>>1HWG:HELIX    7   7 ALA A  155  SER A  184  1                                  30    
ALLKNYGLLYCFRKDMDKVETFLRIVQCRS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 7 7 ALA A 155 SER A 184 1 30 ATOM 1170 N ALA A 155 61.517 5.512 18.146 1.00 53.02 N ATOM 1171 CA ALA A 155 60.399 5.909 17.311 1.00 51.05 C ATOM 1172 C ALA A 155 59.211 6.320 18.176 1.00 49.17 C ATOM 1173 O ALA A 155 58.726 7.434 18.044 1.00 50.32 O ATOM 1174 CB ALA A 155 60.013 4.786 16.374 1.00 51.22 C ATOM 1175 N LEU A 156 58.789 5.454 19.098 1.00 46.63 N ATOM 1176 CA LEU A 156 57.643 5.746 19.968 1.00 44.82 C ATOM 1177 C LEU A 156 57.590 7.199 20.434 1.00 43.94 C ATOM 1178 O LEU A 156 56.603 7.903 20.209 1.00 44.34 O ATOM 1179 CB LEU A 156 57.620 4.789 21.172 1.00 44.77 C ATOM 1180 CG LEU A 156 56.750 5.071 22.407 1.00 43.34 C ATOM 1181 CD1 LEU A 156 56.405 3.784 23.135 1.00 46.45 C ATOM 1182 CD2 LEU A 156 57.472 6.013 23.350 1.00 44.54 C ATOM 1183 N LEU A 157 58.682 7.655 21.033 1.00 43.55 N ATOM 1184 CA LEU A 157 58.750 9.013 21.533 1.00 44.19 C ATOM 1185 C LEU A 157 58.672 10.014 20.388 1.00 43.24 C ATOM 1186 O LEU A 157 57.953 11.004 20.485 1.00 45.65 O ATOM 1187 CB LEU A 157 60.026 9.213 22.356 1.00 45.57 C ATOM 1188 CG LEU A 157 59.844 9.957 23.688 1.00 48.66 C ATOM 1189 CD1 LEU A 157 58.824 9.240 24.577 1.00 50.62 C ATOM 1190 CD2 LEU A 157 61.178 10.069 24.404 1.00 49.78 C ATOM 1191 N LYS A 158 59.369 9.734 19.290 1.00 38.49 N ATOM 1192 CA LYS A 158 59.362 10.620 18.122 1.00 35.23 C ATOM 1193 C LYS A 158 57.941 10.805 17.627 1.00 32.08 C ATOM 1194 O LYS A 158 57.523 11.912 17.292 1.00 34.35 O ATOM 1195 CB LYS A 158 60.205 10.037 16.987 1.00 34.78 C ATOM 1196 CG LYS A 158 60.132 10.825 15.680 1.00 32.67 C ATOM 1197 CD LYS A 158 60.726 10.017 14.527 1.00 40.17 C ATOM 1198 CE LYS A 158 60.647 10.780 13.213 1.00 54.54 C ATOM 1199 NZ LYS A 158 61.476 12.019 13.268 1.00 62.56 N ATOM 1200 N ASN A 159 57.204 9.709 17.573 1.00 26.21 N ATOM 1201 CA ASN A 159 55.829 9.745 17.133 1.00 23.11 C ATOM 1202 C ASN A 159 55.036 10.529 18.155 1.00 31.25 C ATOM 1203 O ASN A 159 54.247 11.407 17.801 1.00 33.50 O ATOM 1204 CB ASN A 159 55.268 8.328 17.030 1.00 36.75 C ATOM 1205 CG ASN A 159 55.662 7.630 15.737 1.00 45.58 C ATOM 1206 OD1 ASN A 159 56.495 8.118 14.973 1.00 56.79 O ATOM 1207 ND2 ASN A 159 55.061 6.475 15.492 1.00 53.45 N ATOM 1208 N TYR A 160 55.301 10.253 19.431 1.00 32.33 N ATOM 1209 CA TYR A 160 