ITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Search OCA for entries with sequence similar to this one (with E=10)

ATOM 86 N ILE A 996 -3.382 30.203 6.295 1.00 25.54 N ATOM 87 CA ILE A 996 -3.010 29.812 7.648 1.00 25.22 C ATOM 88 C ILE A 996 -3.826 30.456 8.764 1.00 25.76 C ATOM 89 O ILE A 996 -3.983 31.673 8.814 1.00 26.46 O ATOM 90 CB ILE A 996 -1.524 30.119 7.907 1.00 25.99 C ATOM 91 CG1 ILE A 996 -0.675 29.599 6.744 1.00 26.58 C ATOM 92 CG2 ILE A 996 -1.080 29.486 9.213 1.00 24.17 C ATOM 93 CD1 ILE A 996 -0.809 28.112 6.495 1.00 28.00 C ATOM 94 N THR A 997 -4.336 29.622 9.663 1.00 25.75 N ATOM 95 CA THR A 997 -5.124 30.090 10.798 1.00 25.33 C ATOM 96 C THR A 997 -4.437 29.622 12.072 1.00 24.91 C ATOM 97 O THR A 997 -4.257 28.421 12.265 1.00 27.12 O ATOM 98 CB THR A 997 -6.550 29.503 10.772 1.00 26.55 C ATOM 99 OG1 THR A 997 -7.224 29.931 9.585 1.00 28.34 O ATOM 100 CG2 THR A 997 -7.339 29.974 11.975 1.00 30.17 C ATOM 101 N LEU A 998 -4.052 30.561 12.934 1.00 23.58 N ATOM 102 CA LEU A 998 -3.388 30.219 14.193 1.00 21.42 C ATOM 103 C LEU A 998 -4.433 30.011 15.279 1.00 21.90 C ATOM 104 O LEU A 998 -5.390 30.779 15.380 1.00 23.92 O ATOM 105 CB LEU A 998 -2.403 31.323 14.598 1.00 20.42 C ATOM 106 CG LEU A 998 -1.272 31.630 13.602 1.00 19.08 C ATOM 107 CD1 LEU A 998 -0.320 32.661 14.191 1.00 16.00 C ATOM 108 CD2 LEU A 998 -0.516 30.354 13.265 1.00 18.45 C ATOM 109 N LEU A 999 -4.245 28.975 16.089 1.00 21.29 N ATOM 110 CA LEU A 999 -5.196 28.630 17.142 1.00 23.09 C ATOM 111 C LEU A 999 -4.742 28.856 18.582 1.00 23.95 C ATOM 112 O LEU A 999 -5.520 29.332 19.407 1.00 24.32 O ATOM 113 CB LEU A 999 -5.604 27.162 16.986 1.00 23.83 C ATOM 114 CG LEU A 999 -6.294 26.810 15.667 1.00 26.11 C ATOM 115 CD1 LEU A 999 -6.337 25.305 15.476 1.00 25.29 C ATOM 116 CD2 LEU A 999 -7.695 27.396 15.665 1.00 24.84 C ATOM 117 N ARG A1000 -3.496 28.505 18.884 1.00 24.16 N ATOM 118 CA ARG A1000 -2.965 28.658 20.234 1.00 25.73 C ATOM 119 C ARG A1000 -1.459 28.454 20.294 1.00 24.06 C ATOM 120 O ARG A1000 -0.867 27.874 19.393 1.00 24.84 O ATOM 121 CB ARG A1000 -3.646 27.664 21.175 1.00 27.99 C ATOM 122 CG ARG A1000 -3.669 26.240 20.655 1.00 34.47 C ATOM 123 CD ARG A1000 -4.433 25.336 21.598 1.00 39.25 C ATOM 124 NE ARG A1000 -3.681 25.097 22.822 1.00 46.73 N ATOM 125 CZ ARG A1000 -2.687 24.219 22.925 1.00 50.58 C ATOM 126 NH1 ARG A1000 -2.330 23.491 21.875 1.00 50.92 N ATOM 127 NH2 ARG A1000 -2.042 24.072 24.077 1.00 51.34 N ATOM 128 N GLU A1001 -0.834 28.934 21.361 1.00 23.29 N ATOM 129 CA GLU A1001 0.604 28.772 21.505 1.00 23.12 C ATOM 130 C GLU A1001 0.947 27.327 21.840 1.00 22.24 C ATOM 131 O GLU A1001 0.247 26.674 22.617 1.00 21.03 O ATOM 132 CB GLU A1001 1.142 29.701 22.594 1.00 24.21 C ATOM 133 CG GLU A1001 1.132 31.173 22.200 1.00 27.70 C ATOM 134 CD GLU A1001 1.724 32.082 23.264 1.00 28.05 C ATOM 135 OE1 GLU A1001 1.847 33.298 23.002 1.00 29.99 O ATOM 136 OE2 GLU A1001 2.065 31.584 24.358 1.00 28.86 O ATOM 137 N LEU A1002 2.024 26.829 21.240 1.00 21.57 N ATOM 138 CA LEU A1002 2.472 25.467 21.494 1.00 22.44 C ATOM 139 C LEU A1002 3.768 25.456 22.298 1.00 23.42 C ATOM 140 O LEU A1002 3.994 24.555 23.105 1.00 25.19 O ATOM 141 CB LEU A1002 2.680 24.709 20.182 1.00 19.78 C ATOM 142 CG LEU A1002 1.423 24.223 19.457 1.00 19.45 C ATOM 143 CD1 LEU A1002 1.825 23.432 18.218 1.00 18.33 C ATOM 144 CD2 LEU A1002 0.593 23.358 20.391 1.00 15.58 C ATOM 145 N GLY A1003 4.615 26.455 22.080 1.00 24.06 N ATOM 146 CA GLY A1003 5.874 26.516 22.799 1.00 25.13 C ATOM 147 C GLY A1003 6.867 27.474 22.170 1.00 25.64 C ATOM 148 O GLY A1003 6.660 27.966 21.065 1.00 24.09 O ATOM 149 N GLN A1004 7.957 27.733 22.879 1.00 27.29 N ATOM 150 CA GLN A1004 8.983 28.638 22.393 1.00 28.31 C ATOM 151 C GLN A1004 10.087 27.951 21.604 1.00 29.37 C ATOM 152 O GLN A1004 10.696 26.983 22.066 1.00 29.62 O ATOM 153 CB GLN A1004 9.604 29.403 23.562 1.00 30.81 C ATOM 154 CG GLN A1004 9.090 30.829 23.696 1.00 34.59 C ATOM 155 CD GLN A1004 9.589 31.724 22.576 1.00 36.31 C ATOM 156 OE1 GLN A1004 9.098 32.839 22.382 1.00 37.41 O ATOM 157 NE2 GLN A1004 10.579 31.238 21.836 1.00 36.54 N ATOM 158 N GLY A1005 10.329 28.463 20.401 1.00 29.20 N ATOM 159 CA GLY A1005 11.383 27.938 19.558 1.00 27.45 C ATOM 160 C GLY A1005 12.557 28.872 19.765 1.00 27.93 C ATOM 161 O GLY A1005 12.413 29.896 20.435 1.00 24.94 O ATOM 162 N SER A1006 13.715 28.548 19.206 1.00 28.06 N ATOM 163 CA SER A1006 14.875 29.409 19.391 1.00 28.59 C ATOM 164 C SER A1006 14.718 30.725 18.639 1.00 27.02 C ATOM 165 O SER A1006 15.365 31.713 18.968 1.00 27.23 O ATOM 166 CB SER A1006 16.145 28.700 18.926 1.00 30.34 C ATOM 167 OG SER A1006 16.119 28.502 17.527 1.00 35.22 O ATOM 168 N PHE A1007 13.855 30.736 17.630 1.00 25.61 N ATOM 169 CA PHE A1007 13.630 31.941 16.838 1.00 22.48 C ATOM 170 C PHE A1007 12.365 32.660 17.275 1.00 21.64 C ATOM 171 O PHE A1007 12.193 33.853 17.014 1.00 21.83 O ATOM 172 CB PHE A1007 13.507 31.587 15.359 1.00 21.11 C ATOM 173 CG PHE A1007 14.807 31.228 14.709 1.00 23.34 C ATOM 174 CD1 PHE A1007 15.720 32.217 14.360 1.00 25.61 C ATOM 175 CD2 PHE A1007 15.113 29.901 14.424 1.00 22.94 C ATOM 176 CE1 PHE A1007 16.920 31.891 13.731 1.00 26.34 C ATOM 177 CE2 PHE A1007 16.304 29.564 13.798 1.00 23.67 C ATOM 178 CZ PHE A1007 17.212 30.560 13.449 1.00 25.53 C ATOM 179 N GLY A1008 11.474 31.935 17.936 1.00 18.81 N ATOM 180 CA GLY A1008 10.239 32.555 18.365 1.00 18.61 C ATOM 181 C GLY A1008 9.166 31.566 18.747 1.00 18.95 C ATOM 182 O GLY A1008 9.388 30.355 18.788 1.00 16.73 O ATOM 183 N MET A1009 7.987 32.098 19.035 1.00 20.70 N ATOM 184 CA MET A1009 6.863 31.271 19.437 1.00 21.95 C ATOM 185 C MET A1009 6.404 30.344 18.319 1.00 21.17 C ATOM 186 O MET A1009 6.396 30.712 17.144 1.00 19.42 O ATOM 187 CB MET A1009 5.695 32.159 19.876 1.00 24.69 C ATOM 188 CG MET A1009 4.499 31.402 20.424 1.00 28.49 C ATOM 189 SD MET A1009 4.899 30.481 21.924 1.00 35.20 S ATOM 190 CE MET A1009 5.034 31.801 23.111 1.00 32.72 C ATOM 191 N VAL A1010 6.028 29.134 18.708 1.00 21.26 N ATOM 192 CA VAL A1010 5.522 28.139 17.779 1.00 20.28 C ATOM 193 C VAL A1010 4.050 27.978 18.126 1.00 21.47 C ATOM 194 O VAL A1010 3.707 27.824 19.302 1.00 19.26 O ATOM 195 CB VAL A1010 6.223 26.787 17.965 1.00 19.60 C ATOM 196 CG1 VAL A1010 5.593 25.752 17.049 1.00 15.37 C ATOM 197 CG2 VAL A1010 7.713 26.932 17.676 1.00 17.49 C ATOM 198 N TYR A1011 3.184 28.018 17.114 1.00 21.54 N ATOM 199 CA TYR A1011 1.748 27.887 17.350 1.00 21.33 C ATOM 200 C TYR A1011 1.116 26.692 16.664 1.00 21.50 C ATOM 201 O TYR A1011 1.659 26.150 15.700 1.00 22.59 O ATOM 202 CB TYR A1011 0.987 29.114 16.846 1.00 21.65 C ATOM 203 CG TYR A1011 1.466 30.446 17.358 1.00 23.41 C ATOM 204 CD1 TYR A1011 2.605 31.052 16.825 1.00 23.17 C ATOM 205 CD2 TYR A1011 0.768 31.114 18.364 1.00 22.97 C ATOM 206 CE1 TYR A1011 3.036 32.293 17.283 1.00 26.35 C ATOM 207 CE2 TYR A1011 1.189 32.350 18.829 1.00 26.50 C ATOM 208 CZ TYR A1011 2.322 32.936 18.287 1.00 27.80 C ATOM 209 OH TYR A1011 2.742 34.157 18.761 1.00 31.13 O ATOM 210 N GLU A1012 -0.042 26.289 17.177 1.00 19.46 N ATOM 211 CA GLU A1012 -0.807 25.224 16.558 1.00 19.51 C ATOM 212 C GLU A1012 -1.751 25.983 15.631 1.00 18.12 C ATOM 213 O GLU A1012 -2.288 27.028 16.006 1.00 14.69 O ATOM 214 CB GLU A1012 -1.647 24.452 17.575 1.00 22.33 C ATOM 215 CG GLU A1012 -2.493 23.372 16.909 1.00 26.11 C ATOM 216 CD GLU A1012 -3.388 22.629 17.874 1.00 29.28 C ATOM 217 OE1 GLU A1012 -3.025 22.525 19.062 1.00 33.88 O ATOM 218 OE2 GLU A1012 -4.446 22.128 17.441 1.00 29.78 O ATOM 219 N GLY A1013 -1.959 25.474 14.426 1.00 17.97 N ATOM 220 CA GLY A1013 -2.857 26.161 13.523 1.00 17.25 C ATOM 221 C GLY A1013 -3.487 25.212 12.534 1.00 17.85 C ATOM 222 O GLY A1013 -3.342 23.994 12.654 1.00 17.05 O ATOM 223 N ASN A1014 -4.207 25.782 11.571 1.00 18.45 N ATOM 224 CA ASN A1014 -4.844 25.020 10.507 1.00 19.45 C ATOM 225 C ASN A1014 -4.446 25.622 9.161 1.00 18.77 C ATOM 226 O ASN A1014 -4.370 26.842 9.005 1.00 17.23 O ATOM 227 CB ASN A1014 -6.366 25.042 10.652 1.00 22.90 C ATOM 228 CG ASN A1014 -6.881 23.896 11.487 1.00 28.02 C ATOM 229 OD1 ASN A1014 -6.643 22.732 11.170 1.00 31.47 O ATOM 230 ND2 ASN A1014 -7.592 24.216 12.563 1.00 31.18 N ATOM 231 N ALA A1015 -4.189 24.760 8.190 1.00 18.33 N ATOM 232 CA ALA A1015 -3.810 25.221 6.867 1.00 19.32 C ATOM 233 C ALA A1015 -4.808 24.728 5.818 1.00 19.89 C ATOM 234 O ALA A1015 -5.105 23.535 5.714 1.00 19.63 O ATOM 235 CB ALA A1015 -2.400 24.746 6.531 1.00 17.06 C ATOM 236 N ARG A1016 -5.324 25.671 5.043 1.00 22.91 N ATOM 237 CA ARG A1016 -6.290 25.376 3.999 1.00 25.26 C ATOM 238 C ARG A1016 -5.583 24.886 2.738 1.00 23.67 C ATOM 239 O ARG A1016 -4.683 25.548 2.225 1.00 22.78 O ATOM 240 CB ARG A1016 -7.086 26.642 3.692 1.00 30.55 C ATOM 241 CG ARG A1016 -8.248 26.482 2.716 1.00 38.16 C ATOM 242 CD ARG A1016 -8.834 27.854 2.402 1.00 42.77 C ATOM 243 NE ARG A1016 -8.990 28.634 3.627 1.00 49.27 N ATOM 244 CZ ARG A1016 -8.792 29.946 3.716 1.00 52.95 C ATOM 245 NH1 ARG A1016 -8.431 30.648 2.643 1.00 52.52 N ATOM 246 NH2 ARG A1016 -8.927 30.553 4.891 1.00 53.54 N ATOM 247 N ASP A1017 -5.997 23.719 2.253 1.00 23.28 N ATOM 248 CA ASP A1017 -5.448 23.122 1.035 1.00 22.50 C ATOM 249 C ASP A1017 -3.941 23.218 0.924 1.00 21.78 C ATOM 250 O ASP A1017 -3.424 23.822 -0.017 1.00 22.43 O ATOM 251 CB ASP A1017 -6.069 23.777 -0.206 1.00 21.06 C ATOM 252 CG ASP A1017 -7.575 23.686 -0.216 1.00 20.17 C ATOM 253 OD1 ASP A1017 -8.092 22.571 -0.014 1.00 19.48 O ATOM 254 OD2 ASP A1017 -8.239 24.721 -0.427 1.00 20.82 O ATOM 255 N ILE A1018 -3.233 22.625 1.875 1.00 22.79 N ATOM 256 CA ILE A1018 -1.778 22.662 1.839 1.00 23.80 C ATOM 257 C ILE A1018 -1.273 21.288 1.377 1.00 22.62 C ATOM 258 O ILE A1018 -0.201 21.167 0.779 1.00 22.18 O ATOM 259 CB ILE A1018 -1.207 23.037 3.237 1.00 24.61 C ATOM 260 CG1 ILE A1018 0.235 23.513 3.102 1.00 25.66 C ATOM 261 CG2 ILE A1018 -1.276 21.848 4.184 1.00 26.32 C ATOM 262 CD1 ILE A1018 0.857 23.917 4.419 1.00 28.61 C ATOM 263 N ILE A1019 -2.069 20.261 1.656 1.00 21.30 N ATOM 264 CA ILE A1019 -1.744 18.894 1.273 1.00 20.62 C ATOM 265 C ILE A1019 -2.826 18.388 0.330 1.00 20.99 C ATOM 266 O ILE A1019 -4.008 18.376 0.678 1.00 20.69 O ATOM 267 CB ILE A1019 -1.682 17.965 2.512 1.00 20.25 C ATOM 268 CG1 ILE A1019 -0.418 18.263 3.328 1.00 19.81 C ATOM 269 CG2 ILE A1019 -1.729 16.501 2.080 1.00 19.99 C ATOM 270 CD1 ILE A1019 -0.288 17.416 4.593 1.00 17.62 C ATOM 271 N LYS A1020 -2.423 17.974 -0.864 1.00 20.98 N ATOM 272 CA LYS A1020 -3.376 17.465 -1.835 1.00 21.67 C ATOM 273 C LYS A1020 -4.169 16.338 -1.202 1.00 22.34 C ATOM 274 O LYS A1020 -3.617 15.489 -0.508 1.00 23.59 O ATOM 275 CB LYS A1020 -2.653 16.948 -3.078 1.00 22.89 C ATOM 276 CG LYS A1020 -3.596 16.408 -4.138 1.00 25.49 C ATOM 277 CD LYS A1020 -2.865 16.044 -5.420 1.00 26.32 C ATOM 278 CE LYS A1020 -3.825 15.456 -6.440 1.00 27.24 C ATOM 279 NZ LYS A1020 -3.151 15.136 -7.727 1.00 29.00 N ATOM 280 N GLY A1021 -5.471 16.330 -1.433 1.00 23.43 N ATOM 281 CA GLY A1021 -6.286 15.278 -0.862 1.00 23.35 C ATOM 282 C GLY A1021 -7.009 15.681 0.405 1.00 24.85 C ATOM 283 O GLY A1021 -7.911 14.976 0.845 1.00 26.47 O ATOM 284 N GLU A1022 -6.624 16.794 1.017 1.00 25.15 N ATOM 285 CA GLU A1022 -7.318 17.208 2.225 1.00 26.18 C ATOM 286 C GLU A1022 -7.583 18.699 2.294 1.00 25.21 C ATOM 287 O GLU A1022 -6.708 19.522 2.027 1.00 25.36 O ATOM 288 CB GLU A1022 -6.585 16.708 3.480 1.00 28.19 C ATOM 289 CG GLU A1022 -5.147 17.128 3.640 1.00 33.35 C ATOM 290 CD GLU A1022 -4.450 16.345 4.747 1.00 36.68 C ATOM 291 OE1 GLU A1022 -4.038 15.190 4.496 1.00 36.85 O ATOM 292 OE2 GLU A1022 -4.330 16.878 5.873 1.00 35.93 O ATOM 293 N ALA A1023 -8.822 19.020 2.653 1.00 24.66 N ATOM 294 CA ALA A1023 -9.302 20.388 2.757 1.00 23.12 C ATOM 295 C ALA A1023 -8.471 21.228 3.709 1.00 22.49 C ATOM 296 O ALA A1023 -8.053 22.328 3.371 1.00 21.35 O ATOM 297 CB ALA A1023 -10.756 20.382 3.196 1.00 23.51 C ATOM 298 N GLU A1024 -8.234 20.716 4.905 1.00 24.32 N ATOM 299 CA GLU A1024 -7.436 21.463 5.857 1.00 26.39 C ATOM 300 C GLU A1024 -6.580 20.530 6.700 1.00 24.33 C ATOM 301 O GLU A1024 -7.027 19.461 7.122 1.00 22.48 O ATOM 302 CB GLU A1024 -8.337 22.317 6.746 1.00 31.51 C ATOM 303 CG GLU A1024 -9.169 21.535 7.736 1.00 39.27 C ATOM 304 CD GLU A1024 -9.990 22.445 8.629 1.00 44.13 C ATOM 305 OE1 GLU A1024 -10.954 23.056 8.116 1.00 46.68 O ATOM 306 OE2 GLU A1024 -9.665 22.555 9.835 1.00 44.62 O ATOM 307 N THR A1025 -5.343 20.946 6.940 1.00 21.13 N ATOM 308 CA THR A1025 -4.402 20.153 7.715 1.00 20.67 C ATOM 309 C THR A1025 -4.040 20.842 9.023 1.00 20.18 C ATOM 310 O THR A1025 -3.825 22.058 9.050 1.00 22.06 O ATOM 311 CB THR A1025 -3.089 19.924 6.921 1.00 21.63 C ATOM 312 OG1 THR A1025 -3.393 19.342 5.646 1.00 21.86 O ATOM 313 CG2 THR A1025 -2.139 19.012 7.699 1.00 19.50 C ATOM 314 N ARG A1026 -3.973 20.070 10.104 1.00 18.70 N ATOM 315 CA ARG A1026 -3.584 20.622 11.401 1.00 17.93 C ATOM 316 C ARG A1026 -2.081 20.846 11.270 1.00 14.80 C ATOM 317 O ARG A1026 -1.369 19.984 10.767 1.00 14.58 O ATOM 318 CB ARG A1026 -3.855 19.621 12.522 1.00 18.62 C ATOM 319 CG ARG A1026 -5.278 19.088 12.566 1.00 21.11 C ATOM 320 CD ARG A1026 -5.438 18.157 13.759 1.00 24.73 C ATOM 321 NE ARG A1026 -5.129 18.848 15.012 1.00 27.90 N ATOM 322 CZ ARG A1026 -4.905 18.241 16.175 1.00 28.62 C ATOM 323 NH1 ARG A1026 -4.949 16.914 16.251 1.00 27.78 N ATOM 324 NH2 ARG A1026 -4.637 18.963 17.261 1.00 24.25 N ATOM 325 N VAL A1027 -1.594 21.993 11.713 1.00 12.66 N ATOM 326 CA VAL A1027 -0.174 22.275 11.575 1.00 11.89 C ATOM 327 C VAL A1027 0.437 23.023 12.751 1.00 11.89 C ATOM 328 O VAL A1027 -0.269 23.567 13.604 1.00 9.39 O ATOM 329 CB VAL A1027 0.100 23.124 10.302 1.00 9.52 C ATOM 330 CG1 VAL A1027 -0.300 22.368 9.069 1.00 9.86 C ATOM 331 CG2 VAL A1027 -0.681 24.424 10.371 1.00 9.69 C ATOM 332 N ALA A1028 1.768 23.029 12.771 1.00 11.73 N ATOM 333 CA ALA A1028 2.550 23.742 13.768 1.00 11.31 C ATOM 334 C ALA A1028 3.105 24.895 12.944 1.00 13.34 C ATOM 335 O ALA A1028 3.548 24.693 11.809 1.00 13.85 O ATOM 336 CB ALA A1028 3.674 22.882 14.281 1.00 10.82 C ATOM 337 N VAL A1029 3.078 26.099 13.499 1.00 13.16 N ATOM 338 CA VAL A1029 3.551 27.258 12.765 1.00 12.77 C ATOM 339 C VAL A1029 4.633 27.993 13.541 1.00 12.92 C ATOM 340 O VAL A1029 4.384 28.519 14.624 1.00 14.56 O ATOM 341 CB VAL A1029 2.371 28.217 12.449 1.00 12.83 C ATOM 342 CG1 VAL A1029 2.841 29.366 11.555 1.00 13.06 C ATOM 343 CG2 VAL A1029 1.248 27.451 11.760 1.00 8.60 C ATOM 344 N LYS A1030 5.837 28.018 12.977 1.00 14.20 N ATOM 345 CA LYS A1030 6.975 28.686 13.600 1.00 15.80 C ATOM 346 C LYS A1030 7.061 30.138 13.166 1.00 17.55 C ATOM 347 O LYS A1030 6.809 30.479 12.008 1.00 16.67 O ATOM 348 CB LYS A1030 8.286 27.975 13.248 1.00 14.17 C ATOM 349 CG LYS A1030 8.429 26.609 13.904 1.00 16.87 C ATOM 350 CD LYS A1030 9.840 26.045 13.775 1.00 18.10 C ATOM 351 CE LYS A1030 10.012 24.833 14.681 1.00 20.44 C ATOM 352 NZ LYS A1030 11.421 24.376 14.757 1.00 22.49 N ATOM 353 N THR A1031 7.414 31.000 14.104 1.00 18.56 N ATOM 354 CA THR A1031 7.531 32.409 13.797 1.00 21.60 C ATOM 355 C THR A1031 8.820 32.933 14.393 1.00 24.58 C ATOM 356 O THR A1031 9.438 32.288 15.245 1.00 24.36 O ATOM 357 CB THR A1031 6.345 33.217 14.373 1.00 20.52 C ATOM 358 OG1 THR A1031 6.407 33.218 15.808 1.00 18.07 O ATOM 359 CG2 THR A1031 5.026 32.607 13.922 1.00 19.12 C ATOM 360 N VAL A1032 9.227 34.107 13.935 1.00 26.22 N ATOM 361 CA VAL A1032 10.433 34.713 14.447 1.00 30.17 C ATOM 362 C VAL A1032 10.040 35.937 15.271 1.00 32.42 C ATOM 363 O VAL A1032 9.335 36.829 14.796 1.00 31.43 O ATOM 364 CB VAL A1032 11.392 35.098 13.297 1.00 29.81 C ATOM 365 CG1 VAL A1032 10.650 35.880 12.234 1.00 31.66 C ATOM 366 CG2 VAL A1032 12.550 35.907 13.841 1.00 30.21 C ATOM 367 N ASN A1033 10.498 35.950 16.519 1.00 34.68 N ATOM 368 CA ASN A1033 10.234 37.031 17.457 1.00 36.76 C ATOM 369 C ASN A1033 10.618 38.387 16.869 1.00 37.74 C ATOM 370 O ASN A1033 11.563 38.487 16.088 1.00 36.81 O ATOM 371 CB ASN A1033 11.007 36.754 18.751 1.00 40.15 C ATOM 372 CG ASN A1033 11.624 38.002 19.353 1.00 46.83 C ATOM 373 OD1 ASN A1033 10.922 38.937 19.745 1.00 50.13 O ATOM 374 ND2 ASN A1033 12.951 38.019 19.434 1.00 48.78 N ATOM 375 N GLU A1034 