>>1KYO:HELIX  149 149 GLU O  262  THR O  297  1                                  36    
EHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKT
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 149 149 GLU O 262 THR O 297 1 36 ATOM 27933 N GLU O 262 5.161 -35.869 33.861 1.00 30.78 N ATOM 27934 CA GLU O 262 4.417 -34.660 34.157 1.00 30.28 C ATOM 27935 C GLU O 262 3.483 -34.300 32.992 1.00 31.77 C ATOM 27936 O GLU O 262 2.428 -33.693 33.213 1.00 31.82 O ATOM 27937 CB GLU O 262 5.360 -33.489 34.482 1.00 28.89 C ATOM 27938 CG GLU O 262 5.978 -32.770 33.286 1.00 26.63 C ATOM 27939 CD GLU O 262 6.999 -33.603 32.554 1.00 26.89 C ATOM 27940 OE1 GLU O 262 7.474 -34.596 33.149 1.00 27.99 O ATOM 27941 OE2 GLU O 262 7.347 -33.253 31.396 1.00 26.80 O ATOM 27942 N HIS O 263 3.853 -34.733 31.779 1.00 32.11 N ATOM 27943 CA HIS O 263 3.121 -34.470 30.524 1.00 33.28 C ATOM 27944 C HIS O 263 1.700 -33.889 30.603 1.00 34.93 C ATOM 27945 O HIS O 263 1.478 -32.689 30.391 1.00 34.63 O ATOM 27946 CB HIS O 263 3.091 -35.732 29.631 1.00 33.62 C ATOM 27947 CG HIS O 263 2.620 -35.478 28.221 1.00 32.28 C ATOM 27948 ND1 HIS O 263 1.295 -35.281 27.897 1.00 31.03 N ATOM 27949 CD2 HIS O 263 3.309 -35.342 27.060 1.00 31.95 C ATOM 27950 CE1 HIS O 263 1.191 -35.029 26.603 1.00 29.91 C ATOM 27951 NE2 HIS O 263 2.398 -35.059 26.072 1.00 29.59 N ATOM 27952 N ASP O 264 0.737 -34.759 30.879 1.00 36.10 N ATOM 27953 CA ASP O 264 -0.657 -34.355 30.941 1.00 37.43 C ATOM 27954 C ASP O 264 -0.911 -33.089 31.748 1.00 36.39 C ATOM 27955 O ASP O 264 -1.481 -32.115 31.247 1.00 35.92 O ATOM 27956 CB ASP O 264 -1.495 -35.514 31.480 1.00 41.17 C ATOM 27957 CG ASP O 264 -1.579 -36.687 30.504 1.00 44.03 C ATOM 27958 OD1 ASP O 264 -0.831 -36.709 29.495 1.00 43.75 O ATOM 27959 OD2 ASP O 264 -2.411 -37.589 30.747 1.00 45.90 O ATOM 27960 N GLU O 265 -0.428 -33.104 32.983 1.00 35.95 N ATOM 27961 CA GLU O 265 -0.602 -32.000 33.911 1.00 34.25 C ATOM 27962 C GLU O 265 0.143 -30.754 33.473 1.00 31.93 C ATOM 27963 O GLU O 265 -0.374 -29.642 33.610 1.00 31.57 O ATOM 27964 CB GLU O 265 -0.152 -32.429 35.306 1.00 37.10 C ATOM 27965 CG GLU O 265 -0.368 -31.390 36.392 1.00 42.58 C ATOM 27966 CD GLU O 265 -1.840 -31.070 36.650 1.00 46.48 C ATOM 27967 OE1 GLU O 265 -2.100 -30.008 37.268 1.00 48.28 O ATOM 27968 OE2 GLU O 265 -2.727 -31.872 36.256 1.00 47.99 O ATOM 27969 N ARG O 266 1.353 -30.936 32.946 1.00 28.54 N ATOM 27970 CA ARG O 266 2.152 -29.807 32.486 1.00 24.71 C ATOM 27971 C ARG O 266 1.376 -29.067 31.421 1.00 23.92 C ATOM 27972 O ARG O 266 