54.605 10.914 20.522 1.00 29.70 C ATOM 1210 C TYR A 160 54.847 12.412 20.559 1.00 29.19 C ATOM 1211 O TYR A 160 53.924 13.173 20.814 1.00 32.04 O ATOM 1212 CB TYR A 160 54.979 10.280 21.859 1.00 30.03 C ATOM 1213 CG TYR A 160 54.371 10.975 23.052 1.00 31.87 C ATOM 1214 CD1 TYR A 160 53.037 10.777 23.400 1.00 32.00 C ATOM 1215 CD2 TYR A 160 55.136 11.828 23.839 1.00 31.31 C ATOM 1216 CE1 TYR A 160 52.485 11.412 24.505 1.00 31.62 C ATOM 1217 CE2 TYR A 160 54.594 12.468 24.943 1.00 33.27 C ATOM 1218 CZ TYR A 160 53.275 12.256 25.269 1.00 36.79 C ATOM 1219 OH TYR A 160 52.757 12.897 26.361 1.00 46.50 O ATOM 1220 N GLY A 161 56.069 12.840 20.275 1.00 26.39 N ATOM 1221 CA GLY A 161 56.373 14.257 20.296 1.00 25.66 C ATOM 1222 C GLY A 161 55.777 14.979 19.107 1.00 27.78 C ATOM 1223 O GLY A 161 55.391 16.143 19.204 1.00 30.14 O ATOM 1224 N LEU A 162 55.714 14.277 17.980 1.00 26.88 N ATOM 1225 CA LEU A 162 55.175 14.791 16.722 1.00 24.34 C ATOM 1226 C LEU A 162 53.674 15.032 16.931 1.00 24.23 C ATOM 1227 O LEU A 162 53.134 16.105 16.654 1.00 25.60 O ATOM 1228 CB LEU A 162 55.401 13.719 15.652 1.00 22.72 C ATOM 1229 CG LEU A 162 55.864 14.036 14.234 1.00 19.56 C ATOM 1230 CD1 LEU A 162 56.753 15.245 14.194 1.00 20.44 C ATOM 1231 CD2 LEU A 162 56.593 12.831 13.696 1.00 13.64 C ATOM 1232 N LEU A 163 53.036 14.028 17.507 1.00 20.00 N ATOM 1233 CA LEU A 163 51.621 14.024 17.813 1.00 18.89 C ATOM 1234 C LEU A 163 51.258 15.057 18.906 1.00 23.79 C ATOM 1235 O LEU A 163 50.198 15.683 18.861 1.00 26.74 O ATOM 1236 CB LEU A 163 51.270 12.606 18.258 1.00 16.14 C ATOM 1237 CG LEU A 163 49.914 11.986 17.950 1.00 16.64 C ATOM 1238 CD1 LEU A 163 49.615 12.097 16.480 1.00 17.92 C ATOM 1239 CD2 LEU A 163 49.920 10.530 18.393 1.00 13.73 C ATOM 1240 N TYR A 164 52.137 15.232 19.888 1.00 21.95 N ATOM 1241 CA TYR A 164 51.921 16.177 20.987 1.00 18.66 C ATOM 1242 C TYR A 164 51.960 17.599 20.460 1.00 16.14 C ATOM 1243 O TYR A 164 51.222 18.460 20.932 1.00 21.77 O ATOM 1244 CB TYR A 164 53.013 15.970 22.052 1.00 20.27 C ATOM 1245 CG TYR A 164 53.217 17.120 23.009 1.00 24.27 C ATOM 1246 CD1 TYR A 164 52.428 17.253 24.143 1.00 26.40 C ATOM 1247 CD2 TYR A 164 54.181 18.094 22.759 1.00 22.06 C ATOM 1248 CE1 TYR A 164 52.582 18.333 25.002 1.00 33.74 C ATOM 1249 CE2 TYR A 164 54.347 19.174 23.602 1.00 22.44 C ATOM 1250 CZ TYR A 164 53.541 19.292 24.722 1.00 43.45 C ATOM 1251 OH TYR A 164 53.672 20.384 25.547 1.00 