>>1I84:HELIX   78  78 ALA V  904  ARG V  943  1                                  40    
AETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEER
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 78 78 ALA V 904 ARG V 943 1 40 ATOM 15126 N ALA V 904 -5.753 110.769 33.739 0.00 0.00 N ATOM 15127 CA ALA V 904 -4.366 110.372 34.051 0.00 0.00 C ATOM 15128 C ALA V 904 -3.390 111.143 33.152 0.00 0.00 C ATOM 15129 O ALA V 904 -2.372 111.699 33.607 0.00 0.00 O ATOM 15130 N GLU V 905 -3.707 111.160 31.875 0.00 0.00 N ATOM 15131 CA GLU V 905 -2.865 111.844 30.893 0.00 0.00 C ATOM 15132 C GLU V 905 -2.721 113.305 31.275 0.00 0.00 C ATOM 15133 O GLU V 905 -1.623 113.843 31.262 0.00 0.00 O ATOM 15134 N THR V 906 -3.833 113.931 31.592 0.00 0.00 N ATOM 15135 CA THR V 906 -3.829 115.345 31.963 0.00 0.00 C ATOM 15136 C THR V 906 -2.895 115.562 33.151 0.00 0.00 C ATOM 15137 O THR V 906 -2.058 116.477 33.136 0.00 0.00 O ATOM 15138 N GLU V 907 -3.050 114.722 34.153 0.00 0.00 N ATOM 15139 CA GLU V 907 -2.207 114.840 35.359 0.00 0.00 C ATOM 15140 C GLU V 907 -0.720 114.747 34.969 0.00 0.00 C ATOM 15141 O GLU V 907 0.133 115.566 35.391 0.00 0.00 O ATOM 15142 N LEU V 908 -0.427 113.746 34.163 0.00 0.00 N ATOM 15143 CA LEU V 908 0.956 113.527 33.714 0.00 0.00 C ATOM 15144 C LEU V 908 1.468 114.772 32.996 0.00 0.00 C ATOM 15145 O LEU V 908 2.579 115.239 33.244 0.00 0.00 O ATOM 15146 N TYR V 909 0.655 115.285 32.100 0.00 0.00 N ATOM 15147 CA TYR V 909 1.019 116.467 31.326 0.00 0.00 C ATOM 15148 C TYR V 909 1.336 117.614 32.268 0.00 0.00 C ATOM 15149 O TYR V 909 2.350 118.285 32.101 0.00 0.00 O ATOM 15150 N ALA V 910 0.464 117.827 33.228 0.00 0.00 N ATOM 15151 CA ALA V 910 0.662 118.918 34.194 0.00 0.00 C ATOM 15152 C ALA V 910 2.016 118.753 34.896 0.00 0.00 C ATOM 15153 O ALA V 910 2.819 119.709 35.005 0.00 0.00 O ATOM 15154 N GLU V 911 2.256 117.542 35.360 0.00 0.00 N ATOM 15155 CA GLU V 911 3.521 117.252 36.062 0.00 0.00 C ATOM 15156 C GLU V 911 4.710 117.578 35.148 0.00 0.00 C ATOM 15157 O GLU V 911 5.690 118.234 35.550 0.00 0.00 O ATOM 15158 N ALA V 912 4.615 117.106 33.924 0.00 0.00 N ATOM 15159 CA ALA V 912 5.678 117.323 32.942 0.00 0.00 C ATOM 15160 C ALA V 912 5.911 118.813 32.765 0.00 0.00 C ATOM 15161 O ALA V 912 7.045 119.265 32.765 0.00 0.00 O ATOM 15162 N GLU V 913 4.834 119.547 32.598 0.00 0.00 N ATOM 15163 CA GLU V 913 4.924 120.996 32.402 0.00 0.00 C ATOM 15164 C GLU V 913 5.666 121.626 33.578 0.00 0.00 C ATOM 15165 O GLU V 913 6.586 122.435 33.382 0.00 0.00 O ATOM 15166 N GLU V 914 5.256 121.250 34.770 0.00 0.00 N ATOM 15167 CA GLU V 914 5.894 121.801 35.984 0.00 0.00 C ATOM 15168 C GLU V 914 7.406 121.514 35.955 0.00 0.00 C ATOM 15169 O GLU V 914 8.260 122.403 36.194 0.00 0.00 O ATOM 15170 N MET V 915 7.723 120.269 35.661 0.00 0.00 N ATOM 15171 CA MET V 915 9.129 119.845 35.606 0.00 0.00 C ATOM 15172 C MET V 915 9.884 120.694 34.589 0.00 0.00 C ATOM 15173 O MET V 915 10.981 121.184 34.854 0.00 0.00 O ATOM 15174 N ARG V 916 9.291 120.843 33.424 0.00 0.00 N ATOM 15175 CA ARG V 916 9.904 121.615 32.349 0.00 0.00 C ATOM 15176 C ARG V 916 10.179 123.029 32.831 0.00 0.00 