9.878 39.427 17.247 1.00 39.34 N ATOM 376 CA GLU A1034 10.135 40.786 16.762 1.00 41.18 C ATOM 377 C GLU A1034 11.544 41.277 17.115 1.00 41.35 C ATOM 378 O GLU A1034 12.170 42.008 16.348 1.00 41.17 O ATOM 379 CB GLU A1034 9.095 41.755 17.340 1.00 41.68 C ATOM 380 N SER A1035 12.031 40.865 18.279 1.00 41.38 N ATOM 381 CA SER A1035 13.354 41.250 18.760 1.00 41.06 C ATOM 382 C SER A1035 14.484 40.624 17.937 1.00 39.67 C ATOM 383 O SER A1035 15.655 40.750 18.293 1.00 38.98 O ATOM 384 CB SER A1035 13.520 40.824 20.225 1.00 42.52 C ATOM 385 OG SER A1035 12.463 41.307 21.036 1.00 46.77 O ATOM 386 N ALA A1036 14.140 39.952 16.844 1.00 36.78 N ATOM 387 CA ALA A1036 15.155 39.306 16.020 1.00 33.88 C ATOM 388 C ALA A1036 15.856 40.267 15.067 1.00 33.61 C ATOM 389 O ALA A1036 15.254 41.226 14.572 1.00 33.77 O ATOM 390 CB ALA A1036 14.535 38.161 15.231 1.00 32.03 C ATOM 391 N SER A1037 17.134 40.000 14.813 1.00 30.27 N ATOM 392 CA SER A1037 17.913 40.822 13.907 1.00 28.02 C ATOM 393 C SER A1037 17.655 40.331 12.490 1.00 27.58 C ATOM 394 O SER A1037 17.176 39.218 12.280 1.00 26.29 O ATOM 395 CB SER A1037 19.403 40.709 14.226 1.00 27.20 C ATOM 396 OG SER A1037 19.894 39.415 13.932 1.00 25.37 O ATOM 397 N LEU A1038 17.977 41.172 11.520 1.00 27.42 N ATOM 398 CA LEU A1038 17.784 40.835 10.122 1.00 28.20 C ATOM 399 C LEU A1038 18.426 39.482 9.798 1.00 28.41 C ATOM 400 O LEU A1038 17.814 38.628 9.151 1.00 27.03 O ATOM 401 CB LEU A1038 18.386 41.948 9.254 1.00 28.25 C ATOM 402 CG LEU A1038 18.229 41.937 7.732 1.00 30.79 C ATOM 403 CD1 LEU A1038 19.178 40.931 7.106 1.00 32.53 C ATOM 404 CD2 LEU A1038 16.789 41.624 7.382 1.00 29.94 C ATOM 405 N ARG A1039 19.658 39.297 10.262 1.00 28.87 N ATOM 406 CA ARG A1039 20.406 38.072 10.020 1.00 27.80 C ATOM 407 C ARG A1039 19.695 36.840 10.560 1.00 26.90 C ATOM 408 O ARG A1039 19.730 35.775 9.943 1.00 24.17 O ATOM 409 CB ARG A1039 21.795 38.170 10.650 1.00 29.93 C ATOM 410 CG ARG A1039 22.768 37.121 10.145 1.00 34.17 C ATOM 411 CD ARG A1039 23.279 36.252 11.268 1.00 37.16 C ATOM 412 NE ARG A1039 23.811 37.052 12.366 1.00 41.31 N ATOM 413 CZ ARG A1039 24.428 36.552 13.435 1.00 42.96 C ATOM 414 NH1 ARG A1039 24.602 35.240 13.559 1.00 39.44 N ATOM 415 NH2 ARG A1039 24.868 37.371 14.387 1.00 41.84 N ATOM 416 N GLU A1040 19.052 36.980 11.713 1.00 24.89 N ATOM 417 CA GLU A1040 18.349 35.849 12.292 1.00 25.43 C ATOM 418 C GLU A1040 17.084 35.541 11.493 1.00 24.37 C ATOM 419 O GLU A1040 16.722 34.379 11.325 1.00 24.19 O ATOM 420 CB GLU A1040 18.022 36.131 13.757 1.00 26.69 C ATOM 421 CG GLU A1040 19.268 36.312 14.617 1.00 29.05 C ATOM 422 CD GLU A1040 18.950 36.639 16.066 1.00 31.36 C ATOM 423 OE1 GLU A1040 18.096 37.515 16.303 1.00 35.26 O ATOM 424 OE2 GLU A1040 19.560 36.035 16.971 1.00 32.87 O ATOM 425 N ARG A1041 16.412 36.573 10.996 1.00 23.97 N ATOM 426 CA ARG A1041 15.209 36.355 10.201 1.00 23.09 C ATOM 427 C ARG A1041 15.620 35.592 8.953 1.00 21.75 C ATOM 428 O ARG A1041 14.864 34.779 8.433 1.00 21.68 O ATOM 429 CB ARG A1041 14.558 37.685 9.805 1.00 23.19 C ATOM 430 CG ARG A1041 13.988 38.458 10.974 1.00 27.95 C ATOM 431 CD ARG A1041 13.536 39.854 10.572 1.00 30.58 C ATOM 432 NE ARG A1041 13.210 40.680 11.735 1.00 34.53 N ATOM 433 CZ ARG A1041 12.153 40.500 12.527 1.00 36.06 C ATOM 434 NH1 ARG A1041 11.292 39.514 12.290 1.00 34.77 N ATOM 435 NH2 ARG A1041 11.955 41.309 13.563 1.00 34.92 N ATOM 436 N ILE A1042 16.830 35.861 8.478 1.00 21.61 N ATOM 437 CA ILE A1042 17.343 35.194 7.293 1.00 21.67 C ATOM 438 C ILE A1042 17.713 33.748 7.605 1.00 21.96 C ATOM 439 O ILE A1042 17.383 32.847 6.837 1.00 21.75 O ATOM 440 CB ILE A1042 18.584 35.933 6.726 1.00 22.00 C ATOM 441 CG1 ILE A1042 18.160 37.286 6.155 1.00 21.92 C ATOM 442 CG2 ILE A1042 19.257 35.095 5.644 1.00 18.91 C ATOM 443 CD1 ILE A1042 19.303 38.068 5.529 1.00 23.36 C ATOM 444 N GLU A1043 18.394 33.535 8.731 1.00 22.52 N ATOM 445 CA GLU A1043 18.811 32.198 9.149 1.00 22.43 C ATOM 446 C GLU A1043 17.577 31.345 9.397 1.00 21.62 C ATOM 447 O GLU A1043 17.578 30.146 9.140 1.00 20.97 O ATOM 448 CB GLU A1043 19.657 32.265 10.429 1.00 23.15 C ATOM 449 CG GLU A1043 20.863 33.191 10.328 1.00 29.32 C ATOM 450 CD GLU A1043 21.710 33.240 11.599 1.00 31.46 C ATOM 451 OE1 GLU A1043 21.137 33.357 12.706 1.00 31.86 O ATOM 452 OE2 GLU A1043 22.956 33.182 11.485 1.00 30.07 O ATOM 453 N PHE A1044 16.524 31.981 9.900 1.00 21.76 N ATOM 454 CA PHE A1044 15.258 31.308 10.180 1.00 22.53 C ATOM 455 C PHE A1044 14.739 30.649 8.893 1.00 23.04 C ATOM 456 O PHE A1044 14.396 29.469 8.883 1.00 23.02 O ATOM 457 CB PHE A1044 14.251 32.337 10.717 1.00 21.14 C ATOM 458 CG PHE A1044 12.872 31.789 10.955 1.00 19.35 C ATOM 459 CD1 PHE A1044 12.651 30.803 11.910 1.00 16.92 C ATOM 460 CD2 PHE A1044 11.782 32.289 10.245 1.00 18.86 C ATOM 461 CE1 PHE A1044 11.367 30.325 12.160 1.00 14.83 C ATOM 462 CE2 PHE A1044 10.491 31.816 10.489 1.00 17.46 C ATOM 463 CZ PHE A1044 10.286 30.832 11.450 1.00 16.52 C ATOM 464 N LEU A1045 14.693 31.421 7.811 1.00 23.54 N ATOM 465 CA LEU A1045 14.234 30.914 6.524 1.00 25.61 C ATOM 466 C LEU A1045 15.192 29.890 5.938 1.00 24.73 C ATOM 467 O LEU A1045 14.762 28.865 5.413 1.00 24.70 O ATOM 468 CB LEU A1045 14.057 32.058 5.521 1.00 28.75 C ATOM 469 CG LEU A1045 12.745 32.847 5.570 1.00 33.07 C ATOM 470 CD1 LEU A1045 11.593 31.918 5.225 1.00 35.16 C ATOM 471 CD2 LEU A1045 12.543 33.458 6.954 1.00 37.61 C ATOM 472 N ASN A1046 16.488 30.165 6.021 1.00 24.09 N ATOM 473 CA ASN A1046 17.471 29.235 5.487 1.00 25.61 C ATOM 474 C ASN A1046 17.295 27.849 6.099 1.00 25.74 C ATOM 475 O ASN A1046 17.422 26.837 5.404 1.00 26.77 O ATOM 476 CB ASN A1046 18.898 29.738 5.740 1.00 25.89 C ATOM 477 CG ASN A1046 19.239 30.975 4.919 1.00 27.91 C ATOM 478 OD1 ASN A1046 18.654 31.214 3.858 1.00 28.37 O ATOM 479 ND2 ASN A1046 20.199 31.758 5.401 1.00 27.57 N ATOM 480 N GLU A1047 17.004 27.802 7.398 1.00 25.07 N ATOM 481 CA GLU A1047 16.801 26.528 8.074 1.00 23.99 C ATOM 482 C GLU A1047 15.642 25.769 7.446 1.00 22.99 C ATOM 483 O GLU A1047 15.722 24.560 7.235 1.00 23.13 O ATOM 484 CB GLU A1047 16.540 26.740 9.566 1.00 25.26 C ATOM 485 CG GLU A1047 17.793 26.611 10.415 1.00 29.46 C ATOM 486 CD GLU A1047 17.498 26.527 11.896 1.00 32.17 C ATOM 487 OE1 GLU A1047 16.592 25.754 12.284 1.00 36.15 O ATOM 488 OE2 GLU A1047 18.181 27.221 12.675 1.00 31.56 O ATOM 489 N ALA A1048 14.565 26.486 7.144 1.00 22.17 N ATOM 490 CA ALA A1048 13.396 25.878 6.521 1.00 22.87 C ATOM 491 C ALA A1048 13.799 25.308 5.169 1.00 22.77 C ATOM 492 O ALA A1048 13.351 24.233 4.776 1.00 22.70 O ATOM 493 CB ALA A1048 12.300 26.916 6.338 1.00 21.43 C ATOM 494 N SER A1049 14.654 26.044 4.469 1.00 22.98 N ATOM 495 CA SER A1049 15.140 25.648 3.154 1.00 25.64 C ATOM 496 C SER A1049 15.889 24.303 3.211 1.00 24.98 C ATOM 497 O SER A1049 15.811 23.500 2.284 1.00 25.65 O ATOM 498 CB SER A1049 16.049 26.754 2.605 1.00 27.41 C ATOM 499 OG SER A1049 16.099 26.728 1.194 1.00 33.86 O ATOM 500 N VAL A1050 16.612 24.059 4.299 1.00 24.91 N ATOM 501 CA VAL A1050 17.337 22.797 4.466 1.00 25.25 C ATOM 502 C VAL A1050 16.335 21.642 4.570 1.00 24.92 C ATOM 503 O VAL A1050 16.483 20.601 3.926 1.00 23.82 O ATOM 504 CB VAL A1050 18.212 22.821 5.748 1.00 25.91 C ATOM 505 CG1 VAL A1050 18.781 21.437 6.024 1.00 24.33 C ATOM 506 CG2 VAL A1050 19.337 23.837 5.588 1.00 23.99 C ATOM 507 N MET A1051 15.312 21.844 5.389 1.00 24.16 N ATOM 508 CA MET A1051 14.263 20.851 5.593 1.00 24.27 C ATOM 509 C MET A1051 13.517 20.491 4.300 1.00 22.98 C ATOM 510 O MET A1051 12.931 19.416 4.209 1.00 19.04 O ATOM 511 CB MET A1051 13.273 21.370 6.639 1.00 25.06 C ATOM 512 CG MET A1051 13.911 21.687 7.986 1.00 26.28 C ATOM 513 SD MET A1051 13.607 20.420 9.235 1.00 31.87 S ATOM 514 CE MET A1051 15.023 19.437 9.145 1.00 28.83 C ATOM 515 N LYS A1052 13.534 21.385 3.309 1.00 23.08 N ATOM 516 CA LYS A1052 12.860 21.117 2.035 1.00 24.14 C ATOM 517 C LYS A1052 13.416 19.852 1.392 1.00 23.54 C ATOM 518 O LYS A1052 12.764 19.233 0.550 1.00 23.28 O ATOM 519 CB LYS A1052 13.055 22.269 1.046 1.00 24.75 C ATOM 520 CG LYS A1052 12.326 23.557 1.371 1.00 27.47 C ATOM 521 CD LYS A1052 12.733 24.641 0.380 1.00 29.05 C ATOM 522 CE LYS A1052 12.164 26.004 0.746 1.00 30.10 C ATOM 523 NZ LYS A1052 12.701 27.065 -0.159 1.00 33.66 N ATOM 524 N GLY A1053 14.627 19.477 1.792 1.00 21.59 N ATOM 525 CA GLY A1053 15.252 18.297 1.234 1.00 19.92 C ATOM 526 C GLY A1053 14.997 17.023 2.016 1.00 20.22 C ATOM 527 O GLY A1053 15.584 15.982 1.710 1.00 20.89 O ATOM 528 N PHE A1054 14.140 17.077 3.030 1.00 18.57 N ATOM 529 CA PHE A1054 13.874 15.869 3.799 1.00 18.93 C ATOM 530 C PHE A1054 12.492 15.304 3.548 1.00 19.66 C ATOM 531 O PHE A1054 11.498 16.027 3.506 1.00 19.14 O ATOM 532 CB PHE A1054 14.050 16.108 5.298 1.00 17.43 C ATOM 533 CG PHE A1054 15.424 16.570 5.686 1.00 17.91 C ATOM 534 CD1 PHE A1054 16.520 16.299 4.884 1.00 18.31 C ATOM 535 CD2 PHE A1054 15.618 17.286 6.857 1.00 16.56 C ATOM 536 CE1 PHE A1054 17.791 16.742 5.242 1.00 20.45 C ATOM 537 CE2 PHE A1054 16.878 17.729 7.221 1.00 19.14 C ATOM 538 CZ PHE A1054 17.969 17.459 6.411 1.00 17.84 C ATOM 539 N THR A1055 12.444 13.991 3.379 1.00 20.23 N ATOM 540 CA THR A1055 11.193 13.301 3.144 1.00 22.21 C ATOM 541 C THR A1055 11.260 11.982 3.893 1.00 21.89 C ATOM 542 O THR A1055 11.229 10.908 3.290 1.00 24.62 O ATOM 543 CB THR A1055 10.976 13.014 1.647 1.00 22.71 C ATOM 544 OG1 THR A1055 12.020 12.152 1.176 1.00 24.34 O ATOM 545 CG2 THR A1055 10.992 14.309 0.844 1.00 23.04 C ATOM 546 N CYS A1056 11.369 12.066 5.212 1.00 20.12 N ATOM 547 CA CYS A1056 11.421 10.869 6.030 1.00 19.73 C ATOM 548 C CYS A1056 10.240 10.865 6.987 1.00 18.13 C ATOM 549 O CYS A1056 9.918 11.873 7.609 1.00 17.50 O ATOM 550 CB CYS A1056 12.738 10.791 6.817 1.00 20.27 C ATOM 551 SG CYS A1056 12.888 9.288 7.838 1.00 21.21 S ATOM 552 N HIS A1057 9.592 9.715 7.094 1.00 18.56 N ATOM 553 CA HIS A1057 8.449 9.571 7.976 1.00 16.26 C ATOM 554 C HIS A1057 8.854 9.760 9.438 1.00 14.08 C ATOM 555 O HIS A1057 8.024 10.113 10.272 1.00 15.84 O ATOM 556 CB HIS A1057 7.831 8.183 7.799 1.00 15.83 C ATOM 557 CG HIS A1057 6.579 7.976 8.591 1.00 16.89 C ATOM 558 ND1 HIS A1057 5.426 8.698 8.361 1.00 17.32 N ATOM 559 CD2 HIS A1057 6.300 7.139 9.618 1.00 16.22 C ATOM 560 CE1 HIS A1057 4.492 8.314 9.212 1.00 16.53 C ATOM 561 NE2 HIS A1057 4.996 7.369 9.985 1.00 17.06 N ATOM 562 N HIS A1058 10.122 9.533 9.754 1.00 10.69 N ATOM 563 CA HIS A1058 10.550 9.662 11.136 1.00 11.92 C ATOM 564 C HIS A1058 11.282 10.945 11.512 1.00 13.53 C ATOM 565 O HIS A1058 12.000 11.007 12.509 1.00 12.80 O ATOM 566 CB HIS A1058 11.330 8.415 11.531 1.00 10.23 C ATOM 567 CG HIS A1058 10.504 7.170 11.454 1.00 13.36 C ATOM 568 ND1 HIS A1058 10.928 6.028 10.812 1.00 12.79 N ATOM 569 CD2 HIS A1058 9.242 6.917 11.878 1.00 11.16 C ATOM 570 CE1 HIS A1058 9.961 5.126 10.837 1.00 13.61 C ATOM 571 NE2 HIS A1058 8.928 5.641 11.479 1.00 12.95 N ATOM 572 N VAL A1059 11.081 11.970 10.692 1.00 13.69 N ATOM 573 CA VAL A1059 11.627 13.290 10.944 1.00 11.91 C ATOM 574 C VAL A1059 10.436 14.212 10.697 1.00 13.17 C ATOM 575 O VAL A1059 9.702 14.015 9.731 1.00 14.76 O ATOM 576 CB VAL A1059 12.761 13.652 9.975 1.00 12.31 C ATOM 577 CG1 VAL A1059 13.240 15.072 10.268 1.00 10.11 C ATOM 578 CG2 VAL A1059 13.921 12.658 10.120 1.00 8.99 C ATOM 579 N VAL A1060 10.235 15.200 11.567 1.00 13.16 N ATOM 580 CA VAL A1060 9.121 16.135 11.423 1.00 12.51 C ATOM 581 C VAL A1060 9.263 16.901 10.103 1.00 13.72 C ATOM 582 O VAL A1060 10.251 17.591 9.875 1.00 13.33 O ATOM 583 CB VAL A1060 9.060 17.109 12.630 1.00 12.14 C ATOM 584 CG1 VAL A1060 7.954 18.127 12.431 1.00 9.98 C ATOM 585 CG2 VAL A1060 8.805 16.316 13.912 1.00 7.19 C ATOM 586 N ARG A1061 8.260 16.767 9.241 1.00 15.05 N ATOM 587 CA ARG A1061 8.277 17.382 7.921 1.00 16.44 C ATOM 588 C ARG A1061 7.849 18.828 7.763 1.00 14.18 C ATOM 589 O ARG A1061 6.988 19.330 8.473 1.00 13.72 O ATOM 590 CB ARG A1061 7.446 16.531 6.955 1.00 20.03 C ATOM 591 CG ARG A1061 8.154 15.267 6.495 1.00 31.66 C ATOM 592 CD ARG A1061 7.193 14.285 5.836 1.00 37.82 C ATOM 593 NE ARG A1061 7.653 13.884 4.511 1.00 40.34 N ATOM 594 CZ ARG A1061 7.790 14.723 3.490 1.00 43.03 C ATOM 595 NH1 ARG A1061 7.502 16.010 3.643 1.00 45.05 N ATOM 596 NH2 ARG A1061 8.213 14.277 2.316 1.00 45.57 N ATOM 597 N LEU A1062 8.480 19.485 6.801 1.00 14.70 N ATOM 598 CA LEU A1062 8.167 20.859 6.446 1.00 14.34 C ATOM 599 C LEU A1062 6.991 20.735 5.477 1.00 14.62 C ATOM 600 O LEU A1062 7.020 19.905 4.568 1.00 13.85 O ATOM 601 CB LEU A1062 9.361 21.497 5.736 1.00 11.53 C ATOM 602 CG LEU A1062 9.086 22.765 4.917 1.00 13.66 C ATOM 603 CD1 LEU A1062 8.711 23.930 5.837 1.00 14.30 C ATOM 604 CD2 LEU A1062 10.319 23.112 4.101 1.00 13.25 C ATOM 605 N LEU A1063 5.958 21.546 5.669 1.00 15.73 N ATOM 606 CA LEU A1063 4.798 21.497 4.787 1.00 15.54 C ATOM 607 C LEU A1063 4.770 22.695 3.854 1.00 17.64 C ATOM 608 O LEU A1063 4.267 22.609 2.738 1.00 19.43 O ATOM 609 CB LEU A1063 3.511 21.452 5.604 1.00 14.52 C ATOM 610 CG LEU A1063 3.333 20.166 6.408 1.00 14.35 C ATOM 611 CD1 LEU A1063 2.017 20.213 7.165 1.00 12.96 C ATOM 612 CD2 LEU A1063 3.360 18.970 5.460 1.00 11.42 C ATOM 613 N GLY A1064 5.317 23.815 4.315 1.00 18.47 N ATOM 614 CA GLY A1064 5.339 25.011 3.500 1.00 17.43 C ATOM 615 C GLY A1064 5.903 26.203 4.239 1.00 17.56 C ATOM 616 O GLY A1064 6.180 26.128 5.433 1.00 18.32 O ATOM 617 N VAL A1065 6.075 27.311 3.526 1.00 19.21 N ATOM 618 CA VAL A1065 6.623 28.524 4.124 1.00 20.91 C ATOM 619 C VAL A1065 6.011 29.797 3.538 1.00 21.32 C ATOM 620 O VAL A1065 5.540 29.814 2.402 1.00 20.98 O ATOM 621 CB VAL A1065 8.169 28.574 3.953 1.00 19.36 C ATOM 622 CG1 VAL A1065 8.541 28.495 2.483 1.00 22.38 C ATOM 623 CG2 VAL A1065 8.721 29.846 4.554 1.00 23.92 C ATOM 624 N VAL A1066 6.017 30.858 4.336 1.00 24.22 N ATOM 625 CA VAL A1066 5.508 32.158 3.921 1.00 23.98 C ATOM 626 C VAL A1066 6.675 33.124 4.089 1.00 24.79 C ATOM 627 O VAL A1066 6.971 33.564 5.201 1.00 23.99 O ATOM 628 CB VAL A1066 4.345 32.615 4.815 1.00 24.01 C ATOM 629 CG1 VAL A1066 3.812 33.960 4.336 1.00 24.69 C ATOM 630 CG2 VAL A1066 3.250 31.569 4.807 1.00 24.68 C ATOM 631 N SER A1067 7.335 33.445 2.982 1.00 25.14 N ATOM 632 CA SER A1067 8.484 34.338 3.014 1.00 28.50 C ATOM 633 C SER A1067 8.194 35.712 2.419 1.00 31.16 C ATOM 634 O SER A1067 9.037 36.611 2.468 1.00 33.60 O ATOM 635 CB SER A1067 9.649 33.685 2.276 1.00 26.18 C ATOM 636 OG SER A1067 9.203 33.170 1.037 1.00 29.14 O ATOM 637 N LYS A1068 7.001 35.868 1.858 1.00 32.61 N ATOM 638 CA LYS A1068 6.588 37.133 1.269 1.00 34.90 C ATOM 639 C LYS A1068 5.965 38.016 2.350 1.00 36.51 C ATOM 640 O LYS A1068 4.918 37.691 2.908 1.00 38.07 O ATOM 641 CB LYS A1068 5.572 36.890 0.148 1.00 34.13 C ATOM 642 N GLY A1069 6.615 39.132 2.646 1.00 37.37 N ATOM 643 CA GLY A1069 6.091 40.028 3.657 1.00 37.49 C ATOM 644 C GLY A1069 6.359 39.546 5.067 1.00 38.64 C ATOM 645 O GLY A1069 6.984 38.505 5.275 1.00 38.01 O ATOM 646 N GLN A1070 5.881 40.311 6.040 1.00 39.00 N ATOM 647 CA GLN A1070 6.061 39.976 7.443 1.00 39.40 C ATOM 648 C GLN A1070 4.700 39.707 8.068 1.00 38.46 C ATOM 649 O GLN A1070 3.687 40.259 7.632 1.00 39.39 O ATOM 650 CB GLN A1070 6.740 41.134 8.175 1.00 42.72 C ATOM 651 CG GLN A1070 8.108 41.518 7.615 1.00 46.25 C ATOM 652 CD GLN A1070 9.207 40.543 8.010 1.00 48.60 C ATOM 653 OE1 GLN A1070 9.440 40.308 9.195 1.00 49.87 O ATOM 654 NE2 GLN A1070 9.894 39.980 7.018 1.00 47.79 N ATOM 655 N PRO A1071 4.651 38.818 9.074 1.00 36.28 N ATOM 656 CA PRO A1071 5.803 38.086 9.607 1.00 33.91 C ATOM 657 C PRO A1071 6.004 36.807 8.786 1.00 32.02 C ATOM 658 O PRO A1071 5.058 36.304 8.182 1.00 32.35 O ATOM 659 CB PRO A1071 5.369 37.789 11.032 1.00 34.41 C ATOM 660 CG PRO A1071 3.919 37.465 10.843 1.00 34.05 C ATOM 661 CD PRO A1071 3.448 38.552 9.886 1.00 34.90 C ATOM 662 N THR A1072 7.222 36.281 8.753 1.00 28.64 N ATOM 663 CA THR A1072 7.459 35.059 7.998 1.00 26.84 C ATOM 664 C THR A1072 7.009 33.848 8.832 1.00 26.25 C ATOM 665 O THR A1072 7.093 33.858 10.060 1.00 25.39 O ATOM 666 CB THR A1072 8.945 34.928 7.593 1.00 26.17 C ATOM 667 OG1 THR A1072 9.766 34.892 8.760 1.00 28.60 O ATOM 668 CG2 THR A1072 9.365 36.113 6.741 1.00 25.79 C ATOM 669 N LEU A1073 6.524 32.808 