>>1JQ0:HELIX    2   2 GLY A   46  LYS A   81  1                                  36    
GWQEWKRKVDFLEENITALLEEAQIQQEKNMYELQK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 2 2 GLY A 46 LYS A 81 1 36 ATOM 279 N GLY A 46 13.896 52.273 9.229 1.00 32.63 N ATOM 280 CA GLY A 46 13.865 52.663 10.627 1.00 29.85 C ATOM 281 C GLY A 46 15.229 52.686 11.292 1.00 27.39 C ATOM 282 O GLY A 46 15.329 52.680 12.520 1.00 26.70 O ATOM 283 N TRP A 47 16.284 52.715 10.488 1.00 24.30 N ATOM 284 CA TRP A 47 17.635 52.737 11.036 1.00 20.90 C ATOM 285 C TRP A 47 18.030 54.051 11.689 1.00 21.64 C ATOM 286 O TRP A 47 18.843 54.065 12.615 1.00 19.10 O ATOM 287 CB TRP A 47 18.649 52.381 9.950 1.00 21.06 C ATOM 288 CG TRP A 47 18.621 50.925 9.625 1.00 21.39 C ATOM 289 CD1 TRP A 47 17.980 50.320 8.583 1.00 23.75 C ATOM 290 CD2 TRP A 47 19.229 49.881 10.385 1.00 20.55 C ATOM 291 NE1 TRP A 47 18.154 48.953 8.650 1.00 22.16 N ATOM 292 CE2 TRP A 47 18.918 48.661 9.749 1.00 22.74 C ATOM 293 CE3 TRP A 47 20.008 49.858 11.550 1.00 20.89 C ATOM 294 CZ2 TRP A 47 19.362 47.427 10.237 1.00 21.39 C ATOM 295 CZ3 TRP A 47 20.449 48.632 12.035 1.00 20.07 C ATOM 296 CH2 TRP A 47 20.122 47.435 11.377 1.00 21.88 C ATOM 297 N GLN A 48 17.472 55.158 11.202 1.00 21.79 N ATOM 298 CA GLN A 48 17.781 56.461 11.769 1.00 24.50 C ATOM 299 C GLN A 48 17.383 56.476 13.240 1.00 22.34 C ATOM 300 O GLN A 48 18.152 56.909 14.109 1.00 21.93 O ATOM 301 CB GLN A 48 17.019 57.556 11.011 1.00 27.89 C ATOM 302 CG GLN A 48 17.412 58.960 11.411 1.00 33.07 C ATOM 303 N GLU A 49 16.177 55.996 13.527 1.00 20.52 N ATOM 304 CA GLU A 49 15.712 55.971 14.901 1.00 20.77 C ATOM 305 C GLU A 49 16.411 54.892 15.706 1.00 19.64 C ATOM 306 O GLU A 49 16.602 55.045 16.907 1.00 21.15 O ATOM 307 CB GLU A 49 14.193 55.791 14.956 1.00 21.16 C ATOM 308 CG GLU A 49 13.442 57.005 14.438 1.00 26.72 C ATOM 309 CD GLU A 49 13.876 58.303 15.112 1.00 29.86 C ATOM 310 OE1 GLU A 49 14.115 59.295 14.393 1.00 36.23 O ATOM 311 OE2 GLU A 49 13.975 58.340 16.353 1.00 30.74 O ATOM 312 N TRP A 50 16.789 53.800 15.047 1.00 20.09 N ATOM 313 CA TRP A 50 17.506 52.724 15.726 1.00 18.56 C ATOM 314 C TRP A 50 18.799 53.330 16.291 1.00 18.05 C ATOM 315 O TRP A 50 19.140 53.121 17.456 1.00 18.26 O ATOM 316 CB TRP A 50 17.847 51.605 14.732 1.00 17.17 C ATOM 317 CG TRP A 50 18.606 50.456 15.336 1.00 17.14 C ATOM 318 CD1 TRP A 50 18.082 49.349 