C ATOM 15177 O ARG V 916 11.272 123.547 32.626 0.00 0.00 O ATOM 15178 N VAL V 917 9.186 123.628 33.450 0.00 0.00 N ATOM 15179 CA VAL V 917 9.334 125.005 33.950 0.00 0.00 C ATOM 15180 C VAL V 917 10.527 125.080 34.914 0.00 0.00 C ATOM 15181 O VAL V 917 11.399 125.975 34.808 0.00 0.00 O ATOM 15182 N ARG V 918 10.556 124.139 35.836 0.00 0.00 N ATOM 15183 CA ARG V 918 11.648 124.104 36.829 0.00 0.00 C ATOM 15184 C ARG V 918 13.001 124.007 36.112 0.00 0.00 C ATOM 15185 O ARG V 918 13.965 124.735 36.419 0.00 0.00 O ATOM 15186 N LEU V 919 13.061 123.098 35.163 0.00 0.00 N ATOM 15187 CA LEU V 919 14.291 122.879 34.399 0.00 0.00 C ATOM 15188 C LEU V 919 14.707 124.172 33.723 0.00 0.00 C ATOM 15189 O LEU V 919 15.868 124.551 33.775 0.00 0.00 O ATOM 15190 N ALA V 920 13.758 124.820 33.084 0.00 0.00 N ATOM 15191 CA ALA V 920 14.035 126.072 32.378 0.00 0.00 C ATOM 15192 C ALA V 920 14.632 127.087 33.349 0.00 0.00 C ATOM 15193 O ALA V 920 15.652 127.723 33.048 0.00 0.00 O ATOM 15194 N ALA V 921 13.990 127.221 34.491 0.00 0.00 N ATOM 15195 CA ALA V 921 14.471 128.180 35.506 0.00 0.00 C ATOM 15196 C ALA V 921 15.927 127.854 35.886 0.00 0.00 C ATOM 15197 O ALA V 921 16.819 128.738 35.933 0.00 0.00 O ATOM 15198 N LYS V 922 16.154 126.584 36.149 0.00 0.00 N ATOM 15199 CA LYS V 922 17.496 126.126 36.536 0.00 0.00 C ATOM 15200 C LYS V 922 18.496 126.483 35.440 0.00 0.00 C ATOM 15201 O LYS V 922 19.581 127.001 35.711 0.00 0.00 O ATOM 15202 N LYS V 923 18.126 126.187 34.215 0.00 0.00 N ATOM 15203 CA LYS V 923 18.990 126.456 33.070 0.00 0.00 C ATOM 15204 C LYS V 923 19.328 127.935 33.027 0.00 0.00 C ATOM 15205 O LYS V 923 20.489 128.296 32.859 0.00 0.00 O ATOM 15206 N GLN V 924 18.316 128.762 33.168 0.00 0.00 N ATOM 15207 CA GLN V 924 18.524 130.218 33.131 0.00 0.00 C ATOM 15208 C GLN V 924 19.540 130.624 34.206 0.00 0.00 C ATOM 15209 O GLN V 924 20.508 131.378 33.944 0.00 0.00 O ATOM 15210 N GLU V 925 19.313 130.117 35.403 0.00 0.00 N ATOM 15211 CA GLU V 925 20.214 130.437 36.529 0.00 0.00 C ATOM 15212 C GLU V 925 21.651 130.023 36.180 0.00 0.00 C ATOM 15213 O GLU V 925 22.621 130.781 36.371 0.00 0.00 O ATOM 15214 N LEU V 926 21.772 128.813 35.674 0.00 0.00 N ATOM 15215 CA LEU V 926 23.081 128.273 35.307 0.00 0.00 C ATOM 15216 C LEU V 926 23.740 129.185 34.288 0.00 0.00 C ATOM 15217 O LEU V 926 24.909 129.516 34.419 0.00 0.00 O ATOM 15218 N GLU V 927 22.985 129.563 33.281 0.00 0.00 N ATOM 15219 CA GLU V 927 23.508 130.430 32.223 0.00 0.00 C ATOM 15220 C GLU V 927 24.038 131.723 32.836 0.00 0.00 C ATOM 15221 O GLU V 927 25.156 132.157 32.522 0.00 0.00 O ATOM 15222 N GLU V 928 23.232 132.314 33.695 0.00 0.00 N ATOM 15223 CA GLU V 928 23.636 133.576 34.345 0.00 0.00 C ATOM 15224 C GLU V 928 24.966 133.376 35.096 0.00 0.00 C ATOM 15225 O GLU V 928 25.926 134.177 34.980 0.00 0.00 O ATOM 15226 N ILE V 929 25.009 132.302 35.858 0.00 0.00 N ATOM 15227 CA ILE V 929 26.212 131.988 36.644 0.00 0.00 C ATOM 15228 C ILE V 929 27.413 131.855 35.713 0.00 0.00 C ATOM 15229 O ILE V 929 28.485 132.401 35.973 0.00 0.00 O ATOM 15230 N LEU V 930 27.223 131.116 34.643 0.00 0.00 N ATOM 15231 CA LEU V 930 28.289 