8.160 1.00 24.47 N ATOM 670 CA LEU A1073 6.040 31.621 8.853 1.00 22.57 C ATOM 671 C LEU A1073 6.562 30.328 8.242 1.00 22.02 C ATOM 672 O LEU A1073 6.739 30.220 7.027 1.00 22.55 O ATOM 673 CB LEU A1073 4.510 31.595 8.831 1.00 21.35 C ATOM 674 CG LEU A1073 3.791 32.884 9.239 1.00 23.61 C ATOM 675 CD1 LEU A1073 2.321 32.782 8.863 1.00 21.67 C ATOM 676 CD2 LEU A1073 3.964 33.139 10.731 1.00 20.63 C ATOM 677 N VAL A1074 6.807 29.348 9.102 1.00 19.62 N ATOM 678 CA VAL A1074 7.286 28.051 8.669 1.00 17.42 C ATOM 679 C VAL A1074 6.282 27.034 9.170 1.00 16.77 C ATOM 680 O VAL A1074 6.133 26.832 10.372 1.00 14.54 O ATOM 681 CB VAL A1074 8.667 27.756 9.248 1.00 18.58 C ATOM 682 CG1 VAL A1074 9.118 26.367 8.835 1.00 19.59 C ATOM 683 CG2 VAL A1074 9.657 28.811 8.754 1.00 19.70 C ATOM 684 N VAL A1075 5.594 26.401 8.226 1.00 15.00 N ATOM 685 CA VAL A1075 4.555 25.427 8.525 1.00 13.41 C ATOM 686 C VAL A1075 5.080 24.002 8.516 1.00 13.61 C ATOM 687 O VAL A1075 5.543 23.498 7.491 1.00 13.17 O ATOM 688 CB VAL A1075 3.398 25.562 7.500 1.00 14.07 C ATOM 689 CG1 VAL A1075 2.209 24.687 7.900 1.00 11.87 C ATOM 690 CG2 VAL A1075 2.990 27.025 7.396 1.00 13.22 C ATOM 691 N MET A1076 4.993 23.363 9.678 1.00 14.62 N ATOM 692 CA MET A1076 5.450 21.993 9.878 1.00 14.48 C ATOM 693 C MET A1076 4.257 21.096 10.180 1.00 15.00 C ATOM 694 O MET A1076 3.193 21.587 10.566 1.00 16.62 O ATOM 695 CB MET A1076 6.393 21.937 11.076 1.00 13.39 C ATOM 696 CG MET A1076 7.526 22.944 11.048 1.00 16.84 C ATOM 697 SD MET A1076 8.745 22.594 9.770 1.00 15.87 S ATOM 698 CE MET A1076 9.272 20.928 10.211 1.00 16.51 C ATOM 699 N GLU A1077 4.424 19.787 10.013 1.00 13.44 N ATOM 700 CA GLU A1077 3.336 18.873 10.331 1.00 13.08 C ATOM 701 C GLU A1077 3.146 18.940 11.851 1.00 11.90 C ATOM 702 O GLU A1077 4.115 19.015 12.611 1.00 9.87 O ATOM 703 CB GLU A1077 3.667 17.435 9.899 1.00 13.13 C ATOM 704 CG GLU A1077 4.826 16.785 10.634 1.00 13.74 C ATOM 705 CD GLU A1077 4.955 15.296 10.330 1.00 15.54 C ATOM 706 OE1 GLU A1077 4.042 14.519 10.687 1.00 16.25 O ATOM 707 OE2 GLU A1077 5.973 14.897 9.734 1.00 14.40 O ATOM 708 N LEU A1078 1.902 18.919 12.301 1.00 10.32 N ATOM 709 CA LEU A1078 1.652 18.986 13.728 1.00 11.55 C ATOM 710 C LEU A1078 1.985 17.679 14.452 1.00 12.47 C ATOM 711 O LEU A1078 1.651 16.588 13.985 1.00 12.76 O ATOM 712 CB LEU A1078 0.185 19.347 13.998 1.00 8.46 C ATOM 713 CG LEU A1078 -0.182 19.448 15.485 1.00 7.34 C ATOM 714 CD1 LEU A1078 0.611 20.573 16.149 1.00 5.29 C ATOM 715 CD2 LEU A1078 -1.677 19.698 15.624 1.00 7.66 C ATOM 716 N MET A1079 2.650 17.793 15.593 1.00 12.35 N ATOM 717 CA MET A1079 2.962 16.621 16.401 1.00 14.78 C ATOM 718 C MET A1079 2.063 16.839 17.618 1.00 16.27 C ATOM 719 O MET A1079 2.455 17.437 18.616 1.00 16.02 O ATOM 720 CB MET A1079 4.449 16.613 16.763 1.00 16.69 C ATOM 721 CG MET A1079 5.366 16.433 15.550 1.00 15.77 C ATOM 722 SD MET A1079 5.240 14.767 14.818 1.00 23.14 S ATOM 723 CE MET A1079 4.046 15.032 13.588 1.00 23.92 C ATOM 724 N ALA A1080 0.834 16.348 17.494 1.00 18.12 N ATOM 725 CA ALA A1080 -0.212 16.507 18.502 1.00 18.93 C ATOM 726 C ALA A1080 0.124 16.217 19.963 1.00 20.43 C ATOM 727 O ALA A1080 -0.551 16.724 20.851 1.00 19.81 O ATOM 728 CB ALA A1080 -1.433 15.700 18.086 1.00 20.29 C ATOM 729 N HIS A1081 1.147 15.414 20.232 1.00 21.07 N ATOM 730 CA HIS A1081 1.480 15.131 21.624 1.00 21.15 C ATOM 731 C HIS A1081 2.746 15.820 22.121 1.00 20.16 C ATOM 732 O HIS A1081 3.248 15.507 23.202 1.00 21.89 O ATOM 733 CB HIS A1081 1.554 13.620 21.845 1.00 23.71 C ATOM 734 CG HIS A1081 0.219 12.946 21.767 1.00 27.17 C ATOM 735 ND1 HIS A1081 -0.794 13.203 22.666 1.00 26.07 N ATOM 736 CD2 HIS A1081 -0.291 12.075 20.864 1.00 27.72 C ATOM 737 CE1 HIS A1081 -1.871 12.522 22.318 1.00 27.98 C ATOM 738 NE2 HIS A1081 -1.593 11.831 21.227 1.00 28.17 N ATOM 739 N GLY A1082 3.256 16.756 21.324 1.00 18.43 N ATOM 740 CA GLY A1082 4.439 17.516 21.703 1.00 17.50 C ATOM 741 C GLY A1082 5.775 16.794 21.774 1.00 17.94 C ATOM 742 O GLY A1082 5.957 15.706 21.212 1.00 16.40 O ATOM 743 N ASP A1083 6.723 17.416 22.468 1.00 16.50 N ATOM 744 CA ASP A1083 8.044 16.839 22.608 1.00 16.83 C ATOM 745 C ASP A1083 7.955 15.559 23.433 1.00 16.12 C ATOM 746 O ASP A1083 7.101 15.428 24.315 1.00 14.08 O ATOM 747 CB ASP A1083 8.994 17.829 23.278 1.00 19.91 C ATOM 748 CG ASP A1083 8.673 18.039 24.738 1.00 23.88 C ATOM 749 OD1 ASP A1083 7.822 18.903 25.043 1.00 24.83 O ATOM 750 OD2 ASP A1083 9.268 17.326 25.578 1.00 23.75 O ATOM 751 N LEU A1084 8.847 14.621 23.137 1.00 15.13 N ATOM 752 CA LEU A1084 8.876 13.330 23.809 1.00 14.18 C ATOM 753 C LEU A1084 9.036 13.421 25.320 1.00 15.56 C ATOM 754 O LEU A1084 8.331 12.732 26.055 1.00 15.17 O ATOM 755 CB LEU A1084 9.987 12.462 23.212 1.00 8.73 C ATOM 756 CG LEU A1084 10.194 11.065 23.791 1.00 8.30 C ATOM 757 CD1 LEU A1084 8.895 10.278 23.744 1.00 3.24 C ATOM 758 CD2 LEU A1084 11.285 10.351 22.990 1.00 7.67 C ATOM 759 N LYS A1085 9.957 14.263 25.783 1.00 16.67 N ATOM 760 CA LYS A1085 10.183 14.426 27.220 1.00 20.50 C ATOM 761 C LYS A1085 8.876 14.737 27.955 1.00 21.72 C ATOM 762 O LYS A1085 8.480 14.018 28.878 1.00 22.50 O ATOM 763 CB LYS A1085 11.193 15.549 27.473 1.00 21.36 C ATOM 764 CG LYS A1085 11.350 15.946 28.941 1.00 25.13 C ATOM 765 CD LYS A1085 12.317 17.121 29.081 1.00 28.98 C ATOM 766 CE LYS A1085 12.241 17.779 30.457 1.00 31.72 C ATOM 767 NZ LYS A1085 12.655 16.875 31.558 1.00 31.88 N ATOM 768 N SER A1086 8.210 15.809 27.539 1.00 21.18 N ATOM 769 CA SER A1086 6.949 16.206 28.145 1.00 22.94 C ATOM 770 C SER A1086 5.937 15.062 28.093 1.00 24.70 C ATOM 771 O SER A1086 5.216 14.809 29.064 1.00 26.75 O ATOM 772 CB SER A1086 6.380 17.430 27.420 1.00 23.41 C ATOM 773 OG SER A1086 7.245 18.544 27.547 1.00 25.20 O ATOM 774 N TYR A1087 5.879 14.369 26.961 1.00 22.96 N ATOM 775 CA TYR A1087 4.948 13.262 26.816 1.00 22.88 C ATOM 776 C TYR A1087 5.261 12.167 27.831 1.00 23.53 C ATOM 777 O TYR A1087 4.362 11.621 28.469 1.00 23.74 O ATOM 778 CB TYR A1087 5.019 12.692 25.403 1.00 21.71 C ATOM 779 CG TYR A1087 4.150 11.479 25.204 1.00 22.98 C ATOM 780 CD1 TYR A1087 2.759 11.585 25.196 1.00 24.72 C ATOM 781 CD2 TYR A1087 4.717 10.213 25.053 1.00 24.15 C ATOM 782 CE1 TYR A1087 1.950 10.457 25.045 1.00 24.76 C ATOM 783 CE2 TYR A1087 3.925 9.082 24.901 1.00 25.43 C ATOM 784 CZ TYR A1087 2.541 9.210 24.899 1.00 27.54 C ATOM 785 OH TYR A1087 1.755 8.088 24.753 1.00 29.37 O ATOM 786 N LEU A1088 6.541 11.846 27.982 1.00 24.06 N ATOM 787 CA LEU A1088 6.952 10.818 28.928 1.00 24.20 C ATOM 788 C LEU A1088 6.575 11.189 30.364 1.00 26.91 C ATOM 789 O LEU A1088 6.087 10.345 31.119 1.00 26.87 O ATOM 790 CB LEU A1088 8.461 10.575 28.817 1.00 21.33 C ATOM 791 CG LEU A1088 8.911 9.813 27.561 1.00 19.50 C ATOM 792 CD1 LEU A1088 10.413 9.920 27.376 1.00 19.25 C ATOM 793 CD2 LEU A1088 8.492 8.351 27.681 1.00 20.34 C ATOM 794 N ARG A1089 6.787 12.443 30.749 1.00 28.33 N ATOM 795 CA ARG A1089 6.451 12.843 32.111 1.00 31.85 C ATOM 796 C ARG A1089 4.960 12.882 32.415 1.00 31.67 C ATOM 797 O ARG A1089 4.559 12.878 33.583 1.00 32.55 O ATOM 798 CB ARG A1089 7.086 14.188 32.451 1.00 33.14 C ATOM 799 CG ARG A1089 8.465 14.029 33.050 1.00 38.97 C ATOM 800 CD ARG A1089 9.502 14.757 32.239 1.00 43.68 C ATOM 801 NE ARG A1089 9.891 16.017 32.855 1.00 49.57 N ATOM 802 CZ ARG A1089 10.482 16.112 34.040 1.00 53.07 C ATOM 803 NH1 ARG A1089 10.750 15.014 34.740 1.00 54.99 N ATOM 804 NH2 ARG A1089 10.814 17.304 34.522 1.00 54.12 N ATOM 805 N SER A1090 4.133 12.914 31.378 1.00 29.39 N ATOM 806 CA SER A1090 2.697 12.945 31.603 1.00 29.03 C ATOM 807 C SER A1090 2.187 11.542 31.903 1.00 29.38 C ATOM 808 O SER A1090 1.062 11.364 32.363 1.00 29.81 O ATOM 809 CB SER A1090 1.972 13.506 30.384 1.00 27.31 C ATOM 810 OG SER A1090 1.992 12.581 29.319 1.00 31.62 O ATOM 811 N LEU A1091 3.019 10.542 31.641 1.00 29.65 N ATOM 812 CA LEU A1091 2.633 9.163 31.892 1.00 31.15 C ATOM 813 C LEU A1091 3.108 8.671 33.251 1.00 33.64 C ATOM 814 O LEU A1091 3.035 7.482 33.546 1.00 32.83 O ATOM 815 CB LEU A1091 3.187 8.262 30.797 1.00 30.68 C ATOM 816 CG LEU A1091 2.518 8.406 29.435 1.00 29.72 C ATOM 817 CD1 LEU A1091 3.338 7.674 28.387 1.00 27.88 C ATOM 818 CD2 LEU A1091 1.095 7.854 29.509 1.00 29.06 C ATOM 819 N ARG A1092 3.594 9.591 34.077 1.00 37.51 N ATOM 820 CA ARG A1092 4.067 9.239 35.408 1.00 42.28 C ATOM 821 C ARG A1092 2.865 9.184 36.346 1.00 46.04 C ATOM 822 O ARG A1092 2.018 10.075 36.339 1.00 46.38 O ATOM 823 CB ARG A1092 5.064 10.280 35.913 1.00 42.64 C ATOM 824 CG ARG A1092 6.013 10.766 34.848 1.00 44.59 C ATOM 825 CD ARG A1092 7.124 11.597 35.436 1.00 46.43 C ATOM 826 NE ARG A1092 8.015 10.773 36.240 1.00 48.27 N ATOM 827 CZ ARG A1092 9.252 11.124 36.567 1.00 50.23 C ATOM 828 NH1 ARG A1092 9.738 12.290 36.158 1.00 49.68 N ATOM 829 NH2 ARG A1092 10.005 10.304 37.290 1.00 51.04 N ATOM 830 N PRO A1093 2.777 8.131 37.168 1.00 49.22 N ATOM 831 CA PRO A1093 1.672 7.957 38.115 1.00 51.63 C ATOM 832 C PRO A1093 1.230 9.234 38.838 1.00 53.26 C ATOM 833 O PRO A1093 0.033 9.498 38.966 1.00 53.36 O ATOM 834 CB PRO A1093 2.219 6.903 39.070 1.00 51.96 C ATOM 835 CG PRO A1093 3.015 6.027 38.144 1.00 50.05 C ATOM 836 CD PRO A1093 3.764 7.045 37.309 1.00 49.62 C ATOM 837 N GLU A1094 2.192 10.024 39.304 1.00 54.27 N ATOM 838 CA GLU A1094 1.874 11.254 40.019 1.00 55.27 C ATOM 839 C GLU A1094 1.665 12.442 39.090 1.00 56.00 C ATOM 840 O GLU A1094 1.591 13.583 39.546 1.00 56.13 O ATOM 841 CB GLU A1094 2.985 11.583 41.020 1.00 55.23 C ATOM 842 N ALA A1095 1.569 12.180 37.791 1.00 56.38 N ATOM 843 CA ALA A1095 1.375 13.259 36.828 1.00 57.35 C ATOM 844 C ALA A1095 -0.020 13.865 36.942 1.00 57.61 C ATOM 845 O ALA A1095 -1.029 13.170 36.791 1.00 57.33 O ATOM 846 CB ALA A1095 1.610 12.753 35.408 1.00 56.65 C ATOM 847 N GLU A1096 -0.066 15.167 37.211 1.00 57.44 N ATOM 848 CA GLU A1096 -1.328 15.881 37.343 1.00 57.45 C ATOM 849 C GLU A1096 -2.057 15.942 35.999 1.00 58.20 C ATOM 850 O GLU A1096 -3.144 16.511 35.894 1.00 58.98 O ATOM 851 CB GLU A1096 -1.074 17.297 37.867 1.00 55.87 C ATOM 852 N ASN A1097 -1.454 15.354 34.971 1.00 57.88 N ATOM 853 CA ASN A1097 -2.054 15.341 33.641 1.00 56.73 C ATOM 854 C ASN A1097 -1.961 13.960 32.996 1.00 55.26 C ATOM 855 O ASN A1097 -1.840 13.843 31.775 1.00 54.26 O ATOM 856 CB ASN A1097 -1.378 16.380 32.740 1.00 57.88 C ATOM 857 CG ASN A1097 0.125 16.165 32.615 1.00 59.78 C ATOM 858 OD1 ASN A1097 0.786 16.806 31.796 1.00 59.60 O ATOM 859 ND2 ASN A1097 0.672 15.268 33.431 1.00 59.54 N ATOM 860 N ASN A1098 -2.020 12.919 33.821 1.00 53.09 N ATOM 861 CA ASN A1098 -1.949 11.549 33.327 1.00 52.43 C ATOM 862 C ASN A1098 -3.077 11.335 32.311 1.00 52.38 C ATOM 863 O ASN A1098 -4.255 11.469 32.642 1.00 51.94 O ATOM 864 CB ASN A1098 -2.101 10.566 34.492 1.00 52.86 C ATOM 865 CG ASN A1098 -1.670 9.157 34.132 1.00 52.50 C ATOM 866 OD1 ASN A1098 -0.479 8.838 34.136 1.00 52.22 O ATOM 867 ND2 ASN A1098 -2.638 8.307 33.808 1.00 52.14 N ATOM 868 N PRO A1099 -2.728 10.999 31.059 1.00 52.60 N ATOM 869 CA PRO A1099 -3.729 10.775 30.011 1.00 53.09 C ATOM 870 C PRO A1099 -4.668 9.604 30.293 1.00 54.34 C ATOM 871 O PRO A1099 -5.621 9.374 29.547 1.00 54.89 O ATOM 872 CB PRO A1099 -2.876 10.553 28.768 1.00 52.67 C ATOM 873 CG PRO A1099 -1.674 9.875 29.324 1.00 52.57 C ATOM 874 CD PRO A1099 -1.377 10.703 30.553 1.00 52.50 C ATOM 875 N GLY A1100 -4.396 8.865 31.366 1.00 54.62 N ATOM 876 CA GLY A1100 -5.247 7.742 31.720 1.00 54.08 C ATOM 877 C GLY A1100 -4.781 6.377 31.242 1.00 54.01 C ATOM 878 O GLY A1100 -5.509 5.393 31.377 1.00 53.90 O ATOM 879 N ARG A1101 -3.582 6.311 30.672 1.00 53.97 N ATOM 880 CA ARG A1101 -3.035 5.043 30.199 1.00 52.95 C ATOM 881 C ARG A1101 -1.800 4.721 31.020 1.00 50.51 C ATOM 882 O ARG A1101 -1.221 5.602 31.656 1.00 49.94 O ATOM 883 CB ARG A1101 -2.642 5.117 28.719 1.00 55.97 C ATOM 884 CG ARG A1101 -3.796 5.352 27.753 1.00 60.97 C ATOM 885 CD ARG A1101 -4.160 6.828 27.650 1.00 64.59 C ATOM 886 NE ARG A1101 -3.029 7.647 27.206 1.00 67.20 N ATOM 887 CZ ARG A1101 -2.452 7.557 26.009 1.00 66.68 C ATOM 888 NH1 ARG A1101 -2.896 6.679 25.116 1.00 66.79 N ATOM 889 NH2 ARG A1101 -1.426 8.344 25.708 1.00 65.79 N ATOM 890 N PRO A1102 -1.379 3.449 31.021 1.00 48.28 N ATOM 891 CA PRO A1102 -0.193 3.056 31.787 1.00 45.82 C ATOM 892 C PRO A1102 1.075 3.516 31.076 1.00 43.07 C ATOM 893 O PRO A1102 1.031 3.914 29.912 1.00 42.26 O ATOM 894 CB PRO A1102 -0.312 1.537 31.836 1.00 45.64 C ATOM 895 CG PRO A1102 -0.897 1.225 30.497 1.00 47.06 C ATOM 896 CD PRO A1102 -1.981 2.283 30.349 1.00 47.68 C ATOM 897 N PRO A1103 2.221 3.483 31.773 1.00 40.78 N ATOM 898 CA PRO A1103 3.458 3.912 31.119 1.00 38.16 C ATOM 899 C PRO A1103 3.665 3.088 29.845 1.00 36.58 C ATOM 900 O PRO A1103 2.978 2.090 29.627 1.00 36.54 O ATOM 901 CB PRO A1103 4.520 3.640 32.183 1.00 38.83 C ATOM 902 CG PRO A1103 3.941 2.483 32.960 1.00 38.93 C ATOM 903 CD PRO A1103 2.498 2.900 33.098 1.00 40.62 C ATOM 904 N PRO A1104 4.608 3.495 28.983 1.00 34.45 N ATOM 905 CA PRO A1104 4.827 2.732 27.751 1.00 32.15 C ATOM 906 C PRO A1104 5.228 1.280 27.982 1.00 29.20 C ATOM 907 O PRO A1104 5.969 0.971 28.913 1.00 29.13 O ATOM 908 CB PRO A1104 5.914 3.538 27.035 1.00 33.11 C ATOM 909 CG PRO A1104 6.669 4.165 28.165 1.00 32.48 C ATOM 910 CD PRO A1104 5.556 4.619 29.076 1.00 33.64 C ATOM 911 N THR A1105 4.728 0.396 27.124 1.00 24.97 N ATOM 912 CA THR A1105 5.035 -1.026 27.214 1.00 21.92 C ATOM 913 C THR A1105 6.403 -1.277 26.589 1.00 20.22 C ATOM 914 O THR A1105 6.950 -0.402 25.916 1.00 18.60 O ATOM 915 CB THR A1105 4.010 -1.869 26.431 1.00 20.57 C ATOM 916 OG1 THR A1105 4.290 -1.769 25.030 1.00 18.36 O ATOM 917 CG2 THR A1105 2.600 -1.365 26.685 1.00 19.02 C ATOM 918 N LEU A1106 6.950 -2.470 26.810 1.00 18.65 N ATOM 919 CA LEU A1106 8.240 -2.824 26.229 1.00 18.51 C ATOM 920 C LEU A1106 8.098 -2.723 24.713 1.00 18.39 C ATOM 921 O LEU A1106 8.988 -2.245 24.011 1.00 18.49 O ATOM 922 CB LEU A1106 8.642 -4.255 26.616 1.00 16.89 C ATOM 923 CG LEU A1106 9.918 -4.805 25.959 1.00 16.74 C ATOM 924 CD1 LEU A1106 11.070 -3.834 26.203 1.00 15.79 C ATOM 925 CD2 LEU A1106 10.258 -6.187 26.512 1.00 13.96 C ATOM 926 N GLN A1107 6.957 -3.179 24.219 1.00 17.89 N ATOM 927 CA GLN A1107 6.663 -3.145 22.800 1.00 17.55 C ATOM 928 C GLN A1107 6.679 -1.703 22.280 1.00 17.94 C ATOM 929 O GLN A1107 7.286 -1.417 21.252 1.00 17.21 O ATOM 930 CB GLN A1107 5.296 -3.782 22.569 1.00 17.34 C ATOM 931 CG GLN A1107 4.790 -3.748 21.151 1.00 17.41 C ATOM 932 CD GLN A1107 3.449 -4.440 21.032 1.00 20.55 C ATOM 933 OE1 GLN A1107 2.489 -4.075 21.713 1.00 21.04 O ATOM 934 NE2 GLN A1107 3.375 -5.450 20.173 1.00 20.56 N ATOM 935 N GLU A1108 6.014 -0.798 22.992 1.00 17.42 N ATOM 936 CA GLU A1108 5.967 0.600 22.571 1.00 18.90 C ATOM 937 C GLU A1108 7.329 1.282 22.664 1.00 18.28 C ATOM 938 O GLU A1108 7.640 2.171 21.865 1.00 16.28 O ATOM 939 CB GLU A1108 4.944 1.376 23.404 1.00 18.78 C ATOM 940 CG GLU A1108 3.533 0.829 23.302 1.00 21.26 C ATOM 941 CD GLU A1108 2.550 1.578 24.188 1.00 22.12 C ATOM 942 OE1 GLU A1108 2.864 1.793 25.374 1.00 21.17 O ATOM 943 OE2 GLU A1108 1.460 1.942 23.701 1.00 24.86 O ATOM 944 N MET A1109 8.137 0.866 23.637 1.00 18.96 N ATOM 945 CA MET A1109 9.466 1.435 23.814 1.00 20.67 C ATOM 946 C MET A1109 10.385 1.036 22.661 1.00 20.22 C ATOM 947 O MET A1109 11.205 1.837 22.203 1.00 22.01 O ATOM 948 CB MET A1109 10.065 0.994 25.155 1.00 23.55 C ATOM 949 CG MET A1109 9.358 1.600 26.366 1.00 28.29 C ATOM 950 SD MET A1109 10.231 1.348 27.931 1.00 33.18 S ATOM 951 CE MET A1109 9.272 0.057 28.681 1.00 33.30 C ATOM 952 N ILE A1110 10.242 -0.200 22.190 1.00 18.24 N ATOM 953 CA ILE A1110 11.042 -0.695 21.075 1.00 16.82 C ATOM 954 C ILE A1110 10.622 0.050 19.813 1.00 16.45 C ATOM 955 O ILE A1110 11.462 0.438 18.987 1.00 17.58 O ATOM 956 CB ILE A1110 10.827 -2.215 20.848 1.00 18.22 C ATOM 957 CG1 ILE A1110 11.359 -3.008 22.043 1.00 19.27 C ATOM 958 CG2 ILE A1110 11.545 -2.665 19.585 1.00 16.35 C ATOM 959 CD1 ILE A1110 12.861 -2.896 22.243 1.00 21.56 C ATOM 960 N GLN A1111 9.319 0.251 19.666 1.00 12.23 N ATOM 961 CA GLN A1111 8.803 0.956 18.507 1.00 14.35 C ATOM 962 C GLN A1111 9.394 2.364 18.508 1.00 13.97 C ATOM 963 O GLN A1111 9.845 2.850 17.476 1.00 15.39 O ATOM 964 CB