>>1KYO:HELIX   64  64 LYS E   51  SER E   80  1                                  30    
KGRSYAYFMVGAMGLLSSAGAKSTVETFIS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 64 64 LYS E 51 SER E 80 1 30 ATOM 11260 N LYS E 51 65.391 10.897 64.423 1.00100.05 N ATOM 11261 CA LYS E 51 65.229 9.773 65.328 1.00 97.34 C ATOM 11262 C LYS E 51 63.784 9.315 65.235 1.00 94.66 C ATOM 11263 O LYS E 51 63.520 8.144 64.954 1.00 94.58 O ATOM 11264 CB LYS E 51 65.581 10.154 66.771 1.00 98.74 C ATOM 11265 CG LYS E 51 66.606 9.221 67.422 1.00 99.86 C ATOM 11266 CD LYS E 51 66.259 7.751 67.187 1.00101.18 C ATOM 11267 CE LYS E 51 67.316 6.804 67.744 1.00101.77 C ATOM 11268 NZ LYS E 51 67.296 6.731 69.231 1.00102.12 N ATOM 11269 N GLY E 52 62.858 10.253 65.438 1.00 91.24 N ATOM 11270 CA GLY E 52 61.439 9.945 65.367 1.00 86.29 C ATOM 11271 C GLY E 52 61.108 9.303 64.035 1.00 82.35 C ATOM 11272 O GLY E 52 60.372 8.310 63.986 1.00 81.57 O ATOM 11273 N ARG E 53 61.692 9.857 62.968 1.00 77.95 N ATOM 11274 CA ARG E 53 61.509 9.367 61.603 1.00 73.48 C ATOM 11275 C ARG E 53 62.089 7.968 61.384 1.00 72.73 C ATOM 11276 O ARG E 53 61.435 7.106 60.796 1.00 73.46 O ATOM 11277 CB ARG E 53 62.144 10.328 60.601 1.00 69.48 C ATOM 11278 CG ARG E 53 62.366 9.725 59.213 1.00 64.54 C ATOM 11279 CD ARG E 53 62.899 10.764 58.268 1.00 60.53 C ATOM 11280 NE ARG E 53 62.102 11.975 58.372 1.00 58.55 N ATOM 11281 CZ ARG E 53 61.729 12.723 57.343 1.00 58.26 C ATOM 11282 NH1 ARG E 53 60.990 13.808 57.551 1.00 58.41 N ATOM 11283 NH2 ARG E 53 62.111 12.400 56.115 1.00 57.58 N ATOM 11284 N SER E 54 63.323 7.754 61.833 1.00 70.67 N ATOM 11285 CA SER E 54 63.973 6.462 61.671 1.00 68.07 C ATOM 11286 C SER E 54 63.231 5.358 62.396 1.00 66.63 C ATOM 11287 O SER E 54 63.146 4.240 61.899 1.00 66.43 O ATOM 11288 CB SER E 54 65.411 6.538 62.152 1.00 68.21 C ATOM 11289 OG SER E 54 66.091 7.559 61.446 1.00 70.94 O ATOM 11290 N TYR E 55 62.675 5.683 63.561 1.00 66.17 N ATOM 11291 CA TYR E 55 61.922 4.716 64.358 1.00 65.42 C ATOM 11292 C TYR E 55 60.584 4.391 63.724 1.00 62.42 C ATOM 11293 O TYR E 55 60.223 3.223 63.600 1.00 62.15 O ATOM 11294 CB TYR E 55 61.704 5.230 65.784 1.00 69.30 C ATOM 11295 CG TYR E 55 62.710 4.711 66.796 1.00 73.46 C ATOM 11296 CD1 TYR E 55 63.698 3.789 66.426 1.00 75.63 C ATOM 11297 CD2 TYR E 55 62.679 5.148 68.125 1.00 74.83 C ATOM 11298 CE1 TYR E 55 64.632 3.317 67.351 1.00 77.79 C ATOM 11299 CE2 TYR E 55 63.604 4.685 69.060 1.00 77.08 C ATOM 11300 CZ TYR E 55 64.579 3.770 68.668 1.00 78.36 C ATOM 11301 OH TYR E 55 