15.944 1.00 17.96 C ATOM 319 CD2 TRP A 50 20.029 50.285 15.349 1.00 18.29 C ATOM 320 NE1 TRP A 50 19.089 48.498 16.323 1.00 18.77 N ATOM 321 CE2 TRP A 50 20.294 49.044 15.972 1.00 19.09 C ATOM 322 CE3 TRP A 50 21.104 51.057 14.892 1.00 18.33 C ATOM 323 CZ2 TRP A 50 21.594 48.555 16.149 1.00 17.95 C ATOM 324 CZ3 TRP A 50 22.397 50.573 15.066 1.00 22.42 C ATOM 325 CH2 TRP A 50 22.629 49.325 15.694 1.00 20.78 C ATOM 326 N LYS A 51 19.506 54.091 15.456 1.00 19.24 N ATOM 327 CA LYS A 51 20.754 54.737 15.863 1.00 19.68 C ATOM 328 C LYS A 51 20.546 55.694 17.040 1.00 20.13 C ATOM 329 O LYS A 51 21.338 55.721 17.984 1.00 19.90 O ATOM 330 CB LYS A 51 21.370 55.508 14.689 1.00 21.60 C ATOM 331 CG LYS A 51 22.679 56.208 15.034 1.00 26.16 C ATOM 332 N ARG A 52 19.494 56.498 16.978 1.00 19.36 N ATOM 333 CA ARG A 52 19.232 57.429 18.066 1.00 20.72 C ATOM 334 C ARG A 52 19.029 56.710 19.390 1.00 19.87 C ATOM 335 O ARG A 52 19.514 57.170 20.428 1.00 20.27 O ATOM 336 CB ARG A 52 17.991 58.274 17.785 1.00 24.10 C ATOM 337 CG ARG A 52 18.154 59.268 16.655 1.00 29.60 C ATOM 338 CD ARG A 52 16.971 60.229 16.633 1.00 33.19 C ATOM 339 NE ARG A 52 17.100 61.226 15.574 1.00 42.12 N ATOM 340 CZ ARG A 52 16.878 60.980 14.288 1.00 44.86 C ATOM 341 NH1 ARG A 52 17.021 61.943 13.388 1.00 48.01 N ATOM 342 NH2 ARG A 52 16.497 59.771 13.903 1.00 48.33 N ATOM 343 N LYS A 53 18.320 55.586 19.353 1.00 19.92 N ATOM 344 CA LYS A 53 18.037 54.832 20.574 1.00 20.48 C ATOM 345 C LYS A 53 19.296 54.160 21.103 1.00 21.39 C ATOM 346 O LYS A 53 19.551 54.146 22.308 1.00 18.44 O ATOM 347 CB LYS A 53 16.959 53.768 20.313 1.00 22.47 C ATOM 348 CG LYS A 53 15.639 54.312 19.801 1.00 28.44 C ATOM 349 CD LYS A 53 14.688 53.188 19.413 1.00 30.47 C ATOM 350 CE LYS A 53 13.490 53.713 18.631 1.00 35.76 C ATOM 351 NZ LYS A 53 12.491 52.640 18.339 1.00 37.94 N ATOM 352 N VAL A 54 20.084 53.592 20.195 1.00 20.22 N ATOM 353 CA VAL A 54 21.313 52.923 20.591 1.00 19.61 C ATOM 354 C VAL A 54 22.269 53.936 21.217 1.00 20.49 C ATOM 355 O VAL A 54 22.905 53.654 22.232 1.00 20.80 O ATOM 356 CB VAL A 54 21.963 52.221 19.377 1.00 21.49 C ATOM 357 CG1 VAL A 54 23.381 51.783 19.710 1.00 27.96 C ATOM 358 CG2 VAL A 54 21.115 51.021 18.987 1.00 20.58 C ATOM 359 N ASP A 55 22.345 55.126 20.632 1.00 21.72 N ATOM 360 CA ASP A 55 23.222 56.163 21.170 1.00 23.31 C ATOM 361 C ASP A 55 22.810 56.546 22.590 