GLN A1111 7.275 1.005 18.552 1.00 11.70 C ATOM 965 CG GLN A1111 6.619 1.711 17.375 1.00 13.42 C ATOM 966 CD GLN A1111 6.802 0.980 16.058 1.00 12.62 C ATOM 967 OE1 GLN A1111 6.654 -0.235 15.989 1.00 14.80 O ATOM 968 NE2 GLN A1111 7.106 1.725 14.999 1.00 13.59 N ATOM 969 N MET A1112 9.396 3.016 19.668 1.00 15.14 N ATOM 970 CA MET A1112 9.956 4.365 19.775 1.00 14.61 C ATOM 971 C MET A1112 11.439 4.364 19.413 1.00 13.07 C ATOM 972 O MET A1112 11.902 5.194 18.644 1.00 12.68 O ATOM 973 CB MET A1112 9.813 4.906 21.199 1.00 17.50 C ATOM 974 CG MET A1112 8.425 5.349 21.593 1.00 20.95 C ATOM 975 SD MET A1112 8.474 6.204 23.181 1.00 21.92 S ATOM 976 CE MET A1112 8.326 4.853 24.294 1.00 22.07 C ATOM 977 N ALA A1113 12.181 3.426 19.983 1.00 11.49 N ATOM 978 CA ALA A1113 13.601 3.334 19.714 1.00 11.68 C ATOM 979 C ALA A1113 13.858 3.256 18.216 1.00 11.82 C ATOM 980 O ALA A1113 14.632 4.042 17.674 1.00 12.33 O ATOM 981 CB ALA A1113 14.177 2.120 20.409 1.00 12.42 C ATOM 982 N ALA A1114 13.200 2.306 17.555 1.00 12.68 N ATOM 983 CA ALA A1114 13.337 2.107 16.113 1.00 11.39 C ATOM 984 C ALA A1114 13.004 3.351 15.288 1.00 12.10 C ATOM 985 O ALA A1114 13.731 3.696 14.355 1.00 12.81 O ATOM 986 CB ALA A1114 12.455 0.947 15.661 1.00 10.30 C ATOM 987 N GLU A1115 11.907 4.021 15.625 1.00 10.88 N ATOM 988 CA GLU A1115 11.516 5.216 14.895 1.00 12.13 C ATOM 989 C GLU A1115 12.557 6.318 15.059 1.00 12.45 C ATOM 990 O GLU A1115 12.925 6.987 14.092 1.00 13.24 O ATOM 991 CB GLU A1115 10.139 5.681 15.369 1.00 9.83 C ATOM 992 CG GLU A1115 9.103 4.581 15.243 1.00 12.94 C ATOM 993 CD GLU A1115 7.708 5.007 15.643 1.00 14.49 C ATOM 994 OE1 GLU A1115 7.573 5.754 16.632 1.00 17.45 O ATOM 995 OE2 GLU A1115 6.745 4.577 14.977 1.00 12.39 O ATOM 996 N ILE A1116 13.033 6.498 16.285 1.00 13.09 N ATOM 997 CA ILE A1116 14.039 7.509 16.576 1.00 10.65 C ATOM 998 C ILE A1116 15.331 7.159 15.847 1.00 12.29 C ATOM 999 O ILE A1116 15.983 8.031 15.267 1.00 12.32 O ATOM 1000 CB ILE A1116 14.312 7.592 18.097 1.00 8.91 C ATOM 1001 CG1 ILE A1116 13.032 8.010 18.830 1.00 9.20 C ATOM 1002 CG2 ILE A1116 15.422 8.588 18.382 1.00 6.10 C ATOM 1003 CD1 ILE A1116 13.139 7.972 20.347 1.00 8.23 C ATOM 1004 N ALA A1117 15.695 5.879 15.871 1.00 11.27 N ATOM 1005 CA ALA A1117 16.920 5.430 15.207 1.00 13.25 C ATOM 1006 C ALA A1117 16.817 5.579 13.696 1.00 13.84 C ATOM 1007 O ALA A1117 17.797 5.923 13.021 1.00 13.38 O ATOM 1008 CB ALA A1117 17.215 3.971 15.565 1.00 12.07 C ATOM 1009 N ASP A1118 15.623 5.313 13.175 1.00 14.65 N ATOM 1010 CA ASP A1118 15.371 5.410 11.745 1.00 14.84 C ATOM 1011 C ASP A1118 15.537 6.854 11.277 1.00 13.88 C ATOM 1012 O ASP A1118 16.175 7.108 10.261 1.00 13.59 O ATOM 1013 CB ASP A1118 13.960 4.911 11.419 1.00 14.69 C ATOM 1014 CG ASP A1118 13.738 4.727 9.928 1.00 15.54 C ATOM 1015 OD1 ASP A1118 12.830 5.381 9.369 1.00 14.66 O ATOM 1016 OD2 ASP A1118 14.476 3.923 9.316 1.00 13.70 O ATOM 1017 N GLY A1119 14.961 7.793 12.021 1.00 13.31 N ATOM 1018 CA GLY A1119 15.083 9.190 11.662 1.00 12.21 C ATOM 1019 C GLY A1119 16.538 9.619 11.722 1.00 13.01 C ATOM 1020 O GLY A1119 17.021 10.329 10.843 1.00 13.47 O ATOM 1021 N MET A1120 17.252 9.192 12.758 1.00 13.00 N ATOM 1022 CA MET A1120 18.659 9.555 12.874 1.00 11.33 C ATOM 1023 C MET A1120 19.473 8.993 11.705 1.00 11.76 C ATOM 1024 O MET A1120 20.332 9.683 11.161 1.00 13.17 O ATOM 1025 CB MET A1120 19.234 9.065 14.204 1.00 9.90 C ATOM 1026 CG MET A1120 18.721 9.831 15.424 1.00 10.13 C ATOM 1027 SD MET A1120 18.997 11.627 15.339 1.00 11.34 S ATOM 1028 CE MET A1120 20.780 11.674 15.246 1.00 5.95 C ATOM 1029 N ALA A1121 19.198 7.750 11.317 1.00 11.25 N ATOM 1030 CA ALA A1121 19.906 7.119 10.208 1.00 11.57 C ATOM 1031 C ALA A1121 19.692 7.925 8.928 1.00 13.63 C ATOM 1032 O ALA A1121 20.609 8.076 8.115 1.00 13.57 O ATOM 1033 CB ALA A1121 19.413 5.685 10.012 1.00 12.76 C ATOM 1034 N TYR A1122 18.476 8.438 8.757 1.00 11.86 N ATOM 1035 CA TYR A1122 18.150 9.244 7.586 1.00 13.70 C ATOM 1036 C TYR A1122 18.991 10.520 7.567 1.00 12.98 C ATOM 1037 O TYR A1122 19.577 10.887 6.539 1.00 11.13 O ATOM 1038 CB TYR A1122 16.670 9.628 7.594 1.00 12.89 C ATOM 1039 CG TYR A1122 16.262 10.468 6.404 1.00 14.79 C ATOM 1040 CD1 TYR A1122 16.025 9.883 5.152 1.00 15.29 C ATOM 1041 CD2 TYR A1122 16.119 11.852 6.521 1.00 15.01 C ATOM 1042 CE1 TYR A1122 15.649 10.659 4.053 1.00 14.45 C ATOM 1043 CE2 TYR A1122 15.744 12.632 5.430 1.00 13.87 C ATOM 1044 CZ TYR A1122 15.509 12.032 4.202 1.00 13.85 C ATOM 1045 OH TYR A1122 15.116 12.810 3.132 1.00 18.55 O ATOM 1046 N LEU A1123 19.040 11.190 8.714 1.00 11.81 N ATOM 1047 CA LEU A1123 19.804 12.416 8.855 1.00 13.21 C ATOM 1048 C LEU A1123 21.274 12.180 8.591 1.00 15.90 C ATOM 1049 O LEU A1123 21.918 12.959 7.890 1.00 15.58 O ATOM 1050 CB LEU A1123 19.645 12.970 10.256 1.00 13.14 C ATOM 1051 CG LEU A1123 18.229 13.414 10.589 1.00 15.78 C ATOM 1052 CD1 LEU A1123 18.160 13.781 12.064 1.00 16.08 C ATOM 1053 CD2 LEU A1123 17.844 14.595 9.702 1.00 13.96 C ATOM 1054 N ASN A1124 21.801 11.102 9.164 1.00 17.67 N ATOM 1055 CA ASN A1124 23.204 10.766 8.995 1.00 18.08 C ATOM 1056 C ASN A1124 23.494 10.472 7.527 1.00 17.16 C ATOM 1057 O ASN A1124 24.530 10.875 7.000 1.00 16.78 O ATOM 1058 CB ASN A1124 23.573 9.565 9.873 1.00 20.73 C ATOM 1059 CG ASN A1124 25.031 9.148 9.714 1.00 24.32 C ATOM 1060 OD1 ASN A1124 25.322 8.017 9.324 1.00 24.74 O ATOM 1061 ND2 ASN A1124 25.951 10.065 10.009 1.00 24.98 N ATOM 1062 N ALA A1125 22.584 9.772 6.862 1.00 15.86 N ATOM 1063 CA ALA A1125 22.779 9.477 5.446 1.00 16.87 C ATOM 1064 C ALA A1125 22.799 10.796 4.667 1.00 17.45 C ATOM 1065 O ALA A1125 23.423 10.902 3.612 1.00 17.78 O ATOM 1066 CB ALA A1125 21.657 8.577 4.930 1.00 14.96 C ATOM 1067 N LYS A1126 22.111 11.799 5.205 1.00 17.59 N ATOM 1068 CA LYS A1126 22.038 13.117 4.583 1.00 19.14 C ATOM 1069 C LYS A1126 23.236 13.978 4.956 1.00 19.88 C ATOM 1070 O LYS A1126 23.299 15.152 4.597 1.00 20.38 O ATOM 1071 CB LYS A1126 20.748 13.835 5.000 1.00 18.80 C ATOM 1072 CG LYS A1126 19.487 13.275 4.368 1.00 17.45 C ATOM 1073 CD LYS A1126 19.487 13.507 2.875 1.00 16.87 C ATOM 1074 CE LYS A1126 18.369 12.744 2.209 1.00 18.33 C ATOM 1075 NZ LYS A1126 18.370 12.959 0.734 1.00 21.26 N ATOM 1076 N LYS A1127 24.176 13.388 5.685 1.00 21.00 N ATOM 1077 CA LYS A1127 25.387 14.081 6.114 1.00 23.17 C ATOM 1078 C LYS A1127 25.197 15.031 7.285 1.00 23.56 C ATOM 1079 O LYS A1127 25.987 15.962 7.475 1.00 24.03 O ATOM 1080 CB LYS A1127 26.020 14.852 4.950 1.00 24.38 C ATOM 1081 CG LYS A1127 27.094 14.089 4.210 1.00 28.40 C ATOM 1082 CD LYS A1127 26.525 13.073 3.240 1.00 31.85 C ATOM 1083 CE LYS A1127 27.653 12.271 2.608 1.00 33.32 C ATOM 1084 NZ LYS A1127 28.798 13.149 2.227 1.00 35.13 N ATOM 1085 N PHE A1128 24.154 14.807 8.074 1.00 23.98 N ATOM 1086 CA PHE A1128 23.923 15.663 9.228 1.00 23.45 C ATOM 1087 C PHE A1128 24.210 14.950 10.539 1.00 23.21 C ATOM 1088 O PHE A1128 23.761 13.826 10.761 1.00 23.91 O ATOM 1089 CB PHE A1128 22.482 16.178 9.261 1.00 22.01 C ATOM 1090 CG PHE A1128 22.150 17.119 8.152 1.00 21.49 C ATOM 1091 CD1 PHE A1128 21.834 16.637 6.885 1.00 22.04 C ATOM 1092 CD2 PHE A1128 22.168 18.494 8.365 1.00 21.57 C ATOM 1093 CE1 PHE A1128 21.539 17.516 5.843 1.00 20.37 C ATOM 1094 CE2 PHE A1128 21.876 19.383 7.332 1.00 20.17 C ATOM 1095 CZ PHE A1128 21.560 18.894 6.069 1.00 20.54 C ATOM 1096 N VAL A1129 24.971 15.613 11.397 1.00 20.87 N ATOM 1097 CA VAL A1129 25.273 15.092 12.718 1.00 20.79 C ATOM 1098 C VAL A1129 24.387 15.997 13.586 1.00 19.10 C ATOM 1099 O VAL A1129 24.530 17.219 13.557 1.00 19.29 O ATOM 1100 CB VAL A1129 26.777 15.281 13.067 1.00 23.27 C ATOM 1101 CG1 VAL A1129 27.129 14.513 14.327 1.00 25.12 C ATOM 1102 CG2 VAL A1129 27.646 14.781 11.920 1.00 22.90 C ATOM 1103 N HIS A1130 23.471 15.409 14.347 1.00 17.34 N ATOM 1104 CA HIS A1130 22.538 16.190 15.165 1.00 16.72 C ATOM 1105 C HIS A1130 23.131 17.082 16.264 1.00 16.50 C ATOM 1106 O HIS A1130 22.830 18.270 16.324 1.00 14.44 O ATOM 1107 CB HIS A1130 21.482 15.257 15.762 1.00 16.23 C ATOM 1108 CG HIS A1130 20.256 15.963 16.249 1.00 17.07 C ATOM 1109 ND1 HIS A1130 20.246 16.740 17.388 1.00 17.43 N ATOM 1110 CD2 HIS A1130 19.001 16.017 15.744 1.00 16.88 C ATOM 1111 CE1 HIS A1130 19.036 17.240 17.565 1.00 16.48 C ATOM 1112 NE2 HIS A1130 18.261 16.816 16.581 1.00 17.29 N ATOM 1113 N ARG A1131 23.960 16.507 17.130 1.00 19.76 N ATOM 1114 CA ARG A1131 24.609 17.236 18.226 1.00 20.17 C ATOM 1115 C ARG A1131 23.734 17.539 19.426 1.00 19.70 C ATOM 1116 O ARG A1131 24.243 17.986 20.458 1.00 20.88 O ATOM 1117 CB ARG A1131 25.205 18.564 17.746 1.00 22.69 C ATOM 1118 CG ARG A1131 26.419 18.442 16.867 1.00 26.80 C ATOM 1119 CD ARG A1131 27.022 19.793 16.552 1.00 33.08 C ATOM 1120 NE ARG A1131 27.699 19.745 15.262 1.00 41.74 N ATOM 1121 CZ ARG A1131 27.065 19.661 14.095 1.00 45.51 C ATOM 1122 NH1 ARG A1131 25.741 19.625 14.057 1.00 46.88 N ATOM 1123 NH2 ARG A1131 27.754 19.590 12.966 1.00 49.00 N ATOM 1124 N ASP A1132 22.430 17.308 19.315 1.00 18.16 N ATOM 1125 CA ASP A1132 21.548 17.615 20.434 1.00 17.57 C ATOM 1126 C ASP A1132 20.378 16.642 20.551 1.00 15.77 C ATOM 1127 O ASP A1132 19.254 17.025 20.873 1.00 13.15 O ATOM 1128 CB ASP A1132 21.050 19.063 20.298 1.00 21.19 C ATOM 1129 CG ASP A1132 20.486 19.622 21.600 1.00 26.52 C ATOM 1130 OD1 ASP A1132 20.627 18.975 22.665 1.00 24.81 O ATOM 1131 OD2 ASP A1132 19.906 20.728 21.558 1.00 29.87 O ATOM 1132 N LEU A1133 20.646 15.371 20.290 1.00 15.86 N ATOM 1133 CA LEU A1133 19.603 14.369 20.395 1.00 14.22 C ATOM 1134 C LEU A1133 19.252 14.169 21.867 1.00 15.37 C ATOM 1135 O LEU A1133 20.121 13.913 22.699 1.00 15.51 O ATOM 1136 CB LEU A1133 20.063 13.051 19.787 1.00 11.35 C ATOM 1137 CG LEU A1133 19.017 11.936 19.866 1.00 9.86 C ATOM 1138 CD1 LEU A1133 17.717 12.395 19.212 1.00 8.46 C ATOM 1139 CD2 LEU A1133 19.561 10.687 19.187 1.00 10.29 C ATOM 1140 N ALA A1134 17.968 14.298 22.176 1.00 15.68 N ATOM 1141 CA ALA A1134 17.460 14.146 23.531 1.00 13.68 C ATOM 1142 C ALA A1134 15.948 14.031 23.393 1.00 14.19 C ATOM 1143 O ALA A1134 15.397 14.358 22.343 1.00 14.17 O ATOM 1144 CB ALA A1134 17.828 15.359 24.373 1.00 7.91 C ATOM 1145 N ALA A1135 15.274 13.566 24.439 1.00 14.85 N ATOM 1146 CA ALA A1135 13.832 13.406 24.361 1.00 14.84 C ATOM 1147 C ALA A1135 13.143 14.731 24.048 1.00 16.62 C ATOM 1148 O ALA A1135 12.175 14.764 23.290 1.00 15.48 O ATOM 1149 CB ALA A1135 13.303 12.824 25.647 1.00 14.41 C ATOM 1150 N ARG A1136 13.645 15.823 24.624 1.00 17.48 N ATOM 1151 CA ARG A1136 13.050 17.136 24.379 1.00 19.71 C ATOM 1152 C ARG A1136 13.089 17.474 22.890 1.00 18.10 C ATOM 1153 O ARG A1136 12.247 18.217 22.392 1.00 19.60 O ATOM 1154 CB ARG A1136 13.783 18.231 25.168 1.00 21.23 C ATOM 1155 CG ARG A1136 15.253 18.391 24.793 1.00 26.50 C ATOM 1156 CD ARG A1136 15.909 19.624 25.440 1.00 28.97 C ATOM 1157 NE ARG A1136 17.349 19.658 25.161 1.00 33.66 N ATOM 1158 CZ ARG A1136 18.255 18.866 25.740 1.00 33.39 C ATOM 1159 NH1 ARG A1136 17.887 17.974 26.654 1.00 31.00 N ATOM 1160 NH2 ARG A1136 19.532 18.938 25.380 1.00 30.84 N ATOM 1161 N ASN A1137 14.064 16.930 22.174 1.00 16.42 N ATOM 1162 CA ASN A1137 14.156 17.229 20.759 1.00 16.82 C ATOM 1163 C ASN A1137 13.526 16.186 19.841 1.00 17.33 C ATOM 1164 O ASN A1137 13.799 16.145 18.645 1.00 18.96 O ATOM 1165 CB ASN A1137 15.609 17.529 20.377 1.00 14.03 C ATOM 1166 CG ASN A1137 16.087 18.861 20.947 1.00 15.07 C ATOM 1167 OD1 ASN A1137 15.327 19.832 20.983 1.00 17.96 O ATOM 1168 ND2 ASN A1137 17.341 18.916 21.386 1.00 11.04 N ATOM 1169 N CYS A1138 12.674 15.347 20.421 1.00 18.00 N ATOM 1170 CA CYS A1138 11.931 14.337 19.673 1.00 17.02 C ATOM 1171 C CYS A1138 10.464 14.686 19.884 1.00 16.80 C ATOM 1172 O CYS A1138 10.101 15.248 20.919 1.00 14.39 O ATOM 1173 CB CYS A1138 12.214 12.932 20.198 1.00 15.86 C ATOM 1174 SG CYS A1138 13.867 12.356 19.821 1.00 14.02 S ATOM 1175 N MET A1139 9.624 14.354 18.910 1.00 15.69 N ATOM 1176 CA MET A1139 8.216 14.683 19.001 1.00 15.72 C ATOM 1177 C MET A1139 7.314 13.483 18.814 1.00 14.93 C ATOM 1178 O MET A1139 7.724 12.465 18.259 1.00 15.96 O ATOM 1179 CB MET A1139 7.887 15.753 17.973 1.00 18.26 C ATOM 1180 CG MET A1139 8.958 16.804 17.887 1.00 21.54 C ATOM 1181 SD MET A1139 8.279 18.436 17.762 1.00 30.55 S ATOM 1182 CE MET A1139 7.904 18.686 19.535 1.00 28.37 C ATOM 1183 N VAL A1140 6.078 13.622 19.279 1.00 13.53 N ATOM 1184 CA VAL A1140 5.097 12.553 19.215 1.00 11.86 C ATOM 1185 C VAL A1140 3.850 12.974 18.457 1.00 12.66 C ATOM 1186 O VAL A1140 3.190 13.943 18.823 1.00 13.56 O ATOM 1187 CB VAL A1140 4.667 12.130 20.635 1.00 11.91 C ATOM 1188 CG1 VAL A1140 3.790 10.880 20.561 1.00 9.98 C ATOM 1189 CG2 VAL A1140 5.904 11.904 21.513 1.00 7.54 C ATOM 1190 N ALA A1141 3.531 12.230 17.405 1.00 13.60 N ATOM 1191 CA ALA A1141 2.364 12.515 16.583 1.00 15.00 C ATOM 1192 C ALA A1141 1.049 12.031 17.210 1.00 16.34 C ATOM 1193 O ALA A1141 1.029 11.413 18.282 1.00 14.42 O ATOM 1194 CB ALA A1141 2.550 11.883 15.211 1.00 13.95 C ATOM 1195 N HIS A1142 -0.051 12.315 16.525 1.00 19.66 N ATOM 1196 CA HIS A1142 -1.379 11.922 16.995 1.00 22.96 C ATOM 1197 C HIS A1142 -1.508 10.411 17.187 1.00 21.28 C ATOM 1198 O HIS A1142 -2.220 9.950 18.082 1.00 20.82 O ATOM 1199 CB HIS A1142 -2.447 12.415 16.010 1.00 26.27 C ATOM 1200 CG HIS A1142 -2.324 11.827 14.636 1.00 32.63 C ATOM 1201 ND1 HIS A1142 -2.909 10.629 14.282 1.00 34.86 N ATOM 1202 CD2 HIS A1142 -1.672 12.266 13.534 1.00 34.82 C ATOM 1203 CE1 HIS A1142 -2.624 10.357 13.021 1.00 35.35 C ATOM 1204 NE2 HIS A1142 -1.873 11.335 12.544 1.00 36.67 N ATOM 1205 N ASP A1143 -0.818 9.644 16.348 1.00 19.51 N ATOM 1206 CA ASP A1143 -0.876 8.191 16.435 1.00 19.82 C ATOM 1207 C ASP A1143 0.286 7.643 17.254 1.00 19.96 C ATOM 1208 O ASP A1143 0.583 6.449 17.210 1.00 22.00 O ATOM 1209 CB ASP A1143 -0.869 7.577 15.031 1.00 19.09 C ATOM 1210 CG ASP A1143 0.456 7.767 14.304 1.00 18.54 C ATOM 1211 OD1 ASP A1143 1.305 8.565 14.760 1.00 16.39 O ATOM 1212 OD2 ASP A1143 0.642 7.112 13.257 1.00 18.84 O ATOM 1213 N PHE A1144 0.938 8.536 17.994 1.00 18.55 N ATOM 1214 CA PHE A1144 2.066 8.197 18.855 1.00 18.12 C ATOM 1215 C PHE A1144 3.372 7.845 18.162 1.00 18.11 C ATOM 1216 O PHE A1144 4.297 7.325 18.789 1.00 17.87 O ATOM 1217 CB PHE A1144 1.666 7.085 19.820 1.00 17.80 C ATOM 1218 CG PHE A1144 0.471 7.435 20.637 1.00 19.62 C ATOM 1219 CD1 PHE A1144 -0.793 6.981 20.273 1.00 18.16 C ATOM 1220 CD2 PHE A1144 0.590 8.311 21.716 1.00 18.42 C ATOM 1221 CE1 PHE A1144 -1.923 7.400 20.965 1.00 20.62 C ATOM 1222 CE2 PHE A1144 -0.534 8.737 22.415 1.00 18.54 C ATOM 1223 CZ PHE A1144 -1.794 8.282 22.037 1.00 19.69 C ATOM 1224 N THR A1145 3.455 8.128 16.870 1.00 16.90 N ATOM 1225 CA THR A1145 4.683 7.869 16.147 1.00 14.92 C ATOM 1226 C THR A1145 5.688 8.913 16.626 1.00 15.47 C ATOM 1227 O THR A1145 5.381 10.107 16.683 1.00 16.13 O ATOM 1228 CB THR A1145 4.490 8.039 14.645 1.00 15.23 C ATOM 1229 OG1 THR A1145 3.400 7.221 14.212 1.00 18.02 O ATOM 1230 CG2 THR A1145 5.755 7.628 13.903 1.00 15.12 C ATOM 1231 N VAL A1146 6.888 8.474 16.975 1.00 15.09 N ATOM 1232 CA VAL A1146 7.906 9.407 17.437 1.00 14.46 C ATOM 1233 C VAL A1146 8.809 9.812 16.271 1.00 14.53 C ATOM 1234 O VAL A1146 9.204 8.972 15.469 1.00 14.87 O ATOM 1235 CB VAL A1146 8.736 8.771 18.578 1.00 12.50 C ATOM 1236 CG1 VAL A1146 9.780 9.757 19.107 1.00 9.66 C ATOM 1237 CG2 VAL A1146 7.800 8.358 19.694 1.00 13.35 C ATOM 1238 N LYS A1147 9.128 11.101 16.176 1.00 15.05 N ATOM 1239 CA LYS A1147 9.982 11.596 15.095 1.00 13.71 C ATOM 1240 C LYS A1147 11.025 12.580 15.617 1.00 13.04 C ATOM 1241 O LYS A1147 10.824 13.229 16.646 1.00 11.27 O ATOM 1242 CB LYS A1147 9.130 12.294 14.024 1.00 13.41 C ATOM 1243 CG LYS A1147 7.904 11.498 13.574 1.00 12.60 C ATOM 1244 CD LYS A1147 7.164 12.204 12.456 1.00 8.22 C ATOM 1245 CE LYS A1147 5.914 11.441 12.054 1.00 12.75 C ATOM 1246 NZ LYS A1147 5.336 11.989 10.797 1.00 15.84 N ATOM 1247 N ILE A1148 12.142 12.684 14.903 1.00 13.32 N ATOM 1248 CA ILE A1148 13.203 13.612 15.276 1.00 11.76 C ATOM 1249 C ILE A1148 12.670 14.994 14.909 1.00 12.91 C ATOM 1250 O ILE A1148 12.148 15.177 13.811 1.00 12.07 O ATOM 1251 CB ILE A1148 14.503 13.362 14.467 1.00 9.76 C ATOM 1252 CG1 ILE A1148 14.899 11.881 