>>1I84:HELIX   34  34 ALA S  904  ARG S  943  1                                  40    
AETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEER
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 34 34 ALA S 904 ARG S 943 1 40 ATOM 6833 N ALA S 904 -9.696 109.944 26.965 0.00 0.00 N ATOM 6834 CA ALA S 904 -9.109 111.202 26.462 0.00 0.00 C ATOM 6835 C ALA S 904 -8.134 111.774 27.500 0.00 0.00 C ATOM 6836 O ALA S 904 -6.999 112.177 27.188 0.00 0.00 O ATOM 6837 N GLU S 905 -8.596 111.809 28.732 0.00 0.00 N ATOM 6838 CA GLU S 905 -7.787 112.341 29.830 0.00 0.00 C ATOM 6839 C GLU S 905 -6.488 111.565 29.927 0.00 0.00 C ATOM 6840 O GLU S 905 -5.423 112.154 30.046 0.00 0.00 O ATOM 6841 N THR S 906 -6.594 110.256 29.892 0.00 0.00 N ATOM 6842 CA THR S 906 -5.416 109.393 29.993 0.00 0.00 C ATOM 6843 C THR S 906 -4.427 109.747 28.885 0.00 0.00 C ATOM 6844 O THR S 906 -3.226 109.919 29.142 0.00 0.00 O ATOM 6845 N GLU S 907 -4.944 109.846 27.677 0.00 0.00 N ATOM 6846 CA GLU S 907 -4.082 110.174 26.525 0.00 0.00 C ATOM 6847 C GLU S 907 -3.357 111.510 26.778 0.00 0.00 C ATOM 6848 O GLU S 907 -2.123 111.647 26.590 0.00 0.00 O ATOM 6849 N LEU S 908 -4.137 112.484 27.202 0.00 0.00 N ATOM 6850 CA LEU S 908 -3.585 113.819 27.475 0.00 0.00 C ATOM 6851 C LEU S 908 -2.480 113.716 28.522 0.00 0.00 C ATOM 6852 O LEU S 908 -1.403 114.292 28.371 0.00 0.00 O ATOM 6853 N TYR S 909 -2.767 112.993 29.581 0.00 0.00 N ATOM 6854 CA TYR S 909 -1.811 112.819 30.669 0.00 0.00 C ATOM 6855 C TYR S 909 -0.527 112.222 30.127 0.00 0.00 C ATOM 6856 O TYR S 909 0.557 112.706 30.439 0.00 0.00 O ATOM 6857 N ALA S 910 -0.665 111.180 29.338 0.00 0.00 N ATOM 6858 CA ALA S 910 0.512 110.512 28.762 0.00 0.00 C ATOM 6859 C ALA S 910 1.347 111.524 27.965 0.00 0.00 C ATOM 6860 O ALA S 910 2.587 111.618 28.121 0.00 0.00 O ATOM 6861 N GLU S 911 0.657 112.271 27.126 0.00 0.00 N ATOM 6862 CA GLU S 911 1.342 113.281 26.295 0.00 0.00 C ATOM 6863 C GLU S 911 2.096 114.270 27.192 0.00 0.00 C ATOM 6864 O GLU S 911 3.275 114.603 26.965 0.00 0.00 O ATOM 6865 N ALA S 912 1.400 114.741 28.206 0.00 0.00 N ATOM 6866 CA ALA S 912 1.979 115.705 29.141 0.00 0.00 C ATOM 6867 C ALA S 912 3.228 115.117 29.772 0.00 0.00 C ATOM 6868 O ALA S 912 4.253 115.779 29.849 0.00 0.00 O ATOM 6869 N GLU S 913 3.120 113.889 30.227 0.00 0.00 N ATOM 6870 CA GLU S 913 4.248 113.213 30.870 0.00 0.00 C ATOM 6871 C GLU S 913 5.439 113.186 29.917 0.00 0.00 C ATOM 6872 O GLU S 913 6.567 113.525 30.305 0.00 0.00 O ATOM 6873 N GLU S 914 5.173 112.782 28.691 0.00 0.00 N ATOM 6874 CA GLU S 914 6.250 112.706 27.684 0.00 0.00 C ATOM 6875 C GLU S 914 6.920 114.084 27.529 0.00 0.00 C ATOM 6876 O GLU S 914 8.168 114.225 27.537 0.00 0.00 O ATOM 6877 N MET S 915 6.079 115.089 27.391 0.00 0.00 N ATOM 6878 CA MET S 915 6.577 116.463 27.224 0.00 0.00 C ATOM 6879 C MET S 915 7.451 116.843 28.415 0.00 0.00 C ATOM 6880 O MET S 915 8.542 117.392 28.255 0.00 0.00 O ATOM 6881 N ARG S 916 6.954 116.559 29.597 0.00 0.00 N ATOM 6882 CA ARG S 916 7.674 116.881 30.825 0.00 0.00 C ATOM 6883 C ARG S 916 9.037 116.212 30.805 0.00 