1.00 21.04 C ATOM 362 O ASP A 55 23.664 56.722 23.463 1.00 24.47 O ATOM 363 CB ASP A 55 23.199 57.401 20.266 1.00 28.23 C ATOM 364 CG ASP A 55 23.959 57.190 18.960 1.00 33.52 C ATOM 365 OD1 ASP A 55 23.914 58.087 18.090 1.00 40.12 O ATOM 366 OD2 ASP A 55 24.606 56.133 18.797 1.00 39.02 O ATOM 367 N PHE A 56 21.506 56.683 22.817 1.00 18.86 N ATOM 368 CA PHE A 56 21.001 57.036 24.139 1.00 21.68 C ATOM 369 C PHE A 56 21.368 55.961 25.152 1.00 21.71 C ATOM 370 O PHE A 56 21.860 56.262 26.244 1.00 21.32 O ATOM 371 CB PHE A 56 19.477 57.189 24.129 1.00 23.57 C ATOM 372 CG PHE A 56 18.866 57.237 25.507 1.00 25.32 C ATOM 373 CD1 PHE A 56 19.049 58.348 26.326 1.00 28.40 C ATOM 374 CD2 PHE A 56 18.128 56.159 25.996 1.00 28.88 C ATOM 375 CE1 PHE A 56 18.509 58.383 27.606 1.00 27.39 C ATOM 376 CE2 PHE A 56 17.584 56.184 27.277 1.00 30.61 C ATOM 377 CZ PHE A 56 17.775 57.302 28.086 1.00 28.84 C ATOM 378 N LEU A 57 21.125 54.705 24.789 1.00 20.21 N ATOM 379 CA LEU A 57 21.426 53.604 25.691 1.00 19.12 C ATOM 380 C LEU A 57 22.910 53.507 26.016 1.00 19.50 C ATOM 381 O LEU A 57 23.278 53.291 27.172 1.00 17.49 O ATOM 382 CB LEU A 57 20.917 52.282 25.104 1.00 16.93 C ATOM 383 CG LEU A 57 19.393 52.144 25.111 1.00 19.04 C ATOM 384 CD1 LEU A 57 18.981 50.906 24.325 1.00 19.48 C ATOM 385 CD2 LEU A 57 18.897 52.069 26.552 1.00 21.28 C ATOM 386 N GLU A 58 23.765 53.664 25.010 1.00 18.03 N ATOM 387 CA GLU A 58 25.199 53.592 25.246 1.00 20.91 C ATOM 388 C GLU A 58 25.633 54.673 26.230 1.00 21.65 C ATOM 389 O GLU A 58 26.400 54.400 27.145 1.00 21.67 O ATOM 390 CB GLU A 58 25.972 53.741 23.934 1.00 23.12 C ATOM 391 CG GLU A 58 26.071 52.453 23.149 1.00 30.28 C ATOM 392 CD GLU A 58 26.750 52.623 21.798 1.00 36.74 C ATOM 393 OE1 GLU A 58 27.247 51.613 21.263 1.00 36.15 O ATOM 394 OE2 GLU A 58 26.775 53.759 21.268 1.00 42.01 O ATOM 395 N GLU A 59 25.132 55.894 26.042 1.00 20.96 N ATOM 396 CA GLU A 59 25.483 57.001 26.931 1.00 22.25 C ATOM 397 C GLU A 59 24.955 56.767 28.346 1.00 23.11 C ATOM 398 O GLU A 59 25.675 56.963 29.332 1.00 23.21 O ATOM 399 CB GLU A 59 24.925 58.320 26.386 1.00 26.82 C ATOM 400 CG GLU A 59 25.301 59.542 27.210 1.00 29.05 C ATOM 401 N ASN A 60 23.699 56.344 28.436 1.00 20.63 N ATOM 402 CA ASN A 60 23.056 56.095 29.722 1.00 21.60 C ATOM 403 C ASN A 60 23.721 54.960 30.497 1.00 20.98 C ATOM 404 O ASN A 60 23.916 55.056 31.714 1.00 21.32 O