14.534 1.00 7.72 C ATOM 1253 CG2 ILE A1148 15.617 14.273 14.989 1.00 5.48 C ATOM 1254 CD1 ILE A1148 15.246 11.387 15.918 1.00 7.39 C ATOM 1255 N GLY A1149 12.798 15.956 15.820 1.00 14.56 N ATOM 1256 CA GLY A1149 12.307 17.298 15.559 1.00 17.02 C ATOM 1257 C GLY A1149 12.910 17.956 14.331 1.00 20.50 C ATOM 1258 O GLY A1149 12.186 18.348 13.409 1.00 22.99 O ATOM 1259 N ASP A1150 14.233 18.082 14.302 1.00 22.28 N ATOM 1260 CA ASP A1150 14.901 18.707 13.161 1.00 24.15 C ATOM 1261 C ASP A1150 16.258 18.078 12.848 1.00 24.16 C ATOM 1262 O ASP A1150 16.607 17.044 13.403 1.00 25.96 O ATOM 1263 CB ASP A1150 15.051 20.211 13.407 1.00 24.37 C ATOM 1264 CG ASP A1150 15.473 20.525 14.824 1.00 26.28 C ATOM 1265 OD1 ASP A1150 16.566 20.082 15.237 1.00 27.64 O ATOM 1266 OD2 ASP A1150 14.705 21.211 15.526 1.00 26.09 O ATOM 1267 N PHE A1151 17.021 18.705 11.958 1.00 26.37 N ATOM 1268 CA PHE A1151 18.317 18.168 11.564 1.00 28.03 C ATOM 1269 C PHE A1151 19.453 18.414 12.560 1.00 30.38 C ATOM 1270 O PHE A1151 20.614 18.114 12.279 1.00 28.12 O ATOM 1271 CB PHE A1151 18.696 18.689 10.168 1.00 27.18 C ATOM 1272 CG PHE A1151 18.763 20.189 10.066 1.00 27.57 C ATOM 1273 CD1 PHE A1151 19.851 20.890 10.577 1.00 27.38 C ATOM 1274 CD2 PHE A1151 17.735 20.900 9.457 1.00 25.97 C ATOM 1275 CE1 PHE A1151 19.914 22.279 10.480 1.00 26.41 C ATOM 1276 CE2 PHE A1151 17.785 22.282 9.356 1.00 27.15 C ATOM 1277 CZ PHE A1151 18.879 22.976 9.869 1.00 27.48 C ATOM 1278 N GLY A1152 19.122 18.956 13.727 1.00 33.08 N ATOM 1279 CA GLY A1152 20.153 19.187 14.720 1.00 38.23 C ATOM 1280 C GLY A1152 20.287 20.612 15.208 1.00 42.47 C ATOM 1281 O GLY A1152 19.601 21.519 14.735 1.00 42.69 O ATOM 1282 N MET A1153 21.185 20.802 16.168 1.00 47.55 N ATOM 1283 CA MET A1153 21.429 22.114 16.743 1.00 52.43 C ATOM 1284 C MET A1153 22.330 22.947 15.846 1.00 54.08 C ATOM 1285 O MET A1153 23.453 22.556 15.524 1.00 54.49 O ATOM 1286 CB MET A1153 22.063 21.987 18.127 1.00 55.73 C ATOM 1287 CG MET A1153 22.332 23.327 18.793 1.00 60.03 C ATOM 1288 SD MET A1153 22.983 23.147 20.458 1.00 65.47 S ATOM 1289 CE MET A1153 21.467 23.306 21.442 1.00 65.48 C ATOM 1290 N THR A1154 21.815 24.103 15.452 1.00 54.88 N ATOM 1291 CA THR A1154 22.527 25.024 14.586 1.00 54.61 C ATOM 1292 C THR A1154 23.480 25.906 15.389 1.00 54.07 C ATOM 1293 O THR A1154 23.623 27.097 15.118 1.00 53.18 O ATOM 1294 CB THR A1154 21.516 25.895 13.827 1.00 55.18 C ATOM 1295 OG1 THR A1154 20.492 26.327 14.732 1.00 53.72 O ATOM 1296 CG2 THR A1154 20.871 25.100 12.703 1.00 54.85 C ATOM 1297 N LEU A1171 26.894 22.521 25.797 1.00 33.12 N ATOM 1298 CA LEU A1171 25.550 22.787 26.312 1.00 32.61 C ATOM 1299 C LEU A1171 24.846 21.545 26.877 1.00 31.42 C ATOM 1300 O LEU A1171 24.733 21.388 28.090 1.00 32.49 O ATOM 1301 N PRO A1172 24.363 20.646 25.997 1.00 29.93 N ATOM 1302 CA PRO A1172 23.667 19.418 26.410 1.00 28.68 C ATOM 1303 C PRO A1172 24.598 18.410 27.107 1.00 29.04 C ATOM 1304 O PRO A1172 24.609 17.210 26.790 1.00 27.67 O ATOM 1305 CB PRO A1172 23.103 18.893 25.094 1.00 27.34 C ATOM 1306 CG PRO A1172 24.167 19.289 24.109 1.00 27.11 C ATOM 1307 CD PRO A1172 24.489 20.710 24.529 1.00 28.27 C ATOM 1308 N VAL A1173 25.365 18.925 28.064 1.00 26.73 N ATOM 1309 CA VAL A1173 26.334 18.157 28.840 1.00 24.95 C ATOM 1310 C VAL A1173 25.903 16.751 29.256 1.00 23.25 C ATOM 1311 O VAL A1173 26.630 15.780 29.030 1.00 21.47 O ATOM 1312 CB VAL A1173 26.749 18.965 30.102 1.00 25.55 C ATOM 1313 CG1 VAL A1173 27.471 18.085 31.095 1.00 25.37 C ATOM 1314 CG2 VAL A1173 27.646 20.128 29.684 1.00 24.90 C ATOM 1315 N ARG A1174 24.726 16.644 29.861 1.00 21.05 N ATOM 1316 CA ARG A1174 24.221 15.360 30.323 1.00 18.94 C ATOM 1317 C ARG A1174 23.882 14.380 29.199 1.00 18.05 C ATOM 1318 O ARG A1174 23.581 13.220 29.460 1.00 18.79 O ATOM 1319 CB ARG A1174 22.999 15.584 31.219 1.00 19.72 C ATOM 1320 CG ARG A1174 23.330 16.312 32.513 1.00 22.49 C ATOM 1321 CD ARG A1174 22.111 16.958 33.158 1.00 22.83 C ATOM 1322 NE ARG A1174 22.514 17.888 34.209 1.00 25.73 N ATOM 1323 CZ ARG A1174 22.853 17.534 35.447 1.00 28.30 C ATOM 1324 NH1 ARG A1174 22.830 16.257 35.820 1.00 27.64 N ATOM 1325 NH2 ARG A1174 23.243 18.461 36.313 1.00 28.91 N ATOM 1326 N TRP A1175 23.942 14.846 27.955 1.00 17.13 N ATOM 1327 CA TRP A1175 23.631 14.016 26.787 1.00 16.50 C ATOM 1328 C TRP A1175 24.839 13.806 25.864 1.00 17.24 C ATOM 1329 O TRP A1175 24.764 13.062 24.886 1.00 16.07 O ATOM 1330 CB TRP A1175 22.505 14.670 25.972 1.00 16.29 C ATOM 1331 CG TRP A1175 21.108 14.451 26.513 1.00 14.74 C ATOM 1332 CD1 TRP A1175 20.186 13.549 26.060 1.00 13.10 C ATOM 1333 CD2 TRP A1175 20.495 15.130 27.613 1.00 13.93 C ATOM 1334 NE1 TRP A1175 19.036 13.624 26.810 1.00 14.74 N ATOM 1335 CE2 TRP A1175 19.198 14.586 27.772 1.00 15.18 C ATOM 1336 CE3 TRP A1175 20.912 16.145 28.483 1.00 15.36 C ATOM 1337 CZ2 TRP A1175 18.317 15.022 28.767 1.00 13.69 C ATOM 1338 CZ3 TRP A1175 20.032 16.580 29.477 1.00 15.75 C ATOM 1339 CH2 TRP A1175 18.751 16.016 29.608 1.00 13.23 C ATOM 1340 N MET A1176 25.948 14.464 26.181 1.00 16.26 N ATOM 1341 CA MET A1176 27.141 14.378 25.358 1.00 17.21 C ATOM 1342 C MET A1176 28.061 13.199 25.638 1.00 17.96 C ATOM 1343 O MET A1176 28.195 12.753 26.777 1.00 19.32 O ATOM 1344 CB MET A1176 27.928 15.678 25.483 1.00 16.65 C ATOM 1345 CG MET A1176 27.196 16.870 24.915 1.00 17.72 C ATOM 1346 SD MET A1176 27.920 18.400 25.439 1.00 23.11 S ATOM 1347 CE MET A1176 29.460 18.374 24.493 1.00 18.73 C ATOM 1348 N ALA A1177 28.691 12.705 24.575 1.00 17.36 N ATOM 1349 CA ALA A1177 29.625 11.592 24.667 1.00 18.59 C ATOM 1350 C ALA A1177 30.919 12.113 25.279 1.00 20.13 C ATOM 1351 O ALA A1177 31.241 13.297 25.155 1.00 19.30 O ATOM 1352 CB ALA A1177 29.896 11.023 23.284 1.00 17.39 C ATOM 1353 N PRO A1178 31.682 11.234 25.942 1.00 21.11 N ATOM 1354 CA PRO A1178 32.948 11.620 26.575 1.00 20.59 C ATOM 1355 C PRO A1178 33.921 12.369 25.662 1.00 18.62 C ATOM 1356 O PRO A1178 34.504 13.371 26.075 1.00 17.82 O ATOM 1357 CB PRO A1178 33.511 10.283 27.066 1.00 21.17 C ATOM 1358 CG PRO A1178 32.915 9.284 26.098 1.00 20.86 C ATOM 1359 CD PRO A1178 31.495 9.773 26.001 1.00 20.48 C ATOM 1360 N GLU A1179 34.095 11.888 24.432 1.00 19.63 N ATOM 1361 CA GLU A1179 35.006 12.531 23.477 1.00 21.14 C ATOM 1362 C GLU A1179 34.502 13.910 23.056 1.00 22.64 C ATOM 1363 O GLU A1179 35.290 14.776 22.677 1.00 25.63 O ATOM 1364 CB GLU A1179 35.190 11.672 22.223 1.00 21.87 C ATOM 1365 CG GLU A1179 33.967 11.615 21.323 1.00 23.78 C ATOM 1366 CD GLU A1179 33.070 10.422 21.604 1.00 24.38 C ATOM 1367 OE1 GLU A1179 33.153 9.842 22.710 1.00 23.86 O ATOM 1368 OE2 GLU A1179 32.270 10.071 20.713 1.00 25.53 O ATOM 1369 N SER A1180 33.188 14.109 23.113 1.00 22.40 N ATOM 1370 CA SER A1180 32.609 15.400 22.762 1.00 22.39 C ATOM 1371 C SER A1180 32.910 16.338 23.920 1.00 21.97 C ATOM 1372 O SER A1180 33.283 17.488 23.722 1.00 19.19 O ATOM 1373 CB SER A1180 31.091 15.286 22.569 1.00 23.85 C ATOM 1374 OG SER A1180 30.768 14.503 21.430 1.00 22.76 O ATOM 1375 N LEU A1181 32.744 15.831 25.136 1.00 21.90 N ATOM 1376 CA LEU A1181 33.021 16.620 26.323 1.00 23.69 C ATOM 1377 C LEU A1181 34.509 16.956 26.361 1.00 26.51 C ATOM 1378 O LEU A1181 34.898 18.065 26.729 1.00 27.28 O ATOM 1379 CB LEU A1181 32.650 15.842 27.587 1.00 20.23 C ATOM 1380 CG LEU A1181 31.168 15.591 27.875 1.00 19.64 C ATOM 1381 CD1 LEU A1181 31.015 14.606 29.021 1.00 17.42 C ATOM 1382 CD2 LEU A1181 30.492 16.900 28.206 1.00 19.43 C ATOM 1383 N LYS A1182 35.336 15.992 25.970 1.00 28.27 N ATOM 1384 CA LYS A1182 36.779 16.172 25.994 1.00 31.53 C ATOM 1385 C LYS A1182 37.344 17.015 24.863 1.00 32.97 C ATOM 1386 O LYS A1182 37.804 18.132 25.079 1.00 33.77 O ATOM 1387 CB LYS A1182 37.485 14.808 25.994 1.00 33.17 C ATOM 1388 CG LYS A1182 38.999 14.895 26.179 1.00 33.41 C ATOM 1389 CD LYS A1182 39.663 13.530 26.166 1.00 33.30 C ATOM 1390 CE LYS A1182 41.150 13.657 26.444 1.00 31.74 C ATOM 1391 NZ LYS A1182 41.859 12.369 26.257 1.00 31.48 N ATOM 1392 N ASP A1183 37.311 16.468 23.657 1.00 35.04 N ATOM 1393 CA ASP A1183 37.861 17.147 22.499 1.00 36.91 C ATOM 1394 C ASP A1183 36.857 18.028 21.777 1.00 37.30 C ATOM 1395 O ASP A1183 37.209 18.728 20.830 1.00 37.54 O ATOM 1396 CB ASP A1183 38.432 16.112 21.527 1.00 39.46 C ATOM 1397 CG ASP A1183 39.367 15.119 22.211 1.00 42.73 C ATOM 1398 OD1 ASP A1183 40.315 15.567 22.897 1.00 44.83 O ATOM 1399 OD2 ASP A1183 39.157 13.892 22.058 1.00 41.66 O ATOM 1400 N GLY A1184 35.606 17.999 22.219 1.00 36.79 N ATOM 1401 CA GLY A1184 34.596 18.806 21.564 1.00 34.74 C ATOM 1402 C GLY A1184 34.321 18.317 20.154 1.00 34.68 C ATOM 1403 O GLY A1184 33.931 19.098 19.294 1.00 36.57 O ATOM 1404 N VAL A1185 34.528 17.025 19.910 1.00 34.33 N ATOM 1405 CA VAL A1185 34.284 16.452 18.587 1.00 32.60 C ATOM 1406 C VAL A1185 32.886 15.823 18.527 1.00 30.68 C ATOM 1407 O VAL A1185 32.488 15.090 19.436 1.00 29.21 O ATOM 1408 CB VAL A1185 35.335 15.350 18.228 1.00 34.28 C ATOM 1409 CG1 VAL A1185 36.727 15.809 18.620 1.00 34.82 C ATOM 1410 CG2 VAL A1185 34.993 14.032 18.914 1.00 34.57 C ATOM 1411 N PHE A1186 32.146 16.113 17.459 1.00 27.71 N ATOM 1412 CA PHE A1186 30.808 15.555 17.287 1.00 24.88 C ATOM 1413 C PHE A1186 30.702 14.709 16.023 1.00 23.34 C ATOM 1414 O PHE A1186 31.055 15.149 14.928 1.00 23.75 O ATOM 1415 CB PHE A1186 29.756 16.666 17.250 1.00 24.40 C ATOM 1416 CG PHE A1186 29.634 17.427 18.536 1.00 24.16 C ATOM 1417 CD1 PHE A1186 30.552 18.415 18.868 1.00 27.38 C ATOM 1418 CD2 PHE A1186 28.600 17.155 19.421 1.00 24.93 C ATOM 1419 CE1 PHE A1186 30.439 19.128 20.071 1.00 27.33 C ATOM 1420 CE2 PHE A1186 28.476 17.861 20.627 1.00 24.91 C ATOM 1421 CZ PHE A1186 29.396 18.848 20.950 1.00 25.03 C ATOM 1422 N THR A1187 30.211 13.486 16.188 1.00 21.54 N ATOM 1423 CA THR A1187 30.046 12.559 15.076 1.00 19.44 C ATOM 1424 C THR A1187 28.709 11.863 15.217 1.00 18.71 C ATOM 1425 O THR A1187 27.974 12.091 16.178 1.00 17.70 O ATOM 1426 CB THR A1187 31.116 11.460 15.093 1.00 20.65 C ATOM 1427 OG1 THR A1187 30.869 10.580 16.201 1.00 21.20 O ATOM 1428 CG2 THR A1187 32.512 12.066 15.234 1.00 21.27 C ATOM 1429 N THR A1188 28.392 11.008 14.256 1.00 18.84 N ATOM 1430 CA THR A1188 27.150 10.271 14.327 1.00 17.67 C ATOM 1431 C THR A1188 27.285 9.327 15.522 1.00 18.86 C ATOM 1432 O THR A1188 26.292 8.913 16.119 1.00 19.40 O ATOM 1433 CB THR A1188 26.901 9.472 13.045 1.00 16.79 C ATOM 1434 OG1 THR A1188 25.612 8.854 13.126 1.00 19.19 O ATOM 1435 CG2 THR A1188 27.976 8.404 12.850 1.00 13.54 C ATOM 1436 N SER A1189 28.526 8.997 15.873 1.00 19.05 N ATOM 1437 CA SER A1189 28.790 8.123 17.016 1.00 22.56 C ATOM 1438 C SER A1189 28.468 8.841 18.331 1.00 20.17 C ATOM 1439 O SER A1189 27.995 8.214 19.281 1.00 20.04 O ATOM 1440 CB SER A1189 30.251 7.671 17.021 1.00 23.70 C ATOM 1441 OG SER A1189 30.585 7.099 15.769 1.00 34.69 O ATOM 1442 N SER A1190 28.729 10.145 18.396 1.00 16.34 N ATOM 1443 CA SER A1190 28.401 10.873 19.613 1.00 16.32 C ATOM 1444 C SER A1190 26.874 11.026 19.661 1.00 15.72 C ATOM 1445 O SER A1190 26.282 11.215 20.728 1.00 15.63 O ATOM 1446 CB SER A1190 29.109 12.238 19.661 1.00 15.02 C ATOM 1447 OG SER A1190 29.014 12.944 18.440 1.00 15.85 O ATOM 1448 N ASP A1191 26.242 10.937 18.494 1.00 14.20 N ATOM 1449 CA ASP A1191 24.790 11.015 18.415 1.00 13.46 C ATOM 1450 C ASP A1191 24.224 9.698 18.950 1.00 12.02 C ATOM 1451 O ASP A1191 23.128 9.671 19.497 1.00 13.63 O ATOM 1452 CB ASP A1191 24.332 11.242 16.965 1.00 11.41 C ATOM 1453 CG ASP A1191 24.326 12.720 16.570 1.00 12.64 C ATOM 1454 OD1 ASP A1191 24.227 13.005 15.362 1.00 12.94 O ATOM 1455 OD2 ASP A1191 24.409 13.599 17.460 1.00 10.87 O ATOM 1456 N MET A1192 24.978 8.611 18.794 1.00 12.19 N ATOM 1457 CA MET A1192 24.545 7.294 19.272 1.00 11.81 C ATOM 1458 C MET A1192 24.549 7.297 20.796 1.00 11.21 C ATOM 1459 O MET A1192 23.655 6.743 21.443 1.00 11.56 O ATOM 1460 CB MET A1192 25.475 6.197 18.748 1.00 11.19 C ATOM 1461 CG MET A1192 25.054 4.793 19.137 1.00 12.00 C ATOM 1462 SD MET A1192 23.365 4.409 18.637 1.00 15.02 S ATOM 1463 CE MET A1192 23.484 4.502 16.847 1.00 13.40 C ATOM 1464 N TRP A1193 25.566 7.926 21.366 1.00 10.47 N ATOM 1465 CA TRP A1193 25.659 8.032 22.812 1.00 10.59 C ATOM 1466 C TRP A1193 24.378 8.725 23.301 1.00 12.21 C ATOM 1467 O TRP A1193 23.683 8.215 24.176 1.00 12.85 O ATOM 1468 CB TRP A1193 26.898 8.852 23.194 1.00 9.50 C ATOM 1469 CG TRP A1193 27.009 9.131 24.661 1.00 9.81 C ATOM 1470 CD1 TRP A1193 26.257 10.014 25.390 1.00 9.83 C ATOM 1471 CD2 TRP A1193 27.876 8.478 25.593 1.00 9.62 C ATOM 1472 NE1 TRP A1193 26.599 9.943 26.718 1.00 10.22 N ATOM 1473 CE2 TRP A1193 27.590 9.008 26.871 1.00 11.77 C ATOM 1474 CE3 TRP A1193 28.864 7.495 25.473 1.00 11.18 C ATOM 1475 CZ2 TRP A1193 28.258 8.584 28.024 1.00 12.87 C ATOM 1476 CZ3 TRP A1193 29.530 7.073 26.621 1.00 12.62 C ATOM 1477 CH2 TRP A1193 29.222 7.619 27.879 1.00 12.54 C ATOM 1478 N SER A1194 24.069 9.886 22.726 1.00 12.50 N ATOM 1479 CA SER A1194 22.870 10.632 23.106 1.00 13.48 C ATOM 1480 C SER A1194 21.634 9.755 22.952 1.00 14.43 C ATOM 1481 O SER A1194 20.741 9.757 23.798 1.00 16.74 O ATOM 1482 CB SER A1194 22.714 11.876 22.227 1.00 12.84 C ATOM 1483 OG SER A1194 23.864 12.700 22.305 1.00 13.38 O ATOM 1484 N PHE A1195 21.591 9.009 21.858 1.00 14.19 N ATOM 1485 CA PHE A1195 20.478 8.117 21.584 1.00 11.92 C ATOM 1486 C PHE A1195 20.273 7.212 22.797 1.00 12.89 C ATOM 1487 O PHE A1195 19.145 6.975 23.228 1.00 11.37 O ATOM 1488 CB PHE A1195 20.793 7.288 20.340 1.00 11.32 C ATOM 1489 CG PHE A1195 19.785 6.225 20.050 1.00 10.49 C ATOM 1490 CD1 PHE A1195 18.478 6.561 19.714 1.00 8.79 C ATOM 1491 CD2 PHE A1195 20.139 4.883 20.119 1.00 8.47 C ATOM 1492 CE1 PHE A1195 17.536 5.574 19.449 1.00 8.91 C ATOM 1493 CE2 PHE A1195 19.203 3.888 19.855 1.00 10.95 C ATOM 1494 CZ PHE A1195 17.897 4.236 19.519 1.00 7.02 C ATOM 1495 N GLY A1196 21.376 6.711 23.346 1.00 13.73 N ATOM 1496 CA GLY A1196 21.290 5.854 24.517 1.00 13.73 C ATOM 1497 C GLY A1196 20.633 6.559 25.692 1.00 14.97 C ATOM 1498 O GLY A1196 19.836 5.968 26.424 1.00 13.64 O ATOM 1499 N VAL A1197 20.966 7.832 25.878 1.00 14.96 N ATOM 1500 CA VAL A1197 20.390 8.609 26.966 1.00 15.74 C ATOM 1501 C VAL A1197 18.892 8.824 26.724 1.00 16.37 C ATOM 1502 O VAL A1197 18.110 8.960 27.674 1.00 17.34 O ATOM 1503 CB VAL A1197 21.098 9.968 27.102 1.00 16.01 C ATOM 1504 CG1 VAL A1197 20.498 10.764 28.267 1.00 12.59 C ATOM 1505 CG2 VAL A1197 22.588 9.744 27.300 1.00 12.43 C ATOM 1506 N VAL A1198 18.495 8.853 25.454 1.00 14.92 N ATOM 1507 CA VAL A1198 17.084 9.018 25.114 1.00 14.70 C ATOM 1508 C VAL A1198 16.355 7.755 25.570 1.00 14.68 C ATOM 1509 O VAL A1198 15.255 7.823 26.120 1.00 15.68 O ATOM 1510 CB VAL A1198 16.870 9.206 23.585 1.00 15.12 C ATOM 1511 CG1 VAL A1198 15.391 9.260 23.279 1.00 11.13 C ATOM 1512 CG2 VAL A1198 17.544 10.487 23.102 1.00 11.60 C ATOM 1513 N LEU A1199 16.975 6.601 25.339 1.00 16.53 N ATOM 1514 CA LEU A1199 16.389 5.330 25.758 1.00 16.13 C ATOM 1515 C LEU A1199 16.287 5.353 27.271 1.00 15.89 C ATOM 1516 O LEU A1199 15.286 4.954 27.855 1.00 17.13 O ATOM 1517 CB LEU A1199 17.264 4.151 25.328 1.00 16.58 C ATOM 1518 CG LEU A1199 17.457 3.917 23.825 1.00 17.20 C ATOM 1519 CD1 LEU A1199 18.303 2.660 23.604 1.00 17.13 C ATOM 1520 CD2 LEU A1199 16.110 3.779 23.150 1.00 14.55 C ATOM 1521 N TRP A1200 17.339 5.831 27.912 1.00 17.87 N ATOM 1522 CA TRP A1200 17.335 5.913 29.358 1.00 18.40 C ATOM 1523 C TRP A1200 16.167 6.819 29.770 1.00 19.39 C ATOM 1524 O TRP A1200 15.392 6.486 30.667 1.00 20.75 O ATOM 1525 CB TRP A1200 18.660 6.488 29.845 1.00 18.50 C ATOM 1526 CG TRP A1200 18.732 6.578 31.317 1.00 20.39 C ATOM 1527 CD1 TRP A1200 19.172 5.617 32.181 1.00 18.88 C ATOM 1528 CD2 TRP A1200 18.317 7.684 32.120 1.00 19.87 C ATOM 1529 NE1 TRP A1200 19.058 6.060 33.475 1.00 20.21 N ATOM 1530 CE2 TRP A1200 18.533 7.326 33.467 1.00 20.00 C ATOM 1531 CE3 TRP A1200 17.778 8.946 31.829 1.00 19.97 C ATOM 1532 CZ2 TRP A1200 18.230 8.188 34.528 1.00 19.04 C ATOM 1533 CZ3 TRP A1200 17.475 9.803 32.883 1.00 17.83 C ATOM 1534 CH2 TRP A1200 17.703 9.419 34.216 1.00 18.36 C ATOM 1535 N GLU A1201 16.043 7.964 29.105 1.00 18.15 N ATOM 1536 CA GLU A1201 14.961 8.889 29.399 1.00 18.22 C ATOM 1537 C GLU A1201 13.613 