65.499 3.310 69.590 1.00 79.83 O ATOM 11302 N ALA E 56 59.861 5.435 63.322 1.00 59.19 N ATOM 11303 CA ALA E 56 58.550 5.297 62.687 1.00 54.27 C ATOM 11304 C ALA E 56 58.627 4.473 61.413 1.00 50.37 C ATOM 11305 O ALA E 56 57.950 3.458 61.277 1.00 50.26 O ATOM 11306 CB ALA E 56 57.961 6.678 62.377 1.00 54.61 C ATOM 11307 N TYR E 57 59.485 4.898 60.497 1.00 45.40 N ATOM 11308 CA TYR E 57 59.640 4.211 59.233 1.00 41.93 C ATOM 11309 C TYR E 57 60.077 2.765 59.349 1.00 40.97 C ATOM 11310 O TYR E 57 59.692 1.948 58.516 1.00 41.87 O ATOM 11311 CB TYR E 57 60.557 5.003 58.320 1.00 39.47 C ATOM 11312 CG TYR E 57 59.962 6.327 57.905 1.00 37.29 C ATOM 11313 CD1 TYR E 57 58.771 6.790 58.473 1.00 34.85 C ATOM 11314 CD2 TYR E 57 60.589 7.122 56.953 1.00 36.81 C ATOM 11315 CE1 TYR E 57 58.226 8.009 58.108 1.00 34.38 C ATOM 11316 CE2 TYR E 57 60.051 8.345 56.572 1.00 36.67 C ATOM 11317 CZ TYR E 57 58.868 8.788 57.153 1.00 35.57 C ATOM 11318 OH TYR E 57 58.346 10.012 56.775 1.00 33.88 O ATOM 11319 N PHE E 58 60.874 2.441 60.367 1.00 40.08 N ATOM 11320 CA PHE E 58 61.297 1.055 60.567 1.00 39.44 C ATOM 11321 C PHE E 58 60.055 0.275 60.976 1.00 40.04 C ATOM 11322 O PHE E 58 59.753 -0.775 60.415 1.00 40.22 O ATOM 11323 CB PHE E 58 62.352 0.921 61.670 1.00 37.29 C ATOM 11324 CG PHE E 58 62.606 -0.513 62.089 1.00 36.90 C ATOM 11325 CD1 PHE E 58 63.486 -1.318 61.374 1.00 35.71 C ATOM 11326 CD2 PHE E 58 61.926 -1.074 63.175 1.00 36.26 C ATOM 11327 CE1 PHE E 58 63.680 -2.655 61.733 1.00 34.87 C ATOM 11328 CE2 PHE E 58 62.117 -2.412 63.539 1.00 34.19 C ATOM 11329 CZ PHE E 58 62.991 -3.200 62.819 1.00 33.48 C ATOM 11330 N MET E 59 59.351 0.799 61.973 1.00 40.79 N ATOM 11331 CA MET E 59 58.132 0.185 62.474 1.00 41.39 C ATOM 11332 C MET E 59 57.188 -0.053 61.299 1.00 40.46 C ATOM 11333 O MET E 59 56.850 -1.196 60.997 1.00 41.84 O ATOM 11334 CB MET E 59 57.456 1.105 63.496 1.00 43.30 C ATOM 11335 CG MET E 59 58.274 1.391 64.743 1.00 46.95 C ATOM 11336 SD MET E 59 58.058 0.183 66.060 1.00 52.89 S ATOM 11337 CE MET E 59 59.612 -0.798 65.900 1.00 52.11 C ATOM 11338 N VAL E 60 56.824 1.023 60.602 1.00 38.39 N ATOM 11339 CA VAL E 60 55.915 0.935 59.462 1.00 36.41 C ATOM 11340 C VAL E 60 56.408 -0.112 58.468 1.00 35.25 C ATOM 11341 O VAL E 60 55.663 -1.016 58.090 1.00 35.27 O ATOM 11342 CB VAL E 60 55.746 2.304 58.742 1.00 35.64 C ATOM 11343 CG1 VAL E 60 54.671 2.201 57.681 1.00 35.02 C ATOM 11344 CG2 VAL E 60 55.372 3.397 59.733 1.00 34.33 C ATOM 11345 N GLY E 61 57.680 -0.020 58.100 1.00 35.05 N ATOM 11346 CA