ATOM 405 CB ASN A 60 21.573 55.790 29.505 1.00 24.38 C ATOM 406 CG ASN A 60 20.871 55.377 30.779 1.00 29.59 C ATOM 407 OD1 ASN A 60 20.813 54.198 31.110 1.00 32.78 O ATOM 408 ND2 ASN A 60 20.350 56.354 31.515 1.00 31.32 N ATOM 409 N ILE A 61 24.079 53.889 29.795 1.00 20.40 N ATOM 410 CA ILE A 61 24.725 52.758 30.453 1.00 19.81 C ATOM 411 C ILE A 61 26.109 53.159 30.957 1.00 19.25 C ATOM 412 O ILE A 61 26.512 52.793 32.061 1.00 19.99 O ATOM 413 CB ILE A 61 24.839 51.555 29.488 1.00 18.06 C ATOM 414 CG1 ILE A 61 23.440 51.008 29.193 1.00 20.28 C ATOM 415 CG2 ILE A 61 25.740 50.489 30.088 1.00 21.15 C ATOM 416 CD1 ILE A 61 23.382 50.023 28.023 1.00 17.53 C ATOM 417 N THR A 62 26.839 53.925 30.152 1.00 19.65 N ATOM 418 CA THR A 62 28.169 54.372 30.553 1.00 22.52 C ATOM 419 C THR A 62 28.080 55.179 31.845 1.00 20.34 C ATOM 420 O THR A 62 28.898 55.012 32.751 1.00 20.64 O ATOM 421 CB THR A 62 28.819 55.250 29.466 1.00 21.56 C ATOM 422 OG1 THR A 62 29.026 54.468 28.281 1.00 25.36 O ATOM 423 CG2 THR A 62 30.152 55.790 29.955 1.00 26.66 C ATOM 424 N ALA A 63 27.084 56.051 31.924 1.00 20.58 N ATOM 425 CA ALA A 63 26.875 56.874 33.108 1.00 21.14 C ATOM 426 C ALA A 63 26.542 55.992 34.314 1.00 22.09 C ATOM 427 O ALA A 63 27.047 56.215 35.420 1.00 23.62 O ATOM 428 CB ALA A 63 25.750 57.861 32.855 1.00 22.02 C ATOM 429 N LEU A 64 25.688 54.994 34.101 1.00 20.15 N ATOM 430 CA LEU A 64 25.289 54.075 35.173 1.00 17.77 C ATOM 431 C LEU A 64 26.454 53.230 35.680 1.00 19.42 C ATOM 432 O LEU A 64 26.510 52.890 36.867 1.00 19.02 O ATOM 433 CB LEU A 64 24.179 53.138 34.691 1.00 20.76 C ATOM 434 CG LEU A 64 22.732 53.632 34.678 1.00 25.63 C ATOM 435 CD1 LEU A 64 21.854 52.578 34.006 1.00 24.90 C ATOM 436 CD2 LEU A 64 22.257 53.886 36.109 1.00 28.99 C ATOM 437 N LEU A 65 27.366 52.863 34.785 1.00 16.62 N ATOM 438 CA LEU A 65 28.524 52.074 35.197 1.00 18.82 C ATOM 439 C LEU A 65 29.381 52.925 36.124 1.00 16.63 C ATOM 440 O LEU A 65 29.903 52.442 37.127 1.00 18.77 O ATOM 441 CB LEU A 65 29.348 51.645 33.979 1.00 17.82 C ATOM 442 CG LEU A 65 28.713 50.544 33.128 1.00 19.15 C ATOM 443 CD1 LEU A 65 29.467 50.423 31.814 1.00 18.07 C ATOM 444 CD2 LEU A 65 28.725 49.220 33.907 1.00 20.42 C ATOM 445 N GLU A 66 29.531 54.200 35.781 1.00 18.03 N ATOM 446 CA GLU A 66 30.331 55.102 36.616 1.00 21.29 C ATOM 447 C GLU A 66 29.704 55.221 38.003 1.00 21.15 C ATOM 448 O