1.295 -27.846 31.434 1.00 24.75 O ATOM 27973 CB ARG O 266 3.483 -30.290 31.932 1.00 22.27 C ATOM 27974 CG ARG O 266 4.144 -29.326 30.988 1.00 18.96 C ATOM 27975 CD ARG O 266 5.612 -29.652 30.838 1.00 19.78 C ATOM 27976 NE ARG O 266 5.860 -30.957 30.230 1.00 19.72 N ATOM 27977 CZ ARG O 266 5.838 -31.181 28.919 1.00 22.76 C ATOM 27978 NH1 ARG O 266 6.088 -32.396 28.431 1.00 23.93 N ATOM 27979 NH2 ARG O 266 5.556 -30.185 28.089 1.00 23.68 N ATOM 27980 N LYS O 267 0.733 -29.832 30.551 1.00 22.82 N ATOM 27981 CA LYS O 267 -0.054 -29.270 29.481 1.00 22.71 C ATOM 27982 C LYS O 267 -1.327 -28.589 29.965 1.00 23.26 C ATOM 27983 O LYS O 267 -1.779 -27.625 29.355 1.00 25.32 O ATOM 27984 CB LYS O 267 -0.376 -30.344 28.457 1.00 23.73 C ATOM 27985 CG LYS O 267 0.671 -30.491 27.376 1.00 24.32 C ATOM 27986 CD LYS O 267 0.240 -31.533 26.379 1.00 23.44 C ATOM 27987 CE LYS O 267 1.108 -31.500 25.153 1.00 25.94 C ATOM 27988 NZ LYS O 267 0.870 -32.689 24.284 1.00 26.16 N ATOM 27989 N ARG O 268 -1.924 -29.081 31.042 1.00 23.52 N ATOM 27990 CA ARG O 268 -3.126 -28.431 31.547 1.00 25.20 C ATOM 27991 C ARG O 268 -2.746 -27.145 32.256 1.00 27.13 C ATOM 27992 O ARG O 268 -3.503 -26.177 32.243 1.00 28.45 O ATOM 27993 CB ARG O 268 -3.912 -29.303 32.525 1.00 25.80 C ATOM 27994 CG ARG O 268 -5.272 -28.699 32.821 1.00 24.61 C ATOM 27995 CD ARG O 268 -5.965 -29.353 33.974 1.00 27.85 C ATOM 27996 NE ARG O 268 -5.918 -28.512 35.167 1.00 31.46 N ATOM 27997 CZ ARG O 268 -5.135 -28.750 36.216 1.00 31.19 C ATOM 27998 NH1 ARG O 268 -5.146 -27.940 37.267 1.00 29.61 N ATOM 27999 NH2 ARG O 268 -4.342 -29.803 36.206 1.00 29.45 N ATOM 28000 N LEU O 269 -1.589 -27.137 32.911 1.00 29.17 N ATOM 28001 CA LEU O 269 -1.156 -25.933 33.612 1.00 30.14 C ATOM 28002 C LEU O 269 -0.679 -24.903 32.587 1.00 32.17 C ATOM 28003 O LEU O 269 -0.780 -23.695 32.813 1.00 31.91 O ATOM 28004 CB LEU O 269 -0.072 -26.263 34.637 1.00 28.88 C ATOM 28005 CG LEU O 269 -0.489 -27.198 35.778 1.00 26.45 C ATOM 28006 CD1 LEU O 269 0.651 -27.333 36.764 1.00 26.83 C ATOM 28007 CD2 LEU O 269 -1.713 -26.678 36.475 1.00 24.16 C ATOM 28008 N GLY O 270 -0.221 -25.397 31.436 1.00 33.30 N ATOM 28009 CA GLY O 270 0.228 -24.524 30.370 1.00 34.36 C ATOM 28010 C GLY O 270 -0.934 -23.724 29.796 1.00 35.21 C ATOM 28011 O GLY O 270 -0.787 -22.549 29.453 1.00 35.81 O ATOM 28012 N LEU O 271 -2.104 -24.347 29.718 1.00 35.41 N ATOM 28013 CA LEU O 271 -3.277 -23.671 29.177 1.00 37.21 C ATOM 28014 C LEU O 271 -3.657 -22.500 30.069 1.00 36.43 C ATOM 28015 O LEU O 271 -3.841 -21.373 