67.28 O ATOM 1252 N CYS A 165 52.852 17.847 19.504 1.00 16.18 N ATOM 1253 CA CYS A 165 53.014 19.171 18.892 1.00 17.43 C ATOM 1254 C CYS A 165 51.907 19.489 17.885 1.00 18.50 C ATOM 1255 O CYS A 165 51.512 20.645 17.746 1.00 17.19 O ATOM 1256 CB CYS A 165 54.380 19.288 18.207 1.00 19.21 C ATOM 1257 SG CYS A 165 55.794 19.009 19.312 1.00 20.89 S ATOM 1258 N PHE A 166 51.441 18.471 17.158 1.00 16.79 N ATOM 1259 CA PHE A 166 50.368 18.628 16.174 1.00 15.80 C ATOM 1260 C PHE A 166 49.128 19.176 16.886 1.00 16.73 C ATOM 1261 O PHE A 166 48.602 20.244 16.540 1.00 21.28 O ATOM 1262 CB PHE A 166 50.068 17.271 15.526 1.00 15.40 C ATOM 1263 CG PHE A 166 49.074 17.329 14.387 1.00 14.43 C ATOM 1264 CD1 PHE A 166 49.192 18.278 13.379 1.00 14.35 C ATOM 1265 CD2 PHE A 166 48.032 16.412 14.316 1.00 13.91 C ATOM 1266 CE1 PHE A 166 48.290 18.310 12.316 1.00 16.90 C ATOM 1267 CE2 PHE A 166 47.129 16.435 13.264 1.00 14.69 C ATOM 1268 CZ PHE A 166 47.253 17.385 12.259 1.00 16.45 C ATOM 1269 N ARG A 167 48.740 18.480 17.949 1.00 16.13 N ATOM 1270 CA ARG A 167 47.597 18.833 18.767 1.00 11.04 C ATOM 1271 C ARG A 167 47.688 20.255 19.257 1.00 17.45 C ATOM 1272 O ARG A 167 46.716 21.000 19.214 1.00 21.89 O ATOM 1273 CB ARG A 167 47.523 17.889 19.963 1.00 16.15 C ATOM 1274 CG ARG A 167 46.433 18.204 20.965 1.00 32.17 C ATOM 1275 CD ARG A 167 47.049 18.644 22.270 1.00 47.80 C ATOM 1276 NE ARG A 167 46.618 17.817 23.395 1.00 54.46 N ATOM 1277 CZ ARG A 167 47.312 17.662 24.521 1.00 59.07 C ATOM 1278 NH1 ARG A 167 48.485 18.267 24.676 1.00 62.14 N ATOM 1279 NH2 ARG A 167 46.808 16.947 25.520 1.00 56.24 N ATOM 1280 N LYS A 168 48.873 20.641 19.687 1.00 18.64 N ATOM 1281 CA LYS A 168 49.107 21.966 20.223 1.00 19.27 C ATOM 1282 C LYS A 168 49.002 23.057 19.167 1.00 18.32 C ATOM 1283 O LYS A 168 48.363 24.089 19.389 1.00 21.60 O ATOM 1284 CB LYS A 168 50.479 21.978 20.903 1.00 28.65 C ATOM 1285 CG LYS A 168 50.955 23.329 21.371 1.00 45.06 C ATOM 1286 CD LYS A 168 52.420 23.284 21.769 1.00 46.50 C ATOM 1287 CE LYS A 168 52.635 22.428 23.005 1.00 54.41 C ATOM 1288 NZ LYS A 168 54.003 22.629 23.580 1.00 64.35 N ATOM 1289 N ASP A 169 49.604 22.818 18.007 1.00 17.68 N ATOM 1290 CA ASP A 169 49.595 23.799 16.922 1.00 19.32 C ATOM 1291 C ASP A 169 48.210 23.973 16.311 1.00 17.80 C ATOM 1292 O ASP A 169 47.863 25.051 15.835 1.00 19.37 O ATOM 1293 CB ASP A 169 50.606 23.419 15.829 1.00 20.32 C ATOM 1294 CG ASP A 169 