130.889 33.672 0.00 0.00 C ATOM 15232 C LEU V 930 28.787 132.220 33.143 0.00 0.00 C ATOM 15233 O LEU V 930 29.990 132.449 33.082 0.00 0.00 O ATOM 15234 N HIS V 931 27.859 133.070 32.759 0.00 0.00 N ATOM 15235 CA HIS V 931 28.223 134.389 32.218 0.00 0.00 C ATOM 15236 C HIS V 931 29.084 135.150 33.237 0.00 0.00 C ATOM 15237 O HIS V 931 30.155 135.707 32.905 0.00 0.00 O ATOM 15238 N GLU V 932 28.606 135.157 34.467 0.00 0.00 N ATOM 15239 CA GLU V 932 29.335 135.860 35.542 0.00 0.00 C ATOM 15240 C GLU V 932 30.758 135.296 35.663 0.00 0.00 C ATOM 15241 O GLU V 932 31.757 136.035 35.741 0.00 0.00 O ATOM 15242 N MET V 933 30.832 133.982 35.685 0.00 0.00 N ATOM 15243 CA MET V 933 32.119 133.298 35.812 0.00 0.00 C ATOM 15244 C MET V 933 33.032 133.715 34.674 0.00 0.00 C ATOM 15245 O MET V 933 34.192 134.032 34.897 0.00 0.00 O ATOM 15246 N GLU V 934 32.501 133.695 33.473 0.00 0.00 N ATOM 15247 CA GLU V 934 33.282 134.063 32.290 0.00 0.00 C ATOM 15248 C GLU V 934 33.837 135.474 32.462 0.00 0.00 C ATOM 15249 O GLU V 934 35.032 135.714 32.233 0.00 0.00 O ATOM 15250 N ALA V 935 32.968 136.379 32.859 0.00 0.00 N ATOM 15251 CA ALA V 935 33.389 137.782 33.050 0.00 0.00 C ATOM 15252 C ALA V 935 34.545 137.846 34.065 0.00 0.00 C ATOM 15253 O ALA V 935 35.591 138.507 33.845 0.00 0.00 O ATOM 15254 N ARG V 936 34.345 137.155 35.169 0.00 0.00 N ATOM 15255 CA ARG V 936 35.360 137.132 36.233 0.00 0.00 C ATOM 15256 C ARG V 936 36.679 136.608 35.676 0.00 0.00 C ATOM 15257 O ARG V 936 37.744 137.174 35.915 0.00 0.00 O ATOM 15258 N ILE V 937 36.592 135.515 34.949 0.00 0.00 N ATOM 15259 CA ILE V 937 37.777 134.892 34.365 0.00 0.00 C ATOM 15260 C ILE V 937 38.494 135.893 33.479 0.00 0.00 C ATOM 15261 O ILE V 937 39.708 136.038 33.574 0.00 0.00 O ATOM 15262 N GLU V 938 37.739 136.557 32.631 0.00 0.00 N ATOM 15263 CA GLU V 938 38.327 137.546 31.714 0.00 0.00 C ATOM 15264 C GLU V 938 39.080 138.615 32.520 0.00 0.00 C ATOM 15265 O GLU V 938 40.246 138.962 32.217 0.00 0.00 O ATOM 15266 N GLU V 939 38.408 139.118 33.535 0.00 0.00 N ATOM 15267 CA GLU V 939 39.018 140.160 34.386 0.00 0.00 C ATOM 15268 C GLU V 939 40.331 139.641 34.986 0.00 0.00 C ATOM 15269 O GLU V 939 41.377 140.318 34.974 0.00 0.00 O ATOM 15270 N GLU V 940 40.260 138.439 35.517 0.00 0.00 N ATOM 15271 CA GLU V 940 41.429 137.816 36.141 0.00 0.00 C ATOM 15272 C GLU V 940 42.558 137.726 35.132 0.00 0.00 C ATOM 15273 O GLU V 940 43.692 138.065 35.442 0.00 0.00 O ATOM 15274 N GLU V 941 42.236 137.256 33.947 0.00 0.00 N ATOM 15275 CA GLU V 941 43.239 137.106 32.892 0.00 0.00 C ATOM 15276 C GLU V 941 43.905 138.453 32.622 0.00 0.00 C ATOM 15277 O GLU V 941 45.141 138.545 32.558 0.00 0.00 O ATOM 15278 N GLU V 942 43.082 139.470 32.470 0.00 0.00 N ATOM 15279 CA GLU V 942 43.613 140.821 32.197 0.00 0.00 C ATOM 15280 C GLU V 942 44.583 141.237 33.318 0.00 0.00 C ATOM 15281 O GLU V 942 45.715 141.725 33.075 0.00 0.00 O ATOM 15282 N ARG V 943 44.128 141.039 34.538 0.00 0.00 N ATOM 15283 CA ARG V 943 44.943 141.400 35.709 0.00 0.00 C ATOM 15284 C ARG V 943 46.273 140.655 35.660 0.00 0.00 C ATOM 15285 O ARG V 943 47.338 141.236 35.871 0.00 0.00 O