GLU A 66 30.397 55.167 39.019 1.00 23.53 O ATOM 449 CB GLU A 66 30.407 56.491 35.981 1.00 22.96 C ATOM 450 CG GLU A 66 31.153 56.558 34.664 1.00 32.11 C ATOM 451 CD GLU A 66 31.182 57.972 34.098 1.00 37.30 C ATOM 452 OE1 GLU A 66 31.540 58.911 34.846 1.00 40.89 O ATOM 453 OE2 GLU A 66 30.849 58.148 32.904 1.00 41.72 O ATOM 454 N GLU A 67 28.390 55.388 38.037 1.00 20.46 N ATOM 455 CA GLU A 67 27.673 55.518 39.296 1.00 20.45 C ATOM 456 C GLU A 67 27.787 54.229 40.110 1.00 20.65 C ATOM 457 O GLU A 67 27.928 54.265 41.333 1.00 19.42 O ATOM 458 CB GLU A 67 26.201 55.845 39.030 1.00 25.80 C ATOM 459 CG GLU A 67 25.974 57.178 38.318 1.00 32.78 C ATOM 460 CD GLU A 67 24.513 57.404 37.953 1.00 38.20 C ATOM 461 OE1 GLU A 67 23.648 57.250 38.840 1.00 42.79 O ATOM 462 OE2 GLU A 67 24.226 57.736 36.782 1.00 43.25 O ATOM 463 N ALA A 68 27.719 53.086 39.438 1.00 17.96 N ATOM 464 CA ALA A 68 27.829 51.813 40.152 1.00 16.65 C ATOM 465 C ALA A 68 29.236 51.658 40.723 1.00 16.70 C ATOM 466 O ALA A 68 29.411 51.113 41.809 1.00 16.23 O ATOM 467 CB ALA A 68 27.500 50.657 39.228 1.00 17.19 C ATOM 468 N GLN A 69 30.247 52.139 39.998 1.00 15.16 N ATOM 469 CA GLN A 69 31.621 52.048 40.486 1.00 19.21 C ATOM 470 C GLN A 69 31.777 52.904 41.748 1.00 17.90 C ATOM 471 O GLN A 69 32.434 52.497 42.702 1.00 18.33 O ATOM 472 CB GLN A 69 32.615 52.532 39.416 1.00 22.63 C ATOM 473 CG GLN A 69 32.778 51.587 38.237 1.00 32.45 C ATOM 474 CD GLN A 69 33.659 52.170 37.136 1.00 36.93 C ATOM 475 OE1 GLN A 69 34.849 52.416 37.340 1.00 38.42 O ATOM 476 NE2 GLN A 69 33.072 52.388 35.961 1.00 38.39 N ATOM 477 N ILE A 70 31.176 54.090 41.738 1.00 17.55 N ATOM 478 CA ILE A 70 31.227 54.989 42.892 1.00 19.51 C ATOM 479 C ILE A 70 30.519 54.334 44.089 1.00 19.01 C ATOM 480 O ILE A 70 31.025 54.364 45.215 1.00 17.85 O ATOM 481 CB ILE A 70 30.544 56.347 42.564 1.00 21.05 C ATOM 482 CG1 ILE A 70 31.353 57.085 41.493 1.00 25.99 C ATOM 483 CG2 ILE A 70 30.412 57.193 43.829 1.00 22.44 C ATOM 484 CD1 ILE A 70 30.656 58.312 40.927 1.00 27.17 C ATOM 485 N GLN A 71 29.357 53.726 43.850 1.00 15.98 N ATOM 486 CA GLN A 71 28.632 53.073 44.936 1.00 16.13 C ATOM 487 C GLN A 71 29.447 51.892 45.480 1.00 15.11 C ATOM 488 O GLN A 71 29.453 51.633 46.683 1.00 16.50 O ATOM 489 CB GLN A 71 27.257 52.593 44.454 1.00 17.35 C ATOM 490 CG GLN A 71 26.373 52.032 45.571 1.00 19.21 C ATOM 491 CD GLN A 71 26.068 