GLY E 61 58.249 -0.970 57.163 1.00 35.52 C ATOM 11347 C GLY E 61 58.225 -2.393 57.687 1.00 35.93 C ATOM 11348 O GLY E 61 57.933 -3.326 56.948 1.00 35.86 O ATOM 11349 N ALA E 62 58.510 -2.555 58.975 1.00 36.90 N ATOM 11350 CA ALA E 62 58.528 -3.872 59.602 1.00 37.64 C ATOM 11351 C ALA E 62 57.123 -4.441 59.628 1.00 37.78 C ATOM 11352 O ALA E 62 56.927 -5.638 59.421 1.00 39.98 O ATOM 11353 CB ALA E 62 59.095 -3.779 61.025 1.00 38.16 C ATOM 11354 N MET E 63 56.148 -3.580 59.904 1.00 36.93 N ATOM 11355 CA MET E 63 54.755 -3.996 59.936 1.00 36.09 C ATOM 11356 C MET E 63 54.392 -4.466 58.538 1.00 35.40 C ATOM 11357 O MET E 63 53.813 -5.539 58.378 1.00 36.87 O ATOM 11358 CB MET E 63 53.850 -2.841 60.354 1.00 35.25 C ATOM 11359 CG MET E 63 52.402 -3.229 60.434 1.00 35.92 C ATOM 11360 SD MET E 63 51.436 -2.053 61.380 1.00 37.90 S ATOM 11361 CE MET E 63 51.224 -0.767 60.211 1.00 38.93 C ATOM 11362 N GLY E 64 54.798 -3.691 57.531 1.00 34.08 N ATOM 11363 CA GLY E 64 54.522 -4.053 56.150 1.00 33.08 C ATOM 11364 C GLY E 64 55.119 -5.398 55.749 1.00 33.52 C ATOM 11365 O GLY E 64 54.465 -6.203 55.082 1.00 33.33 O ATOM 11366 N LEU E 65 56.354 -5.647 56.185 1.00 33.41 N ATOM 11367 CA LEU E 65 57.071 -6.880 55.878 1.00 31.94 C ATOM 11368 C LEU E 65 56.258 -8.069 56.340 1.00 31.45 C ATOM 11369 O LEU E 65 55.878 -8.915 55.532 1.00 31.53 O ATOM 11370 CB LEU E 65 58.440 -6.878 56.580 1.00 33.69 C ATOM 11371 CG LEU E 65 59.550 -7.925 56.354 1.00 33.89 C ATOM 11372 CD1 LEU E 65 59.136 -9.321 56.802 1.00 34.35 C ATOM 11373 CD2 LEU E 65 59.967 -7.931 54.912 1.00 33.76 C ATOM 11374 N LEU E 66 55.957 -8.103 57.634 1.00 29.93 N ATOM 11375 CA LEU E 66 55.210 -9.206 58.217 1.00 30.06 C ATOM 11376 C LEU E 66 53.804 -9.423 57.665 1.00 29.42 C ATOM 11377 O LEU E 66 53.317 -10.556 57.620 1.00 29.41 O ATOM 11378 CB LEU E 66 55.184 -9.071 59.734 1.00 30.69 C ATOM 11379 CG LEU E 66 56.490 -9.435 60.447 1.00 31.09 C ATOM 11380 CD1 LEU E 66 56.360 -9.142 61.930 1.00 31.47 C ATOM 11381 CD2 LEU E 66 56.809 -10.912 60.233 1.00 29.50 C ATOM 11382 N SER E 67 53.172 -8.342 57.219 1.00 28.47 N ATOM 11383 CA SER E 67 51.833 -8.409 56.652 1.00 26.89 C ATOM 11384 C SER E 67 51.800 -9.031 55.252 1.00 27.51 C ATOM 11385 O SER E 67 50.886 -9.786 54.937 1.00 27.70 O ATOM 11386 CB SER E 67 51.196 -7.030 56.650 1.00 26.24 C ATOM 11387 OG SER E 67 50.905 -6.634 57.980 1.00 27.59 O ATOM 11388 N SER E 68 52.793 -8.732 54.414 1.00 27.21 N ATOM 11389 CA SER E 68 52.853 -9.322 53.075 1.00 27.18 C ATOM 11390 C SER E 68 53.037 -10.816 