29.593 1.00 35.75 O ATOM 28016 CB LEU O 271 -4.449 -24.647 29.068 1.00 38.90 C ATOM 28017 CG LEU O 271 -5.601 -24.248 28.143 1.00 39.67 C ATOM 28018 CD1 LEU O 271 -5.080 -24.061 26.708 1.00 38.27 C ATOM 28019 CD2 LEU O 271 -6.682 -25.328 28.193 1.00 40.12 C ATOM 28020 N LYS O 272 -3.742 -22.775 31.369 1.00 35.58 N ATOM 28021 CA LYS O 272 -4.085 -21.753 32.351 1.00 35.56 C ATOM 28022 C LYS O 272 -3.080 -20.604 32.310 1.00 35.51 C ATOM 28023 O LYS O 272 -3.443 -19.442 32.522 1.00 35.40 O ATOM 28024 CB LYS O 272 -4.116 -22.346 33.763 1.00 33.38 C ATOM 28025 CG LYS O 272 -5.134 -23.448 33.940 1.00 34.69 C ATOM 28026 CD LYS O 272 -5.159 -23.984 35.355 1.00 35.55 C ATOM 28027 CE LYS O 272 -5.489 -22.884 36.354 1.00 37.97 C ATOM 28028 NZ LYS O 272 -5.541 -23.358 37.781 1.00 40.21 N ATOM 28029 N THR O 273 -1.829 -20.929 31.982 1.00 34.17 N ATOM 28030 CA THR O 273 -0.772 -19.924 31.948 1.00 32.32 C ATOM 28031 C THR O 273 -0.853 -19.016 30.739 1.00 31.49 C ATOM 28032 O THR O 273 -0.903 -17.795 30.880 1.00 31.42 O ATOM 28033 CB THR O 273 0.635 -20.559 32.046 1.00 32.20 C ATOM 28034 OG1 THR O 273 0.674 -21.453 33.163 1.00 30.39 O ATOM 28035 CG2 THR O 273 1.686 -19.486 32.271 1.00 30.79 C ATOM 28036 N VAL O 274 -0.870 -19.605 29.552 1.00 30.80 N ATOM 28037 CA VAL O 274 -0.948 -18.808 28.340 1.00 30.45 C ATOM 28038 C VAL O 274 -2.178 -17.893 28.340 1.00 30.78 C ATOM 28039 O VAL O 274 -2.059 -16.718 28.027 1.00 32.04 O ATOM 28040 CB VAL O 274 -0.944 -19.683 27.082 1.00 29.87 C ATOM 28041 CG1 VAL O 274 -1.062 -18.821 25.859 1.00 28.88 C ATOM 28042 CG2 VAL O 274 0.337 -20.491 27.017 1.00 29.91 C ATOM 28043 N ILE O 275 -3.339 -18.394 28.753 1.00 30.21 N ATOM 28044 CA ILE O 275 -4.536 -17.549 28.770 1.00 30.53 C ATOM 28045 C ILE O 275 -4.413 -16.311 29.673 1.00 31.17 C ATOM 28046 O ILE O 275 -4.672 -15.190 29.232 1.00 33.57 O ATOM 28047 CB ILE O 275 -5.798 -18.332 29.172 1.00 29.64 C ATOM 28048 CG1 ILE O 275 -6.028 -19.479 28.190 1.00 29.86 C ATOM 28049 CG2 ILE O 275 -7.002 -17.395 29.188 1.00 27.31 C ATOM 28050 CD1 ILE O 275 -7.123 -20.407 28.614 1.00 32.72 C ATOM 28051 N ILE O 276 -4.022 -16.519 30.929 1.00 30.13 N ATOM 28052 CA ILE O 276 -3.866 -15.430 31.884 1.00 26.44 C ATOM 28053 C ILE O 276 -2.734 -14.518 31.442 1.00 26.57 C ATOM 28054 O ILE O 276 -2.860 -13.299 31.489 1.00 26.56 O ATOM 28055 CB ILE O 276 -3.605 -15.979 33.295 1.00 25.42 C ATOM 28056 CG1 ILE O 276 -4.820 -16.782 33.754 1.00 25.73 C ATOM 28057 CG2 ILE O 276 -3.378 -14.860 34.269 1.00 25.12 C ATOM 28058 CD1 ILE O 276 -4.599 -17.564 34.993 1.00 27.58 C ATOM 28059 N LEU O 277 -1.645 -15.103 30.960 1.00 25.99 N ATOM 28060 CA LEU O 277 -0.533 -14.294 30.509 1.00 26.73 C ATOM 28061 C LEU O 277 -0.867 -13.542 29.230 1.00 27.83 C ATOM 28062 O LEU O 277 -0.438 -12.399 29.048 1.00 29.66 O ATOM 28063 CB LEU O 277 0.729 -15.135 30.350 1.00 28.24 C ATOM 28064 CG LEU O 277 1.550 -15.263 31.645 1.00 29.29 C ATOM 28065 CD1 LEU O 277 2.731 -16.223 31.476 1.00 29.73 C ATOM 28066 CD2 LEU O 277 2.049 -13.888 32.047 1.00 28.06 C ATOM 28067 N SER O 278 -1.677 -14.154 28.372 1.00 27.47 N ATOM 28068 CA SER O 278 -2.080 -13.516 27.121 1.00 25.95 C ATOM 28069 C SER O 278 -3.009 -12.356 27.395 1.00 25.65 C ATOM 28070 O SER O 278 -3.010 -11.369 26.667 1.00 26.52 O ATOM 28071 CB SER O 278 -2.775 -14.506 26.206 1.00 26.87 C ATOM 28072 OG SER O 278 -1.831 -15.388 25.623 1.00 27.94 O ATOM 28073 N SER O 279 -3.808 -12.487 28.443 1.00 24.35 N ATOM 28074 CA SER O 279 -4.731 -11.441 28.830 1.00 24.97 C ATOM 28075 C SER O 279 -3.959 -10.285 29.474 1.00 27.22 C ATOM 28076 O SER O 279 -4.116 -9.121 29.072 1.00 28.62 O ATOM 28077 CB SER O 279 -5.752 -12.002 29.802 1.00 24.36 C ATOM 28078 OG SER O 279 -6.284 -13.198 29.276 1.00 25.64 O ATOM 28079 N LEU O 280 -3.119 -10.602 30.463 1.00 27.05 N ATOM 28080 CA LEU O 280 -2.317 -9.584 31.137 1.00 25.61 C ATOM 28081 C LEU O 280 -1.573 -8.753 30.095 1.00 25.64 C ATOM 28082 O LEU O 280 -1.445 -7.538 30.219 1.00 24.36 O ATOM 28083 CB LEU O 280 -1.298 -10.235 32.073 1.00 25.43 C ATOM 28084 CG LEU O 280 -1.598 -10.317 33.571 1.00 24.13 C ATOM 28085 CD1 LEU O 280 -2.406 -9.110 33.995 1.00 24.47 C ATOM 28086 CD2 LEU O 280 -2.336 -11.578 33.906 1.00 23.77 C ATOM 28087 N TYR O 281 -1.119 -9.418 29.041 1.00 26.45 N ATOM 28088 CA TYR O 281 -0.395 -8.734 27.987 1.00 28.02 C ATOM 28089 C TYR O 281 -1.238 -7.742 27.203 1.00 28.69 C ATOM 28090 O TYR O 281 -0.831 -6.598 27.047 1.00 30.96 O ATOM 28091 CB TYR O 281 0.245 -9.734 27.039 1.00 27.47 C ATOM 28092 CG TYR O 281 0.911 -9.105 25.837 1.00 26.99 C ATOM 28093 CD1 TYR O 281 1.892 -8.123 25.987 1.00 26.34 C ATOM 28094 CD2 TYR O 281 0.578 -9.523 24.546 1.00 26.57 C ATOM 28095 CE1 TYR O 281 2.528 -7.577 24.872 1.00 27.89 C ATOM 28096 CE2 TYR O 281 1.204 -8.992 23.432 1.00 26.23 C ATOM 28097 CZ TYR O 281 2.177 -8.023 23.595 1.00 27.71 C ATOM 28098 OH TYR O 281 2.798 -7.518 22.477 1.00 26.23 O ATOM 28099 N LEU O 282 -2.391 -8.170 26.693 1.00 28.19 N ATOM 28100 CA LEU O 282 -3.248 -7.261 25.926 1.00 26.86 C ATOM 28101 C LEU O 282 -3.700 -6.122 26.819 1.00 26.88 C ATOM 