8.184 29.264 1.00 19.90 C ATOM 1538 O GLU A1201 12.728 8.333 30.104 1.00 21.56 O ATOM 1539 CB GLU A1201 15.007 10.082 28.443 1.00 17.32 C ATOM 1540 CG GLU A1201 16.049 11.128 28.788 1.00 16.30 C ATOM 1541 CD GLU A1201 15.997 12.324 27.855 1.00 18.20 C ATOM 1542 OE1 GLU A1201 16.484 12.208 26.713 1.00 16.75 O ATOM 1543 OE2 GLU A1201 15.455 13.378 28.256 1.00 19.87 O ATOM 1544 N ILE A1202 13.461 7.411 28.199 1.00 19.93 N ATOM 1545 CA ILE A1202 12.218 6.699 27.958 1.00 20.03 C ATOM 1546 C ILE A1202 11.871 5.687 29.044 1.00 21.01 C ATOM 1547 O ILE A1202 10.713 5.549 29.434 1.00 22.61 O ATOM 1548 CB ILE A1202 12.273 5.984 26.611 1.00 20.27 C ATOM 1549 CG1 ILE A1202 12.372 7.027 25.494 1.00 19.01 C ATOM 1550 CG2 ILE A1202 11.052 5.093 26.444 1.00 20.01 C ATOM 1551 CD1 ILE A1202 12.671 6.452 24.144 1.00 15.85 C ATOM 1552 N THR A1203 12.872 4.974 29.536 1.00 19.90 N ATOM 1553 CA THR A1203 12.626 3.980 30.564 1.00 19.74 C ATOM 1554 C THR A1203 12.481 4.602 31.958 1.00 20.45 C ATOM 1555 O THR A1203 11.961 3.971 32.876 1.00 21.84 O ATOM 1556 CB THR A1203 13.755 2.935 30.571 1.00 18.92 C ATOM 1557 OG1 THR A1203 15.012 3.590 30.765 1.00 18.02 O ATOM 1558 CG2 THR A1203 13.789 2.190 29.247 1.00 15.53 C ATOM 1559 N SER A1204 12.934 5.840 32.114 1.00 19.31 N ATOM 1560 CA SER A1204 12.851 6.517 33.402 1.00 19.30 C ATOM 1561 C SER A1204 11.745 7.552 33.383 1.00 20.45 C ATOM 1562 O SER A1204 11.642 8.379 34.288 1.00 22.63 O ATOM 1563 CB SER A1204 14.172 7.214 33.715 1.00 17.60 C ATOM 1564 OG SER A1204 14.496 8.145 32.696 1.00 19.95 O ATOM 1565 N LEU A1205 10.920 7.494 32.345 1.00 20.41 N ATOM 1566 CA LEU A1205 9.829 8.435 32.160 1.00 19.91 C ATOM 1567 C LEU A1205 10.315 9.871 32.282 1.00 21.45 C ATOM 1568 O LEU A1205 9.744 10.684 33.010 1.00 21.29 O ATOM 1569 CB LEU A1205 8.697 8.162 33.144 1.00 19.47 C ATOM 1570 CG LEU A1205 8.032 6.792 32.974 1.00 20.11 C ATOM 1571 CD1 LEU A1205 6.827 6.732 33.882 1.00 19.50 C ATOM 1572 CD2 LEU A1205 7.602 6.559 31.523 1.00 18.15 C ATOM 1573 N ALA A1206 11.392 10.152 31.551 1.00 22.76 N ATOM 1574 CA ALA A1206 12.017 11.468 31.456 1.00 24.17 C ATOM 1575 C ALA A1206 12.604 12.090 32.712 1.00 26.22 C ATOM 1576 O ALA A1206 12.492 13.301 32.924 1.00 25.26 O ATOM 1577 CB ALA A1206 11.054 12.443 30.806 1.00 23.71 C ATOM 1578 N GLU A1207 13.230 11.272 33.548 1.00 27.90 N ATOM 1579 CA GLU A1207 13.868 11.799 34.741 1.00 29.58 C ATOM 1580 C GLU A1207 15.083 12.571 34.262 1.00 28.84 C ATOM 1581 O GLU A1207 15.492 12.440 33.110 1.00 27.46 O ATOM 1582 CB GLU A1207 14.329 10.675 35.663 1.00 33.13 C ATOM 1583 CG GLU A1207 13.228 10.067 36.497 1.00 41.31 C ATOM 1584 CD GLU A1207 13.776 9.205 37.608 1.00 45.38 C ATOM 1585 OE1 GLU A1207 14.630 9.707 38.371 1.00 48.61 O ATOM 1586 OE2 GLU A1207 13.355 8.032 37.721 1.00 48.17 O ATOM 1587 N GLN A1208 15.655 13.378 35.143 1.00 29.04 N ATOM 1588 CA GLN A1208 16.840 14.151 34.808 1.00 29.92 C ATOM 1589 C GLN A1208 18.065 13.242 34.896 1.00 30.27 C ATOM 1590 O GLN A1208 18.339 12.658 35.943 1.00 30.01 O ATOM 1591 CB GLN A1208 16.982 15.323 35.782 1.00 31.12 C ATOM 1592 CG GLN A1208 18.413 15.727 36.097 1.00 34.93 C ATOM 1593 CD GLN A1208 18.809 17.042 35.465 1.00 37.25 C ATOM 1594 OE1 GLN A1208 18.762 17.195 34.242 1.00 40.46 O ATOM 1595 NE2 GLN A1208 19.208 18.003 36.296 1.00 36.42 N ATOM 1596 N PRO A1209 18.811 13.097 33.789 1.00 30.54 N ATOM 1597 CA PRO A1209 19.999 12.239 33.823 1.00 29.67 C ATOM 1598 C PRO A1209 21.042 12.779 34.805 1.00 28.71 C ATOM 1599 O PRO A1209 21.354 13.968 34.798 1.00 27.33 O ATOM 1600 CB PRO A1209 20.481 12.259 32.371 1.00 29.20 C ATOM 1601 CG PRO A1209 20.029 13.600 31.879 1.00 30.68 C ATOM 1602 CD PRO A1209 18.639 13.705 32.458 1.00 30.56 C ATOM 1603 N TYR A1210 21.568 11.893 35.647 1.00 29.49 N ATOM 1604 CA TYR A1210 22.570 12.252 36.645 1.00 32.20 C ATOM 1605 C TYR A1210 22.023 13.207 37.706 1.00 35.39 C ATOM 1606 O TYR A1210 22.742 14.077 38.199 1.00 34.31 O ATOM 1607 CB TYR A1210 23.793 12.881 35.970 1.00 31.28 C ATOM 1608 CG TYR A1210 24.342 12.067 34.820 1.00 31.64 C ATOM 1609 CD1 TYR A1210 24.088 12.433 33.495 1.00 29.99 C ATOM 1610 CD2 TYR A1210 25.095 10.912 35.053 1.00 32.18 C ATOM 1611 CE1 TYR A1210 24.567 11.672 32.433 1.00 29.75 C ATOM 1612 CE2 TYR A1210 25.581 10.137 33.993 1.00 31.38 C ATOM 1613 CZ TYR A1210 25.314 10.525 32.688 1.00 31.54 C ATOM 1614 OH TYR A1210 25.793 9.769 31.642 1.00 30.92 O ATOM 1615 N GLN A1211 20.749 13.042 38.055 1.00 39.55 N ATOM 1616 CA GLN A1211 20.115 13.889 39.061 1.00 42.87 C ATOM 1617 C GLN A1211 20.926 13.806 40.342 1.00 44.04 C ATOM 1618 O GLN A1211 21.173 12.713 40.860 1.00 43.41 O ATOM 1619 CB GLN A1211 18.688 13.416 39.347 1.00 45.57 C ATOM 1620 CG GLN A1211 17.916 14.311 40.310 1.00 51.47 C ATOM 1621 CD GLN A1211 17.429 15.597 39.655 1.00 55.70 C ATOM 1622 OE1 GLN A1211 17.837 16.701 40.030 1.00 58.56 O ATOM 1623 NE2 GLN A1211 16.548 15.458 38.670 1.00 57.58 N ATOM 1624 N GLY A1212 21.338 14.961 40.852 1.00 44.44 N ATOM 1625 CA GLY A1212 22.123 14.979 42.070 1.00 44.22 C ATOM 1626 C GLY A1212 23.512 15.501 41.784 1.00 43.83 C ATOM 1627 O GLY A1212 24.127 16.151 42.631 1.00 44.95 O ATOM 1628 N LEU A1213 24.002 15.215 40.581 1.00 42.39 N ATOM 1629 CA LEU A1213 25.322 15.671 40.166 1.00 40.33 C ATOM 1630 C LEU A1213 25.203 17.002 39.442 1.00 39.65 C ATOM 1631 O LEU A1213 24.199 17.283 38.789 1.00 39.74 O ATOM 1632 CB LEU A1213 25.991 14.651 39.237 1.00 38.84 C ATOM 1633 CG LEU A1213 26.140 13.202 39.712 1.00 39.19 C ATOM 1634 CD1 LEU A1213 27.174 12.503 38.847 1.00 38.53 C ATOM 1635 CD2 LEU A1213 26.579 13.162 41.166 1.00 39.95 C ATOM 1636 N SER A1214 26.237 17.819 39.568 1.00 39.61 N ATOM 1637 CA SER A1214 26.272 19.114 38.915 1.00 40.28 C ATOM 1638 C SER A1214 26.864 18.896 37.532 1.00 41.43 C ATOM 1639 O SER A1214 27.564 17.911 37.303 1.00 40.96 O ATOM 1640 CB SER A1214 27.168 20.063 39.700 1.00 40.06 C ATOM 1641 OG SER A1214 28.492 19.556 39.751 1.00 40.85 O ATOM 1642 N ASN A1215 26.591 19.813 36.612 1.00 42.73 N ATOM 1643 CA ASN A1215 27.123 19.692 35.262 1.00 46.09 C ATOM 1644 C ASN A1215 28.649 19.591 35.339 1.00 47.29 C ATOM 1645 O ASN A1215 29.308 19.086 34.428 1.00 46.07 O ATOM 1646 CB ASN A1215 26.705 20.904 34.422 1.00 46.61 C ATOM 1647 CG ASN A1215 25.200 21.142 34.451 1.00 48.62 C ATOM 1648 OD1 ASN A1215 24.401 20.216 34.278 1.00 47.57 O ATOM 1649 ND2 ASN A1215 24.808 22.392 34.666 1.00 49.31 N ATOM 1650 N GLU A1216 29.194 20.082 36.445 1.00 49.40 N ATOM 1651 CA GLU A1216 30.628 20.066 36.698 1.00 50.81 C ATOM 1652 C GLU A1216 31.074 18.632 36.965 1.00 49.32 C ATOM 1653 O GLU A1216 32.094 18.176 36.447 1.00 48.69 O ATOM 1654 CB GLU A1216 30.937 20.934 37.924 1.00 56.35 C ATOM 1655 CG GLU A1216 32.400 20.960 38.363 1.00 62.49 C ATOM 1656 CD GLU A1216 33.172 22.120 37.762 1.00 66.75 C ATOM 1657 OE1 GLU A1216 32.749 23.280 37.969 1.00 69.17 O ATOM 1658 OE2 GLU A1216 34.201 21.875 37.091 1.00 68.64 O ATOM 1659 N GLN A1217 30.297 17.926 37.778 1.00 46.89 N ATOM 1660 CA GLN A1217 30.611 16.550 38.137 1.00 45.12 C ATOM 1661 C GLN A1217 30.284 15.562 37.012 1.00 43.36 C ATOM 1662 O GLN A1217 31.019 14.595 36.792 1.00 42.34 O ATOM 1663 CB GLN A1217 29.865 16.186 39.425 1.00 46.35 C ATOM 1664 CG GLN A1217 30.158 17.153 40.574 1.00 47.42 C ATOM 1665 CD GLN A1217 29.360 16.855 41.831 1.00 49.89 C ATOM 1666 OE1 GLN A1217 28.128 16.902 41.828 1.00 50.80 O ATOM 1667 NE2 GLN A1217 30.063 16.551 42.917 1.00 50.87 N ATOM 1668 N VAL A1218 29.186 15.803 36.300 1.00 40.26 N ATOM 1669 CA VAL A1218 28.802 14.931 35.197 1.00 37.11 C ATOM 1670 C VAL A1218 29.940 14.947 34.186 1.00 36.07 C ATOM 1671 O VAL A1218 30.338 13.911 33.662 1.00 35.16 O ATOM 1672 CB VAL A1218 27.513 15.428 34.495 1.00 36.58 C ATOM 1673 CG1 VAL A1218 27.237 14.588 33.261 1.00 35.11 C ATOM 1674 CG2 VAL A1218 26.328 15.357 35.449 1.00 34.83 C ATOM 1675 N LEU A1219 30.459 16.142 33.930 1.00 34.97 N ATOM 1676 CA LEU A1219 31.546 16.344 32.982 1.00 35.29 C ATOM 1677 C LEU A1219 32.738 15.444 33.285 1.00 34.11 C ATOM 1678 O LEU A1219 33.289 14.811 32.385 1.00 33.15 O ATOM 1679 CB LEU A1219 31.992 17.812 33.003 1.00 37.55 C ATOM 1680 CG LEU A1219 32.972 18.294 31.925 1.00 40.29 C ATOM 1681 CD1 LEU A1219 32.269 18.377 30.583 1.00 40.54 C ATOM 1682 CD2 LEU A1219 33.508 19.669 32.300 1.00 44.27 C ATOM 1683 N LYS A1220 33.136 15.390 34.552 1.00 33.61 N ATOM 1684 CA LYS A1220 34.269 14.569 34.944 1.00 33.30 C ATOM 1685 C LYS A1220 33.883 13.100 34.969 1.00 30.88 C ATOM 1686 O LYS A1220 34.621 12.249 34.477 1.00 32.11 O ATOM 1687 CB LYS A1220 34.784 14.977 36.324 1.00 37.96 C ATOM 1688 CG LYS A1220 36.039 14.220 36.727 1.00 42.80 C ATOM 1689 CD LYS A1220 36.417 14.442 38.176 1.00 44.84 C ATOM 1690 CE LYS A1220 37.699 13.689 38.502 1.00 49.01 C ATOM 1691 NZ LYS A1220 38.068 13.787 39.940 1.00 53.22 N ATOM 1692 N PHE A1221 32.720 12.811 35.546 1.00 27.63 N ATOM 1693 CA PHE A1221 32.211 11.444 35.655 1.00 23.45 C ATOM 1694 C PHE A1221 32.197 10.734 34.308 1.00 23.05 C ATOM 1695 O PHE A1221 32.740 9.640 34.160 1.00 21.74 O ATOM 1696 CB PHE A1221 30.798 11.468 36.231 1.00 20.64 C ATOM 1697 CG PHE A1221 30.211 10.107 36.473 1.00 19.91 C ATOM 1698 CD1 PHE A1221 30.718 9.282 37.473 1.00 18.20 C ATOM 1699 CD2 PHE A1221 29.138 9.654 35.711 1.00 16.53 C ATOM 1700 CE1 PHE A1221 30.163 8.023 37.715 1.00 17.71 C ATOM 1701 CE2 PHE A1221 28.579 8.404 35.943 1.00 19.74 C ATOM 1702 CZ PHE A1221 29.095 7.582 36.952 1.00 18.34 C ATOM 1703 N VAL A1222 31.570 11.367 33.324 1.00 23.69 N ATOM 1704 CA VAL A1222 31.479 10.791 31.992 1.00 23.47 C ATOM 1705 C VAL A1222 32.849 10.679 31.353 1.00 23.32 C ATOM 1706 O VAL A1222 33.164 9.665 30.728 1.00 23.40 O ATOM 1707 CB VAL A1222 30.551 11.628 31.072 1.00 23.85 C ATOM 1708 CG1 VAL A1222 30.564 11.065 29.656 1.00 22.08 C ATOM 1709 CG2 VAL A1222 29.128 11.611 31.623 1.00 24.21 C ATOM 1710 N MET A1223 33.669 11.712 31.509 1.00 22.00 N ATOM 1711 CA MET A1223 34.996 11.674 30.919 1.00 24.31 C ATOM 1712 C MET A1223 35.905 10.632 31.550 1.00 24.70 C ATOM 1713 O MET A1223 36.886 10.213 30.934 1.00 25.50 O ATOM 1714 CB MET A1223 35.654 13.047 30.976 1.00 26.01 C ATOM 1715 CG MET A1223 35.141 13.994 29.909 1.00 26.71 C ATOM 1716 SD MET A1223 36.251 15.379 29.654 1.00 30.32 S ATOM 1717 CE MET A1223 35.529 16.585 30.709 1.00 28.11 C ATOM 1718 N ASP A1224 35.579 10.211 32.770 1.00 24.88 N ATOM 1719 CA ASP A1224 36.370 9.192 33.457 1.00 25.09 C ATOM 1720 C ASP A1224 35.920 7.801 33.047 1.00 25.43 C ATOM 1721 O ASP A1224 36.536 6.802 33.430 1.00 24.70 O ATOM 1722 CB ASP A1224 36.251 9.330 34.973 1.00 25.20 C ATOM 1723 CG ASP A1224 37.080 10.468 35.514 1.00 26.99 C ATOM 1724 OD1 ASP A1224 38.028 10.889 34.809 1.00 28.43 O ATOM 1725 OD2 ASP A1224 36.793 10.930 36.640 1.00 24.21 O ATOM 1726 N GLY A1225 34.840 7.743 32.271 1.00 24.10 N ATOM 1727 CA GLY A1225 34.329 6.470 31.810 1.00 21.57 C ATOM 1728 C GLY A1225 33.025 6.043 32.452 1.00 21.92 C ATOM 1729 O GLY A1225 32.540 4.946 32.179 1.00 23.86 O ATOM 1730 N GLY A1226 32.452 6.895 33.298 1.00 21.70 N ATOM 1731 CA GLY A1226 31.198 6.555 33.947 1.00 21.87 C ATOM 1732 C GLY A1226 29.979 6.775 33.061 1.00 24.15 C ATOM 1733 O GLY A1226 30.049 7.491 32.061 1.00 23.11 O ATOM 1734 N TYR A1227 28.865 6.137 33.407 1.00 24.43 N ATOM 1735 CA TYR A1227 27.624 6.297 32.661 1.00 27.90 C ATOM 1736 C TYR A1227 26.412 6.069 33.561 1.00 28.82 C ATOM 1737 O TYR A1227 26.552 5.701 34.724 1.00 30.84 O ATOM 1738 CB TYR A1227 27.572 5.362 31.447 1.00 29.20 C ATOM 1739 CG TYR A1227 27.941 3.926 31.726 1.00 31.27 C ATOM 1740 CD1 TYR A1227 29.271 3.506 31.675 1.00 32.14 C ATOM 1741 CD2 TYR A1227 26.963 2.988 32.048 1.00 32.20 C ATOM 1742 CE1 TYR A1227 29.619 2.182 31.941 1.00 34.21 C ATOM 1743 CE2 TYR A1227 27.296 1.662 32.318 1.00 34.70 C ATOM 1744 CZ TYR A1227 28.626 1.266 32.262 1.00 36.75 C ATOM 1745 OH TYR A1227 28.958 -0.043 32.531 1.00 39.02 O ATOM 1746 N LEU A1228 25.223 6.293 33.015 1.00 28.55 N ATOM 1747 CA LEU A1228 23.977 6.152 33.758 1.00 29.35 C ATOM 1748 C LEU A1228 23.646 4.749 34.267 1.00 30.82 C ATOM 1749 O LEU A1228 23.952 3.747 33.622 1.00 31.52 O ATOM 1750 CB LEU A1228 22.819 6.664 32.895 1.00 26.54 C ATOM 1751 CG LEU A1228 22.858 8.162 32.591 1.00 25.29 C ATOM 1752 CD1 LEU A1228 22.036 8.469 31.357 1.00 22.04 C ATOM 1753 CD2 LEU A1228 22.345 8.932 33.802 1.00 22.61 C ATOM 1754 N ASP A1229 23.014 4.701 35.437 1.00 32.60 N ATOM 1755 CA ASP A1229 22.589 3.455 36.058 1.00 34.07 C ATOM 1756 C ASP A1229 21.268 3.092 35.419 1.00 35.40 C ATOM 1757 O ASP A1229 20.496 3.975 35.057 1.00 35.14 O ATOM 1758 CB ASP A1229 22.362 3.653 37.556 1.00 37.09 C ATOM 1759 CG ASP A1229 23.651 3.763 38.335 1.00 39.45 C ATOM 1760 OD1 ASP A1229 23.584 4.103 39.536 1.00 41.66 O ATOM 1761 OD2 ASP A1229 24.725 3.504 37.754 1.00 40.48 O ATOM 1762 N GLN A1230 20.996 1.804 35.278 1.00 37.67 N ATOM 1763 CA GLN A1230 19.735 1.395 34.684 1.00 40.79 C ATOM 1764 C GLN A1230 18.565 1.818 35.548 1.00 41.29 C ATOM 1765 O GLN A1230 18.631 1.747 36.775 1.00 42.02 O ATOM 1766 CB GLN A1230 19.701 -0.117 34.495 1.00 42.09 C ATOM 1767 CG GLN A1230 20.643 -0.572 33.419 1.00 47.20 C ATOM 1768 CD GLN A1230 20.510 0.285 32.176 1.00 49.01 C ATOM 1769 OE1 GLN A1230 19.400 0.548 31.705 1.00 49.85 O ATOM 1770 NE2 GLN A1230 21.642 0.727 31.638 1.00 48.76 N ATOM 1771 N PRO A1231 17.484 2.298 34.920 1.00 42.13 N ATOM 1772 CA PRO A1231 16.325 2.709 35.716 1.00 42.26 C ATOM 1773 C PRO A1231 15.793 1.466 36.411 1.00 42.47 C ATOM 1774 O PRO A1231 16.116 0.349 36.010 1.00 40.91 O ATOM 1775 CB PRO A1231 15.355 3.248 34.665 1.00 42.16 C ATOM 1776 CG PRO A1231 16.281 3.794 33.605 1.00 42.34 C ATOM 1777 CD PRO A1231 17.332 2.704 33.511 1.00 42.44 C ATOM 1778 N ASP A1232 14.984 1.657 37.448 1.00 44.68 N ATOM 1779 CA ASP A1232 14.424 0.526 38.178 1.00 45.76 C ATOM 1780 C ASP A1232 13.574 -0.356 37.270 1.00 45.77 C ATOM 1781 O ASP A1232 12.786 0.138 36.458 1.00 45.60 O ATOM 1782 CB ASP A1232 13.592 1.017 39.368 1.00 46.82 C ATOM 1783 CG ASP A1232 14.453 1.442 40.548 1.00 49.31 C ATOM 1784 OD1 ASP A1232 13.884 1.903 41.558 1.00 50.94 O ATOM 1785 OD2 ASP A1232 15.696 1.311 40.470 1.00 50.69 O ATOM 1786 N ASN A1233 13.752 -1.667 37.415 1.00 45.52 N ATOM 1787 CA ASN A1233 13.020 -2.656 36.628 1.00 45.72 C ATOM 1788 C ASN A1233 13.008 -2.335 35.136 1.00 44.17 C ATOM 1789 O ASN A1233 12.004 -2.521 34.449 1.00 44.30 O ATOM 1790 CB ASN A1233 11.585 -2.783 37.147 1.00 46.88 C ATOM 1791 CG ASN A1233 11.528 -3.036 38.639 1.00 46.74 C ATOM 1792 OD1 ASN A1233 11.529 -2.099 39.443 1.00 46.24 O ATOM 1793 ND2 ASN A1233 11.500 -4.307 39.020 1.00 45.99 N ATOM 1794 N CYS A1234 14.134 -1.847 34.639 1.00 43.37 N ATOM 1795 CA CYS A1234 14.249 -1.519 33.230 1.00 42.05 C ATOM 1796 C CYS A1234 14.315 -2.832 32.444 1.00 40.06 C ATOM 1797 O CYS A1234 14.978 -3.783 32.863 1.00 38.48 O ATOM 1798 CB CYS A1234 15.515 -0.686 32.997 1.00 41.92 C ATOM 1799 SG CYS A1234 15.820 -0.248 31.281 1.00 40.14 S ATOM 1800 N PRO A1235 13.608 -2.911 31.308 1.00 39.30 N ATOM 1801 CA PRO A1235 13.636 -4.145 30.514 1.00 38.58 C ATOM 1802 C PRO A1235 15.054 -4.442 30.030 1.00 37.52 C ATOM 1803 O PRO A1235 15.717 -3.580 29.457 1.00 35.69 O ATOM 1804 CB PRO A1235 12.654 -3.853 29.377 1.00 38.05 C ATOM 1805 CG PRO A1235 12.700 -2.355 29.254 1.00 39.41 C ATOM 1806 CD PRO A1235 12.752 -1.887 30.681 1.00 38.95 C ATOM 1807 N GLU A1236 15.511 -5.666 30.270 1.00 37.66 N ATOM 1808 CA GLU A1236 16.863 -6.070 29.897 1.00 38.91 C ATOM 1809 C GLU A1236 17.271 -5.685 28.484 1.00 37.64 C ATOM 1810 O GLU A1236 18.385 -5.203 28.257 1.00 37.32 O ATOM 1811 CB GLU A1236 17.041 -7.583 30.048 1.00 41.00 C ATOM 1812 CG GLU A1236 18.482 -8.024 29.822 1.00 47.90 C ATOM 1813 CD GLU A1236 18.598 -9.346 29.091 1.00 52.07 C ATOM 1814 OE1 GLU A1236 18.083 -9.444 27.955 1.00 54.30 O ATOM 1815 OE2 GLU A1236 19.210 -10.284 29.648 1.00 53.61 O ATOM 1816 N ARG A1237 16.371 -5.903 27.534 1.00 34.74 N ATOM 1817 CA ARG A1237 16.669 -5.610 26.147 1.00 32.86 C ATOM 1818 C ARG A1237 17.058 -4.155 25.921 1.00 32.43 C ATOM 1819 O ARG A1237 17.972 -3.865 25.143 1.00 33.15 O ATOM 1820 CB ARG A1237 15.478 -5.978 25.269 1.00 34.13 C ATOM 1821 CG ARG A1237 15.850 -6.076 23.810 1.00 37.61 C ATOM 1822 CD ARG A1237 14.746 -6.685 