0.00 C ATOM 6884 O ARG S 916 10.041 116.853 31.100 0.00 0.00 O ATOM 6885 N VAL S 917 9.049 114.941 30.469 0.00 0.00 N ATOM 6886 CA VAL S 917 10.312 114.187 30.427 0.00 0.00 C ATOM 6887 C VAL S 917 11.295 114.876 29.470 0.00 0.00 C ATOM 6888 O VAL S 917 12.481 115.109 29.805 0.00 0.00 O ATOM 6889 N ARG S 918 10.792 115.197 28.296 0.00 0.00 N ATOM 6890 CA ARG S 918 11.635 115.859 27.282 0.00 0.00 C ATOM 6891 C ARG S 918 12.204 117.167 27.850 0.00 0.00 C ATOM 6892 O ARG S 918 13.408 117.468 27.735 0.00 0.00 O ATOM 6893 N LEU S 919 11.325 117.938 28.454 0.00 0.00 N ATOM 6894 CA LEU S 919 11.716 119.224 29.032 0.00 0.00 C ATOM 6895 C LEU S 919 12.811 119.007 30.061 0.00 0.00 C ATOM 6896 O LEU S 919 13.804 119.718 30.064 0.00 0.00 O ATOM 6897 N ALA S 920 12.603 118.041 30.928 0.00 0.00 N ATOM 6898 CA ALA S 920 13.577 117.741 31.979 0.00 0.00 C ATOM 6899 C ALA S 920 14.933 117.436 31.350 0.00 0.00 C ATOM 6900 O ALA S 920 15.964 117.976 31.778 0.00 0.00 O ATOM 6901 N ALA S 921 14.912 116.578 30.350 0.00 0.00 N ATOM 6902 CA ALA S 921 16.166 116.199 29.669 0.00 0.00 C ATOM 6903 C ALA S 921 16.865 117.457 29.121 0.00 0.00 C ATOM 6904 O ALA S 921 18.087 117.676 29.306 0.00 0.00 O ATOM 6905 N LYS S 922 16.077 118.274 28.451 0.00 0.00 N ATOM 6906 CA LYS S 922 16.607 119.511 27.861 0.00 0.00 C ATOM 6907 C LYS S 922 17.233 120.375 28.952 0.00 0.00 C ATOM 6908 O LYS S 922 18.337 120.898 28.799 0.00 0.00 O ATOM 6909 N LYS S 923 16.509 120.529 30.038 0.00 0.00 N ATOM 6910 CA LYS S 923 16.972 121.343 31.158 0.00 0.00 C ATOM 6911 C LYS S 923 18.308 120.814 31.650 0.00 0.00 C ATOM 6912 O LYS S 923 19.238 121.586 31.855 0.00 0.00 O ATOM 6913 N GLN S 924 18.376 119.515 31.841 0.00 0.00 N ATOM 6914 CA GLN S 924 19.615 118.891 32.328 0.00 0.00 C ATOM 6915 C GLN S 924 20.775 119.231 31.381 0.00 0.00 C ATOM 6916 O GLN S 924 21.873 119.655 31.814 0.00 0.00 O ATOM 6917 N GLU S 925 20.516 119.045 30.101 0.00 0.00 N ATOM 6918 CA GLU S 925 21.550 119.328 29.086 0.00 0.00 C ATOM 6919 C GLU S 925 22.007 120.789 29.199 0.00 0.00 C ATOM 6920 O GLU S 925 23.211 121.106 29.202 0.00 0.00 O ATOM 6921 N LEU S 926 21.031 121.669 29.283 0.00 0.00 N ATOM 6922 CA LEU S 926 21.308 123.101 29.382 0.00 0.00 C ATOM 6923 C LEU S 926 22.176 123.371 30.598 0.00 0.00 C ATOM 6924 O LEU S 926 23.156 124.097 30.511 0.00 0.00 O ATOM 6925 N GLU S 927 21.794 122.794 31.715 0.00 0.00 N ATOM 6926 CA GLU S 927 22.537 122.986 32.961 0.00 0.00 C ATOM 6927 C GLU S 927 23.988 122.559 32.764 0.00 0.00 C ATOM 6928 O GLU S 927 24.918 123.291 33.134 0.00 0.00 O ATOM 6929 N GLU S 928 24.159 121.386 32.189 0.00 0.00 N ATOM 6930 CA GLU S 928 25.520 120.864 31.953 0.00 0.00 C ATOM 6931 C GLU S 928 26.324 121.864 31.101 0.00 0.00 C ATOM 6932 O GLU S 928 27.486 122.221 31.410 0.00 0.00 O ATOM 6933 N ILE S 929 25.690 122.308 30.035 0.00 0.00 N ATOM 6934 CA ILE S 929 26.338 123.261 29.121 0.00 0.00 C ATOM 6935 C ILE S 929 26.741 124.516 29.889 0.00 0.00 C ATOM 6936 O ILE S 929 27.858 125.016 29.753 0.00 0.00 O ATOM 6937 N LEU S 930 25.817 125.021 30.674 0.00 0.00 N ATOM 6938 CA LEU S 930 