28102 O LEU O 282 -3.651 -4.944 26.440 1.00 27.54 O ATOM 28103 CB LEU O 282 -4.460 -7.996 25.356 1.00 24.71 C ATOM 28104 CG LEU O 282 -4.127 -8.968 24.228 1.00 24.97 C ATOM 28105 CD1 LEU O 282 -5.336 -9.832 23.920 1.00 23.93 C ATOM 28106 CD2 LEU O 282 -3.654 -8.193 23.008 1.00 23.11 C ATOM 28107 N LEU O 283 -4.073 -6.482 28.037 1.00 25.53 N ATOM 28108 CA LEU O 283 -4.523 -5.509 29.000 1.00 26.88 C ATOM 28109 C LEU O 283 -3.458 -4.439 29.250 1.00 28.40 C ATOM 28110 O LEU O 283 -3.739 -3.243 29.146 1.00 30.46 O ATOM 28111 CB LEU O 283 -4.898 -6.220 30.294 1.00 26.52 C ATOM 28112 CG LEU O 283 -6.289 -5.927 30.840 1.00 27.10 C ATOM 28113 CD1 LEU O 283 -7.336 -6.031 29.745 1.00 25.81 C ATOM 28114 CD2 LEU O 283 -6.575 -6.912 31.939 1.00 28.43 C ATOM 28115 N SER O 284 -2.223 -4.863 29.505 1.00 28.47 N ATOM 28116 CA SER O 284 -1.147 -3.917 29.779 1.00 28.27 C ATOM 28117 C SER O 284 -0.972 -2.868 28.688 1.00 28.48 C ATOM 28118 O SER O 284 -0.712 -1.702 28.985 1.00 28.71 O ATOM 28119 CB SER O 284 0.168 -4.651 30.010 1.00 28.25 C ATOM 28120 OG SER O 284 0.544 -5.357 28.854 1.00 27.19 O ATOM 28121 N ILE O 285 -1.131 -3.281 27.433 1.00 28.49 N ATOM 28122 CA ILE O 285 -0.992 -2.363 26.308 1.00 29.75 C ATOM 28123 C ILE O 285 -2.010 -1.233 26.405 1.00 32.79 C ATOM 28124 O ILE O 285 -1.658 -0.051 26.329 1.00 32.85 O ATOM 28125 CB ILE O 285 -1.176 -3.071 24.952 1.00 26.40 C ATOM 28126 CG1 ILE O 285 -0.130 -4.168 24.788 1.00 25.95 C ATOM 28127 CG2 ILE O 285 -1.027 -2.073 23.825 1.00 22.49 C ATOM 28128 CD1 ILE O 285 -0.240 -4.952 23.508 1.00 23.60 C ATOM 28129 N TRP O 286 -3.271 -1.596 26.598 1.00 35.54 N ATOM 28130 CA TRP O 286 -4.319 -0.596 26.697 1.00 39.79 C ATOM 28131 C TRP O 286 -4.002 0.435 27.785 1.00 37.17 C ATOM 28132 O TRP O 286 -4.147 1.643 27.577 1.00 36.19 O ATOM 28133 CB TRP O 286 -5.657 -1.274 26.986 1.00 50.17 C ATOM 28134 CG TRP O 286 -6.843 -0.450 26.563 1.00 61.78 C ATOM 28135 CD1 TRP O 286 -7.574 -0.597 25.411 1.00 65.02 C ATOM 28136 CD2 TRP O 286 -7.417 0.669 27.265 1.00 66.64 C ATOM 28137 NE1 TRP O 286 -8.566 0.363 25.353 1.00 68.95 N ATOM 28138 CE2 TRP O 286 -8.492 1.153 26.474 1.00 69.00 C ATOM 28139 CE3 TRP O 286 -7.123 1.315 28.477 1.00 68.14 C ATOM 28140 CZ2 TRP O 286 -9.274 2.260 26.859 1.00 70.92 C ATOM 28141 CZ3 TRP O 286 -7.899 2.416 28.859 1.00 70.25 C ATOM 28142 CH2 TRP O 286 -8.963 2.876 28.050 1.00 71.27 C ATOM 28143 N VAL O 287 -3.561 -0.055 28.939 1.00 34.76 N ATOM 28144 CA VAL O 287 -3.223 0.797 30.074 1.00 32.23 C ATOM 28145 C VAL O 287 -2.022 1.707 29.768 1.00 32.89 