52.051 23.504 16.294 1.00 18.59 C ATOM 1295 OD1 ASP A 169 52.363 24.189 17.300 1.00 20.11 O ATOM 1296 OD2 ASP A 169 52.891 22.883 15.618 1.00 28.28 O ATOM 1297 N MET A 170 47.430 22.902 16.296 1.00 12.45 N ATOM 1298 CA MET A 170 46.079 22.972 15.759 1.00 12.84 C ATOM 1299 C MET A 170 45.186 23.764 16.727 1.00 13.90 C ATOM 1300 O MET A 170 44.237 24.436 16.320 1.00 17.85 O ATOM 1301 CB MET A 170 45.554 21.564 15.527 1.00 10.97 C ATOM 1302 CG MET A 170 46.306 20.834 14.435 1.00 12.82 C ATOM 1303 SD MET A 170 46.228 21.679 12.848 1.00 13.64 S ATOM 1304 CE MET A 170 47.844 22.384 12.665 1.00 16.01 C ATOM 1305 N ASP A 171 45.537 23.709 18.009 1.00 11.49 N ATOM 1306 CA ASP A 171 44.821 24.424 19.050 1.00 9.10 C ATOM 1307 C ASP A 171 45.116 25.897 18.852 1.00 11.90 C ATOM 1308 O ASP A 171 44.214 26.722 18.928 1.00 15.16 O ATOM 1309 CB ASP A 171 45.303 23.969 20.437 1.00 17.59 C ATOM 1310 CG ASP A 171 44.472 24.552 21.603 1.00 32.25 C ATOM 1311 OD1 ASP A 171 43.587 25.408 21.391 1.00 37.53 O ATOM 1312 OD2 ASP A 171 44.715 24.136 22.756 1.00 37.38 O ATOM 1313 N LYS A 172 46.375 26.235 18.601 1.00 16.34 N ATOM 1314 CA LYS A 172 46.729 27.628 18.395 1.00 16.87 C ATOM 1315 C LYS A 172 45.967 28.200 17.205 1.00 19.49 C ATOM 1316 O LYS A 172 45.388 29.286 17.293 1.00 21.37 O ATOM 1317 CB LYS A 172 48.231 27.781 18.197 1.00 16.37 C ATOM 1318 CG LYS A 172 49.028 27.364 19.395 1.00 11.10 C ATOM 1319 CD LYS A 172 50.498 27.538 19.143 1.00 20.66 C ATOM 1320 CE LYS A 172 51.306 27.095 20.327 1.00 14.75 C ATOM 1321 NZ LYS A 172 52.710 26.927 19.906 1.00 42.83 N ATOM 1322 N VAL A 173 45.944 27.447 16.110 1.00 18.80 N ATOM 1323 CA VAL A 173 45.253 27.852 14.887 1.00 14.49 C ATOM 1324 C VAL A 173 43.769 28.091 15.163 1.00 14.63 C ATOM 1325 O VAL A 173 43.268 29.194 14.973 1.00 16.83 O ATOM 1326 CB VAL A 173 45.402 26.760 13.784 1.00 13.28 C ATOM 1327 CG1 VAL A 173 44.557 27.102 12.552 1.00 14.02 C ATOM 1328 CG2 VAL A 173 46.859 26.598 13.400 1.00 13.05 C ATOM 1329 N GLU A 174 43.065 27.074 15.641 1.00 12.58 N ATOM 1330 CA GLU A 174 41.644 27.237 15.913 1.00 11.88 C ATOM 1331 C GLU A 174 41.386 28.426 16.816 1.00 12.61 C ATOM 1332 O GLU A 174 40.458 29.184 16.590 1.00 13.68 O ATOM 1333 CB GLU A 174 41.074 25.971 16.547 1.00 10.23 C ATOM 1334 CG GLU A 174 39.594 26.058 16.907 1.00 5.34 C ATOM 1335 CD GLU A 174 38.996 24.711 17.252 1.00 15.06 C ATOM 1336 OE1 GLU A 174 39.738 23.829 17.712 1.00 19.73 