22.989 1.00 38.32 C ATOM 1823 NE ARG A1237 15.110 -6.709 21.579 1.00 37.64 N ATOM 1824 CZ ARG A1237 14.269 -7.025 20.604 1.00 37.61 C ATOM 1825 NH1 ARG A1237 13.011 -7.345 20.893 1.00 34.35 N ATOM 1826 NH2 ARG A1237 14.687 -7.016 19.344 1.00 37.92 N ATOM 1827 N VAL A1238 16.373 -3.237 26.597 1.00 28.82 N ATOM 1828 CA VAL A1238 16.692 -1.828 26.440 1.00 28.78 C ATOM 1829 C VAL A1238 18.023 -1.510 27.109 1.00 28.70 C ATOM 1830 O VAL A1238 18.776 -0.655 26.638 1.00 28.43 O ATOM 1831 CB VAL A1238 15.612 -0.913 27.055 1.00 28.19 C ATOM 1832 CG1 VAL A1238 15.964 0.548 26.786 1.00 27.57 C ATOM 1833 CG2 VAL A1238 14.253 -1.241 26.468 1.00 27.71 C ATOM 1834 N THR A1239 18.306 -2.198 28.208 1.00 26.90 N ATOM 1835 CA THR A1239 19.546 -1.985 28.938 1.00 26.81 C ATOM 1836 C THR A1239 20.741 -2.304 28.048 1.00 26.37 C ATOM 1837 O THR A1239 21.743 -1.591 28.056 1.00 24.77 O ATOM 1838 CB THR A1239 19.606 -2.874 30.195 1.00 27.42 C ATOM 1839 OG1 THR A1239 18.655 -2.404 31.156 1.00 26.93 O ATOM 1840 CG2 THR A1239 21.004 -2.849 30.800 1.00 28.22 C ATOM 1841 N ASP A1240 20.624 -3.379 27.277 1.00 26.20 N ATOM 1842 CA ASP A1240 21.697 -3.785 26.389 1.00 25.80 C ATOM 1843 C ASP A1240 21.939 -2.744 25.298 1.00 25.21 C ATOM 1844 O ASP A1240 23.086 -2.473 24.944 1.00 22.94 O ATOM 1845 CB ASP A1240 21.379 -5.146 25.770 1.00 28.16 C ATOM 1846 CG ASP A1240 21.313 -6.263 26.809 1.00 32.05 C ATOM 1847 OD1 ASP A1240 21.791 -6.055 27.949 1.00 33.19 O ATOM 1848 OD2 ASP A1240 20.794 -7.356 26.479 1.00 33.57 O ATOM 1849 N LEU A1241 20.862 -2.164 24.765 1.00 24.39 N ATOM 1850 CA LEU A1241 20.993 -1.136 23.733 1.00 23.22 C ATOM 1851 C LEU A1241 21.723 0.058 24.331 1.00 22.13 C ATOM 1852 O LEU A1241 22.638 0.605 23.717 1.00 20.43 O ATOM 1853 CB LEU A1241 19.621 -0.692 23.222 1.00 25.10 C ATOM 1854 CG LEU A1241 18.827 -1.662 22.342 1.00 25.95 C ATOM 1855 CD1 LEU A1241 17.423 -1.114 22.100 1.00 25.08 C ATOM 1856 CD2 LEU A1241 19.557 -1.861 21.024 1.00 24.52 C ATOM 1857 N MET A1242 21.313 0.454 25.535 1.00 19.85 N ATOM 1858 CA MET A1242 21.942 1.570 26.233 1.00 20.38 C ATOM 1859 C MET A1242 23.431 1.328 26.417 1.00 19.66 C ATOM 1860 O MET A1242 24.250 2.193 26.139 1.00 19.21 O ATOM 1861 CB MET A1242 21.315 1.766 27.610 1.00 19.97 C ATOM 1862 CG MET A1242 19.954 2.412 27.593 1.00 23.37 C ATOM 1863 SD MET A1242 19.388 2.764 29.262 1.00 22.14 S ATOM 1864 CE MET A1242 17.739 2.138 29.201 1.00 19.01 C ATOM 1865 N ARG A1243 23.773 0.142 26.897 1.00 20.13 N ATOM 1866 CA ARG A1243 25.163 -0.210 27.123 1.00 20.90 C ATOM 1867 C ARG A1243 25.992 -0.102 25.840 1.00 21.24 C ATOM 1868 O ARG A1243 27.096 0.443 25.851 1.00 22.23 O ATOM 1869 CB ARG A1243 25.250 -1.624 27.714 1.00 19.78 C ATOM 1870 N MET A1244 25.471 -0.613 24.731 1.00 21.46 N ATOM 1871 CA MET A1244 26.203 -0.533 23.471 1.00 21.52 C ATOM 1872 C MET A1244 26.514 0.927 23.142 1.00 20.28 C ATOM 1873 O MET A1244 27.631 1.254 22.754 1.00 20.67 O ATOM 1874 CB MET A1244 25.378 -1.131 22.332 1.00 24.12 C ATOM 1875 CG MET A1244 25.082 -2.611 22.461 1.00 31.17 C ATOM 1876 SD MET A1244 23.937 -3.170 21.167 1.00 37.72 S ATOM 1877 CE MET A1244 25.103 -3.479 19.800 1.00 38.42 C ATOM 1878 N CYS A1245 25.511 1.791 23.300 1.00 18.18 N ATOM 1879 CA CYS A1245 25.633 3.219 23.020 1.00 17.60 C ATOM 1880 C CYS A1245 26.658 3.933 23.895 1.00 18.22 C ATOM 1881 O CYS A1245 27.200 4.971 23.504 1.00 15.86 O ATOM 1882 CB CYS A1245 24.286 3.924 23.231 1.00 17.53 C ATOM 1883 SG CYS A1245 22.938 3.417 22.149 1.00 18.49 S ATOM 1884 N TRP A1246 26.922 3.383 25.077 1.00 18.01 N ATOM 1885 CA TRP A1246 27.833 4.031 25.997 1.00 18.36 C ATOM 1886 C TRP A1246 29.252 3.489 26.089 1.00 20.87 C ATOM 1887 O TRP A1246 29.958 3.739 27.073 1.00 20.18 O ATOM 1888 CB TRP A1246 27.190 4.091 27.386 1.00 16.88 C ATOM 1889 CG TRP A1246 25.890 4.870 27.398 1.00 16.39 C ATOM 1890 CD1 TRP A1246 25.514 5.854 26.522 1.00 14.64 C ATOM 1891 CD2 TRP A1246 24.794 4.709 28.309 1.00 16.05 C ATOM 1892 NE1 TRP A1246 24.252 6.305 26.824 1.00 14.83 N ATOM 1893 CE2 TRP A1246 23.785 5.622 27.917 1.00 16.83 C ATOM 1894 CE3 TRP A1246 24.564 3.882 29.418 1.00 16.14 C ATOM 1895 CZ2 TRP A1246 22.563 5.731 28.593 1.00 16.71 C ATOM 1896 CZ3 TRP A1246 23.346 3.990 30.093 1.00 15.98 C ATOM 1897 CH2 TRP A1246 22.363 4.908 29.675 1.00 18.07 C ATOM 1898 N GLN A1247 29.684 2.750 25.073 1.00 21.31 N ATOM 1899 CA GLN A1247 31.047 2.237 25.087 1.00 23.77 C ATOM 1900 C GLN A1247 31.967 3.453 24.975 1.00 23.86 C ATOM 1901 O GLN A1247 31.745 4.338 24.140 1.00 22.90 O ATOM 1902 CB GLN A1247 31.263 1.295 23.915 1.00 25.49 C ATOM 1903 CG GLN A1247 30.250 0.185 23.862 1.00 32.26 C ATOM 1904 CD GLN A1247 30.513 -0.758 22.720 1.00 37.59 C ATOM 1905 OE1 GLN A1247 31.493 -1.505 22.736 1.00 43.84 O ATOM 1906 NE2 GLN A1247 29.650 -0.724 21.708 1.00 37.86 N ATOM 1907 N PHE A1248 32.995 3.503 25.814 1.00 23.48 N ATOM 1908 CA PHE A1248 33.904 4.643 25.816 1.00 22.82 C ATOM 1909 C PHE A1248 34.488 4.955 24.440 1.00 22.35 C ATOM 1910 O PHE A1248 34.580 6.120 24.049 1.00 21.00 O ATOM 1911 CB PHE A1248 35.020 4.416 26.839 1.00 22.05 C ATOM 1912 CG PHE A1248 35.795 5.658 27.168 1.00 21.58 C ATOM 1913 CD1 PHE A1248 36.982 5.956 26.502 1.00 19.81 C ATOM 1914 CD2 PHE A1248 35.325 6.549 28.132 1.00 19.85 C ATOM 1915 CE1 PHE A1248 37.692 7.124 26.795 1.00 18.29 C ATOM 1916 CE2 PHE A1248 36.028 7.718 28.431 1.00 16.94 C ATOM 1917 CZ PHE A1248 37.214 8.003 27.759 1.00 15.19 C ATOM 1918 N ASN A1249 34.875 3.914 23.709 1.00 21.34 N ATOM 1919 CA ASN A1249 35.435 4.070 22.368 1.00 21.34 C ATOM 1920 C ASN A1249 34.308 4.265 21.350 1.00 20.06 C ATOM 1921 O ASN A1249 33.532 3.351 21.098 1.00 19.84 O ATOM 1922 CB ASN A1249 36.229 2.822 21.991 1.00 23.48 C ATOM 1923 CG ASN A1249 36.978 2.984 20.686 1.00 26.20 C ATOM 1924 OD1 ASN A1249 36.507 3.656 19.765 1.00 28.65 O ATOM 1925 ND2 ASN A1249 38.144 2.358 20.593 1.00 25.51 N ATOM 1926 N PRO A1250 34.216 5.454 20.738 1.00 20.91 N ATOM 1927 CA PRO A1250 33.149 5.692 19.755 1.00 21.40 C ATOM 1928 C PRO A1250 33.092 4.678 18.610 1.00 24.04 C ATOM 1929 O PRO A1250 32.012 4.364 18.104 1.00 24.06 O ATOM 1930 CB PRO A1250 33.424 7.121 19.279 1.00 20.71 C ATOM 1931 CG PRO A1250 34.908 7.295 19.520 1.00 19.75 C ATOM 1932 CD PRO A1250 35.100 6.626 20.857 1.00 19.41 C ATOM 1933 N LYS A1251 34.247 4.161 18.204 1.00 24.96 N ATOM 1934 CA LYS A1251 34.289 3.180 17.124 1.00 26.63 C ATOM 1935 C LYS A1251 33.547 1.904 17.500 1.00 26.44 C ATOM 1936 O LYS A1251 33.177 1.115 16.631 1.00 27.84 O ATOM 1937 CB LYS A1251 35.741 2.843 16.769 1.00 28.78 C ATOM 1938 CG LYS A1251 36.406 3.788 15.758 1.00 32.47 C ATOM 1939 CD LYS A1251 36.281 5.260 16.137 1.00 36.14 C ATOM 1940 CE LYS A1251 34.945 5.849 15.682 1.00 38.47 C ATOM 1941 NZ LYS A1251 34.711 7.228 16.210 1.00 39.16 N ATOM 1942 N MET A1252 33.328 1.710 18.797 1.00 24.51 N ATOM 1943 CA MET A1252 32.652 0.520 19.297 1.00 22.91 C ATOM 1944 C MET A1252 31.130 0.600 19.318 1.00 21.44 C ATOM 1945 O MET A1252 30.453 -0.425 19.324 1.00 21.71 O ATOM 1946 CB MET A1252 33.160 0.201 20.702 1.00 26.87 C ATOM 1947 CG MET A1252 34.620 -0.227 20.738 1.00 32.68 C ATOM 1948 SD MET A1252 34.912 -1.652 19.665 1.00 40.48 S ATOM 1949 CE MET A1252 34.275 -3.024 20.706 1.00 34.82 C ATOM 1950 N ARG A1253 30.589 1.812 19.331 1.00 18.98 N ATOM 1951 CA ARG A1253 29.141 1.992 19.352 1.00 16.93 C ATOM 1952 C ARG A1253 28.533 1.611 18.005 1.00 16.21 C ATOM 1953 O ARG A1253 29.199 1.656 16.973 1.00 18.18 O ATOM 1954 CB ARG A1253 28.799 3.448 19.682 1.00 14.47 C ATOM 1955 CG ARG A1253 29.441 3.941 20.974 1.00 13.22 C ATOM 1956 CD ARG A1253 29.379 5.455 21.112 1.00 14.21 C ATOM 1957 NE ARG A1253 30.329 5.916 22.124 1.00 18.23 N ATOM 1958 CZ ARG A1253 30.826 7.149 22.190 1.00 17.59 C ATOM 1959 NH1 ARG A1253 30.459 8.073 21.306 1.00 14.97 N ATOM 1960 NH2 ARG A1253 31.730 7.446 23.115 1.00 14.07 N ATOM 1961 N PRO A1254 27.258 1.205 18.003 1.00 16.56 N ATOM 1962 CA PRO A1254 26.606 0.827 16.748 1.00 16.32 C ATOM 1963 C PRO A1254 26.172 2.045 15.936 1.00 18.31 C ATOM 1964 O PRO A1254 26.309 3.190 16.389 1.00 17.39 O ATOM 1965 CB PRO A1254 25.412 0.002 17.221 1.00 15.14 C ATOM 1966 CG PRO A1254 25.054 0.650 18.519 1.00 13.54 C ATOM 1967 CD PRO A1254 26.404 0.882 19.162 1.00 15.31 C ATOM 1968 N THR A1255 25.660 1.787 14.733 1.00 17.89 N ATOM 1969 CA THR A1255 25.160 2.841 13.867 1.00 17.58 C ATOM 1970 C THR A1255 23.651 2.789 14.010 1.00 17.32 C ATOM 1971 O THR A1255 23.093 1.785 14.450 1.00 17.18 O ATOM 1972 CB THR A1255 25.510 2.600 12.388 1.00 18.83 C ATOM 1973 OG1 THR A1255 24.806 1.446 11.913 1.00 20.17 O ATOM 1974 CG2 THR A1255 27.016 2.385 12.218 1.00 19.30 C ATOM 1975 N PHE A1256 22.982 3.867 13.641 1.00 18.29 N ATOM 1976 CA PHE A1256 21.534 3.896 13.734 1.00 17.43 C ATOM 1977 C PHE A1256 20.924 2.819 12.848 1.00 16.21 C ATOM 1978 O PHE A1256 19.925 2.205 13.213 1.00 17.80 O ATOM 1979 CB PHE A1256 21.032 5.288 13.366 1.00 14.66 C ATOM 1980 CG PHE A1256 21.338 6.307 14.410 1.00 13.34 C ATOM 1981 CD1 PHE A1256 20.598 6.348 15.594 1.00 12.95 C ATOM 1982 CD2 PHE A1256 22.410 7.176 14.260 1.00 12.78 C ATOM 1983 CE1 PHE A1256 20.925 7.235 16.612 1.00 10.70 C ATOM 1984 CE2 PHE A1256 22.748 8.073 15.276 1.00 12.03 C ATOM 1985 CZ PHE A1256 22.004 8.101 16.454 1.00 11.42 C ATOM 1986 N LEU A1257 21.532 2.585 11.691 1.00 15.12 N ATOM 1987 CA LEU A1257 21.047 1.549 10.789 1.00 17.42 C ATOM 1988 C LEU A1257 21.123 0.187 11.474 1.00 18.46 C ATOM 1989 O LEU A1257 20.240 -0.654 11.305 1.00 20.29 O ATOM 1990 CB LEU A1257 21.869 1.520 9.495 1.00 17.28 C ATOM 1991 CG LEU A1257 21.593 2.642 8.491 1.00 17.28 C ATOM 1992 CD1 LEU A1257 22.486 2.472 7.267 1.00 15.39 C ATOM 1993 CD2 LEU A1257 20.127 2.607 8.085 1.00 16.35 C ATOM 1994 N GLU A1258 22.181 -0.029 12.249 1.00 19.39 N ATOM 1995 CA GLU A1258 22.340 -1.292 12.962 1.00 18.33 C ATOM 1996 C GLU A1258 21.326 -1.385 14.091 1.00 16.41 C ATOM 1997 O GLU A1258 20.869 -2.474 14.421 1.00 16.60 O ATOM 1998 CB GLU A1258 23.759 -1.424 13.519 1.00 17.55 C ATOM 1999 CG GLU A1258 24.811 -1.488 12.438 1.00 19.12 C ATOM 2000 CD GLU A1258 26.206 -1.643 12.990 1.00 21.18 C ATOM 2001 OE1 GLU A1258 26.487 -1.076 14.065 1.00 22.84 O ATOM 2002 OE2 GLU A1258 27.028 -2.319 12.340 1.00 23.81 O ATOM 2003 N ILE A1259 20.974 -0.247 14.685 1.00 15.02 N ATOM 2004 CA ILE A1259 19.991 -0.254 15.760 1.00 13.13 C ATOM 2005 C ILE A1259 18.673 -0.760 15.171 1.00 14.91 C ATOM 2006 O ILE A1259 18.047 -1.671 15.716 1.00 15.14 O ATOM 2007 CB ILE A1259 19.762 1.164 16.356 1.00 13.23 C ATOM 2008 CG1 ILE A1259 21.014 1.645 17.097 1.00 11.99 C ATOM 2009 CG2 ILE A1259 18.560 1.146 17.308 1.00 12.02 C ATOM 2010 CD1 ILE A1259 21.388 0.827 18.336 1.00 9.66 C ATOM 2011 N VAL A1260 18.262 -0.167 14.053 1.00 12.75 N ATOM 2012 CA VAL A1260 17.021 -0.559 13.403 1.00 14.37 C ATOM 2013 C VAL A1260 17.050 -2.030 13.002 1.00 16.75 C ATOM 2014 O VAL A1260 16.079 -2.759 13.196 1.00 15.53 O ATOM 2015 CB VAL A1260 16.748 0.312 12.158 1.00 12.42 C ATOM 2016 CG1 VAL A1260 15.523 -0.202 11.414 1.00 11.97 C ATOM 2017 CG2 VAL A1260 16.534 1.762 12.582 1.00 7.81 C ATOM 2018 N ASN A1261 18.169 -2.472 12.446 1.00 19.52 N ATOM 2019 CA ASN A1261 18.275 -3.861 12.046 1.00 21.66 C ATOM 2020 C ASN A1261 18.073 -4.805 13.234 1.00 22.32 C ATOM 2021 O ASN A1261 17.444 -5.849 13.097 1.00 23.37 O ATOM 2022 CB ASN A1261 19.628 -4.127 11.399 1.00 22.16 C ATOM 2023 CG ASN A1261 19.699 -5.509 10.783 1.00 26.25 C ATOM 2024 OD1 ASN A1261 18.933 -5.834 9.870 1.00 22.23 O ATOM 2025 ND2 ASN A1261 20.611 -6.338 11.288 1.00 26.87 N ATOM 2026 N LEU A1262 18.605 -4.432 14.395 1.00 22.70 N ATOM 2027 CA LEU A1262 18.475 -5.243 15.607 1.00 22.98 C ATOM 2028 C LEU A1262 17.047 -5.381 16.098 1.00 23.53 C ATOM 2029 O LEU A1262 16.712 -6.354 16.772 1.00 25.03 O ATOM 2030 CB LEU A1262 19.291 -4.635 16.747 1.00 23.49 C ATOM 2031 CG LEU A1262 20.809 -4.805 16.719 1.00 26.59 C ATOM 2032 CD1 LEU A1262 21.450 -3.914 17.776 1.00 25.63 C ATOM 2033 CD2 LEU A1262 21.155 -6.264 16.963 1.00 26.99 C ATOM 2034 N LEU A1263 16.207 -4.408 15.762 1.00 22.79 N ATOM 2035 CA LEU A1263 14.823 -4.403 16.224 1.00 22.56 C ATOM 2036 C LEU A1263 13.761 -4.620 15.152 1.00 22.86 C ATOM 2037 O LEU A1263 12.577 -4.666 15.468 1.00 23.75 O ATOM 2038 CB LEU A1263 14.530 -3.066 16.913 1.00 20.66 C ATOM 2039 CG LEU A1263 15.624 -2.476 17.806 1.00 18.02 C ATOM 2040 CD1 LEU A1263 15.257 -1.040 18.193 1.00 11.50 C ATOM 2041 CD2 LEU A1263 15.809 -3.360 19.045 1.00 18.93 C ATOM 2042 N LYS A1264 14.171 -4.756 13.896 1.00 23.22 N ATOM 2043 CA LYS A1264 13.220 -4.899 12.792 1.00 23.81 C ATOM 2044 C LYS A1264 12.150 -5.990 12.875 1.00 25.32 C ATOM 2045 O LYS A1264 11.045 -5.809 12.363 1.00 25.69 O ATOM 2046 CB LYS A1264 13.978 -5.052 11.474 1.00 22.44 C ATOM 2047 CG LYS A1264 14.788 -6.319 11.381 1.00 22.74 C ATOM 2048 CD LYS A1264 15.523 -6.404 10.061 1.00 23.11 C ATOM 2049 CE LYS A1264 16.398 -7.635 10.028 1.00 23.96 C ATOM 2050 NZ LYS A1264 17.095 -7.754 8.727 1.00 28.72 N ATOM 2051 N ASP A1265 12.457 -7.114 13.508 1.00 26.57 N ATOM 2052 CA ASP A1265 11.475 -8.189 13.591 1.00 30.75 C ATOM 2053 C ASP A1265 10.441 -8.024 14.704 1.00 31.72 C ATOM 2054 O ASP A1265 9.578 -8.882 14.884 1.00 33.32 O ATOM 2055 CB ASP A1265 12.182 -9.542 13.744 1.00 31.44 C ATOM 2056 CG ASP A1265 13.127 -9.837 12.596 1.00 33.92 C ATOM 2057 OD1 ASP A1265 12.763 -9.550 11.436 1.00 34.72 O ATOM 2058 OD2 ASP A1265 14.231 -10.363 12.847 1.00 39.66 O ATOM 2059 N ASP A1266 10.519 -6.926 15.448 1.00 31.69 N ATOM 2060 CA ASP A1266 9.581 -6.698 16.540 1.00 31.18 C ATOM 2061 C ASP A1266 8.879 -5.355 16.422 1.00 28.87 C ATOM 2062 O ASP A1266 8.662 -4.679 17.425 1.00 28.70 O ATOM 2063 CB ASP A1266 10.317 -6.754 17.880 1.00 35.81 C ATOM 2064 CG ASP A1266 11.067 -8.059 18.083 1.00 41.62 C ATOM 2065 OD1 ASP A1266 10.418 -9.130 18.096 1.00 43.92 O ATOM 2066 OD2 ASP A1266 12.308 -8.011 18.231 1.00 42.28 O ATOM 2067 N LEU A1267 8.516 -4.965 15.208 1.00 24.98 N ATOM 2068 CA LEU A1267 7.870 -3.675 15.026 1.00 22.53 C ATOM 2069 C LEU A1267 6.480 -3.757 14.428 1.00 21.06 C ATOM 2070 O LEU A1267 6.065 -4.793 13.919 1.00 21.62 O ATOM 2071 CB LEU A1267 8.751 -2.774 14.155 1.00 19.23 C ATOM 2072 CG LEU A1267 10.161 -2.551 14.717 1.00 19.00 C ATOM 2073 CD1 LEU A1267 10.981 -1.689 13.771 1.00 13.90 C ATOM 2074 CD2 LEU A1267 10.064 -1.900 16.095 1.00 17.40 C ATOM 2075 N HIS A1268 5.765 -2.642 14.503 1.00 20.37 N ATOM 2076 CA HIS A1268 4.427 -2.551 13.951 1.00 20.63 C ATOM 2077 C HIS A1268 4.528 -2.876 12.460 1.00 21.77 C ATOM 2078 O HIS A1268 5.511 -2.522 11.809 1.00 22.96 O ATOM 2079 CB HIS A1268 3.876 -1.138 14.167 1.00 18.53 C ATOM 2080 CG HIS A1268 2.456 -0.971 13.733 1.00 19.13 C ATOM 2081 ND1 HIS A1268 2.086 -0.917 12.407 1.00 20.30 N ATOM 2082 CD2 HIS A1268 1.311 -0.882 14.449 1.00 18.99 C ATOM 2083 CE1 HIS A1268 0.772 -0.802 12.324 1.00 19.35 C ATOM 2084 NE2 HIS A1268 0.279 -0.779 13.550 1.00 21.21 N ATOM 2085 N PRO A1269 3.521 -3.568 11.905 1.00 22.18 N ATOM 2086 CA PRO A1269 3.490 -3.954 10.489 1.00 23.66 C ATOM 2087 C PRO A1269 3.728 -2.820 9.489 1.00 24.11 C ATOM 2088 O PRO A1269 4.343 -3.024 8.439 1.00 24.23 O ATOM 2089 CB PRO A1269 2.101 -4.566 10.333 1.00 24.26 C ATOM 2090 CG PRO A1269 1.855 -5.168 11.670 1.00 23.25 C ATOM 2091 CD PRO A1269 2.332 -4.083 12.606 1.00 22.62 C ATOM 2092 N SER A1270 3.240 -1.630 9.821 1.00 23.51 N ATOM 2093 CA SER A1270 3.380 -0.475 8.946 1.00 23.35 C ATOM 2094 C SER A1270 4.814 0.025 8.758 1.00 23.34 C ATOM 2095 O SER A1270 5.114 0.674 7.754 1.00 23.73 O ATOM 2096 CB SER A1270 2.527 0.679 9.477 1.00 23.20 C ATOM 2097 OG SER A1270 3.029 1.155 10.716 1.00 23.30 O ATOM 2098 N PHE A1271 5.689 -0.283 9.714 1.00 21.83 N ATOM 2099 CA PHE A1271 7.076 0.185 9.692 1.00 20.91 C ATOM 2100 C PHE A1271 7.838 0.107 8.366 1.00 21.71 C ATOM 2101 O PHE A1271 8.371 1.116 7.896 1.00 22.53 O ATOM 2102 CB PHE A1271 7.893 -0.525 10.778 1.00 19.31 C ATOM 2103 CG PHE A1271 9.209 0.139 11.074 1.00 18.32 C ATOM 2104 CD1 PHE A1271 9.264 1.279 11.872 1.00 17.02 C ATOM 2105 CD2 PHE A1271 10.391 -0.353 10.528 1.00 17.44 C ATOM 2106 CE1 PHE A1271 10.475 1.917 12.121 1.00 16.43 C ATOM 2107 CE2 PHE A1271 11.606 0.277 10.771 1.00 15.62 C ATOM 2108 CZ PHE A1271 11.651 1.414 11.567 1.00 15.79 C ATOM 2109 