44 -14.767 -12.040 -19.192 1.00 94.39 H ATOM 656 HD11 LEU A 44 -16.986 -10.809 -20.041 1.00 94.39 H ATOM 657 HD12 LEU A 44 -16.894 -12.094 -21.244 1.00 94.39 H ATOM 658 HD13 LEU A 44 -16.956 -12.497 -19.527 1.00 94.39 H ATOM 659 HD21 LEU A 44 -14.492 -12.326 -22.173 1.00 94.39 H ATOM 660 HD22 LEU A 44 -13.368 -12.843 -20.920 1.00 94.39 H ATOM 661 HD23 LEU A 44 -14.910 -13.673 -21.118 1.00 94.39 H ATOM 662 N LYS A 45 -11.719 -8.400 -20.822 1.00 6.79 N ATOM 663 CA LYS A 45 -11.039 -7.125 -21.238 1.00 6.79 C ATOM 664 C LYS A 45 -10.232 -7.243 -22.594 1.00 6.79 C ATOM 665 O LYS A 45 -10.246 -6.321 -23.399 1.00 6.79 O ATOM 666 CB LYS A 45 -10.031 -6.663 -20.092 1.00 4.00 C ATOM 667 CG LYS A 45 -10.588 -5.968 -18.813 1.00 4.00 C ATOM 668 CD LYS A 45 -12.033 -6.290 -18.425 1.00 4.00 C ATOM 669 CE LYS A 45 -12.535 -5.219 -17.451 1.00 4.00 C ATOM 670 NZ LYS A 45 -14.009 -5.191 -17.285 1.00 4.00 N ATOM 671 H LYS A 45 -11.541 -8.736 -19.919 1.00 79.47 H ATOM 672 HA LYS A 45 -11.799 -6.370 -21.355 1.00 79.47 H ATOM 673 HB2 LYS A 45 -9.491 -7.533 -19.761 1.00 79.47 H ATOM 674 HB3 LYS A 45 -9.314 -5.986 -20.541 1.00 79.47 H ATOM 675 HG2 LYS A 45 -9.960 -6.248 -17.985 1.00 79.47 H ATOM 676 HG3 LYS A 45 -10.502 -4.899 -18.953 1.00 79.47 H ATOM 677 HD2 LYS A 45 -12.648 -6.292 -19.311 1.00 79.47 H ATOM 678 HD3 LYS A 45 -12.070 -7.254 -17.946 1.00 79.47 H ATOM 679 HE2 LYS A 45 -12.087 -5.397 -16.490 1.00 79.47 H ATOM 680 HE3 LYS A 45 -12.209 -4.257 -17.816 1.00 79.47 H ATOM 681 HZ1 LYS A 45 -14.466 -5.659 -18.093 1.00 79.47 H ATOM 682 HZ2 LYS A 45 -14.280 -5.678 -16.413 1.00 79.47 H ATOM 683 HZ3 LYS A 45 -14.345 -4.208 -17.235 1.00 79.47 H ATOM 684 N GLY A 46 -9.572 -8.377 -22.818 1.00 21.64 N ATOM 685 CA GLY A 46 -8.823 -8.632 -24.045 1.00 21.64 C ATOM 686 C GLY A 46 -9.708 -8.964 -25.308 1.00 21.64 C ATOM 687 O GLY A 46 -9.223 -8.675 -26.441 1.00 21.64 O ATOM 688 OXT GLY A 46 -10.838 -9.539 -25.165 1.00 4.00 O ATOM 689 H GLY A 46 -9.622 -9.082 -22.145 1.00 82.84 H ATOM 690 HA2 GLY A 46 -8.155 -9.462 -23.868 1.00 82.84 H ATOM 691 HA3 GLY A 46 -8.229 -7.756 -24.264 1.00 82.84 H