O ATOM 1337 OE2 GLU A 174 37.772 24.532 17.071 1.00 34.58 O ATOM 1338 N THR A 175 42.248 28.615 17.808 1.00 13.57 N ATOM 1339 CA THR A 175 42.111 29.706 18.772 1.00 7.63 C ATOM 1340 C THR A 175 42.381 31.047 18.139 1.00 15.85 C ATOM 1341 O THR A 175 41.640 31.989 18.361 1.00 19.47 O ATOM 1342 CB THR A 175 43.075 29.520 19.947 1.00 2.14 C ATOM 1343 OG1 THR A 175 42.801 28.265 20.574 1.00 12.25 O ATOM 1344 CG2 THR A 175 42.915 30.626 20.967 1.00 2.16 C ATOM 1345 N PHE A 176 43.425 31.124 17.324 1.00 13.00 N ATOM 1346 CA PHE A 176 43.796 32.372 16.678 1.00 11.89 C ATOM 1347 C PHE A 176 42.784 32.805 15.644 1.00 12.42 C ATOM 1348 O PHE A 176 42.460 33.983 15.552 1.00 16.10 O ATOM 1349 CB PHE A 176 45.191 32.267 16.068 1.00 13.95 C ATOM 1350 CG PHE A 176 46.292 32.158 17.084 1.00 16.34 C ATOM 1351 CD1 PHE A 176 46.060 32.449 18.425 1.00 20.39 C ATOM 1352 CD2 PHE A 176 47.570 31.798 16.700 1.00 19.87 C ATOM 1353 CE1 PHE A 176 47.086 32.396 19.363 1.00 20.92 C ATOM 1354 CE2 PHE A 176 48.603 31.740 17.635 1.00 22.24 C ATOM 1355 CZ PHE A 176 48.353 32.041 18.972 1.00 22.14 C ATOM 1356 N LEU A 177 42.262 31.868 14.868 1.00 10.68 N ATOM 1357 CA LEU A 177 41.266 32.237 13.882 1.00 10.31 C ATOM 1358 C LEU A 177 40.007 32.767 14.604 1.00 11.62 C ATOM 1359 O LEU A 177 39.471 33.822 14.255 1.00 17.32 O ATOM 1360 CB LEU A 177 40.941 31.043 12.993 1.00 12.99 C ATOM 1361 CG LEU A 177 41.989 30.579 11.986 1.00 15.38 C ATOM 1362 CD1 LEU A 177 41.434 29.399 11.231 1.00 16.40 C ATOM 1363 CD2 LEU A 177 42.324 31.704 11.027 1.00 21.82 C ATOM 1364 N ARG A 178 39.556 32.054 15.628 1.00 11.18 N ATOM 1365 CA ARG A 178 38.394 32.465 16.424 1.00 14.48 C ATOM 1366 C ARG A 178 38.525 33.933 16.857 1.00 18.39 C ATOM 1367 O ARG A 178 37.640 34.741 16.580 1.00 20.47 O ATOM 1368 CB ARG A 178 38.277 31.558 17.648 1.00 16.72 C ATOM 1369 CG ARG A 178 36.983 31.673 18.415 1.00 13.36 C ATOM 1370 CD ARG A 178 35.800 31.260 17.593 1.00 19.07 C ATOM 1371 NE ARG A 178 34.551 31.522 18.292 1.00 24.93 N ATOM 1372 CZ ARG A 178 33.353 31.172 17.840 1.00 35.84 C ATOM 1373 NH1 ARG A 178 33.229 30.536 16.680 1.00 69.15 N ATOM 1374 NH2 ARG A 178 32.276 31.458 18.549 1.00 31.90 N ATOM 1375 N ILE A 179 39.645 34.292 17.480 1.00 16.77 N ATOM 1376 CA ILE A 179 39.891 35.676 17.922 1.00 17.47 C ATOM 1377 C ILE A 179 39.648 36.673 16.801 1.00 17.21 C ATOM 1378 O ILE A 179 39.092 37.729 17.029 1.00 19.20 O ATOM 1379 CB ILE A 179 