C ATOM 28146 O VAL O 287 -2.024 2.893 30.117 1.00 32.39 O ATOM 28147 CB VAL O 287 -2.944 -0.062 31.320 1.00 29.73 C ATOM 28148 CG1 VAL O 287 -2.698 0.817 32.534 1.00 27.87 C ATOM 28149 CG2 VAL O 287 -4.110 -1.002 31.564 1.00 28.02 C ATOM 28150 N LYS O 288 -1.009 1.155 29.098 1.00 33.02 N ATOM 28151 CA LYS O 288 0.183 1.918 28.733 1.00 31.26 C ATOM 28152 C LYS O 288 -0.254 3.076 27.862 1.00 31.91 C ATOM 28153 O LYS O 288 0.134 4.216 28.102 1.00 30.54 O ATOM 28154 CB LYS O 288 1.183 1.034 27.987 1.00 28.57 C ATOM 28155 CG LYS O 288 2.461 1.737 27.561 1.00 28.65 C ATOM 28156 CD LYS O 288 2.257 2.574 26.310 1.00 30.52 C ATOM 28157 CE LYS O 288 3.567 3.053 25.716 1.00 33.01 C ATOM 28158 NZ LYS O 288 3.329 3.908 24.517 1.00 35.16 N ATOM 28159 N LYS O 289 -1.072 2.770 26.854 1.00 34.13 N ATOM 28160 CA LYS O 289 -1.595 3.788 25.932 1.00 35.58 C ATOM 28161 C LYS O 289 -2.422 4.828 26.672 1.00 34.37 C ATOM 28162 O LYS O 289 -2.279 6.030 26.426 1.00 33.29 O ATOM 28163 CB LYS O 289 -2.449 3.164 24.817 1.00 37.39 C ATOM 28164 CG LYS O 289 -1.658 2.317 23.834 1.00 41.77 C ATOM 28165 CD LYS O 289 -2.391 2.127 22.509 1.00 44.77 C ATOM 28166 CE LYS O 289 -1.464 1.451 21.490 1.00 46.74 C ATOM 28167 NZ LYS O 289 -2.066 1.271 20.129 1.00 48.05 N ATOM 28168 N PHE O 290 -3.288 4.361 27.573 1.00 33.29 N ATOM 28169 CA PHE O 290 -4.107 5.272 28.336 1.00 31.21 C ATOM 28170 C PHE O 290 -3.228 6.243 29.076 1.00 31.13 C ATOM 28171 O PHE O 290 -3.462 7.436 29.009 1.00 33.16 O ATOM 28172 CB PHE O 290 -4.993 4.563 29.338 1.00 29.86 C ATOM 28173 CG PHE O 290 -5.827 5.506 30.134 1.00 30.14 C ATOM 28174 CD1 PHE O 290 -5.443 5.893 31.406 1.00 32.19 C ATOM 28175 CD2 PHE O 290 -6.967 6.062 29.589 1.00 32.09 C ATOM 28176 CE1 PHE O 290 -6.189 6.831 32.128 1.00 33.82 C ATOM 28177 CE2 PHE O 290 -7.719 7.000 30.301 1.00 33.67 C ATOM 28178 CZ PHE O 290 -7.328 7.385 31.572 1.00 33.14 C ATOM 28179 N LYS O 291 -2.191 5.738 29.740 1.00 30.60 N ATOM 28180 CA LYS O 291 -1.281 6.590 30.509 1.00 29.18 C ATOM 28181 C LYS O 291 -0.348 7.441 29.672 1.00 27.76 C ATOM 28182 O LYS O 291 0.131 8.483 30.117 1.00 27.87 O ATOM 28183 CB LYS O 291 -0.485 5.755 31.498 1.00 30.98 C ATOM 28184 CG LYS O 291 -1.365 5.172 32.554 1.00 33.07 C ATOM 28185 CD LYS O 291 -0.608 4.357 33.557 1.00 34.81 C ATOM 28186 CE LYS O 291 -1.543 4.010 34.697 1.00 36.60 C ATOM 28187 NZ LYS O 291 -2.138 5.253 35.282 1.00 38.09 N ATOM 28188 N TRP O 292 -0.113 6.998 28.449 1.00 26.92 N ATOM 28189 CA TRP O 292 0.749 7.715 27.534 1.00 27.25 C ATOM 28190 C TRP O 292 -0.013 