53.066 46.646 1.00 23.90 C ATOM 492 OE1 GLN A 71 26.257 52.817 47.841 1.00 26.61 O ATOM 493 NE2 GLN A 71 25.596 54.231 46.225 1.00 22.10 N ATOM 494 N GLN A 72 30.153 51.188 44.597 1.00 13.42 N ATOM 495 CA GLN A 72 30.961 50.055 45.012 1.00 14.65 C ATOM 496 C GLN A 72 32.045 50.534 45.975 1.00 14.62 C ATOM 497 O GLN A 72 32.292 49.912 47.010 1.00 14.57 O ATOM 498 CB GLN A 72 31.606 49.404 43.786 1.00 16.05 C ATOM 499 CG GLN A 72 32.446 48.169 44.097 1.00 14.87 C ATOM 500 CD GLN A 72 31.632 47.050 44.707 1.00 16.53 C ATOM 501 OE1 GLN A 72 30.426 46.945 44.472 1.00 17.86 O ATOM 502 NE2 GLN A 72 32.291 46.192 45.474 1.00 17.34 N ATOM 503 N GLU A 73 32.684 51.647 45.617 1.00 15.60 N ATOM 504 CA GLU A 73 33.745 52.230 46.438 1.00 18.12 C ATOM 505 C GLU A 73 33.224 52.682 47.807 1.00 17.57 C ATOM 506 O GLU A 73 33.884 52.477 48.831 1.00 19.78 O ATOM 507 CB GLU A 73 34.382 53.408 45.694 1.00 19.05 C ATOM 508 CG GLU A 73 35.124 52.999 44.419 1.00 27.25 C ATOM 509 N LYS A 74 32.045 53.297 47.828 1.00 18.46 N ATOM 510 CA LYS A 74 31.452 53.729 49.092 1.00 18.04 C ATOM 511 C LYS A 74 31.149 52.515 49.968 1.00 17.82 C ATOM 512 O LYS A 74 31.396 52.538 51.173 1.00 18.80 O ATOM 513 CB LYS A 74 30.159 54.508 48.848 1.00 17.78 C ATOM 514 CG LYS A 74 30.375 55.875 48.238 1.00 21.33 C ATOM 515 CD LYS A 74 29.046 56.577 48.052 1.00 23.78 C ATOM 516 CE LYS A 74 29.216 57.901 47.360 1.00 28.09 C ATOM 517 NZ LYS A 74 27.892 58.546 47.143 1.00 29.93 N ATOM 518 N ASN A 75 30.603 51.459 49.363 1.00 15.61 N ATOM 519 CA ASN A 75 30.286 50.240 50.097 1.00 17.67 C ATOM 520 C ASN A 75 31.567 49.615 50.658 1.00 17.23 C ATOM 521 O ASN A 75 31.591 49.151 51.800 1.00 20.26 O ATOM 522 CB ASN A 75 29.577 49.226 49.181 1.00 17.87 C ATOM 523 CG ASN A 75 28.166 49.663 48.795 1.00 19.67 C ATOM 524 OD1 ASN A 75 27.517 49.049 47.922 1.00 18.80 O ATOM 525 ND2 ASN A 75 27.673 50.700 49.445 1.00 16.47 N ATOM 526 N MET A 76 32.630 49.625 49.858 1.00 17.85 N ATOM 527 CA MET A 76 33.900 49.057 50.283 1.00 21.61 C ATOM 528 C MET A 76 34.480 49.907 51.420 1.00 20.68 C ATOM 529 O MET A 76 35.063 49.373 52.367 1.00 21.93 O ATOM 530 CB MET A 76 34.874 49.007 49.104 1.00 24.41 C ATOM 531 CG MET A 76 36.194 48.358 49.444 1.00 31.64 C ATOM 532 SD MET A 76 35.960 46.658 49.997 1.00 38.86 S ATOM 533 CE MET A 76 35.258 45.945 48.514 1.00 36.99 C ATOM 534 N TYR A 77 34.316 51.222 51.323 