N PRO A1272 7.909 -1.085 7.749 1.00 20.91 N ATOM 2110 CA PRO A1272 8.627 -1.237 6.476 1.00 21.68 C ATOM 2111 C PRO A1272 8.076 -0.367 5.343 1.00 22.85 C ATOM 2112 O PRO A1272 8.783 -0.046 4.388 1.00 22.00 O ATOM 2113 CB PRO A1272 8.480 -2.731 6.170 1.00 20.46 C ATOM 2114 CG PRO A1272 8.322 -3.354 7.532 1.00 19.67 C ATOM 2115 CD PRO A1272 7.381 -2.384 8.205 1.00 21.95 C ATOM 2116 N GLU A1273 6.812 0.014 5.458 1.00 22.32 N ATOM 2117 CA GLU A1273 6.174 0.820 4.432 1.00 23.56 C ATOM 2118 C GLU A1273 6.558 2.287 4.545 1.00 21.00 C ATOM 2119 O GLU A1273 6.468 3.032 3.569 1.00 18.85 O ATOM 2120 CB GLU A1273 4.653 0.676 4.542 1.00 28.03 C ATOM 2121 CG GLU A1273 4.210 -0.750 4.848 1.00 37.61 C ATOM 2122 CD GLU A1273 2.706 -0.894 5.008 1.00 43.23 C ATOM 2123 OE1 GLU A1273 2.093 -0.084 5.743 1.00 44.87 O ATOM 2124 OE2 GLU A1273 2.140 -1.830 4.405 1.00 45.17 O ATOM 2125 N VAL A1274 6.991 2.703 5.731 1.00 17.22 N ATOM 2126 CA VAL A1274 7.342 4.101 5.938 1.00 16.22 C ATOM 2127 C VAL A1274 8.769 4.388 6.371 1.00 16.68 C ATOM 2128 O VAL A1274 9.197 5.538 6.347 1.00 19.27 O ATOM 2129 CB VAL A1274 6.422 4.738 6.984 1.00 14.72 C ATOM 2130 CG1 VAL A1274 4.964 4.587 6.558 1.00 12.20 C ATOM 2131 CG2 VAL A1274 6.663 4.084 8.339 1.00 10.14 C ATOM 2132 N SER A1275 9.511 3.363 6.764 1.00 15.53 N ATOM 2133 CA SER A1275 10.866 3.595 7.237 1.00 17.21 C ATOM 2134 C SER A1275 11.887 3.901 6.152 1.00 18.18 C ATOM 2135 O SER A1275 11.734 3.513 4.991 1.00 19.23 O ATOM 2136 CB SER A1275 11.357 2.397 8.043 1.00 18.20 C ATOM 2137 OG SER A1275 11.701 1.329 7.183 1.00 19.24 O ATOM 2138 N PHE A1276 12.933 4.611 6.551 1.00 16.47 N ATOM 2139 CA PHE A1276 14.010 4.948 5.647 1.00 15.80 C ATOM 2140 C PHE A1276 14.810 3.659 5.487 1.00 17.23 C ATOM 2141 O PHE A1276 15.324 3.363 4.411 1.00 18.68 O ATOM 2142 CB PHE A1276 14.881 6.047 6.264 1.00 14.85 C ATOM 2143 CG PHE A1276 16.292 6.088 5.724 1.00 16.96 C ATOM 2144 CD1 PHE A1276 16.546 6.462 4.403 1.00 17.46 C ATOM 2145 CD2 PHE A1276 17.369 5.722 6.532 1.00 16.28 C ATOM 2146 CE1 PHE A1276 17.855 6.469 3.891 1.00 13.71 C ATOM 2147 CE2 PHE A1276 18.683 5.726 6.028 1.00 15.15 C ATOM 2148 CZ PHE A1276 18.921 6.100 4.706 1.00 15.88 C ATOM 2149 N PHE A1277 14.899 2.895 6.573 1.00 17.31 N ATOM 2150 CA PHE A1277 15.643 1.637 6.594 1.00 19.87 C ATOM 2151 C PHE A1277 15.182 0.672 5.505 1.00 21.08 C ATOM 2152 O PHE A1277 15.995 0.024 4.850 1.00 20.41 O ATOM 2153 CB PHE A1277 15.484 0.962 7.961 1.00 20.26 C ATOM 2154 CG PHE A1277 16.235 -0.333 8.095 1.00 18.02 C ATOM 2155 CD1 PHE A1277 17.602 -0.343 8.353 1.00 18.00 C ATOM 2156 CD2 PHE A1277 15.575 -1.549 7.965 1.00 17.87 C ATOM 2157 CE1 PHE A1277 18.300 -1.550 8.480 1.00 18.28 C ATOM 2158 CE2 PHE A1277 16.264 -2.757 8.090 1.00 17.44 C ATOM 2159 CZ PHE A1277 17.627 -2.758 8.349 1.00 16.64 C ATOM 2160 N HIS A1278 13.871 0.585 5.319 1.00 22.77 N ATOM 2161 CA HIS A1278 13.293 -0.305 4.323 1.00 23.54 C ATOM 2162 C HIS A1278 13.083 0.365 2.964 1.00 24.73 C ATOM 2163 O HIS A1278 12.695 -0.293 2.003 1.00 25.49 O ATOM 2164 CB HIS A1278 11.955 -0.843 4.837 1.00 23.84 C ATOM 2165 CG HIS A1278 12.067 -1.681 6.075 1.00 24.81 C ATOM 2166 ND1 HIS A1278 12.455 -3.005 6.047 1.00 25.14 N ATOM 2167 CD2 HIS A1278 11.821 -1.390 7.375 1.00 24.28 C ATOM 2168 CE1 HIS A1278 12.437 -3.493 7.275 1.00 25.31 C ATOM 2169 NE2 HIS A1278 12.056 -2.534 8.101 1.00 23.70 N ATOM 2170 N SER A1279 13.336 1.666 2.880 1.00 26.09 N ATOM 2171 CA SER A1279 13.139 2.394 1.627 1.00 26.33 C ATOM 2172 C SER A1279 14.253 2.122 0.627 1.00 29.71 C ATOM 2173 O SER A1279 15.305 1.589 0.980 1.00 29.77 O ATOM 2174 CB SER A1279 13.076 3.893 1.889 1.00 23.86 C ATOM 2175 OG SER A1279 14.371 4.405 2.132 1.00 23.08 O ATOM 2176 N GLU A1280 14.021 2.494 -0.627 1.00 32.75 N ATOM 2177 CA GLU A1280 15.022 2.286 -1.659 1.00 36.09 C ATOM 2178 C GLU A1280 16.141 3.318 -1.578 1.00 35.95 C ATOM 2179 O GLU A1280 17.123 3.226 -2.308 1.00 37.01 O ATOM 2180 CB GLU A1280 14.382 2.308 -3.050 1.00 38.66 C ATOM 2181 CG GLU A1280 13.566 3.538 -3.381 1.00 42.57 C ATOM 2182 CD GLU A1280 13.021 3.478 -4.798 1.00 46.06 C ATOM 2183 OE1 GLU A1280 12.487 2.415 -5.185 1.00 47.47 O ATOM 2184 OE2 GLU A1280 13.121 4.488 -5.525 1.00 47.98 O ATOM 2185 N GLU A1281 15.993 4.300 -0.694 1.00 35.27 N ATOM 2186 CA GLU A1281 17.024 5.312 -0.522 1.00 35.63 C ATOM 2187 C GLU A1281 18.122 4.770 0.380 1.00 35.55 C ATOM 2188 O GLU A1281 19.059 5.485 0.718 1.00 35.94 O ATOM 2189 CB GLU A1281 16.449 6.579 0.104 1.00 37.25 C ATOM 2190 CG GLU A1281 15.475 7.326 -0.786 1.00 40.72 C ATOM 2191 CD GLU A1281 15.169 8.717 -0.266 1.00 42.18 C ATOM 2192 OE1 GLU A1281 14.385 9.431 -0.923 1.00 45.49 O ATOM 2193 OE2 GLU A1281 15.711 9.100 0.794 1.00 41.11 O ATOM 2194 N ASN A1282 17.994 3.503 0.764 1.00 35.30 N ATOM 2195 CA ASN A1282 18.965 2.842 1.629 1.00 35.89 C ATOM 2196 C ASN A1282 19.262 1.408 1.176 1.00 37.02 C ATOM 2197 O ASN A1282 19.472 0.521 2.000 1.00 36.98 O ATOM 2198 CB ASN A1282 18.443 2.830 3.070 1.00 33.75 C ATOM 2199 CG ASN A1282 19.339 2.049 4.009 1.00 30.28 C ATOM 2200 OD1 ASN A1282 20.549 2.260 4.042 1.00 29.55 O ATOM 2201 ND2 ASN A1282 18.748 1.143 4.779 1.00 27.89 N ATOM 2202 N LYS A1283 19.278 1.180 -0.135 1.00 40.07 N ATOM 2203 CA LYS A1283 19.546 -0.154 -0.678 1.00 40.41 C ATOM 2204 C LYS A1283 19.781 -0.137 -2.189 1.00 39.92 C ATOM 2205 O LYS A1283 19.936 0.976 -2.735 1.00 39.01 O TER 2206 LYS A1283 HETATM 2207 MG MG A 301 15.687 21.832 17.625 1.00 39.70 MG HETATM 2208 PG ACP A 300 16.448 24.266 19.934 1.00 41.70 P HETATM 2209 O1G ACP A 300 16.931 22.954 19.482 1.00 40.95 O HETATM 2210 O2G ACP A 300 16.975 25.420 19.147 1.00 41.96 O HETATM 2211 O3G ACP A 300 16.550 24.450 21.409 1.00 42.49 O HETATM 2212 PB ACP A 300 13.909 24.730 18.179 1.00 36.01 P HETATM 2213 O1B ACP A 300 14.126 26.189 18.046 1.00 35.49 O HETATM 2214 O2B ACP A 300 14.290 23.919 17.006 1.00 37.08 O HETATM 2215 C3B ACP A 300 14.761 24.218 19.575 1.00 38.80 C HETATM 2216 PA ACP A 300 11.548 23.242 18.570 1.00 33.01 P HETATM 2217 O1A ACP A 300 11.290 22.726 17.204 1.00 30.20 O HETATM 2218 O2A ACP A 300 12.124 22.337 19.595 1.00 31.95 O HETATM 2219 O3A ACP A 300 12.423 24.492 18.474 1.00 34.51 O HETATM 2220 O5' ACP A 300 10.170 23.859 19.157 1.00 30.65 O HETATM 2221 C5' ACP A 300 9.942 24.271 20.532 1.00 26.60 C HETATM 2222 C4' ACP A 300 8.649 23.694 21.064 1.00 26.18 C HETATM 2223 O4' ACP A 300 7.561 24.068 20.172 1.00 26.14 O HETATM 2224 C3' ACP A 300 8.580 22.172 21.130 1.00 25.59 C HETATM 2225 O3' ACP A 300 9.124 21.677 22.351 1.00 25.96 O HETATM 2226 C2' ACP A 300 7.081 21.924 21.059 1.00 24.96 C HETATM 2227 O2' ACP A 300 6.443 22.167 22.297 1.00 27.12 O HETATM 2228 C1' ACP A 300 6.651 22.984 20.041 1.00 25.37 C HETATM 2229 N9 ACP A 300 6.695 22.501 18.655 1.00 24.59 N HETATM 2230 C8 ACP A 300 7.646 22.775 17.695 1.00 23.59 C HETATM 2231 N7 ACP A 300 7.434 22.170 16.551 1.00 22.15 N HETATM 2232 C5 ACP A 300 6.264 21.451 16.764 1.00 22.87 C HETATM 2233 C6 ACP A 300 5.510 20.596 15.929 1.00 21.19 C HETATM 2234 N6 ACP A 300 5.855 20.295 14.674 1.00 19.76 N HETATM 2235 N1 ACP A 300 4.379 20.051 16.438 1.00 19.28 N HETATM 2236 C2 ACP A 300 4.042 20.345 17.701 1.00 22.98 C HETATM 2237 N3 ACP A 300 4.673 21.125 18.588 1.00 24.55 N HETATM 2238 C4 ACP A 300 5.789 21.655 18.051 1.00 24.35 C HETATM 2239 O HOH A 1 -4.536 20.753 3.484 1.00 11.81 O HETATM 2240 O HOH A 2 23.028 14.315 19.855 1.00 8.97 O HETATM 2241 O HOH A 3 15.487 17.622 16.909 1.00 8.54 O HETATM 2242 O HOH A 4 7.173 13.060 8.768 1.00 6.26 O HETATM 2243 O HOH A 5 26.830 14.400 18.750 1.00 8.40 O HETATM 2244 O HOH A 6 10.319 -3.983 10.113 1.00 25.19 O HETATM 2245 O HOH A 7 13.529 -6.866 28.425 1.00 25.53 O HETATM 2246 O HOH A 8 0.070 14.755 15.119 1.00 12.80 O HETATM 2247 O HOH A 9 2.847 1.012 16.391 1.00 20.14 O HETATM 2248 O HOH A 10 4.061 4.775 15.416 1.00 26.74 O HETATM 2249 O HOH A 11 5.539 3.414 20.844 1.00 16.25 O HETATM 2250 O HOH A 12 4.067 5.588 11.874 1.00 7.74 O HETATM 2251 O HOH A 13 2.062 8.080 11.143 1.00 16.39 O HETATM 2252 O HOH A 14 3.677 5.678 25.247 1.00 21.42 O HETATM 2253 O HOH A 15 25.479 11.191 29.235 1.00 15.31 O HETATM 2254 O HOH A 16 -4.956 22.161 14.681 1.00 26.27 O HETATM 2255 O HOH A 17 25.485 0.801 9.323 1.00 22.39 O HETATM 2256 O HOH A 18 6.006 5.005 18.648 1.00 17.92 O HETATM 2257 O HOH A 19 10.665 18.245 5.489 1.00 24.04 O HETATM 2258 O HOH A 20 -4.202 16.858 10.049 1.00 25.51 O HETATM 2259 O HOH A 21 -7.672 22.121 14.582 1.00 28.93 O HETATM 2260 O HOH A 22 29.708 11.553 11.391 1.00 21.68 O HETATM 2261 O HOH A 23 2.203 -2.490 23.656 1.00 16.99 O HETATM 2262 O HOH A 24 0.423 9.719 42.165 1.00 38.74 O HETATM 2263 O HOH A 25 -1.542 20.319 19.776 1.00 23.90 O HETATM 2264 O HOH A 26 2.456 22.767 23.991 1.00 31.82 O HETATM 2265 O HOH A 27 21.386 16.545 23.623 1.00 12.81 O HETATM 2266 O HOH A 28 33.766 8.713 38.856 1.00 32.50 O HETATM 2267 O HOH A 29 28.971 0.379 28.189 1.00 24.68 O HETATM 2268 O HOH A 30 11.116 14.265 6.632 1.00 19.47 O HETATM 2269 O HOH A 31 1.620 14.248 11.832 1.00 20.47 O HETATM 2270 O HOH A 32 20.035 -0.990 5.823 1.00 27.09 O HETATM 2271 O HOH A 33 2.722 3.891 10.553 1.00 27.86 O HETATM 2272 O HOH A 34 22.677 0.695 4.078 1.00 26.16 O HETATM 2273 O HOH A 35 5.529 1.877 12.119 1.00 25.04 O HETATM 2274 O HOH A 36 25.161 -4.419 16.840 1.00 37.58 O HETATM 2275 O HOH A 37 27.020 5.506 15.180 1.00 29.40 O HETATM 2276 O HOH A 38 21.929 4.743 3.385 1.00 30.84 O HETATM 2277 O HOH A 39 8.532 -6.376 12.804 1.00 27.84 O HETATM 2278 O HOH A 40 0.272 17.860 10.388 1.00 21.74 O HETATM 2279 O HOH A 41 27.374 13.143 29.325 1.00 18.00 O HETATM 2280 O HOH A 42 4.150 16.753 30.916 1.00 28.81 O HETATM 2281 O HOH A 43 11.867 16.702 7.440 1.00 15.44 O HETATM 2282 O HOH A 44 2.375 10.727 11.362 1.00 25.94 O HETATM 2283 O HOH A 45 0.062 16.436 7.710 1.00 26.06 O HETATM 2284 O HOH A 46 30.670 3.766 15.518 1.00 30.23 O HETATM 2285 O HOH A 47 11.444 3.098 -1.153 1.00 23.56 O HETATM 2286 O HOH A 48 8.321 22.645 24.997 1.00 41.05 O HETATM 2287 O HOH A 49 15.577 17.867 28.719 1.00 17.31 O HETATM 2288 O HOH A 50 11.641 -6.264 8.804 1.00 27.81 O HETATM 2289 O HOH A 51 10.643 7.467 5.531 1.00 25.17 O HETATM 2290 O HOH A 52 4.726 9.215 5.399 1.00 29.35 O HETATM 2291 O HOH A 53 28.290 14.307 22.301 1.00 25.98 O HETATM 2292 O HOH A 54 11.861 28.896 16.561 1.00 22.94 O HETATM 2293 O HOH A 55 18.188 16.030 0.553 1.00 26.33 O HETATM 2294 O HOH A 56 16.763 -8.994 13.564 1.00 46.09 O HETATM 2295 O HOH A 57 18.991 30.493 16.645 1.00 29.19 O HETATM 2296 O HOH A 58 -4.149 10.605 20.250 1.00 26.39 O HETATM 2297 O HOH A 59 35.350 8.645 23.765 1.00 26.57 O HETATM 2298 O HOH A 60 23.743 25.330 26.944 1.00 40.86 O HETATM 2299 O HOH A 61 14.724 -7.787 15.308 1.00 20.78 O HETATM 2300 O HOH A 62 -0.353 13.027 27.584 1.00 30.69 O HETATM 2301 O HOH A 63 14.287 13.772 30.728 1.00 18.38 O HETATM 2302 O HOH A 64 1.319 -7.152 19.576 1.00 22.46 O HETATM 2303 O HOH A 65 3.731 20.955 21.310 1.00 24.97 O HETATM 2304 O HOH A 66 35.025 1.205 24.311 1.00 22.39 O HETATM 2305 O HOH A 67 25.372 7.475 30.197 1.00 19.72 O HETATM 2306 O HOH A 68 -4.670 8.663 15.625 1.00 35.77 O HETATM 2307 O HOH A 69 5.146 -1.848 17.574 1.00 28.51 O HETATM 2308 O HOH A 70 18.620 19.735 2.569 1.00 25.96 O HETATM 2309 O HOH A 71 38.661 19.080 27.959 1.00 40.70 O HETATM 2310 O HOH A 72 0.504 6.219 33.523 1.00 29.19 O HETATM 2311 O HOH A 73 -0.521 5.150 23.636 1.00 32.35 O HETATM 2312 O HOH A 74 18.278 -9.919 9.601 1.00 33.91 O HETATM 2313 O HOH A 75 30.294 -0.512 15.111 1.00 27.08 O HETATM 2314 O HOH A 76 -1.420 -4.765 13.153 1.00 44.89 O HETATM 2315 O HOH A 77 8.911 31.349 26.934 1.00 50.53 O HETATM 2316 O HOH A 78 -11.823 23.833 11.630 1.00 30.44 O HETATM 2317 O HOH A 79 3.909 43.083 5.426 1.00 33.96 O HETATM 2318 O HOH A 80 22.673 -4.942 13.388 1.00 30.43 O HETATM 2319 O HOH A 81 22.257 -9.024 29.149 1.00 22.32 O HETATM 2320 O HOH A 82 7.421 -3.104 19.119 1.00 32.55 O HETATM 2321 O HOH A 83 11.187 20.835 13.568 1.00 42.45 O HETATM 2322 O HOH A 84 5.123 10.374 39.406 1.00 39.90 O HETATM 2323 O HOH A 85 15.448 12.466 38.122 1.00 37.02 O HETATM 2324 O HOH A 86 21.063 18.376 39.271 1.00 35.49 O HETATM 2325 O HOH A 87 28.642 9.688 1.122 1.00 53.24 O HETATM 2326 O HOH A 88 13.803 26.896 12.947 1.00 36.70 O HETATM 2327 O HOH A 89 4.022 15.711 4.656 1.00 32.45 O HETATM 2328 O HOH A 90 27.131 -3.105 16.220 1.00 26.41 O HETATM 2329 O HOH A 91 5.430 -5.831 7.783 1.00 38.28 O HETATM 2330 O HOH A 92 31.849 7.309 30.132 1.00 12.87 O HETATM 2331 O HOH A 93 9.327 29.939 -1.170 1.00 32.81 O HETATM 2332 O HOH A 94 23.073 19.305 11.957 1.00 24.44 O HETATM 2333 O HOH A 95 10.865 7.531 36.794 1.00 58.10 O HETATM 2334 O HOH A 96 19.146 21.637 19.243 1.00 39.13 O HETATM 2335 O HOH A 97 7.149 -4.842 11.176 1.00 21.60 O HETATM 2336 O HOH A 98 23.384 4.955 10.286 1.00 5.99 O HETATM 2337 O HOH A 99 7.668 -8.918 13.411 1.00 18.27 O HETATM 2338 O HOH A 100 12.521 20.409 16.230 1.00 21.78 O HETATM 2339 O HOH A 101 23.495 20.529 14.218 1.00 40.99 O HETATM 2340 O HOH A 102 2.305 23.502 -0.409 1.00 24.94 O HETATM 2341 O HOH A 103 19.231 -5.848 22.033 1.00 32.16 O HETATM 2342 O HOH A 104 25.659 14.161 21.135 1.00 18.18 O HETATM 2343 O HOH A 105 32.334 11.265 18.196 1.00 30.39 O HETATM 2344 O HOH A 106 22.234 16.346 2.679 1.00 19.44 O HETATM 2345 O HOH A 107 12.558 7.978 3.932 1.00 26.58 O HETATM 2346 O HOH A 108 -2.434 15.789 14.153 1.00 19.68 O HETATM 2347 O HOH A 109 -7.238 25.822 20.525 1.00 45.94 O HETATM 2348 O HOH A 110 9.425 29.728 15.948 1.00 21.77 O HETATM 2349 O HOH A 111 15.547 22.002 22.826 1.00 29.83 O HETATM 2350 O HOH A 112 19.230 25.354 21.728 1.00 38.25 O HETATM 2351 O HOH A 113 25.912 16.245 15.741 1.00 63.01 O HETATM 2352 O HOH A 114 17.485 23.521 16.173 1.00 25.80 O HETATM 2353 O HOH A 115 17.705 22.466 12.979 1.00 27.03 O HETATM 2354 O HOH A 116 17.586 20.171 17.511 1.00 20.35 O HETATM 2355 O HOH A 117 0.111 17.738 -1.499 1.00 19.98 O HETATM 2356 O HOH A 118 -6.509 20.533 -0.704 1.00 18.64 O HETATM 2357 O HOH A 119 -10.006 18.431 5.506 1.00 35.18 O HETATM 2358 O HOH A 120 -6.935 28.310 7.356 1.00 35.67 O HETATM 2359 O HOH A 121 13.791 20.668 18.641 1.00 30.49 O HETATM 2360 O HOH A 122 15.287 15.663 26.932 1.00 12.65 O HETATM 2361 O HOH A 123 22.826 18.997 30.701 1.00 27.82 O HETATM 2362 O HOH A 124 11.851 20.920 21.800 1.00 40.31 O HETATM 2363 O HOH A 125 6.403 4.426 12.560 1.00 17.70 O HETATM 2364 O HOH A 126 0.626 3.201 13.530 1.00 29.52 O HETATM 2365 O HOH A 127 23.637 5.371 5.357 1.00 25.30 O HETATM 2366 O HOH A 128 3.012 2.309 14.191 1.00 40.88 O HETATM 2367 O HOH A 129 3.335 4.810 22.764 1.00 26.82 O HETATM 2368 O HOH A 130 24.924 7.951 37.745 1.00 36.31 O HETATM 2369 O HOH A 131 5.912 20.106 23.683 1.00 25.57 O HETATM 2370 O HOH A 132 34.884 10.723 38.211 1.00 36.80 O HETATM 2371 O HOH A 133 9.115 14.739 36.568 1.00 29.04 O HETATM 2372 O HOH A 134 13.196 16.096 34.539 1.00 39.20 O HETATM 2373 O HOH A 135 34.543 18.819 35.666 1.00 28.41 O HETATM 2374 O HOH A 136 0.993 3.825 21.811 1.00 25.65 O HETATM 2375 O HOH A 137 3.309 33.641 0.695 1.00 24.77 O HETATM 2376 O HOH A 138 12.284 23.341 22.795 1.00 42.09 O HETATM 2377 O HOH A 139 13.088 26.356 15.345 1.00 37.10 O HETATM 2378 O HOH A 140 12.763 27.441 10.628 1.00 33.11 O HETATM 2379 O HOH A 141 16.203 25.831 15.709 1.00 43.51 O CONECT 1265 2207 CONECT 1266 2207 CONECT 2207 1265 1266 2209 2214 CONECT 2207 2352 2354 2359 CONECT 2208 2209 2210 2211 2215 CONECT 2209 2207 2208 CONECT 2210 2208 CONECT 2211 2208 CONECT 2212 2213 2214 2215 2219 CONECT 2213 2212 CONECT 2214 2207 2212 CONECT 2215 2208 2212 CONECT 2216 2217 2218 2219 2220 CONECT 2217 2216 CONECT 2218 2216 CONECT 2219 2212 2216 CONECT 2220 2216 2221 CONECT 2221 2220 2222 CONECT 2222 2221 2223 2224 CONECT 2223 2222 2228 CONECT 2224 2222 2225 2226 CONECT 2225 2224 CONECT 2226 2224 2227 2228 CONECT 2227 2226 CONECT 2228 2223 2226 2229 CONECT 2229 2228 2230 2238 CONECT 2230 2229 2231 CONECT 2231 2230 2232 CONECT 2232 2231 2233 2238 CONECT 2233 2232 2234 2235 CONECT 2234 2233 CONECT 2235 2233 2236 CONECT 2236 2235 2237 CONECT 2237 2236 2238 CONECT 2238 2229 2232 2237 CONECT 2352 2207 CONECT 2354 2207 CONECT 2359 2207 MASTER 321 0 2 15 7 0 8 6 2378 1 38 24 END