41.350 35.878 18.426 1.00 17.46 C ATOM 1380 CG1 ILE A 179 41.615 35.076 19.710 1.00 15.42 C ATOM 1381 CG2 ILE A 179 41.644 37.350 18.628 1.00 15.77 C ATOM 1382 CD1 ILE A 179 40.954 35.621 20.925 1.00 20.56 C ATOM 1383 N VAL A 180 40.109 36.351 15.595 1.00 18.92 N ATOM 1384 CA VAL A 180 39.926 37.227 14.433 1.00 16.04 C ATOM 1385 C VAL A 180 38.441 37.224 14.002 1.00 18.74 C ATOM 1386 O VAL A 180 37.883 38.267 13.654 1.00 20.73 O ATOM 1387 CB VAL A 180 40.846 36.810 13.252 1.00 14.34 C ATOM 1388 CG1 VAL A 180 40.689 37.765 12.109 1.00 15.84 C ATOM 1389 CG2 VAL A 180 42.279 36.825 13.688 1.00 13.39 C ATOM 1390 N GLN A 181 37.788 36.069 14.078 1.00 15.91 N ATOM 1391 CA GLN A 181 36.376 35.973 13.715 1.00 13.31 C ATOM 1392 C GLN A 181 35.529 36.899 14.556 1.00 15.38 C ATOM 1393 O GLN A 181 34.786 37.709 14.027 1.00 17.77 O ATOM 1394 CB GLN A 181 35.847 34.555 13.887 1.00 10.36 C ATOM 1395 CG GLN A 181 34.340 34.442 13.620 1.00 4.81 C ATOM 1396 CD GLN A 181 33.844 33.003 13.714 1.00 21.82 C ATOM 1397 OE1 GLN A 181 32.861 32.623 13.071 1.00 28.74 O ATOM 1398 NE2 GLN A 181 34.530 32.192 14.511 1.00 5.96 N ATOM 1399 N CYS A 182 35.643 36.782 15.871 1.00 18.46 N ATOM 1400 CA CYS A 182 34.861 37.627 16.754 1.00 17.74 C ATOM 1401 C CYS A 182 35.061 39.119 16.498 1.00 22.60 C ATOM 1402 O CYS A 182 34.109 39.894 16.613 1.00 25.31 O ATOM 1403 CB CYS A 182 35.159 37.282 18.197 1.00 18.33 C ATOM 1404 SG CYS A 182 34.927 35.525 18.525 1.00 17.86 S ATOM 1405 N ARG A 183 36.282 39.517 16.130 1.00 23.19 N ATOM 1406 CA ARG A 183 36.610 40.926 15.843 1.00 25.96 C ATOM 1407 C ARG A 183 36.060 41.419 14.499 1.00 34.01 C ATOM 1408 O ARG A 183 35.726 42.597 14.353 1.00 37.70 O ATOM 1409 CB ARG A 183 38.129 41.143 15.758 1.00 16.09 C ATOM 1410 CG ARG A 183 38.969 41.029 17.002 1.00 17.53 C ATOM 1411 CD ARG A 183 40.424 41.003 16.574 1.00 15.17 C ATOM 1412 NE ARG A 183 41.350 41.024 17.693 1.00 31.41 N ATOM 1413 CZ ARG A 183 42.660 41.213 17.581 1.00 37.40 C ATOM 1414 NH1 ARG A 183 43.220 41.390 16.395 1.00 23.20 N ATOM 1415 NH2 ARG A 183 43.401 41.293 18.670 1.00 45.86 N ATOM 1416 N SER A 184 36.100 40.544 13.495 1.00 35.26 N ATOM 1417 CA SER A 184 35.666 40.875 12.140 1.00 34.42 C ATOM 1418 C SER A 184 34.202 40.596 11.846 1.00 36.31 C ATOM 1419 O SER A 184 33.506 41.421 11.265 1.00 37.64 O ATOM 1420 CB SER A 184 36.525 40.110 11.146 1.00 32.01 C ATOM 1421 OG SER A 184 37.891 40.295 11.453 1.00 40.37 O