1.00 21.65 N ATOM 535 CA TYR A 77 34.807 52.125 52.362 1.00 23.25 C ATOM 536 C TYR A 77 34.122 51.820 53.684 1.00 25.55 C ATOM 537 O TYR A 77 34.775 51.637 54.707 1.00 27.83 O ATOM 538 CB TYR A 77 34.529 53.585 51.995 1.00 24.07 C ATOM 539 CG TYR A 77 34.533 54.506 53.204 1.00 28.97 C ATOM 540 CD1 TYR A 77 35.725 54.872 53.823 1.00 34.27 C ATOM 541 CD2 TYR A 77 33.336 54.958 53.763 1.00 31.10 C ATOM 542 CE1 TYR A 77 35.729 55.665 54.973 1.00 36.17 C ATOM 543 CE2 TYR A 77 33.327 55.748 54.912 1.00 34.43 C ATOM 544 CZ TYR A 77 34.523 56.095 55.512 1.00 35.27 C ATOM 545 OH TYR A 77 34.510 56.853 56.661 1.00 38.87 O ATOM 546 N GLU A 78 32.795 51.777 53.664 1.00 25.77 N ATOM 547 CA GLU A 78 32.041 51.507 54.876 1.00 29.12 C ATOM 548 C GLU A 78 32.429 50.131 55.428 1.00 30.80 C ATOM 549 O GLU A 78 32.465 49.931 56.640 1.00 30.95 O ATOM 550 CB GLU A 78 30.540 51.578 54.591 1.00 32.61 C ATOM 551 CG GLU A 78 29.682 51.708 55.848 1.00 38.18 C ATOM 552 CD GLU A 78 28.209 51.923 55.542 1.00 41.22 C ATOM 553 OE1 GLU A 78 27.420 52.064 56.499 1.00 46.30 O ATOM 554 OE2 GLU A 78 27.835 51.945 54.349 1.00 44.69 O ATOM 555 N LEU A 79 32.734 49.191 54.537 1.00 27.82 N ATOM 556 CA LEU A 79 33.144 47.855 54.957 1.00 29.63 C ATOM 557 C LEU A 79 34.525 47.907 55.622 1.00 29.26 C ATOM 558 O LEU A 79 34.712 47.377 56.716 1.00 32.00 O ATOM 559 CB LEU A 79 33.200 46.909 53.749 1.00 31.56 C ATOM 560 CG LEU A 79 33.659 45.469 54.009 1.00 31.30 C ATOM 561 CD1 LEU A 79 32.628 44.747 54.856 1.00 34.20 C ATOM 562 CD2 LEU A 79 33.862 44.740 52.684 1.00 31.43 C ATOM 563 N GLN A 80 35.483 48.543 54.951 1.00 31.88 N ATOM 564 CA GLN A 80 36.855 48.646 55.457 1.00 34.29 C ATOM 565 C GLN A 80 36.974 49.451 56.737 1.00 35.15 C ATOM 566 O GLN A 80 37.798 49.136 57.599 1.00 35.81 O ATOM 567 CB GLN A 80 37.784 49.246 54.399 1.00 35.34 C ATOM 568 CG GLN A 80 38.023 48.338 53.206 1.00 39.57 C ATOM 569 CD GLN A 80 38.459 46.945 53.618 1.00 43.75 C ATOM 570 OE1 GLN A 80 39.457 46.773 54.325 1.00 43.78 O ATOM 571 NE2 GLN A 80 37.713 45.939 53.177 1.00 46.67 N ATOM 572 N LYS A 81 36.171 50.503 56.855 1.00 37.86 N ATOM 573 CA LYS A 81 36.182 51.327 58.055 1.00 38.23 C ATOM 574 C LYS A 81 35.593 50.470 59.176 1.00 41.22 C ATOM 575 O LYS A 81 34.636 50.914 59.847 1.00 43.52 O ATOM 576 CB LYS A 81 35.330 52.586 57.843 1.00 37.10 C ATOM 577 CG LYS A 81 35.371 53.581 58.997 1.00 35.16 C