53.266 1.00 28.57 C ATOM 11391 O SER E 68 52.400 -11.637 52.596 1.00 29.59 O ATOM 11392 CB SER E 68 54.044 -8.778 52.304 1.00 26.21 C ATOM 11393 OG SER E 68 53.927 -7.378 52.138 1.00 29.66 O ATOM 11394 N ALA E 69 53.912 -11.157 54.208 1.00 28.20 N ATOM 11395 CA ALA E 69 54.191 -12.543 54.537 1.00 27.26 C ATOM 11396 C ALA E 69 52.903 -13.233 55.021 1.00 26.97 C ATOM 11397 O ALA E 69 52.548 -14.326 54.548 1.00 27.10 O ATOM 11398 CB ALA E 69 55.262 -12.604 55.597 1.00 27.45 C ATOM 11399 N GLY E 70 52.200 -12.586 55.946 1.00 23.96 N ATOM 11400 CA GLY E 70 50.967 -13.155 56.448 1.00 24.53 C ATOM 11401 C GLY E 70 49.905 -13.287 55.363 1.00 25.69 C ATOM 11402 O GLY E 70 49.110 -14.238 55.359 1.00 24.22 O ATOM 11403 N ALA E 71 49.884 -12.322 54.443 1.00 25.43 N ATOM 11404 CA ALA E 71 48.927 -12.340 53.339 1.00 24.49 C ATOM 11405 C ALA E 71 49.281 -13.483 52.393 1.00 24.15 C ATOM 11406 O ALA E 71 48.431 -14.319 52.054 1.00 21.39 O ATOM 11407 CB ALA E 71 48.948 -11.020 52.602 1.00 23.29 C ATOM 11408 N LYS E 72 50.548 -13.525 51.992 1.00 24.23 N ATOM 11409 CA LYS E 72 51.011 -14.570 51.115 1.00 26.54 C ATOM 11410 C LYS E 72 50.631 -15.906 51.752 1.00 26.76 C ATOM 11411 O LYS E 72 50.062 -16.774 51.095 1.00 27.48 O ATOM 11412 CB LYS E 72 52.520 -14.456 50.906 1.00 29.79 C ATOM 11413 CG LYS E 72 53.086 -15.528 49.951 1.00 35.52 C ATOM 11414 CD LYS E 72 54.536 -15.244 49.512 1.00 39.16 C ATOM 11415 CE LYS E 72 55.221 -16.504 48.954 1.00 40.47 C ATOM 11416 NZ LYS E 72 55.377 -17.581 49.991 1.00 38.95 N ATOM 11417 N SER E 73 50.849 -16.030 53.056 1.00 27.43 N ATOM 11418 CA SER E 73 50.508 -17.265 53.765 1.00 28.84 C ATOM 11419 C SER E 73 49.013 -17.619 53.783 1.00 28.09 C ATOM 11420 O SER E 73 48.645 -18.765 53.554 1.00 26.14 O ATOM 11421 CB SER E 73 51.074 -17.241 55.188 1.00 29.49 C ATOM 11422 OG SER E 73 52.319 -17.926 55.245 1.00 31.11 O ATOM 11423 N THR E 74 48.156 -16.636 54.048 1.00 29.64 N ATOM 11424 CA THR E 74 46.709 -16.862 54.083 1.00 28.72 C ATOM 11425 C THR E 74 46.233 -17.301 52.714 1.00 28.44 C ATOM 11426 O THR E 74 45.547 -18.313 52.585 1.00 29.17 O ATOM 11427 CB THR E 74 45.949 -15.579 54.478 1.00 29.76 C ATOM 11428 OG1 THR E 74 46.366 -15.164 55.786 1.00 29.01 O ATOM 11429 CG2 THR E 74 44.441 -15.814 54.472 1.00 26.99 C ATOM 11430 N VAL E 75 46.623 -16.539 51.696 1.00 27.54 N ATOM 11431 CA VAL E 75 46.255 -16.832 50.318 1.00 28.32 C ATOM 11432 C VAL E 75 46.619 -18.262 49.921 1.00 29.22 C ATOM 11433 O VAL E 75 45.765 -19.034 49.475 1.00 28.90 O ATOM 11434 CB VAL E 75 46.922 -15.828 49.358 1.00 28.42 C ATOM 11435 CG1 VAL E 75 46.793 -16.295 47.932 1.00 27.89 C ATOM 11436 CG2 VAL E 75 46.277 -14.461 49.515 1.00 27.63 C ATOM 11437 N GLU E 76 47.876 -18.631 50.135 1.00 31.20 N ATOM 11438 CA GLU E 76 48.334 -19.973 49.792 1.00 33.74 C ATOM 11439 C GLU E 76 47.538 -21.080 50.497 1.00 32.46 C ATOM 11440 O GLU E 76 47.218 -22.101 49.890 1.00 33.31 O ATOM 11441 CB GLU E 76 49.845 -20.094 50.028 1.00 36.57 C ATOM 11442 CG GLU E 76 50.659 -19.343 48.956 1.00 42.33 C ATOM 11443 CD GLU E 76 52.091 -18.973 49.378 1.00 46.68 C ATOM 11444 OE1 GLU E 76 52.391 -18.932 50.596 1.00 48.69 O ATOM 11445 OE2 GLU E 76 52.921 -18.690 48.479 1.00 49.14 O ATOM 11446 N THR E 77 47.140 -20.830 51.739 1.00 30.01 N ATOM 11447 CA THR E 77 46.366 -21.794 52.505 1.00 28.85 C ATOM 11448 C THR E 77 45.053 -22.100 51.823 1.00 28.82 C ATOM 11449 O THR E 77 44.713 -23.270 51.634 1.00 28.18 O ATOM 11450 CB THR E 77 46.056 -21.271 53.900 1.00 28.06 C ATOM 11451 OG1 THR E 77 47.283 -21.082 54.595 1.00 29.11 O ATOM 11452 CG2 THR E 77 45.189 -22.245 54.678 1.00 26.21 C ATOM 11453 N PHE E 78 44.310 -21.052 51.474 1.00 28.37 N ATOM 11454 CA PHE E 78 43.026 -21.239 50.813 1.00 28.88 C ATOM 11455 C PHE E 78 43.193 -21.882 49.441 1.00 29.43 C ATOM 11456 O PHE E 78 42.604 -22.937 49.161 1.00 28.27 O ATOM 11457 CB PHE E 78 42.275 -19.920 50.693 1.00 28.93 C ATOM 11458 CG PHE E 78 41.721 -19.428 51.984 1.00 30.29 C ATOM 11459 CD1 PHE E 78 40.581 -19.999 52.525 1.00 31.57 C ATOM 11460 CD2 PHE E 78 42.342 -18.396 52.673 1.00 32.13 C ATOM 11461 CE1 PHE E 78 40.059 -19.546 53.752 1.00 33.25 C ATOM 11462 CE2 PHE E 78 41.830 -17.937 53.898 1.00 33.41 C ATOM 11463 CZ PHE E 78 40.685 -18.516 54.439 1.00 32.39 C ATOM 11464 N ILE E 79 44.041 -21.286 48.610 1.00 28.59 N ATOM 11465 CA ILE E 79 44.258 -21.821 47.278 1.00 29.06 C ATOM 11466 C ILE E 79 44.551 -23.312 47.322 1.00 29.63 C ATOM 11467 O ILE E 79 43.806 -24.120 46.753 1.00 30.60 O ATOM 11468 CB ILE E 79 45.385 -21.077 46.553 1.00 28.41 C ATOM 11469 CG1 ILE E 79 44.889 -19.683 46.180 1.00 30.21 C ATOM 11470 CG2 ILE E 79 45.809 -21.828 45.286 1.00 25.32 C ATOM 11471 CD1 ILE E 79 45.874 -18.885 45.339 1.00 33.65 C ATOM 11472 N SER E 80 45.573 -23.676 48.086 1.00 29.45 N ATOM 11473 CA SER E 80 45.966 -25.069 48.193 1.00 29.20 C ATOM 11474 C SER E 80 44.905 -26.001 48.777 1.00 28.40 C ATOM 11475 O SER E 80 45.090 -27.214 48.733 1.00 27.61 O ATOM 11476 CB SER E 80 47.287 -25.202 48.959 1.00 30.24 C ATOM 11477 OG SER E 80 47.148 -24.754 50.287 1.00 32.54 O