8.695 26.610 1.00 29.34 C ATOM 28191 O TRP O 292 0.603 9.557 25.958 1.00 30.23 O ATOM 28192 CB TRP O 292 1.539 6.705 26.713 1.00 26.06 C ATOM 28193 CG TRP O 292 2.841 6.344 27.323 1.00 25.09 C ATOM 28194 CD1 TRP O 292 3.075 5.381 28.256 1.00 25.96 C ATOM 28195 CD2 TRP O 292 4.112 6.922 27.013 1.00 25.30 C ATOM 28196 NE1 TRP O 292 4.416 5.316 28.544 1.00 25.96 N ATOM 28197 CE2 TRP O 292 5.075 6.251 27.790 1.00 26.23 C ATOM 28198 CE3 TRP O 292 4.529 7.945 26.150 1.00 24.34 C ATOM 28199 CZ2 TRP O 292 6.434 6.567 27.726 1.00 26.31 C ATOM 28200 CZ3 TRP O 292 5.877 8.259 26.087 1.00 24.87 C ATOM 28201 CH2 TRP O 292 6.814 7.572 26.869 1.00 26.06 C ATOM 28202 N ALA O 293 -1.347 8.589 26.593 1.00 28.98 N ATOM 28203 CA ALA O 293 -2.205 9.437 25.757 1.00 26.19 C ATOM 28204 C ALA O 293 -1.915 10.926 25.902 1.00 26.06 C ATOM 28205 O ALA O 293 -2.000 11.675 24.932 1.00 23.83 O ATOM 28206 CB ALA O 293 -3.664 9.159 26.056 1.00 24.05 C ATOM 28207 N GLY O 294 -1.561 11.347 27.114 1.00 28.55 N ATOM 28208 CA GLY O 294 -1.264 12.748 27.352 1.00 30.10 C ATOM 28209 C GLY O 294 -0.047 13.232 26.586 1.00 30.72 C ATOM 28210 O GLY O 294 -0.081 14.263 25.912 1.00 31.29 O ATOM 28211 N ILE O 295 1.026 12.460 26.652 1.00 30.10 N ATOM 28212 CA ILE O 295 2.252 12.837 25.980 1.00 30.08 C ATOM 28213 C ILE O 295 2.208 12.698 24.458 1.00 30.44 C ATOM 28214 O ILE O 295 2.611 13.609 23.733 1.00 31.20 O ATOM 28215 CB ILE O 295 3.447 12.039 26.553 1.00 29.44 C ATOM 28216 CG1 ILE O 295 3.638 12.374 28.033 1.00 27.68 C ATOM 28217 CG2 ILE O 295 4.726 12.345 25.779 1.00 29.92 C ATOM 28218 CD1 ILE O 295 4.009 13.804 28.288 1.00 25.57 C ATOM 28219 N LYS O 296 1.690 11.575 23.980 1.00 30.16 N ATOM 28220 CA LYS O 296 1.639 11.289 22.548 1.00 30.04 C ATOM 28221 C LYS O 296 0.935 12.308 21.659 1.00 30.64 C ATOM 28222 O LYS O 296 1.249 12.418 20.465 1.00 30.49 O ATOM 28223 CB LYS O 296 1.009 9.923 22.321 1.00 29.23 C ATOM 28224 CG LYS O 296 1.810 8.755 22.852 1.00 29.90 C ATOM 28225 CD LYS O 296 2.793 8.227 21.819 1.00 31.02 C ATOM 28226 CE LYS O 296 3.239 6.807 22.169 1.00 30.85 C ATOM 28227 NZ LYS O 296 3.946 6.146 21.036 1.00 31.67 N ATOM 28228 N THR O 297 -0.036 13.021 22.228 1.00 30.82 N ATOM 28229 CA THR O 297 -0.819 14.010 21.482 1.00 30.84 C ATOM 28230 C THR O 297 -0.420 15.441 21.817 1.00 31.11 C ATOM 28231 O THR O 297 -1.130 16.386 21.522 1.00 29.88 O ATOM 28232 CB THR O 297 -2.311 13.839 21.765 1.00 29.46 C ATOM 28233 OG1 THR O 297 -2.584 14.267 23.104 1.00 31.52 O ATOM 28234 CG2 THR O 297 -2.705 12.386 21.623 1.00 27.01 C