26.057 126.230 31.457 0.00 0.00 C ATOM 6939 C LEU S 930 27.263 126.023 32.354 0.00 0.00 C ATOM 6940 O LEU S 930 28.141 126.877 32.415 0.00 0.00 O ATOM 6941 N HIS S 931 27.282 124.902 33.044 0.00 0.00 N ATOM 6942 CA HIS S 931 28.396 124.598 33.955 0.00 0.00 C ATOM 6943 C HIS S 931 29.723 124.631 33.183 0.00 0.00 C ATOM 6944 O HIS S 931 30.715 125.264 33.613 0.00 0.00 O ATOM 6945 N GLU S 932 29.721 123.955 32.051 0.00 0.00 N ATOM 6946 CA GLU S 932 30.938 123.901 31.217 0.00 0.00 C ATOM 6947 C GLU S 932 31.374 125.324 30.838 0.00 0.00 C ATOM 6948 O GLU S 932 32.556 125.701 30.942 0.00 0.00 O ATOM 6949 N MET S 933 30.409 126.099 30.393 0.00 0.00 N ATOM 6950 CA MET S 933 30.673 127.477 29.978 0.00 0.00 C ATOM 6951 C MET S 933 31.283 128.248 31.134 0.00 0.00 C ATOM 6952 O MET S 933 32.267 128.952 30.957 0.00 0.00 O ATOM 6953 N GLU S 934 30.683 128.115 32.296 0.00 0.00 N ATOM 6954 CA GLU S 934 31.166 128.819 33.486 0.00 0.00 C ATOM 6955 C GLU S 934 32.625 128.450 33.741 0.00 0.00 C ATOM 6956 O GLU S 934 33.469 129.331 33.965 0.00 0.00 O ATOM 6957 N ALA S 935 32.896 127.162 33.706 0.00 0.00 N ATOM 6958 CA ALA S 935 34.273 126.685 33.949 0.00 0.00 C ATOM 6959 C ALA S 935 35.237 127.338 32.941 0.00 0.00 C ATOM 6960 O ALA S 935 36.318 127.866 33.299 0.00 0.00 O ATOM 6961 N ARG S 936 34.832 127.297 31.688 0.00 0.00 N ATOM 6962 CA ARG S 936 35.655 127.873 30.615 0.00 0.00 C ATOM 6963 C ARG S 936 35.909 129.351 30.898 0.00 0.00 C ATOM 6964 O ARG S 936 37.033 129.838 30.790 0.00 0.00 O ATOM 6965 N ILE S 937 34.850 130.053 31.242 0.00 0.00 N ATOM 6966 CA ILE S 937 34.941 131.483 31.524 0.00 0.00 C ATOM 6967 C ILE S 937 35.942 131.716 32.639 0.00 0.00 C ATOM 6968 O ILE S 937 36.798 132.588 32.525 0.00 0.00 O ATOM 6969 N GLU S 938 35.816 130.945 33.698 0.00 0.00 N ATOM 6970 CA GLU S 938 36.724 131.090 34.846 0.00 0.00 C ATOM 6971 C GLU S 938 38.179 130.919 34.382 0.00 0.00 C ATOM 6972 O GLU S 938 39.071 131.734 34.712 0.00 0.00 O ATOM 6973 N GLU S 939 38.395 129.864 33.622 0.00 0.00 N ATOM 6974 CA GLU S 939 39.754 129.581 33.115 0.00 0.00 C ATOM 6975 C GLU S 939 40.268 130.779 32.304 0.00 0.00 C ATOM 6976 O GLU S 939 41.409 131.249 32.471 0.00 0.00 O ATOM 6977 N GLU S 940 39.415 131.257 31.422 0.00 0.00 N ATOM 6978 CA GLU S 940 39.768 132.389 30.564 0.00 0.00 C ATOM 6979 C GLU S 940 40.144 133.581 31.423 0.00 0.00 C ATOM 6980 O GLU S 940 41.148 134.232 31.172 0.00 0.00 O ATOM 6981 N GLU S 941 39.324 133.859 32.412 0.00 0.00 N ATOM 6982 CA GLU S 941 39.568 134.995 33.303 0.00 0.00 C ATOM 6983 C GLU S 941 40.942 134.854 33.949 0.00 0.00 C ATOM 6984 O GLU S 941 41.734 135.809 33.966 0.00 0.00 O ATOM 6985 N GLU S 942 41.206 133.671 34.467 0.00 0.00 N ATOM 6986 CA GLU S 942 42.503 133.421 35.126 0.00 0.00 C ATOM 6987 C GLU S 942 43.652 133.706 34.141 0.00 0.00 C ATOM 6988 O GLU S 942 44.648 134.404 34.460 0.00 0.00 O ATOM 6989 N ARG S 943 43.502 133.163 32.950 0.00 0.00 N ATOM 6990 CA ARG S 943 44.528 133.343 31.911 0.00 0.00 C ATOM 6991 C ARG S 943 44.732 134.830 31.641 0.00 0.00 C ATOM 6992 O ARG S 943 45.861 135.316 31.565 0.00 0.00 O